data_4P8V
# 
_entry.id   4P8V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4P8V         
WWPDB D_1000200948 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4P8X unspecified 
PDB . 4P8V unspecified 
PDB . 4P8U unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4P8V 
_pdbx_database_status.recvd_initial_deposition_date   2014-04-01 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Suginta, W.'       1 
'Ranok, A.'         2 
'Robinson, R.C.'    3 
'Wongsantichon, J.' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                2617 
_citation.page_last                 2629 
_citation.title                     
;Structural and Thermodynamic Insights into Chitooligosaccharide Binding to Human Cartilage Chitinase 3-like Protein 2 (CHI3L2 or YKL-39).
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.588905 
_citation.pdbx_database_id_PubMed   25477513 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ranok, A.'         1 ? 
primary 'Wongsantichon, J.' 2 ? 
primary 'Robinson, R.C.'    3 ? 
primary 'Suginta, W.'       4 ? 
# 
_cell.entry_id           4P8V 
_cell.length_a           70.682 
_cell.length_b           70.682 
_cell.length_c           140.255 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4P8V 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Chitinase-3-like protein 2'                                                              41619.246 1   ? 
'A182V, R318W' ? ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                                                                             96.063    3   ? ? ? ? 
4 water       nat water                                                                                     18.015    699 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Chondrocyte protein 39,YKL-39' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AMADIGSYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILL
SIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLL
LTVGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPS
EKVVMGIPTYGHSFTLASAETTVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITWLQDQQVPYAVKGNQWVGYDDV
KSMETKVQFLKNLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AMADIGSYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILL
SIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLL
LTVGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPS
EKVVMGIPTYGHSFTLASAETTVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITWLQDQQVPYAVKGNQWVGYDDV
KSMETKVQFLKNLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   MET n 
1 3   ALA n 
1 4   ASP n 
1 5   ILE n 
1 6   GLY n 
1 7   SER n 
1 8   TYR n 
1 9   LYS n 
1 10  LEU n 
1 11  VAL n 
1 12  CYS n 
1 13  TYR n 
1 14  PHE n 
1 15  THR n 
1 16  ASN n 
1 17  TRP n 
1 18  SER n 
1 19  GLN n 
1 20  ASP n 
1 21  ARG n 
1 22  GLN n 
1 23  GLU n 
1 24  PRO n 
1 25  GLY n 
1 26  LYS n 
1 27  PHE n 
1 28  THR n 
1 29  PRO n 
1 30  GLU n 
1 31  ASN n 
1 32  ILE n 
1 33  ASP n 
1 34  PRO n 
1 35  PHE n 
1 36  LEU n 
1 37  CYS n 
1 38  SER n 
1 39  HIS n 
1 40  LEU n 
1 41  ILE n 
1 42  TYR n 
1 43  SER n 
1 44  PHE n 
1 45  ALA n 
1 46  SER n 
1 47  ILE n 
1 48  GLU n 
1 49  ASN n 
1 50  ASN n 
1 51  LYS n 
1 52  VAL n 
1 53  ILE n 
1 54  ILE n 
1 55  LYS n 
1 56  ASP n 
1 57  LYS n 
1 58  SER n 
1 59  GLU n 
1 60  VAL n 
1 61  MET n 
1 62  LEU n 
1 63  TYR n 
1 64  GLN n 
1 65  THR n 
1 66  ILE n 
1 67  ASN n 
1 68  SER n 
1 69  LEU n 
1 70  LYS n 
1 71  THR n 
1 72  LYS n 
1 73  ASN n 
1 74  PRO n 
1 75  LYS n 
1 76  LEU n 
1 77  LYS n 
1 78  ILE n 
1 79  LEU n 
1 80  LEU n 
1 81  SER n 
1 82  ILE n 
1 83  GLY n 
1 84  GLY n 
1 85  TYR n 
1 86  LEU n 
1 87  PHE n 
1 88  GLY n 
1 89  SER n 
1 90  LYS n 
1 91  GLY n 
1 92  PHE n 
1 93  HIS n 
1 94  PRO n 
1 95  MET n 
1 96  VAL n 
1 97  ASP n 
1 98  SER n 
1 99  SER n 
1 100 THR n 
1 101 SER n 
1 102 ARG n 
1 103 LEU n 
1 104 GLU n 
1 105 PHE n 
1 106 ILE n 
1 107 ASN n 
1 108 SER n 
1 109 ILE n 
1 110 ILE n 
1 111 LEU n 
1 112 PHE n 
1 113 LEU n 
1 114 ARG n 
1 115 ASN n 
1 116 HIS n 
1 117 ASN n 
1 118 PHE n 
1 119 ASP n 
1 120 GLY n 
1 121 LEU n 
1 122 ASP n 
1 123 VAL n 
1 124 SER n 
1 125 TRP n 
1 126 ILE n 
1 127 TYR n 
1 128 PRO n 
1 129 ASP n 
1 130 GLN n 
1 131 LYS n 
1 132 GLU n 
1 133 ASN n 
1 134 THR n 
1 135 HIS n 
1 136 PHE n 
1 137 THR n 
1 138 VAL n 
1 139 LEU n 
1 140 ILE n 
1 141 HIS n 
1 142 GLU n 
1 143 LEU n 
1 144 ALA n 
1 145 GLU n 
1 146 ALA n 
1 147 PHE n 
1 148 GLN n 
1 149 LYS n 
1 150 ASP n 
1 151 PHE n 
1 152 THR n 
1 153 LYS n 
1 154 SER n 
1 155 THR n 
1 156 LYS n 
1 157 GLU n 
1 158 ARG n 
1 159 LEU n 
1 160 LEU n 
1 161 LEU n 
1 162 THR n 
1 163 VAL n 
1 164 GLY n 
1 165 VAL n 
1 166 SER n 
1 167 ALA n 
1 168 GLY n 
1 169 ARG n 
1 170 GLN n 
1 171 MET n 
1 172 ILE n 
1 173 ASP n 
1 174 ASN n 
1 175 SER n 
1 176 TYR n 
1 177 GLN n 
1 178 VAL n 
1 179 GLU n 
1 180 LYS n 
1 181 LEU n 
1 182 ALA n 
1 183 LYS n 
1 184 ASP n 
1 185 LEU n 
1 186 ASP n 
1 187 PHE n 
1 188 ILE n 
1 189 ASN n 
1 190 LEU n 
1 191 LEU n 
1 192 SER n 
1 193 PHE n 
1 194 ASP n 
1 195 PHE n 
1 196 HIS n 
1 197 GLY n 
1 198 SER n 
1 199 TRP n 
1 200 GLU n 
1 201 LYS n 
1 202 PRO n 
1 203 LEU n 
1 204 ILE n 
1 205 THR n 
1 206 GLY n 
1 207 HIS n 
1 208 ASN n 
1 209 SER n 
1 210 PRO n 
1 211 LEU n 
1 212 SER n 
1 213 LYS n 
1 214 GLY n 
1 215 TRP n 
1 216 GLN n 
1 217 ASP n 
1 218 ARG n 
1 219 GLY n 
1 220 PRO n 
1 221 SER n 
1 222 SER n 
1 223 TYR n 
1 224 TYR n 
1 225 ASN n 
1 226 VAL n 
1 227 GLU n 
1 228 TYR n 
1 229 ALA n 
1 230 VAL n 
1 231 GLY n 
1 232 TYR n 
1 233 TRP n 
1 234 ILE n 
1 235 HIS n 
1 236 LYS n 
1 237 GLY n 
1 238 MET n 
1 239 PRO n 
1 240 SER n 
1 241 GLU n 
1 242 LYS n 
1 243 VAL n 
1 244 VAL n 
1 245 MET n 
1 246 GLY n 
1 247 ILE n 
1 248 PRO n 
1 249 THR n 
1 250 TYR n 
1 251 GLY n 
1 252 HIS n 
1 253 SER n 
1 254 PHE n 
1 255 THR n 
1 256 LEU n 
1 257 ALA n 
1 258 SER n 
1 259 ALA n 
1 260 GLU n 
1 261 THR n 
1 262 THR n 
1 263 VAL n 
1 264 GLY n 
1 265 ALA n 
1 266 PRO n 
1 267 ALA n 
1 268 SER n 
1 269 GLY n 
1 270 PRO n 
1 271 GLY n 
1 272 ALA n 
1 273 ALA n 
1 274 GLY n 
1 275 PRO n 
1 276 ILE n 
1 277 THR n 
1 278 GLU n 
1 279 SER n 
1 280 SER n 
1 281 GLY n 
1 282 PHE n 
1 283 LEU n 
1 284 ALA n 
1 285 TYR n 
1 286 TYR n 
1 287 GLU n 
1 288 ILE n 
1 289 CYS n 
1 290 GLN n 
1 291 PHE n 
1 292 LEU n 
1 293 LYS n 
1 294 GLY n 
1 295 ALA n 
1 296 LYS n 
1 297 ILE n 
1 298 THR n 
1 299 TRP n 
1 300 LEU n 
1 301 GLN n 
1 302 ASP n 
1 303 GLN n 
1 304 GLN n 
1 305 VAL n 
1 306 PRO n 
1 307 TYR n 
1 308 ALA n 
1 309 VAL n 
1 310 LYS n 
1 311 GLY n 
1 312 ASN n 
1 313 GLN n 
1 314 TRP n 
1 315 VAL n 
1 316 GLY n 
1 317 TYR n 
1 318 ASP n 
1 319 ASP n 
1 320 VAL n 
1 321 LYS n 
1 322 SER n 
1 323 MET n 
1 324 GLU n 
1 325 THR n 
1 326 LYS n 
1 327 VAL n 
1 328 GLN n 
1 329 PHE n 
1 330 LEU n 
1 331 LYS n 
1 332 ASN n 
1 333 LEU n 
1 334 ASN n 
1 335 LEU n 
1 336 GLY n 
1 337 GLY n 
1 338 ALA n 
1 339 MET n 
1 340 ILE n 
1 341 TRP n 
1 342 SER n 
1 343 ILE n 
1 344 ASP n 
1 345 MET n 
1 346 ASP n 
1 347 ASP n 
1 348 PHE n 
1 349 THR n 
1 350 GLY n 
1 351 LYS n 
1 352 SER n 
1 353 CYS n 
1 354 ASN n 
1 355 GLN n 
1 356 GLY n 
1 357 PRO n 
1 358 TYR n 
1 359 PRO n 
1 360 LEU n 
1 361 VAL n 
1 362 GLN n 
1 363 ALA n 
1 364 VAL n 
1 365 LYS n 
1 366 ARG n 
1 367 SER n 
1 368 LEU n 
1 369 GLY n 
1 370 SER n 
1 371 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   371 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CHI3L2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET32a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CH3L2_HUMAN 
_struct_ref.pdbx_db_accession          Q15782 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;YKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLF
GSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTAGVSA
GRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGI
PTYGHSFTLASAETTVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKV
QFLKNLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL
;
_struct_ref.pdbx_align_begin           27 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4P8V 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 371 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q15782 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  390 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       27 
_struct_ref_seq.pdbx_auth_seq_align_end       390 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4P8V ALA A 1   ? UNP Q15782 ?   ?   'expression tag'      20  1 
1 4P8V MET A 2   ? UNP Q15782 ?   ?   'expression tag'      21  2 
1 4P8V ALA A 3   ? UNP Q15782 ?   ?   'expression tag'      22  3 
1 4P8V ASP A 4   ? UNP Q15782 ?   ?   'expression tag'      23  4 
1 4P8V ILE A 5   ? UNP Q15782 ?   ?   'expression tag'      24  5 
1 4P8V GLY A 6   ? UNP Q15782 ?   ?   'expression tag'      25  6 
1 4P8V SER A 7   ? UNP Q15782 ?   ?   'expression tag'      26  7 
1 4P8V VAL A 163 ? UNP Q15782 ALA 182 'engineered mutation' 182 8 
1 4P8V TRP A 299 ? UNP Q15782 ARG 318 'engineered mutation' 318 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                  . 'SULFATE ION'                            ? 'O4 S -2'        96.063  
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4P8V 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.14 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.46 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 3350, Lithium Sulfate, Bis Tris' 
_exptl_crystal_grow.pdbx_pH_range   5.3-5.9 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           105 
_diffrn.ambient_temp_details   105K 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-06-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'LN2-Cooled, Fixed-Exit Double Crystal Monochromator' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSRRC BEAMLINE BL13B1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL13B1 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4P8V 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.53 
_reflns.d_resolution_low                 19.61 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       50934 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.5 
_reflns.pdbx_Rmerge_I_obs                0.075 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         2.8 
_reflns.pdbx_netI_over_sigmaI            26.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.53 
_reflns_shell.d_res_low                   1.56 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.753 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             8.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4P8V 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     41175 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.61 
_refine.ls_d_res_high                            1.64 
_refine.ls_percent_reflns_obs                    98.13 
_refine.ls_R_factor_obs                          0.17442 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17280 
_refine.ls_R_factor_R_free                       0.20440 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2180 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.960 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.B_iso_mean                               16.899 
_refine.aniso_B[1][1]                            0.23 
_refine.aniso_B[2][2]                            0.23 
_refine.aniso_B[3][3]                            -0.47 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.108 
_refine.pdbx_overall_ESU_R_Free                  0.102 
_refine.overall_SU_ML                            0.066 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.906 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2895 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             699 
_refine_hist.number_atoms_total               3638 
_refine_hist.d_res_high                       1.64 
_refine_hist.d_res_low                        19.61 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.019  ? 3027 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2819 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.418  1.963  ? 4109 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.797  3.001  ? 6502 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.157  5.000  ? 366  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.821 24.848 ? 132  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.189 15.000 ? 507  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.709 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.086  0.200  ? 447  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 3388 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 701  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.902  1.419  ? 1464 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.898  1.418  ? 1463 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.427  2.127  ? 1830 'X-RAY DIFFRACTION' ? 
r_mcangle_other              1.428  2.128  ? 1831 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.128  1.556  ? 1563 'X-RAY DIFFRACTION' ? 
r_scbond_other               1.118  1.546  ? 1551 'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              1.760  2.270  ? 2262 'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       6.767  15.442 ? 4386 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         5.944  12.931 ? 3814 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.643 
_refine_ls_shell.d_res_low                        1.686 
_refine_ls_shell.number_reflns_R_work             2892 
_refine_ls_shell.R_factor_R_work                  0.202 
_refine_ls_shell.percent_reflns_obs               94.81 
_refine_ls_shell.R_factor_R_free                  0.247 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             141 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     4P8V 
_struct.title                        
'The crystal structures of YKL-39 in the presence of chitooligosaccharides (GlcNAc2) were solved to resolutions of 1.5 angstrom' 
_struct.pdbx_descriptor              'Human chitinase 3-like protein 2 (CHI3L2 or YKL-39)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4P8V 
_struct_keywords.text            'Chitinase 3-like protein 2, human YKL-39, Family-18 chitinase, SUGAR BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'SUGAR BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TRP A 17  ? ARG A 21  ? TRP A 36  ARG A 40  5 ? 5  
HELX_P HELX_P2  AA2 THR A 28  ? ILE A 32  ? THR A 47  ILE A 51  5 ? 5  
HELX_P HELX_P3  AA3 SER A 58  ? ASN A 73  ? SER A 77  ASN A 92  1 ? 16 
HELX_P HELX_P4  AA4 SER A 89  ? HIS A 93  ? SER A 108 HIS A 112 5 ? 5  
HELX_P HELX_P5  AA5 PRO A 94  ? ASP A 97  ? PRO A 113 ASP A 116 5 ? 4  
HELX_P HELX_P6  AA6 SER A 98  ? HIS A 116 ? SER A 117 HIS A 135 1 ? 19 
HELX_P HELX_P7  AA7 PRO A 128 ? LYS A 153 ? PRO A 147 LYS A 172 1 ? 26 
HELX_P HELX_P8  AA8 GLY A 168 ? TYR A 176 ? GLY A 187 TYR A 195 1 ? 9  
HELX_P HELX_P9  AA9 GLN A 177 ? LEU A 185 ? GLN A 196 LEU A 204 1 ? 9  
HELX_P HELX_P10 AB1 ARG A 218 ? TYR A 224 ? ARG A 237 TYR A 243 5 ? 7  
HELX_P HELX_P11 AB2 ASN A 225 ? LYS A 236 ? ASN A 244 LYS A 255 1 ? 12 
HELX_P HELX_P12 AB3 PRO A 239 ? GLU A 241 ? PRO A 258 GLU A 260 5 ? 3  
HELX_P HELX_P13 AB4 TYR A 285 ? LEU A 292 ? TYR A 304 LEU A 311 1 ? 8  
HELX_P HELX_P14 AB5 ASP A 319 ? LEU A 333 ? ASP A 338 LEU A 352 1 ? 15 
HELX_P HELX_P15 AB6 SER A 342 ? ASP A 346 ? SER A 361 ASP A 365 5 ? 5  
HELX_P HELX_P16 AB7 TYR A 358 ? SER A 370 ? TYR A 377 SER A 389 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 12  SG ? ? ? 1_555 A CYS 37  SG ? ? A CYS 31  A CYS 56  1_555 ? ? ? ? ? ? ? 2.015 ? ? 
disulf2 disulf ?    ? A CYS 289 SG ? ? ? 1_555 A CYS 353 SG ? ? A CYS 308 A CYS 372 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
covale1 covale both ? B NAG .   O4 ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.436 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 23  A . ? GLU 42  A PRO 24  A ? PRO 43  A 1 7.93   
2 SER 43  A . ? SER 62  A PHE 44  A ? PHE 63  A 1 -0.86  
3 HIS 93  A . ? HIS 112 A PRO 94  A ? PRO 113 A 1 5.91   
4 ILE 126 A . ? ILE 145 A TYR 127 A ? TYR 146 A 1 -17.47 
5 LYS 201 A . ? LYS 220 A PRO 202 A ? PRO 221 A 1 4.07   
6 TRP 341 A . ? TRP 360 A SER 342 A ? SER 361 A 1 -7.06  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 10 ? 
AA2 ? 3  ? 
AA3 ? 5  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? parallel      
AA1 3 4  ? parallel      
AA1 4 5  ? parallel      
AA1 5 6  ? parallel      
AA1 6 7  ? parallel      
AA1 7 8  ? parallel      
AA1 8 9  ? parallel      
AA1 9 10 ? parallel      
AA2 1 2  ? anti-parallel 
AA2 2 3  ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA3 2 3  ? anti-parallel 
AA3 3 4  ? anti-parallel 
AA3 4 5  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LYS A 51  ? ILE A 53  ? LYS A 70  ILE A 72  
AA1 2  HIS A 39  ? GLU A 48  ? HIS A 58  GLU A 67  
AA1 3  LYS A 77  ? GLY A 84  ? LYS A 96  GLY A 103 
AA1 4  GLY A 120 ? TRP A 125 ? GLY A 139 TRP A 144 
AA1 5  LEU A 160 ? SER A 166 ? LEU A 179 SER A 185 
AA1 6  PHE A 187 ? LEU A 191 ? PHE A 206 LEU A 210 
AA1 7  VAL A 243 ? PRO A 248 ? VAL A 262 PRO A 267 
AA1 8  GLY A 337 ? TRP A 341 ? GLY A 356 TRP A 360 
AA1 9  LYS A 9   ? THR A 15  ? LYS A 28  THR A 34  
AA1 10 HIS A 39  ? GLU A 48  ? HIS A 58  GLU A 67  
AA2 1  ALA A 267 ? PRO A 270 ? ALA A 286 PRO A 289 
AA2 2  TYR A 250 ? LEU A 256 ? TYR A 269 LEU A 275 
AA2 3  PHE A 282 ? ALA A 284 ? PHE A 301 ALA A 303 
AA3 1  ALA A 267 ? PRO A 270 ? ALA A 286 PRO A 289 
AA3 2  TYR A 250 ? LEU A 256 ? TYR A 269 LEU A 275 
AA3 3  GLN A 313 ? GLY A 316 ? GLN A 332 GLY A 335 
AA3 4  VAL A 305 ? LYS A 310 ? VAL A 324 LYS A 329 
AA3 5  LYS A 296 ? LEU A 300 ? LYS A 315 LEU A 319 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O LYS A 51  ? O LYS A 70  N GLU A 48  ? N GLU A 67  
AA1 2 3  N ALA A 45  ? N ALA A 64  O SER A 81  ? O SER A 100 
AA1 3 4  N LEU A 80  ? N LEU A 99  O ASP A 122 ? O ASP A 141 
AA1 4 5  N LEU A 121 ? N LEU A 140 O LEU A 160 ? O LEU A 179 
AA1 5 6  N VAL A 163 ? N VAL A 182 O ASN A 189 ? O ASN A 208 
AA1 6 7  N LEU A 190 ? N LEU A 209 O VAL A 244 ? O VAL A 263 
AA1 7 8  N MET A 245 ? N MET A 264 O MET A 339 ? O MET A 358 
AA1 8 9  O ILE A 340 ? O ILE A 359 N VAL A 11  ? N VAL A 30  
AA1 9 10 N CYS A 12  ? N CYS A 31  O HIS A 39  ? O HIS A 58  
AA2 1 2  O GLY A 269 ? O GLY A 288 N THR A 255 ? N THR A 274 
AA2 2 3  N GLY A 251 ? N GLY A 270 O LEU A 283 ? O LEU A 302 
AA3 1 2  O GLY A 269 ? O GLY A 288 N THR A 255 ? N THR A 274 
AA3 2 3  N HIS A 252 ? N HIS A 271 O GLY A 316 ? O GLY A 335 
AA3 3 4  O VAL A 315 ? O VAL A 334 N ALA A 308 ? N ALA A 327 
AA3 4 5  O TYR A 307 ? O TYR A 326 N THR A 298 ? N THR A 317 
# 
_atom_sites.entry_id                    4P8V 
_atom_sites.fract_transf_matrix[1][1]   0.014148 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014148 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007130 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 7   ? -2.726  12.890 -5.821  1.00 29.10 ? 26   SER A N   1 
ATOM   2    C CA  . SER A 1 7   ? -3.154  14.262 -6.237  1.00 26.56 ? 26   SER A CA  1 
ATOM   3    C C   . SER A 1 7   ? -4.518  14.580 -5.604  1.00 24.01 ? 26   SER A C   1 
ATOM   4    O O   . SER A 1 7   ? -5.500  13.853 -5.817  1.00 26.53 ? 26   SER A O   1 
ATOM   5    C CB  . SER A 1 7   ? -3.220  14.342 -7.751  1.00 29.35 ? 26   SER A CB  1 
ATOM   6    N N   . TYR A 1 8   ? -4.571  15.612 -4.776  1.00 17.78 ? 27   TYR A N   1 
ATOM   7    C CA  . TYR A 1 8   ? -5.857  16.048 -4.214  1.00 15.72 ? 27   TYR A CA  1 
ATOM   8    C C   . TYR A 1 8   ? -6.149  17.454 -4.684  1.00 14.89 ? 27   TYR A C   1 
ATOM   9    O O   . TYR A 1 8   ? -5.250  18.249 -4.838  1.00 17.00 ? 27   TYR A O   1 
ATOM   10   C CB  . TYR A 1 8   ? -5.854  16.007 -2.692  1.00 15.24 ? 27   TYR A CB  1 
ATOM   11   C CG  . TYR A 1 8   ? -5.768  14.595 -2.179  1.00 14.43 ? 27   TYR A CG  1 
ATOM   12   C CD1 . TYR A 1 8   ? -4.585  14.113 -1.674  1.00 14.82 ? 27   TYR A CD1 1 
ATOM   13   C CD2 . TYR A 1 8   ? -6.863  13.743 -2.248  1.00 14.21 ? 27   TYR A CD2 1 
ATOM   14   C CE1 . TYR A 1 8   ? -4.481  12.803 -1.253  1.00 15.41 ? 27   TYR A CE1 1 
ATOM   15   C CE2 . TYR A 1 8   ? -6.782  12.430 -1.817  1.00 14.96 ? 27   TYR A CE2 1 
ATOM   16   C CZ  . TYR A 1 8   ? -5.572  11.978 -1.319  1.00 15.19 ? 27   TYR A CZ  1 
ATOM   17   O OH  . TYR A 1 8   ? -5.429  10.688 -0.876  1.00 16.62 ? 27   TYR A OH  1 
ATOM   18   N N   . LYS A 1 9   ? -7.425  17.745 -4.898  1.00 12.89 ? 28   LYS A N   1 
ATOM   19   C CA  . LYS A 1 9   ? -7.865  19.115 -5.120  1.00 12.16 ? 28   LYS A CA  1 
ATOM   20   C C   . LYS A 1 9   ? -8.176  19.816 -3.800  1.00 10.94 ? 28   LYS A C   1 
ATOM   21   O O   . LYS A 1 9   ? -8.628  19.172 -2.853  1.00 10.29 ? 28   LYS A O   1 
ATOM   22   C CB  . LYS A 1 9   ? -9.138  19.104 -5.982  1.00 12.47 ? 28   LYS A CB  1 
ATOM   23   C CG  . LYS A 1 9   ? -8.944  18.473 -7.357  1.00 12.99 ? 28   LYS A CG  1 
ATOM   24   C CD  . LYS A 1 9   ? -10.242 18.310 -8.124  1.00 14.41 ? 28   LYS A CD  1 
ATOM   25   C CE  . LYS A 1 9   ? -10.012 17.929 -9.582  1.00 14.98 ? 28   LYS A CE  1 
ATOM   26   N NZ  . LYS A 1 9   ? -9.388  16.601 -9.748  1.00 15.39 ? 28   LYS A NZ  1 
ATOM   27   N N   . LEU A 1 10  ? -7.989  21.139 -3.795  1.00 10.01 ? 29   LEU A N   1 
ATOM   28   C CA  . LEU A 1 10  ? -8.454  21.999 -2.709  1.00 9.97  ? 29   LEU A CA  1 
ATOM   29   C C   . LEU A 1 10  ? -9.198  23.128 -3.384  1.00 9.98  ? 29   LEU A C   1 
ATOM   30   O O   . LEU A 1 10  ? -8.580  24.036 -3.928  1.00 9.77  ? 29   LEU A O   1 
ATOM   31   C CB  . LEU A 1 10  ? -7.283  22.530 -1.876  1.00 9.89  ? 29   LEU A CB  1 
ATOM   32   C CG  . LEU A 1 10  ? -7.620  23.480 -0.707  1.00 9.91  ? 29   LEU A CG  1 
ATOM   33   C CD1 . LEU A 1 10  ? -8.813  23.017 0.087   1.00 9.91  ? 29   LEU A CD1 1 
ATOM   34   C CD2 . LEU A 1 10  ? -6.404  23.724 0.200   1.00 10.40 ? 29   LEU A CD2 1 
ATOM   35   N N   . VAL A 1 11  ? -10.516 23.045 -3.332  1.00 10.00 ? 30   VAL A N   1 
ATOM   36   C CA  . VAL A 1 11  ? -11.429 23.887 -4.122  1.00 10.86 ? 30   VAL A CA  1 
ATOM   37   C C   . VAL A 1 11  ? -12.023 24.909 -3.160  1.00 10.49 ? 30   VAL A C   1 
ATOM   38   O O   . VAL A 1 11  ? -12.666 24.547 -2.176  1.00 11.74 ? 30   VAL A O   1 
ATOM   39   C CB  . VAL A 1 11  ? -12.525 23.022 -4.748  1.00 10.86 ? 30   VAL A CB  1 
ATOM   40   C CG1 . VAL A 1 11  ? -13.558 23.843 -5.532  1.00 11.21 ? 30   VAL A CG1 1 
ATOM   41   C CG2 . VAL A 1 11  ? -11.902 21.927 -5.619  1.00 11.32 ? 30   VAL A CG2 1 
ATOM   42   N N   . CYS A 1 12  ? -11.816 26.181 -3.466  1.00 10.78 ? 31   CYS A N   1 
ATOM   43   C CA  . CYS A 1 12  ? -12.068 27.254 -2.516  1.00 10.37 ? 31   CYS A CA  1 
ATOM   44   C C   . CYS A 1 12  ? -13.073 28.246 -3.059  1.00 9.82  ? 31   CYS A C   1 
ATOM   45   O O   . CYS A 1 12  ? -12.765 29.022 -3.957  1.00 10.34 ? 31   CYS A O   1 
ATOM   46   C CB  . CYS A 1 12  ? -10.760 27.952 -2.200  1.00 11.15 ? 31   CYS A CB  1 
ATOM   47   S SG  . CYS A 1 12  ? -9.638  26.870 -1.245  1.00 11.39 ? 31   CYS A SG  1 
ATOM   48   N N   . TYR A 1 13  ? -14.277 28.216 -2.501  1.00 9.52  ? 32   TYR A N   1 
ATOM   49   C CA  . TYR A 1 13  ? -15.243 29.261 -2.806  1.00 9.43  ? 32   TYR A CA  1 
ATOM   50   C C   . TYR A 1 13  ? -14.901 30.538 -2.066  1.00 9.49  ? 32   TYR A C   1 
ATOM   51   O O   . TYR A 1 13  ? -14.467 30.516 -0.904  1.00 9.58  ? 32   TYR A O   1 
ATOM   52   C CB  . TYR A 1 13  ? -16.660 28.864 -2.416  1.00 9.61  ? 32   TYR A CB  1 
ATOM   53   C CG  . TYR A 1 13  ? -17.347 27.847 -3.275  1.00 9.31  ? 32   TYR A CG  1 
ATOM   54   C CD1 . TYR A 1 13  ? -17.300 26.509 -2.934  1.00 9.71  ? 32   TYR A CD1 1 
ATOM   55   C CD2 . TYR A 1 13  ? -18.098 28.206 -4.386  1.00 9.73  ? 32   TYR A CD2 1 
ATOM   56   C CE1 . TYR A 1 13  ? -17.959 25.558 -3.680  1.00 10.03 ? 32   TYR A CE1 1 
ATOM   57   C CE2 . TYR A 1 13  ? -18.764 27.256 -5.139  1.00 9.81  ? 32   TYR A CE2 1 
ATOM   58   C CZ  . TYR A 1 13  ? -18.711 25.930 -4.776  1.00 10.50 ? 32   TYR A CZ  1 
ATOM   59   O OH  . TYR A 1 13  ? -19.401 24.968 -5.512  1.00 9.32  ? 32   TYR A OH  1 
ATOM   60   N N   . PHE A 1 14  ? -15.118 31.650 -2.733  1.00 9.69  ? 33   PHE A N   1 
ATOM   61   C CA  . PHE A 1 14  ? -15.170 32.947 -2.068  1.00 9.77  ? 33   PHE A CA  1 
ATOM   62   C C   . PHE A 1 14  ? -16.363 33.682 -2.591  1.00 10.21 ? 33   PHE A C   1 
ATOM   63   O O   . PHE A 1 14  ? -16.894 33.301 -3.632  1.00 9.60  ? 33   PHE A O   1 
ATOM   64   C CB  . PHE A 1 14  ? -13.855 33.737 -2.252  1.00 9.95  ? 33   PHE A CB  1 
ATOM   65   C CG  . PHE A 1 14  ? -13.556 34.157 -3.666  1.00 10.48 ? 33   PHE A CG  1 
ATOM   66   C CD1 . PHE A 1 14  ? -13.795 35.469 -4.076  1.00 10.92 ? 33   PHE A CD1 1 
ATOM   67   C CD2 . PHE A 1 14  ? -13.036 33.258 -4.579  1.00 10.29 ? 33   PHE A CD2 1 
ATOM   68   C CE1 . PHE A 1 14  ? -13.520 35.860 -5.369  1.00 10.98 ? 33   PHE A CE1 1 
ATOM   69   C CE2 . PHE A 1 14  ? -12.744 33.648 -5.882  1.00 11.26 ? 33   PHE A CE2 1 
ATOM   70   C CZ  . PHE A 1 14  ? -12.996 34.960 -6.268  1.00 11.07 ? 33   PHE A CZ  1 
ATOM   71   N N   . THR A 1 15  ? -16.759 34.755 -1.907  1.00 10.11 ? 34   THR A N   1 
ATOM   72   C CA  . THR A 1 15  ? -18.052 35.376 -2.154  1.00 10.12 ? 34   THR A CA  1 
ATOM   73   C C   . THR A 1 15  ? -17.898 36.873 -2.449  1.00 10.38 ? 34   THR A C   1 
ATOM   74   O O   . THR A 1 15  ? -16.918 37.507 -2.063  1.00 10.86 ? 34   THR A O   1 
ATOM   75   C CB  . THR A 1 15  ? -19.003 35.203 -0.968  1.00 10.53 ? 34   THR A CB  1 
ATOM   76   O OG1 . THR A 1 15  ? -18.631 36.100 0.080   1.00 10.84 ? 34   THR A OG1 1 
ATOM   77   C CG2 . THR A 1 15  ? -18.964 33.791 -0.450  1.00 10.58 ? 34   THR A CG2 1 
ATOM   78   N N   . ASN A 1 16  ? -18.887 37.414 -3.133  1.00 9.84  ? 35   ASN A N   1 
ATOM   79   C CA  . ASN A 1 16  ? -18.844 38.802 -3.505  1.00 10.08 ? 35   ASN A CA  1 
ATOM   80   C C   . ASN A 1 16  ? -19.529 39.746 -2.516  1.00 10.58 ? 35   ASN A C   1 
ATOM   81   O O   . ASN A 1 16  ? -19.571 40.976 -2.744  1.00 11.87 ? 35   ASN A O   1 
ATOM   82   C CB  . ASN A 1 16  ? -19.366 38.990 -4.942  1.00 10.24 ? 35   ASN A CB  1 
ATOM   83   C CG  . ASN A 1 16  ? -20.842 38.736 -5.075  1.00 10.13 ? 35   ASN A CG  1 
ATOM   84   O OD1 . ASN A 1 16  ? -21.577 38.681 -4.086  1.00 10.99 ? 35   ASN A OD1 1 
ATOM   85   N ND2 . ASN A 1 16  ? -21.315 38.637 -6.328  1.00 10.90 ? 35   ASN A ND2 1 
ATOM   86   N N   . TRP A 1 17  ? -20.025 39.212 -1.414  1.00 10.04 ? 36   TRP A N   1 
ATOM   87   C CA  . TRP A 1 17  ? -20.656 40.049 -0.379  1.00 10.23 ? 36   TRP A CA  1 
ATOM   88   C C   . TRP A 1 17  ? -19.758 40.272 0.833   1.00 10.80 ? 36   TRP A C   1 
ATOM   89   O O   . TRP A 1 17  ? -20.052 41.132 1.698   1.00 11.44 ? 36   TRP A O   1 
ATOM   90   C CB  . TRP A 1 17  ? -22.025 39.505 0.007   1.00 10.24 ? 36   TRP A CB  1 
ATOM   91   C CG  . TRP A 1 17  ? -22.007 38.117 0.515   1.00 10.74 ? 36   TRP A CG  1 
ATOM   92   C CD1 . TRP A 1 17  ? -21.822 37.732 1.802   1.00 10.27 ? 36   TRP A CD1 1 
ATOM   93   C CD2 . TRP A 1 17  ? -22.231 36.917 -0.244  1.00 10.63 ? 36   TRP A CD2 1 
ATOM   94   N NE1 . TRP A 1 17  ? -21.863 36.366 1.894   1.00 10.65 ? 36   TRP A NE1 1 
ATOM   95   C CE2 . TRP A 1 17  ? -22.100 35.836 0.654   1.00 10.78 ? 36   TRP A CE2 1 
ATOM   96   C CE3 . TRP A 1 17  ? -22.468 36.651 -1.599  1.00 10.75 ? 36   TRP A CE3 1 
ATOM   97   C CZ2 . TRP A 1 17  ? -22.227 34.502 0.244   1.00 11.57 ? 36   TRP A CZ2 1 
ATOM   98   C CZ3 . TRP A 1 17  ? -22.585 35.338 -2.010  1.00 11.09 ? 36   TRP A CZ3 1 
ATOM   99   C CH2 . TRP A 1 17  ? -22.473 34.273 -1.093  1.00 11.32 ? 36   TRP A CH2 1 
ATOM   100  N N   . SER A 1 18  ? -18.656 39.537 0.916   1.00 10.72 ? 37   SER A N   1 
ATOM   101  C CA  . SER A 1 18  ? -17.739 39.725 2.053   1.00 11.22 ? 37   SER A CA  1 
ATOM   102  C C   . SER A 1 18  ? -16.996 41.062 2.005   1.00 11.78 ? 37   SER A C   1 
ATOM   103  O O   . SER A 1 18  ? -16.527 41.576 3.038   1.00 11.29 ? 37   SER A O   1 
ATOM   104  C CB  . SER A 1 18  ? -16.780 38.546 2.159   1.00 11.00 ? 37   SER A CB  1 
ATOM   105  O OG  . SER A 1 18  ? -16.089 38.381 0.941   1.00 10.80 ? 37   SER A OG  1 
ATOM   106  N N   . GLN A 1 19  ? -16.894 41.653 0.815   1.00 11.88 ? 38   GLN A N   1 
ATOM   107  C CA  . GLN A 1 19  ? -16.287 42.990 0.691   1.00 12.85 ? 38   GLN A CA  1 
ATOM   108  C C   . GLN A 1 19  ? -17.026 44.050 1.479   1.00 13.22 ? 38   GLN A C   1 
ATOM   109  O O   . GLN A 1 19  ? -16.415 45.066 1.843   1.00 15.55 ? 38   GLN A O   1 
ATOM   110  C CB  . GLN A 1 19  ? -16.165 43.407 -0.772  1.00 13.12 ? 38   GLN A CB  1 
ATOM   111  C CG  . GLN A 1 19  ? -17.504 43.546 -1.492  1.00 13.65 ? 38   GLN A CG  1 
ATOM   112  C CD  . GLN A 1 19  ? -17.339 43.916 -2.962  1.00 14.57 ? 38   GLN A CD  1 
ATOM   113  O OE1 . GLN A 1 19  ? -16.672 44.915 -3.294  1.00 15.99 ? 38   GLN A OE1 1 
ATOM   114  N NE2 . GLN A 1 19  ? -17.901 43.113 -3.833  1.00 14.80 ? 38   GLN A NE2 1 
ATOM   115  N N   . ASP A 1 20  ? -18.303 43.835 1.766   1.00 13.84 ? 39   ASP A N   1 
ATOM   116  C CA  . ASP A 1 20  ? -19.102 44.837 2.466   1.00 14.80 ? 39   ASP A CA  1 
ATOM   117  C C   . ASP A 1 20  ? -18.959 44.771 3.993   1.00 13.89 ? 39   ASP A C   1 
ATOM   118  O O   . ASP A 1 20  ? -19.512 45.613 4.705   1.00 15.19 ? 39   ASP A O   1 
ATOM   119  C CB  . ASP A 1 20  ? -20.578 44.705 2.109   1.00 16.79 ? 39   ASP A CB  1 
ATOM   120  C CG  . ASP A 1 20  ? -20.848 44.872 0.623   1.00 19.58 ? 39   ASP A CG  1 
ATOM   121  O OD1 . ASP A 1 20  ? -20.149 45.642 -0.058  1.00 19.79 ? 39   ASP A OD1 1 
ATOM   122  O OD2 . ASP A 1 20  ? -21.795 44.227 0.144   1.00 24.59 ? 39   ASP A OD2 1 
ATOM   123  N N   . ARG A 1 21  ? -18.258 43.766 4.494   1.00 12.47 ? 40   ARG A N   1 
ATOM   124  C CA  . ARG A 1 21  ? -18.141 43.558 5.931   1.00 11.53 ? 40   ARG A CA  1 
ATOM   125  C C   . ARG A 1 21  ? -17.037 44.442 6.472   1.00 11.21 ? 40   ARG A C   1 
ATOM   126  O O   . ARG A 1 21  ? -16.107 44.832 5.760   1.00 11.33 ? 40   ARG A O   1 
ATOM   127  C CB  . ARG A 1 21  ? -17.838 42.076 6.237   1.00 10.73 ? 40   ARG A CB  1 
ATOM   128  C CG  . ARG A 1 21  ? -19.016 41.181 6.000   1.00 10.87 ? 40   ARG A CG  1 
ATOM   129  C CD  . ARG A 1 21  ? -18.656 39.706 6.054   1.00 10.57 ? 40   ARG A CD  1 
ATOM   130  N NE  . ARG A 1 21  ? -19.867 38.930 5.852   1.00 10.66 ? 40   ARG A NE  1 
ATOM   131  C CZ  . ARG A 1 21  ? -19.902 37.690 5.363   1.00 10.48 ? 40   ARG A CZ  1 
ATOM   132  N NH1 . ARG A 1 21  ? -18.797 37.057 5.020   1.00 11.09 ? 40   ARG A NH1 1 
ATOM   133  N NH2 . ARG A 1 21  ? -21.060 37.107 5.205   1.00 11.28 ? 40   ARG A NH2 1 
ATOM   134  N N   . GLN A 1 22  ? -17.135 44.771 7.754   1.00 11.17 ? 41   GLN A N   1 
ATOM   135  C CA  . GLN A 1 22  ? -16.025 45.408 8.431   1.00 11.76 ? 41   GLN A CA  1 
ATOM   136  C C   . GLN A 1 22  ? -14.924 44.398 8.778   1.00 11.85 ? 41   GLN A C   1 
ATOM   137  O O   . GLN A 1 22  ? -15.160 43.192 8.806   1.00 11.42 ? 41   GLN A O   1 
ATOM   138  C CB  . GLN A 1 22  ? -16.539 46.047 9.728   1.00 11.75 ? 41   GLN A CB  1 
ATOM   139  C CG  . GLN A 1 22  ? -17.540 47.162 9.532   1.00 11.78 ? 41   GLN A CG  1 
ATOM   140  C CD  . GLN A 1 22  ? -17.709 48.024 10.771  1.00 11.92 ? 41   GLN A CD  1 
ATOM   141  O OE1 . GLN A 1 22  ? -17.251 47.681 11.861  1.00 12.03 ? 41   GLN A OE1 1 
ATOM   142  N NE2 . GLN A 1 22  ? -18.354 49.179 10.597  1.00 13.45 ? 41   GLN A NE2 1 
ATOM   143  N N   . GLU A 1 23  ? -13.727 44.890 9.101   1.00 12.40 ? 42   GLU A N   1 
ATOM   144  C CA  . GLU A 1 23  ? -12.690 44.041 9.639   1.00 13.65 ? 42   GLU A CA  1 
ATOM   145  C C   . GLU A 1 23  ? -13.112 43.374 10.967  1.00 13.76 ? 42   GLU A C   1 
ATOM   146  O O   . GLU A 1 23  ? -13.793 43.975 11.787  1.00 12.79 ? 42   GLU A O   1 
ATOM   147  C CB  . GLU A 1 23  ? -11.393 44.828 9.858   1.00 14.92 ? 42   GLU A CB  1 
ATOM   148  C CG  . GLU A 1 23  ? -10.829 45.513 8.637   1.00 17.00 ? 42   GLU A CG  1 
ATOM   149  C CD  . GLU A 1 23  ? -10.280 44.545 7.612   1.00 19.24 ? 42   GLU A CD  1 
ATOM   150  O OE1 . GLU A 1 23  ? -10.336 43.328 7.854   0.70 21.05 ? 42   GLU A OE1 1 
ATOM   151  O OE2 . GLU A 1 23  ? -9.772  45.006 6.557   1.00 23.42 ? 42   GLU A OE2 1 
ATOM   152  N N   . PRO A 1 24  ? -12.692 42.132 11.188  1.00 13.56 ? 43   PRO A N   1 
ATOM   153  C CA  . PRO A 1 24  ? -11.741 41.385 10.382  1.00 13.75 ? 43   PRO A CA  1 
ATOM   154  C C   . PRO A 1 24  ? -12.366 40.505 9.305   1.00 13.62 ? 43   PRO A C   1 
ATOM   155  O O   . PRO A 1 24  ? -11.760 39.489 8.922   1.00 14.03 ? 43   PRO A O   1 
ATOM   156  C CB  . PRO A 1 24  ? -11.060 40.495 11.432  1.00 13.57 ? 43   PRO A CB  1 
ATOM   157  C CG  . PRO A 1 24  ? -12.184 40.143 12.329  1.00 13.32 ? 43   PRO A CG  1 
ATOM   158  C CD  . PRO A 1 24  ? -13.049 41.380 12.412  1.00 13.09 ? 43   PRO A CD  1 
ATOM   159  N N   . GLY A 1 25  ? -13.560 40.857 8.826   1.00 12.31 ? 44   GLY A N   1 
ATOM   160  C CA  . GLY A 1 25  ? -14.198 40.067 7.774   1.00 11.68 ? 44   GLY A CA  1 
ATOM   161  C C   . GLY A 1 25  ? -14.237 40.722 6.419   1.00 11.01 ? 44   GLY A C   1 
ATOM   162  O O   . GLY A 1 25  ? -14.912 40.233 5.517   1.00 10.75 ? 44   GLY A O   1 
ATOM   163  N N   . LYS A 1 26  ? -13.529 41.833 6.243   1.00 11.09 ? 45   LYS A N   1 
ATOM   164  C CA  . LYS A 1 26  ? -13.621 42.611 5.016   0.46 10.75 ? 45   LYS A CA  1 
ATOM   165  C C   . LYS A 1 26  ? -12.697 41.988 3.992   1.00 11.85 ? 45   LYS A C   1 
ATOM   166  O O   . LYS A 1 26  ? -11.490 42.173 4.064   1.00 12.94 ? 45   LYS A O   1 
ATOM   167  C CB  . LYS A 1 26  ? -13.211 44.060 5.283   0.46 10.54 ? 45   LYS A CB  1 
ATOM   168  C CG  . LYS A 1 26  ? -13.357 44.977 4.074   0.46 10.63 ? 45   LYS A CG  1 
ATOM   169  C CD  . LYS A 1 26  ? -12.932 46.392 4.390   0.46 11.13 ? 45   LYS A CD  1 
ATOM   170  C CE  . LYS A 1 26  ? -13.895 47.030 5.363   0.46 11.36 ? 45   LYS A CE  1 
ATOM   171  N NZ  . LYS A 1 26  ? -15.290 47.127 4.844   0.46 11.65 ? 45   LYS A NZ  1 
ATOM   172  N N   . PHE A 1 27  ? -13.261 41.254 3.044   1.00 11.57 ? 46   PHE A N   1 
ATOM   173  C CA  . PHE A 1 27  ? -12.504 40.435 2.111   1.00 12.24 ? 46   PHE A CA  1 
ATOM   174  C C   . PHE A 1 27  ? -12.670 40.957 0.698   1.00 14.04 ? 46   PHE A C   1 
ATOM   175  O O   . PHE A 1 27  ? -13.793 41.174 0.254   1.00 14.12 ? 46   PHE A O   1 
ATOM   176  C CB  . PHE A 1 27  ? -13.077 39.011 2.171   1.00 11.47 ? 46   PHE A CB  1 
ATOM   177  C CG  . PHE A 1 27  ? -12.361 38.011 1.307   1.00 11.33 ? 46   PHE A CG  1 
ATOM   178  C CD1 . PHE A 1 27  ? -11.305 37.302 1.809   1.00 11.59 ? 46   PHE A CD1 1 
ATOM   179  C CD2 . PHE A 1 27  ? -12.791 37.752 -0.010  1.00 12.05 ? 46   PHE A CD2 1 
ATOM   180  C CE1 . PHE A 1 27  ? -10.659 36.344 1.045   1.00 11.90 ? 46   PHE A CE1 1 
ATOM   181  C CE2 . PHE A 1 27  ? -12.141 36.812 -0.778  1.00 11.99 ? 46   PHE A CE2 1 
ATOM   182  C CZ  . PHE A 1 27  ? -11.073 36.113 -0.251  1.00 12.39 ? 46   PHE A CZ  1 
ATOM   183  N N   . THR A 1 28  ? -11.568 41.079 -0.024  1.00 16.25 ? 47   THR A N   1 
ATOM   184  C CA  . THR A 1 28  ? -11.667 41.200 -1.475  1.00 18.70 ? 47   THR A CA  1 
ATOM   185  C C   . THR A 1 28  ? -10.743 40.152 -2.093  1.00 18.16 ? 47   THR A C   1 
ATOM   186  O O   . THR A 1 28  ? -9.890  39.598 -1.410  1.00 19.46 ? 47   THR A O   1 
ATOM   187  C CB  . THR A 1 28  ? -11.282 42.613 -1.958  1.00 19.55 ? 47   THR A CB  1 
ATOM   188  O OG1 . THR A 1 28  ? -9.847  42.735 -2.036  1.00 21.41 ? 47   THR A OG1 1 
ATOM   189  C CG2 . THR A 1 28  ? -11.905 43.694 -1.058  1.00 20.72 ? 47   THR A CG2 1 
ATOM   190  N N   . PRO A 1 29  ? -10.899 39.884 -3.395  1.00 17.76 ? 48   PRO A N   1 
ATOM   191  C CA  . PRO A 1 29  ? -10.014 38.977 -4.088  1.00 17.78 ? 48   PRO A CA  1 
ATOM   192  C C   . PRO A 1 29  ? -8.528  39.250 -3.875  1.00 16.90 ? 48   PRO A C   1 
ATOM   193  O O   . PRO A 1 29  ? -7.731  38.329 -3.985  1.00 16.86 ? 48   PRO A O   1 
ATOM   194  C CB  . PRO A 1 29  ? -10.387 39.205 -5.560  1.00 18.06 ? 48   PRO A CB  1 
ATOM   195  C CG  . PRO A 1 29  ? -11.830 39.511 -5.493  1.00 18.39 ? 48   PRO A CG  1 
ATOM   196  C CD  . PRO A 1 29  ? -11.907 40.435 -4.316  1.00 18.68 ? 48   PRO A CD  1 
ATOM   197  N N   . GLU A 1 30  ? -8.147  40.491 -3.578  0.87 17.72 ? 49   GLU A N   1 
ATOM   198  C CA  . GLU A 1 30  ? -6.740  40.756 -3.244  1.00 19.94 ? 49   GLU A CA  1 
ATOM   199  C C   . GLU A 1 30  ? -6.253  40.033 -1.991  0.92 19.23 ? 49   GLU A C   1 
ATOM   200  O O   . GLU A 1 30  ? -5.041  39.880 -1.791  0.73 19.61 ? 49   GLU A O   1 
ATOM   201  C CB  . GLU A 1 30  ? -6.480  42.270 -3.158  1.00 20.45 ? 49   GLU A CB  1 
ATOM   202  C CG  . GLU A 1 30  ? -6.573  42.963 -4.508  1.00 21.38 ? 49   GLU A CG  1 
ATOM   203  C CD  . GLU A 1 30  ? -5.558  42.450 -5.515  0.51 22.03 ? 49   GLU A CD  1 
ATOM   204  O OE1 . GLU A 1 30  ? -5.922  42.279 -6.700  0.48 22.61 ? 49   GLU A OE1 1 
ATOM   205  O OE2 . GLU A 1 30  ? -4.392  42.214 -5.123  0.45 22.38 ? 49   GLU A OE2 1 
ATOM   206  N N   . ASN A 1 31  ? -7.183  39.562 -1.146  1.00 19.92 ? 50   ASN A N   1 
ATOM   207  C CA  . ASN A 1 31  ? -6.816  38.772 0.055   1.00 19.82 ? 50   ASN A CA  1 
ATOM   208  C C   . ASN A 1 31  ? -6.453  37.324 -0.267  1.00 19.20 ? 50   ASN A C   1 
ATOM   209  O O   . ASN A 1 31  ? -6.102  36.562 0.636   1.00 18.75 ? 50   ASN A O   1 
ATOM   210  C CB  . ASN A 1 31  ? -7.947  38.777 1.108   1.00 19.61 ? 50   ASN A CB  1 
ATOM   211  C CG  . ASN A 1 31  ? -8.176  40.152 1.724   1.00 21.38 ? 50   ASN A CG  1 
ATOM   212  O OD1 . ASN A 1 31  ? -9.160  40.834 1.421   1.00 24.35 ? 50   ASN A OD1 1 
ATOM   213  N ND2 . ASN A 1 31  ? -7.273  40.564 2.605   1.00 22.93 ? 50   ASN A ND2 1 
ATOM   214  N N   . ILE A 1 32  ? -6.556  36.944 -1.546  1.00 18.10 ? 51   ILE A N   1 
ATOM   215  C CA  . ILE A 1 32  ? -6.371  35.554 -1.924  1.00 17.42 ? 51   ILE A CA  1 
ATOM   216  C C   . ILE A 1 32  ? -4.902  35.265 -2.126  1.00 17.18 ? 51   ILE A C   1 
ATOM   217  O O   . ILE A 1 32  ? -4.201  35.976 -2.838  1.00 16.75 ? 51   ILE A O   1 
ATOM   218  C CB  . ILE A 1 32  ? -7.164  35.214 -3.208  1.00 17.31 ? 51   ILE A CB  1 
ATOM   219  C CG1 . ILE A 1 32  ? -8.656  35.317 -2.939  1.00 17.87 ? 51   ILE A CG1 1 
ATOM   220  C CG2 . ILE A 1 32  ? -6.860  33.812 -3.696  1.00 17.67 ? 51   ILE A CG2 1 
ATOM   221  C CD1 . ILE A 1 32  ? -9.519  35.302 -4.184  1.00 18.09 ? 51   ILE A CD1 1 
ATOM   222  N N   . ASP A 1 33  ? -4.461  34.204 -1.475  1.00 16.92 ? 52   ASP A N   1 
ATOM   223  C CA  . ASP A 1 33  ? -3.127  33.646 -1.645  1.00 17.12 ? 52   ASP A CA  1 
ATOM   224  C C   . ASP A 1 33  ? -3.153  32.760 -2.899  1.00 17.05 ? 52   ASP A C   1 
ATOM   225  O O   . ASP A 1 33  ? -3.864  31.764 -2.907  1.00 17.18 ? 52   ASP A O   1 
ATOM   226  C CB  . ASP A 1 33  ? -2.878  32.804 -0.395  1.00 18.75 ? 52   ASP A CB  1 
ATOM   227  C CG  . ASP A 1 33  ? -1.581  32.057 -0.419  1.00 19.70 ? 52   ASP A CG  1 
ATOM   228  O OD1 . ASP A 1 33  ? -0.879  32.023 -1.456  1.00 20.58 ? 52   ASP A OD1 1 
ATOM   229  O OD2 . ASP A 1 33  ? -1.259  31.496 0.660   1.00 20.52 ? 52   ASP A OD2 1 
ATOM   230  N N   . PRO A 1 34  ? -2.388  33.100 -3.951  1.00 17.31 ? 53   PRO A N   1 
ATOM   231  C CA  . PRO A 1 34  ? -2.514  32.310 -5.184  1.00 17.02 ? 53   PRO A CA  1 
ATOM   232  C C   . PRO A 1 34  ? -2.129  30.847 -5.072  1.00 15.57 ? 53   PRO A C   1 
ATOM   233  O O   . PRO A 1 34  ? -2.535  30.068 -5.937  1.00 13.56 ? 53   PRO A O   1 
ATOM   234  C CB  . PRO A 1 34  ? -1.583  33.020 -6.173  1.00 17.88 ? 53   PRO A CB  1 
ATOM   235  C CG  . PRO A 1 34  ? -0.772  33.958 -5.390  1.00 18.50 ? 53   PRO A CG  1 
ATOM   236  C CD  . PRO A 1 34  ? -1.490  34.254 -4.124  1.00 18.60 ? 53   PRO A CD  1 
ATOM   237  N N   . PHE A 1 35  ? -1.364  30.490 -4.026  1.00 16.11 ? 54   PHE A N   1 
ATOM   238  C CA  . PHE A 1 35  ? -0.933  29.109 -3.808  1.00 16.03 ? 54   PHE A CA  1 
ATOM   239  C C   . PHE A 1 35  ? -1.690  28.353 -2.710  1.00 15.07 ? 54   PHE A C   1 
ATOM   240  O O   . PHE A 1 35  ? -1.433  27.148 -2.462  1.00 15.61 ? 54   PHE A O   1 
ATOM   241  C CB  . PHE A 1 35  ? 0.571   29.071 -3.529  1.00 17.17 ? 54   PHE A CB  1 
ATOM   242  C CG  . PHE A 1 35  ? 1.390   29.567 -4.687  1.00 18.62 ? 54   PHE A CG  1 
ATOM   243  C CD1 . PHE A 1 35  ? 1.663   28.731 -5.759  1.00 20.15 ? 54   PHE A CD1 1 
ATOM   244  C CD2 . PHE A 1 35  ? 1.832   30.880 -4.733  1.00 20.35 ? 54   PHE A CD2 1 
ATOM   245  C CE1 . PHE A 1 35  ? 2.412   29.181 -6.845  1.00 20.62 ? 54   PHE A CE1 1 
ATOM   246  C CE2 . PHE A 1 35  ? 2.564   31.340 -5.824  1.00 21.00 ? 54   PHE A CE2 1 
ATOM   247  C CZ  . PHE A 1 35  ? 2.844   30.490 -6.874  1.00 20.78 ? 54   PHE A CZ  1 
ATOM   248  N N   . LEU A 1 36  ? -2.648  29.024 -2.082  1.00 13.99 ? 55   LEU A N   1 
ATOM   249  C CA  . LEU A 1 36  ? -3.451  28.368 -1.044  1.00 13.87 ? 55   LEU A CA  1 
ATOM   250  C C   . LEU A 1 36  ? -4.286  27.203 -1.554  1.00 13.19 ? 55   LEU A C   1 
ATOM   251  O O   . LEU A 1 36  ? -4.289  26.138 -0.963  1.00 13.74 ? 55   LEU A O   1 
ATOM   252  C CB  . LEU A 1 36  ? -4.369  29.384 -0.381  1.00 14.48 ? 55   LEU A CB  1 
ATOM   253  C CG  . LEU A 1 36  ? -5.185  28.885 0.811   1.00 16.04 ? 55   LEU A CG  1 
ATOM   254  C CD1 . LEU A 1 36  ? -4.270  28.526 1.980   1.00 17.63 ? 55   LEU A CD1 1 
ATOM   255  C CD2 . LEU A 1 36  ? -6.272  29.870 1.222   1.00 17.06 ? 55   LEU A CD2 1 
ATOM   256  N N   . CYS A 1 37  ? -5.008  27.412 -2.644  1.00 12.34 ? 56   CYS A N   1 
ATOM   257  C CA  . CYS A 1 37  ? -5.902  26.405 -3.185  1.00 12.24 ? 56   CYS A CA  1 
ATOM   258  C C   . CYS A 1 37  ? -5.512  26.038 -4.617  1.00 12.17 ? 56   CYS A C   1 
ATOM   259  O O   . CYS A 1 37  ? -4.786  26.784 -5.265  1.00 13.32 ? 56   CYS A O   1 
ATOM   260  C CB  . CYS A 1 37  ? -7.323  26.956 -3.193  1.00 12.14 ? 56   CYS A CB  1 
ATOM   261  S SG  . CYS A 1 37  ? -7.814  27.651 -1.596  1.00 13.86 ? 56   CYS A SG  1 
ATOM   262  N N   . SER A 1 38  ? -5.978  24.865 -5.081  1.00 11.70 ? 57   SER A N   1 
ATOM   263  C CA  . SER A 1 38  ? -5.825  24.483 -6.481  1.00 11.02 ? 57   SER A CA  1 
ATOM   264  C C   . SER A 1 38  ? -6.888  25.141 -7.357  1.00 11.47 ? 57   SER A C   1 
ATOM   265  O O   . SER A 1 38  ? -6.649  25.379 -8.529  1.00 12.34 ? 57   SER A O   1 
ATOM   266  C CB  . SER A 1 38  ? -5.911  22.968 -6.635  1.00 10.60 ? 57   SER A CB  1 
ATOM   267  O OG  . SER A 1 38  ? -7.150  22.479 -6.175  1.00 10.75 ? 57   SER A OG  1 
ATOM   268  N N   . HIS A 1 39  ? -8.081  25.349 -6.818  1.00 11.31 ? 58   HIS A N   1 
ATOM   269  C CA  . HIS A 1 39  ? -9.180  25.946 -7.580  1.00 11.52 ? 58   HIS A CA  1 
ATOM   270  C C   . HIS A 1 39  ? -9.832  27.004 -6.711  1.00 11.40 ? 58   HIS A C   1 
ATOM   271  O O   . HIS A 1 39  ? -10.003 26.783 -5.528  1.00 11.72 ? 58   HIS A O   1 
ATOM   272  C CB  . HIS A 1 39  ? -10.260 24.944 -7.929  1.00 12.46 ? 58   HIS A CB  1 
ATOM   273  C CG  . HIS A 1 39  ? -9.802  23.790 -8.755  1.00 13.60 ? 58   HIS A CG  1 
ATOM   274  N ND1 . HIS A 1 39  ? -8.873  22.872 -8.310  1.00 13.58 ? 58   HIS A ND1 1 
ATOM   275  C CD2 . HIS A 1 39  ? -10.208 23.359 -9.970  1.00 14.23 ? 58   HIS A CD2 1 
ATOM   276  C CE1 . HIS A 1 39  ? -8.694  21.952 -9.241  1.00 15.12 ? 58   HIS A CE1 1 
ATOM   277  N NE2 . HIS A 1 39  ? -9.502  22.216 -10.256 1.00 15.25 ? 58   HIS A NE2 1 
ATOM   278  N N   . LEU A 1 40  ? -10.172 28.141 -7.311  1.00 10.90 ? 59   LEU A N   1 
ATOM   279  C CA  . LEU A 1 40  ? -10.928 29.198 -6.657  1.00 11.14 ? 59   LEU A CA  1 
ATOM   280  C C   . LEU A 1 40  ? -12.233 29.298 -7.397  1.00 10.49 ? 59   LEU A C   1 
ATOM   281  O O   . LEU A 1 40  ? -12.237 29.197 -8.625  1.00 11.33 ? 59   LEU A O   1 
ATOM   282  C CB  . LEU A 1 40  ? -10.223 30.542 -6.779  1.00 11.94 ? 59   LEU A CB  1 
ATOM   283  C CG  . LEU A 1 40  ? -8.895  30.626 -6.047  1.00 12.70 ? 59   LEU A CG  1 
ATOM   284  C CD1 . LEU A 1 40  ? -8.190  31.926 -6.370  1.00 13.88 ? 59   LEU A CD1 1 
ATOM   285  C CD2 . LEU A 1 40  ? -9.185  30.516 -4.564  1.00 13.18 ? 59   LEU A CD2 1 
ATOM   286  N N   . ILE A 1 41  ? -13.322 29.500 -6.672  1.00 9.70  ? 60   ILE A N   1 
ATOM   287  C CA  . ILE A 1 41  ? -14.637 29.695 -7.286  1.00 9.62  ? 60   ILE A CA  1 
ATOM   288  C C   . ILE A 1 41  ? -15.323 30.972 -6.782  1.00 9.38  ? 60   ILE A C   1 
ATOM   289  O O   . ILE A 1 41  ? -15.551 31.109 -5.595  1.00 9.61  ? 60   ILE A O   1 
ATOM   290  C CB  . ILE A 1 41  ? -15.573 28.503 -7.067  1.00 9.91  ? 60   ILE A CB  1 
ATOM   291  C CG1 . ILE A 1 41  ? -14.911 27.200 -7.495  1.00 9.89  ? 60   ILE A CG1 1 
ATOM   292  C CG2 . ILE A 1 41  ? -16.847 28.708 -7.854  1.00 10.11 ? 60   ILE A CG2 1 
ATOM   293  C CD1 . ILE A 1 41  ? -15.745 25.957 -7.271  1.00 10.34 ? 60   ILE A CD1 1 
ATOM   294  N N   . TYR A 1 42  ? -15.667 31.873 -7.710  1.00 9.22  ? 61   TYR A N   1 
ATOM   295  C CA  . TYR A 1 42  ? -16.326 33.150 -7.397  1.00 9.12  ? 61   TYR A CA  1 
ATOM   296  C C   . TYR A 1 42  ? -17.828 32.920 -7.253  1.00 9.15  ? 61   TYR A C   1 
ATOM   297  O O   . TYR A 1 42  ? -18.459 32.340 -8.139  1.00 9.76  ? 61   TYR A O   1 
ATOM   298  C CB  . TYR A 1 42  ? -16.076 34.183 -8.495  1.00 9.54  ? 61   TYR A CB  1 
ATOM   299  C CG  . TYR A 1 42  ? -16.863 35.471 -8.351  1.00 9.49  ? 61   TYR A CG  1 
ATOM   300  C CD1 . TYR A 1 42  ? -16.312 36.573 -7.741  1.00 9.91  ? 61   TYR A CD1 1 
ATOM   301  C CD2 . TYR A 1 42  ? -18.127 35.606 -8.897  1.00 9.88  ? 61   TYR A CD2 1 
ATOM   302  C CE1 . TYR A 1 42  ? -17.022 37.753 -7.605  1.00 9.94  ? 61   TYR A CE1 1 
ATOM   303  C CE2 . TYR A 1 42  ? -18.841 36.794 -8.782  1.00 10.17 ? 61   TYR A CE2 1 
ATOM   304  C CZ  . TYR A 1 42  ? -18.274 37.877 -8.153  1.00 10.13 ? 61   TYR A CZ  1 
ATOM   305  O OH  . TYR A 1 42  ? -18.999 39.057 -8.075  1.00 11.11 ? 61   TYR A OH  1 
ATOM   306  N N   . SER A 1 43  ? -18.401 33.406 -6.153  1.00 9.00  ? 62   SER A N   1 
ATOM   307  C CA  . SER A 1 43  ? -19.807 33.202 -5.818  1.00 9.53  ? 62   SER A CA  1 
ATOM   308  C C   . SER A 1 43  ? -20.475 34.588 -5.688  1.00 9.99  ? 62   SER A C   1 
ATOM   309  O O   . SER A 1 43  ? -20.066 35.359 -4.832  1.00 9.77  ? 62   SER A O   1 
ATOM   310  C CB  . SER A 1 43  ? -19.947 32.451 -4.490  1.00 10.26 ? 62   SER A CB  1 
ATOM   311  O OG  . SER A 1 43  ? -19.075 31.316 -4.458  1.00 11.66 ? 62   SER A OG  1 
ATOM   312  N N   . PHE A 1 44  ? -21.462 34.943 -6.501  1.00 10.75 ? 63   PHE A N   1 
ATOM   313  C CA  . PHE A 1 44  ? -22.043 34.171 -7.589  1.00 11.37 ? 63   PHE A CA  1 
ATOM   314  C C   . PHE A 1 44  ? -22.338 35.123 -8.758  1.00 11.52 ? 63   PHE A C   1 
ATOM   315  O O   . PHE A 1 44  ? -22.557 36.341 -8.572  1.00 11.27 ? 63   PHE A O   1 
ATOM   316  C CB  . PHE A 1 44  ? -23.374 33.568 -7.164  1.00 11.38 ? 63   PHE A CB  1 
ATOM   317  C CG  . PHE A 1 44  ? -23.275 32.541 -6.078  1.00 10.93 ? 63   PHE A CG  1 
ATOM   318  C CD1 . PHE A 1 44  ? -22.894 31.239 -6.388  1.00 11.13 ? 63   PHE A CD1 1 
ATOM   319  C CD2 . PHE A 1 44  ? -23.645 32.824 -4.776  1.00 11.07 ? 63   PHE A CD2 1 
ATOM   320  C CE1 . PHE A 1 44  ? -22.845 30.271 -5.404  1.00 11.03 ? 63   PHE A CE1 1 
ATOM   321  C CE2 . PHE A 1 44  ? -23.599 31.863 -3.804  1.00 11.41 ? 63   PHE A CE2 1 
ATOM   322  C CZ  . PHE A 1 44  ? -23.200 30.583 -4.109  1.00 11.27 ? 63   PHE A CZ  1 
ATOM   323  N N   . ALA A 1 45  ? -22.373 34.552 -9.940  1.00 11.89 ? 64   ALA A N   1 
ATOM   324  C CA  . ALA A 1 45  ? -22.888 35.243 -11.114 1.00 12.38 ? 64   ALA A CA  1 
ATOM   325  C C   . ALA A 1 45  ? -24.413 35.343 -11.100 1.00 13.62 ? 64   ALA A C   1 
ATOM   326  O O   . ALA A 1 45  ? -25.091 34.766 -10.255 1.00 16.34 ? 64   ALA A O   1 
ATOM   327  C CB  . ALA A 1 45  ? -22.406 34.558 -12.365 1.00 11.99 ? 64   ALA A CB  1 
ATOM   328  N N   . SER A 1 46  ? -24.944 36.077 -12.055 1.00 13.81 ? 65   SER A N   1 
ATOM   329  C CA  . SER A 1 46  ? -26.379 36.307 -12.177 1.00 14.36 ? 65   SER A CA  1 
ATOM   330  C C   . SER A 1 46  ? -26.769 35.972 -13.607 1.00 14.29 ? 65   SER A C   1 
ATOM   331  O O   . SER A 1 46  ? -25.920 35.738 -14.436 1.00 12.45 ? 65   SER A O   1 
ATOM   332  C CB  . SER A 1 46  ? -26.719 37.773 -11.902 1.00 15.23 ? 65   SER A CB  1 
ATOM   333  O OG  . SER A 1 46  ? -26.369 38.179 -10.590 1.00 16.83 ? 65   SER A OG  1 
ATOM   334  N N   . ILE A 1 47  ? -28.064 35.960 -13.866 1.00 15.29 ? 66   ILE A N   1 
ATOM   335  C CA  . ILE A 1 47  ? -28.618 35.670 -15.195 1.00 16.39 ? 66   ILE A CA  1 
ATOM   336  C C   . ILE A 1 47  ? -29.582 36.773 -15.544 1.00 19.03 ? 66   ILE A C   1 
ATOM   337  O O   . ILE A 1 47  ? -30.568 36.978 -14.831 1.00 20.21 ? 66   ILE A O   1 
ATOM   338  C CB  . ILE A 1 47  ? -29.357 34.326 -15.234 1.00 17.72 ? 66   ILE A CB  1 
ATOM   339  C CG1 . ILE A 1 47  ? -28.418 33.218 -14.788 1.00 17.99 ? 66   ILE A CG1 1 
ATOM   340  C CG2 . ILE A 1 47  ? -29.874 34.044 -16.641 1.00 17.69 ? 66   ILE A CG2 1 
ATOM   341  C CD1 . ILE A 1 47  ? -29.022 31.834 -14.767 1.00 18.78 ? 66   ILE A CD1 1 
ATOM   342  N N   . GLU A 1 48  ? -29.279 37.493 -16.624 1.00 18.80 ? 67   GLU A N   1 
ATOM   343  C CA  . GLU A 1 48  ? -30.112 38.593 -17.090 1.00 20.52 ? 67   GLU A CA  1 
ATOM   344  C C   . GLU A 1 48  ? -30.336 38.437 -18.584 1.00 19.31 ? 67   GLU A C   1 
ATOM   345  O O   . GLU A 1 48  ? -29.380 38.328 -19.382 1.00 18.18 ? 67   GLU A O   1 
ATOM   346  C CB  . GLU A 1 48  ? -29.459 39.941 -16.772 1.00 22.08 ? 67   GLU A CB  1 
ATOM   347  C CG  . GLU A 1 48  ? -29.264 40.215 -15.275 1.00 24.73 ? 67   GLU A CG  1 
ATOM   348  C CD  . GLU A 1 48  ? -30.547 40.143 -14.469 1.00 26.91 ? 67   GLU A CD  1 
ATOM   349  O OE1 . GLU A 1 48  ? -31.597 40.521 -15.009 0.70 27.83 ? 67   GLU A OE1 1 
ATOM   350  O OE2 . GLU A 1 48  ? -30.512 39.730 -13.284 0.70 28.39 ? 67   GLU A OE2 1 
ATOM   351  N N   . ASN A 1 49  ? -31.617 38.430 -18.967 1.00 19.56 ? 68   ASN A N   1 
ATOM   352  C CA  . ASN A 1 49  ? -31.975 38.260 -20.373 1.00 19.15 ? 68   ASN A CA  1 
ATOM   353  C C   . ASN A 1 49  ? -31.376 36.953 -20.911 0.80 17.45 ? 68   ASN A C   1 
ATOM   354  O O   . ASN A 1 49  ? -30.916 36.883 -22.039 0.90 16.42 ? 68   ASN A O   1 
ATOM   355  C CB  . ASN A 1 49  ? -31.530 39.485 -21.195 1.00 20.00 ? 68   ASN A CB  1 
ATOM   356  C CG  . ASN A 1 49  ? -32.079 40.799 -20.633 0.46 20.99 ? 68   ASN A CG  1 
ATOM   357  O OD1 . ASN A 1 49  ? -33.207 40.855 -20.139 0.50 21.40 ? 68   ASN A OD1 1 
ATOM   358  N ND2 . ASN A 1 49  ? -31.285 41.865 -20.716 0.58 22.05 ? 68   ASN A ND2 1 
ATOM   359  N N   . ASN A 1 50  ? -31.394 35.926 -20.061 1.00 16.46 ? 69   ASN A N   1 
ATOM   360  C CA  . ASN A 1 50  ? -30.854 34.585 -20.379 1.00 16.15 ? 69   ASN A CA  1 
ATOM   361  C C   . ASN A 1 50  ? -29.356 34.563 -20.634 1.00 16.20 ? 69   ASN A C   1 
ATOM   362  O O   . ASN A 1 50  ? -28.862 33.636 -21.276 1.00 18.30 ? 69   ASN A O   1 
ATOM   363  C CB  . ASN A 1 50  ? -31.593 33.979 -21.570 1.00 16.41 ? 69   ASN A CB  1 
ATOM   364  C CG  . ASN A 1 50  ? -33.093 33.871 -21.306 1.00 16.53 ? 69   ASN A CG  1 
ATOM   365  O OD1 . ASN A 1 50  ? -33.516 33.530 -20.198 1.00 16.57 ? 69   ASN A OD1 1 
ATOM   366  N ND2 . ASN A 1 50  ? -33.892 34.196 -22.309 1.00 16.85 ? 69   ASN A ND2 1 
ATOM   367  N N   . LYS A 1 51  ? -28.632 35.566 -20.144 1.00 14.68 ? 70   LYS A N   1 
ATOM   368  C CA  . LYS A 1 51  ? -27.196 35.621 -20.365 1.00 14.79 ? 70   LYS A CA  1 
ATOM   369  C C   . LYS A 1 51  ? -26.506 35.846 -19.011 1.00 14.70 ? 70   LYS A C   1 
ATOM   370  O O   . LYS A 1 51  ? -27.098 36.448 -18.096 1.00 15.14 ? 70   LYS A O   1 
ATOM   371  C CB  . LYS A 1 51  ? -26.880 36.734 -21.344 1.00 16.96 ? 70   LYS A CB  1 
ATOM   372  C CG  . LYS A 1 51  ? -27.425 36.480 -22.749 1.00 18.06 ? 70   LYS A CG  1 
ATOM   373  C CD  . LYS A 1 51  ? -26.823 37.462 -23.731 1.00 19.81 ? 70   LYS A CD  1 
ATOM   374  C CE  . LYS A 1 51  ? -27.025 37.069 -25.176 0.50 20.61 ? 70   LYS A CE  1 
ATOM   375  N NZ  . LYS A 1 51  ? -27.078 38.294 -26.017 0.50 21.96 ? 70   LYS A NZ  1 
ATOM   376  N N   . VAL A 1 52  ? -25.305 35.290 -18.876 1.00 13.78 ? 71   VAL A N   1 
ATOM   377  C CA  . VAL A 1 52  ? -24.550 35.411 -17.640 1.00 14.03 ? 71   VAL A CA  1 
ATOM   378  C C   . VAL A 1 52  ? -23.977 36.807 -17.502 1.00 14.57 ? 71   VAL A C   1 
ATOM   379  O O   . VAL A 1 52  ? -23.444 37.365 -18.470 1.00 16.46 ? 71   VAL A O   1 
ATOM   380  C CB  . VAL A 1 52  ? -23.385 34.381 -17.588 1.00 13.42 ? 71   VAL A CB  1 
ATOM   381  C CG1 . VAL A 1 52  ? -22.288 34.689 -18.594 1.00 13.23 ? 71   VAL A CG1 1 
ATOM   382  C CG2 . VAL A 1 52  ? -22.793 34.304 -16.187 1.00 13.36 ? 71   VAL A CG2 1 
ATOM   383  N N   . ILE A 1 53  ? -24.068 37.358 -16.299 1.00 14.99 ? 72   ILE A N   1 
ATOM   384  C CA  . ILE A 1 53  ? -23.329 38.561 -15.980 1.00 16.20 ? 72   ILE A CA  1 
ATOM   385  C C   . ILE A 1 53  ? -22.804 38.416 -14.565 1.00 16.08 ? 72   ILE A C   1 
ATOM   386  O O   . ILE A 1 53  ? -23.132 37.463 -13.859 1.00 16.22 ? 72   ILE A O   1 
ATOM   387  C CB  . ILE A 1 53  ? -24.196 39.829 -16.072 1.00 17.60 ? 72   ILE A CB  1 
ATOM   388  C CG1 . ILE A 1 53  ? -25.392 39.730 -15.127 1.00 20.20 ? 72   ILE A CG1 1 
ATOM   389  C CG2 . ILE A 1 53  ? -24.656 40.072 -17.508 1.00 17.94 ? 72   ILE A CG2 1 
ATOM   390  C CD1 . ILE A 1 53  ? -25.952 41.084 -14.755 1.00 22.07 ? 72   ILE A CD1 1 
ATOM   391  N N   . ILE A 1 54  ? -22.001 39.383 -14.159 1.00 16.05 ? 73   ILE A N   1 
ATOM   392  C CA  . ILE A 1 54  ? -21.598 39.514 -12.753 1.00 14.94 ? 73   ILE A CA  1 
ATOM   393  C C   . ILE A 1 54  ? -22.132 40.842 -12.245 1.00 15.72 ? 73   ILE A C   1 
ATOM   394  O O   . ILE A 1 54  ? -21.825 41.872 -12.853 1.00 16.70 ? 73   ILE A O   1 
ATOM   395  C CB  . ILE A 1 54  ? -20.080 39.417 -12.607 1.00 14.66 ? 73   ILE A CB  1 
ATOM   396  C CG1 . ILE A 1 54  ? -19.649 37.950 -12.755 1.00 14.23 ? 73   ILE A CG1 1 
ATOM   397  C CG2 . ILE A 1 54  ? -19.627 39.928 -11.233 1.00 14.19 ? 73   ILE A CG2 1 
ATOM   398  C CD1 . ILE A 1 54  ? -18.150 37.737 -12.868 1.00 15.30 ? 73   ILE A CD1 1 
ATOM   399  N N   . LYS A 1 55  ? -22.918 40.801 -11.167 0.50 14.57 ? 74   LYS A N   1 
ATOM   400  C CA  . LYS A 1 55  ? -23.387 41.992 -10.459 1.00 16.78 ? 74   LYS A CA  1 
ATOM   401  C C   . LYS A 1 55  ? -22.533 42.225 -9.222  1.00 14.76 ? 74   LYS A C   1 
ATOM   402  O O   . LYS A 1 55  ? -22.682 41.545 -8.204  1.00 15.93 ? 74   LYS A O   1 
ATOM   403  C CB  . LYS A 1 55  ? -24.797 41.829 -9.975  1.00 18.30 ? 74   LYS A CB  1 
ATOM   404  C CG  . LYS A 1 55  ? -25.845 41.747 -11.035 1.00 20.67 ? 74   LYS A CG  1 
ATOM   405  C CD  . LYS A 1 55  ? -27.181 41.794 -10.321 0.50 21.42 ? 74   LYS A CD  1 
ATOM   406  C CE  . LYS A 1 55  ? -28.315 41.449 -11.238 0.50 22.62 ? 74   LYS A CE  1 
ATOM   407  N NZ  . LYS A 1 55  ? -29.534 41.268 -10.433 1.00 24.09 ? 74   LYS A NZ  1 
ATOM   408  N N   . ASP A 1 56  ? -21.630 43.172 -9.301  1.00 14.39 ? 75   ASP A N   1 
ATOM   409  C CA  . ASP A 1 56  ? -20.662 43.358 -8.242  1.00 13.53 ? 75   ASP A CA  1 
ATOM   410  C C   . ASP A 1 56  ? -20.074 44.747 -8.516  1.00 13.35 ? 75   ASP A C   1 
ATOM   411  O O   . ASP A 1 56  ? -19.597 45.011 -9.617  1.00 12.40 ? 75   ASP A O   1 
ATOM   412  C CB  . ASP A 1 56  ? -19.641 42.196 -8.335  1.00 13.64 ? 75   ASP A CB  1 
ATOM   413  C CG  . ASP A 1 56  ? -18.524 42.237 -7.284  1.00 13.90 ? 75   ASP A CG  1 
ATOM   414  O OD1 . ASP A 1 56  ? -18.270 43.278 -6.642  1.00 13.00 ? 75   ASP A OD1 1 
ATOM   415  O OD2 . ASP A 1 56  ? -17.837 41.187 -7.141  1.00 14.38 ? 75   ASP A OD2 1 
ATOM   416  N N   . LYS A 1 57  ? -20.149 45.656 -7.545  1.00 13.85 ? 76   LYS A N   1 
ATOM   417  C CA  . LYS A 1 57  ? -19.474 46.962 -7.717  1.00 14.49 ? 76   LYS A CA  1 
ATOM   418  C C   . LYS A 1 57  ? -17.984 46.848 -8.018  1.00 14.45 ? 76   LYS A C   1 
ATOM   419  O O   . LYS A 1 57  ? -17.377 47.762 -8.545  1.00 15.40 ? 76   LYS A O   1 
ATOM   420  C CB  . LYS A 1 57  ? -19.648 47.820 -6.462  1.00 15.97 ? 76   LYS A CB  1 
ATOM   421  C CG  . LYS A 1 57  ? -19.236 47.126 -5.181  0.50 15.99 ? 76   LYS A CG  1 
ATOM   422  C CD  . LYS A 1 57  ? -19.149 48.081 -4.010  0.50 16.90 ? 76   LYS A CD  1 
ATOM   423  C CE  . LYS A 1 57  ? -19.278 47.307 -2.715  0.50 17.06 ? 76   LYS A CE  1 
ATOM   424  N NZ  . LYS A 1 57  ? -20.501 46.460 -2.658  0.50 16.75 ? 76   LYS A NZ  1 
ATOM   425  N N   . SER A 1 58  ? -17.390 45.724 -7.648  1.00 13.31 ? 77   SER A N   1 
ATOM   426  C CA  . SER A 1 58  ? -15.975 45.496 -7.800  1.00 12.93 ? 77   SER A CA  1 
ATOM   427  C C   . SER A 1 58  ? -15.678 44.505 -8.926  1.00 11.89 ? 77   SER A C   1 
ATOM   428  O O   . SER A 1 58  ? -14.587 43.972 -9.000  1.00 12.42 ? 77   SER A O   1 
ATOM   429  C CB  . SER A 1 58  ? -15.412 44.994 -6.494  1.00 13.76 ? 77   SER A CB  1 
ATOM   430  O OG  . SER A 1 58  ? -15.707 45.974 -5.515  1.00 15.05 ? 77   SER A OG  1 
ATOM   431  N N   . GLU A 1 59  ? -16.639 44.318 -9.816  1.00 11.85 ? 78   GLU A N   1 
ATOM   432  C CA  . GLU A 1 59  ? -16.489 43.366 -10.927 1.00 11.34 ? 78   GLU A CA  1 
ATOM   433  C C   . GLU A 1 59  ? -15.203 43.547 -11.737 1.00 11.43 ? 78   GLU A C   1 
ATOM   434  O O   . GLU A 1 59  ? -14.498 42.577 -11.992 1.00 11.15 ? 78   GLU A O   1 
ATOM   435  C CB  . GLU A 1 59  ? -17.682 43.484 -11.898 1.00 12.08 ? 78   GLU A CB  1 
ATOM   436  C CG  . GLU A 1 59  ? -17.574 42.585 -13.116 1.00 12.03 ? 78   GLU A CG  1 
ATOM   437  C CD  . GLU A 1 59  ? -18.619 42.872 -14.168 1.00 13.08 ? 78   GLU A CD  1 
ATOM   438  O OE1 . GLU A 1 59  ? -18.636 42.157 -15.193 1.00 13.14 ? 78   GLU A OE1 1 
ATOM   439  O OE2 . GLU A 1 59  ? -19.381 43.850 -13.985 1.00 14.19 ? 78   GLU A OE2 1 
ATOM   440  N N   . VAL A 1 60  ? -14.930 44.752 -12.232 1.00 11.59 ? 79   VAL A N   1 
ATOM   441  C CA  . VAL A 1 60  ? -13.787 44.898 -13.127 0.56 11.16 ? 79   VAL A CA  1 
ATOM   442  C C   . VAL A 1 60  ? -12.482 44.699 -12.350 1.00 11.75 ? 79   VAL A C   1 
ATOM   443  O O   . VAL A 1 60  ? -11.482 44.276 -12.931 1.00 12.56 ? 79   VAL A O   1 
ATOM   444  C CB  . VAL A 1 60  ? -13.858 46.227 -13.917 0.56 10.93 ? 79   VAL A CB  1 
ATOM   445  C CG1 . VAL A 1 60  ? -12.582 46.487 -14.687 0.20 10.96 ? 79   VAL A CG1 1 
ATOM   446  C CG2 . VAL A 1 60  ? -15.017 46.136 -14.887 0.56 11.46 ? 79   VAL A CG2 1 
ATOM   447  N N   . MET A 1 61  ? -12.475 45.007 -11.051 0.85 11.90 ? 80   MET A N   1 
ATOM   448  C CA  . MET A 1 61  ? -11.278 44.756 -10.245 1.00 13.04 ? 80   MET A CA  1 
ATOM   449  C C   . MET A 1 61  ? -11.068 43.259 -10.031 0.91 12.27 ? 80   MET A C   1 
ATOM   450  O O   . MET A 1 61  ? -9.943  42.804 -9.975  0.90 11.11 ? 80   MET A O   1 
ATOM   451  C CB  . MET A 1 61  ? -11.340 45.539 -8.934  1.00 14.47 ? 80   MET A CB  1 
ATOM   452  C CG  . MET A 1 61  ? -11.247 47.060 -9.180  1.00 15.97 ? 80   MET A CG  1 
ATOM   453  S SD  . MET A 1 61  ? -11.229 48.177 -7.772  0.61 18.30 ? 80   MET A SD  1 
ATOM   454  C CE  . MET A 1 61  ? -12.829 47.791 -7.055  0.72 18.39 ? 80   MET A CE  1 
ATOM   455  N N   . LEU A 1 62  ? -12.161 42.501 -9.967  1.00 11.67 ? 81   LEU A N   1 
ATOM   456  C CA  . LEU A 1 62  ? -12.073 41.029 -9.939  1.00 11.84 ? 81   LEU A CA  1 
ATOM   457  C C   . LEU A 1 62  ? -11.256 40.502 -11.124 1.00 12.13 ? 81   LEU A C   1 
ATOM   458  O O   . LEU A 1 62  ? -10.378 39.655 -10.954 1.00 11.65 ? 81   LEU A O   1 
ATOM   459  C CB  . LEU A 1 62  ? -13.460 40.394 -9.935  1.00 11.93 ? 81   LEU A CB  1 
ATOM   460  C CG  . LEU A 1 62  ? -13.542 38.895 -10.152 1.00 12.64 ? 81   LEU A CG  1 
ATOM   461  C CD1 . LEU A 1 62  ? -12.984 38.155 -8.936  1.00 13.20 ? 81   LEU A CD1 1 
ATOM   462  C CD2 . LEU A 1 62  ? -14.988 38.514 -10.396 1.00 13.33 ? 81   LEU A CD2 1 
ATOM   463  N N   . TYR A 1 63  ? -11.507 41.022 -12.319 1.00 12.50 ? 82   TYR A N   1 
ATOM   464  C CA  . TYR A 1 63  ? -10.768 40.561 -13.516 1.00 12.38 ? 82   TYR A CA  1 
ATOM   465  C C   . TYR A 1 63  ? -9.290  40.852 -13.404 1.00 13.04 ? 82   TYR A C   1 
ATOM   466  O O   . TYR A 1 63  ? -8.448  40.025 -13.760 1.00 13.04 ? 82   TYR A O   1 
ATOM   467  C CB  . TYR A 1 63  ? -11.363 41.202 -14.791 1.00 11.83 ? 82   TYR A CB  1 
ATOM   468  C CG  . TYR A 1 63  ? -12.845 40.913 -14.936 1.00 11.19 ? 82   TYR A CG  1 
ATOM   469  C CD1 . TYR A 1 63  ? -13.373 39.649 -14.589 1.00 11.16 ? 82   TYR A CD1 1 
ATOM   470  C CD2 . TYR A 1 63  ? -13.721 41.871 -15.418 1.00 11.12 ? 82   TYR A CD2 1 
ATOM   471  C CE1 . TYR A 1 63  ? -14.727 39.393 -14.693 1.00 11.14 ? 82   TYR A CE1 1 
ATOM   472  C CE2 . TYR A 1 63  ? -15.077 41.614 -15.541 1.00 11.24 ? 82   TYR A CE2 1 
ATOM   473  C CZ  . TYR A 1 63  ? -15.574 40.367 -15.192 1.00 11.24 ? 82   TYR A CZ  1 
ATOM   474  O OH  . TYR A 1 63  ? -16.911 40.119 -15.280 1.00 11.48 ? 82   TYR A OH  1 
ATOM   475  N N   . GLN A 1 64  ? -8.944  42.017 -12.863 1.00 13.54 ? 83   GLN A N   1 
ATOM   476  C CA  . GLN A 1 64  ? -7.557  42.343 -12.626 1.00 14.51 ? 83   GLN A CA  1 
ATOM   477  C C   . GLN A 1 64  ? -6.922  41.302 -11.700 1.00 14.00 ? 83   GLN A C   1 
ATOM   478  O O   . GLN A 1 64  ? -5.814  40.804 -11.956 1.00 14.09 ? 83   GLN A O   1 
ATOM   479  C CB  . GLN A 1 64  ? -7.416  43.720 -11.989 1.00 15.82 ? 83   GLN A CB  1 
ATOM   480  C CG  . GLN A 1 64  ? -7.762  44.896 -12.896 1.00 17.90 ? 83   GLN A CG  1 
ATOM   481  C CD  . GLN A 1 64  ? -6.899  44.920 -14.150 0.50 18.88 ? 83   GLN A CD  1 
ATOM   482  O OE1 . GLN A 1 64  ? -7.387  44.756 -15.282 1.00 22.63 ? 83   GLN A OE1 1 
ATOM   483  N NE2 . GLN A 1 64  ? -5.606  45.083 -13.953 1.00 20.63 ? 83   GLN A NE2 1 
ATOM   484  N N   . THR A 1 65  ? -7.636  40.965 -10.634 1.00 13.52 ? 84   THR A N   1 
ATOM   485  C CA  . THR A 1 65  ? -7.109  40.003 -9.668  1.00 13.68 ? 84   THR A CA  1 
ATOM   486  C C   . THR A 1 65  ? -7.011  38.601 -10.270 1.00 13.50 ? 84   THR A C   1 
ATOM   487  O O   . THR A 1 65  ? -6.022  37.909 -10.081 1.00 13.00 ? 84   THR A O   1 
ATOM   488  C CB  . THR A 1 65  ? -7.962  39.997 -8.401  1.00 14.04 ? 84   THR A CB  1 
ATOM   489  O OG1 . THR A 1 65  ? -8.096  41.332 -7.910  1.00 14.76 ? 84   THR A OG1 1 
ATOM   490  C CG2 . THR A 1 65  ? -7.328  39.129 -7.328  1.00 14.81 ? 84   THR A CG2 1 
ATOM   491  N N   . ILE A 1 66  ? -8.022  38.185 -11.024 1.00 12.51 ? 85   ILE A N   1 
ATOM   492  C CA  . ILE A 1 66  ? -7.937  36.893 -11.721 1.00 13.29 ? 85   ILE A CA  1 
ATOM   493  C C   . ILE A 1 66  ? -6.643  36.802 -12.546 1.00 13.66 ? 85   ILE A C   1 
ATOM   494  O O   . ILE A 1 66  ? -5.903  35.806 -12.467 1.00 15.37 ? 85   ILE A O   1 
ATOM   495  C CB  . ILE A 1 66  ? -9.192  36.663 -12.594 1.00 13.44 ? 85   ILE A CB  1 
ATOM   496  C CG1 . ILE A 1 66  ? -10.368 36.353 -11.676 1.00 13.95 ? 85   ILE A CG1 1 
ATOM   497  C CG2 . ILE A 1 66  ? -8.963  35.557 -13.619 1.00 13.64 ? 85   ILE A CG2 1 
ATOM   498  C CD1 . ILE A 1 66  ? -11.721 36.330 -12.373 1.00 14.81 ? 85   ILE A CD1 1 
ATOM   499  N N   . ASN A 1 67  ? -6.349  37.839 -13.324 1.00 13.63 ? 86   ASN A N   1 
ATOM   500  C CA  . ASN A 1 67  ? -5.218  37.810 -14.226 1.00 14.00 ? 86   ASN A CA  1 
ATOM   501  C C   . ASN A 1 67  ? -3.933  37.844 -13.406 1.00 13.56 ? 86   ASN A C   1 
ATOM   502  O O   . ASN A 1 67  ? -2.935  37.209 -13.770 1.00 12.82 ? 86   ASN A O   1 
ATOM   503  C CB  . ASN A 1 67  ? -5.221  38.992 -15.205 1.00 15.84 ? 86   ASN A CB  1 
ATOM   504  C CG  . ASN A 1 67  ? -6.432  38.999 -16.138 1.00 17.36 ? 86   ASN A CG  1 
ATOM   505  O OD1 . ASN A 1 67  ? -7.076  37.993 -16.374 1.00 19.55 ? 86   ASN A OD1 1 
ATOM   506  N ND2 . ASN A 1 67  ? -6.718  40.159 -16.692 1.00 18.39 ? 86   ASN A ND2 1 
ATOM   507  N N   . SER A 1 68  ? -3.959  38.554 -12.282 0.59 11.12 ? 87   SER A N   1 
ATOM   508  C CA  . SER A 1 68  ? -2.767  38.632 -11.444 0.59 11.12 ? 87   SER A CA  1 
ATOM   509  C C   . SER A 1 68  ? -2.507  37.284 -10.770 0.59 10.99 ? 87   SER A C   1 
ATOM   510  O O   . SER A 1 68  ? -1.381  36.769 -10.784 0.59 9.38  ? 87   SER A O   1 
ATOM   511  C CB  . SER A 1 68  ? -2.893  39.735 -10.417 0.59 11.10 ? 87   SER A CB  1 
ATOM   512  O OG  . SER A 1 68  ? -1.726  39.764 -9.617  0.59 11.41 ? 87   SER A OG  1 
ATOM   513  N N   . LEU A 1 69  ? -3.549  36.711 -10.201 1.00 11.96 ? 88   LEU A N   1 
ATOM   514  C CA  . LEU A 1 69  ? -3.412  35.419 -9.526  1.00 12.86 ? 88   LEU A CA  1 
ATOM   515  C C   . LEU A 1 69  ? -2.883  34.312 -10.446 1.00 14.39 ? 88   LEU A C   1 
ATOM   516  O O   . LEU A 1 69  ? -2.013  33.533 -10.045 1.00 14.18 ? 88   LEU A O   1 
ATOM   517  C CB  . LEU A 1 69  ? -4.737  34.963 -8.898  1.00 13.12 ? 88   LEU A CB  1 
ATOM   518  C CG  . LEU A 1 69  ? -5.282  35.753 -7.724  1.00 14.02 ? 88   LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 69  ? -6.741  35.378 -7.433  1.00 14.36 ? 88   LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 69  ? -4.398  35.545 -6.504  1.00 14.75 ? 88   LEU A CD2 1 
ATOM   521  N N   . LYS A 1 70  ? -3.393  34.270 -11.677 1.00 14.36 ? 89   LYS A N   1 
ATOM   522  C CA  . LYS A 1 70  ? -3.015  33.241 -12.651 1.00 15.49 ? 89   LYS A CA  1 
ATOM   523  C C   . LYS A 1 70  ? -1.652  33.453 -13.273 1.00 16.23 ? 89   LYS A C   1 
ATOM   524  O O   . LYS A 1 70  ? -1.030  32.493 -13.728 1.00 17.05 ? 89   LYS A O   1 
ATOM   525  C CB  . LYS A 1 70  ? -4.117  33.085 -13.708 1.00 15.23 ? 89   LYS A CB  1 
ATOM   526  C CG  . LYS A 1 70  ? -5.395  32.519 -13.093 1.00 15.05 ? 89   LYS A CG  1 
ATOM   527  C CD  . LYS A 1 70  ? -6.576  32.313 -14.042 1.00 16.02 ? 89   LYS A CD  1 
ATOM   528  C CE  . LYS A 1 70  ? -6.246  31.448 -15.217 1.00 16.04 ? 89   LYS A CE  1 
ATOM   529  N NZ  . LYS A 1 70  ? -7.476  31.198 -16.012 1.00 16.00 ? 89   LYS A NZ  1 
ATOM   530  N N   . THR A 1 71  ? -1.156  34.682 -13.244 1.00 16.89 ? 90   THR A N   1 
ATOM   531  C CA  . THR A 1 71  ? 0.220   34.956 -13.595 1.00 18.29 ? 90   THR A CA  1 
ATOM   532  C C   . THR A 1 71  ? 1.167   34.476 -12.499 1.00 18.84 ? 90   THR A C   1 
ATOM   533  O O   . THR A 1 71  ? 2.218   33.905 -12.798 1.00 21.58 ? 90   THR A O   1 
ATOM   534  C CB  . THR A 1 71  ? 0.415   36.466 -13.834 1.00 19.05 ? 90   THR A CB  1 
ATOM   535  O OG1 . THR A 1 71  ? -0.471  36.876 -14.883 1.00 21.03 ? 90   THR A OG1 1 
ATOM   536  C CG2 . THR A 1 71  ? 1.852   36.773 -14.247 1.00 19.25 ? 90   THR A CG2 1 
ATOM   537  N N   . LYS A 1 72  ? 0.811   34.726 -11.241 1.00 18.42 ? 91   LYS A N   1 
ATOM   538  C CA  . LYS A 1 72  ? 1.642   34.309 -10.100 1.00 18.25 ? 91   LYS A CA  1 
ATOM   539  C C   . LYS A 1 72  ? 1.673   32.786 -9.977  1.00 19.35 ? 91   LYS A C   1 
ATOM   540  O O   . LYS A 1 72  ? 2.731   32.221 -9.676  1.00 19.41 ? 91   LYS A O   1 
ATOM   541  C CB  . LYS A 1 72  ? 1.133   34.910 -8.799  1.00 19.53 ? 91   LYS A CB  1 
ATOM   542  C CG  . LYS A 1 72  ? 1.270   36.408 -8.732  1.00 19.49 ? 91   LYS A CG  1 
ATOM   543  C CD  . LYS A 1 72  ? 0.630   36.969 -7.485  1.00 21.18 ? 91   LYS A CD  1 
ATOM   544  C CE  . LYS A 1 72  ? 0.980   38.440 -7.306  1.00 22.79 ? 91   LYS A CE  1 
ATOM   545  N NZ  . LYS A 1 72  ? 0.545   39.246 -8.462  0.50 22.83 ? 91   LYS A NZ  1 
ATOM   546  N N   . ASN A 1 73  ? 0.522   32.137 -10.172 1.00 16.63 ? 92   ASN A N   1 
ATOM   547  C CA  . ASN A 1 73  ? 0.429   30.685 -10.147 1.00 17.48 ? 92   ASN A CA  1 
ATOM   548  C C   . ASN A 1 73  ? -0.256  30.141 -11.404 1.00 18.31 ? 92   ASN A C   1 
ATOM   549  O O   . ASN A 1 73  ? -1.469  29.995 -11.468 1.00 15.98 ? 92   ASN A O   1 
ATOM   550  C CB  . ASN A 1 73  ? -0.296  30.216 -8.890  1.00 16.79 ? 92   ASN A CB  1 
ATOM   551  C CG  . ASN A 1 73  ? -0.516  28.710 -8.871  1.00 17.44 ? 92   ASN A CG  1 
ATOM   552  O OD1 . ASN A 1 73  ? 0.012   27.976 -9.712  1.00 19.09 ? 92   ASN A OD1 1 
ATOM   553  N ND2 . ASN A 1 73  ? -1.326  28.253 -7.941  1.00 17.03 ? 92   ASN A ND2 1 
ATOM   554  N N   . PRO A 1 74  ? 0.535   29.824 -12.429 1.00 19.07 ? 93   PRO A N   1 
ATOM   555  C CA  . PRO A 1 74  ? -0.012  29.349 -13.690 1.00 20.17 ? 93   PRO A CA  1 
ATOM   556  C C   . PRO A 1 74  ? -0.834  28.053 -13.631 1.00 19.69 ? 93   PRO A C   1 
ATOM   557  O O   . PRO A 1 74  ? -1.588  27.766 -14.573 1.00 20.92 ? 93   PRO A O   1 
ATOM   558  C CB  . PRO A 1 74  ? 1.247   29.205 -14.563 1.00 20.68 ? 93   PRO A CB  1 
ATOM   559  C CG  . PRO A 1 74  ? 2.184   30.224 -13.998 1.00 21.61 ? 93   PRO A CG  1 
ATOM   560  C CD  . PRO A 1 74  ? 1.970   30.143 -12.521 1.00 20.46 ? 93   PRO A CD  1 
ATOM   561  N N   . LYS A 1 75  ? -0.747  27.295 -12.538 1.00 17.89 ? 94   LYS A N   1 
ATOM   562  C CA  . LYS A 1 75  ? -1.540  26.071 -12.420 1.00 18.36 ? 94   LYS A CA  1 
ATOM   563  C C   . LYS A 1 75  ? -2.928  26.333 -11.822 1.00 16.36 ? 94   LYS A C   1 
ATOM   564  O O   . LYS A 1 75  ? -3.765  25.458 -11.850 1.00 15.52 ? 94   LYS A O   1 
ATOM   565  C CB  . LYS A 1 75  ? -0.818  25.015 -11.564 1.00 19.83 ? 94   LYS A CB  1 
ATOM   566  C CG  . LYS A 1 75  ? 0.698   25.093 -11.642 0.50 21.73 ? 94   LYS A CG  1 
ATOM   567  C CD  . LYS A 1 75  ? 1.391   23.809 -11.240 0.50 23.04 ? 94   LYS A CD  1 
ATOM   568  C CE  . LYS A 1 75  ? 2.119   23.225 -12.438 0.50 24.01 ? 94   LYS A CE  1 
ATOM   569  N NZ  . LYS A 1 75  ? 3.523   22.878 -12.082 0.50 25.40 ? 94   LYS A NZ  1 
ATOM   570  N N   . LEU A 1 76  ? -3.143  27.527 -11.278 1.00 16.41 ? 95   LEU A N   1 
ATOM   571  C CA  . LEU A 1 76  ? -4.384  27.861 -10.604 1.00 15.39 ? 95   LEU A CA  1 
ATOM   572  C C   . LEU A 1 76  ? -5.561  27.870 -11.564 1.00 15.03 ? 95   LEU A C   1 
ATOM   573  O O   . LEU A 1 76  ? -5.485  28.450 -12.654 1.00 15.43 ? 95   LEU A O   1 
ATOM   574  C CB  . LEU A 1 76  ? -4.258  29.231 -9.943  1.00 15.31 ? 95   LEU A CB  1 
ATOM   575  C CG  . LEU A 1 76  ? -5.403  29.714 -9.062  1.00 15.27 ? 95   LEU A CG  1 
ATOM   576  C CD1 . LEU A 1 76  ? -5.563  28.869 -7.803  1.00 15.79 ? 95   LEU A CD1 1 
ATOM   577  C CD2 . LEU A 1 76  ? -5.176  31.159 -8.666  1.00 15.39 ? 95   LEU A CD2 1 
ATOM   578  N N   . LYS A 1 77  ? -6.650  27.227 -11.157 1.00 14.11 ? 96   LYS A N   1 
ATOM   579  C CA  . LYS A 1 77  ? -7.902  27.289 -11.922 1.00 13.41 ? 96   LYS A CA  1 
ATOM   580  C C   . LYS A 1 77  ? -8.882  28.185 -11.178 1.00 12.96 ? 96   LYS A C   1 
ATOM   581  O O   . LYS A 1 77  ? -9.009  28.074 -9.959  1.00 12.08 ? 96   LYS A O   1 
ATOM   582  C CB  . LYS A 1 77  ? -8.505  25.902 -12.078 1.00 14.72 ? 96   LYS A CB  1 
ATOM   583  C CG  . LYS A 1 77  ? -7.520  24.859 -12.601 1.00 15.69 ? 96   LYS A CG  1 
ATOM   584  C CD  . LYS A 1 77  ? -7.220  25.120 -14.053 1.00 17.16 ? 96   LYS A CD  1 
ATOM   585  C CE  . LYS A 1 77  ? -6.167  24.167 -14.607 0.50 16.71 ? 96   LYS A CE  1 
ATOM   586  N NZ  . LYS A 1 77  ? -5.774  24.538 -15.992 0.50 16.65 ? 96   LYS A NZ  1 
ATOM   587  N N   . ILE A 1 78  ? -9.580  29.036 -11.923 1.00 12.04 ? 97   ILE A N   1 
ATOM   588  C CA  . ILE A 1 78  ? -10.559 29.938 -11.346 1.00 11.51 ? 97   ILE A CA  1 
ATOM   589  C C   . ILE A 1 78  ? -11.889 29.773 -12.068 1.00 11.79 ? 97   ILE A C   1 
ATOM   590  O O   . ILE A 1 78  ? -11.969 29.984 -13.280 1.00 12.66 ? 97   ILE A O   1 
ATOM   591  C CB  . ILE A 1 78  ? -10.067 31.399 -11.382 1.00 10.98 ? 97   ILE A CB  1 
ATOM   592  C CG1 . ILE A 1 78  ? -8.714  31.537 -10.652 1.00 11.01 ? 97   ILE A CG1 1 
ATOM   593  C CG2 . ILE A 1 78  ? -11.105 32.311 -10.746 1.00 11.19 ? 97   ILE A CG2 1 
ATOM   594  C CD1 . ILE A 1 78  ? -8.172  32.946 -10.592 1.00 10.96 ? 97   ILE A CD1 1 
ATOM   595  N N   . LEU A 1 79  ? -12.913 29.371 -11.325 1.00 11.52 ? 98   LEU A N   1 
ATOM   596  C CA  . LEU A 1 79  ? -14.222 29.085 -11.892 1.00 11.92 ? 98   LEU A CA  1 
ATOM   597  C C   . LEU A 1 79  ? -15.212 30.162 -11.451 1.00 11.26 ? 98   LEU A C   1 
ATOM   598  O O   . LEU A 1 79  ? -15.030 30.823 -10.415 1.00 10.18 ? 98   LEU A O   1 
ATOM   599  C CB  . LEU A 1 79  ? -14.737 27.726 -11.450 1.00 12.74 ? 98   LEU A CB  1 
ATOM   600  C CG  . LEU A 1 79  ? -14.007 26.513 -12.038 1.00 14.33 ? 98   LEU A CG  1 
ATOM   601  C CD1 . LEU A 1 79  ? -12.709 26.238 -11.292 1.00 15.18 ? 98   LEU A CD1 1 
ATOM   602  C CD2 . LEU A 1 79  ? -14.946 25.324 -11.994 1.00 14.57 ? 98   LEU A CD2 1 
ATOM   603  N N   . LEU A 1 80  ? -16.248 30.317 -12.261 1.00 11.07 ? 99   LEU A N   1 
ATOM   604  C CA  . LEU A 1 80  ? -17.406 31.153 -11.954 1.00 11.29 ? 99   LEU A CA  1 
ATOM   605  C C   . LEU A 1 80  ? -18.601 30.281 -11.511 1.00 11.04 ? 99   LEU A C   1 
ATOM   606  O O   . LEU A 1 80  ? -18.984 29.307 -12.178 1.00 10.58 ? 99   LEU A O   1 
ATOM   607  C CB  . LEU A 1 80  ? -17.766 31.977 -13.202 1.00 11.48 ? 99   LEU A CB  1 
ATOM   608  C CG  . LEU A 1 80  ? -18.946 32.929 -13.078 1.00 12.26 ? 99   LEU A CG  1 
ATOM   609  C CD1 . LEU A 1 80  ? -18.590 34.009 -12.092 1.00 12.52 ? 99   LEU A CD1 1 
ATOM   610  C CD2 . LEU A 1 80  ? -19.299 33.505 -14.437 1.00 12.90 ? 99   LEU A CD2 1 
ATOM   611  N N   . SER A 1 81  ? -19.200 30.602 -10.374 1.00 10.22 ? 100  SER A N   1 
ATOM   612  C CA  . SER A 1 81  ? -20.337 29.871 -9.894  1.00 9.92  ? 100  SER A CA  1 
ATOM   613  C C   . SER A 1 81  ? -21.655 30.631 -10.136 1.00 10.07 ? 100  SER A C   1 
ATOM   614  O O   . SER A 1 81  ? -21.695 31.856 -9.955  1.00 10.78 ? 100  SER A O   1 
ATOM   615  C CB  . SER A 1 81  ? -20.207 29.562 -8.406  1.00 10.35 ? 100  SER A CB  1 
ATOM   616  O OG  . SER A 1 81  ? -21.254 28.682 -7.985  1.00 9.80  ? 100  SER A OG  1 
ATOM   617  N N   . ILE A 1 82  ? -22.685 29.907 -10.522 0.54 9.12  ? 101  ILE A N   1 
ATOM   618  C CA  . ILE A 1 82  ? -24.040 30.434 -10.550 0.54 9.76  ? 101  ILE A CA  1 
ATOM   619  C C   . ILE A 1 82  ? -24.895 29.588 -9.654  0.54 9.87  ? 101  ILE A C   1 
ATOM   620  O O   . ILE A 1 82  ? -24.799 28.376 -9.674  0.54 9.14  ? 101  ILE A O   1 
ATOM   621  C CB  . ILE A 1 82  ? -24.638 30.428 -11.955 0.54 10.03 ? 101  ILE A CB  1 
ATOM   622  C CG1 . ILE A 1 82  ? -23.882 31.412 -12.831 0.54 10.80 ? 101  ILE A CG1 1 
ATOM   623  C CG2 . ILE A 1 82  ? -26.110 30.785 -11.889 0.54 10.42 ? 101  ILE A CG2 1 
ATOM   624  C CD1 . ILE A 1 82  ? -24.112 31.269 -14.312 0.54 11.37 ? 101  ILE A CD1 1 
ATOM   625  N N   . GLY A 1 83  ? -25.746 30.250 -8.877  1.00 12.23 ? 102  GLY A N   1 
ATOM   626  C CA  . GLY A 1 83  ? -26.636 29.612 -7.944  1.00 12.58 ? 102  GLY A CA  1 
ATOM   627  C C   . GLY A 1 83  ? -26.531 30.134 -6.529  1.00 13.62 ? 102  GLY A C   1 
ATOM   628  O O   . GLY A 1 83  ? -26.494 31.338 -6.301  1.00 14.68 ? 102  GLY A O   1 
ATOM   629  N N   . GLY A 1 84  ? -26.514 29.217 -5.576  1.00 13.75 ? 103  GLY A N   1 
ATOM   630  C CA  . GLY A 1 84  ? -26.517 29.567 -4.170  1.00 14.04 ? 103  GLY A CA  1 
ATOM   631  C C   . GLY A 1 84  ? -27.893 29.624 -3.592  1.00 13.96 ? 103  GLY A C   1 
ATOM   632  O O   . GLY A 1 84  ? -28.924 29.590 -4.326  1.00 14.87 ? 103  GLY A O   1 
ATOM   633  N N   . TYR A 1 85  ? -27.937 29.676 -2.267  1.00 14.95 ? 104  TYR A N   1 
ATOM   634  C CA  . TYR A 1 85  ? -29.193 29.581 -1.551  1.00 16.30 ? 104  TYR A CA  1 
ATOM   635  C C   . TYR A 1 85  ? -30.183 30.676 -1.939  1.00 16.69 ? 104  TYR A C   1 
ATOM   636  O O   . TYR A 1 85  ? -31.362 30.388 -2.192  1.00 15.99 ? 104  TYR A O   1 
ATOM   637  C CB  . TYR A 1 85  ? -28.957 29.647 -0.035  1.00 18.17 ? 104  TYR A CB  1 
ATOM   638  C CG  . TYR A 1 85  ? -30.224 29.672 0.762   1.00 20.96 ? 104  TYR A CG  1 
ATOM   639  C CD1 . TYR A 1 85  ? -30.969 28.519 0.956   1.00 23.30 ? 104  TYR A CD1 1 
ATOM   640  C CD2 . TYR A 1 85  ? -30.683 30.851 1.328   1.00 21.95 ? 104  TYR A CD2 1 
ATOM   641  C CE1 . TYR A 1 85  ? -32.152 28.539 1.686   1.00 24.87 ? 104  TYR A CE1 1 
ATOM   642  C CE2 . TYR A 1 85  ? -31.850 30.876 2.067   1.00 24.71 ? 104  TYR A CE2 1 
ATOM   643  C CZ  . TYR A 1 85  ? -32.578 29.721 2.238   1.00 25.58 ? 104  TYR A CZ  1 
ATOM   644  O OH  . TYR A 1 85  ? -33.735 29.758 2.973   0.50 27.26 ? 104  TYR A OH  1 
ATOM   645  N N   . LEU A 1 86  ? -29.732 31.926 -1.939  1.00 16.81 ? 105  LEU A N   1 
ATOM   646  C CA  . LEU A 1 86  ? -30.645 33.066 -2.204  1.00 17.06 ? 105  LEU A CA  1 
ATOM   647  C C   . LEU A 1 86  ? -31.222 33.056 -3.622  1.00 16.68 ? 105  LEU A C   1 
ATOM   648  O O   . LEU A 1 86  ? -32.397 33.351 -3.841  1.00 16.78 ? 105  LEU A O   1 
ATOM   649  C CB  . LEU A 1 86  ? -29.935 34.408 -1.948  1.00 17.09 ? 105  LEU A CB  1 
ATOM   650  C CG  . LEU A 1 86  ? -29.692 34.796 -0.492  1.00 18.02 ? 105  LEU A CG  1 
ATOM   651  C CD1 . LEU A 1 86  ? -29.033 36.166 -0.439  1.00 18.22 ? 105  LEU A CD1 1 
ATOM   652  C CD2 . LEU A 1 86  ? -31.004 34.826 0.287   1.00 17.97 ? 105  LEU A CD2 1 
ATOM   653  N N   . PHE A 1 87  ? -30.394 32.682 -4.572  1.00 15.18 ? 106  PHE A N   1 
ATOM   654  C CA  . PHE A 1 87  ? -30.782 32.614 -5.985  1.00 14.17 ? 106  PHE A CA  1 
ATOM   655  C C   . PHE A 1 87  ? -31.854 31.544 -6.144  1.00 14.65 ? 106  PHE A C   1 
ATOM   656  O O   . PHE A 1 87  ? -32.826 31.712 -6.864  1.00 15.39 ? 106  PHE A O   1 
ATOM   657  C CB  . PHE A 1 87  ? -29.533 32.230 -6.779  1.00 13.55 ? 106  PHE A CB  1 
ATOM   658  C CG  . PHE A 1 87  ? -29.646 32.406 -8.268  1.00 12.61 ? 106  PHE A CG  1 
ATOM   659  C CD1 . PHE A 1 87  ? -29.611 33.665 -8.839  1.00 13.30 ? 106  PHE A CD1 1 
ATOM   660  C CD2 . PHE A 1 87  ? -29.719 31.308 -9.103  1.00 11.99 ? 106  PHE A CD2 1 
ATOM   661  C CE1 . PHE A 1 87  ? -29.671 33.827 -10.208 1.00 12.69 ? 106  PHE A CE1 1 
ATOM   662  C CE2 . PHE A 1 87  ? -29.753 31.455 -10.462 1.00 12.10 ? 106  PHE A CE2 1 
ATOM   663  C CZ  . PHE A 1 87  ? -29.732 32.720 -11.034 1.00 12.48 ? 106  PHE A CZ  1 
ATOM   664  N N   . GLY A 1 88  ? -31.660 30.439 -5.446  1.00 13.92 ? 107  GLY A N   1 
ATOM   665  C CA  . GLY A 1 88  ? -32.661 29.387 -5.388  1.00 14.21 ? 107  GLY A CA  1 
ATOM   666  C C   . GLY A 1 88  ? -32.901 28.720 -6.733  1.00 14.55 ? 107  GLY A C   1 
ATOM   667  O O   . GLY A 1 88  ? -32.034 28.692 -7.594  1.00 14.36 ? 107  GLY A O   1 
ATOM   668  N N   . SER A 1 89  ? -34.115 28.201 -6.898  1.00 16.39 ? 108  SER A N   1 
ATOM   669  C CA  . SER A 1 89  ? -34.592 27.726 -8.196  1.00 15.87 ? 108  SER A CA  1 
ATOM   670  C C   . SER A 1 89  ? -35.135 28.889 -9.041  1.00 16.58 ? 108  SER A C   1 
ATOM   671  O O   . SER A 1 89  ? -34.979 28.895 -10.266 1.00 15.81 ? 108  SER A O   1 
ATOM   672  C CB  . SER A 1 89  ? -35.685 26.666 -8.017  1.00 16.32 ? 108  SER A CB  1 
ATOM   673  O OG  . SER A 1 89  ? -35.150 25.499 -7.407  1.00 16.16 ? 108  SER A OG  1 
ATOM   674  N N   . LYS A 1 90  ? -35.751 29.870 -8.391  1.00 17.46 ? 109  LYS A N   1 
ATOM   675  C CA  . LYS A 1 90  ? -36.347 31.012 -9.122  1.00 17.81 ? 109  LYS A CA  1 
ATOM   676  C C   . LYS A 1 90  ? -35.347 31.693 -10.042 1.00 16.98 ? 109  LYS A C   1 
ATOM   677  O O   . LYS A 1 90  ? -35.704 32.101 -11.146 1.00 16.62 ? 109  LYS A O   1 
ATOM   678  C CB  . LYS A 1 90  ? -36.982 32.035 -8.169  1.00 19.21 ? 109  LYS A CB  1 
ATOM   679  C CG  . LYS A 1 90  ? -38.226 31.505 -7.459  0.50 20.98 ? 109  LYS A CG  1 
ATOM   680  C CD  . LYS A 1 90  ? -39.342 32.535 -7.405  0.50 23.07 ? 109  LYS A CD  1 
ATOM   681  C CE  . LYS A 1 90  ? -40.612 31.963 -6.788  1.00 25.56 ? 109  LYS A CE  1 
ATOM   682  N NZ  . LYS A 1 90  ? -40.612 32.093 -5.306  0.50 25.07 ? 109  LYS A NZ  1 
ATOM   683  N N   . GLY A 1 91  ? -34.083 31.757 -9.618  1.00 14.84 ? 110  GLY A N   1 
ATOM   684  C CA  . GLY A 1 91  ? -33.092 32.494 -10.378 1.00 14.86 ? 110  GLY A CA  1 
ATOM   685  C C   . GLY A 1 91  ? -32.855 31.872 -11.747 1.00 14.25 ? 110  GLY A C   1 
ATOM   686  O O   . GLY A 1 91  ? -32.458 32.552 -12.688 1.00 14.35 ? 110  GLY A O   1 
ATOM   687  N N   . PHE A 1 92  ? -33.093 30.564 -11.854 1.00 14.68 ? 111  PHE A N   1 
ATOM   688  C CA  . PHE A 1 92  ? -32.787 29.839 -13.101 1.00 13.67 ? 111  PHE A CA  1 
ATOM   689  C C   . PHE A 1 92  ? -33.927 29.960 -14.117 1.00 14.36 ? 111  PHE A C   1 
ATOM   690  O O   . PHE A 1 92  ? -33.804 29.533 -15.247 1.00 12.88 ? 111  PHE A O   1 
ATOM   691  C CB  . PHE A 1 92  ? -32.480 28.375 -12.820 1.00 13.62 ? 111  PHE A CB  1 
ATOM   692  C CG  . PHE A 1 92  ? -31.133 28.144 -12.194 1.00 12.81 ? 111  PHE A CG  1 
ATOM   693  C CD1 . PHE A 1 92  ? -29.992 28.132 -12.969 1.00 13.28 ? 111  PHE A CD1 1 
ATOM   694  C CD2 . PHE A 1 92  ? -31.022 28.016 -10.823 1.00 13.31 ? 111  PHE A CD2 1 
ATOM   695  C CE1 . PHE A 1 92  ? -28.752 27.935 -12.390 1.00 13.61 ? 111  PHE A CE1 1 
ATOM   696  C CE2 . PHE A 1 92  ? -29.785 27.813 -10.239 1.00 12.77 ? 111  PHE A CE2 1 
ATOM   697  C CZ  . PHE A 1 92  ? -28.653 27.785 -11.025 1.00 13.26 ? 111  PHE A CZ  1 
ATOM   698  N N   . HIS A 1 93  ? -35.019 30.603 -13.715 1.00 15.09 ? 112  HIS A N   1 
ATOM   699  C CA  . HIS A 1 93  ? -36.118 30.887 -14.613 1.00 16.50 ? 112  HIS A CA  1 
ATOM   700  C C   . HIS A 1 93  ? -36.072 32.378 -14.950 1.00 16.33 ? 112  HIS A C   1 
ATOM   701  O O   . HIS A 1 93  ? -35.783 33.206 -14.079 1.00 18.14 ? 112  HIS A O   1 
ATOM   702  C CB  . HIS A 1 93  ? -37.450 30.597 -13.930 1.00 16.99 ? 112  HIS A CB  1 
ATOM   703  C CG  . HIS A 1 93  ? -37.704 29.145 -13.696 1.00 18.01 ? 112  HIS A CG  1 
ATOM   704  N ND1 . HIS A 1 93  ? -38.217 28.315 -14.668 1.00 18.28 ? 112  HIS A ND1 1 
ATOM   705  C CD2 . HIS A 1 93  ? -37.507 28.372 -12.603 1.00 19.20 ? 112  HIS A CD2 1 
ATOM   706  C CE1 . HIS A 1 93  ? -38.344 27.097 -14.174 1.00 18.81 ? 112  HIS A CE1 1 
ATOM   707  N NE2 . HIS A 1 93  ? -37.901 27.103 -12.930 1.00 18.71 ? 112  HIS A NE2 1 
ATOM   708  N N   . PRO A 1 94  ? -36.394 32.728 -16.195 1.00 17.04 ? 113  PRO A N   1 
ATOM   709  C CA  . PRO A 1 94  ? -36.911 31.874 -17.285 1.00 16.35 ? 113  PRO A CA  1 
ATOM   710  C C   . PRO A 1 94  ? -35.860 31.157 -18.144 1.00 15.81 ? 113  PRO A C   1 
ATOM   711  O O   . PRO A 1 94  ? -36.194 30.493 -19.112 1.00 16.19 ? 113  PRO A O   1 
ATOM   712  C CB  . PRO A 1 94  ? -37.663 32.881 -18.156 1.00 16.64 ? 113  PRO A CB  1 
ATOM   713  C CG  . PRO A 1 94  ? -36.887 34.149 -17.988 1.00 17.32 ? 113  PRO A CG  1 
ATOM   714  C CD  . PRO A 1 94  ? -36.412 34.156 -16.565 1.00 17.28 ? 113  PRO A CD  1 
ATOM   715  N N   . MET A 1 95  ? -34.587 31.276 -17.806 1.00 15.47 ? 114  MET A N   1 
ATOM   716  C CA  . MET A 1 95  ? -33.544 30.690 -18.630 1.00 14.77 ? 114  MET A CA  1 
ATOM   717  C C   . MET A 1 95  ? -33.729 29.216 -18.942 1.00 14.76 ? 114  MET A C   1 
ATOM   718  O O   . MET A 1 95  ? -33.538 28.813 -20.067 1.00 14.99 ? 114  MET A O   1 
ATOM   719  C CB  . MET A 1 95  ? -32.186 30.889 -17.958 1.00 15.03 ? 114  MET A CB  1 
ATOM   720  C CG  . MET A 1 95  ? -31.009 30.440 -18.797 1.00 15.11 ? 114  MET A CG  1 
ATOM   721  S SD  . MET A 1 95  ? -30.593 28.704 -18.546 1.00 15.47 ? 114  MET A SD  1 
ATOM   722  C CE  . MET A 1 95  ? -29.907 28.757 -16.890 1.00 15.42 ? 114  MET A CE  1 
ATOM   723  N N   . VAL A 1 96  ? -34.099 28.424 -17.947 1.00 16.00 ? 115  VAL A N   1 
ATOM   724  C CA  . VAL A 1 96  ? -34.199 26.977 -18.162 1.00 17.45 ? 115  VAL A CA  1 
ATOM   725  C C   . VAL A 1 96  ? -35.460 26.548 -18.916 1.00 17.70 ? 115  VAL A C   1 
ATOM   726  O O   . VAL A 1 96  ? -35.559 25.381 -19.288 1.00 18.35 ? 115  VAL A O   1 
ATOM   727  C CB  . VAL A 1 96  ? -34.121 26.154 -16.844 1.00 17.02 ? 115  VAL A CB  1 
ATOM   728  C CG1 . VAL A 1 96  ? -32.766 26.326 -16.175 1.00 18.26 ? 115  VAL A CG1 1 
ATOM   729  C CG2 . VAL A 1 96  ? -35.279 26.449 -15.923 1.00 17.74 ? 115  VAL A CG2 1 
ATOM   730  N N   . ASP A 1 97  ? -36.416 27.457 -19.134 1.00 19.35 ? 116  ASP A N   1 
ATOM   731  C CA  . ASP A 1 97  ? -37.761 27.059 -19.624 1.00 20.47 ? 116  ASP A CA  1 
ATOM   732  C C   . ASP A 1 97  ? -37.792 26.449 -21.022 1.00 21.73 ? 116  ASP A C   1 
ATOM   733  O O   . ASP A 1 97  ? -38.731 25.716 -21.335 1.00 21.79 ? 116  ASP A O   1 
ATOM   734  C CB  . ASP A 1 97  ? -38.729 28.243 -19.678 1.00 22.04 ? 116  ASP A CB  1 
ATOM   735  C CG  . ASP A 1 97  ? -38.931 28.925 -18.352 1.00 24.49 ? 116  ASP A CG  1 
ATOM   736  O OD1 . ASP A 1 97  ? -38.403 28.469 -17.318 1.00 26.47 ? 116  ASP A OD1 1 
ATOM   737  O OD2 . ASP A 1 97  ? -39.626 29.967 -18.358 1.00 27.56 ? 116  ASP A OD2 1 
ATOM   738  N N   . SER A 1 98  ? -36.819 26.750 -21.879 1.00 21.37 ? 117  SER A N   1 
ATOM   739  C CA  . SER A 1 98  ? -36.746 26.075 -23.177 1.00 24.05 ? 117  SER A CA  1 
ATOM   740  C C   . SER A 1 98  ? -35.302 25.883 -23.629 1.00 25.87 ? 117  SER A C   1 
ATOM   741  O O   . SER A 1 98  ? -34.396 26.510 -23.104 1.00 24.53 ? 117  SER A O   1 
ATOM   742  C CB  . SER A 1 98  ? -37.518 26.855 -24.235 1.00 23.81 ? 117  SER A CB  1 
ATOM   743  O OG  . SER A 1 98  ? -36.794 27.975 -24.705 1.00 24.41 ? 117  SER A OG  1 
ATOM   744  N N   . SER A 1 99  ? -35.095 25.014 -24.615 1.00 27.82 ? 118  SER A N   1 
ATOM   745  C CA  . SER A 1 99  ? -33.749 24.779 -25.165 1.00 28.07 ? 118  SER A CA  1 
ATOM   746  C C   . SER A 1 99  ? -33.181 26.020 -25.866 1.00 26.67 ? 118  SER A C   1 
ATOM   747  O O   . SER A 1 99  ? -31.970 26.196 -25.956 1.00 26.96 ? 118  SER A O   1 
ATOM   748  C CB  . SER A 1 99  ? -33.790 23.620 -26.158 1.00 30.01 ? 118  SER A CB  1 
ATOM   749  O OG  . SER A 1 99  ? -34.668 23.955 -27.215 1.00 31.85 ? 118  SER A OG  1 
ATOM   750  N N   . THR A 1 100 ? -34.064 26.862 -26.381 1.00 25.25 ? 119  THR A N   1 
ATOM   751  C CA  . THR A 1 100 ? -33.690 28.122 -27.002 1.00 24.89 ? 119  THR A CA  1 
ATOM   752  C C   . THR A 1 100 ? -33.059 29.104 -26.004 1.00 23.77 ? 119  THR A C   1 
ATOM   753  O O   . THR A 1 100 ? -31.995 29.687 -26.275 1.00 23.88 ? 119  THR A O   1 
ATOM   754  C CB  . THR A 1 100 ? -34.917 28.747 -27.686 1.00 26.62 ? 119  THR A CB  1 
ATOM   755  O OG1 . THR A 1 100 ? -35.416 27.830 -28.677 0.80 28.25 ? 119  THR A OG1 1 
ATOM   756  C CG2 . THR A 1 100 ? -34.584 30.090 -28.344 1.00 27.27 ? 119  THR A CG2 1 
ATOM   757  N N   . SER A 1 101 ? -33.740 29.302 -24.877 1.00 23.41 ? 120  SER A N   1 
ATOM   758  C CA  . SER A 1 101 ? -33.262 30.205 -23.827 1.00 20.24 ? 120  SER A CA  1 
ATOM   759  C C   . SER A 1 101 ? -32.029 29.623 -23.141 1.00 19.80 ? 120  SER A C   1 
ATOM   760  O O   . SER A 1 101 ? -31.121 30.373 -22.822 1.00 18.45 ? 120  SER A O   1 
ATOM   761  C CB  . SER A 1 101 ? -34.362 30.545 -22.807 1.00 20.09 ? 120  SER A CB  1 
ATOM   762  O OG  . SER A 1 101 ? -34.912 29.395 -22.216 1.00 20.56 ? 120  SER A OG  1 
ATOM   763  N N   . ARG A 1 102 ? -31.988 28.298 -22.960 1.00 19.12 ? 121  ARG A N   1 
ATOM   764  C CA  . ARG A 1 102 ? -30.786 27.618 -22.435 1.00 18.22 ? 121  ARG A CA  1 
ATOM   765  C C   . ARG A 1 102 ? -29.584 27.746 -23.382 1.00 18.27 ? 121  ARG A C   1 
ATOM   766  O O   . ARG A 1 102 ? -28.449 27.923 -22.934 1.00 17.22 ? 121  ARG A O   1 
ATOM   767  C CB  . ARG A 1 102 ? -31.056 26.127 -22.166 1.00 17.97 ? 121  ARG A CB  1 
ATOM   768  C CG  . ARG A 1 102 ? -31.940 25.884 -20.963 1.00 18.34 ? 121  ARG A CG  1 
ATOM   769  C CD  . ARG A 1 102 ? -31.864 24.437 -20.519 1.00 19.13 ? 121  ARG A CD  1 
ATOM   770  N NE  . ARG A 1 102 ? -32.224 23.528 -21.604 1.00 20.81 ? 121  ARG A NE  1 
ATOM   771  C CZ  . ARG A 1 102 ? -33.466 23.140 -21.924 1.00 22.26 ? 121  ARG A CZ  1 
ATOM   772  N NH1 . ARG A 1 102 ? -34.545 23.584 -21.266 1.00 22.42 ? 121  ARG A NH1 1 
ATOM   773  N NH2 . ARG A 1 102 ? -33.630 22.294 -22.940 1.00 23.25 ? 121  ARG A NH2 1 
ATOM   774  N N   . LEU A 1 103 ? -29.820 27.656 -24.688 1.00 19.06 ? 122  LEU A N   1 
ATOM   775  C CA  . LEU A 1 103 ? -28.744 27.844 -25.651 1.00 19.75 ? 122  LEU A CA  1 
ATOM   776  C C   . LEU A 1 103 ? -28.196 29.283 -25.613 1.00 19.30 ? 122  LEU A C   1 
ATOM   777  O O   . LEU A 1 103 ? -26.980 29.476 -25.690 1.00 16.76 ? 122  LEU A O   1 
ATOM   778  C CB  . LEU A 1 103 ? -29.206 27.471 -27.058 1.00 21.19 ? 122  LEU A CB  1 
ATOM   779  C CG  . LEU A 1 103 ? -28.209 27.719 -28.184 1.00 22.25 ? 122  LEU A CG  1 
ATOM   780  C CD1 . LEU A 1 103 ? -26.979 26.850 -28.011 1.00 22.27 ? 122  LEU A CD1 1 
ATOM   781  C CD2 . LEU A 1 103 ? -28.856 27.522 -29.557 1.00 23.85 ? 122  LEU A CD2 1 
ATOM   782  N N   . GLU A 1 104 ? -29.082 30.274 -25.490 1.00 18.15 ? 123  GLU A N   1 
ATOM   783  C CA  . GLU A 1 104 ? -28.648 31.677 -25.333 1.00 18.55 ? 123  GLU A CA  1 
ATOM   784  C C   . GLU A 1 104 ? -27.656 31.755 -24.169 1.00 16.83 ? 123  GLU A C   1 
ATOM   785  O O   . GLU A 1 104 ? -26.549 32.329 -24.282 1.00 15.93 ? 123  GLU A O   1 
ATOM   786  C CB  . GLU A 1 104 ? -29.840 32.582 -25.007 1.00 21.28 ? 123  GLU A CB  1 
ATOM   787  C CG  . GLU A 1 104 ? -30.195 33.613 -26.038 1.00 25.14 ? 123  GLU A CG  1 
ATOM   788  C CD  . GLU A 1 104 ? -31.059 34.691 -25.410 1.00 25.56 ? 123  GLU A CD  1 
ATOM   789  O OE1 . GLU A 1 104 ? -30.592 35.853 -25.283 0.80 27.96 ? 123  GLU A OE1 1 
ATOM   790  O OE2 . GLU A 1 104 ? -32.184 34.337 -24.974 1.00 26.67 ? 123  GLU A OE2 1 
ATOM   791  N N   . PHE A 1 105 ? -28.063 31.137 -23.069 1.00 15.29 ? 124  PHE A N   1 
ATOM   792  C CA  . PHE A 1 105 ? -27.268 31.128 -21.859 1.00 14.75 ? 124  PHE A CA  1 
ATOM   793  C C   . PHE A 1 105 ? -25.912 30.434 -22.026 1.00 13.39 ? 124  PHE A C   1 
ATOM   794  O O   . PHE A 1 105 ? -24.864 30.966 -21.645 1.00 13.01 ? 124  PHE A O   1 
ATOM   795  C CB  . PHE A 1 105 ? -28.031 30.442 -20.755 1.00 15.27 ? 124  PHE A CB  1 
ATOM   796  C CG  . PHE A 1 105 ? -27.298 30.427 -19.467 1.00 16.40 ? 124  PHE A CG  1 
ATOM   797  C CD1 . PHE A 1 105 ? -27.101 31.601 -18.765 1.00 16.91 ? 124  PHE A CD1 1 
ATOM   798  C CD2 . PHE A 1 105 ? -26.818 29.247 -18.956 1.00 17.43 ? 124  PHE A CD2 1 
ATOM   799  C CE1 . PHE A 1 105 ? -26.433 31.588 -17.560 1.00 17.07 ? 124  PHE A CE1 1 
ATOM   800  C CE2 . PHE A 1 105 ? -26.121 29.233 -17.753 1.00 17.92 ? 124  PHE A CE2 1 
ATOM   801  C CZ  . PHE A 1 105 ? -25.954 30.403 -17.058 1.00 17.00 ? 124  PHE A CZ  1 
ATOM   802  N N   . ILE A 1 106 ? -25.936 29.234 -22.584 1.00 13.45 ? 125  ILE A N   1 
ATOM   803  C CA  . ILE A 1 106 ? -24.713 28.443 -22.734 1.00 13.11 ? 125  ILE A CA  1 
ATOM   804  C C   . ILE A 1 106 ? -23.691 29.152 -23.619 1.00 12.93 ? 125  ILE A C   1 
ATOM   805  O O   . ILE A 1 106 ? -22.474 29.174 -23.345 1.00 12.69 ? 125  ILE A O   1 
ATOM   806  C CB  . ILE A 1 106 ? -25.059 27.034 -23.271 1.00 13.32 ? 125  ILE A CB  1 
ATOM   807  C CG1 . ILE A 1 106 ? -25.824 26.271 -22.192 1.00 13.79 ? 125  ILE A CG1 1 
ATOM   808  C CG2 . ILE A 1 106 ? -23.823 26.289 -23.675 1.00 13.62 ? 125  ILE A CG2 1 
ATOM   809  C CD1 . ILE A 1 106 ? -26.451 24.964 -22.629 1.00 14.28 ? 125  ILE A CD1 1 
ATOM   810  N N   . ASN A 1 107 ? -24.169 29.766 -24.702 1.00 13.00 ? 126  ASN A N   1 
ATOM   811  C CA  . ASN A 1 107 ? -23.279 30.514 -25.551 1.00 13.74 ? 126  ASN A CA  1 
ATOM   812  C C   . ASN A 1 107 ? -22.718 31.750 -24.849 1.00 12.86 ? 126  ASN A C   1 
ATOM   813  O O   . ASN A 1 107 ? -21.542 32.093 -25.013 1.00 13.42 ? 126  ASN A O   1 
ATOM   814  C CB  . ASN A 1 107 ? -23.967 30.875 -26.867 1.00 14.98 ? 126  ASN A CB  1 
ATOM   815  C CG  . ASN A 1 107 ? -24.139 29.673 -27.766 1.00 16.04 ? 126  ASN A CG  1 
ATOM   816  O OD1 . ASN A 1 107 ? -23.421 28.669 -27.640 1.00 17.78 ? 126  ASN A OD1 1 
ATOM   817  N ND2 . ASN A 1 107 ? -25.102 29.760 -28.669 1.00 17.57 ? 126  ASN A ND2 1 
ATOM   818  N N   . SER A 1 108 ? -23.529 32.356 -24.001 1.00 12.13 ? 127  SER A N   1 
ATOM   819  C CA  . SER A 1 108 ? -23.077 33.501 -23.207 1.00 12.73 ? 127  SER A CA  1 
ATOM   820  C C   . SER A 1 108 ? -21.992 33.116 -22.233 1.00 12.33 ? 127  SER A C   1 
ATOM   821  O O   . SER A 1 108 ? -21.071 33.893 -22.017 1.00 10.74 ? 127  SER A O   1 
ATOM   822  C CB  . SER A 1 108 ? -24.219 34.219 -22.490 1.00 13.32 ? 127  SER A CB  1 
ATOM   823  O OG  . SER A 1 108 ? -24.674 33.557 -21.315 1.00 13.95 ? 127  SER A OG  1 
ATOM   824  N N   . ILE A 1 109 ? -22.126 31.909 -21.658 1.00 12.07 ? 128  ILE A N   1 
ATOM   825  C CA  . ILE A 1 109 ? -21.175 31.369 -20.682 1.00 12.79 ? 128  ILE A CA  1 
ATOM   826  C C   . ILE A 1 109 ? -19.837 31.153 -21.338 1.00 12.22 ? 128  ILE A C   1 
ATOM   827  O O   . ILE A 1 109 ? -18.798 31.570 -20.811 1.00 11.65 ? 128  ILE A O   1 
ATOM   828  C CB  . ILE A 1 109 ? -21.715 30.038 -20.072 1.00 13.43 ? 128  ILE A CB  1 
ATOM   829  C CG1 . ILE A 1 109 ? -22.831 30.331 -19.084 1.00 14.00 ? 128  ILE A CG1 1 
ATOM   830  C CG2 . ILE A 1 109 ? -20.608 29.204 -19.433 1.00 13.55 ? 128  ILE A CG2 1 
ATOM   831  C CD1 . ILE A 1 109 ? -22.382 30.983 -17.786 1.00 14.32 ? 128  ILE A CD1 1 
ATOM   832  N N   . ILE A 1 110 ? -19.823 30.493 -22.494 1.00 12.59 ? 129  ILE A N   1 
ATOM   833  C CA  . ILE A 1 110 ? -18.539 30.246 -23.156 1.00 13.11 ? 129  ILE A CA  1 
ATOM   834  C C   . ILE A 1 110 ? -17.840 31.568 -23.469 1.00 12.36 ? 129  ILE A C   1 
ATOM   835  O O   . ILE A 1 110 ? -16.654 31.727 -23.213 1.00 12.29 ? 129  ILE A O   1 
ATOM   836  C CB  . ILE A 1 110 ? -18.741 29.360 -24.408 1.00 14.01 ? 129  ILE A CB  1 
ATOM   837  C CG1 . ILE A 1 110 ? -19.269 27.992 -23.947 1.00 14.34 ? 129  ILE A CG1 1 
ATOM   838  C CG2 . ILE A 1 110 ? -17.450 29.280 -25.211 1.00 14.30 ? 129  ILE A CG2 1 
ATOM   839  C CD1 . ILE A 1 110 ? -19.631 27.023 -25.054 1.00 14.58 ? 129  ILE A CD1 1 
ATOM   840  N N   . LEU A 1 111 ? -18.578 32.532 -24.011 1.00 11.38 ? 130  LEU A N   1 
ATOM   841  C CA  . LEU A 1 111 ? -17.958 33.816 -24.345 1.00 11.17 ? 130  LEU A CA  1 
ATOM   842  C C   . LEU A 1 111 ? -17.418 34.539 -23.109 1.00 10.42 ? 130  LEU A C   1 
ATOM   843  O O   . LEU A 1 111 ? -16.285 35.093 -23.107 1.00 10.13 ? 130  LEU A O   1 
ATOM   844  C CB  . LEU A 1 111 ? -18.957 34.677 -25.083 1.00 11.39 ? 130  LEU A CB  1 
ATOM   845  C CG  . LEU A 1 111 ? -18.493 36.077 -25.442 1.00 11.39 ? 130  LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 111 ? -17.274 36.073 -26.362 1.00 10.95 ? 130  LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 111 ? -19.676 36.804 -26.067 1.00 11.83 ? 130  LEU A CD2 1 
ATOM   848  N N   . PHE A 1 112 ? -18.231 34.559 -22.061 1.00 10.24 ? 131  PHE A N   1 
ATOM   849  C CA  . PHE A 1 112 ? -17.892 35.285 -20.842 1.00 10.85 ? 131  PHE A CA  1 
ATOM   850  C C   . PHE A 1 112 ? -16.658 34.676 -20.156 1.00 10.61 ? 131  PHE A C   1 
ATOM   851  O O   . PHE A 1 112 ? -15.758 35.392 -19.733 1.00 10.71 ? 131  PHE A O   1 
ATOM   852  C CB  . PHE A 1 112 ? -19.092 35.248 -19.903 1.00 11.11 ? 131  PHE A CB  1 
ATOM   853  C CG  . PHE A 1 112 ? -18.953 36.135 -18.715 1.00 11.75 ? 131  PHE A CG  1 
ATOM   854  C CD1 . PHE A 1 112 ? -19.344 37.465 -18.769 1.00 12.22 ? 131  PHE A CD1 1 
ATOM   855  C CD2 . PHE A 1 112 ? -18.424 35.644 -17.549 1.00 12.52 ? 131  PHE A CD2 1 
ATOM   856  C CE1 . PHE A 1 112 ? -19.222 38.270 -17.658 1.00 13.06 ? 131  PHE A CE1 1 
ATOM   857  C CE2 . PHE A 1 112 ? -18.297 36.454 -16.426 1.00 13.50 ? 131  PHE A CE2 1 
ATOM   858  C CZ  . PHE A 1 112 ? -18.689 37.752 -16.486 1.00 12.83 ? 131  PHE A CZ  1 
ATOM   859  N N   . LEU A 1 113 ? -16.623 33.347 -20.055 1.00 10.98 ? 132  LEU A N   1 
ATOM   860  C CA  . LEU A 1 113 ? -15.518 32.678 -19.380 1.00 11.16 ? 132  LEU A CA  1 
ATOM   861  C C   . LEU A 1 113 ? -14.229 32.883 -20.138 1.00 11.12 ? 132  LEU A C   1 
ATOM   862  O O   . LEU A 1 113 ? -13.227 33.211 -19.550 1.00 11.11 ? 132  LEU A O   1 
ATOM   863  C CB  . LEU A 1 113 ? -15.786 31.181 -19.178 1.00 11.35 ? 132  LEU A CB  1 
ATOM   864  C CG  . LEU A 1 113 ? -17.029 30.829 -18.339 1.00 11.85 ? 132  LEU A CG  1 
ATOM   865  C CD1 . LEU A 1 113 ? -17.118 29.311 -18.236 1.00 12.39 ? 132  LEU A CD1 1 
ATOM   866  C CD2 . LEU A 1 113 ? -17.030 31.465 -16.942 1.00 12.10 ? 132  LEU A CD2 1 
ATOM   867  N N   . ARG A 1 114 ? -14.272 32.778 -21.467 1.00 12.40 ? 133  ARG A N   1 
ATOM   868  C CA  . ARG A 1 114 ? -13.072 33.005 -22.270 1.00 12.43 ? 133  ARG A CA  1 
ATOM   869  C C   . ARG A 1 114 ? -12.612 34.464 -22.243 1.00 11.97 ? 133  ARG A C   1 
ATOM   870  O O   . ARG A 1 114 ? -11.429 34.733 -22.107 1.00 13.40 ? 133  ARG A O   1 
ATOM   871  C CB  . ARG A 1 114 ? -13.296 32.567 -23.699 1.00 13.14 ? 133  ARG A CB  1 
ATOM   872  C CG  . ARG A 1 114 ? -13.618 31.098 -23.842 1.00 14.78 ? 133  ARG A CG  1 
ATOM   873  C CD  . ARG A 1 114 ? -12.453 30.237 -23.408 1.00 16.27 ? 133  ARG A CD  1 
ATOM   874  N NE  . ARG A 1 114 ? -12.609 28.863 -23.911 1.00 17.78 ? 133  ARG A NE  1 
ATOM   875  C CZ  . ARG A 1 114 ? -11.894 27.825 -23.496 1.00 18.88 ? 133  ARG A CZ  1 
ATOM   876  N NH1 . ARG A 1 114 ? -10.997 27.963 -22.519 1.00 18.87 ? 133  ARG A NH1 1 
ATOM   877  N NH2 . ARG A 1 114 ? -12.129 26.628 -24.026 1.00 19.30 ? 133  ARG A NH2 1 
ATOM   878  N N   . ASN A 1 115 ? -13.553 35.404 -22.372 1.00 11.48 ? 134  ASN A N   1 
ATOM   879  C CA  . ASN A 1 115 ? -13.223 36.801 -22.348 1.00 11.38 ? 134  ASN A CA  1 
ATOM   880  C C   . ASN A 1 115 ? -12.568 37.168 -21.027 1.00 11.22 ? 134  ASN A C   1 
ATOM   881  O O   . ASN A 1 115 ? -11.684 37.988 -21.006 1.00 11.97 ? 134  ASN A O   1 
ATOM   882  C CB  . ASN A 1 115 ? -14.466 37.698 -22.558 1.00 11.12 ? 134  ASN A CB  1 
ATOM   883  C CG  . ASN A 1 115 ? -14.852 37.876 -24.031 1.00 11.71 ? 134  ASN A CG  1 
ATOM   884  O OD1 . ASN A 1 115 ? -14.120 37.482 -24.932 1.00 12.52 ? 134  ASN A OD1 1 
ATOM   885  N ND2 . ASN A 1 115 ? -16.013 38.472 -24.269 1.00 11.72 ? 134  ASN A ND2 1 
ATOM   886  N N   . HIS A 1 116 ? -13.002 36.561 -19.938 1.00 11.78 ? 135  HIS A N   1 
ATOM   887  C CA  . HIS A 1 116 ? -12.538 36.992 -18.611 1.00 11.81 ? 135  HIS A CA  1 
ATOM   888  C C   . HIS A 1 116 ? -11.586 36.033 -17.917 1.00 13.48 ? 135  HIS A C   1 
ATOM   889  O O   . HIS A 1 116 ? -11.369 36.135 -16.709 1.00 13.50 ? 135  HIS A O   1 
ATOM   890  C CB  . HIS A 1 116 ? -13.727 37.325 -17.733 1.00 11.10 ? 135  HIS A CB  1 
ATOM   891  C CG  . HIS A 1 116 ? -14.499 38.497 -18.237 1.00 10.79 ? 135  HIS A CG  1 
ATOM   892  N ND1 . HIS A 1 116 ? -13.925 39.738 -18.391 1.00 10.53 ? 135  HIS A ND1 1 
ATOM   893  C CD2 . HIS A 1 116 ? -15.776 38.615 -18.655 1.00 10.15 ? 135  HIS A CD2 1 
ATOM   894  C CE1 . HIS A 1 116 ? -14.822 40.578 -18.871 1.00 10.62 ? 135  HIS A CE1 1 
ATOM   895  N NE2 . HIS A 1 116 ? -15.953 39.920 -19.040 1.00 11.01 ? 135  HIS A NE2 1 
ATOM   896  N N   . ASN A 1 117 ? -11.002 35.128 -18.684 1.00 13.80 ? 136  ASN A N   1 
ATOM   897  C CA  . ASN A 1 117 ? -9.914  34.275 -18.185 1.00 15.15 ? 136  ASN A CA  1 
ATOM   898  C C   . ASN A 1 117 ? -10.381 33.309 -17.073 1.00 14.73 ? 136  ASN A C   1 
ATOM   899  O O   . ASN A 1 117 ? -9.614  32.985 -16.167 1.00 15.49 ? 136  ASN A O   1 
ATOM   900  C CB  . ASN A 1 117 ? -8.763  35.194 -17.736 1.00 15.77 ? 136  ASN A CB  1 
ATOM   901  C CG  . ASN A 1 117 ? -7.402  34.512 -17.713 1.00 18.26 ? 136  ASN A CG  1 
ATOM   902  O OD1 . ASN A 1 117 ? -7.225  33.427 -18.264 1.00 19.35 ? 136  ASN A OD1 1 
ATOM   903  N ND2 . ASN A 1 117 ? -6.426  35.160 -17.057 1.00 20.45 ? 136  ASN A ND2 1 
ATOM   904  N N   . PHE A 1 118 ? -11.628 32.855 -17.129 1.00 13.47 ? 137  PHE A N   1 
ATOM   905  C CA  . PHE A 1 118 ? -12.104 31.829 -16.222 1.00 13.20 ? 137  PHE A CA  1 
ATOM   906  C C   . PHE A 1 118 ? -11.796 30.470 -16.823 1.00 13.41 ? 137  PHE A C   1 
ATOM   907  O O   . PHE A 1 118 ? -11.777 30.306 -18.056 1.00 14.33 ? 137  PHE A O   1 
ATOM   908  C CB  . PHE A 1 118 ? -13.602 31.929 -15.991 1.00 12.67 ? 137  PHE A CB  1 
ATOM   909  C CG  . PHE A 1 118 ? -14.006 33.044 -15.071 1.00 12.66 ? 137  PHE A CG  1 
ATOM   910  C CD1 . PHE A 1 118 ? -14.005 32.859 -13.702 1.00 12.52 ? 137  PHE A CD1 1 
ATOM   911  C CD2 . PHE A 1 118 ? -14.462 34.262 -15.591 1.00 12.33 ? 137  PHE A CD2 1 
ATOM   912  C CE1 . PHE A 1 118 ? -14.413 33.892 -12.866 1.00 12.03 ? 137  PHE A CE1 1 
ATOM   913  C CE2 . PHE A 1 118 ? -14.873 35.284 -14.763 1.00 12.57 ? 137  PHE A CE2 1 
ATOM   914  C CZ  . PHE A 1 118 ? -14.852 35.093 -13.398 1.00 12.61 ? 137  PHE A CZ  1 
ATOM   915  N N   . ASP A 1 119 ? -11.588 29.486 -15.964 1.00 12.92 ? 138  ASP A N   1 
ATOM   916  C CA  . ASP A 1 119 ? -11.294 28.137 -16.420 1.00 13.23 ? 138  ASP A CA  1 
ATOM   917  C C   . ASP A 1 119 ? -12.492 27.242 -16.481 1.00 12.81 ? 138  ASP A C   1 
ATOM   918  O O   . ASP A 1 119 ? -12.394 26.101 -16.976 1.00 14.21 ? 138  ASP A O   1 
ATOM   919  C CB  . ASP A 1 119 ? -10.227 27.536 -15.529 1.00 13.97 ? 138  ASP A CB  1 
ATOM   920  C CG  . ASP A 1 119 ? -8.978  28.312 -15.559 1.00 15.27 ? 138  ASP A CG  1 
ATOM   921  O OD1 . ASP A 1 119 ? -8.763  29.104 -14.631 1.00 14.52 ? 138  ASP A OD1 1 
ATOM   922  O OD2 . ASP A 1 119 ? -8.193  28.207 -16.554 1.00 17.55 ? 138  ASP A OD2 1 
ATOM   923  N N   . GLY A 1 120 ? -13.642 27.711 -15.988 1.00 12.14 ? 139  GLY A N   1 
ATOM   924  C CA  . GLY A 1 120 ? -14.836 26.895 -16.005 1.00 11.13 ? 139  GLY A CA  1 
ATOM   925  C C   . GLY A 1 120 ? -16.011 27.462 -15.237 1.00 11.39 ? 139  GLY A C   1 
ATOM   926  O O   . GLY A 1 120 ? -15.939 28.592 -14.742 1.00 11.77 ? 139  GLY A O   1 
ATOM   927  N N   . LEU A 1 121 ? -17.085 26.679 -15.172 1.00 11.07 ? 140  LEU A N   1 
ATOM   928  C CA  . LEU A 1 121 ? -18.348 27.046 -14.550 1.00 11.26 ? 140  LEU A CA  1 
ATOM   929  C C   . LEU A 1 121 ? -18.744 26.050 -13.465 1.00 11.55 ? 140  LEU A C   1 
ATOM   930  O O   . LEU A 1 121 ? -18.676 24.841 -13.677 1.00 11.43 ? 140  LEU A O   1 
ATOM   931  C CB  . LEU A 1 121 ? -19.457 27.052 -15.598 1.00 10.99 ? 140  LEU A CB  1 
ATOM   932  C CG  . LEU A 1 121 ? -20.815 27.477 -15.107 1.00 12.10 ? 140  LEU A CG  1 
ATOM   933  C CD1 . LEU A 1 121 ? -20.799 28.967 -14.845 1.00 12.69 ? 140  LEU A CD1 1 
ATOM   934  C CD2 . LEU A 1 121 ? -21.897 27.103 -16.124 1.00 12.33 ? 140  LEU A CD2 1 
ATOM   935  N N   . ASP A 1 122 ? -19.176 26.571 -12.311 1.00 11.82 ? 141  ASP A N   1 
ATOM   936  C CA  . ASP A 1 122 ? -19.799 25.781 -11.270 1.00 11.62 ? 141  ASP A CA  1 
ATOM   937  C C   . ASP A 1 122 ? -21.281 26.108 -11.221 1.00 11.83 ? 141  ASP A C   1 
ATOM   938  O O   . ASP A 1 122 ? -21.660 27.283 -11.137 1.00 11.71 ? 141  ASP A O   1 
ATOM   939  C CB  . ASP A 1 122 ? -19.133 26.118 -9.918  1.00 12.16 ? 141  ASP A CB  1 
ATOM   940  C CG  . ASP A 1 122 ? -19.741 25.396 -8.768  1.00 12.39 ? 141  ASP A CG  1 
ATOM   941  O OD1 . ASP A 1 122 ? -19.604 24.140 -8.694  1.00 12.95 ? 141  ASP A OD1 1 
ATOM   942  O OD2 . ASP A 1 122 ? -20.380 26.078 -7.944  1.00 12.91 ? 141  ASP A OD2 1 
ATOM   943  N N   . VAL A 1 123 ? -22.133 25.079 -11.302 1.00 11.88 ? 142  VAL A N   1 
ATOM   944  C CA  . VAL A 1 123 ? -23.578 25.287 -11.214 1.00 12.02 ? 142  VAL A CA  1 
ATOM   945  C C   . VAL A 1 123 ? -24.019 24.813 -9.848  1.00 12.67 ? 142  VAL A C   1 
ATOM   946  O O   . VAL A 1 123 ? -24.101 23.633 -9.620  1.00 12.96 ? 142  VAL A O   1 
ATOM   947  C CB  . VAL A 1 123 ? -24.371 24.549 -12.337 1.00 12.40 ? 142  VAL A CB  1 
ATOM   948  C CG1 . VAL A 1 123 ? -25.853 24.840 -12.190 1.00 12.75 ? 142  VAL A CG1 1 
ATOM   949  C CG2 . VAL A 1 123 ? -23.842 24.991 -13.712 1.00 13.12 ? 142  VAL A CG2 1 
ATOM   950  N N   . SER A 1 124 ? -24.278 25.725 -8.923  1.00 12.58 ? 143  SER A N   1 
ATOM   951  C CA  . SER A 1 124 ? -24.693 25.332 -7.583  1.00 12.87 ? 143  SER A CA  1 
ATOM   952  C C   . SER A 1 124 ? -26.165 25.650 -7.348  1.00 12.74 ? 143  SER A C   1 
ATOM   953  O O   . SER A 1 124 ? -26.532 26.605 -6.688  1.00 13.65 ? 143  SER A O   1 
ATOM   954  C CB  . SER A 1 124 ? -23.812 25.971 -6.508  1.00 14.23 ? 143  SER A CB  1 
ATOM   955  O OG  . SER A 1 124 ? -22.519 25.391 -6.475  1.00 15.14 ? 143  SER A OG  1 
ATOM   956  N N   . TRP A 1 125 ? -27.014 24.785 -7.877  1.00 12.80 ? 144  TRP A N   1 
ATOM   957  C CA  . TRP A 1 125 ? -28.455 24.970 -7.810  1.00 13.10 ? 144  TRP A CA  1 
ATOM   958  C C   . TRP A 1 125 ? -28.962 24.442 -6.482  1.00 13.55 ? 144  TRP A C   1 
ATOM   959  O O   . TRP A 1 125 ? -28.902 23.229 -6.204  1.00 14.79 ? 144  TRP A O   1 
ATOM   960  C CB  . TRP A 1 125 ? -29.072 24.224 -8.981  1.00 13.60 ? 144  TRP A CB  1 
ATOM   961  C CG  . TRP A 1 125 ? -30.540 24.444 -9.205  1.00 13.18 ? 144  TRP A CG  1 
ATOM   962  C CD1 . TRP A 1 125 ? -31.511 24.535 -8.269  1.00 14.10 ? 144  TRP A CD1 1 
ATOM   963  C CD2 . TRP A 1 125 ? -31.193 24.534 -10.480 1.00 13.48 ? 144  TRP A CD2 1 
ATOM   964  N NE1 . TRP A 1 125 ? -32.745 24.735 -8.876  1.00 14.63 ? 144  TRP A NE1 1 
ATOM   965  C CE2 . TRP A 1 125 ? -32.569 24.721 -10.233 1.00 13.79 ? 144  TRP A CE2 1 
ATOM   966  C CE3 . TRP A 1 125 ? -30.744 24.507 -11.797 1.00 13.69 ? 144  TRP A CE3 1 
ATOM   967  C CZ2 . TRP A 1 125 ? -33.498 24.866 -11.273 1.00 14.14 ? 144  TRP A CZ2 1 
ATOM   968  C CZ3 . TRP A 1 125 ? -31.666 24.643 -12.824 1.00 14.56 ? 144  TRP A CZ3 1 
ATOM   969  C CH2 . TRP A 1 125 ? -33.027 24.818 -12.552 1.00 13.55 ? 144  TRP A CH2 1 
ATOM   970  N N   . ILE A 1 126 ? -29.472 25.356 -5.665  1.00 13.48 ? 145  ILE A N   1 
ATOM   971  C CA  . ILE A 1 126 ? -29.869 25.074 -4.305  1.00 13.94 ? 145  ILE A CA  1 
ATOM   972  C C   . ILE A 1 126 ? -31.379 25.137 -4.115  1.00 14.16 ? 145  ILE A C   1 
ATOM   973  O O   . ILE A 1 126 ? -31.947 26.228 -3.955  1.00 13.76 ? 145  ILE A O   1 
ATOM   974  C CB  . ILE A 1 126 ? -29.215 26.064 -3.319  1.00 14.27 ? 145  ILE A CB  1 
ATOM   975  C CG1 . ILE A 1 126 ? -27.700 26.209 -3.587  1.00 13.88 ? 145  ILE A CG1 1 
ATOM   976  C CG2 . ILE A 1 126 ? -29.497 25.641 -1.882  1.00 14.66 ? 145  ILE A CG2 1 
ATOM   977  C CD1 . ILE A 1 126 ? -26.863 24.923 -3.497  1.00 14.13 ? 145  ILE A CD1 1 
ATOM   978  N N   . TYR A 1 127 ? -32.085 24.015 -4.134  1.00 14.34 ? 146  TYR A N   1 
ATOM   979  C CA  . TYR A 1 127 ? -31.678 22.705 -4.659  1.00 15.33 ? 146  TYR A CA  1 
ATOM   980  C C   . TYR A 1 127 ? -32.772 22.350 -5.665  1.00 15.92 ? 146  TYR A C   1 
ATOM   981  O O   . TYR A 1 127 ? -33.885 22.869 -5.543  1.00 15.74 ? 146  TYR A O   1 
ATOM   982  C CB  . TYR A 1 127 ? -31.660 21.673 -3.542  1.00 15.84 ? 146  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 127 ? -30.521 21.833 -2.555  1.00 16.07 ? 146  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 127 ? -30.750 22.285 -1.257  1.00 16.92 ? 146  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 127 ? -29.218 21.564 -2.935  1.00 16.17 ? 146  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 127 ? -29.703 22.432 -0.350  1.00 16.56 ? 146  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 127 ? -28.169 21.720 -2.042  1.00 16.62 ? 146  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 127 ? -28.419 22.130 -0.750  1.00 16.87 ? 146  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 127 ? -27.359 22.307 0.137   1.00 17.99 ? 146  TYR A OH  1 
ATOM   990  N N   . PRO A 1 128 ? -32.481 21.460 -6.634  1.00 16.03 ? 147  PRO A N   1 
ATOM   991  C CA  . PRO A 1 128 ? -33.489 21.187 -7.663  1.00 16.61 ? 147  PRO A CA  1 
ATOM   992  C C   . PRO A 1 128 ? -34.764 20.534 -7.120  1.00 18.15 ? 147  PRO A C   1 
ATOM   993  O O   . PRO A 1 128 ? -35.890 20.946 -7.482  1.00 18.04 ? 147  PRO A O   1 
ATOM   994  C CB  . PRO A 1 128 ? -32.738 20.278 -8.638  1.00 16.03 ? 147  PRO A CB  1 
ATOM   995  C CG  . PRO A 1 128 ? -31.301 20.685 -8.463  1.00 16.07 ? 147  PRO A CG  1 
ATOM   996  C CD  . PRO A 1 128 ? -31.175 20.891 -6.995  1.00 16.19 ? 147  PRO A CD  1 
ATOM   997  N N   . ASP A 1 129 ? -34.598 19.527 -6.262  1.00 18.51 ? 148  ASP A N   1 
ATOM   998  C CA  . ASP A 1 129 ? -35.715 18.734 -5.770  1.00 18.94 ? 148  ASP A CA  1 
ATOM   999  C C   . ASP A 1 129 ? -36.462 18.058 -6.952  1.00 18.71 ? 148  ASP A C   1 
ATOM   1000 O O   . ASP A 1 129 ? -35.993 18.061 -8.095  1.00 17.29 ? 148  ASP A O   1 
ATOM   1001 C CB  . ASP A 1 129 ? -36.666 19.613 -4.959  1.00 20.09 ? 148  ASP A CB  1 
ATOM   1002 C CG  . ASP A 1 129 ? -37.314 18.881 -3.805  1.00 20.81 ? 148  ASP A CG  1 
ATOM   1003 O OD1 . ASP A 1 129 ? -37.483 17.638 -3.864  1.00 21.13 ? 148  ASP A OD1 1 
ATOM   1004 O OD2 . ASP A 1 129 ? -37.665 19.558 -2.823  1.00 22.69 ? 148  ASP A OD2 1 
ATOM   1005 N N   . GLN A 1 130 ? -37.616 17.472 -6.649  1.00 19.21 ? 149  GLN A N   1 
ATOM   1006 C CA  . GLN A 1 130 ? -38.450 16.822 -7.664  1.00 20.40 ? 149  GLN A CA  1 
ATOM   1007 C C   . GLN A 1 130 ? -38.769 17.779 -8.818  1.00 18.54 ? 149  GLN A C   1 
ATOM   1008 O O   . GLN A 1 130 ? -38.600 17.427 -9.979  1.00 18.73 ? 149  GLN A O   1 
ATOM   1009 C CB  . GLN A 1 130 ? -39.749 16.303 -7.009  0.50 19.76 ? 149  GLN A CB  1 
ATOM   1010 C CG  . GLN A 1 130 ? -40.708 15.547 -7.923  0.50 21.42 ? 149  GLN A CG  1 
ATOM   1011 C CD  . GLN A 1 130 ? -42.050 15.226 -7.252  1.00 22.66 ? 149  GLN A CD  1 
ATOM   1012 O OE1 . GLN A 1 130 ? -42.566 16.000 -6.457  0.50 22.33 ? 149  GLN A OE1 1 
ATOM   1013 N NE2 . GLN A 1 130 ? -42.632 14.083 -7.613  0.50 23.78 ? 149  GLN A NE2 1 
ATOM   1014 N N   . LYS A 1 131 ? -39.170 18.999 -8.486  1.00 19.38 ? 150  LYS A N   1 
ATOM   1015 C CA  . LYS A 1 131 ? -39.676 19.935 -9.479  0.50 17.81 ? 150  LYS A CA  1 
ATOM   1016 C C   . LYS A 1 131 ? -38.653 20.348 -10.539 1.00 18.76 ? 150  LYS A C   1 
ATOM   1017 O O   . LYS A 1 131 ? -39.017 20.541 -11.719 1.00 18.96 ? 150  LYS A O   1 
ATOM   1018 C CB  . LYS A 1 131 ? -40.240 21.175 -8.805  0.50 18.01 ? 150  LYS A CB  1 
ATOM   1019 C CG  . LYS A 1 131 ? -40.871 22.144 -9.793  0.50 18.67 ? 150  LYS A CG  1 
ATOM   1020 C CD  . LYS A 1 131 ? -41.452 23.356 -9.097  0.50 19.61 ? 150  LYS A CD  1 
ATOM   1021 C CE  . LYS A 1 131 ? -42.067 24.314 -10.102 0.50 20.35 ? 150  LYS A CE  1 
ATOM   1022 N NZ  . LYS A 1 131 ? -42.790 23.577 -11.174 0.50 20.66 ? 150  LYS A NZ  1 
ATOM   1023 N N   . GLU A 1 132 ? -37.385 20.500 -10.156 1.00 17.83 ? 151  GLU A N   1 
ATOM   1024 C CA  . GLU A 1 132 ? -36.379 21.010 -11.107 1.00 18.18 ? 151  GLU A CA  1 
ATOM   1025 C C   . GLU A 1 132 ? -35.338 19.980 -11.505 1.00 17.42 ? 151  GLU A C   1 
ATOM   1026 O O   . GLU A 1 132 ? -34.399 20.281 -12.209 1.00 17.29 ? 151  GLU A O   1 
ATOM   1027 C CB  . GLU A 1 132 ? -35.700 22.273 -10.559 1.00 19.35 ? 151  GLU A CB  1 
ATOM   1028 C CG  . GLU A 1 132 ? -36.671 23.379 -10.221 1.00 20.64 ? 151  GLU A CG  1 
ATOM   1029 C CD  . GLU A 1 132 ? -37.266 24.027 -11.466 1.00 20.63 ? 151  GLU A CD  1 
ATOM   1030 O OE1 . GLU A 1 132 ? -36.846 23.702 -12.603 1.00 21.13 ? 151  GLU A OE1 1 
ATOM   1031 O OE2 . GLU A 1 132 ? -38.138 24.889 -11.287 1.00 23.70 ? 151  GLU A OE2 1 
ATOM   1032 N N   . ASN A 1 133 ? -35.538 18.742 -11.087 1.00 16.80 ? 152  ASN A N   1 
ATOM   1033 C CA  . ASN A 1 133 ? -34.650 17.646 -11.452 1.00 17.32 ? 152  ASN A CA  1 
ATOM   1034 C C   . ASN A 1 133 ? -34.379 17.583 -12.974 1.00 16.94 ? 152  ASN A C   1 
ATOM   1035 O O   . ASN A 1 133 ? -33.237 17.542 -13.432 1.00 16.73 ? 152  ASN A O   1 
ATOM   1036 C CB  . ASN A 1 133 ? -35.299 16.361 -10.910 1.00 16.83 ? 152  ASN A CB  1 
ATOM   1037 C CG  . ASN A 1 133 ? -34.557 15.094 -11.295 1.00 16.51 ? 152  ASN A CG  1 
ATOM   1038 O OD1 . ASN A 1 133 ? -34.063 14.961 -12.415 1.00 18.13 ? 152  ASN A OD1 1 
ATOM   1039 N ND2 . ASN A 1 133 ? -34.499 14.139 -10.364 1.00 17.10 ? 152  ASN A ND2 1 
ATOM   1040 N N   . THR A 1 134 ? -35.434 17.622 -13.779 1.00 18.08 ? 153  THR A N   1 
ATOM   1041 C CA  . THR A 1 134 ? -35.241 17.565 -15.222 1.00 19.12 ? 153  THR A CA  1 
ATOM   1042 C C   . THR A 1 134 ? -34.501 18.789 -15.760 1.00 18.00 ? 153  THR A C   1 
ATOM   1043 O O   . THR A 1 134 ? -33.582 18.643 -16.555 1.00 18.10 ? 153  THR A O   1 
ATOM   1044 C CB  . THR A 1 134 ? -36.586 17.365 -15.935 1.00 20.63 ? 153  THR A CB  1 
ATOM   1045 O OG1 . THR A 1 134 ? -37.098 16.093 -15.529 1.00 23.77 ? 153  THR A OG1 1 
ATOM   1046 C CG2 . THR A 1 134 ? -36.418 17.356 -17.445 1.00 21.22 ? 153  THR A CG2 1 
ATOM   1047 N N   . HIS A 1 135 ? -34.853 19.972 -15.266 1.00 17.56 ? 154  HIS A N   1 
ATOM   1048 C CA  . HIS A 1 135 ? -34.224 21.202 -15.747 1.00 18.06 ? 154  HIS A CA  1 
ATOM   1049 C C   . HIS A 1 135 ? -32.725 21.220 -15.411 1.00 16.43 ? 154  HIS A C   1 
ATOM   1050 O O   . HIS A 1 135 ? -31.902 21.561 -16.257 1.00 17.14 ? 154  HIS A O   1 
ATOM   1051 C CB  . HIS A 1 135 ? -34.920 22.457 -15.204 1.00 18.21 ? 154  HIS A CB  1 
ATOM   1052 C CG  . HIS A 1 135 ? -36.187 22.815 -15.920 1.00 19.64 ? 154  HIS A CG  1 
ATOM   1053 N ND1 . HIS A 1 135 ? -37.247 23.428 -15.292 1.00 20.15 ? 154  HIS A ND1 1 
ATOM   1054 C CD2 . HIS A 1 135 ? -36.566 22.634 -17.208 1.00 21.06 ? 154  HIS A CD2 1 
ATOM   1055 C CE1 . HIS A 1 135 ? -38.229 23.608 -16.162 1.00 20.50 ? 154  HIS A CE1 1 
ATOM   1056 N NE2 . HIS A 1 135 ? -37.838 23.145 -17.335 1.00 21.67 ? 154  HIS A NE2 1 
ATOM   1057 N N   . PHE A 1 136 ? -32.394 20.866 -14.167 1.00 16.28 ? 155  PHE A N   1 
ATOM   1058 C CA  . PHE A 1 136 ? -31.023 20.793 -13.730 1.00 15.89 ? 155  PHE A CA  1 
ATOM   1059 C C   . PHE A 1 136 ? -30.271 19.797 -14.574 1.00 15.76 ? 155  PHE A C   1 
ATOM   1060 O O   . PHE A 1 136 ? -29.212 20.096 -15.102 1.00 15.04 ? 155  PHE A O   1 
ATOM   1061 C CB  . PHE A 1 136 ? -30.942 20.389 -12.255 1.00 15.86 ? 155  PHE A CB  1 
ATOM   1062 C CG  . PHE A 1 136 ? -29.543 20.188 -11.766 1.00 15.55 ? 155  PHE A CG  1 
ATOM   1063 C CD1 . PHE A 1 136 ? -28.753 21.267 -11.458 1.00 15.71 ? 155  PHE A CD1 1 
ATOM   1064 C CD2 . PHE A 1 136 ? -29.030 18.912 -11.604 1.00 15.70 ? 155  PHE A CD2 1 
ATOM   1065 C CE1 . PHE A 1 136 ? -27.445 21.100 -11.047 1.00 15.54 ? 155  PHE A CE1 1 
ATOM   1066 C CE2 . PHE A 1 136 ? -27.740 18.725 -11.155 1.00 15.87 ? 155  PHE A CE2 1 
ATOM   1067 C CZ  . PHE A 1 136 ? -26.953 19.818 -10.862 1.00 16.00 ? 155  PHE A CZ  1 
ATOM   1068 N N   . THR A 1 137 ? -30.848 18.607 -14.727 1.00 16.01 ? 156  THR A N   1 
ATOM   1069 C CA  . THR A 1 137 ? -30.193 17.553 -15.493 1.00 16.80 ? 156  THR A CA  1 
ATOM   1070 C C   . THR A 1 137 ? -29.895 17.938 -16.955 1.00 16.49 ? 156  THR A C   1 
ATOM   1071 O O   . THR A 1 137 ? -28.782 17.731 -17.448 1.00 16.36 ? 156  THR A O   1 
ATOM   1072 C CB  . THR A 1 137 ? -31.017 16.253 -15.436 1.00 17.87 ? 156  THR A CB  1 
ATOM   1073 O OG1 . THR A 1 137 ? -31.239 15.863 -14.067 1.00 18.77 ? 156  THR A OG1 1 
ATOM   1074 C CG2 . THR A 1 137 ? -30.323 15.142 -16.183 1.00 18.92 ? 156  THR A CG2 1 
ATOM   1075 N N   . VAL A 1 138 ? -30.883 18.542 -17.622 1.00 17.06 ? 157  VAL A N   1 
ATOM   1076 C CA  . VAL A 1 138 ? -30.734 18.975 -19.015 1.00 17.97 ? 157  VAL A CA  1 
ATOM   1077 C C   . VAL A 1 138 ? -29.734 20.132 -19.136 1.00 16.66 ? 157  VAL A C   1 
ATOM   1078 O O   . VAL A 1 138 ? -28.915 20.165 -20.057 1.00 16.56 ? 157  VAL A O   1 
ATOM   1079 C CB  . VAL A 1 138 ? -32.096 19.401 -19.627 1.00 19.64 ? 157  VAL A CB  1 
ATOM   1080 C CG1 . VAL A 1 138 ? -31.923 19.899 -21.048 0.50 19.44 ? 157  VAL A CG1 1 
ATOM   1081 C CG2 . VAL A 1 138 ? -33.096 18.258 -19.594 1.00 21.76 ? 157  VAL A CG2 1 
ATOM   1082 N N   . LEU A 1 139 ? -29.805 21.069 -18.199 1.00 15.96 ? 158  LEU A N   1 
ATOM   1083 C CA  . LEU A 1 139 ? -28.890 22.193 -18.213 1.00 15.72 ? 158  LEU A CA  1 
ATOM   1084 C C   . LEU A 1 139 ? -27.456 21.693 -18.106 1.00 14.43 ? 158  LEU A C   1 
ATOM   1085 O O   . LEU A 1 139 ? -26.588 22.145 -18.844 1.00 13.54 ? 158  LEU A O   1 
ATOM   1086 C CB  . LEU A 1 139 ? -29.195 23.179 -17.081 1.00 15.88 ? 158  LEU A CB  1 
ATOM   1087 C CG  . LEU A 1 139 ? -28.265 24.381 -16.941 1.00 15.77 ? 158  LEU A CG  1 
ATOM   1088 C CD1 . LEU A 1 139 ? -28.332 25.243 -18.193 1.00 15.54 ? 158  LEU A CD1 1 
ATOM   1089 C CD2 . LEU A 1 139 ? -28.627 25.165 -15.701 1.00 15.90 ? 158  LEU A CD2 1 
ATOM   1090 N N   . ILE A 1 140 ? -27.196 20.781 -17.158 1.00 14.48 ? 159  ILE A N   1 
ATOM   1091 C CA  . ILE A 1 140 ? -25.864 20.229 -17.001 1.00 15.44 ? 159  ILE A CA  1 
ATOM   1092 C C   . ILE A 1 140 ? -25.413 19.473 -18.255 1.00 14.86 ? 159  ILE A C   1 
ATOM   1093 O O   . ILE A 1 140 ? -24.296 19.654 -18.745 1.00 14.43 ? 159  ILE A O   1 
ATOM   1094 C CB  . ILE A 1 140 ? -25.758 19.326 -15.740 1.00 15.10 ? 159  ILE A CB  1 
ATOM   1095 C CG1 . ILE A 1 140 ? -25.940 20.142 -14.462 1.00 16.23 ? 159  ILE A CG1 1 
ATOM   1096 C CG2 . ILE A 1 140 ? -24.440 18.582 -15.737 1.00 14.96 ? 159  ILE A CG2 1 
ATOM   1097 C CD1 . ILE A 1 140 ? -24.939 21.265 -14.251 1.00 15.89 ? 159  ILE A CD1 1 
ATOM   1098 N N   . HIS A 1 141 ? -26.315 18.651 -18.792 1.00 16.01 ? 160  HIS A N   1 
ATOM   1099 C CA  . HIS A 1 141 ? -25.992 17.904 -19.980 1.00 17.37 ? 160  HIS A CA  1 
ATOM   1100 C C   . HIS A 1 141 ? -25.659 18.799 -21.169 1.00 17.09 ? 160  HIS A C   1 
ATOM   1101 O O   . HIS A 1 141 ? -24.659 18.581 -21.862 1.00 17.04 ? 160  HIS A O   1 
ATOM   1102 C CB  . HIS A 1 141 ? -27.097 16.923 -20.335 1.00 19.69 ? 160  HIS A CB  1 
ATOM   1103 C CG  . HIS A 1 141 ? -26.683 15.973 -21.407 1.00 22.79 ? 160  HIS A CG  1 
ATOM   1104 N ND1 . HIS A 1 141 ? -25.563 15.175 -21.289 1.00 24.88 ? 160  HIS A ND1 1 
ATOM   1105 C CD2 . HIS A 1 141 ? -27.184 15.745 -22.641 1.00 25.18 ? 160  HIS A CD2 1 
ATOM   1106 C CE1 . HIS A 1 141 ? -25.414 14.469 -22.395 1.00 25.71 ? 160  HIS A CE1 1 
ATOM   1107 N NE2 . HIS A 1 141 ? -26.385 14.792 -23.228 1.00 25.37 ? 160  HIS A NE2 1 
ATOM   1108 N N   . GLU A 1 142 ? -26.436 19.870 -21.356 1.00 16.97 ? 161  GLU A N   1 
ATOM   1109 C CA  . GLU A 1 142 ? -26.208 20.773 -22.481 1.00 16.47 ? 161  GLU A CA  1 
ATOM   1110 C C   . GLU A 1 142 ? -24.927 21.603 -22.337 1.00 15.39 ? 161  GLU A C   1 
ATOM   1111 O O   . GLU A 1 142 ? -24.200 21.776 -23.314 1.00 14.58 ? 161  GLU A O   1 
ATOM   1112 C CB  . GLU A 1 142 ? -27.461 21.626 -22.743 1.00 17.89 ? 161  GLU A CB  1 
ATOM   1113 C CG  . GLU A 1 142 ? -28.628 20.814 -23.301 1.00 19.74 ? 161  GLU A CG  1 
ATOM   1114 C CD  . GLU A 1 142 ? -29.950 21.572 -23.372 1.00 21.49 ? 161  GLU A CD  1 
ATOM   1115 O OE1 . GLU A 1 142 ? -30.022 22.764 -23.000 1.00 22.69 ? 161  GLU A OE1 1 
ATOM   1116 O OE2 . GLU A 1 142 ? -30.957 20.964 -23.794 1.00 24.11 ? 161  GLU A OE2 1 
ATOM   1117 N N   . LEU A 1 143 ? -24.620 22.053 -21.112 1.00 13.99 ? 162  LEU A N   1 
ATOM   1118 C CA  . LEU A 1 143 ? -23.333 22.682 -20.823 1.00 13.25 ? 162  LEU A CA  1 
ATOM   1119 C C   . LEU A 1 143 ? -22.171 21.769 -21.128 1.00 12.94 ? 162  LEU A C   1 
ATOM   1120 O O   . LEU A 1 143 ? -21.237 22.149 -21.809 1.00 13.39 ? 162  LEU A O   1 
ATOM   1121 C CB  . LEU A 1 143 ? -23.267 23.118 -19.354 1.00 12.57 ? 162  LEU A CB  1 
ATOM   1122 C CG  . LEU A 1 143 ? -24.071 24.368 -19.001 1.00 12.05 ? 162  LEU A CG  1 
ATOM   1123 C CD1 . LEU A 1 143 ? -24.426 24.452 -17.510 1.00 12.01 ? 162  LEU A CD1 1 
ATOM   1124 C CD2 . LEU A 1 143 ? -23.285 25.579 -19.461 1.00 12.14 ? 162  LEU A CD2 1 
ATOM   1125 N N   . ALA A 1 144 ? -22.222 20.536 -20.620 1.00 13.71 ? 163  ALA A N   1 
ATOM   1126 C CA  . ALA A 1 144 ? -21.133 19.606 -20.826 1.00 13.73 ? 163  ALA A CA  1 
ATOM   1127 C C   . ALA A 1 144 ? -20.864 19.372 -22.315 1.00 14.79 ? 163  ALA A C   1 
ATOM   1128 O O   . ALA A 1 144 ? -19.714 19.385 -22.745 1.00 15.33 ? 163  ALA A O   1 
ATOM   1129 C CB  . ALA A 1 144 ? -21.429 18.288 -20.126 1.00 13.48 ? 163  ALA A CB  1 
ATOM   1130 N N   . GLU A 1 145 ? -21.941 19.197 -23.073 1.00 17.05 ? 164  GLU A N   1 
ATOM   1131 C CA  . GLU A 1 145 ? -21.851 18.936 -24.514 1.00 17.30 ? 164  GLU A CA  1 
ATOM   1132 C C   . GLU A 1 145 ? -21.258 20.138 -25.235 1.00 17.01 ? 164  GLU A C   1 
ATOM   1133 O O   . GLU A 1 145 ? -20.356 19.996 -26.052 1.00 18.21 ? 164  GLU A O   1 
ATOM   1134 C CB  . GLU A 1 145 ? -23.209 18.512 -25.098 1.00 18.96 ? 164  GLU A CB  1 
ATOM   1135 C CG  . GLU A 1 145 ? -23.747 17.188 -24.534 0.50 21.00 ? 164  GLU A CG  1 
ATOM   1136 C CD  . GLU A 1 145 ? -24.599 16.378 -25.505 0.50 23.71 ? 164  GLU A CD  1 
ATOM   1137 O OE1 . GLU A 1 145 ? -25.679 16.850 -25.916 0.50 25.75 ? 164  GLU A OE1 1 
ATOM   1138 O OE2 . GLU A 1 145 ? -24.191 15.244 -25.843 0.50 24.60 ? 164  GLU A OE2 1 
ATOM   1139 N N   . ALA A 1 146 ? -21.726 21.332 -24.876 1.00 15.92 ? 165  ALA A N   1 
ATOM   1140 C CA  . ALA A 1 146 ? -21.222 22.569 -25.449 1.00 15.74 ? 165  ALA A CA  1 
ATOM   1141 C C   . ALA A 1 146 ? -19.780 22.850 -25.082 1.00 15.53 ? 165  ALA A C   1 
ATOM   1142 O O   . ALA A 1 146 ? -19.025 23.387 -25.881 1.00 17.26 ? 165  ALA A O   1 
ATOM   1143 C CB  . ALA A 1 146 ? -22.103 23.729 -25.051 1.00 15.43 ? 165  ALA A CB  1 
ATOM   1144 N N   . PHE A 1 147 ? -19.375 22.473 -23.866 1.00 15.41 ? 166  PHE A N   1 
ATOM   1145 C CA  . PHE A 1 147 ? -18.001 22.690 -23.477 1.00 15.72 ? 166  PHE A CA  1 
ATOM   1146 C C   . PHE A 1 147 ? -17.110 21.750 -24.270 1.00 15.18 ? 166  PHE A C   1 
ATOM   1147 O O   . PHE A 1 147 ? -16.038 22.140 -24.677 1.00 16.10 ? 166  PHE A O   1 
ATOM   1148 C CB  . PHE A 1 147 ? -17.802 22.504 -21.965 1.00 15.34 ? 166  PHE A CB  1 
ATOM   1149 C CG  . PHE A 1 147 ? -18.341 23.652 -21.111 1.00 16.03 ? 166  PHE A CG  1 
ATOM   1150 C CD1 . PHE A 1 147 ? -19.005 24.762 -21.651 1.00 15.45 ? 166  PHE A CD1 1 
ATOM   1151 C CD2 . PHE A 1 147 ? -18.135 23.616 -19.738 1.00 15.61 ? 166  PHE A CD2 1 
ATOM   1152 C CE1 . PHE A 1 147 ? -19.474 25.780 -20.827 1.00 15.76 ? 166  PHE A CE1 1 
ATOM   1153 C CE2 . PHE A 1 147 ? -18.592 24.636 -18.920 1.00 15.78 ? 166  PHE A CE2 1 
ATOM   1154 C CZ  . PHE A 1 147 ? -19.270 25.715 -19.458 1.00 15.51 ? 166  PHE A CZ  1 
ATOM   1155 N N   . GLN A 1 148 ? -17.583 20.535 -24.499 1.00 16.59 ? 167  GLN A N   1 
ATOM   1156 C CA  . GLN A 1 148 ? -16.831 19.559 -25.283 1.00 19.41 ? 167  GLN A CA  1 
ATOM   1157 C C   . GLN A 1 148 ? -16.738 19.992 -26.739 1.00 19.00 ? 167  GLN A C   1 
ATOM   1158 O O   . GLN A 1 148 ? -15.644 19.998 -27.303 1.00 19.06 ? 167  GLN A O   1 
ATOM   1159 C CB  . GLN A 1 148 ? -17.439 18.168 -25.173 1.00 21.03 ? 167  GLN A CB  1 
ATOM   1160 C CG  . GLN A 1 148 ? -16.776 17.133 -26.083 1.00 23.68 ? 167  GLN A CG  1 
ATOM   1161 C CD  . GLN A 1 148 ? -15.303 16.929 -25.783 1.00 24.95 ? 167  GLN A CD  1 
ATOM   1162 O OE1 . GLN A 1 148 ? -14.878 16.966 -24.626 1.00 27.73 ? 167  GLN A OE1 1 
ATOM   1163 N NE2 . GLN A 1 148 ? -14.510 16.690 -26.827 1.00 28.01 ? 167  GLN A NE2 1 
ATOM   1164 N N   . LYS A 1 149 ? -17.859 20.402 -27.326 1.00 20.60 ? 168  LYS A N   1 
ATOM   1165 C CA  . LYS A 1 149 ? -17.831 20.885 -28.716 1.00 22.93 ? 168  LYS A CA  1 
ATOM   1166 C C   . LYS A 1 149 ? -16.865 22.061 -28.858 1.00 23.20 ? 168  LYS A C   1 
ATOM   1167 O O   . LYS A 1 149 ? -16.085 22.143 -29.821 1.00 24.13 ? 168  LYS A O   1 
ATOM   1168 C CB  . LYS A 1 149 ? -19.217 21.279 -29.208 1.00 24.94 ? 168  LYS A CB  1 
ATOM   1169 C CG  . LYS A 1 149 ? -19.262 21.590 -30.702 1.00 27.12 ? 168  LYS A CG  1 
ATOM   1170 C CD  . LYS A 1 149 ? -20.193 22.753 -31.002 1.00 28.33 ? 168  LYS A CD  1 
ATOM   1171 C CE  . LYS A 1 149 ? -21.628 22.334 -31.260 1.00 30.03 ? 168  LYS A CE  1 
ATOM   1172 N NZ  . LYS A 1 149 ? -22.059 22.654 -32.653 0.50 29.71 ? 168  LYS A NZ  1 
ATOM   1173 N N   . ASP A 1 150 ? -16.895 22.963 -27.879 1.00 21.61 ? 169  ASP A N   1 
ATOM   1174 C CA  . ASP A 1 150 ? -16.002 24.105 -27.871 1.00 22.19 ? 169  ASP A CA  1 
ATOM   1175 C C   . ASP A 1 150 ? -14.520 23.691 -27.797 1.00 22.07 ? 169  ASP A C   1 
ATOM   1176 O O   . ASP A 1 150 ? -13.661 24.285 -28.454 1.00 23.21 ? 169  ASP A O   1 
ATOM   1177 C CB  . ASP A 1 150 ? -16.363 25.012 -26.699 1.00 22.78 ? 169  ASP A CB  1 
ATOM   1178 C CG  . ASP A 1 150 ? -15.399 26.156 -26.536 1.00 23.36 ? 169  ASP A CG  1 
ATOM   1179 O OD1 . ASP A 1 150 ? -15.418 27.101 -27.360 1.00 23.67 ? 169  ASP A OD1 1 
ATOM   1180 O OD2 . ASP A 1 150 ? -14.599 26.113 -25.583 1.00 24.21 ? 169  ASP A OD2 1 
ATOM   1181 N N   . PHE A 1 151 ? -14.229 22.660 -27.012 1.00 23.82 ? 170  PHE A N   1 
ATOM   1182 C CA  . PHE A 1 151 ? -12.871 22.130 -26.920 1.00 25.14 ? 170  PHE A CA  1 
ATOM   1183 C C   . PHE A 1 151 ? -12.430 21.484 -28.241 1.00 27.44 ? 170  PHE A C   1 
ATOM   1184 O O   . PHE A 1 151 ? -11.309 21.697 -28.673 1.00 26.31 ? 170  PHE A O   1 
ATOM   1185 C CB  . PHE A 1 151 ? -12.780 21.099 -25.811 1.00 24.82 ? 170  PHE A CB  1 
ATOM   1186 C CG  . PHE A 1 151 ? -11.403 20.541 -25.609 1.00 24.74 ? 170  PHE A CG  1 
ATOM   1187 C CD1 . PHE A 1 151 ? -10.337 21.380 -25.358 1.00 25.23 ? 170  PHE A CD1 1 
ATOM   1188 C CD2 . PHE A 1 151 ? -11.187 19.167 -25.619 1.00 27.63 ? 170  PHE A CD2 1 
ATOM   1189 C CE1 . PHE A 1 151 ? -9.074  20.874 -25.128 1.00 26.52 ? 170  PHE A CE1 1 
ATOM   1190 C CE2 . PHE A 1 151 ? -9.923  18.655 -25.404 1.00 26.86 ? 170  PHE A CE2 1 
ATOM   1191 C CZ  . PHE A 1 151 ? -8.867  19.505 -25.159 1.00 26.75 ? 170  PHE A CZ  1 
ATOM   1192 N N   . THR A 1 152 ? -13.326 20.722 -28.867 1.00 31.04 ? 171  THR A N   1 
ATOM   1193 C CA  . THR A 1 152 ? -13.074 20.122 -30.187 1.00 35.20 ? 171  THR A CA  1 
ATOM   1194 C C   . THR A 1 152 ? -12.479 21.129 -31.172 1.00 36.86 ? 171  THR A C   1 
ATOM   1195 O O   . THR A 1 152 ? -11.709 20.753 -32.065 1.00 39.12 ? 171  THR A O   1 
ATOM   1196 C CB  . THR A 1 152 ? -14.369 19.505 -30.764 1.00 36.39 ? 171  THR A CB  1 
ATOM   1197 O OG1 . THR A 1 152 ? -14.676 18.306 -30.042 1.00 38.72 ? 171  THR A OG1 1 
ATOM   1198 C CG2 . THR A 1 152 ? -14.247 19.188 -32.250 0.70 38.31 ? 171  THR A CG2 1 
ATOM   1199 N N   . LYS A 1 153 ? -12.809 22.406 -30.984 1.00 38.57 ? 172  LYS A N   1 
ATOM   1200 C CA  . LYS A 1 153 ? -12.381 23.478 -31.888 1.00 39.11 ? 172  LYS A CA  1 
ATOM   1201 C C   . LYS A 1 153 ? -11.341 24.415 -31.316 1.00 39.46 ? 172  LYS A C   1 
ATOM   1202 O O   . LYS A 1 153 ? -10.894 25.329 -32.010 1.00 37.85 ? 172  LYS A O   1 
ATOM   1203 C CB  . LYS A 1 153 ? -13.583 24.339 -32.240 1.00 40.45 ? 172  LYS A CB  1 
ATOM   1204 C CG  . LYS A 1 153 ? -14.396 23.839 -33.417 1.00 42.44 ? 172  LYS A CG  1 
ATOM   1205 C CD  . LYS A 1 153 ? -15.866 23.778 -33.062 1.00 43.63 ? 172  LYS A CD  1 
ATOM   1206 C CE  . LYS A 1 153 ? -16.377 25.079 -32.462 1.00 45.41 ? 172  LYS A CE  1 
ATOM   1207 N NZ  . LYS A 1 153 ? -17.859 25.040 -32.437 1.00 47.17 ? 172  LYS A NZ  1 
ATOM   1208 N N   . SER A 1 154 ? -10.960 24.221 -30.059 1.00 39.64 ? 173  SER A N   1 
ATOM   1209 C CA  . SER A 1 154 ? -10.190 25.243 -29.371 1.00 39.49 ? 173  SER A CA  1 
ATOM   1210 C C   . SER A 1 154 ? -8.738  24.829 -29.289 1.00 40.50 ? 173  SER A C   1 
ATOM   1211 O O   . SER A 1 154 ? -8.406  23.640 -29.345 1.00 42.67 ? 173  SER A O   1 
ATOM   1212 C CB  . SER A 1 154 ? -10.763 25.502 -27.964 1.00 37.83 ? 173  SER A CB  1 
ATOM   1213 O OG  . SER A 1 154 ? -10.015 26.494 -27.274 1.00 35.25 ? 173  SER A OG  1 
ATOM   1214 N N   . THR A 1 155 ? -7.877  25.827 -29.159 1.00 39.99 ? 174  THR A N   1 
ATOM   1215 C CA  . THR A 1 155 ? -6.481  25.594 -28.835 1.00 39.73 ? 174  THR A CA  1 
ATOM   1216 C C   . THR A 1 155 ? -6.298  25.737 -27.327 1.00 39.26 ? 174  THR A C   1 
ATOM   1217 O O   . THR A 1 155 ? -5.181  25.594 -26.814 1.00 41.41 ? 174  THR A O   1 
ATOM   1218 C CB  . THR A 1 155 ? -5.544  26.582 -29.565 1.00 41.64 ? 174  THR A CB  1 
ATOM   1219 O OG1 . THR A 1 155 ? -5.537  27.853 -28.889 1.00 40.75 ? 174  THR A OG1 1 
ATOM   1220 C CG2 . THR A 1 155 ? -5.974  26.754 -31.038 1.00 41.54 ? 174  THR A CG2 1 
ATOM   1221 N N   . LYS A 1 156 ? -7.394  26.033 -26.621 1.00 34.59 ? 175  LYS A N   1 
ATOM   1222 C CA  . LYS A 1 156 ? -7.355  26.214 -25.178 1.00 32.46 ? 175  LYS A CA  1 
ATOM   1223 C C   . LYS A 1 156 ? -7.947  25.013 -24.473 1.00 29.07 ? 175  LYS A C   1 
ATOM   1224 O O   . LYS A 1 156 ? -8.551  24.122 -25.095 1.00 30.17 ? 175  LYS A O   1 
ATOM   1225 C CB  . LYS A 1 156 ? -8.119  27.471 -24.754 1.00 31.80 ? 175  LYS A CB  1 
ATOM   1226 C CG  . LYS A 1 156 ? -7.717  28.718 -25.510 0.50 30.66 ? 175  LYS A CG  1 
ATOM   1227 C CD  . LYS A 1 156 ? -8.148  29.946 -24.739 0.50 30.44 ? 175  LYS A CD  1 
ATOM   1228 C CE  . LYS A 1 156 ? -8.679  31.015 -25.663 0.50 30.08 ? 175  LYS A CE  1 
ATOM   1229 N NZ  . LYS A 1 156 ? -8.983  32.229 -24.873 0.50 29.84 ? 175  LYS A NZ  1 
ATOM   1230 N N   . GLU A 1 157 ? -7.761  25.001 -23.161 1.00 27.39 ? 176  GLU A N   1 
ATOM   1231 C CA  . GLU A 1 157 ? -8.178  23.887 -22.344 1.00 24.83 ? 176  GLU A CA  1 
ATOM   1232 C C   . GLU A 1 157 ? -9.707  23.808 -22.345 1.00 21.86 ? 176  GLU A C   1 
ATOM   1233 O O   . GLU A 1 157 ? -10.359 24.833 -22.519 1.00 23.15 ? 176  GLU A O   1 
ATOM   1234 C CB  . GLU A 1 157 ? -7.627  24.060 -20.926 1.00 27.36 ? 176  GLU A CB  1 
ATOM   1235 C CG  . GLU A 1 157 ? -7.246  22.745 -20.276 0.50 28.78 ? 176  GLU A CG  1 
ATOM   1236 C CD  . GLU A 1 157 ? -6.026  22.114 -20.914 0.50 29.26 ? 176  GLU A CD  1 
ATOM   1237 O OE1 . GLU A 1 157 ? -6.179  21.105 -21.638 0.50 30.82 ? 176  GLU A OE1 1 
ATOM   1238 O OE2 . GLU A 1 157 ? -4.916  22.636 -20.696 0.50 31.19 ? 176  GLU A OE2 1 
ATOM   1239 N N   . ARG A 1 158 ? -10.277 22.609 -22.206 1.00 18.05 ? 177  ARG A N   1 
ATOM   1240 C CA  . ARG A 1 158 ? -11.718 22.463 -22.149 1.00 17.62 ? 177  ARG A CA  1 
ATOM   1241 C C   . ARG A 1 158 ? -12.173 23.200 -20.893 1.00 16.85 ? 177  ARG A C   1 
ATOM   1242 O O   . ARG A 1 158 ? -11.542 23.092 -19.847 1.00 16.98 ? 177  ARG A O   1 
ATOM   1243 C CB  . ARG A 1 158 ? -12.186 20.987 -22.089 1.00 17.63 ? 177  ARG A CB  1 
ATOM   1244 C CG  . ARG A 1 158 ? -13.703 20.837 -22.060 1.00 19.48 ? 177  ARG A CG  1 
ATOM   1245 C CD  . ARG A 1 158 ? -14.183 19.405 -22.248 1.00 20.22 ? 177  ARG A CD  1 
ATOM   1246 N NE  . ARG A 1 158 ? -14.091 18.582 -21.053 1.00 22.20 ? 177  ARG A NE  1 
ATOM   1247 C CZ  . ARG A 1 158 ? -14.462 17.301 -20.978 0.50 22.59 ? 177  ARG A CZ  1 
ATOM   1248 N NH1 . ARG A 1 158 ? -14.930 16.658 -22.047 0.50 22.54 ? 177  ARG A NH1 1 
ATOM   1249 N NH2 . ARG A 1 158 ? -14.346 16.650 -19.825 0.50 23.50 ? 177  ARG A NH2 1 
ATOM   1250 N N   . LEU A 1 159 ? -13.237 23.983 -21.020 1.00 15.91 ? 178  LEU A N   1 
ATOM   1251 C CA  . LEU A 1 159 ? -13.843 24.595 -19.860 1.00 15.22 ? 178  LEU A CA  1 
ATOM   1252 C C   . LEU A 1 159 ? -14.296 23.507 -18.886 1.00 14.66 ? 178  LEU A C   1 
ATOM   1253 O O   . LEU A 1 159 ? -14.931 22.528 -19.279 1.00 14.21 ? 178  LEU A O   1 
ATOM   1254 C CB  . LEU A 1 159 ? -15.032 25.475 -20.287 1.00 15.01 ? 178  LEU A CB  1 
ATOM   1255 C CG  . LEU A 1 159 ? -14.585 26.736 -21.022 1.00 14.83 ? 178  LEU A CG  1 
ATOM   1256 C CD1 . LEU A 1 159 ? -15.776 27.398 -21.692 1.00 14.45 ? 178  LEU A CD1 1 
ATOM   1257 C CD2 . LEU A 1 159 ? -13.854 27.685 -20.087 1.00 15.78 ? 178  LEU A CD2 1 
ATOM   1258 N N   . LEU A 1 160 ? -13.937 23.672 -17.609 1.00 13.66 ? 179  LEU A N   1 
ATOM   1259 C CA  . LEU A 1 160 ? -14.387 22.768 -16.556 1.00 13.85 ? 179  LEU A CA  1 
ATOM   1260 C C   . LEU A 1 160 ? -15.840 22.976 -16.213 1.00 12.65 ? 179  LEU A C   1 
ATOM   1261 O O   . LEU A 1 160 ? -16.349 24.090 -16.312 1.00 12.89 ? 179  LEU A O   1 
ATOM   1262 C CB  . LEU A 1 160 ? -13.563 22.986 -15.285 1.00 14.16 ? 179  LEU A CB  1 
ATOM   1263 C CG  . LEU A 1 160 ? -12.047 22.752 -15.384 1.00 15.06 ? 179  LEU A CG  1 
ATOM   1264 C CD1 . LEU A 1 160 ? -11.336 23.181 -14.108 1.00 15.43 ? 179  LEU A CD1 1 
ATOM   1265 C CD2 . LEU A 1 160 ? -11.777 21.278 -15.647 1.00 16.35 ? 179  LEU A CD2 1 
ATOM   1266 N N   . LEU A 1 161 ? -16.512 21.910 -15.801 1.00 12.46 ? 180  LEU A N   1 
ATOM   1267 C CA  . LEU A 1 161 ? -17.872 21.971 -15.347 1.00 12.00 ? 180  LEU A CA  1 
ATOM   1268 C C   . LEU A 1 161 ? -18.014 21.209 -14.055 1.00 12.40 ? 180  LEU A C   1 
ATOM   1269 O O   . LEU A 1 161 ? -17.787 20.008 -13.993 1.00 12.39 ? 180  LEU A O   1 
ATOM   1270 C CB  . LEU A 1 161 ? -18.838 21.435 -16.391 1.00 12.03 ? 180  LEU A CB  1 
ATOM   1271 C CG  . LEU A 1 161 ? -20.331 21.536 -16.133 1.00 12.53 ? 180  LEU A CG  1 
ATOM   1272 C CD1 . LEU A 1 161 ? -20.798 22.978 -16.010 1.00 12.37 ? 180  LEU A CD1 1 
ATOM   1273 C CD2 . LEU A 1 161 ? -21.149 20.845 -17.223 1.00 13.40 ? 180  LEU A CD2 1 
ATOM   1274 N N   . THR A 1 162 ? -18.431 21.933 -13.029 1.00 12.07 ? 181  THR A N   1 
ATOM   1275 C CA  . THR A 1 162 ? -18.629 21.368 -11.711 1.00 12.38 ? 181  THR A CA  1 
ATOM   1276 C C   . THR A 1 162 ? -20.005 21.752 -11.192 1.00 12.63 ? 181  THR A C   1 
ATOM   1277 O O   . THR A 1 162 ? -20.702 22.572 -11.776 1.00 11.55 ? 181  THR A O   1 
ATOM   1278 C CB  . THR A 1 162 ? -17.535 21.849 -10.721 1.00 12.40 ? 181  THR A CB  1 
ATOM   1279 O OG1 . THR A 1 162 ? -17.677 23.257 -10.449 1.00 13.56 ? 181  THR A OG1 1 
ATOM   1280 C CG2 . THR A 1 162 ? -16.171 21.668 -11.270 1.00 13.54 ? 181  THR A CG2 1 
ATOM   1281 N N   . VAL A 1 163 ? -20.411 21.134 -10.103 1.00 12.74 ? 182  VAL A N   1 
ATOM   1282 C CA  . VAL A 1 163 ? -21.675 21.459 -9.473  1.00 12.69 ? 182  VAL A CA  1 
ATOM   1283 C C   . VAL A 1 163 ? -21.584 21.306 -7.971  1.00 12.44 ? 182  VAL A C   1 
ATOM   1284 O O   . VAL A 1 163 ? -21.153 20.280 -7.463  1.00 11.90 ? 182  VAL A O   1 
ATOM   1285 C CB  . VAL A 1 163 ? -22.798 20.571 -9.978  1.00 13.17 ? 182  VAL A CB  1 
ATOM   1286 C CG1 . VAL A 1 163 ? -22.570 19.133 -9.560  0.20 13.19 ? 182  VAL A CG1 1 
ATOM   1287 C CG2 . VAL A 1 163 ? -24.111 20.993 -9.405  0.50 13.78 ? 182  VAL A CG2 1 
ATOM   1288 N N   . GLY A 1 164 ? -22.075 22.301 -7.265  1.00 11.48 ? 183  GLY A N   1 
ATOM   1289 C CA  . GLY A 1 164 ? -22.377 22.161 -5.850  1.00 11.48 ? 183  GLY A CA  1 
ATOM   1290 C C   . GLY A 1 164 ? -23.684 21.442 -5.630  1.00 11.53 ? 183  GLY A C   1 
ATOM   1291 O O   . GLY A 1 164 ? -24.750 21.866 -6.112  1.00 12.65 ? 183  GLY A O   1 
ATOM   1292 N N   . VAL A 1 165 ? -23.636 20.340 -4.885  1.00 10.97 ? 184  VAL A N   1 
ATOM   1293 C CA  . VAL A 1 165 ? -24.792 19.462 -4.761  1.00 10.74 ? 184  VAL A CA  1 
ATOM   1294 C C   . VAL A 1 165 ? -25.149 19.103 -3.331  1.00 10.80 ? 184  VAL A C   1 
ATOM   1295 O O   . VAL A 1 165 ? -24.303 19.118 -2.438  1.00 9.71  ? 184  VAL A O   1 
ATOM   1296 C CB  . VAL A 1 165 ? -24.578 18.156 -5.543  1.00 11.15 ? 184  VAL A CB  1 
ATOM   1297 C CG1 . VAL A 1 165 ? -24.521 18.427 -7.031  1.00 11.33 ? 184  VAL A CG1 1 
ATOM   1298 C CG2 . VAL A 1 165 ? -23.321 17.449 -5.052  1.00 10.90 ? 184  VAL A CG2 1 
ATOM   1299 N N   . SER A 1 166 ? -26.404 18.772 -3.108  1.00 10.60 ? 185  SER A N   1 
ATOM   1300 C CA  . SER A 1 166 ? -26.881 18.402 -1.788  1.00 11.03 ? 185  SER A CA  1 
ATOM   1301 C C   . SER A 1 166 ? -26.163 17.198 -1.186  1.00 11.13 ? 185  SER A C   1 
ATOM   1302 O O   . SER A 1 166 ? -25.804 16.235 -1.884  1.00 11.89 ? 185  SER A O   1 
ATOM   1303 C CB  . SER A 1 166 ? -28.401 18.150 -1.792  1.00 11.37 ? 185  SER A CB  1 
ATOM   1304 O OG  . SER A 1 166 ? -28.857 17.795 -0.499  1.00 12.12 ? 185  SER A OG  1 
ATOM   1305 N N   . ALA A 1 167 ? -25.939 17.296 0.112   1.00 11.14 ? 186  ALA A N   1 
ATOM   1306 C CA  . ALA A 1 167 ? -25.466 16.175 0.906   1.00 11.66 ? 186  ALA A CA  1 
ATOM   1307 C C   . ALA A 1 167 ? -26.588 15.461 1.653   1.00 12.35 ? 186  ALA A C   1 
ATOM   1308 O O   . ALA A 1 167 ? -26.300 14.579 2.443   1.00 13.28 ? 186  ALA A O   1 
ATOM   1309 C CB  . ALA A 1 167 ? -24.405 16.665 1.875   1.00 11.25 ? 186  ALA A CB  1 
ATOM   1310 N N   . GLY A 1 168 ? -27.853 15.816 1.416   1.00 12.88 ? 187  GLY A N   1 
ATOM   1311 C CA  . GLY A 1 168 ? -28.989 15.189 2.109   1.00 13.35 ? 187  GLY A CA  1 
ATOM   1312 C C   . GLY A 1 168 ? -29.616 14.088 1.276   1.00 14.06 ? 187  GLY A C   1 
ATOM   1313 O O   . GLY A 1 168 ? -30.005 14.328 0.152   1.00 14.58 ? 187  GLY A O   1 
ATOM   1314 N N   . ARG A 1 169 ? -29.708 12.882 1.831   1.00 15.70 ? 188  ARG A N   1 
ATOM   1315 C CA  . ARG A 1 169 ? -30.156 11.708 1.048   1.00 16.32 ? 188  ARG A CA  1 
ATOM   1316 C C   . ARG A 1 169 ? -31.440 11.975 0.288   1.00 16.28 ? 188  ARG A C   1 
ATOM   1317 O O   . ARG A 1 169 ? -31.524 11.661 -0.885  1.00 14.89 ? 188  ARG A O   1 
ATOM   1318 C CB  . ARG A 1 169 ? -30.357 10.493 1.949   1.00 17.55 ? 188  ARG A CB  1 
ATOM   1319 C CG  . ARG A 1 169 ? -31.212 9.429  1.283   1.00 20.35 ? 188  ARG A CG  1 
ATOM   1320 C CD  . ARG A 1 169 ? -31.056 8.073  1.899   1.00 22.46 ? 188  ARG A CD  1 
ATOM   1321 N NE  . ARG A 1 169 ? -31.686 7.114  0.997   1.00 25.16 ? 188  ARG A NE  1 
ATOM   1322 C CZ  . ARG A 1 169 ? -31.645 5.797  1.150   1.00 27.83 ? 188  ARG A CZ  1 
ATOM   1323 N NH1 . ARG A 1 169 ? -31.011 5.259  2.186   1.00 28.21 ? 188  ARG A NH1 1 
ATOM   1324 N NH2 . ARG A 1 169 ? -32.242 5.018  0.253   0.70 27.19 ? 188  ARG A NH2 1 
ATOM   1325 N N   . GLN A 1 170 ? -32.439 12.507 0.979   1.00 16.27 ? 189  GLN A N   1 
ATOM   1326 C CA  . GLN A 1 170 ? -33.749 12.690 0.371   1.00 18.13 ? 189  GLN A CA  1 
ATOM   1327 C C   . GLN A 1 170 ? -33.690 13.697 -0.763  1.00 17.46 ? 189  GLN A C   1 
ATOM   1328 O O   . GLN A 1 170 ? -34.243 13.494 -1.855  1.00 17.80 ? 189  GLN A O   1 
ATOM   1329 C CB  . GLN A 1 170 ? -34.782 13.154 1.385   1.00 18.87 ? 189  GLN A CB  1 
ATOM   1330 C CG  . GLN A 1 170 ? -36.195 12.954 0.874   0.50 20.22 ? 189  GLN A CG  1 
ATOM   1331 C CD  . GLN A 1 170 ? -37.182 14.038 1.217   0.50 21.76 ? 189  GLN A CD  1 
ATOM   1332 O OE1 . GLN A 1 170 ? -38.063 14.342 0.408   0.50 23.79 ? 189  GLN A OE1 1 
ATOM   1333 N NE2 . GLN A 1 170 ? -37.054 14.632 2.404   0.50 22.16 ? 189  GLN A NE2 1 
ATOM   1334 N N   . MET A 1 171 ? -33.016 14.802 -0.513  1.00 17.02 ? 190  MET A N   1 
ATOM   1335 C CA  . MET A 1 171 ? -32.841 15.791 -1.556  1.00 16.21 ? 190  MET A CA  1 
ATOM   1336 C C   . MET A 1 171 ? -32.045 15.236 -2.735  1.00 15.41 ? 190  MET A C   1 
ATOM   1337 O O   . MET A 1 171 ? -32.313 15.587 -3.892  1.00 15.83 ? 190  MET A O   1 
ATOM   1338 C CB  . MET A 1 171 ? -32.156 17.042 -0.995  1.00 16.54 ? 190  MET A CB  1 
ATOM   1339 C CG  . MET A 1 171 ? -32.120 18.221 -1.963  1.00 17.62 ? 190  MET A CG  1 
ATOM   1340 S SD  . MET A 1 171 ? -33.750 18.721 -2.596  1.00 17.31 ? 190  MET A SD  1 
ATOM   1341 C CE  . MET A 1 171 ? -34.488 19.394 -1.122  1.00 18.56 ? 190  MET A CE  1 
ATOM   1342 N N   . ILE A 1 172 ? -31.050 14.382 -2.458  1.00 14.88 ? 191  ILE A N   1 
ATOM   1343 C CA  . ILE A 1 172 ? -30.240 13.777 -3.502  1.00 14.24 ? 191  ILE A CA  1 
ATOM   1344 C C   . ILE A 1 172 ? -31.128 12.901 -4.391  1.00 15.52 ? 191  ILE A C   1 
ATOM   1345 O O   . ILE A 1 172 ? -31.081 13.003 -5.615  1.00 14.94 ? 191  ILE A O   1 
ATOM   1346 C CB  . ILE A 1 172 ? -29.089 12.910 -2.912  1.00 14.56 ? 191  ILE A CB  1 
ATOM   1347 C CG1 . ILE A 1 172 ? -28.053 13.821 -2.244  1.00 14.27 ? 191  ILE A CG1 1 
ATOM   1348 C CG2 . ILE A 1 172 ? -28.435 12.056 -3.984  1.00 13.28 ? 191  ILE A CG2 1 
ATOM   1349 C CD1 . ILE A 1 172 ? -27.133 13.109 -1.262  1.00 14.90 ? 191  ILE A CD1 1 
ATOM   1350 N N   . ASP A 1 173 ? -31.922 12.062 -3.738  1.00 15.55 ? 192  ASP A N   1 
ATOM   1351 C CA  . ASP A 1 173 ? -32.858 11.165 -4.428  1.00 17.29 ? 192  ASP A CA  1 
ATOM   1352 C C   . ASP A 1 173 ? -33.824 11.951 -5.305  1.00 18.70 ? 192  ASP A C   1 
ATOM   1353 O O   . ASP A 1 173 ? -34.065 11.559 -6.456  1.00 19.38 ? 192  ASP A O   1 
ATOM   1354 C CB  . ASP A 1 173 ? -33.634 10.304 -3.429  1.00 17.33 ? 192  ASP A CB  1 
ATOM   1355 C CG  . ASP A 1 173 ? -32.817 9.134  -2.886  1.00 18.14 ? 192  ASP A CG  1 
ATOM   1356 O OD1 . ASP A 1 173 ? -31.755 8.797  -3.436  1.00 18.32 ? 192  ASP A OD1 1 
ATOM   1357 O OD2 . ASP A 1 173 ? -33.267 8.538  -1.897  1.00 22.16 ? 192  ASP A OD2 1 
ATOM   1358 N N   . ASN A 1 174 ? -34.338 13.066 -4.780  1.00 18.56 ? 193  ASN A N   1 
ATOM   1359 C CA  . ASN A 1 174 ? -35.312 13.885 -5.499  1.00 18.14 ? 193  ASN A CA  1 
ATOM   1360 C C   . ASN A 1 174 ? -34.712 14.689 -6.643  1.00 17.43 ? 193  ASN A C   1 
ATOM   1361 O O   . ASN A 1 174 ? -35.362 14.870 -7.680  1.00 17.38 ? 193  ASN A O   1 
ATOM   1362 C CB  . ASN A 1 174 ? -36.047 14.834 -4.535  1.00 20.14 ? 193  ASN A CB  1 
ATOM   1363 C CG  . ASN A 1 174 ? -36.900 14.096 -3.525  1.00 21.14 ? 193  ASN A CG  1 
ATOM   1364 O OD1 . ASN A 1 174 ? -37.112 12.885 -3.641  1.00 24.01 ? 193  ASN A OD1 1 
ATOM   1365 N ND2 . ASN A 1 174 ? -37.401 14.809 -2.539  1.00 23.05 ? 193  ASN A ND2 1 
ATOM   1366 N N   . SER A 1 175 ? -33.472 15.154 -6.473  1.00 16.09 ? 194  SER A N   1 
ATOM   1367 C CA  . SER A 1 175 ? -32.886 16.154 -7.370  1.00 14.97 ? 194  SER A CA  1 
ATOM   1368 C C   . SER A 1 175 ? -32.052 15.663 -8.542  1.00 14.70 ? 194  SER A C   1 
ATOM   1369 O O   . SER A 1 175 ? -31.996 16.338 -9.557  1.00 15.02 ? 194  SER A O   1 
ATOM   1370 C CB  . SER A 1 175 ? -31.987 17.115 -6.567  1.00 14.23 ? 194  SER A CB  1 
ATOM   1371 O OG  . SER A 1 175 ? -32.654 17.744 -5.471  1.00 14.24 ? 194  SER A OG  1 
ATOM   1372 N N   . TYR A 1 176 ? -31.322 14.551 -8.394  1.00 14.53 ? 195  TYR A N   1 
ATOM   1373 C CA  . TYR A 1 176 ? -30.213 14.255 -9.284  1.00 14.69 ? 195  TYR A CA  1 
ATOM   1374 C C   . TYR A 1 176 ? -30.363 12.927 -10.021 1.00 15.62 ? 195  TYR A C   1 
ATOM   1375 O O   . TYR A 1 176 ? -30.906 11.957 -9.460  1.00 16.58 ? 195  TYR A O   1 
ATOM   1376 C CB  . TYR A 1 176 ? -28.872 14.261 -8.509  1.00 14.72 ? 195  TYR A CB  1 
ATOM   1377 C CG  . TYR A 1 176 ? -28.654 15.546 -7.742  1.00 13.94 ? 195  TYR A CG  1 
ATOM   1378 C CD1 . TYR A 1 176 ? -28.592 16.771 -8.407  1.00 14.47 ? 195  TYR A CD1 1 
ATOM   1379 C CD2 . TYR A 1 176 ? -28.494 15.538 -6.371  1.00 13.60 ? 195  TYR A CD2 1 
ATOM   1380 C CE1 . TYR A 1 176 ? -28.391 17.958 -7.705  1.00 13.62 ? 195  TYR A CE1 1 
ATOM   1381 C CE2 . TYR A 1 176 ? -28.310 16.710 -5.652  1.00 13.87 ? 195  TYR A CE2 1 
ATOM   1382 C CZ  . TYR A 1 176 ? -28.248 17.914 -6.326  1.00 13.16 ? 195  TYR A CZ  1 
ATOM   1383 O OH  . TYR A 1 176 ? -28.053 19.046 -5.595  1.00 13.75 ? 195  TYR A OH  1 
ATOM   1384 N N   . GLN A 1 177 ? -29.853 12.921 -11.252 1.00 15.92 ? 196  GLN A N   1 
ATOM   1385 C CA  . GLN A 1 177 ? -29.630 11.716 -12.046 1.00 16.12 ? 196  GLN A CA  1 
ATOM   1386 C C   . GLN A 1 177 ? -28.124 11.456 -12.042 1.00 15.87 ? 196  GLN A C   1 
ATOM   1387 O O   . GLN A 1 177 ? -27.349 11.960 -12.866 1.00 17.18 ? 196  GLN A O   1 
ATOM   1388 C CB  . GLN A 1 177 ? -30.233 11.880 -13.445 1.00 17.17 ? 196  GLN A CB  1 
ATOM   1389 C CG  . GLN A 1 177 ? -31.727 12.153 -13.383 1.00 18.68 ? 196  GLN A CG  1 
ATOM   1390 C CD  . GLN A 1 177 ? -32.356 12.447 -14.732 1.00 19.41 ? 196  GLN A CD  1 
ATOM   1391 O OE1 . GLN A 1 177 ? -31.993 11.865 -15.751 1.00 20.23 ? 196  GLN A OE1 1 
ATOM   1392 N NE2 . GLN A 1 177 ? -33.307 13.353 -14.738 1.00 22.05 ? 196  GLN A NE2 1 
ATOM   1393 N N   . VAL A 1 178 ? -27.699 10.677 -11.046 1.00 15.89 ? 197  VAL A N   1 
ATOM   1394 C CA  . VAL A 1 178 ? -26.296 10.671 -10.640 1.00 15.37 ? 197  VAL A CA  1 
ATOM   1395 C C   . VAL A 1 178 ? -25.343 10.095 -11.673 1.00 15.61 ? 197  VAL A C   1 
ATOM   1396 O O   . VAL A 1 178 ? -24.257 10.631 -11.925 1.00 15.40 ? 197  VAL A O   1 
ATOM   1397 C CB  . VAL A 1 178 ? -26.132 9.974  -9.270  1.00 15.17 ? 197  VAL A CB  1 
ATOM   1398 C CG1 . VAL A 1 178 ? -24.671 9.875  -8.900  1.00 13.89 ? 197  VAL A CG1 1 
ATOM   1399 C CG2 . VAL A 1 178 ? -26.930 10.729 -8.212  1.00 15.50 ? 197  VAL A CG2 1 
ATOM   1400 N N   . GLU A 1 179 ? -25.743 9.004  -12.310 1.00 17.51 ? 198  GLU A N   1 
ATOM   1401 C CA  . GLU A 1 179 ? -24.882 8.402  -13.289 1.00 18.52 ? 198  GLU A CA  1 
ATOM   1402 C C   . GLU A 1 179 ? -24.646 9.326  -14.463 1.00 17.68 ? 198  GLU A C   1 
ATOM   1403 O O   . GLU A 1 179 ? -23.556 9.369  -14.976 1.00 18.71 ? 198  GLU A O   1 
ATOM   1404 C CB  . GLU A 1 179 ? -25.444 7.059  -13.742 1.00 19.69 ? 198  GLU A CB  1 
ATOM   1405 C CG  . GLU A 1 179 ? -25.416 6.024  -12.620 1.00 21.72 ? 198  GLU A CG  1 
ATOM   1406 C CD  . GLU A 1 179 ? -24.037 5.439  -12.367 0.50 22.73 ? 198  GLU A CD  1 
ATOM   1407 O OE1 . GLU A 1 179 ? -23.950 4.242  -12.018 0.50 25.22 ? 198  GLU A OE1 1 
ATOM   1408 O OE2 . GLU A 1 179 ? -23.025 6.161  -12.512 0.50 23.48 ? 198  GLU A OE2 1 
ATOM   1409 N N   . LYS A 1 180 ? -25.671 10.073 -14.863 1.00 19.64 ? 199  LYS A N   1 
ATOM   1410 C CA  . LYS A 1 180 ? -25.525 11.073 -15.911 1.00 21.40 ? 199  LYS A CA  1 
ATOM   1411 C C   . LYS A 1 180 ? -24.644 12.237 -15.466 1.00 19.54 ? 199  LYS A C   1 
ATOM   1412 O O   . LYS A 1 180 ? -23.745 12.648 -16.175 1.00 18.64 ? 199  LYS A O   1 
ATOM   1413 C CB  . LYS A 1 180 ? -26.892 11.572 -16.354 1.00 24.27 ? 199  LYS A CB  1 
ATOM   1414 C CG  . LYS A 1 180 ? -27.676 10.495 -17.101 1.00 27.83 ? 199  LYS A CG  1 
ATOM   1415 C CD  . LYS A 1 180 ? -28.994 10.964 -17.716 1.00 30.68 ? 199  LYS A CD  1 
ATOM   1416 C CE  . LYS A 1 180 ? -28.962 12.405 -18.208 1.00 32.53 ? 199  LYS A CE  1 
ATOM   1417 N NZ  . LYS A 1 180 ? -29.506 12.566 -19.590 1.00 34.35 ? 199  LYS A NZ  1 
ATOM   1418 N N   . LEU A 1 181 ? -24.864 12.694 -14.245 1.00 19.09 ? 200  LEU A N   1 
ATOM   1419 C CA  . LEU A 1 181 ? -24.032 13.727 -13.644 1.00 19.75 ? 200  LEU A CA  1 
ATOM   1420 C C   . LEU A 1 181 ? -22.577 13.310 -13.589 1.00 18.76 ? 200  LEU A C   1 
ATOM   1421 O O   . LEU A 1 181 ? -21.680 14.102 -13.845 1.00 19.13 ? 200  LEU A O   1 
ATOM   1422 C CB  . LEU A 1 181 ? -24.538 13.990 -12.221 1.00 20.21 ? 200  LEU A CB  1 
ATOM   1423 C CG  . LEU A 1 181 ? -24.679 15.387 -11.683 1.00 21.98 ? 200  LEU A CG  1 
ATOM   1424 C CD1 . LEU A 1 181 ? -25.402 16.269 -12.678 1.00 20.94 ? 200  LEU A CD1 1 
ATOM   1425 C CD2 . LEU A 1 181 ? -25.454 15.357 -10.371 1.00 20.68 ? 200  LEU A CD2 1 
ATOM   1426 N N   . ALA A 1 182 ? -22.317 12.052 -13.238 1.00 18.59 ? 201  ALA A N   1 
ATOM   1427 C CA  . ALA A 1 182 ? -20.945 11.548 -13.233 1.00 18.16 ? 201  ALA A CA  1 
ATOM   1428 C C   . ALA A 1 182 ? -20.264 11.627 -14.618 1.00 19.08 ? 201  ALA A C   1 
ATOM   1429 O O   . ALA A 1 182 ? -19.062 11.839 -14.712 1.00 21.72 ? 201  ALA A O   1 
ATOM   1430 C CB  . ALA A 1 182 ? -20.908 10.126 -12.668 1.00 18.11 ? 201  ALA A CB  1 
ATOM   1431 N N   . LYS A 1 183 ? -21.027 11.490 -15.703 1.00 19.01 ? 202  LYS A N   1 
ATOM   1432 C CA  . LYS A 1 183 ? -20.425 11.620 -17.037 1.00 20.47 ? 202  LYS A CA  1 
ATOM   1433 C C   . LYS A 1 183 ? -20.230 13.081 -17.421 1.00 18.37 ? 202  LYS A C   1 
ATOM   1434 O O   . LYS A 1 183 ? -19.224 13.450 -18.027 1.00 19.58 ? 202  LYS A O   1 
ATOM   1435 C CB  . LYS A 1 183 ? -21.292 10.928 -18.096 1.00 23.38 ? 202  LYS A CB  1 
ATOM   1436 C CG  . LYS A 1 183 ? -21.732 9.527  -17.706 1.00 26.64 ? 202  LYS A CG  1 
ATOM   1437 C CD  . LYS A 1 183 ? -21.988 8.645  -18.923 1.00 28.21 ? 202  LYS A CD  1 
ATOM   1438 C CE  . LYS A 1 183 ? -23.419 8.144  -18.931 0.50 27.89 ? 202  LYS A CE  1 
ATOM   1439 N NZ  . LYS A 1 183 ? -24.342 9.239  -19.345 0.50 27.93 ? 202  LYS A NZ  1 
ATOM   1440 N N   . ASP A 1 184 ? -21.180 13.919 -17.038 1.00 16.86 ? 203  ASP A N   1 
ATOM   1441 C CA  . ASP A 1 184 ? -21.198 15.330 -17.464 1.00 16.16 ? 203  ASP A CA  1 
ATOM   1442 C C   . ASP A 1 184 ? -20.241 16.250 -16.675 1.00 15.91 ? 203  ASP A C   1 
ATOM   1443 O O   . ASP A 1 184 ? -19.659 17.196 -17.237 1.00 17.02 ? 203  ASP A O   1 
ATOM   1444 C CB  . ASP A 1 184 ? -22.627 15.866 -17.395 1.00 17.09 ? 203  ASP A CB  1 
ATOM   1445 C CG  . ASP A 1 184 ? -23.511 15.292 -18.477 1.00 18.14 ? 203  ASP A CG  1 
ATOM   1446 O OD1 . ASP A 1 184 ? -22.960 14.789 -19.475 1.00 19.78 ? 203  ASP A OD1 1 
ATOM   1447 O OD2 . ASP A 1 184 ? -24.748 15.309 -18.319 1.00 20.24 ? 203  ASP A OD2 1 
ATOM   1448 N N   . LEU A 1 185 ? -20.067 15.972 -15.386 1.00 14.83 ? 204  LEU A N   1 
ATOM   1449 C CA  . LEU A 1 185 ? -19.268 16.856 -14.524 1.00 15.19 ? 204  LEU A CA  1 
ATOM   1450 C C   . LEU A 1 185 ? -17.810 16.441 -14.401 1.00 14.85 ? 204  LEU A C   1 
ATOM   1451 O O   . LEU A 1 185 ? -17.508 15.257 -14.352 1.00 15.81 ? 204  LEU A O   1 
ATOM   1452 C CB  . LEU A 1 185 ? -19.887 16.861 -13.135 1.00 14.98 ? 204  LEU A CB  1 
ATOM   1453 C CG  . LEU A 1 185 ? -21.307 17.392 -13.008 1.00 15.20 ? 204  LEU A CG  1 
ATOM   1454 C CD1 . LEU A 1 185 ? -21.623 17.338 -11.562 1.00 15.36 ? 204  LEU A CD1 1 
ATOM   1455 C CD2 . LEU A 1 185 ? -21.428 18.822 -13.513 1.00 15.18 ? 204  LEU A CD2 1 
ATOM   1456 N N   . ASP A 1 186 ? -16.902 17.403 -14.291 1.00 14.93 ? 205  ASP A N   1 
ATOM   1457 C CA  . ASP A 1 186 ? -15.532 17.083 -13.942 1.00 14.35 ? 205  ASP A CA  1 
ATOM   1458 C C   . ASP A 1 186 ? -15.465 16.623 -12.487 1.00 14.34 ? 205  ASP A C   1 
ATOM   1459 O O   . ASP A 1 186 ? -14.684 15.707 -12.157 1.00 13.47 ? 205  ASP A O   1 
ATOM   1460 C CB  . ASP A 1 186 ? -14.604 18.263 -14.243 1.00 16.40 ? 205  ASP A CB  1 
ATOM   1461 C CG  . ASP A 1 186 ? -14.442 18.466 -15.738 1.00 18.26 ? 205  ASP A CG  1 
ATOM   1462 O OD1 . ASP A 1 186 ? -13.733 17.659 -16.392 1.00 20.59 ? 205  ASP A OD1 1 
ATOM   1463 O OD2 . ASP A 1 186 ? -15.091 19.368 -16.286 1.00 18.27 ? 205  ASP A OD2 1 
ATOM   1464 N N   . PHE A 1 187 ? -16.261 17.262 -11.629 1.00 13.09 ? 206  PHE A N   1 
ATOM   1465 C CA  . PHE A 1 187 ? -16.412 16.833 -10.239 1.00 12.38 ? 206  PHE A CA  1 
ATOM   1466 C C   . PHE A 1 187 ? -17.593 17.501 -9.577  1.00 12.11 ? 206  PHE A C   1 
ATOM   1467 O O   . PHE A 1 187 ? -18.094 18.513 -10.102 1.00 11.74 ? 206  PHE A O   1 
ATOM   1468 C CB  . PHE A 1 187 ? -15.143 17.038 -9.403  1.00 12.08 ? 206  PHE A CB  1 
ATOM   1469 C CG  . PHE A 1 187 ? -14.580 18.436 -9.402  1.00 11.42 ? 206  PHE A CG  1 
ATOM   1470 C CD1 . PHE A 1 187 ? -14.959 19.366 -8.435  1.00 11.85 ? 206  PHE A CD1 1 
ATOM   1471 C CD2 . PHE A 1 187 ? -13.576 18.785 -10.286 1.00 11.42 ? 206  PHE A CD2 1 
ATOM   1472 C CE1 . PHE A 1 187 ? -14.365 20.621 -8.410  1.00 11.25 ? 206  PHE A CE1 1 
ATOM   1473 C CE2 . PHE A 1 187 ? -13.010 20.031 -10.268 1.00 11.65 ? 206  PHE A CE2 1 
ATOM   1474 C CZ  . PHE A 1 187 ? -13.383 20.944 -9.317  1.00 11.51 ? 206  PHE A CZ  1 
ATOM   1475 N N   . ILE A 1 188 ? -18.073 16.899 -8.475  1.00 11.28 ? 207  ILE A N   1 
ATOM   1476 C CA  . ILE A 1 188 ? -19.054 17.536 -7.599  1.00 11.22 ? 207  ILE A CA  1 
ATOM   1477 C C   . ILE A 1 188 ? -18.352 18.222 -6.420  1.00 11.55 ? 207  ILE A C   1 
ATOM   1478 O O   . ILE A 1 188 ? -17.360 17.730 -5.894  1.00 11.56 ? 207  ILE A O   1 
ATOM   1479 C CB  . ILE A 1 188 ? -20.152 16.589 -7.067  1.00 11.84 ? 207  ILE A CB  1 
ATOM   1480 C CG1 . ILE A 1 188 ? -19.593 15.384 -6.292  1.00 12.07 ? 207  ILE A CG1 1 
ATOM   1481 C CG2 . ILE A 1 188 ? -21.048 16.113 -8.216  1.00 11.74 ? 207  ILE A CG2 1 
ATOM   1482 C CD1 . ILE A 1 188 ? -20.639 14.691 -5.443  1.00 12.37 ? 207  ILE A CD1 1 
ATOM   1483 N N   . ASN A 1 189 ? -18.854 19.404 -6.091  1.00 10.89 ? 208  ASN A N   1 
ATOM   1484 C CA  . ASN A 1 189 ? -18.552 20.067 -4.828  1.00 10.99 ? 208  ASN A CA  1 
ATOM   1485 C C   . ASN A 1 189 ? -19.660 19.680 -3.861  1.00 11.32 ? 208  ASN A C   1 
ATOM   1486 O O   . ASN A 1 189 ? -20.766 20.224 -3.872  1.00 11.71 ? 208  ASN A O   1 
ATOM   1487 C CB  . ASN A 1 189 ? -18.467 21.577 -5.065  1.00 11.09 ? 208  ASN A CB  1 
ATOM   1488 C CG  . ASN A 1 189 ? -17.298 21.938 -5.953  1.00 11.54 ? 208  ASN A CG  1 
ATOM   1489 O OD1 . ASN A 1 189 ? -16.152 21.592 -5.669  1.00 11.01 ? 208  ASN A OD1 1 
ATOM   1490 N ND2 . ASN A 1 189 ? -17.581 22.661 -7.052  1.00 12.19 ? 208  ASN A ND2 1 
ATOM   1491 N N   . LEU A 1 190 ? -19.386 18.672 -3.033  1.00 11.03 ? 209  LEU A N   1 
ATOM   1492 C CA  . LEU A 1 190 ? -20.406 18.167 -2.143  1.00 10.65 ? 209  LEU A CA  1 
ATOM   1493 C C   . LEU A 1 190 ? -20.618 19.132 -0.979  1.00 10.45 ? 209  LEU A C   1 
ATOM   1494 O O   . LEU A 1 190 ? -19.695 19.409 -0.236  1.00 10.09 ? 209  LEU A O   1 
ATOM   1495 C CB  . LEU A 1 190 ? -20.020 16.791 -1.614  1.00 11.09 ? 209  LEU A CB  1 
ATOM   1496 C CG  . LEU A 1 190 ? -20.945 16.147 -0.602  1.00 11.84 ? 209  LEU A CG  1 
ATOM   1497 C CD1 . LEU A 1 190 ? -22.337 15.858 -1.176  1.00 11.98 ? 209  LEU A CD1 1 
ATOM   1498 C CD2 . LEU A 1 190 ? -20.292 14.878 -0.056  1.00 12.44 ? 209  LEU A CD2 1 
ATOM   1499 N N   . LEU A 1 191 ? -21.849 19.613 -0.837  1.00 9.66  ? 210  LEU A N   1 
ATOM   1500 C CA  . LEU A 1 191 ? -22.204 20.617 0.183   1.00 9.77  ? 210  LEU A CA  1 
ATOM   1501 C C   . LEU A 1 191 ? -22.512 19.950 1.521   1.00 9.42  ? 210  LEU A C   1 
ATOM   1502 O O   . LEU A 1 191 ? -23.625 19.985 2.053   1.00 9.25  ? 210  LEU A O   1 
ATOM   1503 C CB  . LEU A 1 191 ? -23.371 21.473 -0.336  1.00 10.08 ? 210  LEU A CB  1 
ATOM   1504 C CG  . LEU A 1 191 ? -23.085 22.185 -1.659  1.00 10.70 ? 210  LEU A CG  1 
ATOM   1505 C CD1 . LEU A 1 191 ? -24.389 22.687 -2.239  1.00 10.47 ? 210  LEU A CD1 1 
ATOM   1506 C CD2 . LEU A 1 191 ? -22.082 23.325 -1.517  1.00 11.10 ? 210  LEU A CD2 1 
ATOM   1507 N N   . SER A 1 192 ? -21.469 19.340 2.074   1.00 9.74  ? 211  SER A N   1 
ATOM   1508 C CA  . SER A 1 192 ? -21.553 18.477 3.262   1.00 9.67  ? 211  SER A CA  1 
ATOM   1509 C C   . SER A 1 192 ? -21.472 19.329 4.535   1.00 10.17 ? 211  SER A C   1 
ATOM   1510 O O   . SER A 1 192 ? -20.519 19.257 5.318   1.00 10.78 ? 211  SER A O   1 
ATOM   1511 C CB  . SER A 1 192 ? -20.462 17.388 3.197   1.00 9.55  ? 211  SER A CB  1 
ATOM   1512 O OG  . SER A 1 192 ? -19.283 17.805 2.497   1.00 8.97  ? 211  SER A OG  1 
ATOM   1513 N N   . PHE A 1 193 ? -22.506 20.129 4.705   1.00 9.92  ? 212  PHE A N   1 
ATOM   1514 C CA  . PHE A 1 193 ? -22.697 21.056 5.807   1.00 10.47 ? 212  PHE A CA  1 
ATOM   1515 C C   . PHE A 1 193 ? -24.184 21.459 5.752   1.00 10.98 ? 212  PHE A C   1 
ATOM   1516 O O   . PHE A 1 193 ? -24.922 20.949 4.901   1.00 11.98 ? 212  PHE A O   1 
ATOM   1517 C CB  . PHE A 1 193 ? -21.702 22.238 5.781   1.00 10.22 ? 212  PHE A CB  1 
ATOM   1518 C CG  . PHE A 1 193 ? -21.359 22.750 4.401   1.00 9.89  ? 212  PHE A CG  1 
ATOM   1519 C CD1 . PHE A 1 193 ? -22.274 23.510 3.689   1.00 9.78  ? 212  PHE A CD1 1 
ATOM   1520 C CD2 . PHE A 1 193 ? -20.129 22.506 3.836   1.00 9.75  ? 212  PHE A CD2 1 
ATOM   1521 C CE1 . PHE A 1 193 ? -21.945 24.004 2.445   1.00 9.21  ? 212  PHE A CE1 1 
ATOM   1522 C CE2 . PHE A 1 193 ? -19.807 22.991 2.576   1.00 9.70  ? 212  PHE A CE2 1 
ATOM   1523 C CZ  . PHE A 1 193 ? -20.726 23.741 1.891   1.00 9.24  ? 212  PHE A CZ  1 
ATOM   1524 N N   . ASP A 1 194 ? -24.632 22.295 6.686   1.00 11.50 ? 213  ASP A N   1 
ATOM   1525 C CA  . ASP A 1 194 ? -26.036 22.666 6.846   1.00 11.89 ? 213  ASP A CA  1 
ATOM   1526 C C   . ASP A 1 194 ? -26.894 21.459 7.139   1.00 12.34 ? 213  ASP A C   1 
ATOM   1527 O O   . ASP A 1 194 ? -28.075 21.404 6.818   1.00 13.00 ? 213  ASP A O   1 
ATOM   1528 C CB  . ASP A 1 194 ? -26.575 23.436 5.625   1.00 12.61 ? 213  ASP A CB  1 
ATOM   1529 C CG  . ASP A 1 194 ? -25.885 24.759 5.412   1.00 13.24 ? 213  ASP A CG  1 
ATOM   1530 O OD1 . ASP A 1 194 ? -25.481 25.408 6.415   1.00 12.38 ? 213  ASP A OD1 1 
ATOM   1531 O OD2 . ASP A 1 194 ? -25.768 25.165 4.217   1.00 13.36 ? 213  ASP A OD2 1 
ATOM   1532 N N   . PHE A 1 195 ? -26.307 20.498 7.828   1.00 11.78 ? 214  PHE A N   1 
ATOM   1533 C CA  . PHE A 1 195 ? -27.055 19.328 8.256   1.00 12.34 ? 214  PHE A CA  1 
ATOM   1534 C C   . PHE A 1 195 ? -28.041 19.657 9.382   1.00 13.24 ? 214  PHE A C   1 
ATOM   1535 O O   . PHE A 1 195 ? -29.066 18.989 9.508   1.00 15.92 ? 214  PHE A O   1 
ATOM   1536 C CB  . PHE A 1 195 ? -26.081 18.240 8.724   1.00 11.70 ? 214  PHE A CB  1 
ATOM   1537 C CG  . PHE A 1 195 ? -25.394 17.494 7.605   1.00 11.36 ? 214  PHE A CG  1 
ATOM   1538 C CD1 . PHE A 1 195 ? -26.089 16.616 6.784   1.00 11.37 ? 214  PHE A CD1 1 
ATOM   1539 C CD2 . PHE A 1 195 ? -24.034 17.658 7.385   1.00 11.08 ? 214  PHE A CD2 1 
ATOM   1540 C CE1 . PHE A 1 195 ? -25.438 15.923 5.776   1.00 11.40 ? 214  PHE A CE1 1 
ATOM   1541 C CE2 . PHE A 1 195 ? -23.393 16.969 6.389   1.00 11.12 ? 214  PHE A CE2 1 
ATOM   1542 C CZ  . PHE A 1 195 ? -24.086 16.104 5.585   1.00 10.60 ? 214  PHE A CZ  1 
ATOM   1543 N N   . HIS A 1 196 ? -27.716 20.640 10.220  1.00 13.22 ? 215  HIS A N   1 
ATOM   1544 C CA  . HIS A 1 196 ? -28.547 21.047 11.339  1.00 13.55 ? 215  HIS A CA  1 
ATOM   1545 C C   . HIS A 1 196 ? -28.387 22.546 11.535  1.00 13.50 ? 215  HIS A C   1 
ATOM   1546 O O   . HIS A 1 196 ? -27.341 23.106 11.217  1.00 14.08 ? 215  HIS A O   1 
ATOM   1547 C CB  . HIS A 1 196 ? -28.121 20.366 12.640  1.00 13.74 ? 215  HIS A CB  1 
ATOM   1548 C CG  . HIS A 1 196 ? -28.199 18.874 12.595  1.00 14.44 ? 215  HIS A CG  1 
ATOM   1549 N ND1 . HIS A 1 196 ? -29.396 18.204 12.468  1.00 14.76 ? 215  HIS A ND1 1 
ATOM   1550 C CD2 . HIS A 1 196 ? -27.241 17.922 12.669  1.00 15.03 ? 215  HIS A CD2 1 
ATOM   1551 C CE1 . HIS A 1 196 ? -29.170 16.898 12.464  1.00 15.69 ? 215  HIS A CE1 1 
ATOM   1552 N NE2 . HIS A 1 196 ? -27.869 16.699 12.571  1.00 15.95 ? 215  HIS A NE2 1 
ATOM   1553 N N   . GLY A 1 197 ? -29.395 23.163 12.126  1.00 14.06 ? 216  GLY A N   1 
ATOM   1554 C CA  . GLY A 1 197 ? -29.424 24.622 12.314  1.00 13.97 ? 216  GLY A CA  1 
ATOM   1555 C C   . GLY A 1 197 ? -30.789 25.027 12.833  1.00 15.27 ? 216  GLY A C   1 
ATOM   1556 O O   . GLY A 1 197 ? -31.670 24.193 12.983  1.00 15.37 ? 216  GLY A O   1 
ATOM   1557 N N   . SER A 1 198 ? -30.974 26.326 13.057  1.00 16.70 ? 217  SER A N   1 
ATOM   1558 C CA  . SER A 1 198 ? -32.135 26.842 13.791  1.00 17.58 ? 217  SER A CA  1 
ATOM   1559 C C   . SER A 1 198 ? -33.454 26.796 13.011  1.00 18.53 ? 217  SER A C   1 
ATOM   1560 O O   . SER A 1 198 ? -34.507 27.104 13.553  1.00 19.35 ? 217  SER A O   1 
ATOM   1561 C CB  . SER A 1 198 ? -31.845 28.268 14.264  1.00 18.23 ? 217  SER A CB  1 
ATOM   1562 O OG  . SER A 1 198 ? -31.544 29.090 13.162  1.00 20.07 ? 217  SER A OG  1 
ATOM   1563 N N   . TRP A 1 199 ? -33.408 26.326 11.775  1.00 18.60 ? 218  TRP A N   1 
ATOM   1564 C CA  . TRP A 1 199 ? -34.605 26.186 10.951  1.00 18.08 ? 218  TRP A CA  1 
ATOM   1565 C C   . TRP A 1 199 ? -35.343 24.884 11.287  1.00 20.22 ? 218  TRP A C   1 
ATOM   1566 O O   . TRP A 1 199 ? -36.481 24.689 10.848  1.00 19.26 ? 218  TRP A O   1 
ATOM   1567 C CB  . TRP A 1 199 ? -34.216 26.148 9.469   1.00 18.21 ? 218  TRP A CB  1 
ATOM   1568 C CG  . TRP A 1 199 ? -33.257 25.025 9.147   1.00 19.20 ? 218  TRP A CG  1 
ATOM   1569 C CD1 . TRP A 1 199 ? -33.572 23.720 8.932   1.00 19.90 ? 218  TRP A CD1 1 
ATOM   1570 C CD2 . TRP A 1 199 ? -31.828 25.113 9.046   1.00 18.47 ? 218  TRP A CD2 1 
ATOM   1571 N NE1 . TRP A 1 199 ? -32.433 22.984 8.696   1.00 19.39 ? 218  TRP A NE1 1 
ATOM   1572 C CE2 . TRP A 1 199 ? -31.347 23.810 8.773   1.00 18.46 ? 218  TRP A CE2 1 
ATOM   1573 C CE3 . TRP A 1 199 ? -30.907 26.158 9.172   1.00 18.01 ? 218  TRP A CE3 1 
ATOM   1574 C CZ2 . TRP A 1 199 ? -29.986 23.533 8.597   1.00 18.09 ? 218  TRP A CZ2 1 
ATOM   1575 C CZ3 . TRP A 1 199 ? -29.552 25.875 9.007   1.00 18.23 ? 218  TRP A CZ3 1 
ATOM   1576 C CH2 . TRP A 1 199 ? -29.109 24.576 8.725   1.00 17.88 ? 218  TRP A CH2 1 
ATOM   1577 N N   . GLU A 1 200 ? -34.699 23.988 12.039  1.00 19.45 ? 219  GLU A N   1 
ATOM   1578 C CA  . GLU A 1 200 ? -35.266 22.663 12.259  1.00 20.49 ? 219  GLU A CA  1 
ATOM   1579 C C   . GLU A 1 200 ? -36.446 22.674 13.221  1.00 20.63 ? 219  GLU A C   1 
ATOM   1580 O O   . GLU A 1 200 ? -36.563 23.553 14.081  1.00 20.87 ? 219  GLU A O   1 
ATOM   1581 C CB  . GLU A 1 200 ? -34.193 21.690 12.734  1.00 21.16 ? 219  GLU A CB  1 
ATOM   1582 C CG  . GLU A 1 200 ? -33.229 21.349 11.617  1.00 22.77 ? 219  GLU A CG  1 
ATOM   1583 C CD  . GLU A 1 200 ? -32.007 20.588 12.083  1.00 25.40 ? 219  GLU A CD  1 
ATOM   1584 O OE1 . GLU A 1 200 ? -31.223 21.159 12.868  1.00 28.43 ? 219  GLU A OE1 1 
ATOM   1585 O OE2 . GLU A 1 200 ? -31.813 19.441 11.650  1.00 24.36 ? 219  GLU A OE2 1 
ATOM   1586 N N   . LYS A 1 201 ? -37.333 21.705 13.017  1.00 23.68 ? 220  LYS A N   1 
ATOM   1587 C CA  . LYS A 1 201 ? -38.522 21.507 13.847  1.00 26.04 ? 220  LYS A CA  1 
ATOM   1588 C C   . LYS A 1 201 ? -38.551 20.007 14.150  1.00 24.31 ? 220  LYS A C   1 
ATOM   1589 O O   . LYS A 1 201 ? -38.604 19.209 13.210  1.00 26.96 ? 220  LYS A O   1 
ATOM   1590 C CB  . LYS A 1 201 ? -39.766 21.953 13.060  1.00 30.41 ? 220  LYS A CB  1 
ATOM   1591 C CG  . LYS A 1 201 ? -40.684 22.932 13.789  1.00 35.38 ? 220  LYS A CG  1 
ATOM   1592 C CD  . LYS A 1 201 ? -41.874 22.253 14.463  1.00 37.11 ? 220  LYS A CD  1 
ATOM   1593 C CE  . LYS A 1 201 ? -43.198 22.507 13.737  1.00 38.91 ? 220  LYS A CE  1 
ATOM   1594 N NZ  . LYS A 1 201 ? -43.280 21.958 12.348  1.00 40.03 ? 220  LYS A NZ  1 
ATOM   1595 N N   . PRO A 1 202 ? -38.445 19.607 15.435  1.00 22.14 ? 221  PRO A N   1 
ATOM   1596 C CA  . PRO A 1 202 ? -38.388 20.510 16.580  1.00 21.33 ? 221  PRO A CA  1 
ATOM   1597 C C   . PRO A 1 202 ? -37.086 21.278 16.642  1.00 19.47 ? 221  PRO A C   1 
ATOM   1598 O O   . PRO A 1 202 ? -36.064 20.836 16.095  1.00 19.90 ? 221  PRO A O   1 
ATOM   1599 C CB  . PRO A 1 202 ? -38.507 19.576 17.792  1.00 22.05 ? 221  PRO A CB  1 
ATOM   1600 C CG  . PRO A 1 202 ? -37.949 18.292 17.329  1.00 22.92 ? 221  PRO A CG  1 
ATOM   1601 C CD  . PRO A 1 202 ? -38.180 18.205 15.840  1.00 22.49 ? 221  PRO A CD  1 
ATOM   1602 N N   . LEU A 1 203 ? -37.135 22.418 17.321  1.00 18.09 ? 222  LEU A N   1 
ATOM   1603 C CA  . LEU A 1 203 ? -35.988 23.293 17.374  1.00 16.63 ? 222  LEU A CA  1 
ATOM   1604 C C   . LEU A 1 203 ? -35.073 22.849 18.517  1.00 15.62 ? 222  LEU A C   1 
ATOM   1605 O O   . LEU A 1 203 ? -35.284 23.202 19.694  1.00 14.25 ? 222  LEU A O   1 
ATOM   1606 C CB  . LEU A 1 203 ? -36.436 24.754 17.496  1.00 17.69 ? 222  LEU A CB  1 
ATOM   1607 C CG  . LEU A 1 203 ? -35.364 25.835 17.561  1.00 17.78 ? 222  LEU A CG  1 
ATOM   1608 C CD1 . LEU A 1 203 ? -34.158 25.594 16.658  1.00 18.58 ? 222  LEU A CD1 1 
ATOM   1609 C CD2 . LEU A 1 203 ? -36.019 27.185 17.268  0.50 18.68 ? 222  LEU A CD2 1 
ATOM   1610 N N   . ILE A 1 204 ? -34.059 22.057 18.130  1.00 13.29 ? 223  ILE A N   1 
ATOM   1611 C CA  . ILE A 1 204 ? -33.069 21.522 19.049  1.00 12.85 ? 223  ILE A CA  1 
ATOM   1612 C C   . ILE A 1 204 ? -31.658 21.754 18.506  1.00 12.38 ? 223  ILE A C   1 
ATOM   1613 O O   . ILE A 1 204 ? -31.476 21.933 17.297  1.00 13.05 ? 223  ILE A O   1 
ATOM   1614 C CB  . ILE A 1 204 ? -33.315 20.021 19.323  1.00 13.40 ? 223  ILE A CB  1 
ATOM   1615 C CG1 . ILE A 1 204 ? -33.148 19.175 18.051  1.00 13.50 ? 223  ILE A CG1 1 
ATOM   1616 C CG2 . ILE A 1 204 ? -34.697 19.850 19.927  1.00 13.67 ? 223  ILE A CG2 1 
ATOM   1617 C CD1 . ILE A 1 204 ? -33.411 17.693 18.289  1.00 13.70 ? 223  ILE A CD1 1 
ATOM   1618 N N   . THR A 1 205 ? -30.672 21.777 19.392  1.00 11.84 ? 224  THR A N   1 
ATOM   1619 C CA  . THR A 1 205 ? -29.304 21.990 18.954  1.00 11.43 ? 224  THR A CA  1 
ATOM   1620 C C   . THR A 1 205 ? -28.845 20.779 18.162  1.00 11.67 ? 224  THR A C   1 
ATOM   1621 O O   . THR A 1 205 ? -29.270 19.657 18.413  1.00 12.09 ? 224  THR A O   1 
ATOM   1622 C CB  . THR A 1 205 ? -28.328 22.139 20.118  1.00 11.36 ? 224  THR A CB  1 
ATOM   1623 O OG1 . THR A 1 205 ? -28.366 20.937 20.905  1.00 10.92 ? 224  THR A OG1 1 
ATOM   1624 C CG2 . THR A 1 205 ? -28.664 23.342 20.963  1.00 11.56 ? 224  THR A CG2 1 
ATOM   1625 N N   . GLY A 1 206 ? -27.971 21.029 17.201  1.00 11.54 ? 225  GLY A N   1 
ATOM   1626 C CA  . GLY A 1 206 ? -27.371 19.970 16.394  1.00 11.74 ? 225  GLY A CA  1 
ATOM   1627 C C   . GLY A 1 206 ? -26.233 20.609 15.638  1.00 11.64 ? 225  GLY A C   1 
ATOM   1628 O O   . GLY A 1 206 ? -26.248 21.818 15.397  1.00 10.85 ? 225  GLY A O   1 
ATOM   1629 N N   . HIS A 1 207 ? -25.273 19.801 15.219  1.00 11.01 ? 226  HIS A N   1 
ATOM   1630 C CA  . HIS A 1 207 ? -24.075 20.313 14.560  1.00 10.66 ? 226  HIS A CA  1 
ATOM   1631 C C   . HIS A 1 207 ? -24.267 20.556 13.040  1.00 11.12 ? 226  HIS A C   1 
ATOM   1632 O O   . HIS A 1 207 ? -24.797 19.710 12.318  1.00 12.13 ? 226  HIS A O   1 
ATOM   1633 C CB  . HIS A 1 207 ? -22.921 19.324 14.789  1.00 10.31 ? 226  HIS A CB  1 
ATOM   1634 C CG  . HIS A 1 207 ? -21.574 19.926 14.589  1.00 9.59  ? 226  HIS A CG  1 
ATOM   1635 N ND1 . HIS A 1 207 ? -21.033 20.125 13.342  1.00 9.56  ? 226  HIS A ND1 1 
ATOM   1636 C CD2 . HIS A 1 207 ? -20.691 20.437 15.467  1.00 9.24  ? 226  HIS A CD2 1 
ATOM   1637 C CE1 . HIS A 1 207 ? -19.839 20.674 13.465  1.00 9.67  ? 226  HIS A CE1 1 
ATOM   1638 N NE2 . HIS A 1 207 ? -19.600 20.847 14.755  1.00 9.42  ? 226  HIS A NE2 1 
ATOM   1639 N N   . ASN A 1 208 ? -23.744 21.671 12.579  1.00 10.62 ? 227  ASN A N   1 
ATOM   1640 C CA  . ASN A 1 208 ? -23.756 22.064 11.152  1.00 11.02 ? 227  ASN A CA  1 
ATOM   1641 C C   . ASN A 1 208 ? -23.211 20.976 10.218  1.00 10.70 ? 227  ASN A C   1 
ATOM   1642 O O   . ASN A 1 208 ? -23.726 20.736 9.110   1.00 10.67 ? 227  ASN A O   1 
ATOM   1643 C CB  . ASN A 1 208 ? -22.920 23.332 11.011  1.00 11.43 ? 227  ASN A CB  1 
ATOM   1644 C CG  . ASN A 1 208 ? -22.765 23.786 9.567   1.00 11.41 ? 227  ASN A CG  1 
ATOM   1645 O OD1 . ASN A 1 208 ? -23.739 23.844 8.808   1.00 12.22 ? 227  ASN A OD1 1 
ATOM   1646 N ND2 . ASN A 1 208 ? -21.554 24.148 9.205   1.00 11.49 ? 227  ASN A ND2 1 
ATOM   1647 N N   . SER A 1 209 ? -22.134 20.315 10.655  1.00 10.14 ? 228  SER A N   1 
ATOM   1648 C CA  . SER A 1 209 ? -21.349 19.461 9.761   1.00 9.66  ? 228  SER A CA  1 
ATOM   1649 C C   . SER A 1 209 ? -20.643 18.287 10.488  1.00 9.69  ? 228  SER A C   1 
ATOM   1650 O O   . SER A 1 209 ? -19.414 18.178 10.479  1.00 9.76  ? 228  SER A O   1 
ATOM   1651 C CB  . SER A 1 209 ? -20.330 20.308 9.025   1.00 9.78  ? 228  SER A CB  1 
ATOM   1652 O OG  . SER A 1 209 ? -19.797 19.609 7.908   1.00 10.23 ? 228  SER A OG  1 
ATOM   1653 N N   . PRO A 1 210 ? -21.432 17.425 11.124  1.00 10.02 ? 229  PRO A N   1 
ATOM   1654 C CA  . PRO A 1 210 ? -20.840 16.282 11.807  1.00 10.06 ? 229  PRO A CA  1 
ATOM   1655 C C   . PRO A 1 210 ? -20.244 15.300 10.799  1.00 10.60 ? 229  PRO A C   1 
ATOM   1656 O O   . PRO A 1 210 ? -20.867 15.003 9.782   1.00 10.96 ? 229  PRO A O   1 
ATOM   1657 C CB  . PRO A 1 210 ? -22.025 15.675 12.541  1.00 10.07 ? 229  PRO A CB  1 
ATOM   1658 C CG  . PRO A 1 210 ? -23.244 16.022 11.711  1.00 10.04 ? 229  PRO A CG  1 
ATOM   1659 C CD  . PRO A 1 210 ? -22.910 17.382 11.129  1.00 9.66  ? 229  PRO A CD  1 
ATOM   1660 N N   . LEU A 1 211 ? -19.036 14.826 11.071  1.00 10.08 ? 230  LEU A N   1 
ATOM   1661 C CA  . LEU A 1 211 ? -18.455 13.777 10.258  1.00 10.21 ? 230  LEU A CA  1 
ATOM   1662 C C   . LEU A 1 211 ? -19.260 12.488 10.333  1.00 10.94 ? 230  LEU A C   1 
ATOM   1663 O O   . LEU A 1 211 ? -19.491 11.837 9.318   1.00 11.18 ? 230  LEU A O   1 
ATOM   1664 C CB  . LEU A 1 211 ? -17.005 13.516 10.664  1.00 10.08 ? 230  LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 211 ? -16.229 12.504 9.851   1.00 9.94  ? 230  LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 211 ? -16.294 12.789 8.349   1.00 9.94  ? 230  LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 211 ? -14.786 12.488 10.335  1.00 10.23 ? 230  LEU A CD2 1 
ATOM   1668 N N   . SER A 1 212 ? -19.655 12.115 11.538  1.00 11.29 ? 231  SER A N   1 
ATOM   1669 C CA  . SER A 1 212 ? -20.332 10.813 11.762  1.00 12.06 ? 231  SER A CA  1 
ATOM   1670 C C   . SER A 1 212 ? -21.636 10.976 12.531  1.00 12.16 ? 231  SER A C   1 
ATOM   1671 O O   . SER A 1 212 ? -21.949 12.055 13.042  1.00 10.36 ? 231  SER A O   1 
ATOM   1672 C CB  . SER A 1 212 ? -19.380 9.786  12.397  1.00 12.86 ? 231  SER A CB  1 
ATOM   1673 O OG  . SER A 1 212 ? -18.631 10.336 13.456  1.00 14.53 ? 231  SER A OG  1 
ATOM   1674 N N   . LYS A 1 213 ? -22.421 9.902  12.598  1.00 12.54 ? 232  LYS A N   1 
ATOM   1675 C CA  . LYS A 1 213 ? -23.730 10.010 13.206  1.00 13.93 ? 232  LYS A CA  1 
ATOM   1676 C C   . LYS A 1 213 ? -23.637 10.229 14.697  1.00 13.26 ? 232  LYS A C   1 
ATOM   1677 O O   . LYS A 1 213 ? -22.674 9.808  15.341  1.00 13.80 ? 232  LYS A O   1 
ATOM   1678 C CB  . LYS A 1 213 ? -24.652 8.821  12.883  1.00 16.38 ? 232  LYS A CB  1 
ATOM   1679 C CG  . LYS A 1 213 ? -24.545 7.623  13.783  1.00 17.50 ? 232  LYS A CG  1 
ATOM   1680 C CD  . LYS A 1 213 ? -25.692 6.654  13.565  1.00 17.73 ? 232  LYS A CD  1 
ATOM   1681 C CE  . LYS A 1 213 ? -25.833 5.677  14.735  1.00 17.54 ? 232  LYS A CE  1 
ATOM   1682 N NZ  . LYS A 1 213 ? -26.463 6.293  15.934  1.00 17.46 ? 232  LYS A NZ  1 
ATOM   1683 N N   . GLY A 1 214 ? -24.666 10.852 15.228  1.00 13.08 ? 233  GLY A N   1 
ATOM   1684 C CA  . GLY A 1 214 ? -24.798 11.047 16.655  1.00 12.94 ? 233  GLY A CA  1 
ATOM   1685 C C   . GLY A 1 214 ? -25.305 9.800  17.337  1.00 12.70 ? 233  GLY A C   1 
ATOM   1686 O O   . GLY A 1 214 ? -26.004 8.955  16.722  1.00 13.24 ? 233  GLY A O   1 
ATOM   1687 N N   . TRP A 1 215 ? -24.984 9.682  18.625  1.00 12.70 ? 234  TRP A N   1 
ATOM   1688 C CA  . TRP A 1 215 ? -25.446 8.537  19.387  1.00 13.02 ? 234  TRP A CA  1 
ATOM   1689 C C   . TRP A 1 215 ? -26.978 8.488  19.466  1.00 13.64 ? 234  TRP A C   1 
ATOM   1690 O O   . TRP A 1 215 ? -27.557 7.413  19.584  1.00 13.67 ? 234  TRP A O   1 
ATOM   1691 C CB  . TRP A 1 215 ? -24.814 8.492  20.775  1.00 12.72 ? 234  TRP A CB  1 
ATOM   1692 C CG  . TRP A 1 215 ? -25.307 9.528  21.729  1.00 13.27 ? 234  TRP A CG  1 
ATOM   1693 C CD1 . TRP A 1 215 ? -24.860 10.787 21.841  1.00 12.53 ? 234  TRP A CD1 1 
ATOM   1694 C CD2 . TRP A 1 215 ? -26.302 9.364  22.739  1.00 13.50 ? 234  TRP A CD2 1 
ATOM   1695 N NE1 . TRP A 1 215 ? -25.535 11.460 22.829  1.00 13.55 ? 234  TRP A NE1 1 
ATOM   1696 C CE2 . TRP A 1 215 ? -26.414 10.598 23.417  1.00 13.91 ? 234  TRP A CE2 1 
ATOM   1697 C CE3 . TRP A 1 215 ? -27.117 8.293  23.136  1.00 14.46 ? 234  TRP A CE3 1 
ATOM   1698 C CZ2 . TRP A 1 215 ? -27.321 10.809 24.459  1.00 14.40 ? 234  TRP A CZ2 1 
ATOM   1699 C CZ3 . TRP A 1 215 ? -27.987 8.495  24.195  1.00 15.18 ? 234  TRP A CZ3 1 
ATOM   1700 C CH2 . TRP A 1 215 ? -28.089 9.737  24.831  1.00 15.49 ? 234  TRP A CH2 1 
ATOM   1701 N N   . GLN A 1 216 ? -27.620 9.638  19.343  1.00 13.75 ? 235  GLN A N   1 
ATOM   1702 C CA  . GLN A 1 216 ? -29.066 9.717  19.416  1.00 14.76 ? 235  GLN A CA  1 
ATOM   1703 C C   . GLN A 1 216 ? -29.737 9.512  18.059  1.00 15.91 ? 235  GLN A C   1 
ATOM   1704 O O   . GLN A 1 216 ? -30.964 9.428  17.984  1.00 15.64 ? 235  GLN A O   1 
ATOM   1705 C CB  . GLN A 1 216 ? -29.459 11.066 19.994  1.00 15.41 ? 235  GLN A CB  1 
ATOM   1706 C CG  . GLN A 1 216 ? -28.913 11.266 21.392  1.00 15.86 ? 235  GLN A CG  1 
ATOM   1707 C CD  . GLN A 1 216 ? -29.151 12.654 21.907  1.00 16.74 ? 235  GLN A CD  1 
ATOM   1708 O OE1 . GLN A 1 216 ? -30.111 12.906 22.665  1.00 18.60 ? 235  GLN A OE1 1 
ATOM   1709 N NE2 . GLN A 1 216 ? -28.284 13.566 21.520  1.00 16.17 ? 235  GLN A NE2 1 
ATOM   1710 N N   . ASP A 1 217 ? -28.946 9.441  16.998  1.00 15.91 ? 236  ASP A N   1 
ATOM   1711 C CA  . ASP A 1 217 ? -29.495 9.280  15.649  1.00 16.05 ? 236  ASP A CA  1 
ATOM   1712 C C   . ASP A 1 217 ? -29.892 7.838  15.380  1.00 18.05 ? 236  ASP A C   1 
ATOM   1713 O O   . ASP A 1 217 ? -29.095 6.926  15.611  1.00 17.35 ? 236  ASP A O   1 
ATOM   1714 C CB  . ASP A 1 217 ? -28.505 9.762  14.600  1.00 15.91 ? 236  ASP A CB  1 
ATOM   1715 C CG  . ASP A 1 217 ? -28.257 11.263 14.682  1.00 14.46 ? 236  ASP A CG  1 
ATOM   1716 O OD1 . ASP A 1 217 ? -29.140 11.950 15.186  1.00 16.97 ? 236  ASP A OD1 1 
ATOM   1717 O OD2 . ASP A 1 217 ? -27.208 11.764 14.255  1.00 14.85 ? 236  ASP A OD2 1 
ATOM   1718 N N   . ARG A 1 218 ? -31.130 7.649  14.909  1.00 19.60 ? 237  ARG A N   1 
ATOM   1719 C CA  . ARG A 1 218 ? -31.573 6.362  14.367  1.00 21.18 ? 237  ARG A CA  1 
ATOM   1720 C C   . ARG A 1 218 ? -32.438 6.586  13.139  1.00 21.62 ? 237  ARG A C   1 
ATOM   1721 O O   . ARG A 1 218 ? -32.969 7.657  12.939  1.00 20.59 ? 237  ARG A O   1 
ATOM   1722 C CB  . ARG A 1 218 ? -32.335 5.531  15.405  1.00 23.23 ? 237  ARG A CB  1 
ATOM   1723 C CG  . ARG A 1 218 ? -33.682 6.066  15.868  1.00 26.68 ? 237  ARG A CG  1 
ATOM   1724 C CD  . ARG A 1 218 ? -34.351 5.042  16.789  1.00 29.66 ? 237  ARG A CD  1 
ATOM   1725 N NE  . ARG A 1 218 ? -35.693 5.392  17.280  1.00 33.82 ? 237  ARG A NE  1 
ATOM   1726 C CZ  . ARG A 1 218 ? -35.970 6.370  18.143  0.70 37.54 ? 237  ARG A CZ  1 
ATOM   1727 N NH1 . ARG A 1 218 ? -35.019 7.185  18.610  1.00 38.15 ? 237  ARG A NH1 1 
ATOM   1728 N NH2 . ARG A 1 218 ? -37.230 6.559  18.523  1.00 39.78 ? 237  ARG A NH2 1 
ATOM   1729 N N   . GLY A 1 219 ? -32.571 5.552  12.318  1.00 24.12 ? 238  GLY A N   1 
ATOM   1730 C CA  . GLY A 1 219 ? -33.433 5.643  11.158  1.00 24.89 ? 238  GLY A CA  1 
ATOM   1731 C C   . GLY A 1 219 ? -32.944 6.743  10.234  1.00 25.04 ? 238  GLY A C   1 
ATOM   1732 O O   . GLY A 1 219 ? -31.728 6.870  10.023  1.00 22.85 ? 238  GLY A O   1 
ATOM   1733 N N   . PRO A 1 220 ? -33.880 7.543  9.691   1.00 27.17 ? 239  PRO A N   1 
ATOM   1734 C CA  . PRO A 1 220 ? -33.538 8.630  8.760   1.00 25.90 ? 239  PRO A CA  1 
ATOM   1735 C C   . PRO A 1 220 ? -32.546 9.675  9.297   1.00 23.79 ? 239  PRO A C   1 
ATOM   1736 O O   . PRO A 1 220 ? -31.732 10.211 8.530   1.00 21.74 ? 239  PRO A O   1 
ATOM   1737 C CB  . PRO A 1 220 ? -34.903 9.249  8.389   1.00 28.61 ? 239  PRO A CB  1 
ATOM   1738 C CG  . PRO A 1 220 ? -35.943 8.479  9.133   1.00 28.36 ? 239  PRO A CG  1 
ATOM   1739 C CD  . PRO A 1 220 ? -35.325 7.237  9.678   1.00 27.68 ? 239  PRO A CD  1 
ATOM   1740 N N   . SER A 1 221 ? -32.553 9.922  10.605  1.00 23.07 ? 240  SER A N   1 
ATOM   1741 C CA  . SER A 1 221 ? -31.616 10.890 11.169  1.00 22.58 ? 240  SER A CA  1 
ATOM   1742 C C   . SER A 1 221 ? -30.152 10.445 11.027  1.00 20.01 ? 240  SER A C   1 
ATOM   1743 O O   . SER A 1 221 ? -29.242 11.295 11.039  1.00 19.70 ? 240  SER A O   1 
ATOM   1744 C CB  . SER A 1 221 ? -31.969 11.250 12.621  1.00 23.89 ? 240  SER A CB  1 
ATOM   1745 O OG  . SER A 1 221 ? -31.871 10.142 13.473  1.00 27.27 ? 240  SER A OG  1 
ATOM   1746 N N   . SER A 1 222 ? -29.936 9.152  10.813  1.00 18.58 ? 241  SER A N   1 
ATOM   1747 C CA  . SER A 1 222 ? -28.588 8.625  10.596  1.00 19.14 ? 241  SER A CA  1 
ATOM   1748 C C   . SER A 1 222 ? -27.944 8.982  9.254   1.00 18.52 ? 241  SER A C   1 
ATOM   1749 O O   . SER A 1 222 ? -26.761 8.722  9.060   1.00 18.70 ? 241  SER A O   1 
ATOM   1750 C CB  . SER A 1 222 ? -28.576 7.121  10.772  1.00 20.86 ? 241  SER A CB  1 
ATOM   1751 O OG  . SER A 1 222 ? -29.024 6.815  12.082  1.00 23.40 ? 241  SER A OG  1 
ATOM   1752 N N   . TYR A 1 223 ? -28.717 9.565  8.343   1.00 18.00 ? 242  TYR A N   1 
ATOM   1753 C CA  . TYR A 1 223 ? -28.194 10.089 7.080   1.00 18.52 ? 242  TYR A CA  1 
ATOM   1754 C C   . TYR A 1 223 ? -27.520 11.452 7.215   1.00 16.64 ? 242  TYR A C   1 
ATOM   1755 O O   . TYR A 1 223 ? -26.768 11.836 6.312   1.00 17.02 ? 242  TYR A O   1 
ATOM   1756 C CB  . TYR A 1 223 ? -29.328 10.293 6.060   1.00 19.72 ? 242  TYR A CB  1 
ATOM   1757 C CG  . TYR A 1 223 ? -30.278 9.148  5.866   1.00 22.02 ? 242  TYR A CG  1 
ATOM   1758 C CD1 . TYR A 1 223 ? -29.859 7.836  5.964   1.00 23.50 ? 242  TYR A CD1 1 
ATOM   1759 C CD2 . TYR A 1 223 ? -31.598 9.395  5.509   1.00 23.61 ? 242  TYR A CD2 1 
ATOM   1760 C CE1 . TYR A 1 223 ? -30.751 6.784  5.764   1.00 25.65 ? 242  TYR A CE1 1 
ATOM   1761 C CE2 . TYR A 1 223 ? -32.486 8.364  5.298   1.00 25.81 ? 242  TYR A CE2 1 
ATOM   1762 C CZ  . TYR A 1 223 ? -32.055 7.066  5.427   1.00 25.08 ? 242  TYR A CZ  1 
ATOM   1763 O OH  . TYR A 1 223 ? -32.973 6.068  5.217   1.00 27.70 ? 242  TYR A OH  1 
ATOM   1764 N N   . TYR A 1 224 ? -27.791 12.174 8.301   1.00 16.45 ? 243  TYR A N   1 
ATOM   1765 C CA  . TYR A 1 224 ? -27.429 13.616 8.417   1.00 17.28 ? 243  TYR A CA  1 
ATOM   1766 C C   . TYR A 1 224 ? -25.993 13.823 8.902   1.00 15.66 ? 243  TYR A C   1 
ATOM   1767 O O   . TYR A 1 224 ? -25.737 14.400 9.984   1.00 15.84 ? 243  TYR A O   1 
ATOM   1768 C CB  . TYR A 1 224 ? -28.397 14.359 9.351   1.00 18.76 ? 243  TYR A CB  1 
ATOM   1769 C CG  . TYR A 1 224 ? -29.870 14.029 9.182   0.50 19.47 ? 243  TYR A CG  1 
ATOM   1770 C CD1 . TYR A 1 224 ? -30.366 13.519 7.994   0.50 19.96 ? 243  TYR A CD1 1 
ATOM   1771 C CD2 . TYR A 1 224 ? -30.762 14.265 10.213  0.50 20.62 ? 243  TYR A CD2 1 
ATOM   1772 C CE1 . TYR A 1 224 ? -31.707 13.233 7.844   0.50 20.59 ? 243  TYR A CE1 1 
ATOM   1773 C CE2 . TYR A 1 224 ? -32.103 13.991 10.072  0.50 20.65 ? 243  TYR A CE2 1 
ATOM   1774 C CZ  . TYR A 1 224 ? -32.570 13.464 8.887   0.50 20.98 ? 243  TYR A CZ  1 
ATOM   1775 O OH  . TYR A 1 224 ? -33.920 13.174 8.759   0.50 21.45 ? 243  TYR A OH  1 
ATOM   1776 N N   . ASN A 1 225 ? -25.055 13.312 8.129   1.00 13.50 ? 244  ASN A N   1 
ATOM   1777 C CA  . ASN A 1 225 ? -23.654 13.486 8.405   1.00 12.40 ? 244  ASN A CA  1 
ATOM   1778 C C   . ASN A 1 225 ? -22.830 13.273 7.141   1.00 11.92 ? 244  ASN A C   1 
ATOM   1779 O O   . ASN A 1 225 ? -23.297 12.733 6.134   1.00 11.57 ? 244  ASN A O   1 
ATOM   1780 C CB  . ASN A 1 225 ? -23.189 12.548 9.523   1.00 11.85 ? 244  ASN A CB  1 
ATOM   1781 C CG  . ASN A 1 225 ? -23.412 11.094 9.193   1.00 12.38 ? 244  ASN A CG  1 
ATOM   1782 O OD1 . ASN A 1 225 ? -22.613 10.490 8.482   1.00 12.38 ? 244  ASN A OD1 1 
ATOM   1783 N ND2 . ASN A 1 225 ? -24.521 10.526 9.694   1.00 12.30 ? 244  ASN A ND2 1 
ATOM   1784 N N   . VAL A 1 226 ? -21.590 13.688 7.233   1.00 11.79 ? 245  VAL A N   1 
ATOM   1785 C CA  . VAL A 1 226 ? -20.717 13.765 6.096   1.00 12.36 ? 245  VAL A CA  1 
ATOM   1786 C C   . VAL A 1 226 ? -20.392 12.368 5.572   1.00 12.41 ? 245  VAL A C   1 
ATOM   1787 O O   . VAL A 1 226 ? -20.379 12.136 4.360   1.00 11.85 ? 245  VAL A O   1 
ATOM   1788 C CB  . VAL A 1 226 ? -19.398 14.498 6.441   1.00 12.71 ? 245  VAL A CB  1 
ATOM   1789 C CG1 . VAL A 1 226 ? -18.456 14.460 5.275   1.00 13.10 ? 245  VAL A CG1 1 
ATOM   1790 C CG2 . VAL A 1 226 ? -19.630 15.951 6.858   1.00 12.80 ? 245  VAL A CG2 1 
ATOM   1791 N N   . GLU A 1 227 ? -20.069 11.454 6.483   1.00 12.70 ? 246  GLU A N   1 
ATOM   1792 C CA  . GLU A 1 227 ? -19.735 10.092 6.062   1.00 13.74 ? 246  GLU A CA  1 
ATOM   1793 C C   . GLU A 1 227 ? -20.849 9.464  5.258   1.00 13.37 ? 246  GLU A C   1 
ATOM   1794 O O   . GLU A 1 227 ? -20.584 8.868  4.212   1.00 12.97 ? 246  GLU A O   1 
ATOM   1795 C CB  . GLU A 1 227 ? -19.399 9.213  7.267   1.00 16.14 ? 246  GLU A CB  1 
ATOM   1796 C CG  . GLU A 1 227 ? -18.027 9.531  7.832   1.00 18.51 ? 246  GLU A CG  1 
ATOM   1797 C CD  . GLU A 1 227 ? -17.646 8.665  9.028   1.00 22.03 ? 246  GLU A CD  1 
ATOM   1798 O OE1 . GLU A 1 227 ? -18.464 7.828  9.483   1.00 25.09 ? 246  GLU A OE1 1 
ATOM   1799 O OE2 . GLU A 1 227 ? -16.512 8.843  9.527   1.00 25.67 ? 246  GLU A OE2 1 
ATOM   1800 N N   . TYR A 1 228 ? -22.080 9.584  5.752   1.00 12.71 ? 247  TYR A N   1 
ATOM   1801 C CA  . TYR A 1 228 ? -23.228 9.022  5.060   1.00 13.26 ? 247  TYR A CA  1 
ATOM   1802 C C   . TYR A 1 228 ? -23.356 9.663  3.673   1.00 12.68 ? 247  TYR A C   1 
ATOM   1803 O O   . TYR A 1 228 ? -23.530 8.982  2.684   1.00 12.57 ? 247  TYR A O   1 
ATOM   1804 C CB  . TYR A 1 228 ? -24.532 9.187  5.845   1.00 14.09 ? 247  TYR A CB  1 
ATOM   1805 C CG  . TYR A 1 228 ? -25.609 8.362  5.174   1.00 15.66 ? 247  TYR A CG  1 
ATOM   1806 C CD1 . TYR A 1 228 ? -25.780 7.023  5.505   1.00 17.29 ? 247  TYR A CD1 1 
ATOM   1807 C CD2 . TYR A 1 228 ? -26.337 8.871  4.103   1.00 16.97 ? 247  TYR A CD2 1 
ATOM   1808 C CE1 . TYR A 1 228 ? -26.709 6.241  4.852   1.00 17.86 ? 247  TYR A CE1 1 
ATOM   1809 C CE2 . TYR A 1 228 ? -27.283 8.084  3.444   1.00 17.31 ? 247  TYR A CE2 1 
ATOM   1810 C CZ  . TYR A 1 228 ? -27.464 6.781  3.835   1.00 18.88 ? 247  TYR A CZ  1 
ATOM   1811 O OH  . TYR A 1 228 ? -28.395 5.990  3.195   1.00 20.92 ? 247  TYR A OH  1 
ATOM   1812 N N   . ALA A 1 229 ? -23.252 10.985 3.608   1.00 11.67 ? 248  ALA A N   1 
ATOM   1813 C CA  . ALA A 1 229 ? -23.454 11.683 2.352   1.00 11.36 ? 248  ALA A CA  1 
ATOM   1814 C C   . ALA A 1 229 ? -22.472 11.232 1.288   1.00 11.22 ? 248  ALA A C   1 
ATOM   1815 O O   . ALA A 1 229 ? -22.848 11.009 0.127   1.00 10.94 ? 248  ALA A O   1 
ATOM   1816 C CB  . ALA A 1 229 ? -23.329 13.185 2.567   1.00 11.27 ? 248  ALA A CB  1 
ATOM   1817 N N   . VAL A 1 230 ? -21.201 11.150 1.669   1.00 11.21 ? 249  VAL A N   1 
ATOM   1818 C CA  . VAL A 1 230 ? -20.141 10.731 0.773   1.00 11.56 ? 249  VAL A CA  1 
ATOM   1819 C C   . VAL A 1 230 ? -20.416 9.305  0.312   1.00 12.07 ? 249  VAL A C   1 
ATOM   1820 O O   . VAL A 1 230 ? -20.291 9.018  -0.864  1.00 11.38 ? 249  VAL A O   1 
ATOM   1821 C CB  . VAL A 1 230 ? -18.773 10.778 1.469   1.00 11.70 ? 249  VAL A CB  1 
ATOM   1822 C CG1 . VAL A 1 230 ? -17.712 9.987  0.716   1.00 12.49 ? 249  VAL A CG1 1 
ATOM   1823 C CG2 . VAL A 1 230 ? -18.331 12.220 1.675   1.00 11.27 ? 249  VAL A CG2 1 
ATOM   1824 N N   . GLY A 1 231 ? -20.782 8.434  1.249   1.00 12.63 ? 250  GLY A N   1 
ATOM   1825 C CA  . GLY A 1 231 ? -21.065 7.029  0.894   1.00 13.21 ? 250  GLY A CA  1 
ATOM   1826 C C   . GLY A 1 231 ? -22.244 6.921  -0.053  1.00 13.96 ? 250  GLY A C   1 
ATOM   1827 O O   . GLY A 1 231 ? -22.236 6.105  -0.980  1.00 14.60 ? 250  GLY A O   1 
ATOM   1828 N N   . TYR A 1 232 ? -23.243 7.774  0.162   1.00 14.15 ? 251  TYR A N   1 
ATOM   1829 C CA  . TYR A 1 232 ? -24.431 7.737  -0.646  1.00 14.33 ? 251  TYR A CA  1 
ATOM   1830 C C   . TYR A 1 232 ? -24.158 8.175  -2.096  1.00 13.63 ? 251  TYR A C   1 
ATOM   1831 O O   . TYR A 1 232 ? -24.604 7.524  -3.043  1.00 14.34 ? 251  TYR A O   1 
ATOM   1832 C CB  . TYR A 1 232 ? -25.527 8.560  -0.007  1.00 15.04 ? 251  TYR A CB  1 
ATOM   1833 C CG  . TYR A 1 232 ? -26.871 8.165  -0.549  1.00 15.88 ? 251  TYR A CG  1 
ATOM   1834 C CD1 . TYR A 1 232 ? -27.384 6.911  -0.288  1.00 16.61 ? 251  TYR A CD1 1 
ATOM   1835 C CD2 . TYR A 1 232 ? -27.609 9.023  -1.341  1.00 16.77 ? 251  TYR A CD2 1 
ATOM   1836 C CE1 . TYR A 1 232 ? -28.608 6.518  -0.767  1.00 17.68 ? 251  TYR A CE1 1 
ATOM   1837 C CE2 . TYR A 1 232 ? -28.857 8.644  -1.824  1.00 18.19 ? 251  TYR A CE2 1 
ATOM   1838 C CZ  . TYR A 1 232 ? -29.349 7.381  -1.548  1.00 18.53 ? 251  TYR A CZ  1 
ATOM   1839 O OH  . TYR A 1 232 ? -30.588 6.937  -2.025  1.00 19.63 ? 251  TYR A OH  1 
ATOM   1840 N N   . TRP A 1 233 ? -23.408 9.267  -2.268  1.00 12.94 ? 252  TRP A N   1 
ATOM   1841 C CA  . TRP A 1 233 ? -23.025 9.707  -3.612  1.00 12.77 ? 252  TRP A CA  1 
ATOM   1842 C C   . TRP A 1 233 ? -22.257 8.624  -4.374  1.00 13.30 ? 252  TRP A C   1 
ATOM   1843 O O   . TRP A 1 233 ? -22.474 8.400  -5.576  1.00 13.00 ? 252  TRP A O   1 
ATOM   1844 C CB  . TRP A 1 233 ? -22.230 11.006 -3.566  1.00 12.82 ? 252  TRP A CB  1 
ATOM   1845 C CG  . TRP A 1 233 ? -23.121 12.184 -3.590  1.00 11.93 ? 252  TRP A CG  1 
ATOM   1846 C CD1 . TRP A 1 233 ? -23.590 12.907 -2.527  1.00 12.14 ? 252  TRP A CD1 1 
ATOM   1847 C CD2 . TRP A 1 233 ? -23.712 12.769 -4.756  1.00 11.29 ? 252  TRP A CD2 1 
ATOM   1848 N NE1 . TRP A 1 233 ? -24.395 13.925 -2.958  1.00 11.35 ? 252  TRP A NE1 1 
ATOM   1849 C CE2 . TRP A 1 233 ? -24.504 13.857 -4.321  1.00 11.65 ? 252  TRP A CE2 1 
ATOM   1850 C CE3 . TRP A 1 233 ? -23.642 12.481 -6.123  1.00 11.87 ? 252  TRP A CE3 1 
ATOM   1851 C CZ2 . TRP A 1 233 ? -25.233 14.660 -5.205  1.00 11.66 ? 252  TRP A CZ2 1 
ATOM   1852 C CZ3 . TRP A 1 233 ? -24.366 13.294 -7.016  1.00 11.83 ? 252  TRP A CZ3 1 
ATOM   1853 C CH2 . TRP A 1 233 ? -25.146 14.371 -6.544  1.00 11.56 ? 252  TRP A CH2 1 
ATOM   1854 N N   . ILE A 1 234 ? -21.363 7.952  -3.676  1.00 12.67 ? 253  ILE A N   1 
ATOM   1855 C CA  . ILE A 1 234 ? -20.602 6.893  -4.292  1.00 13.64 ? 253  ILE A CA  1 
ATOM   1856 C C   . ILE A 1 234 ? -21.523 5.722  -4.648  1.00 14.77 ? 253  ILE A C   1 
ATOM   1857 O O   . ILE A 1 234 ? -21.452 5.212  -5.772  1.00 14.96 ? 253  ILE A O   1 
ATOM   1858 C CB  . ILE A 1 234 ? -19.489 6.451  -3.363  1.00 13.58 ? 253  ILE A CB  1 
ATOM   1859 C CG1 . ILE A 1 234 ? -18.428 7.550  -3.331  1.00 13.25 ? 253  ILE A CG1 1 
ATOM   1860 C CG2 . ILE A 1 234 ? -18.933 5.102  -3.835  1.00 13.78 ? 253  ILE A CG2 1 
ATOM   1861 C CD1 . ILE A 1 234 ? -17.420 7.381  -2.225  1.00 13.68 ? 253  ILE A CD1 1 
ATOM   1862 N N   . HIS A 1 235 ? -22.386 5.345  -3.714  1.00 15.34 ? 254  HIS A N   1 
ATOM   1863 C CA  . HIS A 1 235 ? -23.394 4.293  -3.928  1.00 18.04 ? 254  HIS A CA  1 
ATOM   1864 C C   . HIS A 1 235 ? -24.224 4.582  -5.172  1.00 17.80 ? 254  HIS A C   1 
ATOM   1865 O O   . HIS A 1 235 ? -24.507 3.666  -5.965  1.00 18.82 ? 254  HIS A O   1 
ATOM   1866 C CB  . HIS A 1 235 ? -24.305 4.174  -2.707  1.00 19.97 ? 254  HIS A CB  1 
ATOM   1867 C CG  . HIS A 1 235 ? -25.460 3.248  -2.892  1.00 22.19 ? 254  HIS A CG  1 
ATOM   1868 N ND1 . HIS A 1 235 ? -25.307 1.884  -3.022  1.00 24.64 ? 254  HIS A ND1 1 
ATOM   1869 C CD2 . HIS A 1 235 ? -26.792 3.485  -2.937  1.00 23.54 ? 254  HIS A CD2 1 
ATOM   1870 C CE1 . HIS A 1 235 ? -26.496 1.321  -3.145  1.00 25.33 ? 254  HIS A CE1 1 
ATOM   1871 N NE2 . HIS A 1 235 ? -27.415 2.268  -3.091  1.00 25.72 ? 254  HIS A NE2 1 
ATOM   1872 N N   . LYS A 1 236 ? -24.601 5.843  -5.357  1.00 16.54 ? 255  LYS A N   1 
ATOM   1873 C CA  . LYS A 1 236 ? -25.460 6.229  -6.472  1.00 16.75 ? 255  LYS A CA  1 
ATOM   1874 C C   . LYS A 1 236 ? -24.742 6.275  -7.815  1.00 15.32 ? 255  LYS A C   1 
ATOM   1875 O O   . LYS A 1 236 ? -25.399 6.472  -8.822  1.00 16.00 ? 255  LYS A O   1 
ATOM   1876 C CB  . LYS A 1 236 ? -26.125 7.594  -6.206  1.00 17.44 ? 255  LYS A CB  1 
ATOM   1877 C CG  . LYS A 1 236 ? -27.117 7.579  -5.047  1.00 18.94 ? 255  LYS A CG  1 
ATOM   1878 C CD  . LYS A 1 236 ? -28.488 7.060  -5.451  1.00 20.48 ? 255  LYS A CD  1 
ATOM   1879 C CE  . LYS A 1 236 ? -29.474 8.192  -5.481  1.00 21.40 ? 255  LYS A CE  1 
ATOM   1880 N NZ  . LYS A 1 236 ? -30.778 7.952  -6.154  1.00 21.81 ? 255  LYS A NZ  1 
ATOM   1881 N N   . GLY A 1 237 ? -23.421 6.106  -7.839  1.00 15.65 ? 256  GLY A N   1 
ATOM   1882 C CA  . GLY A 1 237 ? -22.655 6.017  -9.062  1.00 15.42 ? 256  GLY A CA  1 
ATOM   1883 C C   . GLY A 1 237 ? -21.635 7.119  -9.306  1.00 15.97 ? 256  GLY A C   1 
ATOM   1884 O O   . GLY A 1 237 ? -21.023 7.151  -10.369 1.00 15.82 ? 256  GLY A O   1 
ATOM   1885 N N   . MET A 1 238 ? -21.424 8.024  -8.342  1.00 14.70 ? 257  MET A N   1 
ATOM   1886 C CA  . MET A 1 238 ? -20.410 9.045  -8.529  1.00 14.52 ? 257  MET A CA  1 
ATOM   1887 C C   . MET A 1 238 ? -19.064 8.433  -8.171  1.00 14.35 ? 257  MET A C   1 
ATOM   1888 O O   . MET A 1 238 ? -18.918 7.898  -7.061  1.00 14.83 ? 257  MET A O   1 
ATOM   1889 C CB  . MET A 1 238 ? -20.687 10.260 -7.641  1.00 14.16 ? 257  MET A CB  1 
ATOM   1890 C CG  . MET A 1 238 ? -19.761 11.425 -7.895  1.00 14.20 ? 257  MET A CG  1 
ATOM   1891 S SD  . MET A 1 238 ? -19.786 12.177 -9.538  1.00 13.66 ? 257  MET A SD  1 
ATOM   1892 C CE  . MET A 1 238 ? -21.483 12.673 -9.629  1.00 14.27 ? 257  MET A CE  1 
ATOM   1893 N N   . PRO A 1 239 ? -18.089 8.461  -9.087  1.00 13.51 ? 258  PRO A N   1 
ATOM   1894 C CA  . PRO A 1 239 ? -16.756 7.925  -8.754  1.00 13.78 ? 258  PRO A CA  1 
ATOM   1895 C C   . PRO A 1 239 ? -16.180 8.677  -7.573  1.00 13.89 ? 258  PRO A C   1 
ATOM   1896 O O   . PRO A 1 239 ? -16.332 9.913  -7.497  1.00 13.81 ? 258  PRO A O   1 
ATOM   1897 C CB  . PRO A 1 239 ? -15.927 8.226  -9.984  1.00 14.53 ? 258  PRO A CB  1 
ATOM   1898 C CG  . PRO A 1 239 ? -16.917 8.390  -11.083 1.00 14.72 ? 258  PRO A CG  1 
ATOM   1899 C CD  . PRO A 1 239 ? -18.179 8.914  -10.481 1.00 14.21 ? 258  PRO A CD  1 
ATOM   1900 N N   . SER A 1 240 ? -15.519 7.975  -6.667  1.00 13.85 ? 259  SER A N   1 
ATOM   1901 C CA  . SER A 1 240 ? -15.032 8.645  -5.456  1.00 13.99 ? 259  SER A CA  1 
ATOM   1902 C C   . SER A 1 240 ? -14.098 9.793  -5.794  1.00 14.14 ? 259  SER A C   1 
ATOM   1903 O O   . SER A 1 240 ? -14.097 10.825 -5.102  1.00 13.88 ? 259  SER A O   1 
ATOM   1904 C CB  . SER A 1 240 ? -14.334 7.631  -4.522  1.00 14.45 ? 259  SER A CB  1 
ATOM   1905 O OG  . SER A 1 240 ? -13.157 7.116  -5.115  1.00 14.26 ? 259  SER A OG  1 
ATOM   1906 N N   . GLU A 1 241 ? -13.313 9.666  -6.861  1.00 13.98 ? 260  GLU A N   1 
ATOM   1907 C CA  . GLU A 1 241 ? -12.352 10.695 -7.194  1.00 15.30 ? 260  GLU A CA  1 
ATOM   1908 C C   . GLU A 1 241 ? -13.004 11.958 -7.748  1.00 14.42 ? 260  GLU A C   1 
ATOM   1909 O O   . GLU A 1 241 ? -12.354 12.976 -7.857  1.00 14.01 ? 260  GLU A O   1 
ATOM   1910 C CB  . GLU A 1 241 ? -11.252 10.176 -8.123  1.00 17.60 ? 260  GLU A CB  1 
ATOM   1911 C CG  . GLU A 1 241 ? -11.712 9.804  -9.517  1.00 19.57 ? 260  GLU A CG  1 
ATOM   1912 C CD  . GLU A 1 241 ? -12.143 8.353  -9.650  1.00 20.92 ? 260  GLU A CD  1 
ATOM   1913 O OE1 . GLU A 1 241 ? -12.461 7.687  -8.624  1.00 22.73 ? 260  GLU A OE1 1 
ATOM   1914 O OE2 . GLU A 1 241 ? -12.183 7.878  -10.812 1.00 25.10 ? 260  GLU A OE2 1 
ATOM   1915 N N   . LYS A 1 242 ? -14.288 11.876 -8.095  1.00 14.08 ? 261  LYS A N   1 
ATOM   1916 C CA  . LYS A 1 242 ? -15.021 13.061 -8.533  1.00 14.13 ? 261  LYS A CA  1 
ATOM   1917 C C   . LYS A 1 242 ? -15.766 13.690 -7.383  1.00 13.52 ? 261  LYS A C   1 
ATOM   1918 O O   . LYS A 1 242 ? -16.469 14.663 -7.595  1.00 14.01 ? 261  LYS A O   1 
ATOM   1919 C CB  . LYS A 1 242 ? -16.018 12.725 -9.649  1.00 14.70 ? 261  LYS A CB  1 
ATOM   1920 C CG  . LYS A 1 242 ? -15.329 12.476 -10.981 1.00 14.54 ? 261  LYS A CG  1 
ATOM   1921 C CD  . LYS A 1 242 ? -16.300 12.533 -12.159 1.00 15.39 ? 261  LYS A CD  1 
ATOM   1922 C CE  . LYS A 1 242 ? -15.552 12.546 -13.482 1.00 16.17 ? 261  LYS A CE  1 
ATOM   1923 N NZ  . LYS A 1 242 ? -16.463 12.632 -14.663 1.00 16.49 ? 261  LYS A NZ  1 
ATOM   1924 N N   . VAL A 1 243 ? -15.655 13.138 -6.173  1.00 12.80 ? 262  VAL A N   1 
ATOM   1925 C CA  . VAL A 1 243 ? -16.275 13.766 -4.994  1.00 12.43 ? 262  VAL A CA  1 
ATOM   1926 C C   . VAL A 1 243 ? -15.245 14.669 -4.322  1.00 11.67 ? 262  VAL A C   1 
ATOM   1927 O O   . VAL A 1 243 ? -14.218 14.184 -3.826  1.00 11.46 ? 262  VAL A O   1 
ATOM   1928 C CB  . VAL A 1 243 ? -16.754 12.717 -3.975  1.00 12.88 ? 262  VAL A CB  1 
ATOM   1929 C CG1 . VAL A 1 243 ? -17.313 13.391 -2.734  1.00 13.27 ? 262  VAL A CG1 1 
ATOM   1930 C CG2 . VAL A 1 243 ? -17.775 11.783 -4.600  1.00 13.32 ? 262  VAL A CG2 1 
ATOM   1931 N N   . VAL A 1 244 ? -15.494 15.983 -4.319  1.00 11.00 ? 263  VAL A N   1 
ATOM   1932 C CA  . VAL A 1 244 ? -14.667 16.932 -3.605  1.00 10.54 ? 263  VAL A CA  1 
ATOM   1933 C C   . VAL A 1 244 ? -15.506 17.360 -2.421  1.00 10.86 ? 263  VAL A C   1 
ATOM   1934 O O   . VAL A 1 244 ? -16.570 17.948 -2.576  1.00 11.37 ? 263  VAL A O   1 
ATOM   1935 C CB  . VAL A 1 244 ? -14.266 18.123 -4.509  1.00 10.28 ? 263  VAL A CB  1 
ATOM   1936 C CG1 . VAL A 1 244 ? -13.386 19.127 -3.776  1.00 10.04 ? 263  VAL A CG1 1 
ATOM   1937 C CG2 . VAL A 1 244 ? -13.478 17.610 -5.685  1.00 10.05 ? 263  VAL A CG2 1 
ATOM   1938 N N   . MET A 1 245 ? -15.049 16.993 -1.225  1.00 10.69 ? 264  MET A N   1 
ATOM   1939 C CA  . MET A 1 245 ? -15.881 17.002 -0.031  1.00 10.64 ? 264  MET A CA  1 
ATOM   1940 C C   . MET A 1 245 ? -15.869 18.393 0.628   1.00 10.26 ? 264  MET A C   1 
ATOM   1941 O O   . MET A 1 245 ? -14.803 18.890 1.018   1.00 10.66 ? 264  MET A O   1 
ATOM   1942 C CB  . MET A 1 245 ? -15.348 15.954 0.952   1.00 11.29 ? 264  MET A CB  1 
ATOM   1943 C CG  . MET A 1 245 ? -16.198 15.724 2.179   1.00 11.99 ? 264  MET A CG  1 
ATOM   1944 S SD  . MET A 1 245 ? -15.370 14.599 3.329   1.00 14.00 ? 264  MET A SD  1 
ATOM   1945 C CE  . MET A 1 245 ? -14.426 15.784 4.192   1.00 13.83 ? 264  MET A CE  1 
ATOM   1946 N N   . GLY A 1 246 ? -17.045 18.996 0.741   1.00 10.61 ? 265  GLY A N   1 
ATOM   1947 C CA  . GLY A 1 246 ? -17.170 20.334 1.334   1.00 10.30 ? 265  GLY A CA  1 
ATOM   1948 C C   . GLY A 1 246 ? -16.883 20.288 2.819   1.00 10.59 ? 265  GLY A C   1 
ATOM   1949 O O   . GLY A 1 246 ? -17.295 19.355 3.540   1.00 10.41 ? 265  GLY A O   1 
ATOM   1950 N N   . ILE A 1 247 ? -16.176 21.316 3.267   1.00 9.76  ? 266  ILE A N   1 
ATOM   1951 C CA  . ILE A 1 247 ? -15.840 21.519 4.663   1.00 9.79  ? 266  ILE A CA  1 
ATOM   1952 C C   . ILE A 1 247 ? -16.203 22.997 4.926   1.00 9.65  ? 266  ILE A C   1 
ATOM   1953 O O   . ILE A 1 247 ? -15.816 23.858 4.155   1.00 9.86  ? 266  ILE A O   1 
ATOM   1954 C CB  . ILE A 1 247 ? -14.350 21.304 4.920   1.00 10.17 ? 266  ILE A CB  1 
ATOM   1955 C CG1 . ILE A 1 247 ? -13.923 19.843 4.643   1.00 9.93  ? 266  ILE A CG1 1 
ATOM   1956 C CG2 . ILE A 1 247 ? -14.029 21.670 6.363   1.00 10.05 ? 266  ILE A CG2 1 
ATOM   1957 C CD1 . ILE A 1 247 ? -12.417 19.659 4.700   1.00 10.29 ? 266  ILE A CD1 1 
ATOM   1958 N N   . PRO A 1 248 ? -16.968 23.292 5.989   1.00 9.93  ? 267  PRO A N   1 
ATOM   1959 C CA  . PRO A 1 248 ? -17.366 24.690 6.252   1.00 9.96  ? 267  PRO A CA  1 
ATOM   1960 C C   . PRO A 1 248 ? -16.376 25.436 7.134   1.00 10.15 ? 267  PRO A C   1 
ATOM   1961 O O   . PRO A 1 248 ? -15.749 24.839 8.024   1.00 10.48 ? 267  PRO A O   1 
ATOM   1962 C CB  . PRO A 1 248 ? -18.652 24.520 7.048   1.00 9.55  ? 267  PRO A CB  1 
ATOM   1963 C CG  . PRO A 1 248 ? -18.409 23.263 7.823   1.00 10.02 ? 267  PRO A CG  1 
ATOM   1964 C CD  . PRO A 1 248 ? -17.558 22.371 6.971   1.00 9.77  ? 267  PRO A CD  1 
ATOM   1965 N N   . THR A 1 249 ? -16.248 26.742 6.921   1.00 9.89  ? 268  THR A N   1 
ATOM   1966 C CA  . THR A 1 249 ? -15.487 27.607 7.834   1.00 10.70 ? 268  THR A CA  1 
ATOM   1967 C C   . THR A 1 249 ? -16.414 28.508 8.640   1.00 11.40 ? 268  THR A C   1 
ATOM   1968 O O   . THR A 1 249 ? -16.028 29.582 9.064   1.00 14.61 ? 268  THR A O   1 
ATOM   1969 C CB  . THR A 1 249 ? -14.538 28.518 7.055   1.00 11.05 ? 268  THR A CB  1 
ATOM   1970 O OG1 . THR A 1 249 ? -15.311 29.264 6.103   1.00 10.59 ? 268  THR A OG1 1 
ATOM   1971 C CG2 . THR A 1 249 ? -13.449 27.677 6.356   1.00 10.94 ? 268  THR A CG2 1 
ATOM   1972 N N   . TYR A 1 250 ? -17.670 28.123 8.765   1.00 10.45 ? 269  TYR A N   1 
ATOM   1973 C CA  . TYR A 1 250 ? -18.632 28.813 9.595   1.00 10.22 ? 269  TYR A CA  1 
ATOM   1974 C C   . TYR A 1 250 ? -19.254 27.770 10.499  1.00 10.18 ? 269  TYR A C   1 
ATOM   1975 O O   . TYR A 1 250 ? -19.056 26.571 10.280  1.00 10.76 ? 269  TYR A O   1 
ATOM   1976 C CB  . TYR A 1 250 ? -19.735 29.459 8.728   1.00 10.11 ? 269  TYR A CB  1 
ATOM   1977 C CG  . TYR A 1 250 ? -20.589 28.458 7.968   1.00 10.17 ? 269  TYR A CG  1 
ATOM   1978 C CD1 . TYR A 1 250 ? -21.802 28.042 8.480   1.00 10.10 ? 269  TYR A CD1 1 
ATOM   1979 C CD2 . TYR A 1 250 ? -20.161 27.888 6.764   1.00 10.05 ? 269  TYR A CD2 1 
ATOM   1980 C CE1 . TYR A 1 250 ? -22.590 27.116 7.809   1.00 10.46 ? 269  TYR A CE1 1 
ATOM   1981 C CE2 . TYR A 1 250 ? -20.937 26.991 6.095   1.00 10.28 ? 269  TYR A CE2 1 
ATOM   1982 C CZ  . TYR A 1 250 ? -22.126 26.578 6.618   1.00 10.29 ? 269  TYR A CZ  1 
ATOM   1983 O OH  . TYR A 1 250 ? -22.879 25.635 5.944   1.00 11.21 ? 269  TYR A OH  1 
ATOM   1984 N N   . GLY A 1 251 ? -19.971 28.227 11.525  1.00 9.84  ? 270  GLY A N   1 
ATOM   1985 C CA  . GLY A 1 251 ? -20.742 27.347 12.374  1.00 10.08 ? 270  GLY A CA  1 
ATOM   1986 C C   . GLY A 1 251 ? -22.188 27.788 12.449  1.00 10.65 ? 270  GLY A C   1 
ATOM   1987 O O   . GLY A 1 251 ? -22.512 28.900 12.044  1.00 10.53 ? 270  GLY A O   1 
ATOM   1988 N N   . HIS A 1 252 ? -23.051 26.910 12.943  1.00 10.68 ? 271  HIS A N   1 
ATOM   1989 C CA  . HIS A 1 252 ? -24.447 27.260 13.182  1.00 11.15 ? 271  HIS A CA  1 
ATOM   1990 C C   . HIS A 1 252 ? -24.668 27.354 14.668  1.00 10.77 ? 271  HIS A C   1 
ATOM   1991 O O   . HIS A 1 252 ? -24.176 26.533 15.468  1.00 10.43 ? 271  HIS A O   1 
ATOM   1992 C CB  . HIS A 1 252 ? -25.421 26.281 12.549  1.00 12.02 ? 271  HIS A CB  1 
ATOM   1993 C CG  . HIS A 1 252 ? -25.691 26.543 11.096  1.00 13.18 ? 271  HIS A CG  1 
ATOM   1994 N ND1 . HIS A 1 252 ? -26.015 27.790 10.609  1.00 14.52 ? 271  HIS A ND1 1 
ATOM   1995 C CD2 . HIS A 1 252 ? -25.723 25.705 10.031  1.00 14.09 ? 271  HIS A CD2 1 
ATOM   1996 C CE1 . HIS A 1 252 ? -26.191 27.723 9.297   1.00 15.20 ? 271  HIS A CE1 1 
ATOM   1997 N NE2 . HIS A 1 252 ? -26.020 26.466 8.919   1.00 15.14 ? 271  HIS A NE2 1 
ATOM   1998 N N   . SER A 1 253 ? -25.393 28.391 15.031  1.00 11.06 ? 272  SER A N   1 
ATOM   1999 C CA  . SER A 1 253 ? -25.629 28.767 16.406  1.00 11.01 ? 272  SER A CA  1 
ATOM   2000 C C   . SER A 1 253 ? -27.092 28.687 16.809  1.00 10.78 ? 272  SER A C   1 
ATOM   2001 O O   . SER A 1 253 ? -27.997 28.809 15.968  1.00 10.29 ? 272  SER A O   1 
ATOM   2002 C CB  . SER A 1 253 ? -25.173 30.197 16.574  1.00 11.46 ? 272  SER A CB  1 
ATOM   2003 O OG  . SER A 1 253 ? -25.969 31.072 15.803  1.00 11.90 ? 272  SER A OG  1 
ATOM   2004 N N   . PHE A 1 254 ? -27.284 28.509 18.111  1.00 10.29 ? 273  PHE A N   1 
ATOM   2005 C CA  . PHE A 1 254 ? -28.615 28.431 18.730  1.00 10.58 ? 273  PHE A CA  1 
ATOM   2006 C C   . PHE A 1 254 ? -28.616 29.218 20.011  1.00 11.05 ? 273  PHE A C   1 
ATOM   2007 O O   . PHE A 1 254 ? -27.623 29.262 20.730  1.00 10.97 ? 273  PHE A O   1 
ATOM   2008 C CB  . PHE A 1 254 ? -28.997 26.973 19.091  1.00 11.10 ? 273  PHE A CB  1 
ATOM   2009 C CG  . PHE A 1 254 ? -28.979 26.027 17.943  1.00 10.78 ? 273  PHE A CG  1 
ATOM   2010 C CD1 . PHE A 1 254 ? -30.155 25.660 17.304  1.00 11.08 ? 273  PHE A CD1 1 
ATOM   2011 C CD2 . PHE A 1 254 ? -27.782 25.469 17.506  1.00 11.26 ? 273  PHE A CD2 1 
ATOM   2012 C CE1 . PHE A 1 254 ? -30.116 24.781 16.227  1.00 11.22 ? 273  PHE A CE1 1 
ATOM   2013 C CE2 . PHE A 1 254 ? -27.760 24.594 16.433  1.00 10.34 ? 273  PHE A CE2 1 
ATOM   2014 C CZ  . PHE A 1 254 ? -28.918 24.246 15.809  1.00 11.22 ? 273  PHE A CZ  1 
ATOM   2015 N N   . THR A 1 255 ? -29.783 29.781 20.340  1.00 11.48 ? 274  THR A N   1 
ATOM   2016 C CA  . THR A 1 255 ? -30.032 30.286 21.673  1.00 12.31 ? 274  THR A CA  1 
ATOM   2017 C C   . THR A 1 255 ? -30.760 29.174 22.431  1.00 11.92 ? 274  THR A C   1 
ATOM   2018 O O   . THR A 1 255 ? -31.784 28.679 21.962  1.00 13.08 ? 274  THR A O   1 
ATOM   2019 C CB  . THR A 1 255 ? -30.881 31.580 21.627  1.00 12.46 ? 274  THR A CB  1 
ATOM   2020 O OG1 . THR A 1 255 ? -30.124 32.601 20.971  1.00 13.00 ? 274  THR A OG1 1 
ATOM   2021 C CG2 . THR A 1 255 ? -31.232 32.056 23.013  1.00 13.16 ? 274  THR A CG2 1 
ATOM   2022 N N   . LEU A 1 256 ? -30.203 28.771 23.560  1.00 13.06 ? 275  LEU A N   1 
ATOM   2023 C CA  . LEU A 1 256 ? -30.744 27.684 24.358  1.00 12.86 ? 275  LEU A CA  1 
ATOM   2024 C C   . LEU A 1 256 ? -31.999 28.116 25.114  1.00 14.39 ? 275  LEU A C   1 
ATOM   2025 O O   . LEU A 1 256 ? -32.080 29.238 25.614  1.00 15.24 ? 275  LEU A O   1 
ATOM   2026 C CB  . LEU A 1 256 ? -29.696 27.157 25.337  1.00 13.00 ? 275  LEU A CB  1 
ATOM   2027 C CG  . LEU A 1 256 ? -28.461 26.495 24.738  1.00 13.29 ? 275  LEU A CG  1 
ATOM   2028 C CD1 . LEU A 1 256 ? -27.428 26.249 25.838  1.00 13.14 ? 275  LEU A CD1 1 
ATOM   2029 C CD2 . LEU A 1 256 ? -28.862 25.198 24.032  1.00 13.63 ? 275  LEU A CD2 1 
ATOM   2030 N N   . ALA A 1 257 ? -32.974 27.211 25.147  1.00 15.42 ? 276  ALA A N   1 
ATOM   2031 C CA  . ALA A 1 257 ? -34.265 27.442 25.818  1.00 16.40 ? 276  ALA A CA  1 
ATOM   2032 C C   . ALA A 1 257 ? -34.267 27.022 27.273  1.00 18.18 ? 276  ALA A C   1 
ATOM   2033 O O   . ALA A 1 257 ? -35.163 27.438 28.022  1.00 21.01 ? 276  ALA A O   1 
ATOM   2034 C CB  . ALA A 1 257 ? -35.398 26.754 25.074  1.00 16.55 ? 276  ALA A CB  1 
ATOM   2035 N N   . SER A 1 258 ? -33.283 26.227 27.686  1.00 18.90 ? 277  SER A N   1 
ATOM   2036 C CA  . SER A 1 258 ? -33.199 25.700 29.058  1.00 18.69 ? 277  SER A CA  1 
ATOM   2037 C C   . SER A 1 258 ? -31.742 25.633 29.507  1.00 19.13 ? 277  SER A C   1 
ATOM   2038 O O   . SER A 1 258 ? -30.829 26.052 28.792  1.00 19.67 ? 277  SER A O   1 
ATOM   2039 C CB  . SER A 1 258 ? -33.847 24.305 29.138  1.00 18.45 ? 277  SER A CB  1 
ATOM   2040 O OG  . SER A 1 258 ? -33.056 23.268 28.558  1.00 17.93 ? 277  SER A OG  1 
ATOM   2041 N N   . ALA A 1 259 ? -31.540 25.101 30.704  1.00 19.10 ? 278  ALA A N   1 
ATOM   2042 C CA  . ALA A 1 259 ? -30.218 24.808 31.228  1.00 19.42 ? 278  ALA A CA  1 
ATOM   2043 C C   . ALA A 1 259 ? -29.472 23.717 30.454  1.00 17.85 ? 278  ALA A C   1 
ATOM   2044 O O   . ALA A 1 259 ? -28.262 23.595 30.599  1.00 18.55 ? 278  ALA A O   1 
ATOM   2045 C CB  . ALA A 1 259 ? -30.343 24.378 32.684  1.00 20.20 ? 278  ALA A CB  1 
ATOM   2046 N N   . GLU A 1 260 ? -30.183 22.903 29.678  1.00 17.20 ? 279  GLU A N   1 
ATOM   2047 C CA  . GLU A 1 260 ? -29.548 21.776 28.991  1.00 17.09 ? 279  GLU A CA  1 
ATOM   2048 C C   . GLU A 1 260 ? -28.661 22.298 27.872  1.00 16.10 ? 279  GLU A C   1 
ATOM   2049 O O   . GLU A 1 260 ? -29.064 23.206 27.128  1.00 15.01 ? 279  GLU A O   1 
ATOM   2050 C CB  . GLU A 1 260 ? -30.560 20.847 28.370  1.00 19.73 ? 279  GLU A CB  1 
ATOM   2051 C CG  . GLU A 1 260 ? -31.517 20.128 29.298  1.00 23.60 ? 279  GLU A CG  1 
ATOM   2052 C CD  . GLU A 1 260 ? -32.356 19.170 28.476  0.50 26.79 ? 279  GLU A CD  1 
ATOM   2053 O OE1 . GLU A 1 260 ? -31.735 18.283 27.865  1.00 33.25 ? 279  GLU A OE1 1 
ATOM   2054 O OE2 . GLU A 1 260 ? -33.592 19.315 28.372  1.00 31.98 ? 279  GLU A OE2 1 
ATOM   2055 N N   . THR A 1 261 ? -27.453 21.744 27.756  1.00 15.65 ? 280  THR A N   1 
ATOM   2056 C CA  . THR A 1 261 ? -26.470 22.250 26.793  1.00 15.75 ? 280  THR A CA  1 
ATOM   2057 C C   . THR A 1 261 ? -25.948 21.172 25.839  1.00 14.95 ? 280  THR A C   1 
ATOM   2058 O O   . THR A 1 261 ? -24.970 21.389 25.138  1.00 16.13 ? 280  THR A O   1 
ATOM   2059 C CB  . THR A 1 261 ? -25.263 22.861 27.522  1.00 16.32 ? 280  THR A CB  1 
ATOM   2060 O OG1 . THR A 1 261 ? -24.667 21.870 28.370  1.00 17.24 ? 280  THR A OG1 1 
ATOM   2061 C CG2 . THR A 1 261 ? -25.710 24.049 28.395  1.00 16.64 ? 280  THR A CG2 1 
ATOM   2062 N N   . THR A 1 262 ? -26.585 20.017 25.823  1.00 14.50 ? 281  THR A N   1 
ATOM   2063 C CA  . THR A 1 262 ? -26.131 18.897 25.025  1.00 14.53 ? 281  THR A CA  1 
ATOM   2064 C C   . THR A 1 262 ? -26.649 18.983 23.596  1.00 14.36 ? 281  THR A C   1 
ATOM   2065 O O   . THR A 1 262 ? -27.471 19.852 23.276  1.00 14.09 ? 281  THR A O   1 
ATOM   2066 C CB  . THR A 1 262 ? -26.616 17.596 25.673  1.00 15.62 ? 281  THR A CB  1 
ATOM   2067 O OG1 . THR A 1 262 ? -27.995 17.751 26.042  1.00 18.31 ? 281  THR A OG1 1 
ATOM   2068 C CG2 . THR A 1 262 ? -25.788 17.315 26.918  1.00 16.21 ? 281  THR A CG2 1 
ATOM   2069 N N   . VAL A 1 263 ? -26.164 18.085 22.740  1.00 14.43 ? 282  VAL A N   1 
ATOM   2070 C CA  . VAL A 1 263 ? -26.744 17.903 21.419  1.00 13.63 ? 282  VAL A CA  1 
ATOM   2071 C C   . VAL A 1 263 ? -28.179 17.427 21.602  1.00 14.36 ? 282  VAL A C   1 
ATOM   2072 O O   . VAL A 1 263 ? -28.436 16.470 22.312  1.00 16.24 ? 282  VAL A O   1 
ATOM   2073 C CB  . VAL A 1 263 ? -25.968 16.885 20.548  1.00 13.09 ? 282  VAL A CB  1 
ATOM   2074 C CG1 . VAL A 1 263 ? -26.703 16.612 19.232  1.00 13.00 ? 282  VAL A CG1 1 
ATOM   2075 C CG2 . VAL A 1 263 ? -24.558 17.363 20.285  1.00 13.25 ? 282  VAL A CG2 1 
ATOM   2076 N N   . GLY A 1 264 ? -29.102 18.135 20.963  1.00 13.19 ? 283  GLY A N   1 
ATOM   2077 C CA  . GLY A 1 264 ? -30.518 17.845 21.011  1.00 13.69 ? 283  GLY A CA  1 
ATOM   2078 C C   . GLY A 1 264 ? -31.259 18.567 22.120  1.00 13.43 ? 283  GLY A C   1 
ATOM   2079 O O   . GLY A 1 264 ? -32.454 18.301 22.340  1.00 13.98 ? 283  GLY A O   1 
ATOM   2080 N N   . ALA A 1 265 ? -30.563 19.476 22.806  1.00 13.84 ? 284  ALA A N   1 
ATOM   2081 C CA  . ALA A 1 265 ? -31.173 20.345 23.816  1.00 14.23 ? 284  ALA A CA  1 
ATOM   2082 C C   . ALA A 1 265 ? -32.090 21.346 23.152  1.00 14.57 ? 284  ALA A C   1 
ATOM   2083 O O   . ALA A 1 265 ? -31.870 21.730 22.012  1.00 13.66 ? 284  ALA A O   1 
ATOM   2084 C CB  . ALA A 1 265 ? -30.123 21.110 24.591  1.00 14.55 ? 284  ALA A CB  1 
ATOM   2085 N N   . PRO A 1 266 ? -33.160 21.738 23.860  1.00 14.69 ? 285  PRO A N   1 
ATOM   2086 C CA  . PRO A 1 266 ? -34.105 22.647 23.247  1.00 14.75 ? 285  PRO A CA  1 
ATOM   2087 C C   . PRO A 1 266 ? -33.514 24.029 23.022  1.00 14.03 ? 285  PRO A C   1 
ATOM   2088 O O   . PRO A 1 266 ? -32.772 24.533 23.845  1.00 14.02 ? 285  PRO A O   1 
ATOM   2089 C CB  . PRO A 1 266 ? -35.270 22.693 24.245  1.00 15.24 ? 285  PRO A CB  1 
ATOM   2090 C CG  . PRO A 1 266 ? -34.705 22.276 25.521  1.00 15.96 ? 285  PRO A CG  1 
ATOM   2091 C CD  . PRO A 1 266 ? -33.540 21.373 25.228  1.00 15.33 ? 285  PRO A CD  1 
ATOM   2092 N N   . ALA A 1 267 ? -33.847 24.615 21.879  1.00 13.78 ? 286  ALA A N   1 
ATOM   2093 C CA  . ALA A 1 267 ? -33.442 25.963 21.533  1.00 14.04 ? 286  ALA A CA  1 
ATOM   2094 C C   . ALA A 1 267 ? -34.678 26.830 21.314  1.00 14.60 ? 286  ALA A C   1 
ATOM   2095 O O   . ALA A 1 267 ? -35.733 26.366 20.826  1.00 14.29 ? 286  ALA A O   1 
ATOM   2096 C CB  . ALA A 1 267 ? -32.597 25.944 20.283  1.00 13.91 ? 286  ALA A CB  1 
ATOM   2097 N N   . SER A 1 268 ? -34.528 28.092 21.667  1.00 13.99 ? 287  SER A N   1 
ATOM   2098 C CA  . SER A 1 268 ? -35.614 29.056 21.459  1.00 15.55 ? 287  SER A CA  1 
ATOM   2099 C C   . SER A 1 268 ? -35.528 29.712 20.098  1.00 15.52 ? 287  SER A C   1 
ATOM   2100 O O   . SER A 1 268 ? -36.490 30.326 19.643  1.00 16.37 ? 287  SER A O   1 
ATOM   2101 C CB  . SER A 1 268 ? -35.632 30.076 22.587  1.00 15.99 ? 287  SER A CB  1 
ATOM   2102 O OG  . SER A 1 268 ? -34.421 30.790 22.726  1.00 17.11 ? 287  SER A OG  1 
ATOM   2103 N N   . GLY A 1 269 ? -34.397 29.560 19.428  1.00 14.74 ? 288  GLY A N   1 
ATOM   2104 C CA  . GLY A 1 269 ? -34.162 30.285 18.174  1.00 14.48 ? 288  GLY A CA  1 
ATOM   2105 C C   . GLY A 1 269 ? -32.714 30.207 17.766  1.00 13.72 ? 288  GLY A C   1 
ATOM   2106 O O   . GLY A 1 269 ? -31.938 29.493 18.374  1.00 13.42 ? 288  GLY A O   1 
ATOM   2107 N N   . PRO A 1 270 ? -32.349 30.928 16.733  1.00 13.36 ? 289  PRO A N   1 
ATOM   2108 C CA  . PRO A 1 270 ? -30.945 31.005 16.349  1.00 13.29 ? 289  PRO A CA  1 
ATOM   2109 C C   . PRO A 1 270 ? -30.113 31.685 17.413  1.00 12.50 ? 289  PRO A C   1 
ATOM   2110 O O   . PRO A 1 270 ? -30.621 32.404 18.281  1.00 12.38 ? 289  PRO A O   1 
ATOM   2111 C CB  . PRO A 1 270 ? -30.965 31.881 15.096  1.00 13.74 ? 289  PRO A CB  1 
ATOM   2112 C CG  . PRO A 1 270 ? -32.186 32.694 15.252  1.00 13.89 ? 289  PRO A CG  1 
ATOM   2113 C CD  . PRO A 1 270 ? -33.196 31.759 15.863  1.00 14.20 ? 289  PRO A CD  1 
ATOM   2114 N N   . GLY A 1 271 ? -28.804 31.500 17.317  1.00 11.81 ? 290  GLY A N   1 
ATOM   2115 C CA  . GLY A 1 271 ? -27.909 32.172 18.186  1.00 11.55 ? 290  GLY A CA  1 
ATOM   2116 C C   . GLY A 1 271 ? -27.869 33.651 17.828  1.00 11.79 ? 290  GLY A C   1 
ATOM   2117 O O   . GLY A 1 271 ? -28.271 34.054 16.730  1.00 12.15 ? 290  GLY A O   1 
ATOM   2118 N N   . ALA A 1 272 ? -27.359 34.419 18.759  1.00 12.26 ? 291  ALA A N   1 
ATOM   2119 C CA  . ALA A 1 272 ? -27.094 35.826 18.546  1.00 12.55 ? 291  ALA A CA  1 
ATOM   2120 C C   . ALA A 1 272 ? -26.216 36.081 17.321  1.00 11.95 ? 291  ALA A C   1 
ATOM   2121 O O   . ALA A 1 272 ? -25.190 35.418 17.128  1.00 12.28 ? 291  ALA A O   1 
ATOM   2122 C CB  . ALA A 1 272 ? -26.454 36.416 19.776  1.00 12.59 ? 291  ALA A CB  1 
ATOM   2123 N N   . ALA A 1 273 ? -26.598 37.068 16.522  1.00 12.30 ? 292  ALA A N   1 
ATOM   2124 C CA  . ALA A 1 273 ? -25.839 37.407 15.324  1.00 11.96 ? 292  ALA A CA  1 
ATOM   2125 C C   . ALA A 1 273 ? -24.412 37.776 15.690  1.00 12.05 ? 292  ALA A C   1 
ATOM   2126 O O   . ALA A 1 273 ? -24.161 38.388 16.733  1.00 12.15 ? 292  ALA A O   1 
ATOM   2127 C CB  . ALA A 1 273 ? -26.493 38.553 14.594  1.00 12.68 ? 292  ALA A CB  1 
ATOM   2128 N N   . GLY A 1 274 ? -23.472 37.454 14.814  1.00 11.47 ? 293  GLY A N   1 
ATOM   2129 C CA  . GLY A 1 274 ? -22.100 37.852 15.030  1.00 11.57 ? 293  GLY A CA  1 
ATOM   2130 C C   . GLY A 1 274 ? -21.992 39.334 14.724  1.00 11.09 ? 293  GLY A C   1 
ATOM   2131 O O   . GLY A 1 274 ? -22.804 39.855 13.963  1.00 10.97 ? 293  GLY A O   1 
ATOM   2132 N N   . PRO A 1 275 ? -20.999 40.010 15.305  1.00 11.54 ? 294  PRO A N   1 
ATOM   2133 C CA  . PRO A 1 275 ? -20.834 41.459 15.107  1.00 11.40 ? 294  PRO A CA  1 
ATOM   2134 C C   . PRO A 1 275 ? -20.509 41.816 13.658  1.00 11.41 ? 294  PRO A C   1 
ATOM   2135 O O   . PRO A 1 275 ? -20.818 42.917 13.233  1.00 11.64 ? 294  PRO A O   1 
ATOM   2136 C CB  . PRO A 1 275 ? -19.636 41.812 15.974  1.00 12.53 ? 294  PRO A CB  1 
ATOM   2137 C CG  . PRO A 1 275 ? -19.385 40.652 16.841  1.00 13.15 ? 294  PRO A CG  1 
ATOM   2138 C CD  . PRO A 1 275 ? -20.021 39.454 16.253  1.00 12.50 ? 294  PRO A CD  1 
ATOM   2139 N N   . ILE A 1 276 ? -19.852 40.901 12.934  1.00 10.93 ? 295  ILE A N   1 
ATOM   2140 C CA  . ILE A 1 276 ? -19.369 41.201 11.575  1.00 10.66 ? 295  ILE A CA  1 
ATOM   2141 C C   . ILE A 1 276 ? -20.335 40.676 10.510  1.00 10.70 ? 295  ILE A C   1 
ATOM   2142 O O   . ILE A 1 276 ? -20.609 41.369 9.506   1.00 11.40 ? 295  ILE A O   1 
ATOM   2143 C CB  . ILE A 1 276 ? -17.969 40.609 11.338  1.00 10.88 ? 295  ILE A CB  1 
ATOM   2144 C CG1 . ILE A 1 276 ? -17.036 41.017 12.468  1.00 11.30 ? 295  ILE A CG1 1 
ATOM   2145 C CG2 . ILE A 1 276 ? -17.433 40.996 9.964   1.00 10.93 ? 295  ILE A CG2 1 
ATOM   2146 C CD1 . ILE A 1 276 ? -16.890 42.522 12.655  1.00 11.46 ? 295  ILE A CD1 1 
ATOM   2147 N N   . THR A 1 277 ? -20.833 39.454 10.694  1.00 11.34 ? 296  THR A N   1 
ATOM   2148 C CA  . THR A 1 277 ? -21.709 38.839 9.683   1.00 11.06 ? 296  THR A CA  1 
ATOM   2149 C C   . THR A 1 277 ? -23.162 39.195 9.844   1.00 11.60 ? 296  THR A C   1 
ATOM   2150 O O   . THR A 1 277 ? -23.934 39.113 8.879   1.00 11.61 ? 296  THR A O   1 
ATOM   2151 C CB  . THR A 1 277 ? -21.523 37.289 9.602   1.00 11.11 ? 296  THR A CB  1 
ATOM   2152 O OG1 . THR A 1 277 ? -21.701 36.704 10.892  1.00 11.23 ? 296  THR A OG1 1 
ATOM   2153 C CG2 . THR A 1 277 ? -20.137 36.951 9.076   1.00 10.82 ? 296  THR A CG2 1 
ATOM   2154 N N   . GLU A 1 278 ? -23.549 39.605 11.050  1.00 11.49 ? 297  GLU A N   1 
ATOM   2155 C CA  . GLU A 1 278 ? -24.871 40.180 11.319  1.00 12.73 ? 297  GLU A CA  1 
ATOM   2156 C C   . GLU A 1 278 ? -26.021 39.312 10.826  1.00 13.10 ? 297  GLU A C   1 
ATOM   2157 O O   . GLU A 1 278 ? -27.000 39.808 10.245  1.00 15.15 ? 297  GLU A O   1 
ATOM   2158 C CB  . GLU A 1 278 ? -24.983 41.584 10.696  1.00 13.61 ? 297  GLU A CB  1 
ATOM   2159 C CG  . GLU A 1 278 ? -23.965 42.587 11.209  1.00 14.93 ? 297  GLU A CG  1 
ATOM   2160 C CD  . GLU A 1 278 ? -24.174 43.979 10.611  1.00 16.95 ? 297  GLU A CD  1 
ATOM   2161 O OE1 . GLU A 1 278 ? -23.777 44.193 9.439   1.00 18.24 ? 297  GLU A OE1 1 
ATOM   2162 O OE2 . GLU A 1 278 ? -24.745 44.849 11.308  1.00 18.87 ? 297  GLU A OE2 1 
ATOM   2163 N N   . SER A 1 279 ? -25.920 38.010 11.071  0.69 10.91 ? 298  SER A N   1 
ATOM   2164 C CA  . SER A 1 279 ? -26.937 37.083 10.646  0.69 10.95 ? 298  SER A CA  1 
ATOM   2165 C C   . SER A 1 279 ? -27.163 36.014 11.714  0.69 10.77 ? 298  SER A C   1 
ATOM   2166 O O   . SER A 1 279 ? -26.377 35.103 11.859  0.69 10.05 ? 298  SER A O   1 
ATOM   2167 C CB  . SER A 1 279 ? -26.510 36.440 9.341   0.69 10.67 ? 298  SER A CB  1 
ATOM   2168 O OG  . SER A 1 279 ? -27.558 35.650 8.847   0.69 11.88 ? 298  SER A OG  1 
ATOM   2169 N N   . SER A 1 280 ? -28.260 36.140 12.464  1.00 12.28 ? 299  SER A N   1 
ATOM   2170 C CA  . SER A 1 280 ? -28.532 35.240 13.577  0.68 11.21 ? 299  SER A CA  1 
ATOM   2171 C C   . SER A 1 280 ? -28.617 33.820 13.051  1.00 12.09 ? 299  SER A C   1 
ATOM   2172 O O   . SER A 1 280 ? -29.309 33.547 12.066  1.00 13.11 ? 299  SER A O   1 
ATOM   2173 C CB  . SER A 1 280 ? -29.833 35.618 14.259  0.68 12.15 ? 299  SER A CB  1 
ATOM   2174 O OG  . SER A 1 280 ? -29.685 36.903 14.842  0.68 12.67 ? 299  SER A OG  1 
ATOM   2175 N N   . GLY A 1 281 ? -27.886 32.913 13.684  1.00 11.44 ? 300  GLY A N   1 
ATOM   2176 C CA  . GLY A 1 281 ? -27.880 31.526 13.221  1.00 11.57 ? 300  GLY A CA  1 
ATOM   2177 C C   . GLY A 1 281 ? -26.563 31.022 12.675  1.00 11.26 ? 300  GLY A C   1 
ATOM   2178 O O   . GLY A 1 281 ? -26.332 29.792 12.621  1.00 10.75 ? 300  GLY A O   1 
ATOM   2179 N N   . PHE A 1 282 ? -25.694 31.929 12.222  1.00 11.60 ? 301  PHE A N   1 
ATOM   2180 C CA  . PHE A 1 282 ? -24.369 31.503 11.833  1.00 11.92 ? 301  PHE A CA  1 
ATOM   2181 C C   . PHE A 1 282 ? -23.306 32.460 12.322  1.00 11.45 ? 301  PHE A C   1 
ATOM   2182 O O   . PHE A 1 282 ? -23.605 33.594 12.680  1.00 10.55 ? 301  PHE A O   1 
ATOM   2183 C CB  . PHE A 1 282 ? -24.288 31.162 10.314  1.00 12.80 ? 301  PHE A CB  1 
ATOM   2184 C CG  . PHE A 1 282 ? -23.914 32.311 9.391   1.00 13.42 ? 301  PHE A CG  1 
ATOM   2185 C CD1 . PHE A 1 282 ? -24.872 32.953 8.637   1.00 15.27 ? 301  PHE A CD1 1 
ATOM   2186 C CD2 . PHE A 1 282 ? -22.582 32.672 9.217   1.00 14.68 ? 301  PHE A CD2 1 
ATOM   2187 C CE1 . PHE A 1 282 ? -24.514 33.976 7.758   1.00 16.01 ? 301  PHE A CE1 1 
ATOM   2188 C CE2 . PHE A 1 282 ? -22.219 33.678 8.334   1.00 14.51 ? 301  PHE A CE2 1 
ATOM   2189 C CZ  . PHE A 1 282 ? -23.195 34.332 7.612   1.00 14.96 ? 301  PHE A CZ  1 
ATOM   2190 N N   . LEU A 1 283 ? -22.072 31.947 12.400  1.00 10.69 ? 302  LEU A N   1 
ATOM   2191 C CA  . LEU A 1 283 ? -20.907 32.745 12.710  1.00 10.54 ? 302  LEU A CA  1 
ATOM   2192 C C   . LEU A 1 283 ? -19.760 32.311 11.805  1.00 9.54  ? 302  LEU A C   1 
ATOM   2193 O O   . LEU A 1 283 ? -19.600 31.107 11.542  1.00 9.62  ? 302  LEU A O   1 
ATOM   2194 C CB  . LEU A 1 283 ? -20.476 32.554 14.160  1.00 10.65 ? 302  LEU A CB  1 
ATOM   2195 C CG  . LEU A 1 283 ? -21.422 32.932 15.302  1.00 10.71 ? 302  LEU A CG  1 
ATOM   2196 C CD1 . LEU A 1 283 ? -20.808 32.496 16.619  1.00 11.39 ? 302  LEU A CD1 1 
ATOM   2197 C CD2 . LEU A 1 283 ? -21.691 34.436 15.318  1.00 10.85 ? 302  LEU A CD2 1 
ATOM   2198 N N   . ALA A 1 284 ? -18.984 33.282 11.309  1.00 8.84  ? 303  ALA A N   1 
ATOM   2199 C CA  . ALA A 1 284 ? -17.762 32.987 10.582  1.00 8.86  ? 303  ALA A CA  1 
ATOM   2200 C C   . ALA A 1 284 ? -16.704 32.504 11.568  1.00 8.95  ? 303  ALA A C   1 
ATOM   2201 O O   . ALA A 1 284 ? -16.782 32.808 12.734  1.00 8.74  ? 303  ALA A O   1 
ATOM   2202 C CB  . ALA A 1 284 ? -17.239 34.214 9.841   1.00 8.80  ? 303  ALA A CB  1 
ATOM   2203 N N   . TYR A 1 285 ? -15.696 31.791 11.077  1.00 9.20  ? 304  TYR A N   1 
ATOM   2204 C CA  . TYR A 1 285 ? -14.625 31.351 11.969  1.00 9.90  ? 304  TYR A CA  1 
ATOM   2205 C C   . TYR A 1 285 ? -13.962 32.474 12.737  1.00 10.12 ? 304  TYR A C   1 
ATOM   2206 O O   . TYR A 1 285 ? -13.679 32.313 13.915  1.00 10.37 ? 304  TYR A O   1 
ATOM   2207 C CB  . TYR A 1 285 ? -13.599 30.515 11.241  1.00 10.56 ? 304  TYR A CB  1 
ATOM   2208 C CG  . TYR A 1 285 ? -12.680 29.806 12.197  1.00 11.71 ? 304  TYR A CG  1 
ATOM   2209 C CD1 . TYR A 1 285 ? -13.166 28.830 13.037  1.00 12.36 ? 304  TYR A CD1 1 
ATOM   2210 C CD2 . TYR A 1 285 ? -11.320 30.096 12.222  1.00 12.61 ? 304  TYR A CD2 1 
ATOM   2211 C CE1 . TYR A 1 285 ? -12.320 28.172 13.919  1.00 14.25 ? 304  TYR A CE1 1 
ATOM   2212 C CE2 . TYR A 1 285 ? -10.453 29.434 13.096  1.00 13.46 ? 304  TYR A CE2 1 
ATOM   2213 C CZ  . TYR A 1 285 ? -10.971 28.476 13.920  1.00 14.12 ? 304  TYR A CZ  1 
ATOM   2214 O OH  . TYR A 1 285 ? -10.186 27.766 14.820  1.00 18.74 ? 304  TYR A OH  1 
ATOM   2215 N N   . TYR A 1 286 ? -13.747 33.621 12.094  1.00 10.09 ? 305  TYR A N   1 
ATOM   2216 C CA  . TYR A 1 286 ? -13.126 34.738 12.787  1.00 10.37 ? 305  TYR A CA  1 
ATOM   2217 C C   . TYR A 1 286 ? -14.038 35.269 13.894  1.00 10.30 ? 305  TYR A C   1 
ATOM   2218 O O   . TYR A 1 286 ? -13.558 35.916 14.828  1.00 11.18 ? 305  TYR A O   1 
ATOM   2219 C CB  . TYR A 1 286 ? -12.689 35.862 11.843  1.00 10.14 ? 305  TYR A CB  1 
ATOM   2220 C CG  . TYR A 1 286 ? -13.751 36.373 10.875  1.00 9.67  ? 305  TYR A CG  1 
ATOM   2221 C CD1 . TYR A 1 286 ? -14.751 37.227 11.300  1.00 9.99  ? 305  TYR A CD1 1 
ATOM   2222 C CD2 . TYR A 1 286 ? -13.710 36.021 9.533   1.00 9.51  ? 305  TYR A CD2 1 
ATOM   2223 C CE1 . TYR A 1 286 ? -15.714 37.677 10.423  1.00 10.03 ? 305  TYR A CE1 1 
ATOM   2224 C CE2 . TYR A 1 286 ? -14.680 36.454 8.644   1.00 9.39  ? 305  TYR A CE2 1 
ATOM   2225 C CZ  . TYR A 1 286 ? -15.671 37.297 9.089   1.00 9.77  ? 305  TYR A CZ  1 
ATOM   2226 O OH  . TYR A 1 286 ? -16.637 37.747 8.231   1.00 10.15 ? 305  TYR A OH  1 
ATOM   2227 N N   . GLU A 1 287 ? -15.342 35.018 13.812  1.00 9.82  ? 306  GLU A N   1 
ATOM   2228 C CA  . GLU A 1 287 ? -16.240 35.409 14.906  1.00 9.96  ? 306  GLU A CA  1 
ATOM   2229 C C   . GLU A 1 287 ? -16.215 34.330 15.972  1.00 9.85  ? 306  GLU A C   1 
ATOM   2230 O O   . GLU A 1 287 ? -16.297 34.602 17.161  1.00 10.08 ? 306  GLU A O   1 
ATOM   2231 C CB  . GLU A 1 287 ? -17.660 35.623 14.370  1.00 9.90  ? 306  GLU A CB  1 
ATOM   2232 C CG  . GLU A 1 287 ? -17.769 36.872 13.487  1.00 10.51 ? 306  GLU A CG  1 
ATOM   2233 C CD  . GLU A 1 287 ? -19.120 37.001 12.814  1.00 10.39 ? 306  GLU A CD  1 
ATOM   2234 O OE1 . GLU A 1 287 ? -19.616 35.989 12.255  1.00 9.76  ? 306  GLU A OE1 1 
ATOM   2235 O OE2 . GLU A 1 287 ? -19.706 38.087 12.874  1.00 10.55 ? 306  GLU A OE2 1 
ATOM   2236 N N   . ILE A 1 288 ? -16.152 33.085 15.527  1.00 9.42  ? 307  ILE A N   1 
ATOM   2237 C CA  . ILE A 1 288 ? -16.062 31.962 16.456  1.00 10.01 ? 307  ILE A CA  1 
ATOM   2238 C C   . ILE A 1 288 ? -14.862 32.074 17.385  1.00 10.40 ? 307  ILE A C   1 
ATOM   2239 O O   . ILE A 1 288 ? -14.997 31.836 18.582  1.00 9.94  ? 307  ILE A O   1 
ATOM   2240 C CB  . ILE A 1 288 ? -16.070 30.613 15.705  1.00 10.32 ? 307  ILE A CB  1 
ATOM   2241 C CG1 . ILE A 1 288 ? -17.465 30.390 15.143  1.00 10.31 ? 307  ILE A CG1 1 
ATOM   2242 C CG2 . ILE A 1 288 ? -15.701 29.442 16.641  1.00 10.95 ? 307  ILE A CG2 1 
ATOM   2243 C CD1 . ILE A 1 288 ? -17.582 29.386 14.024  1.00 10.79 ? 307  ILE A CD1 1 
ATOM   2244 N N   . CYS A 1 289 ? -13.724 32.490 16.859  1.00 10.66 ? 308  CYS A N   1 
ATOM   2245 C CA  . CYS A 1 289 ? -12.530 32.663 17.719  1.00 12.05 ? 308  CYS A CA  1 
ATOM   2246 C C   . CYS A 1 289 ? -12.769 33.645 18.861  1.00 12.49 ? 308  CYS A C   1 
ATOM   2247 O O   . CYS A 1 289 ? -12.256 33.436 19.961  1.00 13.22 ? 308  CYS A O   1 
ATOM   2248 C CB  . CYS A 1 289 ? -11.314 33.078 16.908  1.00 13.59 ? 308  CYS A CB  1 
ATOM   2249 S SG  . CYS A 1 289 ? -10.845 31.704 15.859  1.00 14.97 ? 308  CYS A SG  1 
ATOM   2250 N N   . GLN A 1 290 ? -13.573 34.674 18.627  1.00 11.61 ? 309  GLN A N   1 
ATOM   2251 C CA  . GLN A 1 290 ? -13.985 35.575 19.717  1.00 12.01 ? 309  GLN A CA  1 
ATOM   2252 C C   . GLN A 1 290 ? -15.007 34.942 20.653  1.00 11.78 ? 309  GLN A C   1 
ATOM   2253 O O   . GLN A 1 290 ? -14.919 35.071 21.886  1.00 12.38 ? 309  GLN A O   1 
ATOM   2254 C CB  . GLN A 1 290 ? -14.518 36.881 19.153  1.00 12.85 ? 309  GLN A CB  1 
ATOM   2255 C CG  . GLN A 1 290 ? -13.527 37.625 18.289  1.00 13.63 ? 309  GLN A CG  1 
ATOM   2256 C CD  . GLN A 1 290 ? -12.260 37.956 19.026  1.00 15.18 ? 309  GLN A CD  1 
ATOM   2257 O OE1 . GLN A 1 290 ? -12.293 38.484 20.145  1.00 17.64 ? 309  GLN A OE1 1 
ATOM   2258 N NE2 . GLN A 1 290 ? -11.129 37.626 18.429  1.00 16.77 ? 309  GLN A NE2 1 
ATOM   2259 N N   . PHE A 1 291 ? -15.947 34.207 20.088  1.00 11.29 ? 310  PHE A N   1 
ATOM   2260 C CA  . PHE A 1 291 ? -16.964 33.527 20.871  1.00 11.00 ? 310  PHE A CA  1 
ATOM   2261 C C   . PHE A 1 291 ? -16.355 32.554 21.867  1.00 11.33 ? 310  PHE A C   1 
ATOM   2262 O O   . PHE A 1 291 ? -16.841 32.416 22.993  1.00 11.07 ? 310  PHE A O   1 
ATOM   2263 C CB  . PHE A 1 291 ? -17.916 32.749 19.979  1.00 11.27 ? 310  PHE A CB  1 
ATOM   2264 C CG  . PHE A 1 291 ? -18.959 31.992 20.741  1.00 11.67 ? 310  PHE A CG  1 
ATOM   2265 C CD1 . PHE A 1 291 ? -20.075 32.629 21.251  1.00 12.27 ? 310  PHE A CD1 1 
ATOM   2266 C CD2 . PHE A 1 291 ? -18.822 30.632 20.989  1.00 11.64 ? 310  PHE A CD2 1 
ATOM   2267 C CE1 . PHE A 1 291 ? -21.043 31.929 21.972  1.00 12.12 ? 310  PHE A CE1 1 
ATOM   2268 C CE2 . PHE A 1 291 ? -19.788 29.926 21.694  1.00 11.67 ? 310  PHE A CE2 1 
ATOM   2269 C CZ  . PHE A 1 291 ? -20.898 30.565 22.198  1.00 12.05 ? 310  PHE A CZ  1 
ATOM   2270 N N   . LEU A 1 292 ? -15.297 31.879 21.443  1.00 10.85 ? 311  LEU A N   1 
ATOM   2271 C CA  . LEU A 1 292 ? -14.693 30.816 22.243  1.00 11.31 ? 311  LEU A CA  1 
ATOM   2272 C C   . LEU A 1 292 ? -14.024 31.322 23.512  1.00 11.92 ? 311  LEU A C   1 
ATOM   2273 O O   . LEU A 1 292 ? -13.813 30.546 24.441  1.00 12.24 ? 311  LEU A O   1 
ATOM   2274 C CB  . LEU A 1 292 ? -13.730 29.987 21.390  1.00 11.34 ? 311  LEU A CB  1 
ATOM   2275 C CG  . LEU A 1 292 ? -14.339 29.146 20.268  1.00 11.39 ? 311  LEU A CG  1 
ATOM   2276 C CD1 . LEU A 1 292 ? -13.222 28.427 19.552  1.00 11.75 ? 311  LEU A CD1 1 
ATOM   2277 C CD2 . LEU A 1 292 ? -15.382 28.158 20.780  1.00 11.15 ? 311  LEU A CD2 1 
ATOM   2278 N N   . LYS A 1 293 ? -13.695 32.610 23.557  1.00 12.98 ? 312  LYS A N   1 
ATOM   2279 C CA  . LYS A 1 293 ? -13.114 33.208 24.762  1.00 13.86 ? 312  LYS A CA  1 
ATOM   2280 C C   . LYS A 1 293 ? -14.157 33.206 25.862  1.00 13.74 ? 312  LYS A C   1 
ATOM   2281 O O   . LYS A 1 293 ? -15.215 33.853 25.728  1.00 14.47 ? 312  LYS A O   1 
ATOM   2282 C CB  . LYS A 1 293 ? -12.646 34.641 24.462  1.00 14.38 ? 312  LYS A CB  1 
ATOM   2283 C CG  . LYS A 1 293 ? -11.565 34.677 23.399  1.00 15.88 ? 312  LYS A CG  1 
ATOM   2284 C CD  . LYS A 1 293 ? -11.319 36.100 22.925  1.00 17.04 ? 312  LYS A CD  1 
ATOM   2285 C CE  . LYS A 1 293 ? -10.204 36.161 21.902  1.00 18.81 ? 312  LYS A CE  1 
ATOM   2286 N NZ  . LYS A 1 293 ? -8.904  35.826 22.526  1.00 20.71 ? 312  LYS A NZ  1 
ATOM   2287 N N   . GLY A 1 294 ? -13.888 32.471 26.946  1.00 13.66 ? 313  GLY A N   1 
ATOM   2288 C CA  . GLY A 1 294 ? -14.910 32.231 27.972  1.00 14.35 ? 313  GLY A CA  1 
ATOM   2289 C C   . GLY A 1 294 ? -15.921 31.126 27.748  1.00 14.34 ? 313  GLY A C   1 
ATOM   2290 O O   . GLY A 1 294 ? -16.824 30.936 28.575  1.00 14.58 ? 313  GLY A O   1 
ATOM   2291 N N   . ALA A 1 295 ? -15.794 30.400 26.638  1.00 13.57 ? 314  ALA A N   1 
ATOM   2292 C CA  . ALA A 1 295 ? -16.710 29.310 26.337  1.00 13.31 ? 314  ALA A CA  1 
ATOM   2293 C C   . ALA A 1 295 ? -16.178 27.964 26.835  1.00 12.92 ? 314  ALA A C   1 
ATOM   2294 O O   . ALA A 1 295 ? -15.006 27.829 27.093  1.00 13.33 ? 314  ALA A O   1 
ATOM   2295 C CB  . ALA A 1 295 ? -16.992 29.262 24.834  1.00 13.34 ? 314  ALA A CB  1 
ATOM   2296 N N   . LYS A 1 296 ? -17.057 26.994 27.000  1.00 13.22 ? 315  LYS A N   1 
ATOM   2297 C CA  . LYS A 1 296 ? -16.652 25.617 27.240  1.00 13.28 ? 315  LYS A CA  1 
ATOM   2298 C C   . LYS A 1 296 ? -16.806 24.845 25.940  1.00 12.59 ? 315  LYS A C   1 
ATOM   2299 O O   . LYS A 1 296 ? -17.881 24.858 25.335  1.00 12.89 ? 315  LYS A O   1 
ATOM   2300 C CB  . LYS A 1 296 ? -17.498 25.008 28.346  1.00 14.88 ? 315  LYS A CB  1 
ATOM   2301 C CG  . LYS A 1 296 ? -17.433 23.493 28.422  0.50 15.69 ? 315  LYS A CG  1 
ATOM   2302 C CD  . LYS A 1 296 ? -17.442 22.995 29.859  0.50 16.63 ? 315  LYS A CD  1 
ATOM   2303 C CE  . LYS A 1 296 ? -16.906 21.576 29.950  0.50 17.38 ? 315  LYS A CE  1 
ATOM   2304 N NZ  . LYS A 1 296 ? -17.312 20.955 31.235  0.50 18.03 ? 315  LYS A NZ  1 
ATOM   2305 N N   . ILE A 1 297 ? -15.734 24.177 25.510  1.00 12.47 ? 316  ILE A N   1 
ATOM   2306 C CA  . ILE A 1 297 ? -15.736 23.442 24.244  1.00 11.72 ? 316  ILE A CA  1 
ATOM   2307 C C   . ILE A 1 297 ? -15.751 21.945 24.532  1.00 12.40 ? 316  ILE A C   1 
ATOM   2308 O O   . ILE A 1 297 ? -14.930 21.465 25.343  1.00 13.04 ? 316  ILE A O   1 
ATOM   2309 C CB  . ILE A 1 297 ? -14.505 23.756 23.367  1.00 11.95 ? 316  ILE A CB  1 
ATOM   2310 C CG1 . ILE A 1 297 ? -14.240 25.260 23.250  1.00 12.06 ? 316  ILE A CG1 1 
ATOM   2311 C CG2 . ILE A 1 297 ? -14.682 23.119 21.988  1.00 12.17 ? 316  ILE A CG2 1 
ATOM   2312 C CD1 . ILE A 1 297 ? -12.913 25.593 22.595  1.00 12.42 ? 316  ILE A CD1 1 
ATOM   2313 N N   . THR A 1 298 ? -16.658 21.232 23.875  1.00 12.11 ? 317  THR A N   1 
ATOM   2314 C CA  . THR A 1 298 ? -16.741 19.777 23.940  1.00 12.93 ? 317  THR A CA  1 
ATOM   2315 C C   . THR A 1 298 ? -16.423 19.213 22.550  1.00 12.38 ? 317  THR A C   1 
ATOM   2316 O O   . THR A 1 298 ? -16.943 19.706 21.554  1.00 13.56 ? 317  THR A O   1 
ATOM   2317 C CB  . THR A 1 298 ? -18.172 19.374 24.328  1.00 14.00 ? 317  THR A CB  1 
ATOM   2318 O OG1 . THR A 1 298 ? -18.509 19.899 25.636  1.00 15.22 ? 317  THR A OG1 1 
ATOM   2319 C CG2 . THR A 1 298 ? -18.365 17.888 24.275  1.00 14.04 ? 317  THR A CG2 1 
ATOM   2320 N N   . TRP A 1 299 ? -15.579 18.193 22.490  1.00 11.89 ? 318  TRP A N   1 
ATOM   2321 C CA  . TRP A 1 299 ? -15.329 17.449 21.265  1.00 11.27 ? 318  TRP A CA  1 
ATOM   2322 C C   . TRP A 1 299 ? -16.234 16.221 21.313  1.00 11.13 ? 318  TRP A C   1 
ATOM   2323 O O   . TRP A 1 299 ? -16.064 15.353 22.183  1.00 11.21 ? 318  TRP A O   1 
ATOM   2324 C CB  . TRP A 1 299 ? -13.864 17.025 21.140  1.00 11.41 ? 318  TRP A CB  1 
ATOM   2325 C CG  . TRP A 1 299 ? -13.608 16.268 19.891  1.00 11.24 ? 318  TRP A CG  1 
ATOM   2326 C CD1 . TRP A 1 299 ? -13.654 14.910 19.742  1.00 12.17 ? 318  TRP A CD1 1 
ATOM   2327 C CD2 . TRP A 1 299 ? -13.321 16.805 18.593  1.00 11.33 ? 318  TRP A CD2 1 
ATOM   2328 N NE1 . TRP A 1 299 ? -13.381 14.561 18.429  1.00 12.10 ? 318  TRP A NE1 1 
ATOM   2329 C CE2 . TRP A 1 299 ? -13.193 15.714 17.703  1.00 11.68 ? 318  TRP A CE2 1 
ATOM   2330 C CE3 . TRP A 1 299 ? -13.151 18.100 18.088  1.00 11.73 ? 318  TRP A CE3 1 
ATOM   2331 C CZ2 . TRP A 1 299 ? -12.891 15.888 16.369  1.00 12.27 ? 318  TRP A CZ2 1 
ATOM   2332 C CZ3 . TRP A 1 299 ? -12.848 18.258 16.752  1.00 11.64 ? 318  TRP A CZ3 1 
ATOM   2333 C CH2 . TRP A 1 299 ? -12.751 17.180 15.910  1.00 11.57 ? 318  TRP A CH2 1 
ATOM   2334 N N   . LEU A 1 300 ? -17.151 16.113 20.364  1.00 10.86 ? 319  LEU A N   1 
ATOM   2335 C CA  . LEU A 1 300 ? -18.033 14.956 20.261  1.00 10.51 ? 319  LEU A CA  1 
ATOM   2336 C C   . LEU A 1 300 ? -17.287 13.723 19.731  1.00 10.37 ? 319  LEU A C   1 
ATOM   2337 O O   . LEU A 1 300 ? -16.824 13.707 18.598  1.00 10.87 ? 319  LEU A O   1 
ATOM   2338 C CB  . LEU A 1 300 ? -19.197 15.290 19.299  1.00 10.92 ? 319  LEU A CB  1 
ATOM   2339 C CG  . LEU A 1 300 ? -20.187 16.342 19.777  1.00 11.88 ? 319  LEU A CG  1 
ATOM   2340 C CD1 . LEU A 1 300 ? -21.025 16.871 18.621  1.00 11.90 ? 319  LEU A CD1 1 
ATOM   2341 C CD2 . LEU A 1 300 ? -21.051 15.815 20.905  1.00 12.25 ? 319  LEU A CD2 1 
ATOM   2342 N N   A GLN A 1 301 ? -17.169 12.688 20.562  0.50 10.37 ? 320  GLN A N   1 
ATOM   2343 N N   B GLN A 1 301 ? -17.176 12.682 20.546  0.50 10.05 ? 320  GLN A N   1 
ATOM   2344 C CA  A GLN A 1 301 ? -16.461 11.473 20.161  0.01 10.31 ? 320  GLN A CA  1 
ATOM   2345 C CA  B GLN A 1 301 ? -16.460 11.486 20.117  0.50 9.56  ? 320  GLN A CA  1 
ATOM   2346 C C   A GLN A 1 301 ? -17.260 10.694 19.125  0.50 10.27 ? 320  GLN A C   1 
ATOM   2347 C C   B GLN A 1 301 ? -17.263 10.688 19.114  0.50 9.95  ? 320  GLN A C   1 
ATOM   2348 O O   A GLN A 1 301 ? -16.680 10.032 18.257  0.50 10.85 ? 320  GLN A O   1 
ATOM   2349 O O   B GLN A 1 301 ? -16.690 10.014 18.252  0.50 10.50 ? 320  GLN A O   1 
ATOM   2350 C CB  A GLN A 1 301 ? -16.176 10.584 21.371  0.01 10.26 ? 320  GLN A CB  1 
ATOM   2351 C CB  B GLN A 1 301 ? -16.111 10.632 21.318  0.50 9.80  ? 320  GLN A CB  1 
ATOM   2352 C CG  A GLN A 1 301 ? -15.147 11.161 22.327  0.01 10.23 ? 320  GLN A CG  1 
ATOM   2353 C CG  B GLN A 1 301 ? -14.986 11.265 22.087  0.50 10.16 ? 320  GLN A CG  1 
ATOM   2354 C CD  A GLN A 1 301 ? -13.744 11.149 21.753  0.01 10.21 ? 320  GLN A CD  1 
ATOM   2355 C CD  B GLN A 1 301 ? -14.876 10.793 23.491  0.50 11.40 ? 320  GLN A CD  1 
ATOM   2356 O OE1 A GLN A 1 301 ? -13.030 12.148 21.816  0.01 10.25 ? 320  GLN A OE1 1 
ATOM   2357 O OE1 B GLN A 1 301 ? -14.103 11.343 24.270  0.50 14.32 ? 320  GLN A OE1 1 
ATOM   2358 N NE2 A GLN A 1 301 ? -13.341 10.015 21.189  0.01 10.18 ? 320  GLN A NE2 1 
ATOM   2359 N NE2 B GLN A 1 301 ? -15.637 9.798  23.840  0.50 11.73 ? 320  GLN A NE2 1 
ATOM   2360 N N   . ASP A 1 302 ? -18.587 10.770 19.234  1.00 10.07 ? 321  ASP A N   1 
ATOM   2361 C CA  . ASP A 1 302 ? -19.500 10.106 18.290  1.00 10.38 ? 321  ASP A CA  1 
ATOM   2362 C C   . ASP A 1 302 ? -19.514 10.746 16.909  1.00 10.13 ? 321  ASP A C   1 
ATOM   2363 O O   . ASP A 1 302 ? -19.461 10.022 15.916  1.00 11.57 ? 321  ASP A O   1 
ATOM   2364 C CB  . ASP A 1 302 ? -20.941 10.015 18.842  1.00 10.72 ? 321  ASP A CB  1 
ATOM   2365 C CG  . ASP A 1 302 ? -21.567 11.346 19.175  1.00 11.09 ? 321  ASP A CG  1 
ATOM   2366 O OD1 . ASP A 1 302 ? -22.808 11.367 19.343  1.00 11.94 ? 321  ASP A OD1 1 
ATOM   2367 O OD2 . ASP A 1 302 ? -20.844 12.350 19.344  1.00 11.36 ? 321  ASP A OD2 1 
ATOM   2368 N N   . GLN A 1 303 ? -19.540 12.083 16.845  1.00 10.25 ? 322  GLN A N   1 
ATOM   2369 C CA  . GLN A 1 303 ? -19.684 12.818 15.572  1.00 10.05 ? 322  GLN A CA  1 
ATOM   2370 C C   . GLN A 1 303 ? -18.390 13.417 15.023  1.00 10.13 ? 322  GLN A C   1 
ATOM   2371 O O   . GLN A 1 303 ? -18.330 13.805 13.853  1.00 9.63  ? 322  GLN A O   1 
ATOM   2372 C CB  . GLN A 1 303 ? -20.762 13.922 15.736  1.00 10.74 ? 322  GLN A CB  1 
ATOM   2373 C CG  . GLN A 1 303 ? -22.091 13.328 16.158  1.00 11.50 ? 322  GLN A CG  1 
ATOM   2374 C CD  . GLN A 1 303 ? -23.279 14.213 15.865  1.00 12.31 ? 322  GLN A CD  1 
ATOM   2375 O OE1 . GLN A 1 303 ? -23.691 15.005 16.706  1.00 12.60 ? 322  GLN A OE1 1 
ATOM   2376 N NE2 . GLN A 1 303 ? -23.884 14.015 14.692  1.00 13.08 ? 322  GLN A NE2 1 
ATOM   2377 N N   . GLN A 1 304 ? -17.351 13.435 15.863  1.00 9.80  ? 323  GLN A N   1 
ATOM   2378 C CA  . GLN A 1 304 ? -15.995 13.829 15.535  1.00 10.17 ? 323  GLN A CA  1 
ATOM   2379 C C   . GLN A 1 304 ? -15.887 15.300 15.134  1.00 9.97  ? 323  GLN A C   1 
ATOM   2380 O O   . GLN A 1 304 ? -15.243 15.614 14.152  1.00 10.51 ? 323  GLN A O   1 
ATOM   2381 C CB  . GLN A 1 304 ? -15.388 12.937 14.453  1.00 11.08 ? 323  GLN A CB  1 
ATOM   2382 C CG  . GLN A 1 304 ? -15.479 11.477 14.829  1.00 11.78 ? 323  GLN A CG  1 
ATOM   2383 C CD  . GLN A 1 304 ? -14.894 10.604 13.758  1.00 13.01 ? 323  GLN A CD  1 
ATOM   2384 O OE1 . GLN A 1 304 ? -13.679 10.551 13.590  1.00 15.53 ? 323  GLN A OE1 1 
ATOM   2385 N NE2 . GLN A 1 304 ? -15.757 9.950  13.002  1.00 13.66 ? 323  GLN A NE2 1 
ATOM   2386 N N   . VAL A 1 305 ? -16.516 16.167 15.919  1.00 9.89  ? 324  VAL A N   1 
ATOM   2387 C CA  . VAL A 1 305 ? -16.534 17.617 15.658  1.00 9.72  ? 324  VAL A CA  1 
ATOM   2388 C C   . VAL A 1 305 ? -16.801 18.301 16.992  1.00 9.69  ? 324  VAL A C   1 
ATOM   2389 O O   . VAL A 1 305 ? -17.320 17.689 17.932  1.00 10.43 ? 324  VAL A O   1 
ATOM   2390 C CB  . VAL A 1 305 ? -17.631 18.081 14.649  1.00 9.90  ? 324  VAL A CB  1 
ATOM   2391 C CG1 . VAL A 1 305 ? -17.204 17.802 13.215  1.00 10.18 ? 324  VAL A CG1 1 
ATOM   2392 C CG2 . VAL A 1 305 ? -18.977 17.434 14.953  1.00 9.91  ? 324  VAL A CG2 1 
ATOM   2393 N N   . PRO A 1 306 ? -16.457 19.590 17.077  1.00 9.62  ? 325  PRO A N   1 
ATOM   2394 C CA  . PRO A 1 306 ? -16.667 20.322 18.336  1.00 9.72  ? 325  PRO A CA  1 
ATOM   2395 C C   . PRO A 1 306 ? -17.930 21.143 18.401  1.00 9.97  ? 325  PRO A C   1 
ATOM   2396 O O   . PRO A 1 306 ? -18.469 21.546 17.369  1.00 9.96  ? 325  PRO A O   1 
ATOM   2397 C CB  . PRO A 1 306 ? -15.483 21.270 18.368  1.00 9.48  ? 325  PRO A CB  1 
ATOM   2398 C CG  . PRO A 1 306 ? -15.303 21.606 16.913  1.00 9.58  ? 325  PRO A CG  1 
ATOM   2399 C CD  . PRO A 1 306 ? -15.646 20.351 16.136  1.00 9.55  ? 325  PRO A CD  1 
ATOM   2400 N N   . TYR A 1 307 ? -18.367 21.421 19.618  1.00 10.46 ? 326  TYR A N   1 
ATOM   2401 C CA  . TYR A 1 307 ? -19.340 22.489 19.848  1.00 10.55 ? 326  TYR A CA  1 
ATOM   2402 C C   . TYR A 1 307 ? -18.927 23.264 21.095  1.00 10.96 ? 326  TYR A C   1 
ATOM   2403 O O   . TYR A 1 307 ? -18.216 22.733 21.950  1.00 11.27 ? 326  TYR A O   1 
ATOM   2404 C CB  . TYR A 1 307 ? -20.774 21.978 19.987  1.00 10.75 ? 326  TYR A CB  1 
ATOM   2405 C CG  . TYR A 1 307 ? -21.111 21.283 21.287  1.00 10.37 ? 326  TYR A CG  1 
ATOM   2406 C CD1 . TYR A 1 307 ? -21.685 21.976 22.353  1.00 11.06 ? 326  TYR A CD1 1 
ATOM   2407 C CD2 . TYR A 1 307 ? -20.932 19.902 21.424  1.00 11.12 ? 326  TYR A CD2 1 
ATOM   2408 C CE1 . TYR A 1 307 ? -22.026 21.335 23.557  1.00 11.28 ? 326  TYR A CE1 1 
ATOM   2409 C CE2 . TYR A 1 307 ? -21.297 19.255 22.598  1.00 11.38 ? 326  TYR A CE2 1 
ATOM   2410 C CZ  . TYR A 1 307 ? -21.837 19.987 23.672  1.00 11.28 ? 326  TYR A CZ  1 
ATOM   2411 O OH  . TYR A 1 307 ? -22.182 19.305 24.868  1.00 12.80 ? 326  TYR A OH  1 
ATOM   2412 N N   . ALA A 1 308 ? -19.358 24.509 21.185  1.00 11.26 ? 327  ALA A N   1 
ATOM   2413 C CA  . ALA A 1 308 ? -18.989 25.355 22.314  1.00 11.73 ? 327  ALA A CA  1 
ATOM   2414 C C   . ALA A 1 308 ? -20.239 26.001 22.888  1.00 11.83 ? 327  ALA A C   1 
ATOM   2415 O O   . ALA A 1 308 ? -21.207 26.279 22.172  1.00 11.27 ? 327  ALA A O   1 
ATOM   2416 C CB  . ALA A 1 308 ? -17.991 26.420 21.887  1.00 12.25 ? 327  ALA A CB  1 
ATOM   2417 N N   . VAL A 1 309 ? -20.218 26.218 24.194  1.00 11.72 ? 328  VAL A N   1 
ATOM   2418 C CA  . VAL A 1 309 ? -21.330 26.855 24.905  1.00 12.35 ? 328  VAL A CA  1 
ATOM   2419 C C   . VAL A 1 309 ? -20.786 28.005 25.742  1.00 12.29 ? 328  VAL A C   1 
ATOM   2420 O O   . VAL A 1 309 ? -19.744 27.909 26.398  1.00 11.94 ? 328  VAL A O   1 
ATOM   2421 C CB  . VAL A 1 309 ? -22.028 25.845 25.831  1.00 12.71 ? 328  VAL A CB  1 
ATOM   2422 C CG1 . VAL A 1 309 ? -23.148 26.477 26.659  1.00 13.33 ? 328  VAL A CG1 1 
ATOM   2423 C CG2 . VAL A 1 309 ? -22.567 24.672 25.019  1.00 13.01 ? 328  VAL A CG2 1 
ATOM   2424 N N   . LYS A 1 310 ? -21.512 29.107 25.711  1.00 12.70 ? 329  LYS A N   1 
ATOM   2425 C CA  . LYS A 1 310 ? -21.192 30.262 26.528  1.00 13.25 ? 329  LYS A CA  1 
ATOM   2426 C C   . LYS A 1 310 ? -22.493 30.985 26.837  1.00 14.09 ? 329  LYS A C   1 
ATOM   2427 O O   . LYS A 1 310 ? -23.196 31.421 25.947  1.00 13.15 ? 329  LYS A O   1 
ATOM   2428 C CB  . LYS A 1 310 ? -20.231 31.208 25.820  1.00 14.11 ? 329  LYS A CB  1 
ATOM   2429 C CG  . LYS A 1 310 ? -19.583 32.239 26.758  1.00 14.26 ? 329  LYS A CG  1 
ATOM   2430 C CD  . LYS A 1 310 ? -18.410 32.967 26.113  1.00 15.06 ? 329  LYS A CD  1 
ATOM   2431 C CE  . LYS A 1 310 ? -18.839 33.874 24.965  1.00 16.07 ? 329  LYS A CE  1 
ATOM   2432 N NZ  . LYS A 1 310 ? -17.733 34.739 24.451  1.00 15.94 ? 329  LYS A NZ  1 
ATOM   2433 N N   . GLY A 1 311 ? -22.809 31.119 28.117  1.00 14.93 ? 330  GLY A N   1 
ATOM   2434 C CA  . GLY A 1 311 ? -24.108 31.640 28.505  1.00 15.11 ? 330  GLY A CA  1 
ATOM   2435 C C   . GLY A 1 311 ? -25.193 30.782 27.899  1.00 15.78 ? 330  GLY A C   1 
ATOM   2436 O O   . GLY A 1 311 ? -25.107 29.555 27.942  1.00 17.14 ? 330  GLY A O   1 
ATOM   2437 N N   . ASN A 1 312 ? -26.189 31.411 27.288  1.00 14.57 ? 331  ASN A N   1 
ATOM   2438 C CA  . ASN A 1 312 ? -27.237 30.668 26.623  1.00 14.52 ? 331  ASN A CA  1 
ATOM   2439 C C   . ASN A 1 312 ? -26.973 30.414 25.137  1.00 13.28 ? 331  ASN A C   1 
ATOM   2440 O O   . ASN A 1 312 ? -27.904 30.129 24.392  1.00 14.46 ? 331  ASN A O   1 
ATOM   2441 C CB  . ASN A 1 312 ? -28.585 31.378 26.805  1.00 15.16 ? 331  ASN A CB  1 
ATOM   2442 C CG  . ASN A 1 312 ? -28.674 32.707 26.073  1.00 16.38 ? 331  ASN A CG  1 
ATOM   2443 O OD1 . ASN A 1 312 ? -27.750 33.140 25.381  1.00 16.26 ? 331  ASN A OD1 1 
ATOM   2444 N ND2 . ASN A 1 312 ? -29.816 33.379 26.241  1.00 17.42 ? 331  ASN A ND2 1 
ATOM   2445 N N   . GLN A 1 313 ? -25.719 30.477 24.717  1.00 12.16 ? 332  GLN A N   1 
ATOM   2446 C CA  . GLN A 1 313 ? -25.370 30.329 23.291  1.00 12.29 ? 332  GLN A CA  1 
ATOM   2447 C C   . GLN A 1 313 ? -24.651 29.012 23.054  1.00 11.44 ? 332  GLN A C   1 
ATOM   2448 O O   . GLN A 1 313 ? -23.764 28.635 23.804  1.00 12.70 ? 332  GLN A O   1 
ATOM   2449 C CB  . GLN A 1 313 ? -24.483 31.480 22.830  1.00 12.28 ? 332  GLN A CB  1 
ATOM   2450 C CG  . GLN A 1 313 ? -25.121 32.867 22.917  1.00 12.52 ? 332  GLN A CG  1 
ATOM   2451 C CD  . GLN A 1 313 ? -26.282 33.006 21.958  1.00 12.54 ? 332  GLN A CD  1 
ATOM   2452 O OE1 . GLN A 1 313 ? -26.114 32.893 20.738  1.00 12.55 ? 332  GLN A OE1 1 
ATOM   2453 N NE2 . GLN A 1 313 ? -27.468 33.173 22.497  1.00 13.65 ? 332  GLN A NE2 1 
ATOM   2454 N N   . TRP A 1 314 ? -25.049 28.326 21.998  1.00 11.20 ? 333  TRP A N   1 
ATOM   2455 C CA  . TRP A 1 314 ? -24.527 27.027 21.614  1.00 10.70 ? 333  TRP A CA  1 
ATOM   2456 C C   . TRP A 1 314 ? -24.086 27.116 20.167  1.00 10.41 ? 333  TRP A C   1 
ATOM   2457 O O   . TRP A 1 314 ? -24.876 27.461 19.283  1.00 10.78 ? 333  TRP A O   1 
ATOM   2458 C CB  . TRP A 1 314 ? -25.648 26.005 21.803  1.00 10.34 ? 333  TRP A CB  1 
ATOM   2459 C CG  . TRP A 1 314 ? -25.298 24.489 21.787  1.00 10.49 ? 333  TRP A CG  1 
ATOM   2460 C CD1 . TRP A 1 314 ? -25.271 23.668 22.864  1.00 10.70 ? 333  TRP A CD1 1 
ATOM   2461 C CD2 . TRP A 1 314 ? -24.992 23.674 20.650  1.00 10.75 ? 333  TRP A CD2 1 
ATOM   2462 N NE1 . TRP A 1 314 ? -25.007 22.380 22.478  1.00 11.09 ? 333  TRP A NE1 1 
ATOM   2463 C CE2 . TRP A 1 314 ? -24.821 22.356 21.117  1.00 10.46 ? 333  TRP A CE2 1 
ATOM   2464 C CE3 . TRP A 1 314 ? -24.899 23.912 19.268  1.00 10.93 ? 333  TRP A CE3 1 
ATOM   2465 C CZ2 . TRP A 1 314 ? -24.507 21.297 20.269  1.00 10.63 ? 333  TRP A CZ2 1 
ATOM   2466 C CZ3 . TRP A 1 314 ? -24.586 22.857 18.432  1.00 11.35 ? 333  TRP A CZ3 1 
ATOM   2467 C CH2 . TRP A 1 314 ? -24.407 21.559 18.928  1.00 10.79 ? 333  TRP A CH2 1 
ATOM   2468 N N   . VAL A 1 315 ? -22.820 26.818 19.907  1.00 10.45 ? 334  VAL A N   1 
ATOM   2469 C CA  . VAL A 1 315 ? -22.302 26.939 18.544  1.00 10.40 ? 334  VAL A CA  1 
ATOM   2470 C C   . VAL A 1 315 ? -21.661 25.613 18.123  1.00 9.78  ? 334  VAL A C   1 
ATOM   2471 O O   . VAL A 1 315 ? -20.739 25.145 18.792  1.00 10.68 ? 334  VAL A O   1 
ATOM   2472 C CB  . VAL A 1 315 ? -21.299 28.097 18.436  1.00 10.86 ? 334  VAL A CB  1 
ATOM   2473 C CG1 . VAL A 1 315 ? -20.801 28.251 16.996  1.00 11.66 ? 334  VAL A CG1 1 
ATOM   2474 C CG2 . VAL A 1 315 ? -21.929 29.390 18.920  1.00 11.23 ? 334  VAL A CG2 1 
ATOM   2475 N N   . GLY A 1 316 ? -22.149 25.023 17.027  1.00 9.58  ? 335  GLY A N   1 
ATOM   2476 C CA  . GLY A 1 316 ? -21.487 23.855 16.409  1.00 9.74  ? 335  GLY A CA  1 
ATOM   2477 C C   . GLY A 1 316 ? -20.665 24.330 15.235  1.00 9.72  ? 335  GLY A C   1 
ATOM   2478 O O   . GLY A 1 316 ? -21.208 25.023 14.355  1.00 11.31 ? 335  GLY A O   1 
ATOM   2479 N N   . TYR A 1 317 ? -19.369 24.017 15.219  1.00 9.38  ? 336  TYR A N   1 
ATOM   2480 C CA  . TYR A 1 317 ? -18.454 24.593 14.249  1.00 9.37  ? 336  TYR A CA  1 
ATOM   2481 C C   . TYR A 1 317 ? -17.355 23.590 13.916  1.00 9.76  ? 336  TYR A C   1 
ATOM   2482 O O   . TYR A 1 317 ? -17.323 22.478 14.469  1.00 9.84  ? 336  TYR A O   1 
ATOM   2483 C CB  . TYR A 1 317 ? -17.872 25.931 14.793  1.00 9.44  ? 336  TYR A CB  1 
ATOM   2484 C CG  . TYR A 1 317 ? -16.936 25.730 15.966  1.00 10.06 ? 336  TYR A CG  1 
ATOM   2485 C CD1 . TYR A 1 317 ? -17.438 25.420 17.209  1.00 10.65 ? 336  TYR A CD1 1 
ATOM   2486 C CD2 . TYR A 1 317 ? -15.567 25.793 15.812  1.00 10.50 ? 336  TYR A CD2 1 
ATOM   2487 C CE1 . TYR A 1 317 ? -16.603 25.175 18.273  1.00 11.02 ? 336  TYR A CE1 1 
ATOM   2488 C CE2 . TYR A 1 317 ? -14.704 25.598 16.882  1.00 10.87 ? 336  TYR A CE2 1 
ATOM   2489 C CZ  . TYR A 1 317 ? -15.248 25.277 18.117  1.00 10.96 ? 336  TYR A CZ  1 
ATOM   2490 O OH  . TYR A 1 317 ? -14.428 25.028 19.203  1.00 13.77 ? 336  TYR A OH  1 
ATOM   2491 N N   . ASP A 1 318 ? -16.453 23.997 13.032  1.00 10.33 ? 337  ASP A N   1 
ATOM   2492 C CA  . ASP A 1 318 ? -15.312 23.195 12.654  1.00 10.63 ? 337  ASP A CA  1 
ATOM   2493 C C   . ASP A 1 318 ? -14.022 23.936 12.979  1.00 11.32 ? 337  ASP A C   1 
ATOM   2494 O O   . ASP A 1 318 ? -13.853 25.130 12.640  1.00 10.09 ? 337  ASP A O   1 
ATOM   2495 C CB  . ASP A 1 318 ? -15.357 22.892 11.151  1.00 11.24 ? 337  ASP A CB  1 
ATOM   2496 C CG  . ASP A 1 318 ? -16.326 21.760 10.795  1.00 11.39 ? 337  ASP A CG  1 
ATOM   2497 O OD1 . ASP A 1 318 ? -15.856 20.644 10.479  1.00 12.15 ? 337  ASP A OD1 1 
ATOM   2498 O OD2 . ASP A 1 318 ? -17.554 21.937 10.826  1.00 11.31 ? 337  ASP A OD2 1 
ATOM   2499 N N   . ASP A 1 319 ? -13.080 23.198 13.556  1.00 11.56 ? 338  ASP A N   1 
ATOM   2500 C CA  . ASP A 1 319 ? -11.785 23.738 13.944  1.00 11.44 ? 338  ASP A CA  1 
ATOM   2501 C C   . ASP A 1 319 ? -10.666 23.001 13.248  1.00 11.00 ? 338  ASP A C   1 
ATOM   2502 O O   . ASP A 1 319 ? -10.895 22.195 12.336  1.00 10.29 ? 338  ASP A O   1 
ATOM   2503 C CB  . ASP A 1 319 ? -11.631 23.686 15.479  1.00 12.29 ? 338  ASP A CB  1 
ATOM   2504 C CG  . ASP A 1 319 ? -11.702 22.285 16.039  1.00 13.04 ? 338  ASP A CG  1 
ATOM   2505 O OD1 . ASP A 1 319 ? -11.936 21.334 15.296  1.00 10.98 ? 338  ASP A OD1 1 
ATOM   2506 O OD2 . ASP A 1 319 ? -11.607 22.182 17.288  1.00 16.01 ? 338  ASP A OD2 1 
ATOM   2507 N N   . VAL A 1 320 ? -9.450  23.303 13.657  1.00 10.21 ? 339  VAL A N   1 
ATOM   2508 C CA  . VAL A 1 320 ? -8.294  22.681 13.053  1.00 10.02 ? 339  VAL A CA  1 
ATOM   2509 C C   . VAL A 1 320 ? -8.340  21.173 13.257  1.00 9.36  ? 339  VAL A C   1 
ATOM   2510 O O   . VAL A 1 320 ? -8.048  20.448 12.323  1.00 9.74  ? 339  VAL A O   1 
ATOM   2511 C CB  . VAL A 1 320 ? -6.984  23.263 13.582  1.00 10.98 ? 339  VAL A CB  1 
ATOM   2512 C CG1 . VAL A 1 320 ? -5.812  22.450 13.073  1.00 10.76 ? 339  VAL A CG1 1 
ATOM   2513 C CG2 . VAL A 1 320 ? -6.820  24.706 13.138  1.00 11.28 ? 339  VAL A CG2 1 
ATOM   2514 N N   . LYS A 1 321 ? -8.696  20.684 14.445  1.00 8.70  ? 340  LYS A N   1 
ATOM   2515 C CA  . LYS A 1 321 ? -8.798  19.225 14.633  0.72 7.95  ? 340  LYS A CA  1 
ATOM   2516 C C   . LYS A 1 321 ? -9.838  18.655 13.652  1.00 8.00  ? 340  LYS A C   1 
ATOM   2517 O O   . LYS A 1 321 ? -9.588  17.599 13.087  1.00 9.23  ? 340  LYS A O   1 
ATOM   2518 C CB  . LYS A 1 321 ? -9.126  18.802 16.058  0.72 7.88  ? 340  LYS A CB  1 
ATOM   2519 C CG  . LYS A 1 321 ? -9.090  17.315 16.283  0.72 7.95  ? 340  LYS A CG  1 
ATOM   2520 C CD  . LYS A 1 321 ? -9.513  16.949 17.708  0.72 8.12  ? 340  LYS A CD  1 
ATOM   2521 C CE  . LYS A 1 321 ? -9.641  15.425 17.867  0.72 8.73  ? 340  LYS A CE  1 
ATOM   2522 N NZ  . LYS A 1 321 ? -10.143 14.980 19.185  0.72 9.35  ? 340  LYS A NZ  1 
ATOM   2523 N N   . SER A 1 322 ? -10.959 19.341 13.439  0.64 7.28  ? 341  SER A N   1 
ATOM   2524 C CA  . SER A 1 322 ? -11.946 18.858 12.456  0.64 7.51  ? 341  SER A CA  1 
ATOM   2525 C C   . SER A 1 322 ? -11.381 18.846 11.033  0.64 7.58  ? 341  SER A C   1 
ATOM   2526 O O   . SER A 1 322 ? -11.616 17.911 10.279  0.64 7.04  ? 341  SER A O   1 
ATOM   2527 C CB  . SER A 1 322 ? -13.242 19.649 12.509  0.64 7.47  ? 341  SER A CB  1 
ATOM   2528 O OG  . SER A 1 322 ? -14.189 18.980 11.698  0.64 7.65  ? 341  SER A OG  1 
ATOM   2529 N N   . MET A 1 323 ? -10.621 19.872 10.665  1.00 9.20  ? 342  MET A N   1 
ATOM   2530 C CA  . MET A 1 323 ? -9.999  19.884 9.315   1.00 9.90  ? 342  MET A CA  1 
ATOM   2531 C C   . MET A 1 323 ? -9.146  18.617 9.087   1.00 10.68 ? 342  MET A C   1 
ATOM   2532 O O   . MET A 1 323 ? -9.248  17.918 8.063   1.00 10.68 ? 342  MET A O   1 
ATOM   2533 C CB  . MET A 1 323 ? -9.074  21.099 9.119   1.00 10.08 ? 342  MET A CB  1 
ATOM   2534 C CG  . MET A 1 323 ? -9.698  22.486 9.256   1.00 10.28 ? 342  MET A CG  1 
ATOM   2535 S SD  . MET A 1 323 ? -11.094 22.816 8.148   1.00 11.28 ? 342  MET A SD  1 
ATOM   2536 C CE  . MET A 1 323 ? -12.450 22.478 9.235   1.00 12.02 ? 342  MET A CE  1 
ATOM   2537 N N   . GLU A 1 324 ? -8.270  18.318 10.046  1.00 10.76 ? 343  GLU A N   1 
ATOM   2538 C CA  . GLU A 1 324 ? -7.333  17.214 9.878   1.00 10.94 ? 343  GLU A CA  1 
ATOM   2539 C C   . GLU A 1 324 ? -8.078  15.876 9.901   1.00 10.58 ? 343  GLU A C   1 
ATOM   2540 O O   . GLU A 1 324 ? -7.756  14.970 9.120   1.00 9.89  ? 343  GLU A O   1 
ATOM   2541 C CB  . GLU A 1 324 ? -6.191  17.241 10.920  1.00 12.08 ? 343  GLU A CB  1 
ATOM   2542 C CG  . GLU A 1 324 ? -6.562  17.070 12.380  0.50 12.61 ? 343  GLU A CG  1 
ATOM   2543 C CD  . GLU A 1 324 ? -5.447  17.455 13.369  1.00 13.84 ? 343  GLU A CD  1 
ATOM   2544 O OE1 . GLU A 1 324 ? -4.294  17.742 12.932  1.00 15.63 ? 343  GLU A OE1 1 
ATOM   2545 O OE2 . GLU A 1 324 ? -5.700  17.408 14.608  1.00 12.94 ? 343  GLU A OE2 1 
ATOM   2546 N N   . THR A 1 325 ? -9.093  15.775 10.749  1.00 9.94  ? 344  THR A N   1 
ATOM   2547 C CA  . THR A 1 325 ? -9.953  14.594 10.799  1.00 10.34 ? 344  THR A CA  1 
ATOM   2548 C C   . THR A 1 325 ? -10.698 14.357 9.492   1.00 9.95  ? 344  THR A C   1 
ATOM   2549 O O   . THR A 1 325 ? -10.727 13.234 8.980   1.00 10.31 ? 344  THR A O   1 
ATOM   2550 C CB  . THR A 1 325 ? -10.923 14.657 11.990  1.00 10.81 ? 344  THR A CB  1 
ATOM   2551 O OG1 . THR A 1 325 ? -10.150 14.874 13.184  1.00 11.99 ? 344  THR A OG1 1 
ATOM   2552 C CG2 . THR A 1 325 ? -11.681 13.357 12.162  1.00 11.63 ? 344  THR A CG2 1 
ATOM   2553 N N   . LYS A 1 326 ? -11.287 15.408 8.949   1.00 9.52  ? 345  LYS A N   1 
ATOM   2554 C CA  . LYS A 1 326 ? -12.056 15.291 7.697   1.00 9.52  ? 345  LYS A CA  1 
ATOM   2555 C C   . LYS A 1 326 ? -11.137 15.012 6.492   1.00 9.79  ? 345  LYS A C   1 
ATOM   2556 O O   . LYS A 1 326 ? -11.498 14.251 5.607   1.00 10.06 ? 345  LYS A O   1 
ATOM   2557 C CB  . LYS A 1 326 ? -12.919 16.548 7.486   1.00 9.84  ? 345  LYS A CB  1 
ATOM   2558 C CG  . LYS A 1 326 ? -14.188 16.508 8.313   1.00 9.52  ? 345  LYS A CG  1 
ATOM   2559 C CD  . LYS A 1 326 ? -15.009 17.799 8.306   1.00 9.74  ? 345  LYS A CD  1 
ATOM   2560 C CE  . LYS A 1 326 ? -16.303 17.570 9.046   1.00 10.09 ? 345  LYS A CE  1 
ATOM   2561 N NZ  . LYS A 1 326 ? -17.146 18.790 9.069   1.00 10.36 ? 345  LYS A NZ  1 
ATOM   2562 N N   . VAL A 1 327 ? -9.929  15.575 6.495   1.00 10.29 ? 346  VAL A N   1 
ATOM   2563 C CA  . VAL A 1 327 ? -8.964  15.256 5.448   1.00 10.88 ? 346  VAL A CA  1 
ATOM   2564 C C   . VAL A 1 327 ? -8.547  13.792 5.538   1.00 11.15 ? 346  VAL A C   1 
ATOM   2565 O O   . VAL A 1 327 ? -8.511  13.134 4.508   1.00 11.37 ? 346  VAL A O   1 
ATOM   2566 C CB  . VAL A 1 327 ? -7.762  16.202 5.458   1.00 10.43 ? 346  VAL A CB  1 
ATOM   2567 C CG1 . VAL A 1 327 ? -6.606  15.687 4.599   1.00 10.71 ? 346  VAL A CG1 1 
ATOM   2568 C CG2 . VAL A 1 327 ? -8.192  17.567 4.965   1.00 10.77 ? 346  VAL A CG2 1 
ATOM   2569 N N   . GLN A 1 328 ? -8.246  13.267 6.734   1.00 11.77 ? 347  GLN A N   1 
ATOM   2570 C CA  . GLN A 1 328 ? -7.901  11.832 6.832   1.00 12.89 ? 347  GLN A CA  1 
ATOM   2571 C C   . GLN A 1 328 ? -9.012  10.955 6.267   1.00 12.22 ? 347  GLN A C   1 
ATOM   2572 O O   . GLN A 1 328 ? -8.750  10.020 5.480   1.00 11.94 ? 347  GLN A O   1 
ATOM   2573 C CB  . GLN A 1 328 ? -7.564  11.387 8.256   1.00 14.93 ? 347  GLN A CB  1 
ATOM   2574 C CG  . GLN A 1 328 ? -6.980  9.965  8.279   1.00 16.64 ? 347  GLN A CG  1 
ATOM   2575 C CD  . GLN A 1 328 ? -5.748  9.829  7.382   1.00 18.91 ? 347  GLN A CD  1 
ATOM   2576 O OE1 . GLN A 1 328 ? -4.705  10.437 7.638   1.00 22.65 ? 347  GLN A OE1 1 
ATOM   2577 N NE2 . GLN A 1 328 ? -5.877  9.066  6.291   1.00 19.81 ? 347  GLN A NE2 1 
ATOM   2578 N N   . PHE A 1 329 ? -10.253 11.282 6.625   1.00 11.46 ? 348  PHE A N   1 
ATOM   2579 C CA  . PHE A 1 329 ? -11.408 10.581 6.114   1.00 11.92 ? 348  PHE A CA  1 
ATOM   2580 C C   . PHE A 1 329 ? -11.475 10.633 4.595   1.00 11.71 ? 348  PHE A C   1 
ATOM   2581 O O   . PHE A 1 329 ? -11.704 9.599  3.958   1.00 11.78 ? 348  PHE A O   1 
ATOM   2582 C CB  . PHE A 1 329 ? -12.704 11.132 6.707   1.00 11.90 ? 348  PHE A CB  1 
ATOM   2583 C CG  . PHE A 1 329 ? -13.937 10.647 5.982   1.00 12.42 ? 348  PHE A CG  1 
ATOM   2584 C CD1 . PHE A 1 329 ? -14.367 9.328  6.106   1.00 13.87 ? 348  PHE A CD1 1 
ATOM   2585 C CD2 . PHE A 1 329 ? -14.623 11.492 5.147   1.00 12.87 ? 348  PHE A CD2 1 
ATOM   2586 C CE1 . PHE A 1 329 ? -15.472 8.875  5.399   1.00 13.94 ? 348  PHE A CE1 1 
ATOM   2587 C CE2 . PHE A 1 329 ? -15.727 11.050 4.440   1.00 12.96 ? 348  PHE A CE2 1 
ATOM   2588 C CZ  . PHE A 1 329 ? -16.167 9.750  4.572   1.00 14.05 ? 348  PHE A CZ  1 
ATOM   2589 N N   . LEU A 1 330 ? -11.281 11.802 3.990   1.00 10.77 ? 349  LEU A N   1 
ATOM   2590 C CA  . LEU A 1 330 ? -11.463 11.870 2.532   1.00 11.34 ? 349  LEU A CA  1 
ATOM   2591 C C   . LEU A 1 330 ? -10.345 11.078 1.828   1.00 12.19 ? 349  LEU A C   1 
ATOM   2592 O O   . LEU A 1 330 ? -10.565 10.470 0.782   1.00 12.49 ? 349  LEU A O   1 
ATOM   2593 C CB  . LEU A 1 330 ? -11.603 13.332 2.025   1.00 11.08 ? 349  LEU A CB  1 
ATOM   2594 C CG  . LEU A 1 330 ? -10.358 14.206 1.961   1.00 10.78 ? 349  LEU A CG  1 
ATOM   2595 C CD1 . LEU A 1 330 ? -9.542  14.016 0.685   1.00 10.77 ? 349  LEU A CD1 1 
ATOM   2596 C CD2 . LEU A 1 330 ? -10.710 15.687 2.094   1.00 10.92 ? 349  LEU A CD2 1 
ATOM   2597 N N   . LYS A 1 331 ? -9.139  11.087 2.402   1.00 12.25 ? 350  LYS A N   1 
ATOM   2598 C CA  . LYS A 1 331 ? -8.057  10.288 1.842   1.00 13.12 ? 350  LYS A CA  1 
ATOM   2599 C C   . LYS A 1 331 ? -8.393  8.822  1.948   1.00 14.09 ? 350  LYS A C   1 
ATOM   2600 O O   . LYS A 1 331 ? -8.217  8.068  0.968   1.00 14.66 ? 350  LYS A O   1 
ATOM   2601 C CB  . LYS A 1 331 ? -6.738  10.561 2.547   1.00 13.52 ? 350  LYS A CB  1 
ATOM   2602 C CG  . LYS A 1 331 ? -6.172  11.928 2.283   1.00 14.62 ? 350  LYS A CG  1 
ATOM   2603 C CD  . LYS A 1 331 ? -4.737  11.911 2.737   1.00 15.14 ? 350  LYS A CD  1 
ATOM   2604 C CE  . LYS A 1 331 ? -4.113  13.256 2.586   1.00 16.10 ? 350  LYS A CE  1 
ATOM   2605 N NZ  . LYS A 1 331 ? -2.687  13.171 2.965   1.00 17.36 ? 350  LYS A NZ  1 
ATOM   2606 N N   . ASN A 1 332 ? -8.916  8.408  3.100   1.00 14.11 ? 351  ASN A N   1 
ATOM   2607 C CA  . ASN A 1 332 ? -9.304  7.010  3.297   1.00 15.21 ? 351  ASN A CA  1 
ATOM   2608 C C   . ASN A 1 332 ? -10.360 6.510  2.329   1.00 15.85 ? 351  ASN A C   1 
ATOM   2609 O O   . ASN A 1 332 ? -10.375 5.317  1.982   1.00 17.46 ? 351  ASN A O   1 
ATOM   2610 C CB  . ASN A 1 332 ? -9.780  6.783  4.732   1.00 16.64 ? 351  ASN A CB  1 
ATOM   2611 C CG  . ASN A 1 332 ? -8.665  6.868  5.724   1.00 17.91 ? 351  ASN A CG  1 
ATOM   2612 O OD1 . ASN A 1 332 ? -7.499  6.956  5.361   1.00 21.76 ? 351  ASN A OD1 1 
ATOM   2613 N ND2 . ASN A 1 332 ? -9.010  6.848  6.979   1.00 21.06 ? 351  ASN A ND2 1 
ATOM   2614 N N   . LEU A 1 333 ? -11.222 7.416  1.880   1.00 16.02 ? 352  LEU A N   1 
ATOM   2615 C CA  . LEU A 1 333 ? -12.304 7.082  0.934   1.00 16.31 ? 352  LEU A CA  1 
ATOM   2616 C C   . LEU A 1 333 ? -11.932 7.374  -0.521  1.00 14.66 ? 352  LEU A C   1 
ATOM   2617 O O   . LEU A 1 333 ? -12.760 7.227  -1.406  1.00 15.90 ? 352  LEU A O   1 
ATOM   2618 C CB  . LEU A 1 333 ? -13.594 7.814  1.334   1.00 17.15 ? 352  LEU A CB  1 
ATOM   2619 C CG  . LEU A 1 333 ? -14.548 7.085  2.269   1.00 18.40 ? 352  LEU A CG  1 
ATOM   2620 C CD1 . LEU A 1 333 ? -15.254 5.971  1.529   1.00 20.04 ? 352  LEU A CD1 1 
ATOM   2621 C CD2 . LEU A 1 333 ? -13.835 6.540  3.501   1.00 18.63 ? 352  LEU A CD2 1 
ATOM   2622 N N   . ASN A 1 334 ? -10.691 7.763  -0.766  1.00 14.67 ? 353  ASN A N   1 
ATOM   2623 C CA  . ASN A 1 334 ? -10.186 8.004  -2.104  1.00 14.94 ? 353  ASN A CA  1 
ATOM   2624 C C   . ASN A 1 334 ? -10.993 9.069  -2.816  1.00 13.98 ? 353  ASN A C   1 
ATOM   2625 O O   . ASN A 1 334 ? -11.303 8.970  -3.995  1.00 13.21 ? 353  ASN A O   1 
ATOM   2626 C CB  . ASN A 1 334 ? -10.157 6.701  -2.898  1.00 16.30 ? 353  ASN A CB  1 
ATOM   2627 C CG  . ASN A 1 334 ? -9.253  5.658  -2.265  1.00 18.52 ? 353  ASN A CG  1 
ATOM   2628 O OD1 . ASN A 1 334 ? -9.664  4.514  -2.080  1.00 23.35 ? 353  ASN A OD1 1 
ATOM   2629 N ND2 . ASN A 1 334 ? -8.049  6.039  -1.924  1.00 17.74 ? 353  ASN A ND2 1 
ATOM   2630 N N   . LEU A 1 335 ? -11.321 10.114 -2.066  1.00 12.76 ? 354  LEU A N   1 
ATOM   2631 C CA  . LEU A 1 335 ? -12.046 11.219 -2.651  1.00 11.63 ? 354  LEU A CA  1 
ATOM   2632 C C   . LEU A 1 335 ? -11.133 12.087 -3.476  1.00 11.03 ? 354  LEU A C   1 
ATOM   2633 O O   . LEU A 1 335 ? -9.895  11.968 -3.425  1.00 11.71 ? 354  LEU A O   1 
ATOM   2634 C CB  . LEU A 1 335 ? -12.782 12.019 -1.556  1.00 10.80 ? 354  LEU A CB  1 
ATOM   2635 C CG  . LEU A 1 335 ? -13.753 11.223 -0.683  1.00 11.32 ? 354  LEU A CG  1 
ATOM   2636 C CD1 . LEU A 1 335 ? -14.679 12.157 0.094   1.00 11.65 ? 354  LEU A CD1 1 
ATOM   2637 C CD2 . LEU A 1 335 ? -14.636 10.238 -1.446  1.00 11.19 ? 354  LEU A CD2 1 
ATOM   2638 N N   . GLY A 1 336 ? -11.723 12.980 -4.268  1.00 10.90 ? 355  GLY A N   1 
ATOM   2639 C CA  . GLY A 1 336 ? -10.944 13.845 -5.113  1.00 11.13 ? 355  GLY A CA  1 
ATOM   2640 C C   . GLY A 1 336 ? -10.241 14.994 -4.435  1.00 10.76 ? 355  GLY A C   1 
ATOM   2641 O O   . GLY A 1 336 ? -9.347  15.620 -5.008  1.00 11.68 ? 355  GLY A O   1 
ATOM   2642 N N   . GLY A 1 337 ? -10.627 15.273 -3.192  1.00 11.21 ? 356  GLY A N   1 
ATOM   2643 C CA  . GLY A 1 337 ? -10.118 16.420 -2.473  1.00 10.32 ? 356  GLY A CA  1 
ATOM   2644 C C   . GLY A 1 337 ? -11.159 17.018 -1.536  1.00 9.83  ? 356  GLY A C   1 
ATOM   2645 O O   . GLY A 1 337 ? -12.185 16.402 -1.223  1.00 9.76  ? 356  GLY A O   1 
ATOM   2646 N N   . ALA A 1 338 ? -10.856 18.236 -1.095  1.00 10.21 ? 357  ALA A N   1 
ATOM   2647 C CA  . ALA A 1 338 ? -11.682 19.020 -0.210  1.00 9.90  ? 357  ALA A CA  1 
ATOM   2648 C C   . ALA A 1 338 ? -12.128 20.306 -0.882  1.00 9.90  ? 357  ALA A C   1 
ATOM   2649 O O   . ALA A 1 338 ? -11.396 20.888 -1.662  1.00 10.50 ? 357  ALA A O   1 
ATOM   2650 C CB  . ALA A 1 338 ? -10.906 19.363 1.055   1.00 10.27 ? 357  ALA A CB  1 
ATOM   2651 N N   . MET A 1 339 ? -13.331 20.720 -0.539  1.00 10.15 ? 358  MET A N   1 
ATOM   2652 C CA  . MET A 1 339 ? -13.857 21.994 -0.972  1.00 9.93  ? 358  MET A CA  1 
ATOM   2653 C C   . MET A 1 339 ? -14.100 22.801 0.294   1.00 9.75  ? 358  MET A C   1 
ATOM   2654 O O   . MET A 1 339 ? -14.442 22.226 1.325   1.00 10.14 ? 358  MET A O   1 
ATOM   2655 C CB  . MET A 1 339 ? -15.134 21.770 -1.792  1.00 10.28 ? 358  MET A CB  1 
ATOM   2656 C CG  . MET A 1 339 ? -15.907 23.079 -2.053  1.00 10.30 ? 358  MET A CG  1 
ATOM   2657 S SD  . MET A 1 339 ? -17.069 23.496 -0.758  1.00 10.60 ? 358  MET A SD  1 
ATOM   2658 C CE  . MET A 1 339 ? -18.390 22.369 -1.168  1.00 10.88 ? 358  MET A CE  1 
ATOM   2659 N N   . ILE A 1 340 ? -13.917 24.124 0.208   1.00 9.59  ? 359  ILE A N   1 
ATOM   2660 C CA  . ILE A 1 340 ? -14.122 24.994 1.358   1.00 9.89  ? 359  ILE A CA  1 
ATOM   2661 C C   . ILE A 1 340 ? -15.243 25.995 1.081   1.00 8.96  ? 359  ILE A C   1 
ATOM   2662 O O   . ILE A 1 340 ? -15.181 26.746 0.116   1.00 9.55  ? 359  ILE A O   1 
ATOM   2663 C CB  . ILE A 1 340 ? -12.894 25.814 1.684   1.00 10.01 ? 359  ILE A CB  1 
ATOM   2664 C CG1 . ILE A 1 340 ? -11.612 24.948 1.787   1.00 10.36 ? 359  ILE A CG1 1 
ATOM   2665 C CG2 . ILE A 1 340 ? -13.173 26.676 2.926   1.00 10.25 ? 359  ILE A CG2 1 
ATOM   2666 C CD1 . ILE A 1 340 ? -11.586 23.976 2.930   1.00 10.52 ? 359  ILE A CD1 1 
ATOM   2667 N N   . TRP A 1 341 ? -16.253 26.002 1.941   1.00 8.72  ? 360  TRP A N   1 
ATOM   2668 C CA  . TRP A 1 341 ? -17.239 27.068 1.961   1.00 8.74  ? 360  TRP A CA  1 
ATOM   2669 C C   . TRP A 1 341 ? -17.116 27.870 3.272   1.00 8.79  ? 360  TRP A C   1 
ATOM   2670 O O   . TRP A 1 341 ? -17.533 27.368 4.339   1.00 8.70  ? 360  TRP A O   1 
ATOM   2671 C CB  . TRP A 1 341 ? -18.668 26.576 1.819   1.00 8.82  ? 360  TRP A CB  1 
ATOM   2672 C CG  . TRP A 1 341 ? -19.607 27.770 1.757   1.00 9.16  ? 360  TRP A CG  1 
ATOM   2673 C CD1 . TRP A 1 341 ? -20.194 28.427 2.822   1.00 8.96  ? 360  TRP A CD1 1 
ATOM   2674 C CD2 . TRP A 1 341 ? -19.920 28.546 0.591   1.00 9.24  ? 360  TRP A CD2 1 
ATOM   2675 N NE1 . TRP A 1 341 ? -20.888 29.537 2.371   1.00 9.30  ? 360  TRP A NE1 1 
ATOM   2676 C CE2 . TRP A 1 341 ? -20.753 29.617 1.010   1.00 9.09  ? 360  TRP A CE2 1 
ATOM   2677 C CE3 . TRP A 1 341 ? -19.626 28.418 -0.766  1.00 9.40  ? 360  TRP A CE3 1 
ATOM   2678 C CZ2 . TRP A 1 341 ? -21.249 30.563 0.125   1.00 9.27  ? 360  TRP A CZ2 1 
ATOM   2679 C CZ3 . TRP A 1 341 ? -20.148 29.375 -1.656  1.00 9.76  ? 360  TRP A CZ3 1 
ATOM   2680 C CH2 . TRP A 1 341 ? -20.926 30.432 -1.191  1.00 9.55  ? 360  TRP A CH2 1 
ATOM   2681 N N   . SER A 1 342 ? -16.552 29.080 3.240   1.00 9.39  ? 361  SER A N   1 
ATOM   2682 C CA  . SER A 1 342 ? -15.876 29.744 2.116   1.00 9.39  ? 361  SER A CA  1 
ATOM   2683 C C   . SER A 1 342 ? -14.615 30.393 2.695   1.00 9.42  ? 361  SER A C   1 
ATOM   2684 O O   . SER A 1 342 ? -14.508 30.641 3.900   1.00 8.94  ? 361  SER A O   1 
ATOM   2685 C CB  . SER A 1 342 ? -16.790 30.779 1.445   1.00 10.02 ? 361  SER A CB  1 
ATOM   2686 O OG  . SER A 1 342 ? -17.209 31.770 2.377   1.00 10.61 ? 361  SER A OG  1 
ATOM   2687 N N   . ILE A 1 343 ? -13.623 30.654 1.859   1.00 9.05  ? 362  ILE A N   1 
ATOM   2688 C CA  . ILE A 1 343 ? -12.322 31.028 2.407   1.00 8.96  ? 362  ILE A CA  1 
ATOM   2689 C C   . ILE A 1 343 ? -12.398 32.418 3.061   1.00 9.44  ? 362  ILE A C   1 
ATOM   2690 O O   . ILE A 1 343 ? -11.597 32.732 3.938   1.00 9.19  ? 362  ILE A O   1 
ATOM   2691 C CB  . ILE A 1 343 ? -11.165 30.930 1.392   1.00 9.33  ? 362  ILE A CB  1 
ATOM   2692 C CG1 . ILE A 1 343 ? -11.365 31.912 0.237   1.00 9.38  ? 362  ILE A CG1 1 
ATOM   2693 C CG2 . ILE A 1 343 ? -11.040 29.496 0.887   1.00 9.09  ? 362  ILE A CG2 1 
ATOM   2694 C CD1 . ILE A 1 343 ? -10.154 32.037 -0.654  1.00 9.88  ? 362  ILE A CD1 1 
ATOM   2695 N N   . ASP A 1 344 ? -13.363 33.215 2.638   1.00 9.29  ? 363  ASP A N   1 
ATOM   2696 C CA  . ASP A 1 344 ? -13.549 34.540 3.200   1.00 9.87  ? 363  ASP A CA  1 
ATOM   2697 C C   . ASP A 1 344 ? -14.255 34.526 4.569   1.00 10.23 ? 363  ASP A C   1 
ATOM   2698 O O   . ASP A 1 344 ? -14.446 35.596 5.175   1.00 10.27 ? 363  ASP A O   1 
ATOM   2699 C CB  . ASP A 1 344 ? -14.199 35.522 2.211   1.00 9.96  ? 363  ASP A CB  1 
ATOM   2700 C CG  . ASP A 1 344 ? -15.395 34.959 1.436   1.00 10.36 ? 363  ASP A CG  1 
ATOM   2701 O OD1 . ASP A 1 344 ? -15.664 33.728 1.439   1.00 11.38 ? 363  ASP A OD1 1 
ATOM   2702 O OD2 . ASP A 1 344 ? -16.025 35.769 0.741   1.00 10.98 ? 363  ASP A OD2 1 
ATOM   2703 N N   . MET A 1 345 ? -14.578 33.327 5.070   1.00 9.68  ? 364  MET A N   1 
ATOM   2704 C CA  . MET A 1 345 ? -15.046 33.182 6.464   1.00 10.03 ? 364  MET A CA  1 
ATOM   2705 C C   . MET A 1 345 ? -14.042 32.480 7.354   1.00 9.55  ? 364  MET A C   1 
ATOM   2706 O O   . MET A 1 345 ? -14.270 32.411 8.547   1.00 9.24  ? 364  MET A O   1 
ATOM   2707 C CB  . MET A 1 345 ? -16.393 32.479 6.528   1.00 10.26 ? 364  MET A CB  1 
ATOM   2708 C CG  . MET A 1 345 ? -17.507 33.285 5.882   1.00 11.19 ? 364  MET A CG  1 
ATOM   2709 S SD  . MET A 1 345 ? -19.151 32.614 6.174   1.00 12.53 ? 364  MET A SD  1 
ATOM   2710 C CE  . MET A 1 345 ? -19.005 31.040 5.352   1.00 11.62 ? 364  MET A CE  1 
ATOM   2711 N N   . ASP A 1 346 ? -12.940 31.983 6.781   1.00 9.61  ? 365  ASP A N   1 
ATOM   2712 C CA  . ASP A 1 346 ? -11.768 31.606 7.585   1.00 9.88  ? 365  ASP A CA  1 
ATOM   2713 C C   . ASP A 1 346 ? -11.203 32.905 8.144   1.00 10.30 ? 365  ASP A C   1 
ATOM   2714 O O   . ASP A 1 346 ? -11.589 33.999 7.708   1.00 9.80  ? 365  ASP A O   1 
ATOM   2715 C CB  . ASP A 1 346 ? -10.773 30.852 6.722   1.00 9.91  ? 365  ASP A CB  1 
ATOM   2716 C CG  . ASP A 1 346 ? -9.722  30.067 7.518   1.00 10.44 ? 365  ASP A CG  1 
ATOM   2717 O OD1 . ASP A 1 346 ? -9.702  30.116 8.766   1.00 10.37 ? 365  ASP A OD1 1 
ATOM   2718 O OD2 . ASP A 1 346 ? -8.892  29.423 6.840   1.00 10.37 ? 365  ASP A OD2 1 
ATOM   2719 N N   . ASP A 1 347 ? -10.264 32.794 9.083   1.00 10.48 ? 366  ASP A N   1 
ATOM   2720 C CA  . ASP A 1 347 ? -9.645  33.986 9.643   1.00 11.01 ? 366  ASP A CA  1 
ATOM   2721 C C   . ASP A 1 347 ? -8.532  34.386 8.683   1.00 11.03 ? 366  ASP A C   1 
ATOM   2722 O O   . ASP A 1 347 ? -7.353  34.193 8.936   1.00 11.87 ? 366  ASP A O   1 
ATOM   2723 C CB  . ASP A 1 347 ? -9.142  33.699 11.052  1.00 11.31 ? 366  ASP A CB  1 
ATOM   2724 C CG  . ASP A 1 347 ? -8.526  34.912 11.730  1.00 12.37 ? 366  ASP A CG  1 
ATOM   2725 O OD1 . ASP A 1 347 ? -8.924  36.068 11.406  1.00 13.75 ? 366  ASP A OD1 1 
ATOM   2726 O OD2 . ASP A 1 347 ? -7.618  34.697 12.591  1.00 12.21 ? 366  ASP A OD2 1 
ATOM   2727 N N   . PHE A 1 348 ? -8.933  34.899 7.530   1.00 11.70 ? 367  PHE A N   1 
ATOM   2728 C CA  . PHE A 1 348 ? -7.971  35.183 6.449   1.00 11.75 ? 367  PHE A CA  1 
ATOM   2729 C C   . PHE A 1 348 ? -6.924  36.246 6.811   1.00 12.92 ? 367  PHE A C   1 
ATOM   2730 O O   . PHE A 1 348 ? -5.822  36.220 6.282   1.00 14.56 ? 367  PHE A O   1 
ATOM   2731 C CB  . PHE A 1 348 ? -8.687  35.537 5.141   1.00 12.20 ? 367  PHE A CB  1 
ATOM   2732 C CG  . PHE A 1 348 ? -9.596  36.744 5.240   1.00 11.00 ? 367  PHE A CG  1 
ATOM   2733 C CD1 . PHE A 1 348 ? -10.928 36.617 5.620   1.00 11.34 ? 367  PHE A CD1 1 
ATOM   2734 C CD2 . PHE A 1 348 ? -9.106  38.001 4.965   1.00 11.30 ? 367  PHE A CD2 1 
ATOM   2735 C CE1 . PHE A 1 348 ? -11.749 37.737 5.706   1.00 11.13 ? 367  PHE A CE1 1 
ATOM   2736 C CE2 . PHE A 1 348 ? -9.921  39.106 5.016   1.00 11.35 ? 367  PHE A CE2 1 
ATOM   2737 C CZ  . PHE A 1 348 ? -11.245 38.980 5.407   1.00 10.61 ? 367  PHE A CZ  1 
ATOM   2738 N N   . THR A 1 349 ? -7.277  37.194 7.680   1.00 13.23 ? 368  THR A N   1 
ATOM   2739 C CA  . THR A 1 349 ? -6.297  38.195 8.111   1.00 14.05 ? 368  THR A CA  1 
ATOM   2740 C C   . THR A 1 349 ? -5.301  37.641 9.129   1.00 14.44 ? 368  THR A C   1 
ATOM   2741 O O   . THR A 1 349 ? -4.239  38.236 9.308   1.00 16.04 ? 368  THR A O   1 
ATOM   2742 C CB  . THR A 1 349 ? -6.950  39.427 8.771   1.00 13.04 ? 368  THR A CB  1 
ATOM   2743 O OG1 . THR A 1 349 ? -7.510  39.045 10.024  1.00 13.26 ? 368  THR A OG1 1 
ATOM   2744 C CG2 . THR A 1 349 ? -7.996  40.044 7.868   1.00 13.92 ? 368  THR A CG2 1 
ATOM   2745 N N   . GLY A 1 350 ? -5.679  36.574 9.836   1.00 14.91 ? 369  GLY A N   1 
ATOM   2746 C CA  . GLY A 1 350 ? -4.933  36.009 10.977  1.00 15.18 ? 369  GLY A CA  1 
ATOM   2747 C C   . GLY A 1 350 ? -5.158  36.731 12.294  1.00 16.51 ? 369  GLY A C   1 
ATOM   2748 O O   . GLY A 1 350 ? -4.647  36.294 13.357  1.00 15.70 ? 369  GLY A O   1 
ATOM   2749 N N   . LYS A 1 351 ? -5.920  37.832 12.257  1.00 16.87 ? 370  LYS A N   1 
ATOM   2750 C CA  . LYS A 1 351 ? -5.952  38.732 13.408  1.00 17.10 ? 370  LYS A CA  1 
ATOM   2751 C C   . LYS A 1 351 ? -6.914  38.298 14.524  1.00 16.43 ? 370  LYS A C   1 
ATOM   2752 O O   . LYS A 1 351 ? -6.776  38.709 15.683  1.00 16.30 ? 370  LYS A O   1 
ATOM   2753 C CB  . LYS A 1 351 ? -6.254  40.170 12.950  1.00 18.58 ? 370  LYS A CB  1 
ATOM   2754 C CG  . LYS A 1 351 ? -5.237  40.777 12.007  1.00 20.40 ? 370  LYS A CG  1 
ATOM   2755 C CD  . LYS A 1 351 ? -3.821  40.759 12.566  1.00 22.25 ? 370  LYS A CD  1 
ATOM   2756 C CE  . LYS A 1 351 ? -2.823  41.320 11.564  1.00 23.74 ? 370  LYS A CE  1 
ATOM   2757 N NZ  . LYS A 1 351 ? -1.450  40.756 11.750  0.50 23.37 ? 370  LYS A NZ  1 
ATOM   2758 N N   . SER A 1 352 ? -7.889  37.446 14.232  1.00 15.24 ? 371  SER A N   1 
ATOM   2759 C CA  . SER A 1 352 ? -8.860  37.082 15.254  1.00 14.80 ? 371  SER A CA  1 
ATOM   2760 C C   . SER A 1 352 ? -8.415  35.901 16.078  1.00 15.03 ? 371  SER A C   1 
ATOM   2761 O O   . SER A 1 352 ? -8.598  35.869 17.282  1.00 15.83 ? 371  SER A O   1 
ATOM   2762 C CB  . SER A 1 352 ? -10.211 36.740 14.612  1.00 14.82 ? 371  SER A CB  1 
ATOM   2763 O OG  . SER A 1 352 ? -11.149 36.362 15.610  1.00 15.89 ? 371  SER A OG  1 
ATOM   2764 N N   . CYS A 1 353 ? -7.899  34.873 15.405  1.00 14.31 ? 372  CYS A N   1 
ATOM   2765 C CA  . CYS A 1 353 ? -7.661  33.583 16.046  1.00 14.97 ? 372  CYS A CA  1 
ATOM   2766 C C   . CYS A 1 353 ? -6.213  33.445 16.517  1.00 15.89 ? 372  CYS A C   1 
ATOM   2767 O O   . CYS A 1 353 ? -5.893  32.541 17.276  1.00 16.76 ? 372  CYS A O   1 
ATOM   2768 C CB  . CYS A 1 353 ? -7.993  32.460 15.057  1.00 14.23 ? 372  CYS A CB  1 
ATOM   2769 S SG  . CYS A 1 353 ? -9.695  32.544 14.415  1.00 14.67 ? 372  CYS A SG  1 
ATOM   2770 N N   . ASN A 1 354 ? -5.345  34.306 16.016  1.00 16.45 ? 373  ASN A N   1 
ATOM   2771 C CA  . ASN A 1 354 ? -3.953  34.323 16.424  1.00 18.34 ? 373  ASN A CA  1 
ATOM   2772 C C   . ASN A 1 354 ? -3.326  32.936 16.138  1.00 18.28 ? 373  ASN A C   1 
ATOM   2773 O O   . ASN A 1 354 ? -2.596  32.347 16.957  1.00 18.99 ? 373  ASN A O   1 
ATOM   2774 C CB  . ASN A 1 354 ? -3.843  34.742 17.896  1.00 19.21 ? 373  ASN A CB  1 
ATOM   2775 C CG  . ASN A 1 354 ? -4.262  36.191 18.124  0.50 20.20 ? 373  ASN A CG  1 
ATOM   2776 O OD1 . ASN A 1 354 ? -3.943  37.069 17.325  1.00 19.81 ? 373  ASN A OD1 1 
ATOM   2777 N ND2 . ASN A 1 354 ? -4.977  36.446 19.212  1.00 22.98 ? 373  ASN A ND2 1 
ATOM   2778 N N   . GLN A 1 355 ? -3.673  32.407 14.965  1.00 17.01 ? 374  GLN A N   1 
ATOM   2779 C CA  . GLN A 1 355 ? -3.084  31.178 14.459  1.00 18.01 ? 374  GLN A CA  1 
ATOM   2780 C C   . GLN A 1 355 ? -2.607  31.371 13.001  1.00 17.47 ? 374  GLN A C   1 
ATOM   2781 O O   . GLN A 1 355 ? -2.490  30.407 12.222  1.00 17.34 ? 374  GLN A O   1 
ATOM   2782 C CB  . GLN A 1 355 ? -4.050  29.993 14.647  1.00 19.74 ? 374  GLN A CB  1 
ATOM   2783 C CG  . GLN A 1 355 ? -3.290  28.701 14.962  0.50 19.57 ? 374  GLN A CG  1 
ATOM   2784 C CD  . GLN A 1 355 ? -4.150  27.455 15.128  0.50 20.06 ? 374  GLN A CD  1 
ATOM   2785 O OE1 . GLN A 1 355 ? -3.657  26.346 14.901  1.00 23.26 ? 374  GLN A OE1 1 
ATOM   2786 N NE2 . GLN A 1 355 ? -5.400  27.610 15.533  0.50 18.27 ? 374  GLN A NE2 1 
ATOM   2787 N N   . GLY A 1 356 ? -2.272  32.616 12.665  1.00 17.09 ? 375  GLY A N   1 
ATOM   2788 C CA  . GLY A 1 356 ? -1.842  32.998 11.338  1.00 15.97 ? 375  GLY A CA  1 
ATOM   2789 C C   . GLY A 1 356 ? -2.979  33.074 10.324  1.00 15.14 ? 375  GLY A C   1 
ATOM   2790 O O   . GLY A 1 356 ? -4.099  32.748 10.647  1.00 14.97 ? 375  GLY A O   1 
ATOM   2791 N N   . PRO A 1 357 ? -2.675  33.518 9.093   1.00 15.81 ? 376  PRO A N   1 
ATOM   2792 C CA  . PRO A 1 357 ? -3.731  33.675 8.103   1.00 15.82 ? 376  PRO A CA  1 
ATOM   2793 C C   . PRO A 1 357 ? -4.273  32.337 7.651   1.00 14.71 ? 376  PRO A C   1 
ATOM   2794 O O   . PRO A 1 357 ? -3.518  31.377 7.505   1.00 14.84 ? 376  PRO A O   1 
ATOM   2795 C CB  . PRO A 1 357 ? -3.061  34.378 6.926   1.00 16.97 ? 376  PRO A CB  1 
ATOM   2796 C CG  . PRO A 1 357 ? -1.700  34.816 7.427   1.00 18.13 ? 376  PRO A CG  1 
ATOM   2797 C CD  . PRO A 1 357 ? -1.354  33.919 8.574   1.00 17.31 ? 376  PRO A CD  1 
ATOM   2798 N N   . TYR A 1 358 ? -5.584  32.296 7.465   1.00 13.28 ? 377  TYR A N   1 
ATOM   2799 C CA  . TYR A 1 358 ? -6.283  31.111 6.978   1.00 12.97 ? 377  TYR A CA  1 
ATOM   2800 C C   . TYR A 1 358 ? -5.935  29.886 7.814   1.00 12.62 ? 377  TYR A C   1 
ATOM   2801 O O   . TYR A 1 358 ? -5.480  28.869 7.276   1.00 13.51 ? 377  TYR A O   1 
ATOM   2802 C CB  . TYR A 1 358 ? -5.934  30.842 5.509   1.00 13.16 ? 377  TYR A CB  1 
ATOM   2803 C CG  . TYR A 1 358 ? -6.417  31.875 4.503   1.00 12.67 ? 377  TYR A CG  1 
ATOM   2804 C CD1 . TYR A 1 358 ? -7.759  31.926 4.117   1.00 12.62 ? 377  TYR A CD1 1 
ATOM   2805 C CD2 . TYR A 1 358 ? -5.529  32.741 3.886   1.00 13.03 ? 377  TYR A CD2 1 
ATOM   2806 C CE1 . TYR A 1 358 ? -8.191  32.837 3.179   1.00 13.29 ? 377  TYR A CE1 1 
ATOM   2807 C CE2 . TYR A 1 358 ? -5.960  33.673 2.949   1.00 13.62 ? 377  TYR A CE2 1 
ATOM   2808 C CZ  . TYR A 1 358 ? -7.297  33.724 2.602   1.00 13.23 ? 377  TYR A CZ  1 
ATOM   2809 O OH  . TYR A 1 358 ? -7.747  34.629 1.662   1.00 15.05 ? 377  TYR A OH  1 
ATOM   2810 N N   . PRO A 1 359 ? -6.197  29.922 9.123   1.00 12.44 ? 378  PRO A N   1 
ATOM   2811 C CA  . PRO A 1 359 ? -5.818  28.748 9.916   1.00 12.91 ? 378  PRO A CA  1 
ATOM   2812 C C   . PRO A 1 359 ? -6.508  27.461 9.507   1.00 12.78 ? 378  PRO A C   1 
ATOM   2813 O O   . PRO A 1 359 ? -5.891  26.404 9.570   1.00 14.11 ? 378  PRO A O   1 
ATOM   2814 C CB  . PRO A 1 359 ? -6.227  29.123 11.338  1.00 13.25 ? 378  PRO A CB  1 
ATOM   2815 C CG  . PRO A 1 359 ? -7.214  30.255 11.180  1.00 12.95 ? 378  PRO A CG  1 
ATOM   2816 C CD  . PRO A 1 359 ? -6.816  30.981 9.948   1.00 12.50 ? 378  PRO A CD  1 
ATOM   2817 N N   . LEU A 1 360 ? -7.790  27.522 9.133   1.00 11.90 ? 379  LEU A N   1 
ATOM   2818 C CA  . LEU A 1 360 ? -8.515  26.318 8.763   1.00 11.31 ? 379  LEU A CA  1 
ATOM   2819 C C   . LEU A 1 360 ? -8.040  25.829 7.411   1.00 10.74 ? 379  LEU A C   1 
ATOM   2820 O O   . LEU A 1 360 ? -7.706  24.638 7.256   1.00 10.86 ? 379  LEU A O   1 
ATOM   2821 C CB  . LEU A 1 360 ? -10.042 26.548 8.755   1.00 11.17 ? 379  LEU A CB  1 
ATOM   2822 C CG  . LEU A 1 360 ? -10.636 26.917 10.113  1.00 11.47 ? 379  LEU A CG  1 
ATOM   2823 C CD1 . LEU A 1 360 ? -12.107 27.193 9.954   1.00 11.81 ? 379  LEU A CD1 1 
ATOM   2824 C CD2 . LEU A 1 360 ? -10.378 25.843 11.186  1.00 12.18 ? 379  LEU A CD2 1 
ATOM   2825 N N   . VAL A 1 361 ? -7.950  26.730 6.447   1.00 10.71 ? 380  VAL A N   1 
ATOM   2826 C CA  . VAL A 1 361 ? -7.624  26.292 5.096   1.00 10.41 ? 380  VAL A CA  1 
ATOM   2827 C C   . VAL A 1 361 ? -6.175  25.849 5.024   1.00 10.91 ? 380  VAL A C   1 
ATOM   2828 O O   . VAL A 1 361 ? -5.886  24.888 4.319   1.00 9.74  ? 380  VAL A O   1 
ATOM   2829 C CB  . VAL A 1 361 ? -7.955  27.334 3.993   1.00 11.11 ? 380  VAL A CB  1 
ATOM   2830 C CG1 . VAL A 1 361 ? -7.673  26.768 2.613   1.00 11.53 ? 380  VAL A CG1 1 
ATOM   2831 C CG2 . VAL A 1 361 ? -9.416  27.726 4.076   1.00 11.37 ? 380  VAL A CG2 1 
ATOM   2832 N N   . GLN A 1 362 ? -5.285  26.511 5.765   1.00 11.10 ? 381  GLN A N   1 
ATOM   2833 C CA  . GLN A 1 362 ? -3.875  26.050 5.793   1.00 11.95 ? 381  GLN A CA  1 
ATOM   2834 C C   . GLN A 1 362 ? -3.797  24.646 6.397   1.00 10.83 ? 381  GLN A C   1 
ATOM   2835 O O   . GLN A 1 362 ? -2.980  23.800 5.926   1.00 10.86 ? 381  GLN A O   1 
ATOM   2836 C CB  . GLN A 1 362 ? -2.938  27.034 6.509   1.00 13.62 ? 381  GLN A CB  1 
ATOM   2837 C CG  . GLN A 1 362 ? -2.645  28.291 5.706   1.00 15.77 ? 381  GLN A CG  1 
ATOM   2838 C CD  . GLN A 1 362 ? -1.667  28.054 4.541   1.00 17.73 ? 381  GLN A CD  1 
ATOM   2839 O OE1 . GLN A 1 362 ? -1.132  26.964 4.387   1.00 23.36 ? 381  GLN A OE1 1 
ATOM   2840 N NE2 . GLN A 1 362 ? -1.424  29.076 3.751   0.50 18.68 ? 381  GLN A NE2 1 
ATOM   2841 N N   . ALA A 1 363 ? -4.630  24.354 7.404   1.00 10.40 ? 382  ALA A N   1 
ATOM   2842 C CA  . ALA A 1 363 ? -4.618  23.032 8.021   1.00 10.33 ? 382  ALA A CA  1 
ATOM   2843 C C   . ALA A 1 363 ? -5.115  21.998 7.020   1.00 10.26 ? 382  ALA A C   1 
ATOM   2844 O O   . ALA A 1 363 ? -4.564  20.917 6.909   1.00 10.63 ? 382  ALA A O   1 
ATOM   2845 C CB  . ALA A 1 363 ? -5.455  23.014 9.286   1.00 10.68 ? 382  ALA A CB  1 
ATOM   2846 N N   . VAL A 1 364 ? -6.133  22.345 6.234   1.00 9.77  ? 383  VAL A N   1 
ATOM   2847 C CA  . VAL A 1 364 ? -6.562  21.450 5.140   1.00 9.46  ? 383  VAL A CA  1 
ATOM   2848 C C   . VAL A 1 364 ? -5.446  21.195 4.131   1.00 9.85  ? 383  VAL A C   1 
ATOM   2849 O O   . VAL A 1 364 ? -5.197  20.049 3.759   1.00 9.64  ? 383  VAL A O   1 
ATOM   2850 C CB  . VAL A 1 364 ? -7.855  21.969 4.435   1.00 9.27  ? 383  VAL A CB  1 
ATOM   2851 C CG1 . VAL A 1 364 ? -8.273  21.037 3.284   1.00 9.03  ? 383  VAL A CG1 1 
ATOM   2852 C CG2 . VAL A 1 364 ? -8.987  22.054 5.432   1.00 9.12  ? 383  VAL A CG2 1 
ATOM   2853 N N   . LYS A 1 365 ? -4.808  22.271 3.664   1.00 10.15 ? 384  LYS A N   1 
ATOM   2854 C CA  . LYS A 1 365 ? -3.754  22.147 2.686   1.00 10.75 ? 384  LYS A CA  1 
ATOM   2855 C C   . LYS A 1 365 ? -2.604  21.277 3.218   1.00 11.46 ? 384  LYS A C   1 
ATOM   2856 O O   . LYS A 1 365 ? -2.151  20.337 2.547   1.00 11.11 ? 384  LYS A O   1 
ATOM   2857 C CB  . LYS A 1 365 ? -3.267  23.536 2.303   1.00 11.80 ? 384  LYS A CB  1 
ATOM   2858 C CG  . LYS A 1 365 ? -2.121  23.492 1.314   1.00 12.46 ? 384  LYS A CG  1 
ATOM   2859 C CD  . LYS A 1 365 ? -1.631  24.875 0.958   1.00 13.59 ? 384  LYS A CD  1 
ATOM   2860 C CE  . LYS A 1 365 ? -0.421  24.745 0.044   1.00 15.63 ? 384  LYS A CE  1 
ATOM   2861 N NZ  . LYS A 1 365 ? 0.185   26.078 -0.162  1.00 17.41 ? 384  LYS A NZ  1 
ATOM   2862 N N   . ARG A 1 366 ? -2.196  21.559 4.451   1.00 11.39 ? 385  ARG A N   1 
ATOM   2863 C CA  . ARG A 1 366 ? -1.090  20.839 5.085   1.00 12.00 ? 385  ARG A CA  1 
ATOM   2864 C C   . ARG A 1 366 ? -1.445  19.374 5.225   1.00 11.60 ? 385  ARG A C   1 
ATOM   2865 O O   . ARG A 1 366 ? -0.621  18.481 4.937   1.00 11.90 ? 385  ARG A O   1 
ATOM   2866 C CB  . ARG A 1 366 ? -0.800  21.472 6.453   1.00 13.37 ? 385  ARG A CB  1 
ATOM   2867 C CG  . ARG A 1 366 ? 0.481   21.024 7.111   1.00 13.91 ? 385  ARG A CG  1 
ATOM   2868 C CD  . ARG A 1 366 ? 0.635   21.650 8.479   1.00 13.39 ? 385  ARG A CD  1 
ATOM   2869 N NE  . ARG A 1 366 ? 0.774   23.110 8.386   1.00 13.31 ? 385  ARG A NE  1 
ATOM   2870 C CZ  . ARG A 1 366 ? -0.084  24.022 8.849   1.00 13.85 ? 385  ARG A CZ  1 
ATOM   2871 N NH1 . ARG A 1 366 ? -1.209  23.715 9.490   1.00 14.16 ? 385  ARG A NH1 1 
ATOM   2872 N NH2 . ARG A 1 366 ? 0.188   25.312 8.656   1.00 15.65 ? 385  ARG A NH2 1 
ATOM   2873 N N   . SER A 1 367 ? -2.685  19.109 5.628   1.00 10.96 ? 386  SER A N   1 
ATOM   2874 C CA  . SER A 1 367 ? -3.125  17.725 5.820   1.00 11.45 ? 386  SER A CA  1 
ATOM   2875 C C   . SER A 1 367 ? -3.209  17.010 4.489   1.00 11.91 ? 386  SER A C   1 
ATOM   2876 O O   . SER A 1 367 ? -2.800  15.848 4.393   1.00 11.36 ? 386  SER A O   1 
ATOM   2877 C CB  . SER A 1 367 ? -4.441  17.669 6.594   1.00 11.68 ? 386  SER A CB  1 
ATOM   2878 O OG  . SER A 1 367 ? -4.303  18.363 7.843   1.00 12.12 ? 386  SER A OG  1 
ATOM   2879 N N   . LEU A 1 368 ? -3.708  17.677 3.440   1.00 11.46 ? 387  LEU A N   1 
ATOM   2880 C CA  . LEU A 1 368 ? -3.753  17.047 2.123   1.00 12.39 ? 387  LEU A CA  1 
ATOM   2881 C C   . LEU A 1 368 ? -2.375  16.713 1.597   1.00 13.75 ? 387  LEU A C   1 
ATOM   2882 O O   . LEU A 1 368 ? -2.181  15.656 0.999   1.00 14.41 ? 387  LEU A O   1 
ATOM   2883 C CB  . LEU A 1 368 ? -4.460  17.939 1.091   1.00 11.93 ? 387  LEU A CB  1 
ATOM   2884 C CG  . LEU A 1 368 ? -5.968  18.054 1.257   1.00 11.91 ? 387  LEU A CG  1 
ATOM   2885 C CD1 . LEU A 1 368 ? -6.461  19.189 0.372   1.00 12.16 ? 387  LEU A CD1 1 
ATOM   2886 C CD2 . LEU A 1 368 ? -6.668  16.755 0.927   1.00 11.80 ? 387  LEU A CD2 1 
ATOM   2887 N N   . GLY A 1 369 ? -1.433  17.606 1.807   1.00 15.49 ? 388  GLY A N   1 
ATOM   2888 C CA  . GLY A 1 369 ? -0.065  17.445 1.277   1.00 18.00 ? 388  GLY A CA  1 
ATOM   2889 C C   . GLY A 1 369 ? 0.823   16.492 2.050   1.00 20.21 ? 388  GLY A C   1 
ATOM   2890 O O   . GLY A 1 369 ? 1.854   16.054 1.515   1.00 21.18 ? 388  GLY A O   1 
ATOM   2891 N N   . SER A 1 370 ? 0.458   16.204 3.298   1.00 21.07 ? 389  SER A N   1 
ATOM   2892 C CA  . SER A 1 370 ? 1.218   15.343 4.214   1.00 23.34 ? 389  SER A CA  1 
ATOM   2893 C C   . SER A 1 370 ? 1.160   13.896 3.735   1.00 23.98 ? 389  SER A C   1 
ATOM   2894 O O   . SER A 1 370 ? 0.076   13.365 3.505   1.00 23.79 ? 389  SER A O   1 
ATOM   2895 C CB  . SER A 1 370 ? 0.635   15.417 5.637   1.00 25.63 ? 389  SER A CB  1 
ATOM   2896 O OG  . SER A 1 370 ? 1.192   14.422 6.505   1.00 27.74 ? 389  SER A OG  1 
ATOM   2897 N N   . LEU A 1 371 ? 2.328   13.276 3.567   0.83 23.17 ? 390  LEU A N   1 
ATOM   2898 C CA  . LEU A 1 371 ? 2.407   11.864 3.138   0.83 27.23 ? 390  LEU A CA  1 
ATOM   2899 C C   . LEU A 1 371 ? 1.928   10.933 4.255   0.83 29.59 ? 390  LEU A C   1 
ATOM   2900 O O   . LEU A 1 371 ? 1.630   11.362 5.374   0.83 32.05 ? 390  LEU A O   1 
ATOM   2901 C CB  . LEU A 1 371 ? 3.845   11.466 2.720   0.83 28.23 ? 390  LEU A CB  1 
ATOM   2902 C CG  . LEU A 1 371 ? 4.423   11.354 1.277   0.83 29.59 ? 390  LEU A CG  1 
ATOM   2903 C CD1 . LEU A 1 371 ? 3.644   10.404 0.370   0.50 29.26 ? 390  LEU A CD1 1 
ATOM   2904 C CD2 . LEU A 1 371 ? 4.616   12.699 0.582   1.00 29.33 ? 390  LEU A CD2 1 
HETATM 2905 C C1  . NAG B 2 .   ? -25.013 26.545 0.181   1.00 13.71 ? 1    NAG B C1  1 
HETATM 2906 C C2  . NAG B 2 .   ? -24.564 27.588 -0.833  1.00 13.39 ? 1    NAG B C2  1 
HETATM 2907 C C3  . NAG B 2 .   ? -24.505 28.990 -0.240  1.00 13.16 ? 1    NAG B C3  1 
HETATM 2908 C C4  . NAG B 2 .   ? -24.679 28.994 1.276   1.00 12.89 ? 1    NAG B C4  1 
HETATM 2909 C C5  . NAG B 2 .   ? -23.860 27.852 1.869   1.00 12.47 ? 1    NAG B C5  1 
HETATM 2910 C C6  . NAG B 2 .   ? -23.900 27.766 3.406   1.00 12.22 ? 1    NAG B C6  1 
HETATM 2911 C C7  . NAG B 2 .   ? -23.164 26.974 -2.760  1.00 14.50 ? 1    NAG B C7  1 
HETATM 2912 C C8  . NAG B 2 .   ? -21.821 26.582 -3.296  1.00 14.15 ? 1    NAG B C8  1 
HETATM 2913 N N2  . NAG B 2 .   ? -23.289 27.225 -1.441  1.00 13.89 ? 1    NAG B N2  1 
HETATM 2914 O O1  . NAG B 2 .   ? -26.378 26.742 0.521   1.00 14.40 ? 1    NAG B O1  1 
HETATM 2915 O O3  . NAG B 2 .   ? -25.487 29.749 -0.932  1.00 13.26 ? 1    NAG B O3  1 
HETATM 2916 O O4  . NAG B 2 .   ? -24.118 30.171 1.834   1.00 12.47 ? 1    NAG B O4  1 
HETATM 2917 O O5  . NAG B 2 .   ? -24.181 26.582 1.336   1.00 12.73 ? 1    NAG B O5  1 
HETATM 2918 O O6  . NAG B 2 .   ? -25.198 27.669 3.907   1.00 12.48 ? 1    NAG B O6  1 
HETATM 2919 O O7  . NAG B 2 .   ? -24.118 27.094 -3.530  1.00 15.50 ? 1    NAG B O7  1 
HETATM 2920 C C1  . NAG B 2 .   ? -25.026 31.279 1.940   1.00 13.48 ? 2    NAG B C1  1 
HETATM 2921 C C2  . NAG B 2 .   ? -24.433 32.222 2.972   1.00 13.06 ? 2    NAG B C2  1 
HETATM 2922 C C3  . NAG B 2 .   ? -25.256 33.517 3.092   1.00 13.82 ? 2    NAG B C3  1 
HETATM 2923 C C4  . NAG B 2 .   ? -25.505 34.122 1.706   1.00 14.21 ? 2    NAG B C4  1 
HETATM 2924 C C5  . NAG B 2 .   ? -26.054 33.039 0.768   1.00 13.81 ? 2    NAG B C5  1 
HETATM 2925 C C6  . NAG B 2 .   ? -26.223 33.543 -0.652  1.00 14.19 ? 2    NAG B C6  1 
HETATM 2926 C C7  . NAG B 2 .   ? -23.067 31.278 4.759   1.00 12.86 ? 2    NAG B C7  1 
HETATM 2927 C C8  . NAG B 2 .   ? -23.063 30.688 6.127   1.00 13.14 ? 2    NAG B C8  1 
HETATM 2928 N N2  . NAG B 2 .   ? -24.250 31.601 4.283   1.00 12.63 ? 2    NAG B N2  1 
HETATM 2929 O O3  . NAG B 2 .   ? -24.560 34.467 3.882   1.00 14.59 ? 2    NAG B O3  1 
HETATM 2930 O O4  . NAG B 2 .   ? -26.411 35.220 1.758   1.00 14.16 ? 2    NAG B O4  1 
HETATM 2931 O O5  . NAG B 2 .   ? -25.116 31.969 0.704   1.00 13.86 ? 2    NAG B O5  1 
HETATM 2932 O O6  . NAG B 2 .   ? -26.814 32.523 -1.446  1.00 15.31 ? 2    NAG B O6  1 
HETATM 2933 O O7  . NAG B 2 .   ? -22.008 31.408 4.144   1.00 12.68 ? 2    NAG B O7  1 
HETATM 2934 S S   . SO4 C 3 .   ? -29.119 3.094  12.812  0.57 26.90 ? 403  SO4 A S   1 
HETATM 2935 O O1  . SO4 C 3 .   ? -29.310 2.559  11.456  0.57 28.77 ? 403  SO4 A O1  1 
HETATM 2936 O O2  . SO4 C 3 .   ? -28.412 4.367  12.675  0.57 27.05 ? 403  SO4 A O2  1 
HETATM 2937 O O3  . SO4 C 3 .   ? -28.309 2.126  13.577  0.57 26.75 ? 403  SO4 A O3  1 
HETATM 2938 O O4  . SO4 C 3 .   ? -30.409 3.320  13.489  0.57 26.72 ? 403  SO4 A O4  1 
HETATM 2939 S S   . SO4 D 3 .   ? -37.347 22.017 -23.767 0.70 31.19 ? 404  SO4 A S   1 
HETATM 2940 O O1  . SO4 D 3 .   ? -38.511 21.113 -23.637 0.70 31.25 ? 404  SO4 A O1  1 
HETATM 2941 O O2  . SO4 D 3 .   ? -37.615 23.075 -24.755 0.70 30.20 ? 404  SO4 A O2  1 
HETATM 2942 O O3  . SO4 D 3 .   ? -36.166 21.257 -24.230 0.70 31.56 ? 404  SO4 A O3  1 
HETATM 2943 O O4  . SO4 D 3 .   ? -37.074 22.606 -22.426 0.70 31.17 ? 404  SO4 A O4  1 
HETATM 2944 S S   . SO4 E 3 .   ? -29.302 38.036 -8.458  0.64 24.92 ? 405  SO4 A S   1 
HETATM 2945 O O1  . SO4 E 3 .   ? -29.354 38.654 -9.799  0.64 29.36 ? 405  SO4 A O1  1 
HETATM 2946 O O2  . SO4 E 3 .   ? -29.225 39.130 -7.469  0.64 28.91 ? 405  SO4 A O2  1 
HETATM 2947 O O3  . SO4 E 3 .   ? -28.113 37.196 -8.396  0.64 27.39 ? 405  SO4 A O3  1 
HETATM 2948 O O4  . SO4 E 3 .   ? -30.506 37.229 -8.246  0.64 26.24 ? 405  SO4 A O4  1 
HETATM 2949 O O   . HOH F 4 .   ? -13.936 10.595 26.177  1.00 27.16 ? 501  HOH A O   1 
HETATM 2950 O O   . HOH F 4 .   ? -7.254  28.792 15.117  1.00 32.12 ? 502  HOH A O   1 
HETATM 2951 O O   . HOH F 4 .   ? -3.530  25.990 12.659  1.00 46.47 ? 503  HOH A O   1 
HETATM 2952 O O   . HOH F 4 .   ? -32.403 3.830  5.366   1.00 40.71 ? 504  HOH A O   1 
HETATM 2953 O O   . HOH F 4 .   ? -41.429 12.424 -8.716  1.00 44.27 ? 505  HOH A O   1 
HETATM 2954 O O   . HOH F 4 .   ? -26.960 31.166 -28.247 1.00 58.40 ? 506  HOH A O   1 
HETATM 2955 O O   . HOH F 4 .   ? -5.461  39.267 17.631  1.00 48.25 ? 507  HOH A O   1 
HETATM 2956 O O   . HOH F 4 .   ? -44.850 15.559 -5.719  1.00 49.58 ? 508  HOH A O   1 
HETATM 2957 O O   . HOH F 4 .   ? -35.321 40.215 -21.326 1.00 23.96 ? 509  HOH A O   1 
HETATM 2958 O O   . HOH F 4 .   ? -24.946 47.280 10.704  1.00 26.99 ? 510  HOH A O   1 
HETATM 2959 O O   . HOH F 4 .   ? -15.743 8.538  26.027  1.00 15.20 ? 511  HOH A O   1 
HETATM 2960 O O   . HOH F 4 .   ? -13.327 13.212 25.791  1.00 30.35 ? 512  HOH A O   1 
HETATM 2961 O O   . HOH F 4 .   ? -32.370 40.607 -11.767 1.00 27.32 ? 513  HOH A O   1 
HETATM 2962 O O   . HOH F 4 .   ? -31.930 3.137  11.442  1.00 33.91 ? 514  HOH A O   1 
HETATM 2963 O O   . HOH F 4 .   ? -26.678 3.148  11.218  1.00 36.01 ? 515  HOH A O   1 
HETATM 2964 O O   . HOH F 4 .   ? -37.191 10.927 -5.320  1.00 37.74 ? 516  HOH A O   1 
HETATM 2965 O O   . HOH F 4 .   ? -1.272  13.492 -3.768  1.00 42.76 ? 517  HOH A O   1 
HETATM 2966 O O   . HOH F 4 .   ? -32.133 41.701 -17.253 1.00 33.26 ? 518  HOH A O   1 
HETATM 2967 O O   . HOH F 4 .   ? -30.421 40.474 -5.587  1.00 44.87 ? 519  HOH A O   1 
HETATM 2968 O O   . HOH F 4 .   ? -29.052 4.148  15.557  1.00 41.93 ? 520  HOH A O   1 
HETATM 2969 O O   . HOH F 4 .   ? -3.505  25.767 10.426  1.00 25.91 ? 521  HOH A O   1 
HETATM 2970 O O   . HOH F 4 .   ? -21.569 7.480  15.798  1.00 18.49 ? 522  HOH A O   1 
HETATM 2971 O O   . HOH F 4 .   ? 5.246   32.805 -9.215  1.00 30.26 ? 523  HOH A O   1 
HETATM 2972 O O   . HOH F 4 .   ? -4.510  45.997 -11.746 1.00 24.78 ? 524  HOH A O   1 
HETATM 2973 O O   . HOH F 4 .   ? -15.484 48.597 -5.549  1.00 25.05 ? 525  HOH A O   1 
HETATM 2974 O O   . HOH F 4 .   ? -15.167 19.951 27.501  1.00 31.25 ? 526  HOH A O   1 
HETATM 2975 O O   . HOH F 4 .   ? -8.752  25.617 15.425  1.00 19.93 ? 527  HOH A O   1 
HETATM 2976 O O   . HOH F 4 .   ? -25.959 34.135 -26.137 1.00 22.03 ? 528  HOH A O   1 
HETATM 2977 O O   . HOH F 4 .   ? -3.233  45.235 -15.162 1.00 23.93 ? 529  HOH A O   1 
HETATM 2978 O O   . HOH F 4 .   ? 0.984   38.680 -11.040 1.00 36.28 ? 530  HOH A O   1 
HETATM 2979 O O   . HOH F 4 .   ? -21.521 36.474 -22.609 1.00 17.27 ? 531  HOH A O   1 
HETATM 2980 O O   . HOH F 4 .   ? -24.334 46.562 8.293   1.00 37.59 ? 532  HOH A O   1 
HETATM 2981 O O   . HOH F 4 .   ? -14.041 9.570  18.005  1.00 14.76 ? 533  HOH A O   1 
HETATM 2982 O O   . HOH F 4 .   ? -13.205 27.881 25.087  1.00 29.23 ? 534  HOH A O   1 
HETATM 2983 O O   . HOH F 4 .   ? -19.509 46.867 -11.579 1.00 21.86 ? 535  HOH A O   1 
HETATM 2984 O O   . HOH F 4 .   ? -3.318  15.292 12.336  1.00 21.71 ? 536  HOH A O   1 
HETATM 2985 O O   . HOH F 4 .   ? -26.610 5.106  18.534  1.00 19.27 ? 537  HOH A O   1 
HETATM 2986 O O   . HOH F 4 .   ? -27.118 2.571  15.972  1.00 18.85 ? 538  HOH A O   1 
HETATM 2987 O O   . HOH F 4 .   ? -13.689 29.022 -26.523 1.00 26.56 ? 539  HOH A O   1 
HETATM 2988 O O   . HOH F 4 .   ? -10.333 44.747 -15.354 1.00 17.86 ? 540  HOH A O   1 
HETATM 2989 O O   . HOH F 4 .   ? -8.190  34.547 19.629  1.00 21.87 ? 541  HOH A O   1 
HETATM 2990 O O   . HOH F 4 .   ? -10.130 38.501 -16.155 1.00 20.72 ? 542  HOH A O   1 
HETATM 2991 O O   . HOH F 4 .   ? -30.278 4.211  9.509   1.00 35.14 ? 543  HOH A O   1 
HETATM 2992 O O   . HOH F 4 .   ? -15.123 46.072 12.926  1.00 11.65 ? 544  HOH A O   1 
HETATM 2993 O O   . HOH F 4 .   ? -5.615  16.059 -7.427  1.00 46.40 ? 545  HOH A O   1 
HETATM 2994 O O   . HOH F 4 .   ? -29.301 -0.180 11.343  1.00 31.90 ? 546  HOH A O   1 
HETATM 2995 O O   . HOH F 4 .   ? -8.891  21.886 17.039  1.00 16.01 ? 547  HOH A O   1 
HETATM 2996 O O   . HOH F 4 .   ? -14.030 40.499 20.816  1.00 30.55 ? 548  HOH A O   1 
HETATM 2997 O O   . HOH F 4 .   ? 3.393   23.714 7.827   1.00 61.11 ? 549  HOH A O   1 
HETATM 2998 O O   . HOH F 4 .   ? -21.057 41.330 -16.190 1.00 16.22 ? 550  HOH A O   1 
HETATM 2999 O O   . HOH F 4 .   ? 4.845   14.365 3.425   1.00 24.86 ? 551  HOH A O   1 
HETATM 3000 O O   . HOH F 4 .   ? -29.989 6.515  18.673  1.00 41.81 ? 552  HOH A O   1 
HETATM 3001 O O   . HOH F 4 .   ? -22.556 42.370 7.782   1.00 20.08 ? 553  HOH A O   1 
HETATM 3002 O O   . HOH F 4 .   ? -1.531  37.306 16.017  1.00 31.26 ? 554  HOH A O   1 
HETATM 3003 O O   . HOH F 4 .   ? -19.884 31.633 -27.166 1.00 17.76 ? 555  HOH A O   1 
HETATM 3004 O O   . HOH F 4 .   ? -33.154 33.385 18.752  1.00 20.50 ? 556  HOH A O   1 
HETATM 3005 O O   . HOH F 4 .   ? -5.187  14.669 8.163   1.00 16.76 ? 557  HOH A O   1 
HETATM 3006 O O   . HOH F 4 .   ? -41.365 19.696 -12.917 1.00 35.30 ? 558  HOH A O   1 
HETATM 3007 O O   . HOH F 4 .   ? -9.515  32.738 -21.968 1.00 31.08 ? 559  HOH A O   1 
HETATM 3008 O O   . HOH F 4 .   ? -21.304 45.446 6.809   1.00 42.93 ? 560  HOH A O   1 
HETATM 3009 O O   . HOH F 4 .   ? -37.046 26.118 29.568  1.00 38.38 ? 561  HOH A O   1 
HETATM 3010 O O   . HOH F 4 .   ? -39.102 30.418 20.582  1.00 30.44 ? 562  HOH A O   1 
HETATM 3011 O O   . HOH F 4 .   ? -40.247 31.339 -16.024 1.00 35.41 ? 563  HOH A O   1 
HETATM 3012 O O   . HOH F 4 .   ? -37.463 31.294 -21.453 1.00 21.02 ? 564  HOH A O   1 
HETATM 3013 O O   . HOH F 4 .   ? -26.608 40.252 7.526   1.00 33.64 ? 565  HOH A O   1 
HETATM 3014 O O   . HOH F 4 .   ? -32.232 11.972 -18.523 1.00 34.38 ? 566  HOH A O   1 
HETATM 3015 O O   . HOH F 4 .   ? -11.730 24.827 18.537  1.00 24.73 ? 567  HOH A O   1 
HETATM 3016 O O   . HOH F 4 .   ? -30.223 42.503 -13.292 1.00 50.85 ? 568  HOH A O   1 
HETATM 3017 O O   . HOH F 4 .   ? -5.891  44.459 -17.623 1.00 25.21 ? 569  HOH A O   1 
HETATM 3018 O O   . HOH F 4 .   ? -20.650 28.804 -27.993 1.00 35.16 ? 570  HOH A O   1 
HETATM 3019 O O   . HOH F 4 .   ? -3.782  41.910 -13.528 1.00 16.01 ? 571  HOH A O   1 
HETATM 3020 O O   . HOH F 4 .   ? -7.029  30.612 18.955  1.00 21.28 ? 572  HOH A O   1 
HETATM 3021 O O   . HOH F 4 .   ? -28.223 40.820 -25.625 1.00 40.10 ? 573  HOH A O   1 
HETATM 3022 O O   . HOH F 4 .   ? -32.298 7.073  19.269  1.00 34.39 ? 574  HOH A O   1 
HETATM 3023 O O   . HOH F 4 .   ? -18.282 49.951 -10.052 1.00 12.23 ? 575  HOH A O   1 
HETATM 3024 O O   . HOH F 4 .   ? -5.544  34.318 20.956  1.00 30.58 ? 576  HOH A O   1 
HETATM 3025 O O   . HOH F 4 .   ? -10.982 12.373 19.837  1.00 26.02 ? 577  HOH A O   1 
HETATM 3026 O O   . HOH F 4 .   ? -8.510  33.068 22.960  1.00 23.06 ? 578  HOH A O   1 
HETATM 3027 O O   . HOH F 4 .   ? -34.537 40.224 -17.726 1.00 46.81 ? 579  HOH A O   1 
HETATM 3028 O O   . HOH F 4 .   ? -13.196 47.668 9.122   1.00 20.57 ? 580  HOH A O   1 
HETATM 3029 O O   . HOH F 4 .   ? -37.491 13.185 -8.478  1.00 24.60 ? 581  HOH A O   1 
HETATM 3030 O O   . HOH F 4 .   ? -24.555 41.821 15.031  1.00 21.01 ? 582  HOH A O   1 
HETATM 3031 O O   . HOH F 4 .   ? -11.152 40.316 -18.101 1.00 16.21 ? 583  HOH A O   1 
HETATM 3032 O O   . HOH F 4 .   ? -22.614 43.517 -15.046 1.00 25.84 ? 584  HOH A O   1 
HETATM 3033 O O   . HOH F 4 .   ? -12.182 20.713 25.064  1.00 23.82 ? 585  HOH A O   1 
HETATM 3034 O O   . HOH F 4 .   ? -34.349 33.211 21.200  1.00 16.47 ? 586  HOH A O   1 
HETATM 3035 O O   . HOH F 4 .   ? -13.723 14.382 23.517  1.00 18.22 ? 587  HOH A O   1 
HETATM 3036 O O   . HOH F 4 .   ? -3.868  39.778 16.390  1.00 35.43 ? 588  HOH A O   1 
HETATM 3037 O O   . HOH F 4 .   ? -33.001 38.317 -13.074 1.00 33.40 ? 589  HOH A O   1 
HETATM 3038 O O   . HOH F 4 .   ? -1.466  27.341 9.845   1.00 20.46 ? 590  HOH A O   1 
HETATM 3039 O O   . HOH F 4 .   ? -21.371 44.684 -12.078 1.00 17.16 ? 591  HOH A O   1 
HETATM 3040 O O   . HOH F 4 .   ? -6.319  14.898 15.877  1.00 27.44 ? 592  HOH A O   1 
HETATM 3041 O O   . HOH F 4 .   ? -26.643 44.970 13.473  1.00 42.83 ? 593  HOH A O   1 
HETATM 3042 O O   . HOH F 4 .   ? -34.239 23.175 -29.958 1.00 47.59 ? 594  HOH A O   1 
HETATM 3043 O O   . HOH F 4 .   ? -38.269 17.462 -12.854 1.00 20.44 ? 595  HOH A O   1 
HETATM 3044 O O   . HOH F 4 .   ? -0.365  31.991 18.772  1.00 24.42 ? 596  HOH A O   1 
HETATM 3045 O O   . HOH F 4 .   ? -16.720 46.993 -11.790 1.00 16.59 ? 597  HOH A O   1 
HETATM 3046 O O   . HOH F 4 .   ? 2.135   8.695  6.411   1.00 39.79 ? 598  HOH A O   1 
HETATM 3047 O O   . HOH F 4 .   ? -0.315  35.200 -17.264 1.00 45.31 ? 599  HOH A O   1 
HETATM 3048 O O   . HOH F 4 .   ? -6.516  17.075 -9.535  1.00 27.73 ? 600  HOH A O   1 
HETATM 3049 O O   . HOH F 4 .   ? -35.353 13.982 -16.724 1.00 35.91 ? 601  HOH A O   1 
HETATM 3050 O O   . HOH F 4 .   ? -8.062  22.532 -32.028 1.00 48.99 ? 602  HOH A O   1 
HETATM 3051 O O   . HOH F 4 .   ? -35.594 29.435 14.953  1.00 41.77 ? 603  HOH A O   1 
HETATM 3052 O O   . HOH F 4 .   ? -33.489 4.716  7.764   1.00 30.77 ? 604  HOH A O   1 
HETATM 3053 O O   . HOH F 4 .   ? -8.946  36.258 -21.785 1.00 32.26 ? 605  HOH A O   1 
HETATM 3054 O O   . HOH F 4 .   ? -29.853 37.456 8.536   1.00 35.74 ? 606  HOH A O   1 
HETATM 3055 O O   . HOH F 4 .   ? -2.013  11.423 5.233   1.00 34.31 ? 607  HOH A O   1 
HETATM 3056 O O   . HOH F 4 .   ? 4.174   13.675 5.841   1.00 41.95 ? 608  HOH A O   1 
HETATM 3057 O O   . HOH F 4 .   ? -11.338 31.021 27.380  1.00 25.37 ? 609  HOH A O   1 
HETATM 3058 O O   . HOH F 4 .   ? -37.228 14.150 -13.291 1.00 33.50 ? 610  HOH A O   1 
HETATM 3059 O O   . HOH F 4 .   ? 3.349   33.131 -15.437 1.00 46.96 ? 611  HOH A O   1 
HETATM 3060 O O   . HOH F 4 .   ? -38.080 14.625 -10.896 1.00 31.88 ? 612  HOH A O   1 
HETATM 3061 O O   . HOH F 4 .   ? -19.144 50.610 8.076   1.00 28.87 ? 613  HOH A O   1 
HETATM 3062 O O   . HOH F 4 .   ? 2.079   26.620 6.707   1.00 41.20 ? 614  HOH A O   1 
HETATM 3063 O O   . HOH F 4 .   ? -30.835 43.870 -18.503 1.00 43.37 ? 615  HOH A O   1 
HETATM 3064 O O   . HOH F 4 .   ? -22.862 48.234 -2.024  1.00 34.99 ? 616  HOH A O   1 
HETATM 3065 O O   . HOH F 4 .   ? -40.066 16.358 -16.091 1.00 37.68 ? 617  HOH A O   1 
HETATM 3066 O O   . HOH F 4 .   ? -36.891 33.714 -22.167 1.00 19.86 ? 618  HOH A O   1 
HETATM 3067 O O   . HOH F 4 .   ? -0.904  11.093 -4.170  1.00 40.73 ? 619  HOH A O   1 
HETATM 3068 O O   . HOH F 4 .   ? -30.259 35.888 24.568  1.00 33.72 ? 620  HOH A O   1 
HETATM 3069 O O   . HOH F 4 .   ? -30.425 15.401 -20.241 1.00 33.93 ? 621  HOH A O   1 
HETATM 3070 O O   . HOH F 4 .   ? -30.585 2.805  3.963   1.00 47.01 ? 622  HOH A O   1 
HETATM 3071 O O   . HOH F 4 .   ? -19.666 48.070 6.553   1.00 42.29 ? 623  HOH A O   1 
HETATM 3072 O O   . HOH F 4 .   ? -21.918 39.459 -20.159 1.00 32.09 ? 624  HOH A O   1 
HETATM 3073 O O   . HOH F 4 .   ? -3.457  8.689  4.375   1.00 38.76 ? 625  HOH A O   1 
HETATM 3074 O O   . HOH F 4 .   ? -11.816 39.890 22.896  1.00 39.07 ? 626  HOH A O   1 
HETATM 3075 O O   . HOH F 4 .   ? -34.056 42.169 -22.848 1.00 33.88 ? 627  HOH A O   1 
HETATM 3076 O O   . HOH F 4 .   ? 0.042   28.512 12.348  1.00 33.98 ? 628  HOH A O   1 
HETATM 3077 O O   . HOH F 4 .   ? -25.836 13.828 24.928  1.00 20.85 ? 629  HOH A O   1 
HETATM 3078 O O   . HOH F 4 .   ? -4.119  23.109 -28.499 1.00 41.66 ? 630  HOH A O   1 
HETATM 3079 O O   . HOH F 4 .   ? -25.244 28.178 -31.432 1.00 32.42 ? 631  HOH A O   1 
HETATM 3080 O O   . HOH F 4 .   ? -23.623 6.286  17.388  1.00 19.35 ? 632  HOH A O   1 
HETATM 3081 O O   . HOH F 4 .   ? -16.505 50.608 8.388   1.00 29.39 ? 633  HOH A O   1 
HETATM 3082 O O   . HOH F 4 .   ? -0.274  33.946 15.291  1.00 45.53 ? 634  HOH A O   1 
HETATM 3083 O O   . HOH F 4 .   ? 0.368   12.123 8.708   1.00 34.90 ? 635  HOH A O   1 
HETATM 3084 O O   . HOH F 4 .   ? -36.570 7.069  14.570  1.00 44.59 ? 636  HOH A O   1 
HETATM 3085 O O   . HOH F 4 .   ? -32.826 9.372  20.733  1.00 37.36 ? 637  HOH A O   1 
HETATM 3086 O O   . HOH F 4 .   ? -36.296 8.877  21.176  1.00 38.92 ? 638  HOH A O   1 
HETATM 3087 O O   . HOH F 4 .   ? 4.423   34.269 -7.490  1.00 38.64 ? 639  HOH A O   1 
HETATM 3088 O O   . HOH F 4 .   ? -15.046 50.211 10.771  1.00 16.94 ? 640  HOH A O   1 
HETATM 3089 O O   . HOH F 4 .   ? -38.853 34.884 -13.694 1.00 30.42 ? 641  HOH A O   1 
HETATM 3090 O O   . HOH F 4 .   ? -4.098  34.571 -19.656 1.00 44.70 ? 642  HOH A O   1 
HETATM 3091 O O   . HOH F 4 .   ? -23.647 19.538 -33.327 1.00 46.14 ? 643  HOH A O   1 
HETATM 3092 O O   . HOH F 4 .   ? -14.805 8.059  15.883  1.00 37.15 ? 644  HOH A O   1 
HETATM 3093 O O   . HOH F 4 .   ? -26.298 3.853  -14.688 1.00 62.07 ? 645  HOH A O   1 
HETATM 3094 O O   . HOH F 4 .   ? -35.141 37.551 -22.333 1.00 30.63 ? 646  HOH A O   1 
HETATM 3095 O O   . HOH F 4 .   ? 1.904   9.061  2.607   1.00 51.24 ? 647  HOH A O   1 
HETATM 3096 O O   . HOH F 4 .   ? -13.675 48.205 11.871  1.00 22.06 ? 648  HOH A O   1 
HETATM 3097 O O   . HOH F 4 .   ? -10.517 29.094 25.027  1.00 48.49 ? 649  HOH A O   1 
HETATM 3098 O O   . HOH F 4 .   ? -3.275  33.295 -17.255 1.00 35.05 ? 650  HOH A O   1 
HETATM 3099 O O   . HOH F 4 .   ? -36.353 33.813 -25.007 1.00 49.80 ? 651  HOH A O   1 
HETATM 3100 O O   . HOH F 4 .   ? -11.304 40.169 15.771  1.00 18.64 ? 652  HOH A O   1 
HETATM 3101 O O   . HOH F 4 .   ? -8.467  46.072 -9.117  1.00 42.05 ? 653  HOH A O   1 
HETATM 3102 O O   . HOH F 4 .   ? -34.751 37.419 -17.302 1.00 22.10 ? 654  HOH A O   1 
HETATM 3103 O O   . HOH F 4 .   ? 2.991   26.294 -13.397 1.00 42.42 ? 655  HOH A O   1 
HETATM 3104 O O   . HOH F 4 .   ? -17.124 32.235 -27.404 1.00 22.25 ? 656  HOH A O   1 
HETATM 3105 O O   . HOH F 4 .   ? -8.236  24.599 16.941  1.00 11.84 ? 657  HOH A O   1 
HETATM 3106 O O   . HOH F 4 .   ? -45.809 22.704 -9.135  1.00 52.83 ? 658  HOH A O   1 
HETATM 3107 O O   . HOH F 4 .   ? -4.478  13.793 10.574  1.00 26.26 ? 659  HOH A O   1 
HETATM 3108 O O   . HOH F 4 .   ? -33.348 35.940 14.906  1.00 35.48 ? 660  HOH A O   1 
HETATM 3109 O O   . HOH F 4 .   ? -5.770  3.176  -3.076  1.00 39.35 ? 661  HOH A O   1 
HETATM 3110 O O   . HOH F 4 .   ? -22.287 28.036 -31.254 1.00 42.44 ? 662  HOH A O   1 
HETATM 3111 O O   . HOH F 4 .   ? 1.291   30.902 12.856  1.00 53.91 ? 663  HOH A O   1 
HETATM 3112 O O   . HOH F 4 .   ? -6.742  17.173 -12.539 1.00 47.79 ? 664  HOH A O   1 
HETATM 3113 O O   . HOH F 4 .   ? -43.463 30.637 -17.924 1.00 46.85 ? 665  HOH A O   1 
HETATM 3114 O O   . HOH F 4 .   ? -26.630 42.487 13.829  1.00 39.19 ? 666  HOH A O   1 
HETATM 3115 O O   . HOH F 4 .   ? -28.617 31.036 -29.959 1.00 42.11 ? 667  HOH A O   1 
HETATM 3116 O O   . HOH F 4 .   ? -39.622 5.368  15.595  1.00 44.76 ? 668  HOH A O   1 
HETATM 3117 O O   . HOH F 4 .   ? -10.830 17.137 -28.458 1.00 48.71 ? 669  HOH A O   1 
HETATM 3118 O O   . HOH F 4 .   ? -23.900 45.202 -6.064  1.00 47.40 ? 670  HOH A O   1 
HETATM 3119 O O   . HOH F 4 .   ? -33.202 28.858 6.895   1.00 51.78 ? 671  HOH A O   1 
HETATM 3120 O O   . HOH F 4 .   ? -4.390  8.831  -4.346  1.00 44.43 ? 672  HOH A O   1 
HETATM 3121 O O   . HOH F 4 .   ? 4.944   19.036 -12.181 1.00 49.49 ? 673  HOH A O   1 
HETATM 3122 O O   . HOH F 4 .   ? -10.464 0.664  -3.237  1.00 38.13 ? 674  HOH A O   1 
HETATM 3123 O O   . HOH F 4 .   ? -10.162 31.049 -28.625 1.00 41.67 ? 675  HOH A O   1 
HETATM 3124 O O   . HOH F 4 .   ? -14.850 31.179 -27.528 1.00 27.03 ? 676  HOH A O   1 
HETATM 3125 O O   . HOH F 4 .   ? -14.339 6.353  14.443  1.00 47.10 ? 677  HOH A O   1 
HETATM 3126 O O   . HOH F 4 .   ? -28.660 3.989  7.581   1.00 37.85 ? 678  HOH A O   1 
HETATM 3127 O O   . HOH F 4 .   ? -28.201 7.215  -16.591 1.00 38.37 ? 679  HOH A O   1 
HETATM 3128 O O   . HOH F 4 .   ? -23.320 37.069 -24.542 1.00 32.36 ? 680  HOH A O   1 
HETATM 3129 O O   . HOH F 4 .   ? -27.660 41.669 -23.461 1.00 41.86 ? 681  HOH A O   1 
HETATM 3130 O O   . HOH F 4 .   ? -19.352 6.320  18.053  1.00 28.69 ? 682  HOH A O   1 
HETATM 3131 O O   . HOH F 4 .   ? -10.068 34.442 27.051  1.00 36.72 ? 683  HOH A O   1 
HETATM 3132 O O   . HOH F 4 .   ? -7.400  24.408 17.601  1.00 25.96 ? 684  HOH A O   1 
HETATM 3133 O O   . HOH F 4 .   ? -37.204 21.696 28.704  1.00 36.78 ? 685  HOH A O   1 
HETATM 3134 O O   . HOH F 4 .   ? -22.289 16.171 27.965  1.00 25.68 ? 686  HOH A O   1 
HETATM 3135 O O   . HOH F 4 .   ? -39.262 28.394 22.535  1.00 49.29 ? 687  HOH A O   1 
HETATM 3136 O O   . HOH F 4 .   ? -3.625  44.339 10.325  1.00 36.64 ? 688  HOH A O   1 
HETATM 3137 O O   . HOH F 4 .   ? -13.285 40.833 16.236  1.00 20.94 ? 689  HOH A O   1 
HETATM 3138 O O   . HOH F 4 .   ? 1.571   32.492 -17.400 1.00 38.72 ? 690  HOH A O   1 
HETATM 3139 O O   . HOH F 4 .   ? -36.037 2.780  5.493   1.00 32.42 ? 691  HOH A O   1 
HETATM 3140 O O   . HOH F 4 .   ? -11.192 49.080 7.936   1.00 33.65 ? 692  HOH A O   1 
HETATM 3141 O O   . HOH F 4 .   ? -14.842 12.127 -20.369 1.00 52.91 ? 693  HOH A O   1 
HETATM 3142 O O   . HOH F 4 .   ? -18.682 1.730  -4.592  1.00 36.86 ? 694  HOH A O   1 
HETATM 3143 O O   . HOH F 4 .   ? -11.141 3.370  -9.577  1.00 35.56 ? 695  HOH A O   1 
HETATM 3144 O O   . HOH F 4 .   ? -16.641 39.754 19.222  1.00 33.84 ? 696  HOH A O   1 
HETATM 3145 O O   . HOH F 4 .   ? -11.738 3.402  -11.881 1.00 31.72 ? 697  HOH A O   1 
HETATM 3146 O O   . HOH F 4 .   ? -34.699 1.970  3.732   1.00 43.00 ? 698  HOH A O   1 
HETATM 3147 O O   . HOH F 4 .   ? -30.846 8.048  -20.083 1.00 50.08 ? 699  HOH A O   1 
HETATM 3148 O O   . HOH F 4 .   ? -33.208 7.415  -17.081 1.00 42.66 ? 700  HOH A O   1 
HETATM 3149 O O   . HOH F 4 .   ? -6.618  48.615 7.192   1.00 43.15 ? 701  HOH A O   1 
HETATM 3150 O O   . HOH F 4 .   ? -28.223 43.465 -16.913 1.00 46.15 ? 702  HOH A O   1 
HETATM 3151 O O   . HOH F 4 .   ? -14.506 30.954 -30.391 1.00 38.62 ? 703  HOH A O   1 
HETATM 3152 O O   . HOH F 4 .   ? -31.235 -1.442 -2.455  1.00 48.98 ? 704  HOH A O   1 
HETATM 3153 O O   . HOH F 4 .   ? -15.123 28.388 -31.515 1.00 44.21 ? 705  HOH A O   1 
HETATM 3154 O O   . HOH F 4 .   ? -15.358 5.899  -13.651 1.00 38.98 ? 706  HOH A O   1 
HETATM 3155 O O   . HOH F 4 .   ? -37.248 18.831 31.521  1.00 31.09 ? 707  HOH A O   1 
HETATM 3156 O O   . HOH F 4 .   ? -41.901 4.150  16.965  1.00 54.49 ? 708  HOH A O   1 
HETATM 3157 O O   . HOH F 4 .   ? -24.301 23.718 14.600  1.00 10.88 ? 709  HOH A O   1 
HETATM 3158 O O   . HOH F 4 .   ? -16.003 37.799 5.589   1.00 9.17  ? 710  HOH A O   1 
HETATM 3159 O O   . HOH F 4 .   ? -23.835 36.438 12.201  1.00 11.49 ? 711  HOH A O   1 
HETATM 3160 O O   . HOH F 4 .   ? -17.627 18.688 6.190   1.00 11.35 ? 712  HOH A O   1 
HETATM 3161 O O   . HOH F 4 .   ? -9.739  37.572 9.306   1.00 10.98 ? 713  HOH A O   1 
HETATM 3162 O O   . HOH F 4 .   ? -26.318 19.965 1.365   1.00 12.68 ? 714  HOH A O   1 
HETATM 3163 O O   . HOH F 4 .   ? -18.954 35.161 2.886   1.00 12.61 ? 715  HOH A O   1 
HETATM 3164 O O   . HOH F 4 .   ? -21.855 34.596 4.268   1.00 12.63 ? 716  HOH A O   1 
HETATM 3165 O O   . HOH F 4 .   ? -31.676 24.058 26.299  1.00 13.33 ? 717  HOH A O   1 
HETATM 3166 O O   . HOH F 4 .   ? -23.789 38.477 -9.772  1.00 13.58 ? 718  HOH A O   1 
HETATM 3167 O O   . HOH F 4 .   ? -19.404 23.929 11.093  1.00 10.77 ? 719  HOH A O   1 
HETATM 3168 O O   . HOH F 4 .   ? -19.975 32.758 2.597   1.00 12.20 ? 720  HOH A O   1 
HETATM 3169 O O   . HOH F 4 .   ? -5.530  32.959 12.818  1.00 12.87 ? 721  HOH A O   1 
HETATM 3170 O O   . HOH F 4 .   ? -23.918 14.025 22.027  1.00 12.73 ? 722  HOH A O   1 
HETATM 3171 O O   . HOH F 4 .   ? -24.037 13.708 19.219  1.00 12.37 ? 723  HOH A O   1 
HETATM 3172 O O   . HOH F 4 .   ? -26.622 12.497 19.280  1.00 13.33 ? 724  HOH A O   1 
HETATM 3173 O O   . HOH F 4 .   ? -27.347 32.851 -4.156  1.00 14.49 ? 725  HOH A O   1 
HETATM 3174 O O   . HOH F 4 .   ? -25.219 33.579 14.955  1.00 12.02 ? 726  HOH A O   1 
HETATM 3175 O O   . HOH F 4 .   ? -14.418 24.124 -23.587 1.00 16.05 ? 727  HOH A O   1 
HETATM 3176 O O   . HOH F 4 .   ? -16.128 40.128 -1.556  1.00 16.74 ? 728  HOH A O   1 
HETATM 3177 O O   . HOH F 4 .   ? -22.646 20.468 27.199  1.00 17.41 ? 729  HOH A O   1 
HETATM 3178 O O   . HOH F 4 .   ? -29.529 28.129 -6.599  1.00 15.20 ? 730  HOH A O   1 
HETATM 3179 O O   . HOH F 4 .   ? -22.155 16.659 25.177  1.00 16.16 ? 731  HOH A O   1 
HETATM 3180 O O   . HOH F 4 .   ? -28.230 13.597 17.280  1.00 15.14 ? 732  HOH A O   1 
HETATM 3181 O O   . HOH F 4 .   ? -10.634 10.587 10.036  1.00 16.22 ? 733  HOH A O   1 
HETATM 3182 O O   . HOH F 4 .   ? -29.857 17.275 17.087  1.00 17.06 ? 734  HOH A O   1 
HETATM 3183 O O   . HOH F 4 .   ? -30.131 36.869 -11.928 1.00 17.26 ? 735  HOH A O   1 
HETATM 3184 O O   . HOH F 4 .   ? -13.236 42.434 -6.878  1.00 15.79 ? 736  HOH A O   1 
HETATM 3185 O O   . HOH F 4 .   ? -9.431  20.539 -12.575 1.00 16.94 ? 737  HOH A O   1 
HETATM 3186 O O   . HOH F 4 .   ? -28.544 27.649 13.470  1.00 14.82 ? 738  HOH A O   1 
HETATM 3187 O O   . HOH F 4 .   ? -27.564 21.144 -6.981  1.00 17.52 ? 739  HOH A O   1 
HETATM 3188 O O   . HOH F 4 .   ? -30.637 20.549 15.155  1.00 21.67 ? 740  HOH A O   1 
HETATM 3189 O O   . HOH F 4 .   ? -27.445 12.344 3.639   1.00 16.90 ? 741  HOH A O   1 
HETATM 3190 O O   . HOH F 4 .   ? -27.165 19.543 3.959   1.00 20.73 ? 742  HOH A O   1 
HETATM 3191 O O   . HOH F 4 .   ? -23.606 6.006  2.776   1.00 17.89 ? 743  HOH A O   1 
HETATM 3192 O O   . HOH F 4 .   ? -20.764 3.760  -0.919  1.00 18.16 ? 744  HOH A O   1 
HETATM 3193 O O   . HOH F 4 .   ? -24.380 15.936 23.725  1.00 17.39 ? 745  HOH A O   1 
HETATM 3194 O O   . HOH F 4 .   ? -32.548 15.564 2.253   1.00 18.32 ? 746  HOH A O   1 
HETATM 3195 O O   . HOH F 4 .   ? -27.816 15.939 15.840  1.00 13.98 ? 747  HOH A O   1 
HETATM 3196 O O   . HOH F 4 .   ? -29.042 15.530 -12.260 1.00 19.03 ? 748  HOH A O   1 
HETATM 3197 O O   . HOH F 4 .   ? -14.068 16.090 11.743  1.00 14.10 ? 749  HOH A O   1 
HETATM 3198 O O   . HOH F 4 .   ? -15.294 40.815 -5.984  1.00 19.62 ? 750  HOH A O   1 
HETATM 3199 O O   . HOH F 4 .   ? -12.708 11.882 17.675  1.00 20.92 ? 751  HOH A O   1 
HETATM 3200 O O   . HOH F 4 .   ? -33.184 32.932 -15.672 1.00 16.04 ? 752  HOH A O   1 
HETATM 3201 O O   . HOH F 4 .   ? -25.323 16.983 15.615  1.00 13.91 ? 753  HOH A O   1 
HETATM 3202 O O   . HOH F 4 .   ? -10.514 42.302 -6.690  1.00 19.77 ? 754  HOH A O   1 
HETATM 3203 O O   . HOH F 4 .   ? -4.768  23.846 -10.015 1.00 19.13 ? 755  HOH A O   1 
HETATM 3204 O O   . HOH F 4 .   ? -18.719 4.621  2.859   1.00 22.43 ? 756  HOH A O   1 
HETATM 3205 O O   . HOH F 4 .   ? -19.338 22.504 25.594  1.00 18.57 ? 757  HOH A O   1 
HETATM 3206 O O   . HOH F 4 .   ? -23.599 37.960 6.302   1.00 19.98 ? 758  HOH A O   1 
HETATM 3207 O O   . HOH F 4 .   ? -26.747 31.337 5.684   1.00 22.51 ? 759  HOH A O   1 
HETATM 3208 O O   . HOH F 4 .   ? -20.171 24.965 -28.061 1.00 19.35 ? 760  HOH A O   1 
HETATM 3209 O O   . HOH F 4 .   ? -19.168 5.132  -7.481  1.00 24.62 ? 761  HOH A O   1 
HETATM 3210 O O   . HOH F 4 .   ? -16.078 26.637 11.735  1.00 18.79 ? 762  HOH A O   1 
HETATM 3211 O O   . HOH F 4 .   ? -26.780 19.585 29.775  1.00 21.37 ? 763  HOH A O   1 
HETATM 3212 O O   . HOH F 4 .   ? -16.666 38.789 16.536  1.00 20.03 ? 764  HOH A O   1 
HETATM 3213 O O   . HOH F 4 .   ? -32.224 35.309 -12.552 1.00 20.11 ? 765  HOH A O   1 
HETATM 3214 O O   . HOH F 4 .   ? -22.754 34.147 25.215  1.00 21.50 ? 766  HOH A O   1 
HETATM 3215 O O   . HOH F 4 .   ? -28.359 7.444  -12.186 1.00 37.95 ? 767  HOH A O   1 
HETATM 3216 O O   . HOH F 4 .   ? -25.264 21.770 -25.834 1.00 19.92 ? 768  HOH A O   1 
HETATM 3217 O O   . HOH F 4 .   ? -24.039 33.308 18.830  1.00 17.52 ? 769  HOH A O   1 
HETATM 3218 O O   . HOH F 4 .   ? -30.158 19.491 1.051   1.00 21.20 ? 770  HOH A O   1 
HETATM 3219 O O   . HOH F 4 .   ? -30.000 16.249 24.537  1.00 22.73 ? 771  HOH A O   1 
HETATM 3220 O O   . HOH F 4 .   ? -20.723 22.399 27.922  1.00 18.05 ? 772  HOH A O   1 
HETATM 3221 O O   . HOH F 4 .   ? -10.459 25.035 -18.353 1.00 23.32 ? 773  HOH A O   1 
HETATM 3222 O O   . HOH F 4 .   ? -12.520 9.347  11.463  1.00 23.46 ? 774  HOH A O   1 
HETATM 3223 O O   . HOH F 4 .   ? -8.348  10.701 11.794  1.00 27.63 ? 775  HOH A O   1 
HETATM 3224 O O   . HOH F 4 .   ? -18.357 4.554  0.093   1.00 21.92 ? 776  HOH A O   1 
HETATM 3225 O O   . HOH F 4 .   ? -14.425 38.735 14.659  1.00 18.53 ? 777  HOH A O   1 
HETATM 3226 O O   . HOH F 4 .   ? -26.606 15.731 -16.686 1.00 23.52 ? 778  HOH A O   1 
HETATM 3227 O O   . HOH F 4 .   ? -21.726 5.972  6.897   1.00 26.14 ? 779  HOH A O   1 
HETATM 3228 O O   . HOH F 4 .   ? -18.461 7.048  3.930   1.00 19.33 ? 780  HOH A O   1 
HETATM 3229 O O   . HOH F 4 .   ? -10.598 30.161 -20.501 1.00 21.83 ? 781  HOH A O   1 
HETATM 3230 O O   . HOH F 4 .   ? -15.617 5.075  -6.696  1.00 20.73 ? 782  HOH A O   1 
HETATM 3231 O O   . HOH F 4 .   ? -33.814 15.884 21.808  1.00 20.89 ? 783  HOH A O   1 
HETATM 3232 O O   . HOH F 4 .   ? -25.034 6.565  9.309   1.00 25.01 ? 784  HOH A O   1 
HETATM 3233 O O   . HOH F 4 .   ? -2.185  35.285 13.608  1.00 20.35 ? 785  HOH A O   1 
HETATM 3234 O O   . HOH F 4 .   ? -37.365 19.917 22.342  1.00 23.80 ? 786  HOH A O   1 
HETATM 3235 O O   . HOH F 4 .   ? -24.144 39.305 -7.093  1.00 22.10 ? 787  HOH A O   1 
HETATM 3236 O O   . HOH F 4 .   ? -29.625 29.231 11.130  1.00 21.02 ? 788  HOH A O   1 
HETATM 3237 O O   . HOH F 4 .   ? -32.466 13.134 4.106   1.00 19.93 ? 789  HOH A O   1 
HETATM 3238 O O   . HOH F 4 .   ? 1.988   18.292 4.961   1.00 22.89 ? 790  HOH A O   1 
HETATM 3239 O O   . HOH F 4 .   ? -22.377 35.194 19.939  1.00 18.64 ? 791  HOH A O   1 
HETATM 3240 O O   . HOH F 4 .   ? -22.631 7.722  8.748   1.00 17.51 ? 792  HOH A O   1 
HETATM 3241 O O   . HOH F 4 .   ? -36.973 23.256 -6.635  1.00 23.29 ? 793  HOH A O   1 
HETATM 3242 O O   . HOH F 4 .   ? -2.248  29.897 9.391   1.00 23.61 ? 794  HOH A O   1 
HETATM 3243 O O   . HOH F 4 .   ? -29.517 14.269 13.936  1.00 22.79 ? 795  HOH A O   1 
HETATM 3244 O O   . HOH F 4 .   ? -37.514 20.415 -14.176 1.00 20.49 ? 796  HOH A O   1 
HETATM 3245 O O   . HOH F 4 .   ? -26.345 14.300 13.021  1.00 20.94 ? 797  HOH A O   1 
HETATM 3246 O O   . HOH F 4 .   ? -3.239  9.717  -0.062  1.00 25.34 ? 798  HOH A O   1 
HETATM 3247 O O   . HOH F 4 .   ? -30.478 14.973 18.604  1.00 18.99 ? 799  HOH A O   1 
HETATM 3248 O O   . HOH F 4 .   ? -11.126 18.415 -13.132 1.00 21.73 ? 800  HOH A O   1 
HETATM 3249 O O   . HOH F 4 .   ? -19.043 36.213 22.453  1.00 19.97 ? 801  HOH A O   1 
HETATM 3250 O O   . HOH F 4 .   ? -33.147 35.023 -17.817 1.00 22.04 ? 802  HOH A O   1 
HETATM 3251 O O   . HOH F 4 .   ? -15.712 37.070 23.425  1.00 24.97 ? 803  HOH A O   1 
HETATM 3252 O O   . HOH F 4 .   ? -29.500 8.825  -9.642  1.00 20.89 ? 804  HOH A O   1 
HETATM 3253 O O   . HOH F 4 .   ? -25.858 36.387 -3.201  1.00 28.18 ? 805  HOH A O   1 
HETATM 3254 O O   . HOH F 4 .   ? -21.358 44.937 -5.021  1.00 20.84 ? 806  HOH A O   1 
HETATM 3255 O O   . HOH F 4 .   ? -3.333  23.860 -2.434  1.00 25.67 ? 807  HOH A O   1 
HETATM 3256 O O   . HOH F 4 .   ? -1.511  11.589 0.883   1.00 27.07 ? 808  HOH A O   1 
HETATM 3257 O O   . HOH F 4 .   ? -7.906  13.719 -5.973  1.00 46.13 ? 809  HOH A O   1 
HETATM 3258 O O   . HOH F 4 .   ? -24.666 40.092 -21.255 1.00 26.11 ? 810  HOH A O   1 
HETATM 3259 O O   . HOH F 4 .   ? -27.651 30.410 9.614   1.00 22.30 ? 811  HOH A O   1 
HETATM 3260 O O   . HOH F 4 .   ? -18.055 36.760 17.695  1.00 21.80 ? 812  HOH A O   1 
HETATM 3261 O O   . HOH F 4 .   ? -23.294 21.453 -27.828 1.00 27.97 ? 813  HOH A O   1 
HETATM 3262 O O   . HOH F 4 .   ? -27.385 35.393 -4.909  1.00 23.35 ? 814  HOH A O   1 
HETATM 3263 O O   . HOH F 4 .   ? -32.824 19.504 14.107  1.00 40.02 ? 815  HOH A O   1 
HETATM 3264 O O   . HOH F 4 .   ? -12.492 14.547 -12.791 1.00 33.38 ? 816  HOH A O   1 
HETATM 3265 O O   . HOH F 4 .   ? -23.555 37.707 -21.067 1.00 22.51 ? 817  HOH A O   1 
HETATM 3266 O O   . HOH F 4 .   ? -32.550 28.021 -1.902  1.00 21.08 ? 818  HOH A O   1 
HETATM 3267 O O   . HOH F 4 .   ? -26.430 11.559 11.480  1.00 17.01 ? 819  HOH A O   1 
HETATM 3268 O O   . HOH F 4 .   ? -19.168 18.291 27.695  1.00 26.99 ? 820  HOH A O   1 
HETATM 3269 O O   . HOH F 4 .   ? -4.303  13.172 6.216   1.00 31.92 ? 821  HOH A O   1 
HETATM 3270 O O   . HOH F 4 .   ? -22.783 4.754  5.061   1.00 25.10 ? 822  HOH A O   1 
HETATM 3271 O O   . HOH F 4 .   ? -34.908 18.496 14.976  1.00 21.30 ? 823  HOH A O   1 
HETATM 3272 O O   . HOH F 4 .   ? -34.618 21.062 29.266  1.00 29.06 ? 824  HOH A O   1 
HETATM 3273 O O   . HOH F 4 .   ? -22.263 41.480 3.378   1.00 24.98 ? 825  HOH A O   1 
HETATM 3274 O O   . HOH F 4 .   ? -21.121 30.182 30.228  1.00 25.38 ? 826  HOH A O   1 
HETATM 3275 O O   . HOH F 4 .   ? -13.634 43.248 -4.019  1.00 26.75 ? 827  HOH A O   1 
HETATM 3276 O O   . HOH F 4 .   ? -32.055 15.391 13.838  1.00 27.01 ? 828  HOH A O   1 
HETATM 3277 O O   . HOH F 4 .   ? -38.183 33.239 -11.584 1.00 24.98 ? 829  HOH A O   1 
HETATM 3278 O O   . HOH F 4 .   ? -18.424 25.026 -30.158 1.00 31.27 ? 830  HOH A O   1 
HETATM 3279 O O   . HOH F 4 .   ? -30.593 10.417 -7.055  1.00 28.79 ? 831  HOH A O   1 
HETATM 3280 O O   . HOH F 4 .   ? -34.981 18.760 23.463  1.00 25.05 ? 832  HOH A O   1 
HETATM 3281 O O   . HOH F 4 .   ? -17.237 36.671 26.440  1.00 31.08 ? 833  HOH A O   1 
HETATM 3282 O O   . HOH F 4 .   ? -33.609 24.558 32.701  1.00 33.81 ? 834  HOH A O   1 
HETATM 3283 O O   . HOH F 4 .   ? -23.739 36.776 -5.067  1.00 22.45 ? 835  HOH A O   1 
HETATM 3284 O O   . HOH F 4 .   ? -22.555 2.620  1.014   1.00 25.47 ? 836  HOH A O   1 
HETATM 3285 O O   . HOH F 4 .   ? -26.410 33.092 -8.942  1.00 23.25 ? 837  HOH A O   1 
HETATM 3286 O O   . HOH F 4 .   ? -22.509 18.510 29.009  1.00 34.96 ? 838  HOH A O   1 
HETATM 3287 O O   . HOH F 4 .   ? -31.931 20.043 8.831   1.00 25.67 ? 839  HOH A O   1 
HETATM 3288 O O   . HOH F 4 .   ? -31.866 14.244 20.573  1.00 26.20 ? 840  HOH A O   1 
HETATM 3289 O O   . HOH F 4 .   ? -2.560  21.490 -6.406  1.00 33.04 ? 841  HOH A O   1 
HETATM 3290 O O   . HOH F 4 .   ? -11.709 11.109 15.113  1.00 26.97 ? 842  HOH A O   1 
HETATM 3291 O O   . HOH F 4 .   ? -20.808 1.963  -2.924  1.00 28.30 ? 843  HOH A O   1 
HETATM 3292 O O   . HOH F 4 .   ? -34.150 31.529 25.293  1.00 26.64 ? 844  HOH A O   1 
HETATM 3293 O O   . HOH F 4 .   ? -28.546 35.272 3.553   1.00 26.56 ? 845  HOH A O   1 
HETATM 3294 O O   . HOH F 4 .   ? -18.393 4.918  -10.273 1.00 33.78 ? 846  HOH A O   1 
HETATM 3295 O O   . HOH F 4 .   ? -17.479 18.599 -21.302 1.00 23.49 ? 847  HOH A O   1 
HETATM 3296 O O   . HOH F 4 .   ? -5.119  21.365 -11.070 1.00 25.38 ? 848  HOH A O   1 
HETATM 3297 O O   . HOH F 4 .   ? -24.532 39.064 3.473   1.00 57.09 ? 849  HOH A O   1 
HETATM 3298 O O   . HOH F 4 .   ? -37.500 22.440 21.233  1.00 20.82 ? 850  HOH A O   1 
HETATM 3299 O O   . HOH F 4 .   ? -14.192 46.259 0.667   1.00 26.15 ? 851  HOH A O   1 
HETATM 3300 O O   . HOH F 4 .   ? -33.609 8.661  -6.992  1.00 35.33 ? 852  HOH A O   1 
HETATM 3301 O O   . HOH F 4 .   ? -17.286 5.856  6.052   1.00 26.37 ? 853  HOH A O   1 
HETATM 3302 O O   . HOH F 4 .   ? -0.354  29.078 0.664   1.00 30.59 ? 854  HOH A O   1 
HETATM 3303 O O   . HOH F 4 .   ? -28.397 33.128 9.590   1.00 22.25 ? 855  HOH A O   1 
HETATM 3304 O O   . HOH F 4 .   ? -21.854 7.394  -14.909 1.00 23.51 ? 856  HOH A O   1 
HETATM 3305 O O   . HOH F 4 .   ? -8.842  43.261 0.355   1.00 26.25 ? 857  HOH A O   1 
HETATM 3306 O O   . HOH F 4 .   ? -22.258 40.367 5.961   1.00 21.47 ? 858  HOH A O   1 
HETATM 3307 O O   . HOH F 4 .   ? -22.121 35.312 22.710  1.00 24.15 ? 859  HOH A O   1 
HETATM 3308 O O   . HOH F 4 .   ? -7.198  42.658 4.388   1.00 33.31 ? 860  HOH A O   1 
HETATM 3309 O O   . HOH F 4 .   ? -33.508 5.861  -2.344  1.00 38.82 ? 861  HOH A O   1 
HETATM 3310 O O   . HOH F 4 .   ? -2.176  26.161 -5.772  1.00 26.69 ? 862  HOH A O   1 
HETATM 3311 O O   . HOH F 4 .   ? -28.068 6.545  -9.297  1.00 25.65 ? 863  HOH A O   1 
HETATM 3312 O O   . HOH F 4 .   ? -17.602 7.731  16.006  1.00 27.17 ? 864  HOH A O   1 
HETATM 3313 O O   . HOH F 4 .   ? 2.655   27.197 -10.274 1.00 28.72 ? 865  HOH A O   1 
HETATM 3314 O O   . HOH F 4 .   ? -10.487 17.831 -15.781 1.00 29.83 ? 866  HOH A O   1 
HETATM 3315 O O   . HOH F 4 .   ? -29.956 36.190 -5.315  1.00 32.19 ? 867  HOH A O   1 
HETATM 3316 O O   . HOH F 4 .   ? -25.515 37.130 0.296   1.00 27.62 ? 868  HOH A O   1 
HETATM 3317 O O   . HOH F 4 .   ? -14.039 4.963  -1.977  1.00 21.19 ? 869  HOH A O   1 
HETATM 3318 O O   . HOH F 4 .   ? -8.081  9.903  -4.079  1.00 30.67 ? 870  HOH A O   1 
HETATM 3319 O O   . HOH F 4 .   ? -28.288 31.105 3.401   1.00 31.43 ? 871  HOH A O   1 
HETATM 3320 O O   . HOH F 4 .   ? -30.958 18.407 -24.266 1.00 29.94 ? 872  HOH A O   1 
HETATM 3321 O O   . HOH F 4 .   ? -24.202 39.296 -3.698  1.00 28.30 ? 873  HOH A O   1 
HETATM 3322 O O   . HOH F 4 .   ? -27.499 14.533 -14.385 1.00 23.53 ? 874  HOH A O   1 
HETATM 3323 O O   . HOH F 4 .   ? -2.442  38.550 -6.929  1.00 36.09 ? 875  HOH A O   1 
HETATM 3324 O O   . HOH F 4 .   ? -3.348  29.912 -13.747 1.00 28.87 ? 876  HOH A O   1 
HETATM 3325 O O   . HOH F 4 .   ? -34.786 25.940 -4.732  1.00 27.54 ? 877  HOH A O   1 
HETATM 3326 O O   . HOH F 4 .   ? -26.194 34.217 28.078  1.00 32.83 ? 878  HOH A O   1 
HETATM 3327 O O   . HOH F 4 .   ? -24.817 4.422  0.836   1.00 24.67 ? 879  HOH A O   1 
HETATM 3328 O O   . HOH F 4 .   ? -6.050  19.721 -9.275  1.00 27.17 ? 880  HOH A O   1 
HETATM 3329 O O   . HOH F 4 .   ? -39.306 20.212 -16.324 1.00 23.93 ? 881  HOH A O   1 
HETATM 3330 O O   . HOH F 4 .   ? -15.046 41.366 -3.610  1.00 35.34 ? 882  HOH A O   1 
HETATM 3331 O O   . HOH F 4 .   ? -13.348 5.528  -11.873 1.00 30.28 ? 883  HOH A O   1 
HETATM 3332 O O   . HOH F 4 .   ? -18.169 17.474 -29.501 1.00 32.37 ? 884  HOH A O   1 
HETATM 3333 O O   . HOH F 4 .   ? -13.292 9.749  -12.523 1.00 26.11 ? 885  HOH A O   1 
HETATM 3334 O O   . HOH F 4 .   ? -31.792 12.111 16.164  1.00 29.84 ? 886  HOH A O   1 
HETATM 3335 O O   . HOH F 4 .   ? -33.516 34.330 -7.315  1.00 32.12 ? 887  HOH A O   1 
HETATM 3336 O O   . HOH F 4 .   ? -35.102 16.848 1.988   1.00 27.02 ? 888  HOH A O   1 
HETATM 3337 O O   . HOH F 4 .   ? -23.426 41.863 -5.740  1.00 29.82 ? 889  HOH A O   1 
HETATM 3338 O O   . HOH F 4 .   ? -8.929  8.525  -6.093  1.00 33.48 ? 890  HOH A O   1 
HETATM 3339 O O   . HOH F 4 .   ? -19.656 35.831 19.729  1.00 28.38 ? 891  HOH A O   1 
HETATM 3340 O O   . HOH F 4 .   ? -33.306 25.935 -0.114  1.00 35.83 ? 892  HOH A O   1 
HETATM 3341 O O   . HOH F 4 .   ? -29.101 28.342 28.847  1.00 31.10 ? 893  HOH A O   1 
HETATM 3342 O O   . HOH F 4 .   ? -30.406 38.059 -3.782  1.00 37.46 ? 894  HOH A O   1 
HETATM 3343 O O   . HOH F 4 .   ? -35.733 17.857 12.432  1.00 32.41 ? 895  HOH A O   1 
HETATM 3344 O O   . HOH F 4 .   ? -33.194 9.669  15.800  1.00 32.82 ? 896  HOH A O   1 
HETATM 3345 O O   . HOH F 4 .   ? -15.130 38.713 -4.388  1.00 29.05 ? 897  HOH A O   1 
HETATM 3346 O O   . HOH F 4 .   ? -30.392 4.187  -2.788  1.00 29.15 ? 898  HOH A O   1 
HETATM 3347 O O   . HOH F 4 .   ? -10.629 6.686  -7.085  1.00 28.37 ? 899  HOH A O   1 
HETATM 3348 O O   . HOH F 4 .   ? -7.631  43.930 -8.110  1.00 36.65 ? 900  HOH A O   1 
HETATM 3349 O O   . HOH F 4 .   ? -2.541  23.431 -8.250  1.00 26.78 ? 901  HOH A O   1 
HETATM 3350 O O   . HOH F 4 .   ? -11.558 46.843 0.590   1.00 33.46 ? 902  HOH A O   1 
HETATM 3351 O O   . HOH F 4 .   ? -3.305  40.347 7.965   1.00 27.46 ? 903  HOH A O   1 
HETATM 3352 O O   . HOH F 4 .   ? -6.359  30.320 -18.486 1.00 37.94 ? 904  HOH A O   1 
HETATM 3353 O O   . HOH F 4 .   ? -24.046 25.948 -27.114 1.00 31.51 ? 905  HOH A O   1 
HETATM 3354 O O   . HOH F 4 .   ? -27.376 40.338 -20.442 1.00 32.34 ? 906  HOH A O   1 
HETATM 3355 O O   . HOH F 4 .   ? -17.288 9.550  -14.945 1.00 29.32 ? 907  HOH A O   1 
HETATM 3356 O O   . HOH F 4 .   ? -4.365  20.565 -3.568  1.00 36.73 ? 908  HOH A O   1 
HETATM 3357 O O   . HOH F 4 .   ? -29.094 24.582 -25.071 1.00 31.01 ? 909  HOH A O   1 
HETATM 3358 O O   . HOH F 4 .   ? -28.769 13.876 25.450  1.00 30.80 ? 910  HOH A O   1 
HETATM 3359 O O   . HOH F 4 .   ? -20.323 17.832 -27.800 1.00 33.45 ? 911  HOH A O   1 
HETATM 3360 O O   . HOH F 4 .   ? -4.309  19.339 -7.267  1.00 31.67 ? 912  HOH A O   1 
HETATM 3361 O O   . HOH F 4 .   ? -1.424  30.986 5.470   1.00 39.72 ? 913  HOH A O   1 
HETATM 3362 O O   . HOH F 4 .   ? -14.572 16.280 -33.155 1.00 47.91 ? 914  HOH A O   1 
HETATM 3363 O O   . HOH F 4 .   ? -9.418  13.057 -8.744  1.00 32.90 ? 915  HOH A O   1 
HETATM 3364 O O   . HOH F 4 .   ? -6.873  8.795  -1.639  1.00 34.94 ? 916  HOH A O   1 
HETATM 3365 O O   . HOH F 4 .   ? -31.235 17.896 3.093   1.00 22.44 ? 917  HOH A O   1 
HETATM 3366 O O   . HOH F 4 .   ? -29.155 17.759 4.707   1.00 19.57 ? 918  HOH A O   1 
HETATM 3367 O O   . HOH F 4 .   ? -26.099 28.585 6.372   1.00 19.91 ? 919  HOH A O   1 
HETATM 3368 O O   . HOH F 4 .   ? -27.750 28.442 3.201   1.00 22.19 ? 920  HOH A O   1 
HETATM 3369 O O   . HOH F 4 .   ? -27.375 24.366 1.856   1.00 23.92 ? 921  HOH A O   1 
HETATM 3370 O O   . HOH F 4 .   ? -20.200 27.375 29.244  1.00 23.58 ? 922  HOH A O   1 
HETATM 3371 O O   . HOH F 4 .   ? -29.171 21.335 3.054   1.00 21.97 ? 923  HOH A O   1 
HETATM 3372 O O   . HOH F 4 .   ? -21.854 43.722 5.301   1.00 32.69 ? 924  HOH A O   1 
HETATM 3373 O O   . HOH F 4 .   ? -18.198 28.969 29.894  1.00 34.23 ? 925  HOH A O   1 
HETATM 3374 O O   . HOH F 4 .   ? -32.454 36.121 -9.281  1.00 26.39 ? 926  HOH A O   1 
HETATM 3375 O O   . HOH F 4 .   ? -36.835 20.122 10.677  1.00 31.87 ? 927  HOH A O   1 
HETATM 3376 O O   . HOH F 4 .   ? -2.463  35.137 3.200   1.00 31.72 ? 928  HOH A O   1 
HETATM 3377 O O   . HOH F 4 .   ? 1.332   23.155 3.346   1.00 30.55 ? 929  HOH A O   1 
HETATM 3378 O O   . HOH F 4 .   ? -11.822 11.957 -12.814 1.00 29.19 ? 930  HOH A O   1 
HETATM 3379 O O   . HOH F 4 .   ? -27.255 23.281 -29.261 1.00 33.86 ? 931  HOH A O   1 
HETATM 3380 O O   . HOH F 4 .   ? -30.317 25.688 5.546   1.00 33.82 ? 932  HOH A O   1 
HETATM 3381 O O   . HOH F 4 .   ? -24.927 18.500 30.559  1.00 37.89 ? 933  HOH A O   1 
HETATM 3382 O O   . HOH F 4 .   ? -40.085 19.587 -5.684  1.00 25.70 ? 934  HOH A O   1 
HETATM 3383 O O   . HOH F 4 .   ? -9.201  20.017 -21.751 1.00 31.71 ? 935  HOH A O   1 
HETATM 3384 O O   . HOH F 4 .   ? -35.005 9.277  -0.474  1.00 41.85 ? 936  HOH A O   1 
HETATM 3385 O O   . HOH F 4 .   ? -8.026  21.459 -14.894 1.00 34.22 ? 937  HOH A O   1 
HETATM 3386 O O   . HOH F 4 .   ? -4.977  42.509 8.585   1.00 31.91 ? 938  HOH A O   1 
HETATM 3387 O O   . HOH F 4 .   ? -38.712 20.012 -18.792 1.00 32.88 ? 939  HOH A O   1 
HETATM 3388 O O   . HOH F 4 .   ? -30.905 30.641 -28.693 1.00 30.15 ? 940  HOH A O   1 
HETATM 3389 O O   . HOH F 4 .   ? -30.321 19.683 6.582   1.00 29.63 ? 941  HOH A O   1 
HETATM 3390 O O   . HOH F 4 .   ? -8.463  13.585 14.681  1.00 36.98 ? 942  HOH A O   1 
HETATM 3391 O O   . HOH F 4 .   ? 2.098   25.602 -2.178  1.00 33.30 ? 943  HOH A O   1 
HETATM 3392 O O   . HOH F 4 .   ? -17.575 33.028 30.262  1.00 31.20 ? 944  HOH A O   1 
HETATM 3393 O O   . HOH F 4 .   ? -35.348 35.334 -9.006  1.00 30.65 ? 945  HOH A O   1 
HETATM 3394 O O   . HOH F 4 .   ? -11.337 18.685 -17.820 1.00 38.09 ? 946  HOH A O   1 
HETATM 3395 O O   . HOH F 4 .   ? -32.819 15.640 25.186  1.00 35.80 ? 947  HOH A O   1 
HETATM 3396 O O   . HOH F 4 .   ? -28.084 5.997  13.501  1.00 44.32 ? 948  HOH A O   1 
HETATM 3397 O O   . HOH F 4 .   ? -14.547 3.950  -4.546  1.00 28.35 ? 949  HOH A O   1 
HETATM 3398 O O   . HOH F 4 .   ? -4.171  36.938 4.311   1.00 35.32 ? 950  HOH A O   1 
HETATM 3399 O O   . HOH F 4 .   ? -9.938  21.000 -19.016 1.00 28.34 ? 951  HOH A O   1 
HETATM 3400 O O   . HOH F 4 .   ? -10.493 8.327  8.596   1.00 35.48 ? 952  HOH A O   1 
HETATM 3401 O O   . HOH F 4 .   ? -29.456 37.970 2.884   1.00 40.61 ? 953  HOH A O   1 
HETATM 3402 O O   . HOH F 4 .   ? -31.151 9.183  -15.782 1.00 33.49 ? 954  HOH A O   1 
HETATM 3403 O O   . HOH F 4 .   ? -23.000 0.681  -2.897  1.00 36.42 ? 955  HOH A O   1 
HETATM 3404 O O   . HOH F 4 .   ? -30.052 33.201 3.340   1.00 42.44 ? 956  HOH A O   1 
HETATM 3405 O O   . HOH F 4 .   ? -32.905 36.232 -4.947  1.00 35.60 ? 957  HOH A O   1 
HETATM 3406 O O   . HOH F 4 .   ? -22.734 37.718 19.060  1.00 28.51 ? 958  HOH A O   1 
HETATM 3407 O O   . HOH F 4 .   ? -25.699 3.669  -9.994  1.00 58.23 ? 959  HOH A O   1 
HETATM 3408 O O   . HOH F 4 .   ? -11.899 4.497  -5.563  1.00 33.85 ? 960  HOH A O   1 
HETATM 3409 O O   . HOH F 4 .   ? -15.521 46.725 -1.790  1.00 34.23 ? 961  HOH A O   1 
HETATM 3410 O O   . HOH F 4 .   ? -34.503 23.623 -1.797  1.00 36.28 ? 962  HOH A O   1 
HETATM 3411 O O   . HOH F 4 .   ? -5.510  6.768  3.293   1.00 43.14 ? 963  HOH A O   1 
HETATM 3412 O O   . HOH F 4 .   ? -20.757 15.816 -23.294 1.00 42.07 ? 964  HOH A O   1 
HETATM 3413 O O   . HOH F 4 .   ? -16.255 3.534  -1.016  1.00 28.18 ? 965  HOH A O   1 
HETATM 3414 O O   . HOH F 4 .   ? -9.511  44.239 -4.825  1.00 36.10 ? 966  HOH A O   1 
HETATM 3415 O O   . HOH F 4 .   ? -9.697  16.050 -12.493 1.00 33.07 ? 967  HOH A O   1 
HETATM 3416 O O   . HOH F 4 .   ? -12.369 15.977 -23.923 1.00 34.74 ? 968  HOH A O   1 
HETATM 3417 O O   . HOH F 4 .   ? -41.858 22.453 -16.260 1.00 44.14 ? 969  HOH A O   1 
HETATM 3418 O O   . HOH F 4 .   ? -34.084 31.283 -1.716  1.00 35.56 ? 970  HOH A O   1 
HETATM 3419 O O   . HOH F 4 .   ? -18.178 47.590 0.214   1.00 36.85 ? 971  HOH A O   1 
HETATM 3420 O O   . HOH F 4 .   ? -41.228 29.818 -13.648 1.00 33.85 ? 972  HOH A O   1 
HETATM 3421 O O   . HOH F 4 .   ? -0.591  41.066 8.508   1.00 34.88 ? 973  HOH A O   1 
HETATM 3422 O O   . HOH F 4 .   ? -19.889 15.528 -26.012 1.00 34.04 ? 974  HOH A O   1 
HETATM 3423 O O   . HOH F 4 .   ? -19.179 5.360  7.683   1.00 43.53 ? 975  HOH A O   1 
HETATM 3424 O O   . HOH F 4 .   ? -0.378  10.867 -1.333  1.00 44.87 ? 976  HOH A O   1 
HETATM 3425 O O   . HOH F 4 .   ? -34.529 16.408 29.321  1.00 33.46 ? 977  HOH A O   1 
HETATM 3426 O O   . HOH F 4 .   ? -42.786 18.651 -7.502  1.00 46.83 ? 978  HOH A O   1 
HETATM 3427 O O   . HOH F 4 .   ? -40.112 16.824 -3.333  1.00 35.84 ? 979  HOH A O   1 
HETATM 3428 O O   . HOH F 4 .   ? -35.581 6.901  4.188   1.00 43.44 ? 980  HOH A O   1 
HETATM 3429 O O   . HOH F 4 .   ? -37.458 22.120 -2.369  1.00 36.31 ? 981  HOH A O   1 
HETATM 3430 O O   . HOH F 4 .   ? -12.950 15.016 -15.786 1.00 36.26 ? 982  HOH A O   1 
HETATM 3431 O O   . HOH F 4 .   ? -38.362 18.423 -0.479  1.00 37.35 ? 983  HOH A O   1 
HETATM 3432 O O   . HOH F 4 .   ? -24.442 21.923 30.927  1.00 33.18 ? 984  HOH A O   1 
HETATM 3433 O O   . HOH F 4 .   ? -33.722 35.202 -2.182  1.00 44.83 ? 985  HOH A O   1 
HETATM 3434 O O   . HOH F 4 .   ? -25.659 36.678 4.961   1.00 23.74 ? 986  HOH A O   1 
HETATM 3435 O O   . HOH F 4 .   ? -41.769 26.747 -13.354 1.00 42.93 ? 987  HOH A O   1 
HETATM 3436 O O   . HOH F 4 .   ? -16.710 27.277 -29.636 1.00 29.47 ? 988  HOH A O   1 
HETATM 3437 O O   . HOH F 4 .   ? -12.386 6.531  7.635   1.00 33.23 ? 989  HOH A O   1 
HETATM 3438 O O   . HOH F 4 .   ? -17.136 18.417 -17.876 1.00 34.79 ? 990  HOH A O   1 
HETATM 3439 O O   . HOH F 4 .   ? -22.396 24.121 -28.810 1.00 29.25 ? 991  HOH A O   1 
HETATM 3440 O O   . HOH F 4 .   ? -19.482 20.594 29.844  1.00 34.79 ? 992  HOH A O   1 
HETATM 3441 O O   . HOH F 4 .   ? -3.741  26.168 -15.398 1.00 43.64 ? 993  HOH A O   1 
HETATM 3442 O O   . HOH F 4 .   ? -30.033 4.859  -7.776  1.00 41.52 ? 994  HOH A O   1 
HETATM 3443 O O   . HOH F 4 .   ? -38.733 16.344 12.990  1.00 55.43 ? 995  HOH A O   1 
HETATM 3444 O O   . HOH F 4 .   ? -1.853  38.548 5.924   1.00 47.96 ? 996  HOH A O   1 
HETATM 3445 O O   . HOH F 4 .   ? -2.581  16.582 -3.200  1.00 35.57 ? 997  HOH A O   1 
HETATM 3446 O O   . HOH F 4 .   ? -1.029  31.774 -16.308 1.00 33.85 ? 998  HOH A O   1 
HETATM 3447 O O   . HOH F 4 .   ? -23.746 28.233 29.881  1.00 28.46 ? 999  HOH A O   1 
HETATM 3448 O O   . HOH F 4 .   ? -39.831 23.264 18.256  1.00 39.44 ? 1000 HOH A O   1 
HETATM 3449 O O   . HOH F 4 .   ? -26.956 25.881 31.160  1.00 35.51 ? 1001 HOH A O   1 
HETATM 3450 O O   . HOH F 4 .   ? -23.592 42.787 1.170   1.00 36.11 ? 1002 HOH A O   1 
HETATM 3451 O O   . HOH F 4 .   ? -26.815 13.833 -26.006 1.00 51.83 ? 1003 HOH A O   1 
HETATM 3452 O O   . HOH F 4 .   ? -28.856 17.609 28.887  1.00 36.30 ? 1004 HOH A O   1 
HETATM 3453 O O   . HOH F 4 .   ? -40.638 25.204 -23.302 1.00 44.86 ? 1005 HOH A O   1 
HETATM 3454 O O   . HOH F 4 .   ? -26.680 2.755  -7.444  1.00 37.06 ? 1006 HOH A O   1 
HETATM 3455 O O   . HOH F 4 .   ? -2.042  32.608 3.168   1.00 35.23 ? 1007 HOH A O   1 
HETATM 3456 O O   . HOH F 4 .   ? -3.924  25.045 -24.234 1.00 42.36 ? 1008 HOH A O   1 
HETATM 3457 O O   . HOH F 4 .   ? -25.441 35.312 25.914  1.00 37.03 ? 1009 HOH A O   1 
HETATM 3458 O O   . HOH F 4 .   ? 0.698   32.924 4.765   1.00 41.39 ? 1010 HOH A O   1 
HETATM 3459 O O   . HOH F 4 .   ? 1.771   32.240 -0.917  1.00 40.10 ? 1011 HOH A O   1 
HETATM 3460 O O   . HOH F 4 .   ? -14.153 19.768 -18.715 1.00 39.17 ? 1012 HOH A O   1 
HETATM 3461 O O   . HOH F 4 .   ? -36.214 29.754 -5.572  1.00 21.07 ? 1013 HOH A O   1 
HETATM 3462 O O   . HOH F 4 .   ? -40.300 25.236 16.171  1.00 37.71 ? 1014 HOH A O   1 
HETATM 3463 O O   . HOH F 4 .   ? -13.583 5.197  -8.614  1.00 37.08 ? 1015 HOH A O   1 
HETATM 3464 O O   . HOH F 4 .   ? -7.890  11.607 -5.579  1.00 42.48 ? 1016 HOH A O   1 
HETATM 3465 O O   . HOH F 4 .   ? -33.916 11.378 -9.427  1.00 37.44 ? 1017 HOH A O   1 
HETATM 3466 O O   . HOH F 4 .   ? -17.768 11.431 -19.236 1.00 37.78 ? 1018 HOH A O   1 
HETATM 3467 O O   . HOH F 4 .   ? -35.384 35.729 -12.875 1.00 47.91 ? 1019 HOH A O   1 
HETATM 3468 O O   . HOH F 4 .   ? -28.404 33.085 6.815   1.00 40.25 ? 1020 HOH A O   1 
HETATM 3469 O O   . HOH F 4 .   ? -24.129 26.039 31.340  1.00 36.43 ? 1021 HOH A O   1 
HETATM 3470 O O   . HOH F 4 .   ? -2.992  30.178 -16.499 1.00 32.88 ? 1022 HOH A O   1 
HETATM 3471 O O   . HOH F 4 .   ? -15.612 4.267  -10.933 1.00 33.39 ? 1023 HOH A O   1 
HETATM 3472 O O   . HOH F 4 .   ? -8.703  2.010  -0.884  1.00 44.18 ? 1024 HOH A O   1 
HETATM 3473 O O   . HOH F 4 .   ? -32.177 33.408 11.441  1.00 39.53 ? 1025 HOH A O   1 
HETATM 3474 O O   . HOH F 4 .   ? -24.595 28.348 -13.070 1.00 36.09 ? 1026 HOH A O   1 
HETATM 3475 O O   . HOH F 4 .   ? -5.124  11.222 -5.081  1.00 42.12 ? 1027 HOH A O   1 
HETATM 3476 O O   . HOH F 4 .   ? -29.048 19.828 32.136  1.00 53.60 ? 1028 HOH A O   1 
HETATM 3477 O O   . HOH F 4 .   ? 1.757   29.334 2.837   1.00 48.36 ? 1029 HOH A O   1 
HETATM 3478 O O   . HOH F 4 .   ? 1.664   34.545 6.914   1.00 58.45 ? 1030 HOH A O   1 
HETATM 3479 O O   . HOH F 4 .   ? -25.021 11.215 -24.134 1.00 39.36 ? 1031 HOH A O   1 
HETATM 3480 O O   . HOH F 4 .   ? -14.866 8.732  -14.267 1.00 28.85 ? 1032 HOH A O   1 
HETATM 3481 O O   . HOH F 4 .   ? -28.366 3.198  4.297   1.00 49.74 ? 1033 HOH A O   1 
HETATM 3482 O O   . HOH F 4 .   ? -27.947 27.535 33.176  1.00 38.78 ? 1034 HOH A O   1 
HETATM 3483 O O   . HOH F 4 .   ? -10.685 0.418  1.671   1.00 46.01 ? 1035 HOH A O   1 
HETATM 3484 O O   . HOH F 4 .   ? -32.484 20.935 1.354   1.00 33.16 ? 1036 HOH A O   1 
HETATM 3485 O O   . HOH F 4 .   ? -11.452 28.735 -27.938 1.00 34.89 ? 1037 HOH A O   1 
HETATM 3486 O O   . HOH F 4 .   ? -33.687 30.400 12.193  1.00 37.82 ? 1038 HOH A O   1 
HETATM 3487 O O   . HOH F 4 .   ? -31.257 38.084 -24.511 1.00 44.50 ? 1039 HOH A O   1 
HETATM 3488 O O   . HOH F 4 .   ? -38.585 28.431 -9.153  1.00 28.48 ? 1040 HOH A O   1 
HETATM 3489 O O   . HOH F 4 .   ? -12.407 3.058  1.536   1.00 39.22 ? 1041 HOH A O   1 
HETATM 3490 O O   . HOH F 4 .   ? -33.683 22.933 -18.280 1.00 42.92 ? 1042 HOH A O   1 
HETATM 3491 O O   . HOH F 4 .   ? 2.074   26.570 2.700   1.00 41.25 ? 1043 HOH A O   1 
HETATM 3492 O O   . HOH F 4 .   ? -11.577 15.810 -30.867 1.00 52.53 ? 1044 HOH A O   1 
HETATM 3493 O O   . HOH F 4 .   ? -28.146 42.535 0.000   0.50 35.71 ? 1045 HOH A O   1 
HETATM 3494 O O   . HOH F 4 .   ? -28.431 39.559 0.600   1.00 39.66 ? 1046 HOH A O   1 
HETATM 3495 O O   . HOH F 4 .   ? 0.828   20.735 -1.114  1.00 58.87 ? 1047 HOH A O   1 
HETATM 3496 O O   . HOH F 4 .   ? -40.663 22.246 -4.881  1.00 43.70 ? 1048 HOH A O   1 
HETATM 3497 O O   . HOH F 4 .   ? -1.995  20.269 -0.322  1.00 29.30 ? 1049 HOH A O   1 
HETATM 3498 O O   . HOH F 4 .   ? -0.264  16.266 -4.190  1.00 35.59 ? 1050 HOH A O   1 
HETATM 3499 O O   . HOH F 4 .   ? -3.170  18.473 -1.980  1.00 42.08 ? 1051 HOH A O   1 
HETATM 3500 O O   . HOH F 4 .   ? -22.460 42.875 -1.613  1.00 42.54 ? 1052 HOH A O   1 
HETATM 3501 O O   . HOH F 4 .   ? -12.024 45.061 -5.004  1.00 38.93 ? 1053 HOH A O   1 
HETATM 3502 O O   . HOH F 4 .   ? -9.435  43.422 4.143   1.00 36.82 ? 1054 HOH A O   1 
HETATM 3503 O O   . HOH F 4 .   ? -5.003  44.980 -1.645  1.00 40.93 ? 1055 HOH A O   1 
HETATM 3504 O O   . HOH F 4 .   ? -5.054  42.202 0.167   1.00 45.73 ? 1056 HOH A O   1 
HETATM 3505 O O   . HOH F 4 .   ? -5.652  44.530 2.717   1.00 39.93 ? 1057 HOH A O   1 
HETATM 3506 O O   . HOH F 4 .   ? -6.366  46.134 6.699   1.00 39.50 ? 1058 HOH A O   1 
HETATM 3507 O O   . HOH F 4 .   ? -25.467 36.742 -7.653  1.00 31.59 ? 1059 HOH A O   1 
HETATM 3508 O O   . HOH F 4 .   ? -7.643  25.555 -17.629 1.00 41.09 ? 1060 HOH A O   1 
HETATM 3509 O O   . HOH F 4 .   ? -32.391 38.455 -1.917  1.00 32.70 ? 1061 HOH A O   1 
HETATM 3510 O O   . HOH F 4 .   ? -30.464 24.289 -27.385 1.00 47.20 ? 1062 HOH A O   1 
HETATM 3511 O O   . HOH F 4 .   ? -24.986 26.173 -30.633 1.00 41.23 ? 1063 HOH A O   1 
HETATM 3512 O O   . HOH F 4 .   ? -36.098 23.460 -3.823  1.00 37.13 ? 1064 HOH A O   1 
HETATM 3513 O O   . HOH F 4 .   ? -26.305 13.274 -19.638 1.00 47.68 ? 1065 HOH A O   1 
HETATM 3514 O O   . HOH F 4 .   ? -17.479 27.776 -34.025 1.00 54.21 ? 1066 HOH A O   1 
HETATM 3515 O O   . HOH F 4 .   ? -10.274 17.408 -22.266 1.00 41.33 ? 1067 HOH A O   1 
HETATM 3516 O O   . HOH F 4 .   ? -34.634 19.287 2.384   1.00 40.67 ? 1068 HOH A O   1 
HETATM 3517 O O   . HOH F 4 .   ? -33.167 19.059 4.541   1.00 48.40 ? 1069 HOH A O   1 
HETATM 3518 O O   . HOH F 4 .   ? -34.192 4.445  -7.007  1.00 37.04 ? 1070 HOH A O   1 
HETATM 3519 O O   . HOH F 4 .   ? -29.332 2.653  -0.640  1.00 46.64 ? 1071 HOH A O   1 
HETATM 3520 O O   . HOH F 4 .   ? -30.972 8.573  -11.846 1.00 45.11 ? 1072 HOH A O   1 
HETATM 3521 O O   . HOH F 4 .   ? -28.806 27.947 5.658   1.00 38.59 ? 1073 HOH A O   1 
HETATM 3522 O O   . HOH F 4 .   ? -29.956 22.603 5.243   1.00 46.71 ? 1074 HOH A O   1 
HETATM 3523 O O   . HOH F 4 .   ? -32.366 21.371 5.493   1.00 46.70 ? 1075 HOH A O   1 
HETATM 3524 O O   . HOH F 4 .   ? -32.236 24.207 1.725   1.00 38.52 ? 1076 HOH A O   1 
HETATM 3525 O O   . HOH F 4 .   ? -21.206 5.935  -12.636 1.00 33.22 ? 1077 HOH A O   1 
HETATM 3526 O O   . HOH F 4 .   ? -38.411 25.650 14.310  1.00 36.53 ? 1078 HOH A O   1 
HETATM 3527 O O   . HOH F 4 .   ? -39.822 19.551 10.328  1.00 37.76 ? 1079 HOH A O   1 
HETATM 3528 O O   . HOH F 4 .   ? -40.600 22.614 9.884   1.00 46.86 ? 1080 HOH A O   1 
HETATM 3529 O O   . HOH F 4 .   ? -35.588 15.968 15.662  1.00 32.02 ? 1081 HOH A O   1 
HETATM 3530 O O   . HOH F 4 .   ? -38.090 17.829 20.787  1.00 36.52 ? 1082 HOH A O   1 
HETATM 3531 O O   . HOH F 4 .   ? -35.075 9.446  13.611  1.00 46.84 ? 1083 HOH A O   1 
HETATM 3532 O O   . HOH F 4 .   ? -29.209 15.259 5.762   1.00 35.44 ? 1084 HOH A O   1 
HETATM 3533 O O   . HOH F 4 .   ? -30.559 14.016 4.981   1.00 33.07 ? 1085 HOH A O   1 
HETATM 3534 O O   . HOH F 4 .   ? -24.875 3.179  6.096   1.00 40.94 ? 1086 HOH A O   1 
HETATM 3535 O O   . HOH F 4 .   ? -37.042 24.192 27.359  1.00 36.24 ? 1087 HOH A O   1 
HETATM 3536 O O   . HOH F 4 .   ? -35.812 18.131 26.333  1.00 40.19 ? 1088 HOH A O   1 
HETATM 3537 O O   . HOH F 4 .   ? -37.631 19.983 26.278  1.00 34.74 ? 1089 HOH A O   1 
HETATM 3538 O O   . HOH F 4 .   ? -21.446 24.507 29.465  1.00 32.13 ? 1090 HOH A O   1 
HETATM 3539 O O   . HOH F 4 .   ? -21.313 35.643 27.414  1.00 34.08 ? 1091 HOH A O   1 
HETATM 3540 O O   . HOH F 4 .   ? -12.512 4.082  6.246   1.00 39.75 ? 1092 HOH A O   1 
HETATM 3541 O O   . HOH F 4 .   ? -0.587  24.776 4.637   1.00 34.13 ? 1093 HOH A O   1 
HETATM 3542 O O   . HOH F 4 .   ? -0.757  18.961 -2.602  1.00 40.22 ? 1094 HOH A O   1 
HETATM 3543 O O   . HOH F 4 .   ? -22.888 41.062 -3.136  1.00 38.04 ? 1095 HOH A O   1 
HETATM 3544 O O   . HOH F 4 .   ? -26.048 38.320 -1.691  1.00 38.42 ? 1096 HOH A O   1 
HETATM 3545 O O   . HOH F 4 .   ? -15.792 49.678 6.786   1.00 32.49 ? 1097 HOH A O   1 
HETATM 3546 O O   . HOH F 4 .   ? -14.532 48.641 7.801   1.00 38.41 ? 1098 HOH A O   1 
HETATM 3547 O O   . HOH F 4 .   ? -10.698 41.779 7.210   1.00 30.01 ? 1099 HOH A O   1 
HETATM 3548 O O   . HOH F 4 .   ? -32.912 26.422 5.513   1.00 51.82 ? 1100 HOH A O   1 
HETATM 3549 O O   . HOH F 4 .   ? -29.927 24.497 2.989   1.00 37.46 ? 1101 HOH A O   1 
HETATM 3550 O O   . HOH F 4 .   ? -38.235 35.669 -8.738  1.00 39.34 ? 1102 HOH A O   1 
HETATM 3551 O O   . HOH F 4 .   ? -39.966 26.126 -17.258 1.00 46.61 ? 1103 HOH A O   1 
HETATM 3552 O O   . HOH F 4 .   ? -26.549 19.514 -26.453 1.00 40.15 ? 1104 HOH A O   1 
HETATM 3553 O O   . HOH F 4 .   ? -39.110 24.704 -7.090  1.00 37.48 ? 1105 HOH A O   1 
HETATM 3554 O O   . HOH F 4 .   ? -39.233 25.873 -9.516  1.00 40.86 ? 1106 HOH A O   1 
HETATM 3555 O O   . HOH F 4 .   ? -21.368 13.899 -21.350 1.00 36.92 ? 1107 HOH A O   1 
HETATM 3556 O O   . HOH F 4 .   ? -22.816 19.530 -29.737 1.00 46.98 ? 1108 HOH A O   1 
HETATM 3557 O O   . HOH F 4 .   ? -24.643 23.594 -28.144 1.00 37.72 ? 1109 HOH A O   1 
HETATM 3558 O O   . HOH F 4 .   ? -34.785 19.608 8.452   1.00 46.06 ? 1110 HOH A O   1 
HETATM 3559 O O   . HOH F 4 .   ? -35.490 14.768 17.955  1.00 41.48 ? 1111 HOH A O   1 
HETATM 3560 O O   . HOH F 4 .   ? -35.587 13.329 11.712  1.00 38.88 ? 1112 HOH A O   1 
HETATM 3561 O O   . HOH F 4 .   ? -26.308 4.492  8.239   1.00 37.73 ? 1113 HOH A O   1 
HETATM 3562 O O   . HOH F 4 .   ? -32.125 2.122  2.258   1.00 38.61 ? 1114 HOH A O   1 
HETATM 3563 O O   . HOH F 4 .   ? -33.339 28.995 30.381  1.00 46.65 ? 1115 HOH A O   1 
HETATM 3564 O O   . HOH F 4 .   ? -26.824 32.019 30.629  1.00 52.86 ? 1116 HOH A O   1 
HETATM 3565 O O   . HOH F 4 .   ? -32.343 17.765 25.699  1.00 37.09 ? 1117 HOH A O   1 
HETATM 3566 O O   . HOH F 4 .   ? -37.314 25.384 23.211  1.00 44.39 ? 1118 HOH A O   1 
HETATM 3567 O O   . HOH F 4 .   ? -20.316 39.045 19.996  1.00 36.99 ? 1119 HOH A O   1 
HETATM 3568 O O   . HOH F 4 .   ? -21.892 35.191 29.770  1.00 46.14 ? 1120 HOH A O   1 
HETATM 3569 O O   . HOH F 4 .   ? -24.965 41.523 -1.014  1.00 41.02 ? 1121 HOH A O   1 
HETATM 3570 O O   . HOH F 4 .   ? -31.231 39.450 -0.000  0.50 46.06 ? 1122 HOH A O   1 
HETATM 3571 O O   . HOH F 4 .   ? -40.412 17.753 2.293   1.00 39.32 ? 1123 HOH A O   1 
HETATM 3572 O O   . HOH F 4 .   ? -34.814 9.439  -14.286 1.00 38.91 ? 1124 HOH A O   1 
HETATM 3573 O O   . HOH F 4 .   ? -33.555 15.434 6.921   1.00 45.49 ? 1125 HOH A O   1 
HETATM 3574 O O   . HOH F 4 .   ? -30.266 16.695 8.094   1.00 40.89 ? 1126 HOH A O   1 
HETATM 3575 O O   . HOH F 4 .   ? -29.075 -1.317 -3.984  1.00 44.07 ? 1127 HOH A O   1 
HETATM 3576 O O   . HOH F 4 .   ? -31.044 29.666 29.093  1.00 41.18 ? 1128 HOH A O   1 
HETATM 3577 O O   . HOH F 4 .   ? -30.956 28.260 32.316  1.00 42.02 ? 1129 HOH A O   1 
HETATM 3578 O O   . HOH F 4 .   ? -26.055 15.919 30.507  1.00 44.89 ? 1130 HOH A O   1 
HETATM 3579 O O   . HOH F 4 .   ? -19.868 37.739 26.368  1.00 46.84 ? 1131 HOH A O   1 
HETATM 3580 O O   . HOH F 4 .   ? -27.453 42.746 -19.180 1.00 38.23 ? 1132 HOH A O   1 
HETATM 3581 O O   . HOH F 4 .   ? -31.733 29.797 8.896   1.00 41.18 ? 1133 HOH A O   1 
HETATM 3582 O O   . HOH F 4 .   ? -32.890 11.549 19.107  1.00 42.63 ? 1134 HOH A O   1 
HETATM 3583 O O   . HOH F 4 .   ? -34.281 14.313 14.156  1.00 52.94 ? 1135 HOH A O   1 
HETATM 3584 O O   . HOH F 4 .   ? -19.069 0.613  1.489   1.00 45.26 ? 1136 HOH A O   1 
HETATM 3585 O O   . HOH F 4 .   ? -24.367 35.171 29.798  1.00 41.57 ? 1137 HOH A O   1 
HETATM 3586 O O   . HOH F 4 .   ? 5.792   29.017 -8.698  1.00 41.33 ? 1138 HOH A O   1 
HETATM 3587 O O   . HOH F 4 .   ? -1.693  21.281 -10.600 1.00 40.28 ? 1139 HOH A O   1 
HETATM 3588 O O   . HOH F 4 .   ? -28.755 26.319 1.591   1.00 46.93 ? 1140 HOH A O   1 
HETATM 3589 O O   . HOH F 4 .   ? -29.537 20.755 -27.714 1.00 38.97 ? 1141 HOH A O   1 
HETATM 3590 O O   . HOH F 4 .   ? -26.302 24.330 -26.347 1.00 30.37 ? 1142 HOH A O   1 
HETATM 3591 O O   . HOH F 4 .   ? -39.535 15.247 17.062  1.00 32.75 ? 1143 HOH A O   1 
HETATM 3592 O O   . HOH F 4 .   ? -16.081 7.053  11.867  1.00 43.11 ? 1144 HOH A O   1 
HETATM 3593 O O   . HOH F 4 .   ? -16.517 3.323  4.321   1.00 41.57 ? 1145 HOH A O   1 
HETATM 3594 O O   . HOH F 4 .   ? -21.082 3.155  3.725   1.00 35.54 ? 1146 HOH A O   1 
HETATM 3595 O O   . HOH F 4 .   ? -27.621 3.666  1.613   1.00 48.97 ? 1147 HOH A O   1 
HETATM 3596 O O   . HOH F 4 .   ? -32.098 31.646 27.074  1.00 35.01 ? 1148 HOH A O   1 
HETATM 3597 O O   . HOH F 4 .   ? -1.225  16.145 -1.538  1.00 46.80 ? 1149 HOH A O   1 
HETATM 3598 O O   . HOH F 4 .   ? -1.082  13.690 -1.006  1.00 39.44 ? 1150 HOH A O   1 
HETATM 3599 O O   . HOH F 4 .   ? 1.548   17.940 -1.583  1.00 45.45 ? 1151 HOH A O   1 
HETATM 3600 O O   . HOH F 4 .   ? -26.946 39.309 3.101   1.00 53.28 ? 1152 HOH A O   1 
HETATM 3601 O O   . HOH F 4 .   ? -25.133 41.433 2.682   1.00 70.95 ? 1153 HOH A O   1 
HETATM 3602 O O   . HOH F 4 .   ? -28.221 22.778 -26.640 1.00 46.79 ? 1154 HOH A O   1 
HETATM 3603 O O   . HOH F 4 .   ? -34.686 12.620 6.006   1.00 50.48 ? 1155 HOH A O   1 
HETATM 3604 O O   . HOH F 4 .   ? -32.611 8.384  -13.606 1.00 47.77 ? 1156 HOH A O   1 
HETATM 3605 O O   . HOH F 4 .   ? -41.146 17.854 12.367  1.00 52.58 ? 1157 HOH A O   1 
HETATM 3606 O O   . HOH F 4 .   ? 4.947   15.565 -0.342  1.00 48.08 ? 1158 HOH A O   1 
HETATM 3607 O O   . HOH F 4 .   ? -26.613 39.997 -6.118  1.00 37.80 ? 1159 HOH A O   1 
HETATM 3608 O O   . HOH F 4 .   ? -28.208 39.095 -3.123  1.00 43.81 ? 1160 HOH A O   1 
HETATM 3609 O O   . HOH F 4 .   ? -29.850 28.562 -32.488 1.00 52.02 ? 1161 HOH A O   1 
HETATM 3610 O O   . HOH F 4 .   ? -34.160 10.772 4.406   1.00 41.84 ? 1162 HOH A O   1 
HETATM 3611 O O   . HOH F 4 .   ? -1.067  35.925 0.152   1.00 48.72 ? 1163 HOH A O   1 
HETATM 3612 O O   . HOH F 4 .   ? -34.513 9.292  2.293   1.00 40.13 ? 1164 HOH A O   1 
HETATM 3613 O O   . HOH F 4 .   ? -9.198  12.084 -11.169 1.00 39.13 ? 1165 HOH A O   1 
HETATM 3614 O O   . HOH F 4 .   ? 0.666   12.712 0.300   1.00 44.18 ? 1166 HOH A O   1 
HETATM 3615 O O   . HOH F 4 .   ? -32.899 33.927 3.341   1.00 46.04 ? 1167 HOH A O   1 
HETATM 3616 O O   . HOH F 4 .   ? 1.580   13.232 -2.258  1.00 41.32 ? 1168 HOH A O   1 
HETATM 3617 O O   . HOH F 4 .   ? -28.779 8.754  -14.186 1.00 24.86 ? 1169 HOH A O   1 
HETATM 3618 O O   . HOH F 4 .   ? -31.765 21.286 -26.346 1.00 43.49 ? 1170 HOH A O   1 
HETATM 3619 O O   . HOH F 4 .   ? -12.333 18.275 -19.427 1.00 47.80 ? 1171 HOH A O   1 
HETATM 3620 O O   . HOH F 4 .   ? -38.195 29.214 25.212  1.00 34.17 ? 1172 HOH A O   1 
HETATM 3621 O O   . HOH F 4 .   ? -13.247 30.660 35.292  1.00 40.24 ? 1173 HOH A O   1 
HETATM 3622 O O   . HOH F 4 .   ? -36.896 11.425 -1.149  1.00 35.66 ? 1174 HOH A O   1 
HETATM 3623 O O   . HOH F 4 .   ? -36.547 10.122 0.985   1.00 40.37 ? 1175 HOH A O   1 
HETATM 3624 O O   . HOH F 4 .   ? -38.968 23.186 -19.912 1.00 34.88 ? 1176 HOH A O   1 
HETATM 3625 O O   . HOH F 4 .   ? -31.961 25.090 -29.390 1.00 38.26 ? 1177 HOH A O   1 
HETATM 3626 O O   . HOH F 4 .   ? -40.033 24.364 -13.533 1.00 28.40 ? 1178 HOH A O   1 
HETATM 3627 O O   . HOH F 4 .   ? -21.416 7.555  11.047  1.00 20.95 ? 1179 HOH A O   1 
HETATM 3628 O O   . HOH F 4 .   ? -8.109  15.060 -7.455  1.00 20.11 ? 1180 HOH A O   1 
HETATM 3629 O O   . HOH F 4 .   ? -25.914 39.456 0.875   1.00 48.44 ? 1181 HOH A O   1 
HETATM 3630 O O   . HOH F 4 .   ? -7.331  43.533 7.004   1.00 41.87 ? 1182 HOH A O   1 
HETATM 3631 O O   . HOH F 4 .   ? -5.224  29.817 -4.222  1.00 14.33 ? 1183 HOH A O   1 
HETATM 3632 O O   . HOH F 4 .   ? -25.952 22.305 -8.455  1.00 27.29 ? 1184 HOH A O   1 
HETATM 3633 O O   . HOH F 4 .   ? -36.375 20.277 -20.077 1.00 37.15 ? 1185 HOH A O   1 
HETATM 3634 O O   . HOH F 4 .   ? -32.054 29.118 -30.530 1.00 45.26 ? 1186 HOH A O   1 
HETATM 3635 O O   . HOH F 4 .   ? -9.201  27.345 -19.541 1.00 36.11 ? 1187 HOH A O   1 
HETATM 3636 O O   . HOH F 4 .   ? -16.322 15.690 -29.034 1.00 28.08 ? 1188 HOH A O   1 
HETATM 3637 O O   . HOH F 4 .   ? -36.982 27.597 13.530  1.00 34.81 ? 1189 HOH A O   1 
HETATM 3638 O O   . HOH F 4 .   ? -31.754 17.668 15.076  1.00 23.11 ? 1190 HOH A O   1 
HETATM 3639 O O   . HOH F 4 .   ? -18.594 5.702  -13.009 1.00 46.60 ? 1191 HOH A O   1 
HETATM 3640 O O   . HOH F 4 .   ? -26.922 35.404 -7.285  1.00 34.63 ? 1192 HOH A O   1 
HETATM 3641 O O   . HOH F 4 .   ? -38.898 28.873 -5.499  1.00 46.79 ? 1193 HOH A O   1 
HETATM 3642 O O   . HOH F 4 .   ? -35.430 32.000 -3.914  1.00 33.77 ? 1194 HOH A O   1 
HETATM 3643 O O   . HOH F 4 .   ? -37.153 28.839 -4.685  1.00 28.24 ? 1195 HOH A O   1 
HETATM 3644 O O   . HOH F 4 .   ? 2.548   14.047 0.152   1.00 37.09 ? 1196 HOH A O   1 
HETATM 3645 O O   . HOH F 4 .   ? -16.580 20.258 -19.585 1.00 40.08 ? 1197 HOH A O   1 
HETATM 3646 O O   . HOH F 4 .   ? -21.437 3.407  -12.541 1.00 45.54 ? 1198 HOH A O   1 
HETATM 3647 O O   . HOH F 4 .   ? -37.470 23.190 7.702   1.00 47.05 ? 1199 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   20  ?   ?   ?   A . n 
A 1 2   MET 2   21  ?   ?   ?   A . n 
A 1 3   ALA 3   22  ?   ?   ?   A . n 
A 1 4   ASP 4   23  ?   ?   ?   A . n 
A 1 5   ILE 5   24  ?   ?   ?   A . n 
A 1 6   GLY 6   25  ?   ?   ?   A . n 
A 1 7   SER 7   26  26  SER ALA A . n 
A 1 8   TYR 8   27  27  TYR TYR A . n 
A 1 9   LYS 9   28  28  LYS LYS A . n 
A 1 10  LEU 10  29  29  LEU LEU A . n 
A 1 11  VAL 11  30  30  VAL VAL A . n 
A 1 12  CYS 12  31  31  CYS CYS A . n 
A 1 13  TYR 13  32  32  TYR TYR A . n 
A 1 14  PHE 14  33  33  PHE PHE A . n 
A 1 15  THR 15  34  34  THR THR A . n 
A 1 16  ASN 16  35  35  ASN ASN A . n 
A 1 17  TRP 17  36  36  TRP TRP A . n 
A 1 18  SER 18  37  37  SER SER A . n 
A 1 19  GLN 19  38  38  GLN GLN A . n 
A 1 20  ASP 20  39  39  ASP ASP A . n 
A 1 21  ARG 21  40  40  ARG ARG A . n 
A 1 22  GLN 22  41  41  GLN GLN A . n 
A 1 23  GLU 23  42  42  GLU GLU A . n 
A 1 24  PRO 24  43  43  PRO PRO A . n 
A 1 25  GLY 25  44  44  GLY GLY A . n 
A 1 26  LYS 26  45  45  LYS LYS A . n 
A 1 27  PHE 27  46  46  PHE PHE A . n 
A 1 28  THR 28  47  47  THR THR A . n 
A 1 29  PRO 29  48  48  PRO PRO A . n 
A 1 30  GLU 30  49  49  GLU GLU A . n 
A 1 31  ASN 31  50  50  ASN ASN A . n 
A 1 32  ILE 32  51  51  ILE ILE A . n 
A 1 33  ASP 33  52  52  ASP ASP A . n 
A 1 34  PRO 34  53  53  PRO PRO A . n 
A 1 35  PHE 35  54  54  PHE PHE A . n 
A 1 36  LEU 36  55  55  LEU LEU A . n 
A 1 37  CYS 37  56  56  CYS CYS A . n 
A 1 38  SER 38  57  57  SER SER A . n 
A 1 39  HIS 39  58  58  HIS HIS A . n 
A 1 40  LEU 40  59  59  LEU LEU A . n 
A 1 41  ILE 41  60  60  ILE ILE A . n 
A 1 42  TYR 42  61  61  TYR TYR A . n 
A 1 43  SER 43  62  62  SER SER A . n 
A 1 44  PHE 44  63  63  PHE PHE A . n 
A 1 45  ALA 45  64  64  ALA ALA A . n 
A 1 46  SER 46  65  65  SER SER A . n 
A 1 47  ILE 47  66  66  ILE ILE A . n 
A 1 48  GLU 48  67  67  GLU GLU A . n 
A 1 49  ASN 49  68  68  ASN ASN A . n 
A 1 50  ASN 50  69  69  ASN ASN A . n 
A 1 51  LYS 51  70  70  LYS LYS A . n 
A 1 52  VAL 52  71  71  VAL VAL A . n 
A 1 53  ILE 53  72  72  ILE ILE A . n 
A 1 54  ILE 54  73  73  ILE ILE A . n 
A 1 55  LYS 55  74  74  LYS LYS A . n 
A 1 56  ASP 56  75  75  ASP ASP A . n 
A 1 57  LYS 57  76  76  LYS LYS A . n 
A 1 58  SER 58  77  77  SER SER A . n 
A 1 59  GLU 59  78  78  GLU GLU A . n 
A 1 60  VAL 60  79  79  VAL VAL A . n 
A 1 61  MET 61  80  80  MET MET A . n 
A 1 62  LEU 62  81  81  LEU LEU A . n 
A 1 63  TYR 63  82  82  TYR TYR A . n 
A 1 64  GLN 64  83  83  GLN GLN A . n 
A 1 65  THR 65  84  84  THR THR A . n 
A 1 66  ILE 66  85  85  ILE ILE A . n 
A 1 67  ASN 67  86  86  ASN ASN A . n 
A 1 68  SER 68  87  87  SER SER A . n 
A 1 69  LEU 69  88  88  LEU LEU A . n 
A 1 70  LYS 70  89  89  LYS LYS A . n 
A 1 71  THR 71  90  90  THR THR A . n 
A 1 72  LYS 72  91  91  LYS LYS A . n 
A 1 73  ASN 73  92  92  ASN ASN A . n 
A 1 74  PRO 74  93  93  PRO PRO A . n 
A 1 75  LYS 75  94  94  LYS LYS A . n 
A 1 76  LEU 76  95  95  LEU LEU A . n 
A 1 77  LYS 77  96  96  LYS LYS A . n 
A 1 78  ILE 78  97  97  ILE ILE A . n 
A 1 79  LEU 79  98  98  LEU LEU A . n 
A 1 80  LEU 80  99  99  LEU LEU A . n 
A 1 81  SER 81  100 100 SER SER A . n 
A 1 82  ILE 82  101 101 ILE ILE A . n 
A 1 83  GLY 83  102 102 GLY GLY A . n 
A 1 84  GLY 84  103 103 GLY GLY A . n 
A 1 85  TYR 85  104 104 TYR TYR A . n 
A 1 86  LEU 86  105 105 LEU LEU A . n 
A 1 87  PHE 87  106 106 PHE PHE A . n 
A 1 88  GLY 88  107 107 GLY GLY A . n 
A 1 89  SER 89  108 108 SER SER A . n 
A 1 90  LYS 90  109 109 LYS LYS A . n 
A 1 91  GLY 91  110 110 GLY GLY A . n 
A 1 92  PHE 92  111 111 PHE PHE A . n 
A 1 93  HIS 93  112 112 HIS HIS A . n 
A 1 94  PRO 94  113 113 PRO PRO A . n 
A 1 95  MET 95  114 114 MET MET A . n 
A 1 96  VAL 96  115 115 VAL VAL A . n 
A 1 97  ASP 97  116 116 ASP ASP A . n 
A 1 98  SER 98  117 117 SER SER A . n 
A 1 99  SER 99  118 118 SER SER A . n 
A 1 100 THR 100 119 119 THR THR A . n 
A 1 101 SER 101 120 120 SER SER A . n 
A 1 102 ARG 102 121 121 ARG ARG A . n 
A 1 103 LEU 103 122 122 LEU LEU A . n 
A 1 104 GLU 104 123 123 GLU GLU A . n 
A 1 105 PHE 105 124 124 PHE PHE A . n 
A 1 106 ILE 106 125 125 ILE ILE A . n 
A 1 107 ASN 107 126 126 ASN ASN A . n 
A 1 108 SER 108 127 127 SER SER A . n 
A 1 109 ILE 109 128 128 ILE ILE A . n 
A 1 110 ILE 110 129 129 ILE ILE A . n 
A 1 111 LEU 111 130 130 LEU LEU A . n 
A 1 112 PHE 112 131 131 PHE PHE A . n 
A 1 113 LEU 113 132 132 LEU LEU A . n 
A 1 114 ARG 114 133 133 ARG ARG A . n 
A 1 115 ASN 115 134 134 ASN ASN A . n 
A 1 116 HIS 116 135 135 HIS HIS A . n 
A 1 117 ASN 117 136 136 ASN ASN A . n 
A 1 118 PHE 118 137 137 PHE PHE A . n 
A 1 119 ASP 119 138 138 ASP ASP A . n 
A 1 120 GLY 120 139 139 GLY GLY A . n 
A 1 121 LEU 121 140 140 LEU LEU A . n 
A 1 122 ASP 122 141 141 ASP ASP A . n 
A 1 123 VAL 123 142 142 VAL VAL A . n 
A 1 124 SER 124 143 143 SER SER A . n 
A 1 125 TRP 125 144 144 TRP TRP A . n 
A 1 126 ILE 126 145 145 ILE ILE A . n 
A 1 127 TYR 127 146 146 TYR TYR A . n 
A 1 128 PRO 128 147 147 PRO PRO A . n 
A 1 129 ASP 129 148 148 ASP ASP A . n 
A 1 130 GLN 130 149 149 GLN GLN A . n 
A 1 131 LYS 131 150 150 LYS LYS A . n 
A 1 132 GLU 132 151 151 GLU GLU A . n 
A 1 133 ASN 133 152 152 ASN ASN A . n 
A 1 134 THR 134 153 153 THR THR A . n 
A 1 135 HIS 135 154 154 HIS HIS A . n 
A 1 136 PHE 136 155 155 PHE PHE A . n 
A 1 137 THR 137 156 156 THR THR A . n 
A 1 138 VAL 138 157 157 VAL VAL A . n 
A 1 139 LEU 139 158 158 LEU LEU A . n 
A 1 140 ILE 140 159 159 ILE ILE A . n 
A 1 141 HIS 141 160 160 HIS HIS A . n 
A 1 142 GLU 142 161 161 GLU GLU A . n 
A 1 143 LEU 143 162 162 LEU LEU A . n 
A 1 144 ALA 144 163 163 ALA ALA A . n 
A 1 145 GLU 145 164 164 GLU GLU A . n 
A 1 146 ALA 146 165 165 ALA ALA A . n 
A 1 147 PHE 147 166 166 PHE PHE A . n 
A 1 148 GLN 148 167 167 GLN GLN A . n 
A 1 149 LYS 149 168 168 LYS LYS A . n 
A 1 150 ASP 150 169 169 ASP ASP A . n 
A 1 151 PHE 151 170 170 PHE PHE A . n 
A 1 152 THR 152 171 171 THR THR A . n 
A 1 153 LYS 153 172 172 LYS LYS A . n 
A 1 154 SER 154 173 173 SER SER A . n 
A 1 155 THR 155 174 174 THR THR A . n 
A 1 156 LYS 156 175 175 LYS LYS A . n 
A 1 157 GLU 157 176 176 GLU GLU A . n 
A 1 158 ARG 158 177 177 ARG ARG A . n 
A 1 159 LEU 159 178 178 LEU LEU A . n 
A 1 160 LEU 160 179 179 LEU LEU A . n 
A 1 161 LEU 161 180 180 LEU LEU A . n 
A 1 162 THR 162 181 181 THR THR A . n 
A 1 163 VAL 163 182 182 VAL VAL A . n 
A 1 164 GLY 164 183 183 GLY GLY A . n 
A 1 165 VAL 165 184 184 VAL VAL A . n 
A 1 166 SER 166 185 185 SER SER A . n 
A 1 167 ALA 167 186 186 ALA ALA A . n 
A 1 168 GLY 168 187 187 GLY GLY A . n 
A 1 169 ARG 169 188 188 ARG ARG A . n 
A 1 170 GLN 170 189 189 GLN GLN A . n 
A 1 171 MET 171 190 190 MET MET A . n 
A 1 172 ILE 172 191 191 ILE ILE A . n 
A 1 173 ASP 173 192 192 ASP ASP A . n 
A 1 174 ASN 174 193 193 ASN ASN A . n 
A 1 175 SER 175 194 194 SER SER A . n 
A 1 176 TYR 176 195 195 TYR TYR A . n 
A 1 177 GLN 177 196 196 GLN GLN A . n 
A 1 178 VAL 178 197 197 VAL VAL A . n 
A 1 179 GLU 179 198 198 GLU GLU A . n 
A 1 180 LYS 180 199 199 LYS LYS A . n 
A 1 181 LEU 181 200 200 LEU LEU A . n 
A 1 182 ALA 182 201 201 ALA ALA A . n 
A 1 183 LYS 183 202 202 LYS LYS A . n 
A 1 184 ASP 184 203 203 ASP ASP A . n 
A 1 185 LEU 185 204 204 LEU LEU A . n 
A 1 186 ASP 186 205 205 ASP ASP A . n 
A 1 187 PHE 187 206 206 PHE PHE A . n 
A 1 188 ILE 188 207 207 ILE ILE A . n 
A 1 189 ASN 189 208 208 ASN ASN A . n 
A 1 190 LEU 190 209 209 LEU LEU A . n 
A 1 191 LEU 191 210 210 LEU LEU A . n 
A 1 192 SER 192 211 211 SER SER A . n 
A 1 193 PHE 193 212 212 PHE PHE A . n 
A 1 194 ASP 194 213 213 ASP ASP A . n 
A 1 195 PHE 195 214 214 PHE PHE A . n 
A 1 196 HIS 196 215 215 HIS HIS A . n 
A 1 197 GLY 197 216 216 GLY GLY A . n 
A 1 198 SER 198 217 217 SER SER A . n 
A 1 199 TRP 199 218 218 TRP TRP A . n 
A 1 200 GLU 200 219 219 GLU GLU A . n 
A 1 201 LYS 201 220 220 LYS LYS A . n 
A 1 202 PRO 202 221 221 PRO PRO A . n 
A 1 203 LEU 203 222 222 LEU LEU A . n 
A 1 204 ILE 204 223 223 ILE ILE A . n 
A 1 205 THR 205 224 224 THR THR A . n 
A 1 206 GLY 206 225 225 GLY GLY A . n 
A 1 207 HIS 207 226 226 HIS HIS A . n 
A 1 208 ASN 208 227 227 ASN ASN A . n 
A 1 209 SER 209 228 228 SER SER A . n 
A 1 210 PRO 210 229 229 PRO PRO A . n 
A 1 211 LEU 211 230 230 LEU LEU A . n 
A 1 212 SER 212 231 231 SER SER A . n 
A 1 213 LYS 213 232 232 LYS LYS A . n 
A 1 214 GLY 214 233 233 GLY GLY A . n 
A 1 215 TRP 215 234 234 TRP TRP A . n 
A 1 216 GLN 216 235 235 GLN GLN A . n 
A 1 217 ASP 217 236 236 ASP ASP A . n 
A 1 218 ARG 218 237 237 ARG ARG A . n 
A 1 219 GLY 219 238 238 GLY GLY A . n 
A 1 220 PRO 220 239 239 PRO PRO A . n 
A 1 221 SER 221 240 240 SER SER A . n 
A 1 222 SER 222 241 241 SER SER A . n 
A 1 223 TYR 223 242 242 TYR TYR A . n 
A 1 224 TYR 224 243 243 TYR TYR A . n 
A 1 225 ASN 225 244 244 ASN ASN A . n 
A 1 226 VAL 226 245 245 VAL VAL A . n 
A 1 227 GLU 227 246 246 GLU GLU A . n 
A 1 228 TYR 228 247 247 TYR TYR A . n 
A 1 229 ALA 229 248 248 ALA ALA A . n 
A 1 230 VAL 230 249 249 VAL VAL A . n 
A 1 231 GLY 231 250 250 GLY GLY A . n 
A 1 232 TYR 232 251 251 TYR TYR A . n 
A 1 233 TRP 233 252 252 TRP TRP A . n 
A 1 234 ILE 234 253 253 ILE ILE A . n 
A 1 235 HIS 235 254 254 HIS HIS A . n 
A 1 236 LYS 236 255 255 LYS LYS A . n 
A 1 237 GLY 237 256 256 GLY GLY A . n 
A 1 238 MET 238 257 257 MET MET A . n 
A 1 239 PRO 239 258 258 PRO PRO A . n 
A 1 240 SER 240 259 259 SER SER A . n 
A 1 241 GLU 241 260 260 GLU GLU A . n 
A 1 242 LYS 242 261 261 LYS LYS A . n 
A 1 243 VAL 243 262 262 VAL VAL A . n 
A 1 244 VAL 244 263 263 VAL VAL A . n 
A 1 245 MET 245 264 264 MET MET A . n 
A 1 246 GLY 246 265 265 GLY GLY A . n 
A 1 247 ILE 247 266 266 ILE ILE A . n 
A 1 248 PRO 248 267 267 PRO PRO A . n 
A 1 249 THR 249 268 268 THR THR A . n 
A 1 250 TYR 250 269 269 TYR TYR A . n 
A 1 251 GLY 251 270 270 GLY GLY A . n 
A 1 252 HIS 252 271 271 HIS HIS A . n 
A 1 253 SER 253 272 272 SER SER A . n 
A 1 254 PHE 254 273 273 PHE PHE A . n 
A 1 255 THR 255 274 274 THR THR A . n 
A 1 256 LEU 256 275 275 LEU LEU A . n 
A 1 257 ALA 257 276 276 ALA ALA A . n 
A 1 258 SER 258 277 277 SER SER A . n 
A 1 259 ALA 259 278 278 ALA ALA A . n 
A 1 260 GLU 260 279 279 GLU GLU A . n 
A 1 261 THR 261 280 280 THR THR A . n 
A 1 262 THR 262 281 281 THR THR A . n 
A 1 263 VAL 263 282 282 VAL VAL A . n 
A 1 264 GLY 264 283 283 GLY GLY A . n 
A 1 265 ALA 265 284 284 ALA ALA A . n 
A 1 266 PRO 266 285 285 PRO PRO A . n 
A 1 267 ALA 267 286 286 ALA ALA A . n 
A 1 268 SER 268 287 287 SER SER A . n 
A 1 269 GLY 269 288 288 GLY GLY A . n 
A 1 270 PRO 270 289 289 PRO PRO A . n 
A 1 271 GLY 271 290 290 GLY GLY A . n 
A 1 272 ALA 272 291 291 ALA ALA A . n 
A 1 273 ALA 273 292 292 ALA ALA A . n 
A 1 274 GLY 274 293 293 GLY GLY A . n 
A 1 275 PRO 275 294 294 PRO PRO A . n 
A 1 276 ILE 276 295 295 ILE ILE A . n 
A 1 277 THR 277 296 296 THR THR A . n 
A 1 278 GLU 278 297 297 GLU GLU A . n 
A 1 279 SER 279 298 298 SER SER A . n 
A 1 280 SER 280 299 299 SER SER A . n 
A 1 281 GLY 281 300 300 GLY GLY A . n 
A 1 282 PHE 282 301 301 PHE PHE A . n 
A 1 283 LEU 283 302 302 LEU LEU A . n 
A 1 284 ALA 284 303 303 ALA ALA A . n 
A 1 285 TYR 285 304 304 TYR TYR A . n 
A 1 286 TYR 286 305 305 TYR TYR A . n 
A 1 287 GLU 287 306 306 GLU GLU A . n 
A 1 288 ILE 288 307 307 ILE ILE A . n 
A 1 289 CYS 289 308 308 CYS CYS A . n 
A 1 290 GLN 290 309 309 GLN GLN A . n 
A 1 291 PHE 291 310 310 PHE PHE A . n 
A 1 292 LEU 292 311 311 LEU LEU A . n 
A 1 293 LYS 293 312 312 LYS LYS A . n 
A 1 294 GLY 294 313 313 GLY GLY A . n 
A 1 295 ALA 295 314 314 ALA ALA A . n 
A 1 296 LYS 296 315 315 LYS LYS A . n 
A 1 297 ILE 297 316 316 ILE ILE A . n 
A 1 298 THR 298 317 317 THR THR A . n 
A 1 299 TRP 299 318 318 TRP TRP A . n 
A 1 300 LEU 300 319 319 LEU LEU A . n 
A 1 301 GLN 301 320 320 GLN GLN A . n 
A 1 302 ASP 302 321 321 ASP ASP A . n 
A 1 303 GLN 303 322 322 GLN GLN A . n 
A 1 304 GLN 304 323 323 GLN GLN A . n 
A 1 305 VAL 305 324 324 VAL VAL A . n 
A 1 306 PRO 306 325 325 PRO PRO A . n 
A 1 307 TYR 307 326 326 TYR TYR A . n 
A 1 308 ALA 308 327 327 ALA ALA A . n 
A 1 309 VAL 309 328 328 VAL VAL A . n 
A 1 310 LYS 310 329 329 LYS LYS A . n 
A 1 311 GLY 311 330 330 GLY GLY A . n 
A 1 312 ASN 312 331 331 ASN ASN A . n 
A 1 313 GLN 313 332 332 GLN GLN A . n 
A 1 314 TRP 314 333 333 TRP TRP A . n 
A 1 315 VAL 315 334 334 VAL VAL A . n 
A 1 316 GLY 316 335 335 GLY GLY A . n 
A 1 317 TYR 317 336 336 TYR TYR A . n 
A 1 318 ASP 318 337 337 ASP ASP A . n 
A 1 319 ASP 319 338 338 ASP ASP A . n 
A 1 320 VAL 320 339 339 VAL VAL A . n 
A 1 321 LYS 321 340 340 LYS LYS A . n 
A 1 322 SER 322 341 341 SER SER A . n 
A 1 323 MET 323 342 342 MET MET A . n 
A 1 324 GLU 324 343 343 GLU GLU A . n 
A 1 325 THR 325 344 344 THR THR A . n 
A 1 326 LYS 326 345 345 LYS LYS A . n 
A 1 327 VAL 327 346 346 VAL VAL A . n 
A 1 328 GLN 328 347 347 GLN GLN A . n 
A 1 329 PHE 329 348 348 PHE PHE A . n 
A 1 330 LEU 330 349 349 LEU LEU A . n 
A 1 331 LYS 331 350 350 LYS LYS A . n 
A 1 332 ASN 332 351 351 ASN ASN A . n 
A 1 333 LEU 333 352 352 LEU LEU A . n 
A 1 334 ASN 334 353 353 ASN ASN A . n 
A 1 335 LEU 335 354 354 LEU LEU A . n 
A 1 336 GLY 336 355 355 GLY GLY A . n 
A 1 337 GLY 337 356 356 GLY GLY A . n 
A 1 338 ALA 338 357 357 ALA ALA A . n 
A 1 339 MET 339 358 358 MET MET A . n 
A 1 340 ILE 340 359 359 ILE ILE A . n 
A 1 341 TRP 341 360 360 TRP TRP A . n 
A 1 342 SER 342 361 361 SER SER A . n 
A 1 343 ILE 343 362 362 ILE ILE A . n 
A 1 344 ASP 344 363 363 ASP ASP A . n 
A 1 345 MET 345 364 364 MET MET A . n 
A 1 346 ASP 346 365 365 ASP ASP A . n 
A 1 347 ASP 347 366 366 ASP ASP A . n 
A 1 348 PHE 348 367 367 PHE PHE A . n 
A 1 349 THR 349 368 368 THR THR A . n 
A 1 350 GLY 350 369 369 GLY GLY A . n 
A 1 351 LYS 351 370 370 LYS LYS A . n 
A 1 352 SER 352 371 371 SER SER A . n 
A 1 353 CYS 353 372 372 CYS CYS A . n 
A 1 354 ASN 354 373 373 ASN ASN A . n 
A 1 355 GLN 355 374 374 GLN GLN A . n 
A 1 356 GLY 356 375 375 GLY GLY A . n 
A 1 357 PRO 357 376 376 PRO PRO A . n 
A 1 358 TYR 358 377 377 TYR TYR A . n 
A 1 359 PRO 359 378 378 PRO PRO A . n 
A 1 360 LEU 360 379 379 LEU LEU A . n 
A 1 361 VAL 361 380 380 VAL VAL A . n 
A 1 362 GLN 362 381 381 GLN GLN A . n 
A 1 363 ALA 363 382 382 ALA ALA A . n 
A 1 364 VAL 364 383 383 VAL VAL A . n 
A 1 365 LYS 365 384 384 LYS LYS A . n 
A 1 366 ARG 366 385 385 ARG ARG A . n 
A 1 367 SER 367 386 386 SER SER A . n 
A 1 368 LEU 368 387 387 LEU LEU A . n 
A 1 369 GLY 369 388 388 GLY GLY A . n 
A 1 370 SER 370 389 389 SER SER A . n 
A 1 371 LEU 371 390 390 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1   403  411 SO4 SO4 A . 
D 3 SO4 1   404  412 SO4 SO4 A . 
E 3 SO4 1   405  413 SO4 SO4 A . 
F 4 HOH 1   501  288 HOH HOH A . 
F 4 HOH 2   502  287 HOH HOH A . 
F 4 HOH 3   503  533 HOH HOH A . 
F 4 HOH 4   504  584 HOH HOH A . 
F 4 HOH 5   505  560 HOH HOH A . 
F 4 HOH 6   506  601 HOH HOH A . 
F 4 HOH 7   507  247 HOH HOH A . 
F 4 HOH 8   508  552 HOH HOH A . 
F 4 HOH 9   509  92  HOH HOH A . 
F 4 HOH 10  510  221 HOH HOH A . 
F 4 HOH 11  511  22  HOH HOH A . 
F 4 HOH 12  512  348 HOH HOH A . 
F 4 HOH 13  513  62  HOH HOH A . 
F 4 HOH 14  514  275 HOH HOH A . 
F 4 HOH 15  515  512 HOH HOH A . 
F 4 HOH 16  516  612 HOH HOH A . 
F 4 HOH 17  517  462 HOH HOH A . 
F 4 HOH 18  518  684 HOH HOH A . 
F 4 HOH 19  519  606 HOH HOH A . 
F 4 HOH 20  520  681 HOH HOH A . 
F 4 HOH 21  521  246 HOH HOH A . 
F 4 HOH 22  522  129 HOH HOH A . 
F 4 HOH 23  523  241 HOH HOH A . 
F 4 HOH 24  524  166 HOH HOH A . 
F 4 HOH 25  525  205 HOH HOH A . 
F 4 HOH 26  526  291 HOH HOH A . 
F 4 HOH 27  527  525 HOH HOH A . 
F 4 HOH 28  528  690 HOH HOH A . 
F 4 HOH 29  529  140 HOH HOH A . 
F 4 HOH 30  530  314 HOH HOH A . 
F 4 HOH 31  531  61  HOH HOH A . 
F 4 HOH 32  532  479 HOH HOH A . 
F 4 HOH 33  533  696 HOH HOH A . 
F 4 HOH 34  534  238 HOH HOH A . 
F 4 HOH 35  535  109 HOH HOH A . 
F 4 HOH 36  536  147 HOH HOH A . 
F 4 HOH 37  537  123 HOH HOH A . 
F 4 HOH 38  538  82  HOH HOH A . 
F 4 HOH 39  539  217 HOH HOH A . 
F 4 HOH 40  540  665 HOH HOH A . 
F 4 HOH 41  541  96  HOH HOH A . 
F 4 HOH 42  542  77  HOH HOH A . 
F 4 HOH 43  543  694 HOH HOH A . 
F 4 HOH 44  544  4   HOH HOH A . 
F 4 HOH 45  545  292 HOH HOH A . 
F 4 HOH 46  546  431 HOH HOH A . 
F 4 HOH 47  547  29  HOH HOH A . 
F 4 HOH 48  548  298 HOH HOH A . 
F 4 HOH 49  549  535 HOH HOH A . 
F 4 HOH 50  550  15  HOH HOH A . 
F 4 HOH 51  551  160 HOH HOH A . 
F 4 HOH 52  552  532 HOH HOH A . 
F 4 HOH 53  553  46  HOH HOH A . 
F 4 HOH 54  554  414 HOH HOH A . 
F 4 HOH 55  555  54  HOH HOH A . 
F 4 HOH 56  556  102 HOH HOH A . 
F 4 HOH 57  557  91  HOH HOH A . 
F 4 HOH 58  558  677 HOH HOH A . 
F 4 HOH 59  559  201 HOH HOH A . 
F 4 HOH 60  560  577 HOH HOH A . 
F 4 HOH 61  561  261 HOH HOH A . 
F 4 HOH 62  562  167 HOH HOH A . 
F 4 HOH 63  563  273 HOH HOH A . 
F 4 HOH 64  564  76  HOH HOH A . 
F 4 HOH 65  565  329 HOH HOH A . 
F 4 HOH 66  566  488 HOH HOH A . 
F 4 HOH 67  567  90  HOH HOH A . 
F 4 HOH 68  568  222 HOH HOH A . 
F 4 HOH 69  569  135 HOH HOH A . 
F 4 HOH 70  570  369 HOH HOH A . 
F 4 HOH 71  571  27  HOH HOH A . 
F 4 HOH 72  572  666 HOH HOH A . 
F 4 HOH 73  573  529 HOH HOH A . 
F 4 HOH 74  574  315 HOH HOH A . 
F 4 HOH 75  575  14  HOH HOH A . 
F 4 HOH 76  576  270 HOH HOH A . 
F 4 HOH 77  577  683 HOH HOH A . 
F 4 HOH 78  578  145 HOH HOH A . 
F 4 HOH 79  579  477 HOH HOH A . 
F 4 HOH 80  580  467 HOH HOH A . 
F 4 HOH 81  581  159 HOH HOH A . 
F 4 HOH 82  582  143 HOH HOH A . 
F 4 HOH 83  583  278 HOH HOH A . 
F 4 HOH 84  584  195 HOH HOH A . 
F 4 HOH 85  585  149 HOH HOH A . 
F 4 HOH 86  586  35  HOH HOH A . 
F 4 HOH 87  587  125 HOH HOH A . 
F 4 HOH 88  588  531 HOH HOH A . 
F 4 HOH 89  589  381 HOH HOH A . 
F 4 HOH 90  590  110 HOH HOH A . 
F 4 HOH 91  591  56  HOH HOH A . 
F 4 HOH 92  592  158 HOH HOH A . 
F 4 HOH 93  593  621 HOH HOH A . 
F 4 HOH 94  594  460 HOH HOH A . 
F 4 HOH 95  595  117 HOH HOH A . 
F 4 HOH 96  596  249 HOH HOH A . 
F 4 HOH 97  597  48  HOH HOH A . 
F 4 HOH 98  598  47  HOH HOH A . 
F 4 HOH 99  599  481 HOH HOH A . 
F 4 HOH 100 600  667 HOH HOH A . 
F 4 HOH 101 601  299 HOH HOH A . 
F 4 HOH 102 602  410 HOH HOH A . 
F 4 HOH 103 603  345 HOH HOH A . 
F 4 HOH 104 604  343 HOH HOH A . 
F 4 HOH 105 605  383 HOH HOH A . 
F 4 HOH 106 606  268 HOH HOH A . 
F 4 HOH 107 607  357 HOH HOH A . 
F 4 HOH 108 608  426 HOH HOH A . 
F 4 HOH 109 609  71  HOH HOH A . 
F 4 HOH 110 610  487 HOH HOH A . 
F 4 HOH 111 611  385 HOH HOH A . 
F 4 HOH 112 612  311 HOH HOH A . 
F 4 HOH 113 613  172 HOH HOH A . 
F 4 HOH 114 614  697 HOH HOH A . 
F 4 HOH 115 615  394 HOH HOH A . 
F 4 HOH 116 616  448 HOH HOH A . 
F 4 HOH 117 617  610 HOH HOH A . 
F 4 HOH 118 618  89  HOH HOH A . 
F 4 HOH 119 619  461 HOH HOH A . 
F 4 HOH 120 620  333 HOH HOH A . 
F 4 HOH 121 621  489 HOH HOH A . 
F 4 HOH 122 622  567 HOH HOH A . 
F 4 HOH 123 623  663 HOH HOH A . 
F 4 HOH 124 624  377 HOH HOH A . 
F 4 HOH 125 625  350 HOH HOH A . 
F 4 HOH 126 626  510 HOH HOH A . 
F 4 HOH 127 627  335 HOH HOH A . 
F 4 HOH 128 628  302 HOH HOH A . 
F 4 HOH 129 629  116 HOH HOH A . 
F 4 HOH 130 630  582 HOH HOH A . 
F 4 HOH 131 631  443 HOH HOH A . 
F 4 HOH 132 632  392 HOH HOH A . 
F 4 HOH 133 633  540 HOH HOH A . 
F 4 HOH 134 634  432 HOH HOH A . 
F 4 HOH 135 635  546 HOH HOH A . 
F 4 HOH 136 636  616 HOH HOH A . 
F 4 HOH 137 637  615 HOH HOH A . 
F 4 HOH 138 638  407 HOH HOH A . 
F 4 HOH 139 639  475 HOH HOH A . 
F 4 HOH 140 640  38  HOH HOH A . 
F 4 HOH 141 641  354 HOH HOH A . 
F 4 HOH 142 642  442 HOH HOH A . 
F 4 HOH 143 643  611 HOH HOH A . 
F 4 HOH 144 644  509 HOH HOH A . 
F 4 HOH 145 645  561 HOH HOH A . 
F 4 HOH 146 646  301 HOH HOH A . 
F 4 HOH 147 647  695 HOH HOH A . 
F 4 HOH 148 648  70  HOH HOH A . 
F 4 HOH 149 649  672 HOH HOH A . 
F 4 HOH 150 650  296 HOH HOH A . 
F 4 HOH 151 651  478 HOH HOH A . 
F 4 HOH 152 652  85  HOH HOH A . 
F 4 HOH 153 653  480 HOH HOH A . 
F 4 HOH 154 654  168 HOH HOH A . 
F 4 HOH 155 655  627 HOH HOH A . 
F 4 HOH 156 656  69  HOH HOH A . 
F 4 HOH 157 657  646 HOH HOH A . 
F 4 HOH 158 658  553 HOH HOH A . 
F 4 HOH 159 659  526 HOH HOH A . 
F 4 HOH 160 660  438 HOH HOH A . 
F 4 HOH 161 661  530 HOH HOH A . 
F 4 HOH 162 662  430 HOH HOH A . 
F 4 HOH 163 663  578 HOH HOH A . 
F 4 HOH 164 664  575 HOH HOH A . 
F 4 HOH 165 665  643 HOH HOH A . 
F 4 HOH 166 666  645 HOH HOH A . 
F 4 HOH 167 667  603 HOH HOH A . 
F 4 HOH 168 668  604 HOH HOH A . 
F 4 HOH 169 669  664 HOH HOH A . 
F 4 HOH 170 670  538 HOH HOH A . 
F 4 HOH 171 671  640 HOH HOH A . 
F 4 HOH 172 672  459 HOH HOH A . 
F 4 HOH 173 673  556 HOH HOH A . 
F 4 HOH 174 674  649 HOH HOH A . 
F 4 HOH 175 675  698 HOH HOH A . 
F 4 HOH 176 676  455 HOH HOH A . 
F 4 HOH 177 677  422 HOH HOH A . 
F 4 HOH 178 678  513 HOH HOH A . 
F 4 HOH 179 679  498 HOH HOH A . 
F 4 HOH 180 680  300 HOH HOH A . 
F 4 HOH 181 681  528 HOH HOH A . 
F 4 HOH 182 682  255 HOH HOH A . 
F 4 HOH 183 683  599 HOH HOH A . 
F 4 HOH 184 684  699 HOH HOH A . 
F 4 HOH 185 685  245 HOH HOH A . 
F 4 HOH 186 686  220 HOH HOH A . 
F 4 HOH 187 687  654 HOH HOH A . 
F 4 HOH 188 688  420 HOH HOH A . 
F 4 HOH 189 689  115 HOH HOH A . 
F 4 HOH 190 690  579 HOH HOH A . 
F 4 HOH 191 691  545 HOH HOH A . 
F 4 HOH 192 692  469 HOH HOH A . 
F 4 HOH 193 693  594 HOH HOH A . 
F 4 HOH 194 694  517 HOH HOH A . 
F 4 HOH 195 695  518 HOH HOH A . 
F 4 HOH 196 696  322 HOH HOH A . 
F 4 HOH 197 697  520 HOH HOH A . 
F 4 HOH 198 698  474 HOH HOH A . 
F 4 HOH 199 699  628 HOH HOH A . 
F 4 HOH 200 700  631 HOH HOH A . 
F 4 HOH 201 701  564 HOH HOH A . 
F 4 HOH 202 702  592 HOH HOH A . 
F 4 HOH 203 703  458 HOH HOH A . 
F 4 HOH 204 704  544 HOH HOH A . 
F 4 HOH 205 705  454 HOH HOH A . 
F 4 HOH 206 706  436 HOH HOH A . 
F 4 HOH 207 707  240 HOH HOH A . 
F 4 HOH 208 708  639 HOH HOH A . 
F 4 HOH 209 709  1   HOH HOH A . 
F 4 HOH 210 710  2   HOH HOH A . 
F 4 HOH 211 711  3   HOH HOH A . 
F 4 HOH 212 712  5   HOH HOH A . 
F 4 HOH 213 713  6   HOH HOH A . 
F 4 HOH 214 714  7   HOH HOH A . 
F 4 HOH 215 715  8   HOH HOH A . 
F 4 HOH 216 716  9   HOH HOH A . 
F 4 HOH 217 717  10  HOH HOH A . 
F 4 HOH 218 718  11  HOH HOH A . 
F 4 HOH 219 719  12  HOH HOH A . 
F 4 HOH 220 720  13  HOH HOH A . 
F 4 HOH 221 721  16  HOH HOH A . 
F 4 HOH 222 722  17  HOH HOH A . 
F 4 HOH 223 723  18  HOH HOH A . 
F 4 HOH 224 724  19  HOH HOH A . 
F 4 HOH 225 725  20  HOH HOH A . 
F 4 HOH 226 726  21  HOH HOH A . 
F 4 HOH 227 727  23  HOH HOH A . 
F 4 HOH 228 728  24  HOH HOH A . 
F 4 HOH 229 729  25  HOH HOH A . 
F 4 HOH 230 730  26  HOH HOH A . 
F 4 HOH 231 731  28  HOH HOH A . 
F 4 HOH 232 732  30  HOH HOH A . 
F 4 HOH 233 733  31  HOH HOH A . 
F 4 HOH 234 734  32  HOH HOH A . 
F 4 HOH 235 735  33  HOH HOH A . 
F 4 HOH 236 736  34  HOH HOH A . 
F 4 HOH 237 737  36  HOH HOH A . 
F 4 HOH 238 738  37  HOH HOH A . 
F 4 HOH 239 739  39  HOH HOH A . 
F 4 HOH 240 740  40  HOH HOH A . 
F 4 HOH 241 741  41  HOH HOH A . 
F 4 HOH 242 742  42  HOH HOH A . 
F 4 HOH 243 743  43  HOH HOH A . 
F 4 HOH 244 744  44  HOH HOH A . 
F 4 HOH 245 745  45  HOH HOH A . 
F 4 HOH 246 746  49  HOH HOH A . 
F 4 HOH 247 747  50  HOH HOH A . 
F 4 HOH 248 748  51  HOH HOH A . 
F 4 HOH 249 749  52  HOH HOH A . 
F 4 HOH 250 750  53  HOH HOH A . 
F 4 HOH 251 751  55  HOH HOH A . 
F 4 HOH 252 752  57  HOH HOH A . 
F 4 HOH 253 753  58  HOH HOH A . 
F 4 HOH 254 754  59  HOH HOH A . 
F 4 HOH 255 755  60  HOH HOH A . 
F 4 HOH 256 756  63  HOH HOH A . 
F 4 HOH 257 757  64  HOH HOH A . 
F 4 HOH 258 758  65  HOH HOH A . 
F 4 HOH 259 759  66  HOH HOH A . 
F 4 HOH 260 760  67  HOH HOH A . 
F 4 HOH 261 761  68  HOH HOH A . 
F 4 HOH 262 762  72  HOH HOH A . 
F 4 HOH 263 763  73  HOH HOH A . 
F 4 HOH 264 764  74  HOH HOH A . 
F 4 HOH 265 765  75  HOH HOH A . 
F 4 HOH 266 766  78  HOH HOH A . 
F 4 HOH 267 767  79  HOH HOH A . 
F 4 HOH 268 768  80  HOH HOH A . 
F 4 HOH 269 769  81  HOH HOH A . 
F 4 HOH 270 770  83  HOH HOH A . 
F 4 HOH 271 771  84  HOH HOH A . 
F 4 HOH 272 772  86  HOH HOH A . 
F 4 HOH 273 773  87  HOH HOH A . 
F 4 HOH 274 774  88  HOH HOH A . 
F 4 HOH 275 775  93  HOH HOH A . 
F 4 HOH 276 776  94  HOH HOH A . 
F 4 HOH 277 777  95  HOH HOH A . 
F 4 HOH 278 778  97  HOH HOH A . 
F 4 HOH 279 779  98  HOH HOH A . 
F 4 HOH 280 780  99  HOH HOH A . 
F 4 HOH 281 781  100 HOH HOH A . 
F 4 HOH 282 782  101 HOH HOH A . 
F 4 HOH 283 783  103 HOH HOH A . 
F 4 HOH 284 784  104 HOH HOH A . 
F 4 HOH 285 785  105 HOH HOH A . 
F 4 HOH 286 786  106 HOH HOH A . 
F 4 HOH 287 787  107 HOH HOH A . 
F 4 HOH 288 788  108 HOH HOH A . 
F 4 HOH 289 789  111 HOH HOH A . 
F 4 HOH 290 790  112 HOH HOH A . 
F 4 HOH 291 791  113 HOH HOH A . 
F 4 HOH 292 792  114 HOH HOH A . 
F 4 HOH 293 793  118 HOH HOH A . 
F 4 HOH 294 794  119 HOH HOH A . 
F 4 HOH 295 795  120 HOH HOH A . 
F 4 HOH 296 796  121 HOH HOH A . 
F 4 HOH 297 797  122 HOH HOH A . 
F 4 HOH 298 798  124 HOH HOH A . 
F 4 HOH 299 799  126 HOH HOH A . 
F 4 HOH 300 800  127 HOH HOH A . 
F 4 HOH 301 801  128 HOH HOH A . 
F 4 HOH 302 802  130 HOH HOH A . 
F 4 HOH 303 803  131 HOH HOH A . 
F 4 HOH 304 804  132 HOH HOH A . 
F 4 HOH 305 805  133 HOH HOH A . 
F 4 HOH 306 806  134 HOH HOH A . 
F 4 HOH 307 807  136 HOH HOH A . 
F 4 HOH 308 808  137 HOH HOH A . 
F 4 HOH 309 809  138 HOH HOH A . 
F 4 HOH 310 810  139 HOH HOH A . 
F 4 HOH 311 811  141 HOH HOH A . 
F 4 HOH 312 812  142 HOH HOH A . 
F 4 HOH 313 813  144 HOH HOH A . 
F 4 HOH 314 814  146 HOH HOH A . 
F 4 HOH 315 815  148 HOH HOH A . 
F 4 HOH 316 816  150 HOH HOH A . 
F 4 HOH 317 817  151 HOH HOH A . 
F 4 HOH 318 818  152 HOH HOH A . 
F 4 HOH 319 819  153 HOH HOH A . 
F 4 HOH 320 820  154 HOH HOH A . 
F 4 HOH 321 821  155 HOH HOH A . 
F 4 HOH 322 822  156 HOH HOH A . 
F 4 HOH 323 823  157 HOH HOH A . 
F 4 HOH 324 824  161 HOH HOH A . 
F 4 HOH 325 825  162 HOH HOH A . 
F 4 HOH 326 826  163 HOH HOH A . 
F 4 HOH 327 827  164 HOH HOH A . 
F 4 HOH 328 828  165 HOH HOH A . 
F 4 HOH 329 829  169 HOH HOH A . 
F 4 HOH 330 830  170 HOH HOH A . 
F 4 HOH 331 831  171 HOH HOH A . 
F 4 HOH 332 832  173 HOH HOH A . 
F 4 HOH 333 833  174 HOH HOH A . 
F 4 HOH 334 834  175 HOH HOH A . 
F 4 HOH 335 835  176 HOH HOH A . 
F 4 HOH 336 836  177 HOH HOH A . 
F 4 HOH 337 837  178 HOH HOH A . 
F 4 HOH 338 838  179 HOH HOH A . 
F 4 HOH 339 839  180 HOH HOH A . 
F 4 HOH 340 840  181 HOH HOH A . 
F 4 HOH 341 841  182 HOH HOH A . 
F 4 HOH 342 842  183 HOH HOH A . 
F 4 HOH 343 843  184 HOH HOH A . 
F 4 HOH 344 844  185 HOH HOH A . 
F 4 HOH 345 845  186 HOH HOH A . 
F 4 HOH 346 846  187 HOH HOH A . 
F 4 HOH 347 847  188 HOH HOH A . 
F 4 HOH 348 848  189 HOH HOH A . 
F 4 HOH 349 849  190 HOH HOH A . 
F 4 HOH 350 850  191 HOH HOH A . 
F 4 HOH 351 851  192 HOH HOH A . 
F 4 HOH 352 852  193 HOH HOH A . 
F 4 HOH 353 853  194 HOH HOH A . 
F 4 HOH 354 854  196 HOH HOH A . 
F 4 HOH 355 855  197 HOH HOH A . 
F 4 HOH 356 856  198 HOH HOH A . 
F 4 HOH 357 857  199 HOH HOH A . 
F 4 HOH 358 858  200 HOH HOH A . 
F 4 HOH 359 859  202 HOH HOH A . 
F 4 HOH 360 860  203 HOH HOH A . 
F 4 HOH 361 861  204 HOH HOH A . 
F 4 HOH 362 862  206 HOH HOH A . 
F 4 HOH 363 863  207 HOH HOH A . 
F 4 HOH 364 864  208 HOH HOH A . 
F 4 HOH 365 865  209 HOH HOH A . 
F 4 HOH 366 866  210 HOH HOH A . 
F 4 HOH 367 867  211 HOH HOH A . 
F 4 HOH 368 868  212 HOH HOH A . 
F 4 HOH 369 869  213 HOH HOH A . 
F 4 HOH 370 870  214 HOH HOH A . 
F 4 HOH 371 871  215 HOH HOH A . 
F 4 HOH 372 872  216 HOH HOH A . 
F 4 HOH 373 873  218 HOH HOH A . 
F 4 HOH 374 874  219 HOH HOH A . 
F 4 HOH 375 875  223 HOH HOH A . 
F 4 HOH 376 876  224 HOH HOH A . 
F 4 HOH 377 877  225 HOH HOH A . 
F 4 HOH 378 878  226 HOH HOH A . 
F 4 HOH 379 879  227 HOH HOH A . 
F 4 HOH 380 880  228 HOH HOH A . 
F 4 HOH 381 881  229 HOH HOH A . 
F 4 HOH 382 882  230 HOH HOH A . 
F 4 HOH 383 883  231 HOH HOH A . 
F 4 HOH 384 884  232 HOH HOH A . 
F 4 HOH 385 885  233 HOH HOH A . 
F 4 HOH 386 886  234 HOH HOH A . 
F 4 HOH 387 887  235 HOH HOH A . 
F 4 HOH 388 888  236 HOH HOH A . 
F 4 HOH 389 889  237 HOH HOH A . 
F 4 HOH 390 890  239 HOH HOH A . 
F 4 HOH 391 891  242 HOH HOH A . 
F 4 HOH 392 892  243 HOH HOH A . 
F 4 HOH 393 893  244 HOH HOH A . 
F 4 HOH 394 894  248 HOH HOH A . 
F 4 HOH 395 895  250 HOH HOH A . 
F 4 HOH 396 896  251 HOH HOH A . 
F 4 HOH 397 897  252 HOH HOH A . 
F 4 HOH 398 898  253 HOH HOH A . 
F 4 HOH 399 899  254 HOH HOH A . 
F 4 HOH 400 900  256 HOH HOH A . 
F 4 HOH 401 901  257 HOH HOH A . 
F 4 HOH 402 902  258 HOH HOH A . 
F 4 HOH 403 903  259 HOH HOH A . 
F 4 HOH 404 904  260 HOH HOH A . 
F 4 HOH 405 905  262 HOH HOH A . 
F 4 HOH 406 906  263 HOH HOH A . 
F 4 HOH 407 907  264 HOH HOH A . 
F 4 HOH 408 908  265 HOH HOH A . 
F 4 HOH 409 909  266 HOH HOH A . 
F 4 HOH 410 910  267 HOH HOH A . 
F 4 HOH 411 911  269 HOH HOH A . 
F 4 HOH 412 912  271 HOH HOH A . 
F 4 HOH 413 913  272 HOH HOH A . 
F 4 HOH 414 914  274 HOH HOH A . 
F 4 HOH 415 915  276 HOH HOH A . 
F 4 HOH 416 916  277 HOH HOH A . 
F 4 HOH 417 917  279 HOH HOH A . 
F 4 HOH 418 918  280 HOH HOH A . 
F 4 HOH 419 919  281 HOH HOH A . 
F 4 HOH 420 920  282 HOH HOH A . 
F 4 HOH 421 921  283 HOH HOH A . 
F 4 HOH 422 922  284 HOH HOH A . 
F 4 HOH 423 923  285 HOH HOH A . 
F 4 HOH 424 924  286 HOH HOH A . 
F 4 HOH 425 925  289 HOH HOH A . 
F 4 HOH 426 926  290 HOH HOH A . 
F 4 HOH 427 927  293 HOH HOH A . 
F 4 HOH 428 928  294 HOH HOH A . 
F 4 HOH 429 929  295 HOH HOH A . 
F 4 HOH 430 930  297 HOH HOH A . 
F 4 HOH 431 931  303 HOH HOH A . 
F 4 HOH 432 932  304 HOH HOH A . 
F 4 HOH 433 933  305 HOH HOH A . 
F 4 HOH 434 934  306 HOH HOH A . 
F 4 HOH 435 935  307 HOH HOH A . 
F 4 HOH 436 936  308 HOH HOH A . 
F 4 HOH 437 937  309 HOH HOH A . 
F 4 HOH 438 938  310 HOH HOH A . 
F 4 HOH 439 939  312 HOH HOH A . 
F 4 HOH 440 940  313 HOH HOH A . 
F 4 HOH 441 941  316 HOH HOH A . 
F 4 HOH 442 942  317 HOH HOH A . 
F 4 HOH 443 943  318 HOH HOH A . 
F 4 HOH 444 944  319 HOH HOH A . 
F 4 HOH 445 945  320 HOH HOH A . 
F 4 HOH 446 946  321 HOH HOH A . 
F 4 HOH 447 947  323 HOH HOH A . 
F 4 HOH 448 948  324 HOH HOH A . 
F 4 HOH 449 949  325 HOH HOH A . 
F 4 HOH 450 950  326 HOH HOH A . 
F 4 HOH 451 951  327 HOH HOH A . 
F 4 HOH 452 952  328 HOH HOH A . 
F 4 HOH 453 953  330 HOH HOH A . 
F 4 HOH 454 954  331 HOH HOH A . 
F 4 HOH 455 955  332 HOH HOH A . 
F 4 HOH 456 956  334 HOH HOH A . 
F 4 HOH 457 957  336 HOH HOH A . 
F 4 HOH 458 958  337 HOH HOH A . 
F 4 HOH 459 959  338 HOH HOH A . 
F 4 HOH 460 960  339 HOH HOH A . 
F 4 HOH 461 961  340 HOH HOH A . 
F 4 HOH 462 962  341 HOH HOH A . 
F 4 HOH 463 963  342 HOH HOH A . 
F 4 HOH 464 964  344 HOH HOH A . 
F 4 HOH 465 965  346 HOH HOH A . 
F 4 HOH 466 966  347 HOH HOH A . 
F 4 HOH 467 967  349 HOH HOH A . 
F 4 HOH 468 968  351 HOH HOH A . 
F 4 HOH 469 969  352 HOH HOH A . 
F 4 HOH 470 970  353 HOH HOH A . 
F 4 HOH 471 971  355 HOH HOH A . 
F 4 HOH 472 972  356 HOH HOH A . 
F 4 HOH 473 973  358 HOH HOH A . 
F 4 HOH 474 974  359 HOH HOH A . 
F 4 HOH 475 975  360 HOH HOH A . 
F 4 HOH 476 976  361 HOH HOH A . 
F 4 HOH 477 977  362 HOH HOH A . 
F 4 HOH 478 978  363 HOH HOH A . 
F 4 HOH 479 979  364 HOH HOH A . 
F 4 HOH 480 980  365 HOH HOH A . 
F 4 HOH 481 981  366 HOH HOH A . 
F 4 HOH 482 982  367 HOH HOH A . 
F 4 HOH 483 983  368 HOH HOH A . 
F 4 HOH 484 984  370 HOH HOH A . 
F 4 HOH 485 985  371 HOH HOH A . 
F 4 HOH 486 986  372 HOH HOH A . 
F 4 HOH 487 987  373 HOH HOH A . 
F 4 HOH 488 988  374 HOH HOH A . 
F 4 HOH 489 989  375 HOH HOH A . 
F 4 HOH 490 990  376 HOH HOH A . 
F 4 HOH 491 991  378 HOH HOH A . 
F 4 HOH 492 992  379 HOH HOH A . 
F 4 HOH 493 993  380 HOH HOH A . 
F 4 HOH 494 994  382 HOH HOH A . 
F 4 HOH 495 995  384 HOH HOH A . 
F 4 HOH 496 996  386 HOH HOH A . 
F 4 HOH 497 997  387 HOH HOH A . 
F 4 HOH 498 998  388 HOH HOH A . 
F 4 HOH 499 999  389 HOH HOH A . 
F 4 HOH 500 1000 390 HOH HOH A . 
F 4 HOH 501 1001 391 HOH HOH A . 
F 4 HOH 502 1002 393 HOH HOH A . 
F 4 HOH 503 1003 395 HOH HOH A . 
F 4 HOH 504 1004 396 HOH HOH A . 
F 4 HOH 505 1005 397 HOH HOH A . 
F 4 HOH 506 1006 398 HOH HOH A . 
F 4 HOH 507 1007 399 HOH HOH A . 
F 4 HOH 508 1008 400 HOH HOH A . 
F 4 HOH 509 1009 401 HOH HOH A . 
F 4 HOH 510 1010 402 HOH HOH A . 
F 4 HOH 511 1011 403 HOH HOH A . 
F 4 HOH 512 1012 404 HOH HOH A . 
F 4 HOH 513 1013 405 HOH HOH A . 
F 4 HOH 514 1014 406 HOH HOH A . 
F 4 HOH 515 1015 408 HOH HOH A . 
F 4 HOH 516 1016 409 HOH HOH A . 
F 4 HOH 517 1017 411 HOH HOH A . 
F 4 HOH 518 1018 412 HOH HOH A . 
F 4 HOH 519 1019 413 HOH HOH A . 
F 4 HOH 520 1020 415 HOH HOH A . 
F 4 HOH 521 1021 416 HOH HOH A . 
F 4 HOH 522 1022 417 HOH HOH A . 
F 4 HOH 523 1023 418 HOH HOH A . 
F 4 HOH 524 1024 419 HOH HOH A . 
F 4 HOH 525 1025 421 HOH HOH A . 
F 4 HOH 526 1026 423 HOH HOH A . 
F 4 HOH 527 1027 424 HOH HOH A . 
F 4 HOH 528 1028 425 HOH HOH A . 
F 4 HOH 529 1029 427 HOH HOH A . 
F 4 HOH 530 1030 428 HOH HOH A . 
F 4 HOH 531 1031 429 HOH HOH A . 
F 4 HOH 532 1032 433 HOH HOH A . 
F 4 HOH 533 1033 434 HOH HOH A . 
F 4 HOH 534 1034 435 HOH HOH A . 
F 4 HOH 535 1035 437 HOH HOH A . 
F 4 HOH 536 1036 439 HOH HOH A . 
F 4 HOH 537 1037 440 HOH HOH A . 
F 4 HOH 538 1038 441 HOH HOH A . 
F 4 HOH 539 1039 444 HOH HOH A . 
F 4 HOH 540 1040 445 HOH HOH A . 
F 4 HOH 541 1041 446 HOH HOH A . 
F 4 HOH 542 1042 447 HOH HOH A . 
F 4 HOH 543 1043 449 HOH HOH A . 
F 4 HOH 544 1044 450 HOH HOH A . 
F 4 HOH 545 1045 451 HOH HOH A . 
F 4 HOH 546 1046 452 HOH HOH A . 
F 4 HOH 547 1047 453 HOH HOH A . 
F 4 HOH 548 1048 456 HOH HOH A . 
F 4 HOH 549 1049 457 HOH HOH A . 
F 4 HOH 550 1050 463 HOH HOH A . 
F 4 HOH 551 1051 464 HOH HOH A . 
F 4 HOH 552 1052 465 HOH HOH A . 
F 4 HOH 553 1053 466 HOH HOH A . 
F 4 HOH 554 1054 468 HOH HOH A . 
F 4 HOH 555 1055 470 HOH HOH A . 
F 4 HOH 556 1056 471 HOH HOH A . 
F 4 HOH 557 1057 472 HOH HOH A . 
F 4 HOH 558 1058 473 HOH HOH A . 
F 4 HOH 559 1059 476 HOH HOH A . 
F 4 HOH 560 1060 482 HOH HOH A . 
F 4 HOH 561 1061 483 HOH HOH A . 
F 4 HOH 562 1062 484 HOH HOH A . 
F 4 HOH 563 1063 485 HOH HOH A . 
F 4 HOH 564 1064 486 HOH HOH A . 
F 4 HOH 565 1065 490 HOH HOH A . 
F 4 HOH 566 1066 491 HOH HOH A . 
F 4 HOH 567 1067 492 HOH HOH A . 
F 4 HOH 568 1068 493 HOH HOH A . 
F 4 HOH 569 1069 494 HOH HOH A . 
F 4 HOH 570 1070 495 HOH HOH A . 
F 4 HOH 571 1071 496 HOH HOH A . 
F 4 HOH 572 1072 497 HOH HOH A . 
F 4 HOH 573 1073 499 HOH HOH A . 
F 4 HOH 574 1074 500 HOH HOH A . 
F 4 HOH 575 1075 501 HOH HOH A . 
F 4 HOH 576 1076 502 HOH HOH A . 
F 4 HOH 577 1077 503 HOH HOH A . 
F 4 HOH 578 1078 504 HOH HOH A . 
F 4 HOH 579 1079 505 HOH HOH A . 
F 4 HOH 580 1080 506 HOH HOH A . 
F 4 HOH 581 1081 507 HOH HOH A . 
F 4 HOH 582 1082 508 HOH HOH A . 
F 4 HOH 583 1083 511 HOH HOH A . 
F 4 HOH 584 1084 514 HOH HOH A . 
F 4 HOH 585 1085 515 HOH HOH A . 
F 4 HOH 586 1086 516 HOH HOH A . 
F 4 HOH 587 1087 519 HOH HOH A . 
F 4 HOH 588 1088 521 HOH HOH A . 
F 4 HOH 589 1089 522 HOH HOH A . 
F 4 HOH 590 1090 523 HOH HOH A . 
F 4 HOH 591 1091 524 HOH HOH A . 
F 4 HOH 592 1092 527 HOH HOH A . 
F 4 HOH 593 1093 534 HOH HOH A . 
F 4 HOH 594 1094 536 HOH HOH A . 
F 4 HOH 595 1095 537 HOH HOH A . 
F 4 HOH 596 1096 539 HOH HOH A . 
F 4 HOH 597 1097 541 HOH HOH A . 
F 4 HOH 598 1098 542 HOH HOH A . 
F 4 HOH 599 1099 543 HOH HOH A . 
F 4 HOH 600 1100 547 HOH HOH A . 
F 4 HOH 601 1101 548 HOH HOH A . 
F 4 HOH 602 1102 549 HOH HOH A . 
F 4 HOH 603 1103 550 HOH HOH A . 
F 4 HOH 604 1104 551 HOH HOH A . 
F 4 HOH 605 1105 554 HOH HOH A . 
F 4 HOH 606 1106 555 HOH HOH A . 
F 4 HOH 607 1107 557 HOH HOH A . 
F 4 HOH 608 1108 558 HOH HOH A . 
F 4 HOH 609 1109 559 HOH HOH A . 
F 4 HOH 610 1110 562 HOH HOH A . 
F 4 HOH 611 1111 563 HOH HOH A . 
F 4 HOH 612 1112 565 HOH HOH A . 
F 4 HOH 613 1113 566 HOH HOH A . 
F 4 HOH 614 1114 568 HOH HOH A . 
F 4 HOH 615 1115 569 HOH HOH A . 
F 4 HOH 616 1116 570 HOH HOH A . 
F 4 HOH 617 1117 571 HOH HOH A . 
F 4 HOH 618 1118 572 HOH HOH A . 
F 4 HOH 619 1119 573 HOH HOH A . 
F 4 HOH 620 1120 574 HOH HOH A . 
F 4 HOH 621 1121 576 HOH HOH A . 
F 4 HOH 622 1122 580 HOH HOH A . 
F 4 HOH 623 1123 581 HOH HOH A . 
F 4 HOH 624 1124 583 HOH HOH A . 
F 4 HOH 625 1125 585 HOH HOH A . 
F 4 HOH 626 1126 586 HOH HOH A . 
F 4 HOH 627 1127 587 HOH HOH A . 
F 4 HOH 628 1128 588 HOH HOH A . 
F 4 HOH 629 1129 589 HOH HOH A . 
F 4 HOH 630 1130 590 HOH HOH A . 
F 4 HOH 631 1131 591 HOH HOH A . 
F 4 HOH 632 1132 593 HOH HOH A . 
F 4 HOH 633 1133 595 HOH HOH A . 
F 4 HOH 634 1134 596 HOH HOH A . 
F 4 HOH 635 1135 597 HOH HOH A . 
F 4 HOH 636 1136 598 HOH HOH A . 
F 4 HOH 637 1137 600 HOH HOH A . 
F 4 HOH 638 1138 602 HOH HOH A . 
F 4 HOH 639 1139 605 HOH HOH A . 
F 4 HOH 640 1140 607 HOH HOH A . 
F 4 HOH 641 1141 608 HOH HOH A . 
F 4 HOH 642 1142 609 HOH HOH A . 
F 4 HOH 643 1143 613 HOH HOH A . 
F 4 HOH 644 1144 614 HOH HOH A . 
F 4 HOH 645 1145 617 HOH HOH A . 
F 4 HOH 646 1146 618 HOH HOH A . 
F 4 HOH 647 1147 619 HOH HOH A . 
F 4 HOH 648 1148 620 HOH HOH A . 
F 4 HOH 649 1149 622 HOH HOH A . 
F 4 HOH 650 1150 623 HOH HOH A . 
F 4 HOH 651 1151 624 HOH HOH A . 
F 4 HOH 652 1152 625 HOH HOH A . 
F 4 HOH 653 1153 626 HOH HOH A . 
F 4 HOH 654 1154 629 HOH HOH A . 
F 4 HOH 655 1155 630 HOH HOH A . 
F 4 HOH 656 1156 632 HOH HOH A . 
F 4 HOH 657 1157 633 HOH HOH A . 
F 4 HOH 658 1158 634 HOH HOH A . 
F 4 HOH 659 1159 635 HOH HOH A . 
F 4 HOH 660 1160 636 HOH HOH A . 
F 4 HOH 661 1161 637 HOH HOH A . 
F 4 HOH 662 1162 638 HOH HOH A . 
F 4 HOH 663 1163 641 HOH HOH A . 
F 4 HOH 664 1164 642 HOH HOH A . 
F 4 HOH 665 1165 644 HOH HOH A . 
F 4 HOH 666 1166 647 HOH HOH A . 
F 4 HOH 667 1167 648 HOH HOH A . 
F 4 HOH 668 1168 650 HOH HOH A . 
F 4 HOH 669 1169 651 HOH HOH A . 
F 4 HOH 670 1170 652 HOH HOH A . 
F 4 HOH 671 1171 653 HOH HOH A . 
F 4 HOH 672 1172 655 HOH HOH A . 
F 4 HOH 673 1173 656 HOH HOH A . 
F 4 HOH 674 1174 657 HOH HOH A . 
F 4 HOH 675 1175 658 HOH HOH A . 
F 4 HOH 676 1176 659 HOH HOH A . 
F 4 HOH 677 1177 660 HOH HOH A . 
F 4 HOH 678 1178 661 HOH HOH A . 
F 4 HOH 679 1179 662 HOH HOH A . 
F 4 HOH 680 1180 668 HOH HOH A . 
F 4 HOH 681 1181 669 HOH HOH A . 
F 4 HOH 682 1182 670 HOH HOH A . 
F 4 HOH 683 1183 671 HOH HOH A . 
F 4 HOH 684 1184 673 HOH HOH A . 
F 4 HOH 685 1185 674 HOH HOH A . 
F 4 HOH 686 1186 675 HOH HOH A . 
F 4 HOH 687 1187 676 HOH HOH A . 
F 4 HOH 688 1188 678 HOH HOH A . 
F 4 HOH 689 1189 679 HOH HOH A . 
F 4 HOH 690 1190 680 HOH HOH A . 
F 4 HOH 691 1191 682 HOH HOH A . 
F 4 HOH 692 1192 685 HOH HOH A . 
F 4 HOH 693 1193 686 HOH HOH A . 
F 4 HOH 694 1194 687 HOH HOH A . 
F 4 HOH 695 1195 688 HOH HOH A . 
F 4 HOH 696 1196 689 HOH HOH A . 
F 4 HOH 697 1197 691 HOH HOH A . 
F 4 HOH 698 1198 692 HOH HOH A . 
F 4 HOH 699 1199 693 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 1045 ? F HOH . 
2 1 A HOH 1122 ? F HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-12-03 
2 'Structure model' 1 1 2014-12-17 
3 'Structure model' 1 2 2015-02-04 
4 'Structure model' 1 3 2015-02-11 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'  
2  3 'Structure model' 'Derived calculations' 
3  4 'Structure model' 'Database references'  
4  5 'Structure model' 'Atomic model'         
5  5 'Structure model' 'Data collection'      
6  5 'Structure model' 'Database references'  
7  5 'Structure model' 'Derived calculations' 
8  5 'Structure model' Other                  
9  5 'Structure model' 'Source and taxonomy'  
10 5 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  5 'Structure model' atom_site                     
2  5 'Structure model' chem_comp                     
3  5 'Structure model' citation                      
4  5 'Structure model' entity                        
5  5 'Structure model' entity_src_gen                
6  5 'Structure model' pdbx_branch_scheme            
7  5 'Structure model' pdbx_chem_comp_identifier     
8  5 'Structure model' pdbx_database_status          
9  5 'Structure model' pdbx_entity_branch            
10 5 'Structure model' pdbx_entity_branch_descriptor 
11 5 'Structure model' pdbx_entity_branch_link       
12 5 'Structure model' pdbx_entity_branch_list       
13 5 'Structure model' pdbx_nonpoly_scheme           
14 5 'Structure model' pdbx_struct_oper_list         
15 5 'Structure model' struct_conn                   
16 5 'Structure model' struct_site                   
17 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_atom_site.auth_asym_id'                     
2  5 'Structure model' '_atom_site.auth_seq_id'                      
3  5 'Structure model' '_chem_comp.name'                             
4  5 'Structure model' '_chem_comp.type'                             
5  5 'Structure model' '_citation.journal_id_CSD'                    
6  5 'Structure model' '_entity.pdbx_description'                    
7  5 'Structure model' '_entity.type'                                
8  5 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
9  5 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
10 5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
11 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
12 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
13 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
14 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   REFMAC 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                5.7.0032 
_software.pdbx_ordinal           1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 657  ? ? O A HOH 684  ? ? 1.08 
2  1 O   A HOH 1013 ? ? O A HOH 1195 ? ? 1.58 
3  1 OE1 A GLU 42   ? ? O A HOH 1099 ? ? 1.72 
4  1 OE2 A GLU 198  ? ? O A HOH 1077 ? ? 1.84 
5  1 O2  A SO4 403  ? ? O A HOH 948  ? ? 1.86 
6  1 OG  A SER 241  ? ? O A HOH 948  ? ? 1.89 
7  1 O   A HOH 527  ? ? O A HOH 657  ? ? 1.90 
8  1 O   A HOH 1097 ? ? O A HOH 1098 ? ? 1.92 
9  1 O   A HOH 1193 ? ? O A HOH 1195 ? ? 1.93 
10 1 O   A HOH 946  ? ? O A HOH 1171 ? ? 1.93 
11 1 O   A HOH 633  ? ? O A HOH 1097 ? ? 1.98 
12 1 O   A HOH 1084 ? ? O A HOH 1085 ? ? 1.99 
13 1 O   A HOH 809  ? ? O A HOH 1180 ? ? 2.01 
14 1 O   A HOH 1059 ? ? O A HOH 1192 ? ? 2.01 
15 1 OE1 A GLN 320  ? B O A HOH 501  ? ? 2.06 
16 1 O   A HOH 507  ? ? O A HOH 588  ? ? 2.08 
17 1 O   A HOH 580  ? ? O A HOH 1098 ? ? 2.12 
18 1 O   A HOH 652  ? ? O A HOH 689  ? ? 2.14 
19 1 O   A HOH 809  ? ? O A HOH 1016 ? ? 2.15 
20 1 O   A HOH 631  ? ? O A HOH 1063 ? ? 2.17 
21 1 O   A HOH 997  ? ? O A HOH 1149 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 507 ? ? 1_555 O A HOH 520 ? ? 5_455 2.06 
2 1 O A HOH 506 ? ? 1_555 O A HOH 598 ? ? 4_454 2.10 
3 1 O A HOH 501 ? ? 1_555 O A HOH 560 ? ? 5_445 2.14 
4 1 O A HOH 514 ? ? 1_555 O A HOH 530 ? ? 7_455 2.19 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              385 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              385 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              385 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.56 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.26 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 143 ? ? -108.59 79.04   
2 1 ASP A 148 ? ? 59.10   -170.30 
3 1 SER A 228 ? ? -151.24 60.10   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 931  ? 6.24 .    
2 1 O ? A HOH 1045 ? 6.57 .    
3 1 O ? A HOH 1111 ? 6.20 .    
4 1 O ? A HOH 1122 ? .    6.65 
5 1 O ? A HOH 1136 ? 6.80 .    
6 1 O ? A HOH 1145 ? 6.87 .    
7 1 O ? A HOH 1161 ? 6.21 .    
8 1 O ? A HOH 1173 ? 7.62 .    
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     SER 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      26 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     OG 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    SER 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     7 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    OG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 20 ? A ALA 1 
2 1 Y 1 A MET 21 ? A MET 2 
3 1 Y 1 A ALA 22 ? A ALA 3 
4 1 Y 1 A ASP 23 ? A ASP 4 
5 1 Y 1 A ILE 24 ? A ILE 5 
6 1 Y 1 A GLY 25 ? A GLY 6 
# 
_pdbx_audit_support.funding_organization   'The Higher Education Commission' 
_pdbx_audit_support.country                Thailand 
_pdbx_audit_support.grant_number           CHE500307 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 400 n 
B 2 NAG 2 B NAG 2 A NAG 401 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-ROH                            'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}'             LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#