data_4QQN
# 
_entry.id   4QQN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.293 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4QQN         
RCSB  RCSB086390   
WWPDB D_1000086390 
# 
_pdbx_database_status.entry_id                        4QQN 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-27 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dong, A.'                             1  
'Dobrovetsky, E.'                      2  
'Tempel, W.'                           3  
'He, H.'                               4  
'Zhao, K.'                             5  
'Smil, D.'                             6  
'Landon, M.'                           7  
'Luo, X.'                              8  
'Chen, Z.'                             9  
'Dai, M.'                              10 
'Yu, Z.'                               11 
'Lin, Y.'                              12 
'Zhang, H.'                            13 
'Zhao, K.'                             14 
'Schapira, M.'                         15 
'Brown, P.J.'                          16 
'Bountra, C.'                          17 
'Arrowsmith, C.H.'                     18 
'Edwards, A.M.'                        19 
'Vedadi, M.'                           20 
'Structural Genomics Consortium (SGC)' 21 
# 
_citation.id                        primary 
_citation.title                     
'Discovery of Potent and Selective Allosteric Inhibitors of Protein Arginine Methyltransferase 3 (PRMT3).' 
_citation.journal_abbrev            'J. Med. Chem.' 
_citation.journal_volume            61 
_citation.page_first                1204 
_citation.page_last                 1217 
_citation.year                      2018 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           1520-4804 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   29244490 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.7b01674 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kaniskan, H.U.'      1  
primary 'Eram, M.S.'          2  
primary 'Zhao, K.'            3  
primary 'Szewczyk, M.M.'      4  
primary 'Yang, X.'            5  
primary 'Schmidt, K.'         6  
primary 'Luo, X.'             7  
primary 'Xiao, S.'            8  
primary 'Dai, M.'             9  
primary 'He, F.'              10 
primary 'Zang, I.'            11 
primary 'Lin, Y.'             12 
primary 'Li, F.'              13 
primary 'Dobrovetsky, E.'     14 
primary 'Smil, D.'            15 
primary 'Min, S.J.'           16 
primary 'Lin-Jones, J.'       17 
primary 'Schapira, M.'        18 
primary 'Atadja, P.'          19 
primary 'Li, E.'              20 
primary 'Barsyte-Lovejoy, D.' 21 
primary 'Arrowsmith, C.H.'    22 
primary 'Brown, P.J.'         23 
primary 'Liu, F.'             24 
primary 'Yu, Z.'              25 
primary 'Vedadi, M.'          26 
primary 'Jin, J.'             27 
# 
_cell.length_a           70.319 
_cell.length_b           70.319 
_cell.length_c           172.918 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4QQN 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.entry_id                         4QQN 
_symmetry.Int_Tables_number                96 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PRMT3 protein'                                                 38281.914 1   ? ? ? ? 
2 non-polymer syn '1-{2-[1-(aminomethyl)cyclohexyl]ethyl}-3-isoquinolin-6-ylurea' 326.436   1   ? ? ? ? 
3 non-polymer syn GLYCEROL                                                        92.094    1   ? ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                                                  35.453    1   ? ? ? ? 
5 non-polymer syn 'UNKNOWN ATOM OR ION'                                           ?         12  ? ? ? ? 
6 water       nat water                                                           18.015    156 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  ASP n 
1 21  LEU n 
1 22  GLN n 
1 23  GLU n 
1 24  ASP n 
1 25  GLU n 
1 26  ASP n 
1 27  GLY n 
1 28  VAL n 
1 29  TYR n 
1 30  PHE n 
1 31  SER n 
1 32  SER n 
1 33  TYR n 
1 34  GLY n 
1 35  HIS n 
1 36  TYR n 
1 37  GLY n 
1 38  ILE n 
1 39  HIS n 
1 40  GLU n 
1 41  GLU n 
1 42  MET n 
1 43  LEU n 
1 44  LYS n 
1 45  ASP n 
1 46  LYS n 
1 47  ILE n 
1 48  ARG n 
1 49  THR n 
1 50  GLU n 
1 51  SER n 
1 52  TYR n 
1 53  ARG n 
1 54  ASP n 
1 55  PHE n 
1 56  ILE n 
1 57  TYR n 
1 58  GLN n 
1 59  ASN n 
1 60  PRO n 
1 61  HIS n 
1 62  ILE n 
1 63  PHE n 
1 64  LYS n 
1 65  ASP n 
1 66  LYS n 
1 67  VAL n 
1 68  VAL n 
1 69  LEU n 
1 70  ASP n 
1 71  VAL n 
1 72  GLY n 
1 73  CYS n 
1 74  GLY n 
1 75  THR n 
1 76  GLY n 
1 77  ILE n 
1 78  LEU n 
1 79  SER n 
1 80  MET n 
1 81  PHE n 
1 82  ALA n 
1 83  ALA n 
1 84  LYS n 
1 85  ALA n 
1 86  GLY n 
1 87  ALA n 
1 88  LYS n 
1 89  LYS n 
1 90  VAL n 
1 91  LEU n 
1 92  GLY n 
1 93  VAL n 
1 94  ASP n 
1 95  GLN n 
1 96  SER n 
1 97  GLU n 
1 98  ILE n 
1 99  LEU n 
1 100 TYR n 
1 101 GLN n 
1 102 ALA n 
1 103 MET n 
1 104 ASP n 
1 105 ILE n 
1 106 ILE n 
1 107 ARG n 
1 108 LEU n 
1 109 ASN n 
1 110 LYS n 
1 111 LEU n 
1 112 GLU n 
1 113 ASP n 
1 114 THR n 
1 115 ILE n 
1 116 THR n 
1 117 LEU n 
1 118 ILE n 
1 119 LYS n 
1 120 GLY n 
1 121 LYS n 
1 122 ILE n 
1 123 GLU n 
1 124 GLU n 
1 125 VAL n 
1 126 HIS n 
1 127 LEU n 
1 128 PRO n 
1 129 VAL n 
1 130 GLU n 
1 131 LYS n 
1 132 VAL n 
1 133 ASP n 
1 134 VAL n 
1 135 ILE n 
1 136 ILE n 
1 137 SER n 
1 138 GLU n 
1 139 TRP n 
1 140 MET n 
1 141 GLY n 
1 142 TYR n 
1 143 PHE n 
1 144 LEU n 
1 145 LEU n 
1 146 PHE n 
1 147 GLU n 
1 148 SER n 
1 149 MET n 
1 150 LEU n 
1 151 ASP n 
1 152 SER n 
1 153 VAL n 
1 154 LEU n 
1 155 TYR n 
1 156 ALA n 
1 157 LYS n 
1 158 ASN n 
1 159 LYS n 
1 160 TYR n 
1 161 LEU n 
1 162 ALA n 
1 163 LYS n 
1 164 GLY n 
1 165 GLY n 
1 166 SER n 
1 167 VAL n 
1 168 TYR n 
1 169 PRO n 
1 170 ASP n 
1 171 ILE n 
1 172 CYS n 
1 173 THR n 
1 174 ILE n 
1 175 SER n 
1 176 LEU n 
1 177 VAL n 
1 178 ALA n 
1 179 VAL n 
1 180 SER n 
1 181 ASP n 
1 182 VAL n 
1 183 ASN n 
1 184 LYS n 
1 185 HIS n 
1 186 ALA n 
1 187 ASP n 
1 188 ARG n 
1 189 ILE n 
1 190 ALA n 
1 191 PHE n 
1 192 TRP n 
1 193 ASP n 
1 194 ASP n 
1 195 VAL n 
1 196 TYR n 
1 197 GLY n 
1 198 PHE n 
1 199 LYS n 
1 200 MET n 
1 201 SER n 
1 202 CYS n 
1 203 MET n 
1 204 LYS n 
1 205 LYS n 
1 206 ALA n 
1 207 VAL n 
1 208 ILE n 
1 209 PRO n 
1 210 GLU n 
1 211 ALA n 
1 212 VAL n 
1 213 VAL n 
1 214 GLU n 
1 215 VAL n 
1 216 LEU n 
1 217 ASP n 
1 218 PRO n 
1 219 LYS n 
1 220 THR n 
1 221 LEU n 
1 222 ILE n 
1 223 SER n 
1 224 GLU n 
1 225 PRO n 
1 226 CYS n 
1 227 GLY n 
1 228 ILE n 
1 229 LYS n 
1 230 HIS n 
1 231 ILE n 
1 232 ASP n 
1 233 CYS n 
1 234 HIS n 
1 235 THR n 
1 236 THR n 
1 237 SER n 
1 238 ILE n 
1 239 SER n 
1 240 ASP n 
1 241 LEU n 
1 242 GLU n 
1 243 PHE n 
1 244 SER n 
1 245 SER n 
1 246 ASP n 
1 247 PHE n 
1 248 THR n 
1 249 LEU n 
1 250 LYS n 
1 251 ILE n 
1 252 THR n 
1 253 ARG n 
1 254 THR n 
1 255 SER n 
1 256 MET n 
1 257 CYS n 
1 258 THR n 
1 259 ALA n 
1 260 ILE n 
1 261 ALA n 
1 262 GLY n 
1 263 TYR n 
1 264 PHE n 
1 265 ASP n 
1 266 ILE n 
1 267 TYR n 
1 268 PHE n 
1 269 GLU n 
1 270 LYS n 
1 271 ASN n 
1 272 CYS n 
1 273 HIS n 
1 274 ASN n 
1 275 ARG n 
1 276 VAL n 
1 277 VAL n 
1 278 PHE n 
1 279 SER n 
1 280 THR n 
1 281 GLY n 
1 282 PRO n 
1 283 GLN n 
1 284 SER n 
1 285 THR n 
1 286 LYS n 
1 287 THR n 
1 288 HIS n 
1 289 TRP n 
1 290 LYS n 
1 291 GLN n 
1 292 THR n 
1 293 VAL n 
1 294 PHE n 
1 295 LEU n 
1 296 LEU n 
1 297 GLU n 
1 298 LYS n 
1 299 PRO n 
1 300 PHE n 
1 301 SER n 
1 302 VAL n 
1 303 LYS n 
1 304 ALA n 
1 305 GLY n 
1 306 GLU n 
1 307 ALA n 
1 308 LEU n 
1 309 LYS n 
1 310 GLY n 
1 311 LYS n 
1 312 VAL n 
1 313 THR n 
1 314 VAL n 
1 315 HIS n 
1 316 LYS n 
1 317 ASN n 
1 318 LYS n 
1 319 LYS n 
1 320 ASP n 
1 321 PRO n 
1 322 ARG n 
1 323 SER n 
1 324 LEU n 
1 325 THR n 
1 326 VAL n 
1 327 THR n 
1 328 LEU n 
1 329 THR n 
1 330 LEU n 
1 331 ASN n 
1 332 ASN n 
1 333 SER n 
1 334 THR n 
1 335 GLN n 
1 336 THR n 
1 337 TYR n 
1 338 GLY n 
1 339 LEU n 
1 340 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PRMT3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-codon plus RIL(Stratagen)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8WUV3_HUMAN 
_struct_ref.pdbx_db_accession          Q8WUV3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEIL
YQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAV
SDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTA
IAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGL
Q
;
_struct_ref.pdbx_align_begin           228 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4QQN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 340 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8WUV3 
_struct_ref_seq.db_align_beg                  228 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  548 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       228 
_struct_ref_seq.pdbx_auth_seq_align_end       548 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4QQN MET A 1  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 209 1  
1 4QQN GLY A 2  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 210 2  
1 4QQN SER A 3  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 211 3  
1 4QQN SER A 4  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 212 4  
1 4QQN HIS A 5  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 213 5  
1 4QQN HIS A 6  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 214 6  
1 4QQN HIS A 7  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 215 7  
1 4QQN HIS A 8  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 216 8  
1 4QQN HIS A 9  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 217 9  
1 4QQN HIS A 10 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 218 10 
1 4QQN SER A 11 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 219 11 
1 4QQN SER A 12 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 220 12 
1 4QQN GLY A 13 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 221 13 
1 4QQN LEU A 14 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 222 14 
1 4QQN VAL A 15 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 223 15 
1 4QQN PRO A 16 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 224 16 
1 4QQN ARG A 17 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 225 17 
1 4QQN GLY A 18 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 226 18 
1 4QQN SER A 19 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 227 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3BQ non-polymer         . '1-{2-[1-(aminomethyl)cyclohexyl]ethyl}-3-isoquinolin-6-ylurea' ?                               
'C19 H26 N4 O'   326.436 
ALA 'L-peptide linking' y ALANINE                                                         ?                               
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                        ?                               
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                      ?                               
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                 ?                               
'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                  ?                               'Cl -1' 
35.453  
CYS 'L-peptide linking' y CYSTEINE                                                        ?                               
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                       ?                               
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                 ?                               
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                         ?                               
'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                                                        'GLYCERIN; PROPANE-1,2,3-TRIOL' 
'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                                                       ?                               
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                           ?                               'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                      ?                               
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                         ?                               
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                          ?                               
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                      ?                               
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                   ?                               
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                         ?                               
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                          ?                               
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                       ?                               
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                      ?                               
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                        ?                               
'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'                                           ?                               ? ? 
VAL 'L-peptide linking' y VALINE                                                          ?                               
'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4QQN 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'30% PEG 4000, 0.2 M MgCl2, 0.1 M Tris HCL pH8.5, vapor diffusion hanging drop, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2013-04-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97904 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength_list        0.97904 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     4QQN 
_reflns.d_resolution_high            2.080 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   27071 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_netI_over_sigmaI        25.4 
_reflns.pdbx_chi_squared             1.035 
_reflns.pdbx_redundancy              6.000 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        30.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.080 2.120  ? ? ? 0.704 ? ? 0.826 4.400 ? 1303 99.900  1  1 
2.120 2.150  ? ? ? 0.710 ? ? 0.817 5.200 ? 1324 100.000 2  1 
2.150 2.200  ? ? ? 0.535 ? ? 0.829 5.600 ? 1329 100.000 3  1 
2.200 2.240  ? ? ? 0.471 ? ? 0.822 6.200 ? 1305 100.000 4  1 
2.240 2.290  ? ? ? 0.444 ? ? 0.859 6.400 ? 1338 100.000 5  1 
2.290 2.340  ? ? ? 0.374 ? ? 0.856 6.400 ? 1330 100.000 6  1 
2.340 2.400  ? ? ? 0.321 ? ? 0.861 6.400 ? 1311 100.000 7  1 
2.400 2.470  ? ? ? 0.303 ? ? 0.840 6.400 ? 1339 100.000 8  1 
2.470 2.540  ? ? ? 0.251 ? ? 0.863 6.400 ? 1345 100.000 9  1 
2.540 2.620  ? ? ? 0.206 ? ? 0.895 6.400 ? 1339 100.000 10 1 
2.620 2.710  ? ? ? 0.172 ? ? 0.937 6.400 ? 1338 100.000 11 1 
2.710 2.820  ? ? ? 0.136 ? ? 0.939 6.300 ? 1336 100.000 12 1 
2.820 2.950  ? ? ? 0.115 ? ? 0.955 6.300 ? 1340 100.000 13 1 
2.950 3.110  ? ? ? 0.079 ? ? 0.965 6.300 ? 1349 100.000 14 1 
3.110 3.300  ? ? ? 0.061 ? ? 1.027 6.300 ? 1351 100.000 15 1 
3.300 3.560  ? ? ? 0.049 ? ? 1.131 6.200 ? 1374 100.000 16 1 
3.560 3.910  ? ? ? 0.045 ? ? 1.395 6.100 ? 1382 100.000 17 1 
3.910 4.480  ? ? ? 0.046 ? ? 2.081 6.000 ? 1379 100.000 18 1 
4.480 5.640  ? ? ? 0.038 ? ? 1.707 5.800 ? 1418 100.000 19 1 
5.640 50.000 ? ? ? 0.025 ? ? 0.984 5.500 ? 1541 99.500  20 1 
# 
_refine.entry_id                                 4QQN 
_refine.ls_d_res_high                            2.0800 
_refine.ls_d_res_low                             50.0000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.8900 
_refine.ls_number_reflns_obs                     26987 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1839 
_refine.ls_R_factor_R_work                       0.1830 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2116 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 3.2000 
_refine.ls_number_reflns_R_free                  858 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               33.6700 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0600 
_refine.aniso_B[2][2]                            0.0600 
_refine.aniso_B[3][3]                            -0.1200 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9590 
_refine.correlation_coeff_Fo_to_Fc_free          0.9490 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.1550 
_refine.pdbx_overall_ESU_R_Free                  0.1390 
_refine.overall_SU_ML                            0.0970 
_refine.overall_SU_B                             3.6140 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4HSG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                75.440 
_refine.B_iso_min                                21.800 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2328 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             156 
_refine_hist.number_atoms_total               2527 
_refine_hist.d_res_high                       2.0800 
_refine_hist.d_res_low                        50.0000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       2461 0.008  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         2369 0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    3343 1.231  1.954  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      5470 0.720  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 311  5.818  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 96   33.377 24.583 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 430  11.751 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 7    19.776 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         390  0.075  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   2778 0.004  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     535  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1213 1.674  3.223  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         1214 1.674  3.224  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1515 2.524  4.814  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.0780 
_refine_ls_shell.d_res_low                        2.1320 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.7900 
_refine_ls_shell.number_reflns_R_work             1878 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2460 
_refine_ls_shell.R_factor_R_free                  0.2490 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1942 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4QQN 
_struct.title                     'Protein arginine methyltransferase 3 in complex with compound MTV044246' 
_struct.pdbx_descriptor           'PRMT3 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4QQN 
_struct_keywords.text            'PRMT3, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE, Epigenetics' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 36  ? ASP A 45  ? TYR A 244 ASP A 253 1 ? 10 
HELX_P HELX_P2  2  ASP A 45  ? ASN A 59  ? ASP A 253 ASN A 267 1 ? 15 
HELX_P HELX_P3  3  PRO A 60  ? PHE A 63  ? PRO A 268 PHE A 271 5 ? 4  
HELX_P HELX_P4  4  GLY A 76  ? ALA A 85  ? GLY A 284 ALA A 293 1 ? 10 
HELX_P HELX_P5  5  GLU A 97  ? ASN A 109 ? GLU A 305 ASN A 317 1 ? 13 
HELX_P HELX_P6  6  MET A 149 ? TYR A 160 ? MET A 357 TYR A 368 1 ? 12 
HELX_P HELX_P7  7  ASP A 181 ? ILE A 189 ? ASP A 389 ILE A 397 1 ? 9  
HELX_P HELX_P8  8  ALA A 190 ? ASP A 194 ? ALA A 398 ASP A 402 5 ? 5  
HELX_P HELX_P9  9  MET A 200 ? CYS A 202 ? MET A 408 CYS A 410 5 ? 3  
HELX_P HELX_P10 10 MET A 203 ? ILE A 208 ? MET A 411 ILE A 416 1 ? 6  
HELX_P HELX_P11 11 ASP A 217 ? LEU A 221 ? ASP A 425 LEU A 429 5 ? 5  
HELX_P HELX_P12 12 SER A 237 ? GLU A 242 ? SER A 445 GLU A 450 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           168 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            376 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    169 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     377 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 115 ? LYS A 119 ? ILE A 323 LYS A 327 
A 2 LYS A 89  ? ASP A 94  ? LYS A 297 ASP A 302 
A 3 VAL A 67  ? VAL A 71  ? VAL A 275 VAL A 279 
A 4 VAL A 132 ? ILE A 136 ? VAL A 340 ILE A 344 
A 5 LEU A 161 ? TYR A 168 ? LEU A 369 TYR A 376 
B 1 VAL A 212 ? GLU A 214 ? VAL A 420 GLU A 422 
B 2 GLN A 291 ? VAL A 302 ? GLN A 499 VAL A 510 
B 3 SER A 255 ? PHE A 268 ? SER A 463 PHE A 476 
B 4 ILE A 171 ? VAL A 179 ? ILE A 379 VAL A 387 
B 5 CYS A 226 ? ASP A 232 ? CYS A 434 ASP A 440 
C 1 VAL A 212 ? GLU A 214 ? VAL A 420 GLU A 422 
C 2 GLN A 291 ? VAL A 302 ? GLN A 499 VAL A 510 
C 3 SER A 255 ? PHE A 268 ? SER A 463 PHE A 476 
C 4 VAL A 276 ? SER A 279 ? VAL A 484 SER A 487 
D 1 PHE A 243 ? LYS A 250 ? PHE A 451 LYS A 458 
D 2 ALA A 307 ? HIS A 315 ? ALA A 515 HIS A 523 
D 3 THR A 325 ? LEU A 330 ? THR A 533 LEU A 538 
D 4 SER A 333 ? GLY A 338 ? SER A 541 GLY A 546 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 116 ? O THR A 324 N VAL A 90  ? N VAL A 298 
A 2 3 O LEU A 91  ? O LEU A 299 N VAL A 68  ? N VAL A 276 
A 3 4 N LEU A 69  ? N LEU A 277 O VAL A 134 ? O VAL A 342 
A 4 5 N VAL A 132 ? N VAL A 340 O ALA A 162 ? O ALA A 370 
B 1 2 N VAL A 212 ? N VAL A 420 O VAL A 293 ? O VAL A 501 
B 2 3 O THR A 292 ? O THR A 500 N GLY A 262 ? N GLY A 470 
B 3 4 O ALA A 261 ? O ALA A 469 N VAL A 177 ? N VAL A 385 
B 4 5 N ILE A 174 ? N ILE A 382 O ILE A 228 ? O ILE A 436 
C 1 2 N VAL A 212 ? N VAL A 420 O VAL A 293 ? O VAL A 501 
C 2 3 O THR A 292 ? O THR A 500 N GLY A 262 ? N GLY A 470 
C 3 4 N PHE A 268 ? N PHE A 476 O VAL A 276 ? O VAL A 484 
D 1 2 N LEU A 249 ? N LEU A 457 O LEU A 308 ? O LEU A 516 
D 2 3 N THR A 313 ? N THR A 521 O THR A 327 ? O THR A 535 
D 3 4 N VAL A 326 ? N VAL A 534 O TYR A 337 ? O TYR A 545 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE 3BQ A 601' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 602' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 603'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 GLY A 37  ? GLY A 245 . ? 8_555 ? 
2  AC1 11 GLU A 40  ? GLU A 248 . ? 8_555 ? 
3  AC1 11 ASP A 181 ? ASP A 389 . ? 1_555 ? 
4  AC1 11 LYS A 184 ? LYS A 392 . ? 1_555 ? 
5  AC1 11 HIS A 185 ? HIS A 393 . ? 1_555 ? 
6  AC1 11 ARG A 188 ? ARG A 396 . ? 1_555 ? 
7  AC1 11 VAL A 212 ? VAL A 420 . ? 1_555 ? 
8  AC1 11 GLU A 214 ? GLU A 422 . ? 1_555 ? 
9  AC1 11 THR A 258 ? THR A 466 . ? 1_555 ? 
10 AC1 11 ALA A 259 ? ALA A 467 . ? 1_555 ? 
11 AC1 11 HOH Q .   ? HOH A 775 . ? 1_555 ? 
12 AC2 3  TYR A 57  ? TYR A 265 . ? 1_555 ? 
13 AC2 3  PRO A 60  ? PRO A 268 . ? 1_555 ? 
14 AC2 3  LYS A 84  ? LYS A 292 . ? 1_555 ? 
15 AC3 3  TYR A 263 ? TYR A 471 . ? 1_555 ? 
16 AC3 3  GLN A 283 ? GLN A 491 . ? 1_555 ? 
17 AC3 3  HOH Q .   ? HOH A 710 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4QQN 
_atom_sites.fract_transf_matrix[1][1]   0.014221 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014221 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005783 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TYR A 1 36  ? -0.035  14.607  49.912 1.00 54.18 ? 244 TYR A N   1 
ATOM   2    C  CA  . TYR A 1 36  ? 1.321   14.340  50.487 1.00 51.92 ? 244 TYR A CA  1 
ATOM   3    C  C   . TYR A 1 36  ? 1.967   13.111  49.848 1.00 51.07 ? 244 TYR A C   1 
ATOM   4    O  O   . TYR A 1 36  ? 3.194   13.077  49.642 1.00 42.54 ? 244 TYR A O   1 
ATOM   5    C  CB  . TYR A 1 36  ? 1.243   14.167  52.018 1.00 49.87 ? 244 TYR A CB  1 
ATOM   6    C  CG  A TYR A 1 36  ? 0.597   15.346  52.715 0.50 47.22 ? 244 TYR A CG  1 
ATOM   7    C  CD1 A TYR A 1 36  ? 1.151   16.621  52.620 0.50 44.21 ? 244 TYR A CD1 1 
ATOM   8    C  CD2 A TYR A 1 36  ? -0.576  15.193  53.453 0.50 45.29 ? 244 TYR A CD2 1 
ATOM   9    C  CE1 A TYR A 1 36  ? 0.564   17.706  53.244 0.50 43.23 ? 244 TYR A CE1 1 
ATOM   10   C  CE2 A TYR A 1 36  ? -1.167  16.274  54.079 0.50 43.82 ? 244 TYR A CE2 1 
ATOM   11   C  CZ  A TYR A 1 36  ? -0.590  17.525  53.969 0.50 43.53 ? 244 TYR A CZ  1 
ATOM   12   O  OH  A TYR A 1 36  ? -1.166  18.600  54.591 0.50 43.76 ? 244 TYR A OH  1 
ATOM   13   N  N   . GLY A 1 37  ? 1.128   12.113  49.545 1.00 46.56 ? 245 GLY A N   1 
ATOM   14   C  CA  . GLY A 1 37  ? 1.579   10.843  48.987 1.00 43.18 ? 245 GLY A CA  1 
ATOM   15   C  C   . GLY A 1 37  ? 2.339   11.031  47.696 1.00 38.65 ? 245 GLY A C   1 
ATOM   16   O  O   . GLY A 1 37  ? 3.463   10.567  47.569 1.00 36.57 ? 245 GLY A O   1 
ATOM   17   N  N   . ILE A 1 38  ? 1.716   11.714  46.741 1.00 39.07 ? 246 ILE A N   1 
ATOM   18   C  CA  . ILE A 1 38  ? 2.350   11.963  45.448 1.00 40.43 ? 246 ILE A CA  1 
ATOM   19   C  C   . ILE A 1 38  ? 3.668   12.752  45.613 1.00 36.50 ? 246 ILE A C   1 
ATOM   20   O  O   . ILE A 1 38  ? 4.638   12.474  44.915 1.00 38.41 ? 246 ILE A O   1 
ATOM   21   C  CB  . ILE A 1 38  ? 1.383   12.643  44.442 1.00 41.88 ? 246 ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1 38  ? 2.008   12.729  43.041 1.00 43.31 ? 246 ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1 38  ? 0.987   14.039  44.900 1.00 44.28 ? 246 ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1 38  ? 2.255   11.389  42.373 1.00 44.17 ? 246 ILE A CD1 1 
ATOM   25   N  N   . HIS A 1 39  ? 3.717   13.686  46.561 1.00 34.20 ? 247 HIS A N   1 
ATOM   26   C  CA  . HIS A 1 39  ? 4.937   14.477  46.792 1.00 32.78 ? 247 HIS A CA  1 
ATOM   27   C  C   . HIS A 1 39  ? 6.086   13.635  47.304 1.00 30.45 ? 247 HIS A C   1 
ATOM   28   O  O   . HIS A 1 39  ? 7.190   13.750  46.811 1.00 29.00 ? 247 HIS A O   1 
ATOM   29   C  CB  . HIS A 1 39  ? 4.657   15.646  47.718 1.00 33.90 ? 247 HIS A CB  1 
ATOM   30   C  CG  . HIS A 1 39  ? 3.759   16.656  47.096 1.00 34.28 ? 247 HIS A CG  1 
ATOM   31   N  ND1 . HIS A 1 39  ? 4.165   17.455  46.048 1.00 36.31 ? 247 HIS A ND1 1 
ATOM   32   C  CD2 . HIS A 1 39  ? 2.457   16.943  47.313 1.00 33.24 ? 247 HIS A CD2 1 
ATOM   33   C  CE1 . HIS A 1 39  ? 3.154   18.215  45.667 1.00 34.19 ? 247 HIS A CE1 1 
ATOM   34   N  NE2 . HIS A 1 39  ? 2.109   17.926  46.423 1.00 33.56 ? 247 HIS A NE2 1 
ATOM   35   N  N   . GLU A 1 40  ? 5.813   12.756  48.253 1.00 28.34 ? 248 GLU A N   1 
ATOM   36   C  CA  . GLU A 1 40  ? 6.820   11.843  48.746 1.00 28.66 ? 248 GLU A CA  1 
ATOM   37   C  C   . GLU A 1 40  ? 7.328   10.921  47.632 1.00 28.21 ? 248 GLU A C   1 
ATOM   38   O  O   . GLU A 1 40  ? 8.510   10.660  47.529 1.00 27.20 ? 248 GLU A O   1 
ATOM   39   C  CB  . GLU A 1 40  ? 6.238   11.003  49.880 1.00 29.17 ? 248 GLU A CB  1 
ATOM   40   C  CG  . GLU A 1 40  ? 7.213   9.998   50.476 1.00 29.65 ? 248 GLU A CG  1 
ATOM   41   C  CD  . GLU A 1 40  ? 6.626   9.239   51.670 1.00 31.49 ? 248 GLU A CD  1 
ATOM   42   O  OE1 . GLU A 1 40  ? 7.156   8.158   52.007 1.00 30.64 ? 248 GLU A OE1 1 
ATOM   43   O  OE2 . GLU A 1 40  ? 5.630   9.719   52.257 1.00 30.25 ? 248 GLU A OE2 1 
ATOM   44   N  N   . GLU A 1 41  ? 6.401   10.440  46.818 1.00 30.00 ? 249 GLU A N   1 
ATOM   45   C  CA  . GLU A 1 41  ? 6.690   9.529   45.735 1.00 32.05 ? 249 GLU A CA  1 
ATOM   46   C  C   . GLU A 1 41  ? 7.564   10.212  44.689 1.00 28.74 ? 249 GLU A C   1 
ATOM   47   O  O   . GLU A 1 41  ? 8.566   9.657   44.260 1.00 27.48 ? 249 GLU A O   1 
ATOM   48   C  CB  . GLU A 1 41  ? 5.368   9.074   45.113 1.00 36.51 ? 249 GLU A CB  1 
ATOM   49   C  CG  . GLU A 1 41  ? 5.494   8.035   44.021 1.00 43.59 ? 249 GLU A CG  1 
ATOM   50   C  CD  . GLU A 1 41  ? 4.137   7.546   43.513 1.00 50.02 ? 249 GLU A CD  1 
ATOM   51   O  OE1 . GLU A 1 41  ? 3.128   7.628   44.256 1.00 51.71 ? 249 GLU A OE1 1 
ATOM   52   O  OE2 . GLU A 1 41  ? 4.085   7.070   42.361 1.00 53.75 ? 249 GLU A OE2 1 
ATOM   53   N  N   . MET A 1 42  ? 7.191   11.427  44.313 1.00 28.13 ? 250 MET A N   1 
ATOM   54   C  CA  . MET A 1 42  ? 7.992   12.226  43.398 1.00 29.88 ? 250 MET A CA  1 
ATOM   55   C  C   . MET A 1 42  ? 9.382   12.489  43.950 1.00 30.11 ? 250 MET A C   1 
ATOM   56   O  O   . MET A 1 42  ? 10.347  12.375  43.207 1.00 26.43 ? 250 MET A O   1 
ATOM   57   C  CB  . MET A 1 42  ? 7.285   13.527  43.042 1.00 32.98 ? 250 MET A CB  1 
ATOM   58   C  CG  . MET A 1 42  ? 6.086   13.310  42.119 1.00 35.74 ? 250 MET A CG  1 
ATOM   59   S  SD  . MET A 1 42  ? 5.461   14.838  41.382 1.00 43.24 ? 250 MET A SD  1 
ATOM   60   C  CE  . MET A 1 42  ? 4.885   15.726  42.835 1.00 41.49 ? 250 MET A CE  1 
ATOM   61   N  N   . LEU A 1 43  ? 9.493   12.773  45.255 1.00 28.39 ? 251 LEU A N   1 
ATOM   62   C  CA  . LEU A 1 43  ? 10.804  13.008  45.857 1.00 28.96 ? 251 LEU A CA  1 
ATOM   63   C  C   . LEU A 1 43  ? 11.669  11.766  45.856 1.00 27.36 ? 251 LEU A C   1 
ATOM   64   O  O   . LEU A 1 43  ? 12.865  11.864  45.678 1.00 28.78 ? 251 LEU A O   1 
ATOM   65   C  CB  . LEU A 1 43  ? 10.694  13.541  47.300 1.00 29.52 ? 251 LEU A CB  1 
ATOM   66   C  CG  . LEU A 1 43  ? 10.228  14.986  47.432 1.00 30.28 ? 251 LEU A CG  1 
ATOM   67   C  CD1 . LEU A 1 43  ? 9.911   15.297  48.881 1.00 32.41 ? 251 LEU A CD1 1 
ATOM   68   C  CD2 . LEU A 1 43  ? 11.278  15.957  46.897 1.00 31.84 ? 251 LEU A CD2 1 
ATOM   69   N  N   . LYS A 1 44  ? 11.072  10.599  46.049 1.00 26.50 ? 252 LYS A N   1 
ATOM   70   C  CA  . LYS A 1 44  ? 11.828  9.353   46.080 1.00 27.00 ? 252 LYS A CA  1 
ATOM   71   C  C   . LYS A 1 44  ? 12.118  8.808   44.680 1.00 25.89 ? 252 LYS A C   1 
ATOM   72   O  O   . LYS A 1 44  ? 12.845  7.843   44.543 1.00 26.96 ? 252 LYS A O   1 
ATOM   73   C  CB  . LYS A 1 44  ? 11.094  8.302   46.911 1.00 30.79 ? 252 LYS A CB  1 
ATOM   74   C  CG  . LYS A 1 44  ? 11.078  8.597   48.410 1.00 31.47 ? 252 LYS A CG  1 
ATOM   75   C  CD  . LYS A 1 44  ? 10.210  7.578   49.160 1.00 33.61 ? 252 LYS A CD  1 
ATOM   76   C  CE  . LYS A 1 44  ? 10.439  7.650   50.682 1.00 36.42 ? 252 LYS A CE  1 
ATOM   77   N  NZ  . LYS A 1 44  ? 9.493   6.802   51.482 1.00 35.63 ? 252 LYS A NZ  1 
ATOM   78   N  N   . ASP A 1 45  ? 11.561  9.428   43.643 1.00 26.03 ? 253 ASP A N   1 
ATOM   79   C  CA  . ASP A 1 45  ? 11.937  9.127   42.248 1.00 25.17 ? 253 ASP A CA  1 
ATOM   80   C  C   . ASP A 1 45  ? 13.299  9.786   41.985 1.00 25.02 ? 253 ASP A C   1 
ATOM   81   O  O   . ASP A 1 45  ? 13.374  10.978  41.673 1.00 22.49 ? 253 ASP A O   1 
ATOM   82   C  CB  . ASP A 1 45  ? 10.839  9.675   41.329 1.00 26.49 ? 253 ASP A CB  1 
ATOM   83   C  CG  . ASP A 1 45  ? 11.073  9.379   39.861 1.00 26.17 ? 253 ASP A CG  1 
ATOM   84   O  OD1 . ASP A 1 45  ? 12.191  9.039   39.479 1.00 25.71 ? 253 ASP A OD1 1 
ATOM   85   O  OD2 . ASP A 1 45  ? 10.113  9.529   39.081 1.00 28.79 ? 253 ASP A OD2 1 
ATOM   86   N  N   . LYS A 1 46  ? 14.372  9.000   42.120 1.00 26.37 ? 254 LYS A N   1 
ATOM   87   C  CA  . LYS A 1 46  ? 15.740  9.506   42.022 1.00 29.28 ? 254 LYS A CA  1 
ATOM   88   C  C   . LYS A 1 46  ? 16.085  10.007  40.631 1.00 27.62 ? 254 LYS A C   1 
ATOM   89   O  O   . LYS A 1 46  ? 16.782  10.994  40.489 1.00 25.24 ? 254 LYS A O   1 
ATOM   90   C  CB  . LYS A 1 46  ? 16.766  8.425   42.392 1.00 32.94 ? 254 LYS A CB  1 
ATOM   91   C  CG  . LYS A 1 46  ? 16.901  8.158   43.881 1.00 38.19 ? 254 LYS A CG  1 
ATOM   92   C  CD  . LYS A 1 46  ? 18.041  7.173   44.113 1.00 44.18 ? 254 LYS A CD  1 
ATOM   93   C  CE  . LYS A 1 46  ? 18.164  6.769   45.566 1.00 48.70 ? 254 LYS A CE  1 
ATOM   94   N  NZ  . LYS A 1 46  ? 17.020  5.902   45.957 1.00 51.91 ? 254 LYS A NZ  1 
ATOM   95   N  N   . ILE A 1 47  ? 15.602  9.322   39.610 1.00 27.51 ? 255 ILE A N   1 
ATOM   96   C  CA  . ILE A 1 47  ? 15.838  9.754   38.222 1.00 27.02 ? 255 ILE A CA  1 
ATOM   97   C  C   . ILE A 1 47  ? 15.249  11.148  38.008 1.00 26.38 ? 255 ILE A C   1 
ATOM   98   O  O   . ILE A 1 47  ? 15.928  12.062  37.562 1.00 27.08 ? 255 ILE A O   1 
ATOM   99   C  CB  . ILE A 1 47  ? 15.220  8.763   37.215 1.00 28.26 ? 255 ILE A CB  1 
ATOM   100  C  CG1 . ILE A 1 47  ? 15.884  7.376   37.332 1.00 29.43 ? 255 ILE A CG1 1 
ATOM   101  C  CG2 . ILE A 1 47  ? 15.364  9.285   35.784 1.00 28.38 ? 255 ILE A CG2 1 
ATOM   102  C  CD1 . ILE A 1 47  ? 17.326  7.309   36.858 1.00 31.31 ? 255 ILE A CD1 1 
ATOM   103  N  N   . ARG A 1 48  ? 13.992  11.323  38.387 1.00 24.92 ? 256 ARG A N   1 
ATOM   104  C  CA  . ARG A 1 48  ? 13.363  12.617  38.308 1.00 24.79 ? 256 ARG A CA  1 
ATOM   105  C  C   . ARG A 1 48  ? 14.147  13.671  39.091 1.00 26.17 ? 256 ARG A C   1 
ATOM   106  O  O   . ARG A 1 48  ? 14.568  14.684  38.542 1.00 24.60 ? 256 ARG A O   1 
ATOM   107  C  CB  . ARG A 1 48  ? 11.961  12.525  38.867 1.00 25.24 ? 256 ARG A CB  1 
ATOM   108  C  CG  . ARG A 1 48  ? 11.211  13.850  38.963 1.00 26.77 ? 256 ARG A CG  1 
ATOM   109  C  CD  . ARG A 1 48  ? 10.296  13.762  40.150 1.00 28.46 ? 256 ARG A CD  1 
ATOM   110  N  NE  . ARG A 1 48  ? 9.441   14.914  40.286 1.00 29.91 ? 256 ARG A NE  1 
ATOM   111  C  CZ  . ARG A 1 48  ? 9.507   15.817  41.253 1.00 29.73 ? 256 ARG A CZ  1 
ATOM   112  N  NH1 . ARG A 1 48  ? 8.632   16.810  41.246 1.00 30.71 ? 256 ARG A NH1 1 
ATOM   113  N  NH2 . ARG A 1 48  ? 10.420  15.740  42.221 1.00 31.69 ? 256 ARG A NH2 1 
ATOM   114  N  N   . THR A 1 49  ? 14.324  13.434  40.386 1.00 25.01 ? 257 THR A N   1 
ATOM   115  C  CA  . THR A 1 49  ? 14.752  14.504  41.264 1.00 25.18 ? 257 THR A CA  1 
ATOM   116  C  C   . THR A 1 49  ? 16.244  14.799  41.127 1.00 25.26 ? 257 THR A C   1 
ATOM   117  O  O   . THR A 1 49  ? 16.645  15.953  41.188 1.00 26.03 ? 257 THR A O   1 
ATOM   118  C  CB  . THR A 1 49  ? 14.349  14.229  42.739 1.00 25.76 ? 257 THR A CB  1 
ATOM   119  O  OG1 . THR A 1 49  ? 12.935  13.955  42.829 1.00 25.15 ? 257 THR A OG1 1 
ATOM   120  C  CG2 . THR A 1 49  ? 14.655  15.435  43.597 1.00 26.15 ? 257 THR A CG2 1 
ATOM   121  N  N   . GLU A 1 50  ? 17.063  13.764  40.951 1.00 26.58 ? 258 GLU A N   1 
ATOM   122  C  CA  . GLU A 1 50  ? 18.499  13.965  40.720 1.00 28.13 ? 258 GLU A CA  1 
ATOM   123  C  C   . GLU A 1 50  ? 18.789  14.626  39.369 1.00 26.68 ? 258 GLU A C   1 
ATOM   124  O  O   . GLU A 1 50  ? 19.756  15.385  39.253 1.00 24.90 ? 258 GLU A O   1 
ATOM   125  C  CB  . GLU A 1 50  ? 19.273  12.645  40.877 1.00 29.78 ? 258 GLU A CB  1 
ATOM   126  C  CG  . GLU A 1 50  ? 19.197  12.139  42.308 1.00 32.01 ? 258 GLU A CG  1 
ATOM   127  C  CD  . GLU A 1 50  ? 19.911  10.830  42.564 1.00 37.40 ? 258 GLU A CD  1 
ATOM   128  O  OE1 . GLU A 1 50  ? 19.994  10.451  43.753 1.00 46.07 ? 258 GLU A OE1 1 
ATOM   129  O  OE2 . GLU A 1 50  ? 20.368  10.172  41.613 1.00 39.84 ? 258 GLU A OE2 1 
ATOM   130  N  N   . SER A 1 51  ? 17.948  14.362  38.364 1.00 25.96 ? 259 SER A N   1 
ATOM   131  C  CA  . SER A 1 51  ? 18.077  15.030  37.064 1.00 25.42 ? 259 SER A CA  1 
ATOM   132  C  C   . SER A 1 51  ? 17.907  16.534  37.211 1.00 25.59 ? 259 SER A C   1 
ATOM   133  O  O   . SER A 1 51  ? 18.704  17.311  36.678 1.00 24.22 ? 259 SER A O   1 
ATOM   134  C  CB  . SER A 1 51  ? 17.071  14.484  36.040 1.00 25.34 ? 259 SER A CB  1 
ATOM   135  O  OG  . SER A 1 51  ? 17.415  13.153  35.686 1.00 24.58 ? 259 SER A OG  1 
ATOM   136  N  N   . TYR A 1 52  ? 16.890  16.955  37.959 1.00 25.29 ? 260 TYR A N   1 
ATOM   137  C  CA  . TYR A 1 52  ? 16.678  18.381  38.160 1.00 24.90 ? 260 TYR A CA  1 
ATOM   138  C  C   . TYR A 1 52  ? 17.819  18.956  38.995 1.00 26.35 ? 260 TYR A C   1 
ATOM   139  O  O   . TYR A 1 52  ? 18.361  20.012  38.672 1.00 25.20 ? 260 TYR A O   1 
ATOM   140  C  CB  . TYR A 1 52  ? 15.341  18.662  38.837 1.00 25.85 ? 260 TYR A CB  1 
ATOM   141  C  CG  . TYR A 1 52  ? 14.170  18.768  37.892 1.00 25.01 ? 260 TYR A CG  1 
ATOM   142  C  CD1 . TYR A 1 52  ? 13.509  17.627  37.447 1.00 24.95 ? 260 TYR A CD1 1 
ATOM   143  C  CD2 . TYR A 1 52  ? 13.729  20.006  37.435 1.00 25.08 ? 260 TYR A CD2 1 
ATOM   144  C  CE1 . TYR A 1 52  ? 12.431  17.716  36.588 1.00 25.47 ? 260 TYR A CE1 1 
ATOM   145  C  CE2 . TYR A 1 52  ? 12.641  20.111  36.578 1.00 24.65 ? 260 TYR A CE2 1 
ATOM   146  C  CZ  . TYR A 1 52  ? 11.993  18.965  36.154 1.00 24.79 ? 260 TYR A CZ  1 
ATOM   147  O  OH  . TYR A 1 52  ? 10.924  19.060  35.292 1.00 24.53 ? 260 TYR A OH  1 
ATOM   148  N  N   . ARG A 1 53  ? 18.184  18.241  40.054 1.00 25.96 ? 261 ARG A N   1 
ATOM   149  C  CA  . ARG A 1 53  ? 19.281  18.664  40.913 1.00 27.41 ? 261 ARG A CA  1 
ATOM   150  C  C   . ARG A 1 53  ? 20.572  18.832  40.131 1.00 26.04 ? 261 ARG A C   1 
ATOM   151  O  O   . ARG A 1 53  ? 21.246  19.851  40.247 1.00 24.86 ? 261 ARG A O   1 
ATOM   152  C  CB  . ARG A 1 53  ? 19.528  17.661  42.044 1.00 27.45 ? 261 ARG A CB  1 
ATOM   153  C  CG  . ARG A 1 53  ? 20.526  18.215  43.048 1.00 28.96 ? 261 ARG A CG  1 
ATOM   154  C  CD  . ARG A 1 53  ? 21.351  17.151  43.723 1.00 32.36 ? 261 ARG A CD  1 
ATOM   155  N  NE  . ARG A 1 53  ? 21.807  16.114  42.799 1.00 33.30 ? 261 ARG A NE  1 
ATOM   156  C  CZ  . ARG A 1 53  ? 22.161  14.899  43.196 1.00 33.50 ? 261 ARG A CZ  1 
ATOM   157  N  NH1 . ARG A 1 53  ? 22.155  14.605  44.480 1.00 32.46 ? 261 ARG A NH1 1 
ATOM   158  N  NH2 . ARG A 1 53  ? 22.527  13.983  42.313 1.00 33.87 ? 261 ARG A NH2 1 
ATOM   159  N  N   . ASP A 1 54  ? 20.920  17.814  39.350 1.00 26.84 ? 262 ASP A N   1 
ATOM   160  C  CA  . ASP A 1 54  ? 22.133  17.865  38.527 1.00 26.48 ? 262 ASP A CA  1 
ATOM   161  C  C   . ASP A 1 54  ? 22.108  19.000  37.537 1.00 26.04 ? 262 ASP A C   1 
ATOM   162  O  O   . ASP A 1 54  ? 23.097  19.707  37.405 1.00 25.13 ? 262 ASP A O   1 
ATOM   163  C  CB  . ASP A 1 54  ? 22.388  16.552  37.814 1.00 27.79 ? 262 ASP A CB  1 
ATOM   164  C  CG  . ASP A 1 54  ? 22.760  15.438  38.778 1.00 28.50 ? 262 ASP A CG  1 
ATOM   165  O  OD1 . ASP A 1 54  ? 22.989  15.687  39.984 1.00 28.98 ? 262 ASP A OD1 1 
ATOM   166  O  OD2 . ASP A 1 54  ? 22.802  14.317  38.320 1.00 30.60 ? 262 ASP A OD2 1 
ATOM   167  N  N   . PHE A 1 55  ? 20.987  19.204  36.856 1.00 25.13 ? 263 PHE A N   1 
ATOM   168  C  CA  . PHE A 1 55  ? 20.888  20.327  35.929 1.00 24.50 ? 263 PHE A CA  1 
ATOM   169  C  C   . PHE A 1 55  ? 21.204  21.644  36.651 1.00 25.45 ? 263 PHE A C   1 
ATOM   170  O  O   . PHE A 1 55  ? 21.999  22.449  36.177 1.00 25.40 ? 263 PHE A O   1 
ATOM   171  C  CB  . PHE A 1 55  ? 19.498  20.394  35.294 1.00 24.59 ? 263 PHE A CB  1 
ATOM   172  C  CG  . PHE A 1 55  ? 19.125  21.763  34.793 1.00 25.39 ? 263 PHE A CG  1 
ATOM   173  C  CD1 . PHE A 1 55  ? 19.853  22.374  33.772 1.00 25.39 ? 263 PHE A CD1 1 
ATOM   174  C  CD2 . PHE A 1 55  ? 18.058  22.455  35.354 1.00 25.33 ? 263 PHE A CD2 1 
ATOM   175  C  CE1 . PHE A 1 55  ? 19.522  23.635  33.319 1.00 24.21 ? 263 PHE A CE1 1 
ATOM   176  C  CE2 . PHE A 1 55  ? 17.714  23.715  34.894 1.00 25.47 ? 263 PHE A CE2 1 
ATOM   177  C  CZ  . PHE A 1 55  ? 18.453  24.311  33.874 1.00 24.72 ? 263 PHE A CZ  1 
ATOM   178  N  N   . ILE A 1 56  ? 20.570  21.861  37.798 1.00 25.02 ? 264 ILE A N   1 
ATOM   179  C  CA  . ILE A 1 56  ? 20.675  23.131  38.487 1.00 24.31 ? 264 ILE A CA  1 
ATOM   180  C  C   . ILE A 1 56  ? 22.090  23.294  39.066 1.00 25.71 ? 264 ILE A C   1 
ATOM   181  O  O   . ILE A 1 56  ? 22.749  24.308  38.803 1.00 27.76 ? 264 ILE A O   1 
ATOM   182  C  CB  . ILE A 1 56  ? 19.575  23.282  39.550 1.00 24.79 ? 264 ILE A CB  1 
ATOM   183  C  CG1 . ILE A 1 56  ? 18.190  23.297  38.887 1.00 24.70 ? 264 ILE A CG1 1 
ATOM   184  C  CG2 . ILE A 1 56  ? 19.755  24.549  40.363 1.00 26.08 ? 264 ILE A CG2 1 
ATOM   185  C  CD1 . ILE A 1 56  ? 17.031  23.228  39.858 1.00 25.72 ? 264 ILE A CD1 1 
ATOM   186  N  N   . TYR A 1 57  ? 22.562  22.291  39.795 1.00 25.80 ? 265 TYR A N   1 
ATOM   187  C  CA  . TYR A 1 57  ? 23.861  22.361  40.458 1.00 27.03 ? 265 TYR A CA  1 
ATOM   188  C  C   . TYR A 1 57  ? 25.054  22.338  39.489 1.00 29.49 ? 265 TYR A C   1 
ATOM   189  O  O   . TYR A 1 57  ? 26.102  22.892  39.813 1.00 27.75 ? 265 TYR A O   1 
ATOM   190  C  CB  . TYR A 1 57  ? 24.013  21.219  41.462 1.00 27.49 ? 265 TYR A CB  1 
ATOM   191  C  CG  . TYR A 1 57  ? 23.230  21.386  42.755 1.00 27.24 ? 265 TYR A CG  1 
ATOM   192  C  CD1 . TYR A 1 57  ? 22.268  22.388  42.908 1.00 26.60 ? 265 TYR A CD1 1 
ATOM   193  C  CD2 . TYR A 1 57  ? 23.448  20.518  43.833 1.00 28.34 ? 265 TYR A CD2 1 
ATOM   194  C  CE1 . TYR A 1 57  ? 21.574  22.541  44.094 1.00 26.40 ? 265 TYR A CE1 1 
ATOM   195  C  CE2 . TYR A 1 57  ? 22.739  20.660  45.025 1.00 27.36 ? 265 TYR A CE2 1 
ATOM   196  C  CZ  . TYR A 1 57  ? 21.806  21.670  45.144 1.00 26.59 ? 265 TYR A CZ  1 
ATOM   197  O  OH  . TYR A 1 57  ? 21.103  21.820  46.320 1.00 29.31 ? 265 TYR A OH  1 
ATOM   198  N  N   . GLN A 1 58  ? 24.918  21.698  38.326 1.00 28.35 ? 266 GLN A N   1 
ATOM   199  C  CA  . GLN A 1 58  ? 26.040  21.614  37.399 1.00 29.58 ? 266 GLN A CA  1 
ATOM   200  C  C   . GLN A 1 58  ? 25.994  22.716  36.341 1.00 28.55 ? 266 GLN A C   1 
ATOM   201  O  O   . GLN A 1 58  ? 26.868  22.773  35.477 1.00 28.54 ? 266 GLN A O   1 
ATOM   202  C  CB  . GLN A 1 58  ? 26.088  20.242  36.732 1.00 30.71 ? 266 GLN A CB  1 
ATOM   203  C  CG  . GLN A 1 58  ? 26.420  19.108  37.696 1.00 33.96 ? 266 GLN A CG  1 
ATOM   204  C  CD  . GLN A 1 58  ? 26.263  17.738  37.049 1.00 39.52 ? 266 GLN A CD  1 
ATOM   205  O  OE1 . GLN A 1 58  ? 26.127  17.618  35.829 1.00 42.99 ? 266 GLN A OE1 1 
ATOM   206  N  NE2 . GLN A 1 58  ? 26.272  16.690  37.872 1.00 43.10 ? 266 GLN A NE2 1 
ATOM   207  N  N   . ASN A 1 59  ? 24.969  23.564  36.386 1.00 26.06 ? 267 ASN A N   1 
ATOM   208  C  CA  . ASN A 1 59  ? 24.892  24.738  35.514 1.00 26.49 ? 267 ASN A CA  1 
ATOM   209  C  C   . ASN A 1 59  ? 24.496  25.973  36.316 1.00 25.90 ? 267 ASN A C   1 
ATOM   210  O  O   . ASN A 1 59  ? 23.495  26.652  35.991 1.00 24.93 ? 267 ASN A O   1 
ATOM   211  C  CB  . ASN A 1 59  ? 23.887  24.489  34.380 1.00 25.62 ? 267 ASN A CB  1 
ATOM   212  C  CG  . ASN A 1 59  ? 24.278  23.308  33.503 1.00 26.40 ? 267 ASN A CG  1 
ATOM   213  O  OD1 . ASN A 1 59  ? 25.124  23.436  32.618 1.00 24.32 ? 267 ASN A OD1 1 
ATOM   214  N  ND2 . ASN A 1 59  ? 23.656  22.153  33.738 1.00 26.01 ? 267 ASN A ND2 1 
ATOM   215  N  N   . PRO A 1 60  ? 25.282  26.290  37.363 1.00 27.48 ? 268 PRO A N   1 
ATOM   216  C  CA  . PRO A 1 60  ? 24.932  27.398  38.262 1.00 29.44 ? 268 PRO A CA  1 
ATOM   217  C  C   . PRO A 1 60  ? 24.926  28.778  37.582 1.00 28.81 ? 268 PRO A C   1 
ATOM   218  O  O   . PRO A 1 60  ? 24.251  29.692  38.047 1.00 28.48 ? 268 PRO A O   1 
ATOM   219  C  CB  . PRO A 1 60  ? 26.012  27.321  39.355 1.00 30.43 ? 268 PRO A CB  1 
ATOM   220  C  CG  . PRO A 1 60  ? 27.195  26.708  38.648 1.00 31.80 ? 268 PRO A CG  1 
ATOM   221  C  CD  . PRO A 1 60  ? 26.598  25.710  37.688 1.00 29.66 ? 268 PRO A CD  1 
ATOM   222  N  N   . HIS A 1 61  ? 25.651  28.920  36.477 1.00 28.97 ? 269 HIS A N   1 
ATOM   223  C  CA  . HIS A 1 61  ? 25.594  30.143  35.672 1.00 29.26 ? 269 HIS A CA  1 
ATOM   224  C  C   . HIS A 1 61  ? 24.171  30.514  35.221 1.00 29.44 ? 269 HIS A C   1 
ATOM   225  O  O   . HIS A 1 61  ? 23.877  31.672  35.043 1.00 28.96 ? 269 HIS A O   1 
ATOM   226  C  CB  . HIS A 1 61  ? 26.520  30.034  34.448 1.00 31.37 ? 269 HIS A CB  1 
ATOM   227  C  CG  . HIS A 1 61  ? 26.152  28.929  33.508 1.00 29.19 ? 269 HIS A CG  1 
ATOM   228  N  ND1 . HIS A 1 61  ? 26.402  27.603  33.783 1.00 29.40 ? 269 HIS A ND1 1 
ATOM   229  C  CD2 . HIS A 1 61  ? 25.527  28.952  32.307 1.00 29.93 ? 269 HIS A CD2 1 
ATOM   230  C  CE1 . HIS A 1 61  ? 25.968  26.855  32.788 1.00 29.00 ? 269 HIS A CE1 1 
ATOM   231  N  NE2 . HIS A 1 61  ? 25.426  27.651  31.878 1.00 30.58 ? 269 HIS A NE2 1 
ATOM   232  N  N   . ILE A 1 62  ? 23.284  29.533  35.065 1.00 28.67 ? 270 ILE A N   1 
ATOM   233  C  CA  . ILE A 1 62  ? 21.914  29.791  34.635 1.00 27.93 ? 270 ILE A CA  1 
ATOM   234  C  C   . ILE A 1 62  ? 21.101  30.465  35.756 1.00 27.63 ? 270 ILE A C   1 
ATOM   235  O  O   . ILE A 1 62  ? 20.112  31.167  35.499 1.00 28.17 ? 270 ILE A O   1 
ATOM   236  C  CB  . ILE A 1 62  ? 21.237  28.465  34.169 1.00 29.04 ? 270 ILE A CB  1 
ATOM   237  C  CG1 . ILE A 1 62  ? 21.906  27.971  32.878 1.00 29.68 ? 270 ILE A CG1 1 
ATOM   238  C  CG2 . ILE A 1 62  ? 19.748  28.651  33.955 1.00 28.65 ? 270 ILE A CG2 1 
ATOM   239  C  CD1 . ILE A 1 62  ? 21.453  26.605  32.416 1.00 30.27 ? 270 ILE A CD1 1 
ATOM   240  N  N   . PHE A 1 63  ? 21.526  30.248  36.992 1.00 27.22 ? 271 PHE A N   1 
ATOM   241  C  CA  . PHE A 1 63  ? 20.779  30.687  38.159 1.00 27.78 ? 271 PHE A CA  1 
ATOM   242  C  C   . PHE A 1 63  ? 21.449  31.825  38.937 1.00 29.48 ? 271 PHE A C   1 
ATOM   243  O  O   . PHE A 1 63  ? 20.754  32.576  39.615 1.00 30.18 ? 271 PHE A O   1 
ATOM   244  C  CB  . PHE A 1 63  ? 20.529  29.471  39.061 1.00 26.12 ? 271 PHE A CB  1 
ATOM   245  C  CG  . PHE A 1 63  ? 19.691  28.423  38.389 1.00 26.16 ? 271 PHE A CG  1 
ATOM   246  C  CD1 . PHE A 1 63  ? 20.277  27.452  37.583 1.00 25.77 ? 271 PHE A CD1 1 
ATOM   247  C  CD2 . PHE A 1 63  ? 18.312  28.469  38.483 1.00 25.83 ? 271 PHE A CD2 1 
ATOM   248  C  CE1 . PHE A 1 63  ? 19.494  26.509  36.923 1.00 26.61 ? 271 PHE A CE1 1 
ATOM   249  C  CE2 . PHE A 1 63  ? 17.525  27.540  37.822 1.00 26.58 ? 271 PHE A CE2 1 
ATOM   250  C  CZ  . PHE A 1 63  ? 18.124  26.558  37.038 1.00 26.55 ? 271 PHE A CZ  1 
ATOM   251  N  N   . LYS A 1 64  ? 22.768  31.969  38.838 1.00 30.94 ? 272 LYS A N   1 
ATOM   252  C  CA  . LYS A 1 64  ? 23.483  32.934  39.701 1.00 35.79 ? 272 LYS A CA  1 
ATOM   253  C  C   . LYS A 1 64  ? 22.936  34.345  39.504 1.00 32.62 ? 272 LYS A C   1 
ATOM   254  O  O   . LYS A 1 64  ? 22.916  34.856  38.400 1.00 31.77 ? 272 LYS A O   1 
ATOM   255  C  CB  . LYS A 1 64  ? 25.007  32.886  39.482 1.00 38.25 ? 272 LYS A CB  1 
ATOM   256  C  CG  . LYS A 1 64  ? 25.846  33.781  40.416 1.00 41.33 ? 272 LYS A CG  1 
ATOM   257  C  CD  . LYS A 1 64  ? 25.683  33.451  41.906 1.00 44.67 ? 272 LYS A CD  1 
ATOM   258  C  CE  . LYS A 1 64  ? 26.528  34.352  42.814 1.00 46.77 ? 272 LYS A CE  1 
ATOM   259  N  N   . ASP A 1 65  ? 22.449  34.934  40.593 1.00 33.15 ? 273 ASP A N   1 
ATOM   260  C  CA  . ASP A 1 65  ? 21.862  36.283  40.604 1.00 34.11 ? 273 ASP A CA  1 
ATOM   261  C  C   . ASP A 1 65  ? 20.616  36.447  39.746 1.00 34.38 ? 273 ASP A C   1 
ATOM   262  O  O   . ASP A 1 65  ? 20.250  37.566  39.415 1.00 34.43 ? 273 ASP A O   1 
ATOM   263  C  CB  . ASP A 1 65  ? 22.921  37.346  40.222 1.00 37.10 ? 273 ASP A CB  1 
ATOM   264  C  CG  . ASP A 1 65  ? 24.133  37.319  41.156 1.00 39.16 ? 273 ASP A CG  1 
ATOM   265  O  OD1 . ASP A 1 65  ? 23.951  37.039  42.360 1.00 42.32 ? 273 ASP A OD1 1 
ATOM   266  O  OD2 . ASP A 1 65  ? 25.272  37.556  40.696 1.00 45.89 ? 273 ASP A OD2 1 
ATOM   267  N  N   . LYS A 1 66  ? 19.932  35.350  39.417 1.00 33.42 ? 274 LYS A N   1 
ATOM   268  C  CA  . LYS A 1 66  ? 18.733  35.439  38.594 1.00 32.38 ? 274 LYS A CA  1 
ATOM   269  C  C   . LYS A 1 66  ? 17.451  35.433  39.412 1.00 32.43 ? 274 LYS A C   1 
ATOM   270  O  O   . LYS A 1 66  ? 17.419  34.985  40.555 1.00 33.42 ? 274 LYS A O   1 
ATOM   271  C  CB  . LYS A 1 66  ? 18.686  34.288  37.589 1.00 33.29 ? 274 LYS A CB  1 
ATOM   272  C  CG  . LYS A 1 66  ? 19.867  34.221  36.650 1.00 34.31 ? 274 LYS A CG  1 
ATOM   273  C  CD  . LYS A 1 66  ? 20.052  35.486  35.840 1.00 35.61 ? 274 LYS A CD  1 
ATOM   274  C  CE  . LYS A 1 66  ? 21.236  35.329  34.900 1.00 37.10 ? 274 LYS A CE  1 
ATOM   275  N  NZ  . LYS A 1 66  ? 21.348  36.483  33.980 1.00 40.58 ? 274 LYS A NZ  1 
ATOM   276  N  N   . VAL A 1 67  ? 16.390  35.934  38.792 1.00 32.20 ? 275 VAL A N   1 
ATOM   277  C  CA  . VAL A 1 67  ? 15.047  35.819  39.318 1.00 32.02 ? 275 VAL A CA  1 
ATOM   278  C  C   . VAL A 1 67  ? 14.391  34.587  38.681 1.00 30.77 ? 275 VAL A C   1 
ATOM   279  O  O   . VAL A 1 67  ? 14.270  34.489  37.458 1.00 29.58 ? 275 VAL A O   1 
ATOM   280  C  CB  . VAL A 1 67  ? 14.228  37.090  39.033 1.00 32.63 ? 275 VAL A CB  1 
ATOM   281  C  CG1 . VAL A 1 67  ? 12.813  36.937  39.571 1.00 33.73 ? 275 VAL A CG1 1 
ATOM   282  C  CG2 . VAL A 1 67  ? 14.913  38.308  39.666 1.00 34.12 ? 275 VAL A CG2 1 
ATOM   283  N  N   . VAL A 1 68  ? 13.996  33.647  39.530 1.00 30.18 ? 276 VAL A N   1 
ATOM   284  C  CA  . VAL A 1 68  ? 13.508  32.323  39.106 1.00 29.83 ? 276 VAL A CA  1 
ATOM   285  C  C   . VAL A 1 68  ? 12.063  32.115  39.537 1.00 28.41 ? 276 VAL A C   1 
ATOM   286  O  O   . VAL A 1 68  ? 11.703  32.418  40.674 1.00 28.58 ? 276 VAL A O   1 
ATOM   287  C  CB  . VAL A 1 68  ? 14.354  31.201  39.746 1.00 30.61 ? 276 VAL A CB  1 
ATOM   288  C  CG1 . VAL A 1 68  ? 13.853  29.823  39.336 1.00 30.85 ? 276 VAL A CG1 1 
ATOM   289  C  CG2 . VAL A 1 68  ? 15.809  31.359  39.359 1.00 32.29 ? 276 VAL A CG2 1 
ATOM   290  N  N   . LEU A 1 69  ? 11.250  31.596  38.621 1.00 28.23 ? 277 LEU A N   1 
ATOM   291  C  CA  . LEU A 1 69  ? 9.880   31.192  38.896 1.00 28.25 ? 277 LEU A CA  1 
ATOM   292  C  C   . LEU A 1 69  ? 9.762   29.668  38.858 1.00 28.88 ? 277 LEU A C   1 
ATOM   293  O  O   . LEU A 1 69  ? 10.089  29.053  37.847 1.00 28.37 ? 277 LEU A O   1 
ATOM   294  C  CB  . LEU A 1 69  ? 8.955   31.796  37.848 1.00 29.42 ? 277 LEU A CB  1 
ATOM   295  C  CG  . LEU A 1 69  ? 7.479   31.386  37.945 1.00 30.63 ? 277 LEU A CG  1 
ATOM   296  C  CD1 . LEU A 1 69  ? 6.876   31.756  39.290 1.00 33.10 ? 277 LEU A CD1 1 
ATOM   297  C  CD2 . LEU A 1 69  ? 6.694   32.030  36.823 1.00 30.59 ? 277 LEU A CD2 1 
ATOM   298  N  N   . ASP A 1 70  ? 9.313   29.078  39.963 1.00 30.06 ? 278 ASP A N   1 
ATOM   299  C  CA  . ASP A 1 70  ? 9.067   27.638  40.078 1.00 30.55 ? 278 ASP A CA  1 
ATOM   300  C  C   . ASP A 1 70  ? 7.549   27.390  40.006 1.00 32.40 ? 278 ASP A C   1 
ATOM   301  O  O   . ASP A 1 70  ? 6.829   27.621  40.983 1.00 32.98 ? 278 ASP A O   1 
ATOM   302  C  CB  . ASP A 1 70  ? 9.661   27.119  41.393 1.00 30.14 ? 278 ASP A CB  1 
ATOM   303  C  CG  . ASP A 1 70  ? 9.487   25.599  41.593 1.00 32.32 ? 278 ASP A CG  1 
ATOM   304  O  OD1 . ASP A 1 70  ? 8.899   24.903  40.724 1.00 31.98 ? 278 ASP A OD1 1 
ATOM   305  O  OD2 . ASP A 1 70  ? 9.951   25.105  42.651 1.00 31.02 ? 278 ASP A OD2 1 
ATOM   306  N  N   . VAL A 1 71  ? 7.079   26.935  38.840 1.00 31.09 ? 279 VAL A N   1 
ATOM   307  C  CA  . VAL A 1 71  ? 5.665   26.712  38.593 1.00 29.98 ? 279 VAL A CA  1 
ATOM   308  C  C   . VAL A 1 71  ? 5.216   25.322  39.074 1.00 31.26 ? 279 VAL A C   1 
ATOM   309  O  O   . VAL A 1 71  ? 5.681   24.279  38.572 1.00 32.00 ? 279 VAL A O   1 
ATOM   310  C  CB  . VAL A 1 71  ? 5.333   26.873  37.101 1.00 31.70 ? 279 VAL A CB  1 
ATOM   311  C  CG1 . VAL A 1 71  ? 3.834   26.656  36.852 1.00 31.67 ? 279 VAL A CG1 1 
ATOM   312  C  CG2 . VAL A 1 71  ? 5.796   28.237  36.587 1.00 31.36 ? 279 VAL A CG2 1 
ATOM   313  N  N   . GLY A 1 72  ? 4.314   25.314  40.049 1.00 29.39 ? 280 GLY A N   1 
ATOM   314  C  CA  . GLY A 1 72  ? 3.856   24.079  40.679 1.00 29.76 ? 280 GLY A CA  1 
ATOM   315  C  C   . GLY A 1 72  ? 4.941   23.553  41.601 1.00 29.80 ? 280 GLY A C   1 
ATOM   316  O  O   . GLY A 1 72  ? 5.416   22.431  41.447 1.00 30.75 ? 280 GLY A O   1 
ATOM   317  N  N   . CYS A 1 73  ? 5.324   24.365  42.578 1.00 30.24 ? 281 CYS A N   1 
ATOM   318  C  CA  . CYS A 1 73  ? 6.557   24.133  43.328 1.00 30.11 ? 281 CYS A CA  1 
ATOM   319  C  C   . CYS A 1 73  ? 6.458   23.014  44.347 1.00 30.09 ? 281 CYS A C   1 
ATOM   320  O  O   . CYS A 1 73  ? 7.467   22.575  44.884 1.00 30.81 ? 281 CYS A O   1 
ATOM   321  C  CB  . CYS A 1 73  ? 7.005   25.417  44.007 1.00 30.81 ? 281 CYS A CB  1 
ATOM   322  S  SG  . CYS A 1 73  ? 5.867   26.019  45.280 1.00 34.70 ? 281 CYS A SG  1 
ATOM   323  N  N   . GLY A 1 74  ? 5.249   22.557  44.643 1.00 30.97 ? 282 GLY A N   1 
ATOM   324  C  CA  . GLY A 1 74  ? 5.076   21.467  45.598 1.00 29.17 ? 282 GLY A CA  1 
ATOM   325  C  C   . GLY A 1 74  ? 5.730   21.772  46.938 1.00 29.41 ? 282 GLY A C   1 
ATOM   326  O  O   . GLY A 1 74  ? 5.513   22.839  47.512 1.00 31.06 ? 282 GLY A O   1 
ATOM   327  N  N   . THR A 1 75  ? 6.552   20.841  47.413 1.00 29.46 ? 283 THR A N   1 
ATOM   328  C  CA  . THR A 1 75  ? 7.260   20.972  48.673 1.00 29.75 ? 283 THR A CA  1 
ATOM   329  C  C   . THR A 1 75  ? 8.358   22.024  48.647 1.00 30.66 ? 283 THR A C   1 
ATOM   330  O  O   . THR A 1 75  ? 8.931   22.341  49.697 1.00 30.06 ? 283 THR A O   1 
ATOM   331  C  CB  . THR A 1 75  ? 7.906   19.642  49.074 1.00 32.83 ? 283 THR A CB  1 
ATOM   332  O  OG1 . THR A 1 75  ? 8.752   19.182  48.014 1.00 35.68 ? 283 THR A OG1 1 
ATOM   333  C  CG2 . THR A 1 75  ? 6.837   18.604  49.369 1.00 33.97 ? 283 THR A CG2 1 
ATOM   334  N  N   . GLY A 1 76  ? 8.669   22.548  47.456 1.00 29.46 ? 284 GLY A N   1 
ATOM   335  C  CA  . GLY A 1 76  ? 9.639   23.621  47.307 1.00 28.89 ? 284 GLY A CA  1 
ATOM   336  C  C   . GLY A 1 76  ? 11.048  23.201  46.935 1.00 28.43 ? 284 GLY A C   1 
ATOM   337  O  O   . GLY A 1 76  ? 11.929  24.053  46.848 1.00 26.60 ? 284 GLY A O   1 
ATOM   338  N  N   . ILE A 1 77  ? 11.263  21.906  46.703 1.00 27.85 ? 285 ILE A N   1 
ATOM   339  C  CA  . ILE A 1 77  ? 12.610  21.358  46.512 1.00 27.71 ? 285 ILE A CA  1 
ATOM   340  C  C   . ILE A 1 77  ? 13.383  22.006  45.351 1.00 27.00 ? 285 ILE A C   1 
ATOM   341  O  O   . ILE A 1 77  ? 14.570  22.287  45.490 1.00 25.82 ? 285 ILE A O   1 
ATOM   342  C  CB  . ILE A 1 77  ? 12.587  19.817  46.357 1.00 29.75 ? 285 ILE A CB  1 
ATOM   343  C  CG1 . ILE A 1 77  ? 14.005  19.238  46.311 1.00 32.03 ? 285 ILE A CG1 1 
ATOM   344  C  CG2 . ILE A 1 77  ? 11.870  19.385  45.096 1.00 30.43 ? 285 ILE A CG2 1 
ATOM   345  C  CD1 . ILE A 1 77  ? 14.763  19.400  47.595 1.00 32.29 ? 285 ILE A CD1 1 
ATOM   346  N  N   . LEU A 1 78  ? 12.720  22.253  44.224 1.00 25.82 ? 286 LEU A N   1 
ATOM   347  C  CA  . LEU A 1 78  ? 13.398  22.832  43.071 1.00 27.29 ? 286 LEU A CA  1 
ATOM   348  C  C   . LEU A 1 78  ? 13.765  24.283  43.356 1.00 28.12 ? 286 LEU A C   1 
ATOM   349  O  O   . LEU A 1 78  ? 14.796  24.766  42.892 1.00 25.73 ? 286 LEU A O   1 
ATOM   350  C  CB  . LEU A 1 78  ? 12.536  22.773  41.813 1.00 28.19 ? 286 LEU A CB  1 
ATOM   351  C  CG  . LEU A 1 78  ? 12.077  21.411  41.292 1.00 29.75 ? 286 LEU A CG  1 
ATOM   352  C  CD1 . LEU A 1 78  ? 11.367  21.593  39.957 1.00 31.45 ? 286 LEU A CD1 1 
ATOM   353  C  CD2 . LEU A 1 78  ? 13.247  20.461  41.149 1.00 31.55 ? 286 LEU A CD2 1 
ATOM   354  N  N   . SER A 1 79  ? 12.907  24.972  44.111 1.00 27.15 ? 287 SER A N   1 
ATOM   355  C  CA  . SER A 1 79  ? 13.187  26.331  44.518 1.00 27.72 ? 287 SER A CA  1 
ATOM   356  C  C   . SER A 1 79  ? 14.396  26.372  45.447 1.00 26.27 ? 287 SER A C   1 
ATOM   357  O  O   . SER A 1 79  ? 15.220  27.252  45.336 1.00 25.83 ? 287 SER A O   1 
ATOM   358  C  CB  . SER A 1 79  ? 11.961  26.972  45.196 1.00 28.06 ? 287 SER A CB  1 
ATOM   359  O  OG  . SER A 1 79  ? 10.949  27.191  44.219 1.00 29.78 ? 287 SER A OG  1 
ATOM   360  N  N   . MET A 1 80  ? 14.515  25.403  46.335 1.00 26.62 ? 288 MET A N   1 
ATOM   361  C  CA  . MET A 1 80  ? 15.695  25.323  47.196 1.00 26.72 ? 288 MET A CA  1 
ATOM   362  C  C   . MET A 1 80  ? 16.973  24.981  46.413 1.00 26.88 ? 288 MET A C   1 
ATOM   363  O  O   . MET A 1 80  ? 18.040  25.503  46.731 1.00 25.99 ? 288 MET A O   1 
ATOM   364  C  CB  . MET A 1 80  ? 15.449  24.336  48.333 1.00 27.29 ? 288 MET A CB  1 
ATOM   365  C  CG  . MET A 1 80  ? 14.325  24.816  49.256 1.00 28.55 ? 288 MET A CG  1 
ATOM   366  S  SD  . MET A 1 80  ? 14.263  23.954  50.843 1.00 28.32 ? 288 MET A SD  1 
ATOM   367  C  CE  . MET A 1 80  ? 13.649  22.343  50.349 1.00 28.61 ? 288 MET A CE  1 
ATOM   368  N  N   . PHE A 1 81  ? 16.872  24.117  45.402 1.00 23.98 ? 289 PHE A N   1 
ATOM   369  C  CA  . PHE A 1 81  ? 18.009  23.848  44.527 1.00 25.13 ? 289 PHE A CA  1 
ATOM   370  C  C   . PHE A 1 81  ? 18.459  25.159  43.852 1.00 25.33 ? 289 PHE A C   1 
ATOM   371  O  O   . PHE A 1 81  ? 19.645  25.472  43.810 1.00 24.32 ? 289 PHE A O   1 
ATOM   372  C  CB  . PHE A 1 81  ? 17.675  22.821  43.422 1.00 24.89 ? 289 PHE A CB  1 
ATOM   373  C  CG  . PHE A 1 81  ? 17.490  21.393  43.894 1.00 25.11 ? 289 PHE A CG  1 
ATOM   374  C  CD1 . PHE A 1 81  ? 18.170  20.882  45.000 1.00 25.19 ? 289 PHE A CD1 1 
ATOM   375  C  CD2 . PHE A 1 81  ? 16.689  20.530  43.164 1.00 24.51 ? 289 PHE A CD2 1 
ATOM   376  C  CE1 . PHE A 1 81  ? 18.012  19.562  45.377 1.00 25.75 ? 289 PHE A CE1 1 
ATOM   377  C  CE2 . PHE A 1 81  ? 16.523  19.213  43.538 1.00 26.01 ? 289 PHE A CE2 1 
ATOM   378  C  CZ  . PHE A 1 81  ? 17.178  18.728  44.651 1.00 26.81 ? 289 PHE A CZ  1 
ATOM   379  N  N   . ALA A 1 82  ? 17.505  25.917  43.322 1.00 25.53 ? 290 ALA A N   1 
ATOM   380  C  CA  . ALA A 1 82  ? 17.838  27.143  42.604 1.00 26.79 ? 290 ALA A CA  1 
ATOM   381  C  C   . ALA A 1 82  ? 18.491  28.153  43.544 1.00 28.23 ? 290 ALA A C   1 
ATOM   382  O  O   . ALA A 1 82  ? 19.454  28.827  43.168 1.00 27.39 ? 290 ALA A O   1 
ATOM   383  C  CB  . ALA A 1 82  ? 16.603  27.744  41.973 1.00 26.53 ? 290 ALA A CB  1 
ATOM   384  N  N   . ALA A 1 83  ? 17.974  28.248  44.765 1.00 28.14 ? 291 ALA A N   1 
ATOM   385  C  CA  . ALA A 1 83  ? 18.569  29.131  45.766 1.00 30.63 ? 291 ALA A CA  1 
ATOM   386  C  C   . ALA A 1 83  ? 20.000  28.723  46.101 1.00 32.80 ? 291 ALA A C   1 
ATOM   387  O  O   . ALA A 1 83  ? 20.889  29.584  46.186 1.00 35.26 ? 291 ALA A O   1 
ATOM   388  C  CB  . ALA A 1 83  ? 17.713  29.174  47.025 1.00 31.63 ? 291 ALA A CB  1 
ATOM   389  N  N   . LYS A 1 84  ? 20.240  27.426  46.301 1.00 32.57 ? 292 LYS A N   1 
ATOM   390  C  CA  . LYS A 1 84  ? 21.595  26.975  46.606 1.00 32.69 ? 292 LYS A CA  1 
ATOM   391  C  C   . LYS A 1 84  ? 22.539  27.254  45.427 1.00 32.27 ? 292 LYS A C   1 
ATOM   392  O  O   . LYS A 1 84  ? 23.700  27.529  45.638 1.00 30.26 ? 292 LYS A O   1 
ATOM   393  C  CB  . LYS A 1 84  ? 21.674  25.491  46.988 1.00 34.20 ? 292 LYS A CB  1 
ATOM   394  C  CG  . LYS A 1 84  ? 22.963  25.167  47.744 1.00 38.33 ? 292 LYS A CG  1 
ATOM   395  C  CD  . LYS A 1 84  ? 23.114  23.700  48.119 1.00 42.55 ? 292 LYS A CD  1 
ATOM   396  N  N   . ALA A 1 85  ? 22.038  27.175  44.199 1.00 30.19 ? 293 ALA A N   1 
ATOM   397  C  CA  . ALA A 1 85  ? 22.849  27.490  43.021 1.00 29.56 ? 293 ALA A CA  1 
ATOM   398  C  C   . ALA A 1 85  ? 23.053  29.004  42.798 1.00 30.49 ? 293 ALA A C   1 
ATOM   399  O  O   . ALA A 1 85  ? 23.626  29.401  41.788 1.00 32.58 ? 293 ALA A O   1 
ATOM   400  C  CB  . ALA A 1 85  ? 22.237  26.852  41.779 1.00 28.67 ? 293 ALA A CB  1 
ATOM   401  N  N   . GLY A 1 86  ? 22.541  29.838  43.696 1.00 30.31 ? 294 GLY A N   1 
ATOM   402  C  CA  . GLY A 1 86  ? 22.864  31.266  43.704 1.00 31.86 ? 294 GLY A CA  1 
ATOM   403  C  C   . GLY A 1 86  ? 21.796  32.191  43.161 1.00 31.79 ? 294 GLY A C   1 
ATOM   404  O  O   . GLY A 1 86  ? 22.096  33.334  42.876 1.00 32.45 ? 294 GLY A O   1 
ATOM   405  N  N   . ALA A 1 87  ? 20.552  31.720  43.018 1.00 31.34 ? 295 ALA A N   1 
ATOM   406  C  CA  . ALA A 1 87  ? 19.468  32.607  42.605 1.00 31.76 ? 295 ALA A CA  1 
ATOM   407  C  C   . ALA A 1 87  ? 19.364  33.815  43.542 1.00 34.10 ? 295 ALA A C   1 
ATOM   408  O  O   . ALA A 1 87  ? 19.537  33.693  44.752 1.00 31.37 ? 295 ALA A O   1 
ATOM   409  C  CB  . ALA A 1 87  ? 18.144  31.879  42.545 1.00 32.52 ? 295 ALA A CB  1 
ATOM   410  N  N   . LYS A 1 88  ? 19.107  34.976  42.952 1.00 34.61 ? 296 LYS A N   1 
ATOM   411  C  CA  . LYS A 1 88  ? 18.885  36.195  43.713 1.00 36.50 ? 296 LYS A CA  1 
ATOM   412  C  C   . LYS A 1 88  ? 17.537  36.089  44.416 1.00 34.34 ? 296 LYS A C   1 
ATOM   413  O  O   . LYS A 1 88  ? 17.429  36.357  45.606 1.00 34.56 ? 296 LYS A O   1 
ATOM   414  C  CB  . LYS A 1 88  ? 18.902  37.407  42.787 1.00 39.82 ? 296 LYS A CB  1 
ATOM   415  C  CG  . LYS A 1 88  ? 18.552  38.725  43.469 1.00 44.69 ? 296 LYS A CG  1 
ATOM   416  C  CD  . LYS A 1 88  ? 18.888  39.912  42.580 1.00 49.83 ? 296 LYS A CD  1 
ATOM   417  C  CE  . LYS A 1 88  ? 18.185  39.832  41.232 1.00 53.50 ? 296 LYS A CE  1 
ATOM   418  N  NZ  . LYS A 1 88  ? 18.237  41.128  40.503 1.00 59.02 ? 296 LYS A NZ  1 
ATOM   419  N  N   . LYS A 1 89  ? 16.533  35.643  43.673 1.00 32.44 ? 297 LYS A N   1 
ATOM   420  C  CA  . LYS A 1 89  ? 15.162  35.573  44.156 1.00 32.32 ? 297 LYS A CA  1 
ATOM   421  C  C   . LYS A 1 89  ? 14.458  34.382  43.500 1.00 30.65 ? 297 LYS A C   1 
ATOM   422  O  O   . LYS A 1 89  ? 14.535  34.204  42.279 1.00 29.04 ? 297 LYS A O   1 
ATOM   423  C  CB  . LYS A 1 89  ? 14.455  36.882  43.773 1.00 32.60 ? 297 LYS A CB  1 
ATOM   424  C  CG  . LYS A 1 89  ? 12.998  36.998  44.151 1.00 36.52 ? 297 LYS A CG  1 
ATOM   425  C  CD  . LYS A 1 89  ? 12.757  36.780  45.635 1.00 39.97 ? 297 LYS A CD  1 
ATOM   426  C  CE  . LYS A 1 89  ? 13.517  37.795  46.483 1.00 42.99 ? 297 LYS A CE  1 
ATOM   427  N  NZ  . LYS A 1 89  ? 13.131  37.662  47.910 1.00 46.05 ? 297 LYS A NZ  1 
ATOM   428  N  N   . VAL A 1 90  ? 13.769  33.579  44.301 1.00 29.50 ? 298 VAL A N   1 
ATOM   429  C  CA  . VAL A 1 90  ? 12.980  32.476  43.767 1.00 30.90 ? 298 VAL A CA  1 
ATOM   430  C  C   . VAL A 1 90  ? 11.526  32.613  44.194 1.00 30.33 ? 298 VAL A C   1 
ATOM   431  O  O   . VAL A 1 90  ? 11.233  32.672  45.381 1.00 30.18 ? 298 VAL A O   1 
ATOM   432  C  CB  . VAL A 1 90  ? 13.504  31.102  44.231 1.00 30.76 ? 298 VAL A CB  1 
ATOM   433  C  CG1 . VAL A 1 90  ? 12.688  29.994  43.578 1.00 32.63 ? 298 VAL A CG1 1 
ATOM   434  C  CG2 . VAL A 1 90  ? 14.989  30.945  43.912 1.00 30.36 ? 298 VAL A CG2 1 
ATOM   435  N  N   . LEU A 1 91  ? 10.626  32.628  43.220 1.00 30.45 ? 299 LEU A N   1 
ATOM   436  C  CA  . LEU A 1 91  ? 9.199   32.653  43.476 1.00 31.95 ? 299 LEU A CA  1 
ATOM   437  C  C   . LEU A 1 91  ? 8.598   31.268  43.223 1.00 32.10 ? 299 LEU A C   1 
ATOM   438  O  O   . LEU A 1 91  ? 8.584   30.799  42.088 1.00 31.18 ? 299 LEU A O   1 
ATOM   439  C  CB  . LEU A 1 91  ? 8.514   33.676  42.554 1.00 33.97 ? 299 LEU A CB  1 
ATOM   440  C  CG  . LEU A 1 91  ? 9.131   35.077  42.524 1.00 36.52 ? 299 LEU A CG  1 
ATOM   441  C  CD1 . LEU A 1 91  ? 8.489   35.913  41.431 1.00 37.13 ? 299 LEU A CD1 1 
ATOM   442  C  CD2 . LEU A 1 91  ? 8.995   35.737  43.881 1.00 36.60 ? 299 LEU A CD2 1 
ATOM   443  N  N   . GLY A 1 92  ? 8.098   30.615  44.270 1.00 32.50 ? 300 GLY A N   1 
ATOM   444  C  CA  . GLY A 1 92  ? 7.434   29.336  44.112 1.00 33.76 ? 300 GLY A CA  1 
ATOM   445  C  C   . GLY A 1 92  ? 5.927   29.491  44.171 1.00 35.62 ? 300 GLY A C   1 
ATOM   446  O  O   . GLY A 1 92  ? 5.412   30.067  45.122 1.00 34.98 ? 300 GLY A O   1 
ATOM   447  N  N   . VAL A 1 93  ? 5.227   28.978  43.158 1.00 34.95 ? 301 VAL A N   1 
ATOM   448  C  CA  . VAL A 1 93  ? 3.777   29.063  43.094 1.00 36.87 ? 301 VAL A CA  1 
ATOM   449  C  C   . VAL A 1 93  ? 3.140   27.680  43.019 1.00 37.64 ? 301 VAL A C   1 
ATOM   450  O  O   . VAL A 1 93  ? 3.599   26.807  42.272 1.00 35.62 ? 301 VAL A O   1 
ATOM   451  C  CB  . VAL A 1 93  ? 3.320   29.877  41.873 1.00 39.58 ? 301 VAL A CB  1 
ATOM   452  C  CG1 . VAL A 1 93  ? 1.798   29.952  41.818 1.00 40.82 ? 301 VAL A CG1 1 
ATOM   453  C  CG2 . VAL A 1 93  ? 3.945   31.261  41.903 1.00 41.58 ? 301 VAL A CG2 1 
ATOM   454  N  N   . ASP A 1 94  ? 2.086   27.484  43.806 1.00 37.75 ? 302 ASP A N   1 
ATOM   455  C  CA  . ASP A 1 94  ? 1.297   26.258  43.759 1.00 38.86 ? 302 ASP A CA  1 
ATOM   456  C  C   . ASP A 1 94  ? -0.107  26.545  44.289 1.00 42.24 ? 302 ASP A C   1 
ATOM   457  O  O   . ASP A 1 94  ? -0.258  27.292  45.250 1.00 38.58 ? 302 ASP A O   1 
ATOM   458  C  CB  . ASP A 1 94  ? 1.951   25.165  44.605 1.00 39.87 ? 302 ASP A CB  1 
ATOM   459  C  CG  . ASP A 1 94  ? 1.589   23.759  44.129 1.00 42.91 ? 302 ASP A CG  1 
ATOM   460  O  OD1 . ASP A 1 94  ? 0.383   23.430  44.106 1.00 46.28 ? 302 ASP A OD1 1 
ATOM   461  O  OD2 . ASP A 1 94  ? 2.510   22.982  43.774 1.00 40.32 ? 302 ASP A OD2 1 
ATOM   462  N  N   . GLN A 1 95  ? -1.120  25.939  43.672 1.00 44.79 ? 303 GLN A N   1 
ATOM   463  C  CA  . GLN A 1 95  ? -2.505  26.112  44.114 1.00 47.22 ? 303 GLN A CA  1 
ATOM   464  C  C   . GLN A 1 95  ? -2.846  25.164  45.262 1.00 46.71 ? 303 GLN A C   1 
ATOM   465  O  O   . GLN A 1 95  ? -3.769  25.416  46.036 1.00 45.47 ? 303 GLN A O   1 
ATOM   466  C  CB  . GLN A 1 95  ? -3.467  25.924  42.941 1.00 51.49 ? 303 GLN A CB  1 
ATOM   467  C  CG  . GLN A 1 95  ? -3.617  24.493  42.452 1.00 55.18 ? 303 GLN A CG  1 
ATOM   468  C  CD  . GLN A 1 95  ? -4.448  24.403  41.189 1.00 60.09 ? 303 GLN A CD  1 
ATOM   469  O  OE1 . GLN A 1 95  ? -5.209  25.312  40.867 1.00 65.32 ? 303 GLN A OE1 1 
ATOM   470  N  NE2 . GLN A 1 95  ? -4.308  23.302  40.468 1.00 64.83 ? 303 GLN A NE2 1 
ATOM   471  N  N   . SER A 1 96  ? -2.080  24.089  45.388 1.00 44.40 ? 304 SER A N   1 
ATOM   472  C  CA  . SER A 1 96  ? -2.352  23.068  46.392 1.00 43.95 ? 304 SER A CA  1 
ATOM   473  C  C   . SER A 1 96  ? -2.011  23.501  47.826 1.00 46.06 ? 304 SER A C   1 
ATOM   474  O  O   . SER A 1 96  ? -1.200  24.410  48.042 1.00 45.60 ? 304 SER A O   1 
ATOM   475  C  CB  . SER A 1 96  ? -1.593  21.790  46.036 1.00 44.17 ? 304 SER A CB  1 
ATOM   476  O  OG  . SER A 1 96  ? -1.524  20.925  47.146 1.00 45.91 ? 304 SER A OG  1 
ATOM   477  N  N   . GLU A 1 97  ? -2.634  22.830  48.801 1.00 44.57 ? 305 GLU A N   1 
ATOM   478  C  CA  . GLU A 1 97  ? -2.367  23.062  50.230 1.00 44.11 ? 305 GLU A CA  1 
ATOM   479  C  C   . GLU A 1 97  ? -0.943  22.647  50.652 1.00 43.11 ? 305 GLU A C   1 
ATOM   480  O  O   . GLU A 1 97  ? -0.471  23.050  51.719 1.00 41.99 ? 305 GLU A O   1 
ATOM   481  C  CB  . GLU A 1 97  ? -3.401  22.330  51.106 1.00 44.89 ? 305 GLU A CB  1 
ATOM   482  N  N   . ILE A 1 98  ? -0.266  21.848  49.817 1.00 40.89 ? 306 ILE A N   1 
ATOM   483  C  CA  . ILE A 1 98  ? 1.153   21.504  50.021 1.00 37.95 ? 306 ILE A CA  1 
ATOM   484  C  C   . ILE A 1 98  ? 2.021   22.749  50.180 1.00 36.69 ? 306 ILE A C   1 
ATOM   485  O  O   . ILE A 1 98  ? 3.047   22.712  50.858 1.00 34.63 ? 306 ILE A O   1 
ATOM   486  C  CB  . ILE A 1 98  ? 1.717   20.638  48.857 1.00 38.30 ? 306 ILE A CB  1 
ATOM   487  C  CG1 . ILE A 1 98  ? 3.033   19.943  49.248 1.00 37.43 ? 306 ILE A CG1 1 
ATOM   488  C  CG2 . ILE A 1 98  ? 1.926   21.476  47.602 1.00 35.97 ? 306 ILE A CG2 1 
ATOM   489  C  CD1 . ILE A 1 98  ? 2.922   18.937  50.378 1.00 37.78 ? 306 ILE A CD1 1 
ATOM   490  N  N   . LEU A 1 99  ? 1.606   23.852  49.568 1.00 36.26 ? 307 LEU A N   1 
ATOM   491  C  CA  . LEU A 1 99  ? 2.345   25.087  49.682 1.00 37.34 ? 307 LEU A CA  1 
ATOM   492  C  C   . LEU A 1 99  ? 2.606   25.522  51.135 1.00 38.79 ? 307 LEU A C   1 
ATOM   493  O  O   . LEU A 1 99  ? 3.642   26.131  51.418 1.00 38.42 ? 307 LEU A O   1 
ATOM   494  C  CB  . LEU A 1 99  ? 1.661   26.210  48.909 1.00 38.07 ? 307 LEU A CB  1 
ATOM   495  C  CG  . LEU A 1 99  ? 2.664   27.351  48.698 1.00 40.98 ? 307 LEU A CG  1 
ATOM   496  C  CD1 . LEU A 1 99  ? 3.718   26.992  47.653 1.00 40.33 ? 307 LEU A CD1 1 
ATOM   497  C  CD2 . LEU A 1 99  ? 1.970   28.627  48.315 1.00 43.00 ? 307 LEU A CD2 1 
ATOM   498  N  N   . TYR A 1 100 ? 1.690   25.201  52.045 1.00 37.83 ? 308 TYR A N   1 
ATOM   499  C  CA  . TYR A 1 100 ? 1.846   25.579  53.448 1.00 40.06 ? 308 TYR A CA  1 
ATOM   500  C  C   . TYR A 1 100 ? 2.967   24.800  54.092 1.00 39.84 ? 308 TYR A C   1 
ATOM   501  O  O   . TYR A 1 100 ? 3.712   25.336  54.903 1.00 39.66 ? 308 TYR A O   1 
ATOM   502  C  CB  . TYR A 1 100 ? 0.547   25.347  54.228 1.00 43.16 ? 308 TYR A CB  1 
ATOM   503  C  CG  . TYR A 1 100 ? -0.594  26.191  53.730 1.00 45.67 ? 308 TYR A CG  1 
ATOM   504  C  CD1 . TYR A 1 100 ? -0.459  27.572  53.608 1.00 47.81 ? 308 TYR A CD1 1 
ATOM   505  C  CD2 . TYR A 1 100 ? -1.813  25.614  53.372 1.00 49.81 ? 308 TYR A CD2 1 
ATOM   506  C  CE1 . TYR A 1 100 ? -1.500  28.356  53.145 1.00 49.49 ? 308 TYR A CE1 1 
ATOM   507  C  CE2 . TYR A 1 100 ? -2.863  26.394  52.909 1.00 50.61 ? 308 TYR A CE2 1 
ATOM   508  C  CZ  . TYR A 1 100 ? -2.698  27.761  52.803 1.00 50.68 ? 308 TYR A CZ  1 
ATOM   509  O  OH  . TYR A 1 100 ? -3.725  28.542  52.348 1.00 55.58 ? 308 TYR A OH  1 
ATOM   510  N  N   . GLN A 1 101 ? 3.084   23.530  53.731 1.00 39.46 ? 309 GLN A N   1 
ATOM   511  C  CA  . GLN A 1 101 ? 4.233   22.744  54.123 1.00 41.28 ? 309 GLN A CA  1 
ATOM   512  C  C   . GLN A 1 101 ? 5.530   23.320  53.523 1.00 38.90 ? 309 GLN A C   1 
ATOM   513  O  O   . GLN A 1 101 ? 6.569   23.363  54.186 1.00 36.35 ? 309 GLN A O   1 
ATOM   514  C  CB  . GLN A 1 101 ? 4.044   21.293  53.692 1.00 45.70 ? 309 GLN A CB  1 
ATOM   515  C  CG  . GLN A 1 101 ? 3.192   20.478  54.645 1.00 47.97 ? 309 GLN A CG  1 
ATOM   516  C  CD  . GLN A 1 101 ? 3.955   20.046  55.882 1.00 51.74 ? 309 GLN A CD  1 
ATOM   517  O  OE1 . GLN A 1 101 ? 5.131   20.382  56.063 1.00 59.20 ? 309 GLN A OE1 1 
ATOM   518  N  NE2 . GLN A 1 101 ? 3.290   19.294  56.746 1.00 55.54 ? 309 GLN A NE2 1 
ATOM   519  N  N   . ALA A 1 102 ? 5.464   23.744  52.268 1.00 35.51 ? 310 ALA A N   1 
ATOM   520  C  CA  . ALA A 1 102 ? 6.607   24.383  51.607 1.00 34.32 ? 310 ALA A CA  1 
ATOM   521  C  C   . ALA A 1 102 ? 7.059   25.646  52.356 1.00 35.80 ? 310 ALA A C   1 
ATOM   522  O  O   . ALA A 1 102 ? 8.249   25.916  52.458 1.00 33.81 ? 310 ALA A O   1 
ATOM   523  C  CB  . ALA A 1 102 ? 6.267   24.716  50.173 1.00 33.31 ? 310 ALA A CB  1 
ATOM   524  N  N   . MET A 1 103 ? 6.108   26.408  52.886 1.00 36.24 ? 311 MET A N   1 
ATOM   525  C  CA  . MET A 1 103 ? 6.440   27.583  53.691 1.00 38.23 ? 311 MET A CA  1 
ATOM   526  C  C   . MET A 1 103 ? 7.284   27.206  54.897 1.00 35.12 ? 311 MET A C   1 
ATOM   527  O  O   . MET A 1 103 ? 8.318   27.818  55.140 1.00 32.53 ? 311 MET A O   1 
ATOM   528  C  CB  . MET A 1 103 ? 5.171   28.328  54.112 1.00 41.62 ? 311 MET A CB  1 
ATOM   529  C  CG  . MET A 1 103 ? 4.519   29.038  52.937 1.00 46.19 ? 311 MET A CG  1 
ATOM   530  S  SD  . MET A 1 103 ? 2.921   29.784  53.309 1.00 51.17 ? 311 MET A SD  1 
ATOM   531  C  CE  . MET A 1 103 ? 3.047   31.258  52.304 1.00 51.87 ? 311 MET A CE  1 
ATOM   532  N  N   . ASP A 1 104 ? 6.873   26.169  55.616 1.00 34.64 ? 312 ASP A N   1 
ATOM   533  C  CA  . ASP A 1 104 ? 7.603   25.714  56.776 1.00 34.10 ? 312 ASP A CA  1 
ATOM   534  C  C   . ASP A 1 104 ? 8.954   25.135  56.408 1.00 36.46 ? 312 ASP A C   1 
ATOM   535  O  O   . ASP A 1 104 ? 9.942   25.337  57.122 1.00 34.91 ? 312 ASP A O   1 
ATOM   536  C  CB  . ASP A 1 104 ? 6.788   24.678  57.542 1.00 38.55 ? 312 ASP A CB  1 
ATOM   537  C  CG  . ASP A 1 104 ? 5.584   25.291  58.250 1.00 43.37 ? 312 ASP A CG  1 
ATOM   538  O  OD1 . ASP A 1 104 ? 5.479   26.538  58.324 1.00 43.55 ? 312 ASP A OD1 1 
ATOM   539  O  OD2 . ASP A 1 104 ? 4.740   24.525  58.732 1.00 46.91 ? 312 ASP A OD2 1 
ATOM   540  N  N   . ILE A 1 105 ? 9.001   24.415  55.290 1.00 33.48 ? 313 ILE A N   1 
ATOM   541  C  CA  . ILE A 1 105 ? 10.253  23.819  54.818 1.00 32.09 ? 313 ILE A CA  1 
ATOM   542  C  C   . ILE A 1 105 ? 11.279  24.899  54.473 1.00 29.93 ? 313 ILE A C   1 
ATOM   543  O  O   . ILE A 1 105 ? 12.432  24.789  54.840 1.00 28.40 ? 313 ILE A O   1 
ATOM   544  C  CB  . ILE A 1 105 ? 10.008  22.902  53.588 1.00 31.01 ? 313 ILE A CB  1 
ATOM   545  C  CG1 . ILE A 1 105 ? 9.246   21.641  54.025 1.00 32.80 ? 313 ILE A CG1 1 
ATOM   546  C  CG2 . ILE A 1 105 ? 11.319  22.516  52.920 1.00 30.31 ? 313 ILE A CG2 1 
ATOM   547  C  CD1 . ILE A 1 105 ? 8.555   20.915  52.881 1.00 34.15 ? 313 ILE A CD1 1 
ATOM   548  N  N   . ILE A 1 106 ? 10.851  25.923  53.751 1.00 31.32 ? 314 ILE A N   1 
ATOM   549  C  CA  . ILE A 1 106 ? 11.730  27.029  53.382 1.00 34.10 ? 314 ILE A CA  1 
ATOM   550  C  C   . ILE A 1 106 ? 12.298  27.678  54.659 1.00 35.24 ? 314 ILE A C   1 
ATOM   551  O  O   . ILE A 1 106 ? 13.491  27.963  54.722 1.00 32.79 ? 314 ILE A O   1 
ATOM   552  C  CB  . ILE A 1 106 ? 10.997  28.026  52.435 1.00 35.96 ? 314 ILE A CB  1 
ATOM   553  C  CG1 . ILE A 1 106 ? 11.247  27.659  50.963 1.00 36.11 ? 314 ILE A CG1 1 
ATOM   554  C  CG2 . ILE A 1 106 ? 11.486  29.451  52.591 1.00 36.63 ? 314 ILE A CG2 1 
ATOM   555  C  CD1 . ILE A 1 106 ? 11.030  26.221  50.606 1.00 33.66 ? 314 ILE A CD1 1 
ATOM   556  N  N   . ARG A 1 107 ? 11.457  27.849  55.682 1.00 34.71 ? 315 ARG A N   1 
ATOM   557  C  CA  . ARG A 1 107 ? 11.904  28.399  56.957 1.00 36.73 ? 315 ARG A CA  1 
ATOM   558  C  C   . ARG A 1 107 ? 12.889  27.499  57.689 1.00 34.92 ? 315 ARG A C   1 
ATOM   559  O  O   . ARG A 1 107 ? 13.881  27.990  58.182 1.00 33.10 ? 315 ARG A O   1 
ATOM   560  C  CB  . ARG A 1 107 ? 10.719  28.740  57.868 1.00 40.81 ? 315 ARG A CB  1 
ATOM   561  C  CG  . ARG A 1 107 ? 10.075  30.072  57.509 1.00 46.86 ? 315 ARG A CG  1 
ATOM   562  C  CD  . ARG A 1 107 ? 9.024   30.523  58.514 1.00 52.61 ? 315 ARG A CD  1 
ATOM   563  N  NE  . ARG A 1 107 ? 7.673   30.297  58.006 1.00 61.44 ? 315 ARG A NE  1 
ATOM   564  C  CZ  . ARG A 1 107 ? 6.861   29.296  58.362 1.00 63.88 ? 315 ARG A CZ  1 
ATOM   565  N  NH1 . ARG A 1 107 ? 7.230   28.383  59.267 1.00 64.89 ? 315 ARG A NH1 1 
ATOM   566  N  NH2 . ARG A 1 107 ? 5.654   29.215  57.805 1.00 64.21 ? 315 ARG A NH2 1 
ATOM   567  N  N   . LEU A 1 108 ? 12.628  26.190  57.740 1.00 33.60 ? 316 LEU A N   1 
ATOM   568  C  CA  . LEU A 1 108 ? 13.557  25.232  58.343 1.00 33.31 ? 316 LEU A CA  1 
ATOM   569  C  C   . LEU A 1 108 ? 14.931  25.254  57.711 1.00 31.84 ? 316 LEU A C   1 
ATOM   570  O  O   . LEU A 1 108 ? 15.906  24.898  58.373 1.00 29.81 ? 316 LEU A O   1 
ATOM   571  C  CB  . LEU A 1 108 ? 13.059  23.787  58.199 1.00 35.69 ? 316 LEU A CB  1 
ATOM   572  C  CG  . LEU A 1 108 ? 12.194  23.156  59.267 1.00 40.42 ? 316 LEU A CG  1 
ATOM   573  C  CD1 . LEU A 1 108 ? 11.829  21.744  58.810 1.00 41.14 ? 316 LEU A CD1 1 
ATOM   574  C  CD2 . LEU A 1 108 ? 12.905  23.134  60.621 1.00 40.13 ? 316 LEU A CD2 1 
ATOM   575  N  N   . ASN A 1 109 ? 14.998  25.578  56.415 1.00 29.90 ? 317 ASN A N   1 
ATOM   576  C  CA  . ASN A 1 109 ? 16.280  25.661  55.712 1.00 30.81 ? 317 ASN A CA  1 
ATOM   577  C  C   . ASN A 1 109 ? 16.824  27.086  55.617 1.00 31.47 ? 317 ASN A C   1 
ATOM   578  O  O   . ASN A 1 109 ? 17.806  27.335  54.916 1.00 29.89 ? 317 ASN A O   1 
ATOM   579  C  CB  . ASN A 1 109 ? 16.164  25.016  54.336 1.00 29.05 ? 317 ASN A CB  1 
ATOM   580  C  CG  . ASN A 1 109 ? 15.881  23.533  54.433 1.00 28.65 ? 317 ASN A CG  1 
ATOM   581  O  OD1 . ASN A 1 109 ? 16.765  22.730  54.757 1.00 28.94 ? 317 ASN A OD1 1 
ATOM   582  N  ND2 . ASN A 1 109 ? 14.634  23.163  54.197 1.00 29.44 ? 317 ASN A ND2 1 
ATOM   583  N  N   . LYS A 1 110 ? 16.181  28.016  56.322 1.00 32.29 ? 318 LYS A N   1 
ATOM   584  C  CA  . LYS A 1 110 ? 16.660  29.394  56.424 1.00 34.61 ? 318 LYS A CA  1 
ATOM   585  C  C   . LYS A 1 110 ? 16.833  30.059  55.054 1.00 34.59 ? 318 LYS A C   1 
ATOM   586  O  O   . LYS A 1 110 ? 17.844  30.721  54.787 1.00 35.52 ? 318 LYS A O   1 
ATOM   587  C  CB  . LYS A 1 110 ? 17.954  29.442  57.249 1.00 35.08 ? 318 LYS A CB  1 
ATOM   588  C  CG  . LYS A 1 110 ? 17.797  28.814  58.637 1.00 37.81 ? 318 LYS A CG  1 
ATOM   589  C  CD  . LYS A 1 110 ? 19.064  28.921  59.464 1.00 40.59 ? 318 LYS A CD  1 
ATOM   590  C  CE  . LYS A 1 110 ? 19.014  28.052  60.720 1.00 43.39 ? 318 LYS A CE  1 
ATOM   591  N  NZ  . LYS A 1 110 ? 18.027  28.574  61.691 1.00 42.23 ? 318 LYS A NZ  1 
ATOM   592  N  N   . LEU A 1 111 ? 15.828  29.891  54.194 1.00 32.58 ? 319 LEU A N   1 
ATOM   593  C  CA  . LEU A 1 111 ? 15.878  30.412  52.826 1.00 31.20 ? 319 LEU A CA  1 
ATOM   594  C  C   . LEU A 1 111 ? 14.774  31.422  52.555 1.00 32.35 ? 319 LEU A C   1 
ATOM   595  O  O   . LEU A 1 111 ? 14.565  31.815  51.408 1.00 31.03 ? 319 LEU A O   1 
ATOM   596  C  CB  . LEU A 1 111 ? 15.795  29.246  51.827 1.00 30.41 ? 319 LEU A CB  1 
ATOM   597  C  CG  . LEU A 1 111 ? 17.059  28.395  51.717 1.00 31.02 ? 319 LEU A CG  1 
ATOM   598  C  CD1 . LEU A 1 111 ? 16.780  27.098  50.959 1.00 31.46 ? 319 LEU A CD1 1 
ATOM   599  C  CD2 . LEU A 1 111 ? 18.180  29.187  51.050 1.00 30.98 ? 319 LEU A CD2 1 
ATOM   600  N  N   . GLU A 1 112 ? 14.092  31.879  53.604 1.00 34.25 ? 320 GLU A N   1 
ATOM   601  C  CA  . GLU A 1 112 ? 12.940  32.766  53.418 1.00 37.71 ? 320 GLU A CA  1 
ATOM   602  C  C   . GLU A 1 112 ? 13.323  34.142  52.865 1.00 38.23 ? 320 GLU A C   1 
ATOM   603  O  O   . GLU A 1 112 ? 12.493  34.804  52.246 1.00 37.97 ? 320 GLU A O   1 
ATOM   604  C  CB  . GLU A 1 112 ? 12.070  32.868  54.690 1.00 41.88 ? 320 GLU A CB  1 
ATOM   605  C  CG  . GLU A 1 112 ? 12.724  33.494  55.908 1.00 44.38 ? 320 GLU A CG  1 
ATOM   606  C  CD  . GLU A 1 112 ? 13.481  32.507  56.786 1.00 48.45 ? 320 GLU A CD  1 
ATOM   607  O  OE1 . GLU A 1 112 ? 14.036  31.508  56.276 1.00 49.91 ? 320 GLU A OE1 1 
ATOM   608  O  OE2 . GLU A 1 112 ? 13.538  32.753  58.007 1.00 54.06 ? 320 GLU A OE2 1 
ATOM   609  N  N   . ASP A 1 113 ? 14.583  34.552  53.029 1.00 37.27 ? 321 ASP A N   1 
ATOM   610  C  CA  . ASP A 1 113 ? 15.052  35.791  52.403 1.00 37.84 ? 321 ASP A CA  1 
ATOM   611  C  C   . ASP A 1 113 ? 15.353  35.661  50.911 1.00 37.42 ? 321 ASP A C   1 
ATOM   612  O  O   . ASP A 1 113 ? 15.522  36.672  50.232 1.00 32.80 ? 321 ASP A O   1 
ATOM   613  C  CB  . ASP A 1 113 ? 16.284  36.322  53.122 1.00 41.20 ? 321 ASP A CB  1 
ATOM   614  C  CG  . ASP A 1 113 ? 15.987  36.740  54.550 1.00 46.39 ? 321 ASP A CG  1 
ATOM   615  O  OD1 . ASP A 1 113 ? 14.799  36.745  54.975 1.00 49.59 ? 321 ASP A OD1 1 
ATOM   616  O  OD2 . ASP A 1 113 ? 16.956  37.069  55.261 1.00 55.50 ? 321 ASP A OD2 1 
ATOM   617  N  N   . THR A 1 114 ? 15.430  34.435  50.396 1.00 36.13 ? 322 THR A N   1 
ATOM   618  C  CA  . THR A 1 114 ? 15.631  34.232  48.953 1.00 35.50 ? 322 THR A CA  1 
ATOM   619  C  C   . THR A 1 114 ? 14.396  33.658  48.238 1.00 32.56 ? 322 THR A C   1 
ATOM   620  O  O   . THR A 1 114 ? 14.148  33.980  47.071 1.00 34.32 ? 322 THR A O   1 
ATOM   621  C  CB  . THR A 1 114 ? 16.854  33.332  48.697 1.00 36.84 ? 322 THR A CB  1 
ATOM   622  O  OG1 . THR A 1 114 ? 17.993  33.930  49.297 1.00 39.46 ? 322 THR A OG1 1 
ATOM   623  C  CG2 . THR A 1 114 ? 17.133  33.157  47.195 1.00 36.59 ? 322 THR A CG2 1 
ATOM   624  N  N   . ILE A 1 115 ? 13.631  32.821  48.934 1.00 31.40 ? 323 ILE A N   1 
ATOM   625  C  CA  . ILE A 1 115 ? 12.462  32.134  48.354 1.00 30.96 ? 323 ILE A CA  1 
ATOM   626  C  C   . ILE A 1 115 ? 11.145  32.657  48.931 1.00 30.85 ? 323 ILE A C   1 
ATOM   627  O  O   . ILE A 1 115 ? 10.889  32.535  50.129 1.00 30.04 ? 323 ILE A O   1 
ATOM   628  C  CB  . ILE A 1 115 ? 12.537  30.607  48.604 1.00 31.16 ? 323 ILE A CB  1 
ATOM   629  C  CG1 . ILE A 1 115 ? 13.833  30.035  48.022 1.00 31.80 ? 323 ILE A CG1 1 
ATOM   630  C  CG2 . ILE A 1 115 ? 11.321  29.897  47.993 1.00 33.71 ? 323 ILE A CG2 1 
ATOM   631  C  CD1 . ILE A 1 115 ? 14.090  28.574  48.334 1.00 30.87 ? 323 ILE A CD1 1 
ATOM   632  N  N   . THR A 1 116 ? 10.311  33.212  48.063 1.00 33.23 ? 324 THR A N   1 
ATOM   633  C  CA  . THR A 1 116 ? 8.943   33.622  48.410 1.00 35.04 ? 324 THR A CA  1 
ATOM   634  C  C   . THR A 1 116 ? 7.941   32.632  47.804 1.00 34.84 ? 324 THR A C   1 
ATOM   635  O  O   . THR A 1 116 ? 7.973   32.358  46.599 1.00 33.57 ? 324 THR A O   1 
ATOM   636  C  CB  . THR A 1 116 ? 8.654   35.037  47.868 1.00 35.37 ? 324 THR A CB  1 
ATOM   637  O  OG1 . THR A 1 116 ? 9.541   35.970  48.500 1.00 36.72 ? 324 THR A OG1 1 
ATOM   638  C  CG2 . THR A 1 116 ? 7.194   35.461  48.107 1.00 35.90 ? 324 THR A CG2 1 
ATOM   639  N  N   . LEU A 1 117 ? 7.058   32.100  48.639 1.00 35.44 ? 325 LEU A N   1 
ATOM   640  C  CA  . LEU A 1 117 ? 6.006   31.201  48.173 1.00 37.41 ? 325 LEU A CA  1 
ATOM   641  C  C   . LEU A 1 117 ? 4.649   31.911  48.123 1.00 40.32 ? 325 LEU A C   1 
ATOM   642  O  O   . LEU A 1 117 ? 4.326   32.694  49.017 1.00 39.05 ? 325 LEU A O   1 
ATOM   643  C  CB  . LEU A 1 117 ? 5.936   30.003  49.092 1.00 39.11 ? 325 LEU A CB  1 
ATOM   644  C  CG  . LEU A 1 117 ? 7.312   29.363  49.255 1.00 41.17 ? 325 LEU A CG  1 
ATOM   645  C  CD1 . LEU A 1 117 ? 7.341   28.497  50.490 1.00 44.23 ? 325 LEU A CD1 1 
ATOM   646  C  CD2 . LEU A 1 117 ? 7.692   28.586  48.005 1.00 40.59 ? 325 LEU A CD2 1 
ATOM   647  N  N   . ILE A 1 118 ? 3.878   31.623  47.074 1.00 38.71 ? 326 ILE A N   1 
ATOM   648  C  CA  . ILE A 1 118 ? 2.598   32.269  46.800 1.00 41.73 ? 326 ILE A CA  1 
ATOM   649  C  C   . ILE A 1 118 ? 1.593   31.191  46.422 1.00 44.20 ? 326 ILE A C   1 
ATOM   650  O  O   . ILE A 1 118 ? 1.846   30.408  45.508 1.00 42.78 ? 326 ILE A O   1 
ATOM   651  C  CB  . ILE A 1 118 ? 2.691   33.236  45.601 1.00 45.28 ? 326 ILE A CB  1 
ATOM   652  C  CG1 . ILE A 1 118 ? 3.817   34.259  45.796 1.00 46.04 ? 326 ILE A CG1 1 
ATOM   653  C  CG2 . ILE A 1 118 ? 1.354   33.937  45.371 1.00 46.92 ? 326 ILE A CG2 1 
ATOM   654  C  CD1 . ILE A 1 118 ? 4.119   35.069  44.556 1.00 47.20 ? 326 ILE A CD1 1 
ATOM   655  N  N   . LYS A 1 119 ? 0.451   31.164  47.107 1.00 44.68 ? 327 LYS A N   1 
ATOM   656  C  CA  . LYS A 1 119 ? -0.574  30.155  46.875 1.00 45.79 ? 327 LYS A CA  1 
ATOM   657  C  C   . LYS A 1 119 ? -1.603  30.613  45.846 1.00 47.03 ? 327 LYS A C   1 
ATOM   658  O  O   . LYS A 1 119 ? -2.104  31.732  45.909 1.00 49.82 ? 327 LYS A O   1 
ATOM   659  C  CB  . LYS A 1 119 ? -1.269  29.808  48.188 1.00 49.95 ? 327 LYS A CB  1 
ATOM   660  C  CG  . LYS A 1 119 ? -2.198  28.606  48.092 1.00 51.19 ? 327 LYS A CG  1 
ATOM   661  C  CD  . LYS A 1 119 ? -2.436  27.998  49.462 1.00 51.83 ? 327 LYS A CD  1 
ATOM   662  C  CE  . LYS A 1 119 ? -3.838  27.423  49.609 1.00 53.80 ? 327 LYS A CE  1 
ATOM   663  N  NZ  . LYS A 1 119 ? -4.296  26.636  48.439 1.00 54.59 ? 327 LYS A NZ  1 
ATOM   664  N  N   . GLY A 1 120 ? -1.902  29.740  44.893 1.00 45.74 ? 328 GLY A N   1 
ATOM   665  C  CA  . GLY A 1 120 ? -2.923  29.995  43.885 1.00 44.80 ? 328 GLY A CA  1 
ATOM   666  C  C   . GLY A 1 120 ? -2.492  29.495  42.527 1.00 45.46 ? 328 GLY A C   1 
ATOM   667  O  O   . GLY A 1 120 ? -1.420  28.921  42.375 1.00 44.81 ? 328 GLY A O   1 
ATOM   668  N  N   . LYS A 1 121 ? -3.335  29.723  41.535 1.00 46.29 ? 329 LYS A N   1 
ATOM   669  C  CA  . LYS A 1 121 ? -3.008  29.384  40.168 1.00 51.35 ? 329 LYS A CA  1 
ATOM   670  C  C   . LYS A 1 121 ? -2.107  30.470  39.622 1.00 48.50 ? 329 LYS A C   1 
ATOM   671  O  O   . LYS A 1 121 ? -2.263  31.642  39.960 1.00 48.01 ? 329 LYS A O   1 
ATOM   672  C  CB  . LYS A 1 121 ? -4.270  29.283  39.305 1.00 56.70 ? 329 LYS A CB  1 
ATOM   673  C  CG  . LYS A 1 121 ? -5.384  28.466  39.930 1.00 59.77 ? 329 LYS A CG  1 
ATOM   674  C  CD  . LYS A 1 121 ? -6.425  28.066  38.902 1.00 65.61 ? 329 LYS A CD  1 
ATOM   675  C  CE  . LYS A 1 121 ? -7.563  27.305  39.560 1.00 68.52 ? 329 LYS A CE  1 
ATOM   676  N  NZ  . LYS A 1 121 ? -8.293  26.464  38.574 1.00 73.70 ? 329 LYS A NZ  1 
ATOM   677  N  N   . ILE A 1 122 ? -1.176  30.081  38.762 1.00 45.26 ? 330 ILE A N   1 
ATOM   678  C  CA  . ILE A 1 122 ? -0.261  31.034  38.131 1.00 44.79 ? 330 ILE A CA  1 
ATOM   679  C  C   . ILE A 1 122 ? -1.035  32.089  37.340 1.00 46.92 ? 330 ILE A C   1 
ATOM   680  O  O   . ILE A 1 122 ? -0.594  33.224  37.189 1.00 44.82 ? 330 ILE A O   1 
ATOM   681  C  CB  . ILE A 1 122 ? 0.750   30.311  37.201 1.00 42.78 ? 330 ILE A CB  1 
ATOM   682  C  CG1 . ILE A 1 122 ? 1.903   31.233  36.812 1.00 40.93 ? 330 ILE A CG1 1 
ATOM   683  C  CG2 . ILE A 1 122 ? 0.076   29.786  35.943 1.00 43.23 ? 330 ILE A CG2 1 
ATOM   684  C  CD1 . ILE A 1 122 ? 2.710   31.759  37.981 1.00 42.27 ? 330 ILE A CD1 1 
ATOM   685  N  N   . GLU A 1 123 ? -2.191  31.686  36.831 1.00 51.07 ? 331 GLU A N   1 
ATOM   686  C  CA  . GLU A 1 123 ? -3.027  32.557  36.028 1.00 55.69 ? 331 GLU A CA  1 
ATOM   687  C  C   . GLU A 1 123 ? -3.674  33.662  36.859 1.00 55.80 ? 331 GLU A C   1 
ATOM   688  O  O   . GLU A 1 123 ? -4.062  34.677  36.307 1.00 63.80 ? 331 GLU A O   1 
ATOM   689  C  CB  . GLU A 1 123 ? -4.078  31.764  35.211 1.00 55.79 ? 331 GLU A CB  1 
ATOM   690  C  CG  . GLU A 1 123 ? -4.477  30.376  35.730 1.00 56.68 ? 331 GLU A CG  1 
ATOM   691  C  CD  . GLU A 1 123 ? -3.517  29.257  35.316 1.00 54.95 ? 331 GLU A CD  1 
ATOM   692  O  OE1 . GLU A 1 123 ? -3.232  28.381  36.156 0.50 54.19 ? 331 GLU A OE1 1 
ATOM   693  O  OE2 . GLU A 1 123 ? -3.055  29.239  34.154 0.50 53.14 ? 331 GLU A OE2 1 
ATOM   694  N  N   . GLU A 1 124 ? -3.759  33.503  38.175 1.00 58.63 ? 332 GLU A N   1 
ATOM   695  C  CA  . GLU A 1 124 ? -4.424  34.518  38.992 1.00 58.51 ? 332 GLU A CA  1 
ATOM   696  C  C   . GLU A 1 124 ? -3.639  35.105  40.170 1.00 57.35 ? 332 GLU A C   1 
ATOM   697  O  O   . GLU A 1 124 ? -4.102  36.077  40.755 1.00 58.58 ? 332 GLU A O   1 
ATOM   698  C  CB  . GLU A 1 124 ? -5.806  34.021  39.442 1.00 60.28 ? 332 GLU A CB  1 
ATOM   699  C  CG  . GLU A 1 124 ? -5.836  32.738  40.255 1.00 62.31 ? 332 GLU A CG  1 
ATOM   700  C  CD  . GLU A 1 124 ? -7.187  32.023  40.176 1.00 65.79 ? 332 GLU A CD  1 
ATOM   701  O  OE1 . GLU A 1 124 ? -7.412  31.077  40.954 1.00 68.01 ? 332 GLU A OE1 1 
ATOM   702  O  OE2 . GLU A 1 124 ? -8.032  32.393  39.337 1.00 67.65 ? 332 GLU A OE2 1 
ATOM   703  N  N   . VAL A 1 125 ? -2.465  34.566  40.507 1.00 52.76 ? 333 VAL A N   1 
ATOM   704  C  CA  . VAL A 1 125 ? -1.677  35.126  41.618 1.00 50.41 ? 333 VAL A CA  1 
ATOM   705  C  C   . VAL A 1 125 ? -1.029  36.457  41.260 1.00 48.83 ? 333 VAL A C   1 
ATOM   706  O  O   . VAL A 1 125 ? -0.843  36.779  40.091 1.00 47.53 ? 333 VAL A O   1 
ATOM   707  C  CB  . VAL A 1 125 ? -0.561  34.182  42.135 1.00 51.14 ? 333 VAL A CB  1 
ATOM   708  C  CG1 . VAL A 1 125 ? -1.156  32.925  42.746 1.00 51.32 ? 333 VAL A CG1 1 
ATOM   709  C  CG2 . VAL A 1 125 ? 0.453   33.854  41.044 1.00 48.39 ? 333 VAL A CG2 1 
ATOM   710  N  N   . HIS A 1 126 ? -0.691  37.230  42.286 1.00 52.60 ? 334 HIS A N   1 
ATOM   711  C  CA  . HIS A 1 126 ? 0.042   38.477  42.110 1.00 55.47 ? 334 HIS A CA  1 
ATOM   712  C  C   . HIS A 1 126 ? 1.512   38.200  42.428 1.00 49.08 ? 334 HIS A C   1 
ATOM   713  O  O   . HIS A 1 126 ? 1.842   37.748  43.516 1.00 46.37 ? 334 HIS A O   1 
ATOM   714  C  CB  . HIS A 1 126 ? -0.533  39.580  43.018 1.00 59.00 ? 334 HIS A CB  1 
ATOM   715  C  CG  . HIS A 1 126 ? 0.207   40.884  42.942 1.00 67.36 ? 334 HIS A CG  1 
ATOM   716  N  ND1 . HIS A 1 126 ? 0.311   41.619  41.777 1.00 70.97 ? 334 HIS A ND1 1 
ATOM   717  C  CD2 . HIS A 1 126 ? 0.873   41.590  43.890 1.00 71.43 ? 334 HIS A CD2 1 
ATOM   718  C  CE1 . HIS A 1 126 ? 1.013   42.715  42.009 1.00 71.43 ? 334 HIS A CE1 1 
ATOM   719  N  NE2 . HIS A 1 126 ? 1.366   42.722  43.283 1.00 72.23 ? 334 HIS A NE2 1 
ATOM   720  N  N   . LEU A 1 127 ? 2.388   38.463  41.468 1.00 48.13 ? 335 LEU A N   1 
ATOM   721  C  CA  . LEU A 1 127 ? 3.823   38.320  41.692 1.00 46.40 ? 335 LEU A CA  1 
ATOM   722  C  C   . LEU A 1 127 ? 4.409   39.656  42.138 1.00 46.20 ? 335 LEU A C   1 
ATOM   723  O  O   . LEU A 1 127 ? 3.962   40.703  41.687 1.00 46.60 ? 335 LEU A O   1 
ATOM   724  C  CB  . LEU A 1 127 ? 4.514   37.848  40.409 1.00 45.19 ? 335 LEU A CB  1 
ATOM   725  C  CG  . LEU A 1 127 ? 4.105   36.473  39.861 1.00 46.95 ? 335 LEU A CG  1 
ATOM   726  C  CD1 . LEU A 1 127 ? 5.018   36.090  38.700 1.00 46.55 ? 335 LEU A CD1 1 
ATOM   727  C  CD2 . LEU A 1 127 ? 4.146   35.390  40.941 1.00 47.03 ? 335 LEU A CD2 1 
ATOM   728  N  N   . PRO A 1 128 ? 5.442   39.626  42.992 1.00 46.39 ? 336 PRO A N   1 
ATOM   729  C  CA  . PRO A 1 128 ? 6.128   40.860  43.374 1.00 46.42 ? 336 PRO A CA  1 
ATOM   730  C  C   . PRO A 1 128 ? 7.104   41.376  42.319 1.00 47.39 ? 336 PRO A C   1 
ATOM   731  O  O   . PRO A 1 128 ? 7.889   42.266  42.609 1.00 48.62 ? 336 PRO A O   1 
ATOM   732  C  CB  . PRO A 1 128 ? 6.882   40.453  44.640 1.00 47.22 ? 336 PRO A CB  1 
ATOM   733  C  CG  . PRO A 1 128 ? 7.202   39.015  44.410 1.00 47.95 ? 336 PRO A CG  1 
ATOM   734  C  CD  . PRO A 1 128 ? 6.005   38.455  43.686 1.00 46.77 ? 336 PRO A CD  1 
ATOM   735  N  N   . VAL A 1 129 ? 7.077   40.826  41.109 1.00 44.96 ? 337 VAL A N   1 
ATOM   736  C  CA  . VAL A 1 129 ? 7.889   41.361  40.024 1.00 44.75 ? 337 VAL A CA  1 
ATOM   737  C  C   . VAL A 1 129 ? 7.081   41.271  38.758 1.00 45.17 ? 337 VAL A C   1 
ATOM   738  O  O   . VAL A 1 129 ? 6.084   40.559  38.708 1.00 44.19 ? 337 VAL A O   1 
ATOM   739  C  CB  . VAL A 1 129 ? 9.224   40.596  39.825 1.00 47.36 ? 337 VAL A CB  1 
ATOM   740  C  CG1 . VAL A 1 129 ? 10.075  40.641  41.090 1.00 46.55 ? 337 VAL A CG1 1 
ATOM   741  C  CG2 . VAL A 1 129 ? 8.982   39.153  39.379 1.00 47.05 ? 337 VAL A CG2 1 
ATOM   742  N  N   . GLU A 1 130 ? 7.524   41.979  37.733 1.00 46.24 ? 338 GLU A N   1 
ATOM   743  C  CA  . GLU A 1 130 ? 6.835   41.964  36.452 1.00 50.54 ? 338 GLU A CA  1 
ATOM   744  C  C   . GLU A 1 130 ? 7.383   40.874  35.534 1.00 46.15 ? 338 GLU A C   1 
ATOM   745  O  O   . GLU A 1 130 ? 6.634   40.288  34.763 1.00 47.61 ? 338 GLU A O   1 
ATOM   746  C  CB  . GLU A 1 130 ? 6.926   43.340  35.791 1.00 55.44 ? 338 GLU A CB  1 
ATOM   747  C  CG  . GLU A 1 130 ? 6.523   44.457  36.747 1.00 60.36 ? 338 GLU A CG  1 
ATOM   748  C  CD  . GLU A 1 130 ? 6.060   45.717  36.054 1.00 66.37 ? 338 GLU A CD  1 
ATOM   749  O  OE1 . GLU A 1 130 ? 6.403   45.918  34.868 1.00 67.45 ? 338 GLU A OE1 1 
ATOM   750  O  OE2 . GLU A 1 130 ? 5.358   46.514  36.718 1.00 73.26 ? 338 GLU A OE2 1 
ATOM   751  N  N   . LYS A 1 131 ? 8.684   40.613  35.611 1.00 42.00 ? 339 LYS A N   1 
ATOM   752  C  CA  . LYS A 1 131 ? 9.308   39.577  34.795 1.00 41.54 ? 339 LYS A CA  1 
ATOM   753  C  C   . LYS A 1 131 ? 10.311  38.743  35.602 1.00 39.15 ? 339 LYS A C   1 
ATOM   754  O  O   . LYS A 1 131 ? 10.808  39.184  36.636 1.00 37.97 ? 339 LYS A O   1 
ATOM   755  C  CB  . LYS A 1 131 ? 10.011  40.198  33.587 1.00 42.58 ? 339 LYS A CB  1 
ATOM   756  C  CG  . LYS A 1 131 ? 9.112   41.033  32.681 1.00 43.41 ? 339 LYS A CG  1 
ATOM   757  C  CD  . LYS A 1 131 ? 8.150   40.186  31.874 1.00 42.54 ? 339 LYS A CD  1 
ATOM   758  C  CE  . LYS A 1 131 ? 7.113   41.056  31.181 1.00 44.60 ? 339 LYS A CE  1 
ATOM   759  N  NZ  . LYS A 1 131 ? 6.367   40.300  30.138 1.00 45.26 ? 339 LYS A NZ  1 
ATOM   760  N  N   . VAL A 1 132 ? 10.581  37.532  35.117 1.00 35.42 ? 340 VAL A N   1 
ATOM   761  C  CA  . VAL A 1 132 ? 11.581  36.642  35.714 1.00 34.48 ? 340 VAL A CA  1 
ATOM   762  C  C   . VAL A 1 132 ? 12.568  36.216  34.652 1.00 32.10 ? 340 VAL A C   1 
ATOM   763  O  O   . VAL A 1 132 ? 12.238  36.178  33.472 1.00 33.11 ? 340 VAL A O   1 
ATOM   764  C  CB  . VAL A 1 132 ? 10.950  35.380  36.344 1.00 33.32 ? 340 VAL A CB  1 
ATOM   765  C  CG1 . VAL A 1 132 ? 9.888   35.770  37.352 1.00 33.36 ? 340 VAL A CG1 1 
ATOM   766  C  CG2 . VAL A 1 132 ? 10.373  34.445  35.274 1.00 35.06 ? 340 VAL A CG2 1 
ATOM   767  N  N   . ASP A 1 133 ? 13.776  35.874  35.082 1.00 32.44 ? 341 ASP A N   1 
ATOM   768  C  CA  . ASP A 1 133 ? 14.828  35.473  34.165 1.00 32.04 ? 341 ASP A CA  1 
ATOM   769  C  C   . ASP A 1 133 ? 14.701  34.023  33.723 1.00 31.25 ? 341 ASP A C   1 
ATOM   770  O  O   . ASP A 1 133 ? 15.105  33.663  32.606 1.00 30.68 ? 341 ASP A O   1 
ATOM   771  C  CB  . ASP A 1 133 ? 16.174  35.665  34.835 1.00 34.50 ? 341 ASP A CB  1 
ATOM   772  C  CG  . ASP A 1 133 ? 16.398  37.100  35.259 1.00 35.57 ? 341 ASP A CG  1 
ATOM   773  O  OD1 . ASP A 1 133 ? 16.286  37.967  34.381 1.00 37.33 ? 341 ASP A OD1 1 
ATOM   774  O  OD2 . ASP A 1 133 ? 16.661  37.342  36.453 1.00 33.43 ? 341 ASP A OD2 1 
ATOM   775  N  N   . VAL A 1 134 ? 14.187  33.189  34.615 1.00 29.37 ? 342 VAL A N   1 
ATOM   776  C  CA  . VAL A 1 134 ? 14.212  31.746  34.401 1.00 29.90 ? 342 VAL A CA  1 
ATOM   777  C  C   . VAL A 1 134 ? 12.971  31.120  34.988 1.00 29.58 ? 342 VAL A C   1 
ATOM   778  O  O   . VAL A 1 134 ? 12.568  31.461  36.102 1.00 29.58 ? 342 VAL A O   1 
ATOM   779  C  CB  . VAL A 1 134 ? 15.447  31.083  35.060 1.00 30.74 ? 342 VAL A CB  1 
ATOM   780  C  CG1 . VAL A 1 134 ? 15.408  29.563  34.889 1.00 29.08 ? 342 VAL A CG1 1 
ATOM   781  C  CG2 . VAL A 1 134 ? 16.730  31.640  34.466 1.00 32.07 ? 342 VAL A CG2 1 
ATOM   782  N  N   . ILE A 1 135 ? 12.379  30.202  34.233 1.00 29.33 ? 343 ILE A N   1 
ATOM   783  C  CA  . ILE A 1 135 ? 11.265  29.384  34.728 1.00 30.71 ? 343 ILE A CA  1 
ATOM   784  C  C   . ILE A 1 135 ? 11.708  27.917  34.822 1.00 29.51 ? 343 ILE A C   1 
ATOM   785  O  O   . ILE A 1 135 ? 12.248  27.374  33.866 1.00 28.47 ? 343 ILE A O   1 
ATOM   786  C  CB  . ILE A 1 135 ? 10.053  29.473  33.792 1.00 30.94 ? 343 ILE A CB  1 
ATOM   787  C  CG1 . ILE A 1 135 ? 9.490   30.897  33.812 1.00 32.64 ? 343 ILE A CG1 1 
ATOM   788  C  CG2 . ILE A 1 135 ? 8.992   28.454  34.189 1.00 31.56 ? 343 ILE A CG2 1 
ATOM   789  C  CD1 . ILE A 1 135 ? 8.424   31.154  32.762 1.00 34.09 ? 343 ILE A CD1 1 
ATOM   790  N  N   . ILE A 1 136 ? 11.489  27.302  35.981 1.00 28.98 ? 344 ILE A N   1 
ATOM   791  C  CA  . ILE A 1 136 ? 11.726  25.869  36.172 1.00 30.26 ? 344 ILE A CA  1 
ATOM   792  C  C   . ILE A 1 136 ? 10.414  25.257  36.623 1.00 30.32 ? 344 ILE A C   1 
ATOM   793  O  O   . ILE A 1 136 ? 9.629   25.891  37.335 1.00 30.11 ? 344 ILE A O   1 
ATOM   794  C  CB  . ILE A 1 136 ? 12.849  25.557  37.200 1.00 31.44 ? 344 ILE A CB  1 
ATOM   795  C  CG1 . ILE A 1 136 ? 12.504  26.085  38.596 1.00 33.17 ? 344 ILE A CG1 1 
ATOM   796  C  CG2 . ILE A 1 136 ? 14.167  26.160  36.745 1.00 33.69 ? 344 ILE A CG2 1 
ATOM   797  C  CD1 . ILE A 1 136 ? 13.549  25.764  39.643 1.00 34.95 ? 344 ILE A CD1 1 
ATOM   798  N  N   . SER A 1 137 ? 10.165  24.026  36.201 1.00 29.40 ? 345 SER A N   1 
ATOM   799  C  CA  . SER A 1 137 ? 8.945   23.345  36.584 1.00 28.13 ? 345 SER A CA  1 
ATOM   800  C  C   . SER A 1 137 ? 9.076   21.853  36.384 1.00 27.13 ? 345 SER A C   1 
ATOM   801  O  O   . SER A 1 137 ? 9.686   21.406  35.403 1.00 26.56 ? 345 SER A O   1 
ATOM   802  C  CB  . SER A 1 137 ? 7.752   23.872  35.767 1.00 28.76 ? 345 SER A CB  1 
ATOM   803  O  OG  . SER A 1 137 ? 6.549   23.226  36.172 1.00 29.60 ? 345 SER A OG  1 
ATOM   804  N  N   . GLU A 1 138 ? 8.509   21.091  37.317 1.00 25.25 ? 346 GLU A N   1 
ATOM   805  C  CA  . GLU A 1 138 ? 8.200   19.686  37.068 1.00 26.01 ? 346 GLU A CA  1 
ATOM   806  C  C   . GLU A 1 138 ? 6.672   19.564  36.877 1.00 27.03 ? 346 GLU A C   1 
ATOM   807  O  O   . GLU A 1 138 ? 5.901   19.499  37.829 1.00 24.96 ? 346 GLU A O   1 
ATOM   808  C  CB  . GLU A 1 138 ? 8.744   18.813  38.195 1.00 26.14 ? 346 GLU A CB  1 
ATOM   809  C  CG  . GLU A 1 138 ? 8.972   17.375  37.785 1.00 26.31 ? 346 GLU A CG  1 
ATOM   810  C  CD  . GLU A 1 138 ? 7.677   16.604  37.668 1.00 26.23 ? 346 GLU A CD  1 
ATOM   811  O  OE1 . GLU A 1 138 ? 6.921   16.837  36.700 1.00 28.65 ? 346 GLU A OE1 1 
ATOM   812  O  OE2 . GLU A 1 138 ? 7.415   15.774  38.550 1.00 25.55 ? 346 GLU A OE2 1 
ATOM   813  N  N   . TRP A 1 139 ? 6.257   19.565  35.615 1.00 26.97 ? 347 TRP A N   1 
ATOM   814  C  CA  . TRP A 1 139 ? 4.856   19.683  35.236 1.00 28.28 ? 347 TRP A CA  1 
ATOM   815  C  C   . TRP A 1 139 ? 4.306   18.416  34.581 1.00 26.75 ? 347 TRP A C   1 
ATOM   816  O  O   . TRP A 1 139 ? 3.116   18.328  34.344 1.00 27.58 ? 347 TRP A O   1 
ATOM   817  C  CB  . TRP A 1 139 ? 4.685   20.862  34.254 1.00 28.56 ? 347 TRP A CB  1 
ATOM   818  C  CG  . TRP A 1 139 ? 5.643   20.791  33.084 1.00 29.22 ? 347 TRP A CG  1 
ATOM   819  C  CD1 . TRP A 1 139 ? 6.845   21.432  32.976 1.00 29.00 ? 347 TRP A CD1 1 
ATOM   820  C  CD2 . TRP A 1 139 ? 5.483   20.034  31.870 1.00 29.87 ? 347 TRP A CD2 1 
ATOM   821  N  NE1 . TRP A 1 139 ? 7.445   21.118  31.784 1.00 29.32 ? 347 TRP A NE1 1 
ATOM   822  C  CE2 . TRP A 1 139 ? 6.627   20.270  31.081 1.00 29.41 ? 347 TRP A CE2 1 
ATOM   823  C  CE3 . TRP A 1 139 ? 4.477   19.194  31.368 1.00 30.71 ? 347 TRP A CE3 1 
ATOM   824  C  CZ2 . TRP A 1 139 ? 6.802   19.693  29.822 1.00 29.64 ? 347 TRP A CZ2 1 
ATOM   825  C  CZ3 . TRP A 1 139 ? 4.653   18.618  30.120 1.00 30.37 ? 347 TRP A CZ3 1 
ATOM   826  C  CH2 . TRP A 1 139 ? 5.805   18.882  29.354 1.00 30.13 ? 347 TRP A CH2 1 
ATOM   827  N  N   . MET A 1 140 ? 5.170   17.449  34.306 1.00 26.85 ? 348 MET A N   1 
ATOM   828  C  CA  . MET A 1 140 ? 4.868   16.368  33.369 1.00 27.22 ? 348 MET A CA  1 
ATOM   829  C  C   . MET A 1 140 ? 3.890   15.355  33.954 1.00 26.63 ? 348 MET A C   1 
ATOM   830  O  O   . MET A 1 140 ? 3.987   14.999  35.111 1.00 24.95 ? 348 MET A O   1 
ATOM   831  C  CB  . MET A 1 140 ? 6.154   15.659  32.947 1.00 26.64 ? 348 MET A CB  1 
ATOM   832  C  CG  . MET A 1 140 ? 7.103   16.533  32.136 1.00 27.34 ? 348 MET A CG  1 
ATOM   833  S  SD  . MET A 1 140 ? 8.163   17.623  33.113 1.00 26.57 ? 348 MET A SD  1 
ATOM   834  C  CE  . MET A 1 140 ? 9.206   16.411  33.928 1.00 27.24 ? 348 MET A CE  1 
ATOM   835  N  N   . GLY A 1 141 ? 2.974   14.879  33.115 1.00 27.95 ? 349 GLY A N   1 
ATOM   836  C  CA  . GLY A 1 141 ? 2.016   13.847  33.491 1.00 27.85 ? 349 GLY A CA  1 
ATOM   837  C  C   . GLY A 1 141 ? 2.339   12.522  32.831 1.00 28.24 ? 349 GLY A C   1 
ATOM   838  O  O   . GLY A 1 141 ? 3.338   12.390  32.123 1.00 26.48 ? 349 GLY A O   1 
ATOM   839  N  N   . TYR A 1 142 ? 1.502   11.519  33.080 1.00 27.12 ? 350 TYR A N   1 
ATOM   840  C  CA  . TYR A 1 142 ? 1.662   10.245  32.402 1.00 27.92 ? 350 TYR A CA  1 
ATOM   841  C  C   . TYR A 1 142 ? 1.566   10.494  30.924 1.00 26.39 ? 350 TYR A C   1 
ATOM   842  O  O   . TYR A 1 142 ? 0.779   11.339  30.504 1.00 26.06 ? 350 TYR A O   1 
ATOM   843  C  CB  . TYR A 1 142 ? 0.583   9.251   32.823 1.00 29.30 ? 350 TYR A CB  1 
ATOM   844  C  CG  . TYR A 1 142 ? 0.618   8.927   34.281 1.00 30.59 ? 350 TYR A CG  1 
ATOM   845  C  CD1 . TYR A 1 142 ? 1.753   8.395   34.864 1.00 29.79 ? 350 TYR A CD1 1 
ATOM   846  C  CD2 . TYR A 1 142 ? -0.486  9.174   35.093 1.00 34.44 ? 350 TYR A CD2 1 
ATOM   847  C  CE1 . TYR A 1 142 ? 1.794   8.097   36.216 1.00 32.07 ? 350 TYR A CE1 1 
ATOM   848  C  CE2 . TYR A 1 142 ? -0.454  8.882   36.442 1.00 33.83 ? 350 TYR A CE2 1 
ATOM   849  C  CZ  . TYR A 1 142 ? 0.693   8.347   36.990 1.00 33.20 ? 350 TYR A CZ  1 
ATOM   850  O  OH  . TYR A 1 142 ? 0.726   8.054   38.320 1.00 36.97 ? 350 TYR A OH  1 
ATOM   851  N  N   . PHE A 1 143 ? 2.382   9.792   30.142 1.00 25.32 ? 351 PHE A N   1 
ATOM   852  C  CA  . PHE A 1 143 ? 2.429   9.999   28.682 1.00 26.82 ? 351 PHE A CA  1 
ATOM   853  C  C   . PHE A 1 143 ? 2.713   11.477  28.344 1.00 27.41 ? 351 PHE A C   1 
ATOM   854  O  O   . PHE A 1 143 ? 2.252   12.014  27.318 1.00 28.78 ? 351 PHE A O   1 
ATOM   855  C  CB  . PHE A 1 143 ? 1.130   9.483   28.015 1.00 26.95 ? 351 PHE A CB  1 
ATOM   856  C  CG  . PHE A 1 143 ? 1.217   9.310   26.512 1.00 26.97 ? 351 PHE A CG  1 
ATOM   857  C  CD1 . PHE A 1 143 ? 2.202   8.532   25.933 1.00 27.37 ? 351 PHE A CD1 1 
ATOM   858  C  CD2 . PHE A 1 143 ? 0.294   9.926   25.679 1.00 27.71 ? 351 PHE A CD2 1 
ATOM   859  C  CE1 . PHE A 1 143 ? 2.257   8.362   24.555 1.00 28.39 ? 351 PHE A CE1 1 
ATOM   860  C  CE2 . PHE A 1 143 ? 0.339   9.755   24.309 1.00 28.10 ? 351 PHE A CE2 1 
ATOM   861  C  CZ  . PHE A 1 143 ? 1.322   8.973   23.738 1.00 27.18 ? 351 PHE A CZ  1 
ATOM   862  N  N   . LEU A 1 144 ? 3.485   12.119  29.227 1.00 27.96 ? 352 LEU A N   1 
ATOM   863  C  CA  . LEU A 1 144 ? 3.868   13.537  29.158 1.00 27.32 ? 352 LEU A CA  1 
ATOM   864  C  C   . LEU A 1 144 ? 2.693   14.479  29.414 1.00 29.10 ? 352 LEU A C   1 
ATOM   865  O  O   . LEU A 1 144 ? 2.788   15.349  30.289 1.00 27.73 ? 352 LEU A O   1 
ATOM   866  C  CB  . LEU A 1 144 ? 4.601   13.910  27.850 1.00 27.59 ? 352 LEU A CB  1 
ATOM   867  C  CG  . LEU A 1 144 ? 5.278   15.303  27.882 1.00 28.55 ? 352 LEU A CG  1 
ATOM   868  C  CD1 . LEU A 1 144 ? 6.490   15.274  28.795 1.00 28.11 ? 352 LEU A CD1 1 
ATOM   869  C  CD2 . LEU A 1 144 ? 5.673   15.843  26.502 1.00 28.01 ? 352 LEU A CD2 1 
ATOM   870  N  N   . LEU A 1 145 ? 1.576   14.282  28.711 1.00 29.67 ? 353 LEU A N   1 
ATOM   871  C  CA  . LEU A 1 145 ? 0.507   15.277  28.714 1.00 31.83 ? 353 LEU A CA  1 
ATOM   872  C  C   . LEU A 1 145 ? -0.768  14.944  29.507 1.00 33.75 ? 353 LEU A C   1 
ATOM   873  O  O   . LEU A 1 145 ? -1.604  15.825  29.658 1.00 35.16 ? 353 LEU A O   1 
ATOM   874  C  CB  . LEU A 1 145 ? 0.133   15.629  27.264 1.00 32.31 ? 353 LEU A CB  1 
ATOM   875  C  CG  . LEU A 1 145 ? 1.274   16.044  26.334 1.00 32.81 ? 353 LEU A CG  1 
ATOM   876  C  CD1 . LEU A 1 145 ? 0.808   16.154  24.887 1.00 34.95 ? 353 LEU A CD1 1 
ATOM   877  C  CD2 . LEU A 1 145 ? 1.888   17.347  26.792 1.00 32.71 ? 353 LEU A CD2 1 
ATOM   878  N  N   . PHE A 1 146 ? -0.956  13.722  30.006 1.00 34.61 ? 354 PHE A N   1 
ATOM   879  C  CA  . PHE A 1 146 ? -2.179  13.458  30.805 1.00 37.14 ? 354 PHE A CA  1 
ATOM   880  C  C   . PHE A 1 146 ? -2.123  14.249  32.104 1.00 36.65 ? 354 PHE A C   1 
ATOM   881  O  O   . PHE A 1 146 ? -1.194  14.074  32.882 1.00 37.01 ? 354 PHE A O   1 
ATOM   882  C  CB  . PHE A 1 146 ? -2.368  11.977  31.131 1.00 40.69 ? 354 PHE A CB  1 
ATOM   883  C  CG  . PHE A 1 146 ? -2.817  11.127  29.953 1.00 43.79 ? 354 PHE A CG  1 
ATOM   884  C  CD1 . PHE A 1 146 ? -4.028  11.376  29.305 1.00 47.60 ? 354 PHE A CD1 1 
ATOM   885  C  CD2 . PHE A 1 146 ? -2.060  10.031  29.535 1.00 46.19 ? 354 PHE A CD2 1 
ATOM   886  C  CE1 . PHE A 1 146 ? -4.449  10.583  28.240 1.00 49.18 ? 354 PHE A CE1 1 
ATOM   887  C  CE2 . PHE A 1 146 ? -2.479  9.233   28.472 1.00 48.33 ? 354 PHE A CE2 1 
ATOM   888  C  CZ  . PHE A 1 146 ? -3.673  9.511   27.820 1.00 49.62 ? 354 PHE A CZ  1 
ATOM   889  N  N   . GLU A 1 147 ? -3.101  15.131  32.324 1.00 36.34 ? 355 GLU A N   1 
ATOM   890  C  CA  . GLU A 1 147 ? -3.197  15.919  33.566 1.00 39.58 ? 355 GLU A CA  1 
ATOM   891  C  C   . GLU A 1 147 ? -1.901  16.633  33.950 1.00 37.80 ? 355 GLU A C   1 
ATOM   892  O  O   . GLU A 1 147 ? -1.550  16.719  35.121 1.00 38.06 ? 355 GLU A O   1 
ATOM   893  C  CB  . GLU A 1 147 ? -3.652  15.029  34.722 1.00 45.20 ? 355 GLU A CB  1 
ATOM   894  C  CG  . GLU A 1 147 ? -4.987  14.353  34.483 1.00 49.92 ? 355 GLU A CG  1 
ATOM   895  C  CD  . GLU A 1 147 ? -5.704  14.039  35.782 1.00 55.99 ? 355 GLU A CD  1 
ATOM   896  O  OE1 . GLU A 1 147 ? -5.146  13.286  36.608 1.00 57.39 ? 355 GLU A OE1 1 
ATOM   897  O  OE2 . GLU A 1 147 ? -6.820  14.560  35.984 1.00 63.25 ? 355 GLU A OE2 1 
ATOM   898  N  N   . SER A 1 148 ? -1.210  17.152  32.941 1.00 37.81 ? 356 SER A N   1 
ATOM   899  C  CA  . SER A 1 148 ? 0.056   17.833  33.119 1.00 36.91 ? 356 SER A CA  1 
ATOM   900  C  C   . SER A 1 148 ? -0.204  19.316  33.403 1.00 39.58 ? 356 SER A C   1 
ATOM   901  O  O   . SER A 1 148 ? -1.274  19.828  33.101 1.00 39.52 ? 356 SER A O   1 
ATOM   902  C  CB  . SER A 1 148 ? 0.903   17.697  31.852 1.00 35.35 ? 356 SER A CB  1 
ATOM   903  O  OG  . SER A 1 148 ? 0.732   18.810  30.973 1.00 33.75 ? 356 SER A OG  1 
ATOM   904  N  N   . MET A 1 149 ? 0.792   20.008  33.946 1.00 39.62 ? 357 MET A N   1 
ATOM   905  C  CA  . MET A 1 149 ? 0.675   21.441  34.184 1.00 40.74 ? 357 MET A CA  1 
ATOM   906  C  C   . MET A 1 149 ? 1.339   22.256  33.075 1.00 36.47 ? 357 MET A C   1 
ATOM   907  O  O   . MET A 1 149 ? 1.656   23.417  33.289 1.00 32.83 ? 357 MET A O   1 
ATOM   908  C  CB  . MET A 1 149 ? 1.294   21.813  35.540 1.00 47.37 ? 357 MET A CB  1 
ATOM   909  C  CG  . MET A 1 149 ? 0.901   20.907  36.700 1.00 56.08 ? 357 MET A CG  1 
ATOM   910  S  SD  . MET A 1 149 ? -0.858  20.955  37.100 1.00 75.44 ? 357 MET A SD  1 
ATOM   911  C  CE  . MET A 1 149 ? -1.059  19.425  38.025 1.00 73.88 ? 357 MET A CE  1 
ATOM   912  N  N   . LEU A 1 150 ? 1.546   21.671  31.893 1.00 35.59 ? 358 LEU A N   1 
ATOM   913  C  CA  . LEU A 1 150 ? 2.238   22.397  30.820 1.00 36.86 ? 358 LEU A CA  1 
ATOM   914  C  C   . LEU A 1 150 ? 1.500   23.680  30.448 1.00 37.76 ? 358 LEU A C   1 
ATOM   915  O  O   . LEU A 1 150 ? 2.134   24.682  30.135 1.00 34.67 ? 358 LEU A O   1 
ATOM   916  C  CB  . LEU A 1 150 ? 2.455   21.536  29.566 1.00 36.75 ? 358 LEU A CB  1 
ATOM   917  C  CG  . LEU A 1 150 ? 3.241   22.196  28.409 1.00 37.39 ? 358 LEU A CG  1 
ATOM   918  C  CD1 . LEU A 1 150 ? 4.542   22.838  28.861 1.00 37.80 ? 358 LEU A CD1 1 
ATOM   919  C  CD2 . LEU A 1 150 ? 3.560   21.205  27.301 1.00 36.66 ? 358 LEU A CD2 1 
ATOM   920  N  N   . ASP A 1 151 ? 0.170   23.662  30.494 1.00 38.40 ? 359 ASP A N   1 
ATOM   921  C  CA  . ASP A 1 151 ? -0.597  24.868  30.127 1.00 41.62 ? 359 ASP A CA  1 
ATOM   922  C  C   . ASP A 1 151 ? -0.260  26.038  31.058 1.00 38.68 ? 359 ASP A C   1 
ATOM   923  O  O   . ASP A 1 151 ? -0.135  27.160  30.596 1.00 37.67 ? 359 ASP A O   1 
ATOM   924  C  CB  . ASP A 1 151 ? -2.100  24.592  30.091 1.00 44.13 ? 359 ASP A CB  1 
ATOM   925  C  CG  . ASP A 1 151 ? -2.513  23.729  28.885 1.00 50.94 ? 359 ASP A CG  1 
ATOM   926  O  OD1 . ASP A 1 151 ? -1.644  23.330  28.068 1.00 57.78 ? 359 ASP A OD1 1 
ATOM   927  O  OD2 . ASP A 1 151 ? -3.725  23.455  28.738 1.00 55.27 ? 359 ASP A OD2 1 
ATOM   928  N  N   . SER A 1 152 ? -0.075  25.768  32.347 1.00 38.02 ? 360 SER A N   1 
ATOM   929  C  CA  . SER A 1 152 ? 0.367   26.795  33.293 1.00 38.37 ? 360 SER A CA  1 
ATOM   930  C  C   . SER A 1 152 ? 1.798   27.284  33.026 1.00 36.81 ? 360 SER A C   1 
ATOM   931  O  O   . SER A 1 152 ? 2.077   28.477  33.157 1.00 35.96 ? 360 SER A O   1 
ATOM   932  C  CB  . SER A 1 152 ? 0.280   26.277  34.720 1.00 42.02 ? 360 SER A CB  1 
ATOM   933  O  OG  . SER A 1 152 ? -1.056  25.980  35.057 1.00 45.62 ? 360 SER A OG  1 
ATOM   934  N  N   . VAL A 1 153 ? 2.701   26.360  32.686 1.00 33.45 ? 361 VAL A N   1 
ATOM   935  C  CA  . VAL A 1 153 ? 4.063   26.721  32.350 1.00 32.58 ? 361 VAL A CA  1 
ATOM   936  C  C   . VAL A 1 153 ? 4.071   27.624  31.101 1.00 33.67 ? 361 VAL A C   1 
ATOM   937  O  O   . VAL A 1 153 ? 4.780   28.629  31.059 1.00 32.40 ? 361 VAL A O   1 
ATOM   938  C  CB  . VAL A 1 153 ? 4.964   25.471  32.155 1.00 33.15 ? 361 VAL A CB  1 
ATOM   939  C  CG1 . VAL A 1 153 ? 6.343   25.853  31.636 1.00 31.93 ? 361 VAL A CG1 1 
ATOM   940  C  CG2 . VAL A 1 153 ? 5.112   24.700  33.467 1.00 32.47 ? 361 VAL A CG2 1 
ATOM   941  N  N   . LEU A 1 154 ? 3.288   27.281  30.089 1.00 32.53 ? 362 LEU A N   1 
ATOM   942  C  CA  . LEU A 1 154 ? 3.256   28.098  28.883 1.00 35.75 ? 362 LEU A CA  1 
ATOM   943  C  C   . LEU A 1 154 ? 2.646   29.477  29.163 1.00 36.63 ? 362 LEU A C   1 
ATOM   944  O  O   . LEU A 1 154 ? 3.139   30.486  28.667 1.00 37.06 ? 362 LEU A O   1 
ATOM   945  C  CB  . LEU A 1 154 ? 2.522   27.377  27.762 1.00 35.82 ? 362 LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 154 ? 3.210   26.096  27.302 1.00 35.86 ? 362 LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 154 ? 2.412   25.432  26.187 1.00 36.39 ? 362 LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 154 ? 4.649   26.348  26.868 1.00 37.25 ? 362 LEU A CD2 1 
ATOM   949  N  N   . TYR A 1 155 ? 1.604   29.513  29.987 1.00 37.80 ? 363 TYR A N   1 
ATOM   950  C  CA  . TYR A 1 155 ? 1.034   30.766  30.457 1.00 39.21 ? 363 TYR A CA  1 
ATOM   951  C  C   . TYR A 1 155 ? 2.102   31.614  31.156 1.00 41.44 ? 363 TYR A C   1 
ATOM   952  O  O   . TYR A 1 155 ? 2.264   32.801  30.841 1.00 41.63 ? 363 TYR A O   1 
ATOM   953  C  CB  . TYR A 1 155 ? -0.148  30.516  31.404 1.00 42.12 ? 363 TYR A CB  1 
ATOM   954  C  CG  . TYR A 1 155 ? -0.758  31.796  31.931 1.00 46.85 ? 363 TYR A CG  1 
ATOM   955  C  CD1 . TYR A 1 155 ? -0.225  32.430  33.054 1.00 48.06 ? 363 TYR A CD1 1 
ATOM   956  C  CD2 . TYR A 1 155 ? -1.842  32.398  31.287 1.00 48.18 ? 363 TYR A CD2 1 
ATOM   957  C  CE1 . TYR A 1 155 ? -0.754  33.616  33.528 1.00 49.60 ? 363 TYR A CE1 1 
ATOM   958  C  CE2 . TYR A 1 155 ? -2.382  33.587  31.762 1.00 49.81 ? 363 TYR A CE2 1 
ATOM   959  C  CZ  . TYR A 1 155 ? -1.831  34.188  32.883 1.00 50.93 ? 363 TYR A CZ  1 
ATOM   960  O  OH  . TYR A 1 155 ? -2.350  35.358  33.381 1.00 56.38 ? 363 TYR A OH  1 
ATOM   961  N  N   . ALA A 1 156 ? 2.833   31.011  32.099 1.00 37.27 ? 364 ALA A N   1 
ATOM   962  C  CA  . ALA A 1 156 ? 3.878   31.740  32.812 1.00 34.54 ? 364 ALA A CA  1 
ATOM   963  C  C   . ALA A 1 156 ? 4.944   32.254  31.856 1.00 34.24 ? 364 ALA A C   1 
ATOM   964  O  O   . ALA A 1 156 ? 5.422   33.370  32.004 1.00 36.40 ? 364 ALA A O   1 
ATOM   965  C  CB  . ALA A 1 156 ? 4.509   30.871  33.893 1.00 34.45 ? 364 ALA A CB  1 
ATOM   966  N  N   . LYS A 1 157 ? 5.338   31.446  30.882 1.00 34.50 ? 365 LYS A N   1 
ATOM   967  C  CA  . LYS A 1 157 ? 6.302   31.898  29.882 1.00 37.87 ? 365 LYS A CA  1 
ATOM   968  C  C   . LYS A 1 157 ? 5.829   33.172  29.162 1.00 41.73 ? 365 LYS A C   1 
ATOM   969  O  O   . LYS A 1 157 ? 6.568   34.155  29.067 1.00 42.29 ? 365 LYS A O   1 
ATOM   970  C  CB  . LYS A 1 157 ? 6.563   30.799  28.857 1.00 37.76 ? 365 LYS A CB  1 
ATOM   971  C  CG  . LYS A 1 157 ? 7.478   31.224  27.725 1.00 40.41 ? 365 LYS A CG  1 
ATOM   972  C  CD  . LYS A 1 157 ? 7.558   30.190  26.630 1.00 42.83 ? 365 LYS A CD  1 
ATOM   973  C  CE  . LYS A 1 157 ? 6.268   30.118  25.822 1.00 47.25 ? 365 LYS A CE  1 
ATOM   974  N  NZ  . LYS A 1 157 ? 6.398   29.180  24.670 1.00 49.88 ? 365 LYS A NZ  1 
ATOM   975  N  N   . ASN A 1 158 ? 4.601   33.147  28.659 1.00 43.56 ? 366 ASN A N   1 
ATOM   976  C  CA  . ASN A 1 158 ? 4.082   34.252  27.842 1.00 45.41 ? 366 ASN A CA  1 
ATOM   977  C  C   . ASN A 1 158 ? 3.822   35.509  28.649 1.00 44.34 ? 366 ASN A C   1 
ATOM   978  O  O   . ASN A 1 158 ? 4.036   36.608  28.160 1.00 45.81 ? 366 ASN A O   1 
ATOM   979  C  CB  . ASN A 1 158 ? 2.799   33.827  27.129 1.00 46.09 ? 366 ASN A CB  1 
ATOM   980  C  CG  . ASN A 1 158 ? 3.046   32.736  26.114 1.00 48.48 ? 366 ASN A CG  1 
ATOM   981  O  OD1 . ASN A 1 158 ? 4.004   32.793  25.338 1.00 52.58 ? 366 ASN A OD1 1 
ATOM   982  N  ND2 . ASN A 1 158 ? 2.188   31.729  26.113 1.00 52.98 ? 366 ASN A ND2 1 
ATOM   983  N  N   . LYS A 1 159 ? 3.377   35.346  29.886 1.00 42.03 ? 367 LYS A N   1 
ATOM   984  C  CA  . LYS A 1 159 ? 3.067   36.485  30.731 1.00 43.82 ? 367 LYS A CA  1 
ATOM   985  C  C   . LYS A 1 159 ? 4.295   37.013  31.475 1.00 43.13 ? 367 LYS A C   1 
ATOM   986  O  O   . LYS A 1 159 ? 4.464   38.227  31.600 1.00 41.25 ? 367 LYS A O   1 
ATOM   987  C  CB  . LYS A 1 159 ? 1.964   36.116  31.730 1.00 45.46 ? 367 LYS A CB  1 
ATOM   988  C  CG  . LYS A 1 159 ? 1.424   37.295  32.541 1.00 49.83 ? 367 LYS A CG  1 
ATOM   989  C  CD  . LYS A 1 159 ? 0.445   36.851  33.623 1.00 51.57 ? 367 LYS A CD  1 
ATOM   990  N  N   . TYR A 1 160 ? 5.160   36.124  31.967 1.00 40.79 ? 368 TYR A N   1 
ATOM   991  C  CA  . TYR A 1 160 ? 6.185   36.552  32.921 1.00 39.06 ? 368 TYR A CA  1 
ATOM   992  C  C   . TYR A 1 160 ? 7.648   36.372  32.528 1.00 38.95 ? 368 TYR A C   1 
ATOM   993  O  O   . TYR A 1 160 ? 8.521   36.940  33.192 1.00 39.87 ? 368 TYR A O   1 
ATOM   994  C  CB  . TYR A 1 160 ? 5.961   35.879  34.271 1.00 38.33 ? 368 TYR A CB  1 
ATOM   995  C  CG  . TYR A 1 160 ? 4.692   36.268  34.991 1.00 40.52 ? 368 TYR A CG  1 
ATOM   996  C  CD1 . TYR A 1 160 ? 4.461   37.586  35.396 1.00 44.10 ? 368 TYR A CD1 1 
ATOM   997  C  CD2 . TYR A 1 160 ? 3.735   35.311  35.314 1.00 40.51 ? 368 TYR A CD2 1 
ATOM   998  C  CE1 . TYR A 1 160 ? 3.300   37.935  36.080 1.00 44.83 ? 368 TYR A CE1 1 
ATOM   999  C  CE2 . TYR A 1 160 ? 2.576   35.645  35.991 1.00 42.20 ? 368 TYR A CE2 1 
ATOM   1000 C  CZ  . TYR A 1 160 ? 2.356   36.955  36.373 1.00 45.72 ? 368 TYR A CZ  1 
ATOM   1001 O  OH  . TYR A 1 160 ? 1.197   37.268  37.053 1.00 44.94 ? 368 TYR A OH  1 
ATOM   1002 N  N   . LEU A 1 161 ? 7.952   35.604  31.488 1.00 38.42 ? 369 LEU A N   1 
ATOM   1003 C  CA  . LEU A 1 161 ? 9.353   35.342  31.182 1.00 37.47 ? 369 LEU A CA  1 
ATOM   1004 C  C   . LEU A 1 161 ? 9.957   36.568  30.528 1.00 40.39 ? 369 LEU A C   1 
ATOM   1005 O  O   . LEU A 1 161 ? 9.395   37.076  29.568 1.00 40.53 ? 369 LEU A O   1 
ATOM   1006 C  CB  . LEU A 1 161 ? 9.518   34.159  30.239 1.00 36.22 ? 369 LEU A CB  1 
ATOM   1007 C  CG  . LEU A 1 161 ? 10.971  33.722  30.019 1.00 34.99 ? 369 LEU A CG  1 
ATOM   1008 C  CD1 . LEU A 1 161 ? 11.627  33.284  31.327 1.00 33.40 ? 369 LEU A CD1 1 
ATOM   1009 C  CD2 . LEU A 1 161 ? 11.020  32.606  28.979 1.00 35.59 ? 369 LEU A CD2 1 
ATOM   1010 N  N   . ALA A 1 162 ? 11.103  37.023  31.022 1.00 38.90 ? 370 ALA A N   1 
ATOM   1011 C  CA  . ALA A 1 162 ? 11.759  38.189  30.424 1.00 41.49 ? 370 ALA A CA  1 
ATOM   1012 C  C   . ALA A 1 162 ? 12.221  37.852  29.005 1.00 42.83 ? 370 ALA A C   1 
ATOM   1013 O  O   . ALA A 1 162 ? 12.489  36.687  28.698 1.00 41.94 ? 370 ALA A O   1 
ATOM   1014 C  CB  . ALA A 1 162 ? 12.929  38.635  31.280 1.00 41.02 ? 370 ALA A CB  1 
ATOM   1015 N  N   . LYS A 1 163 ? 12.277  38.863  28.136 1.00 42.28 ? 371 LYS A N   1 
ATOM   1016 C  CA  . LYS A 1 163 ? 12.826  38.701  26.791 1.00 41.98 ? 371 LYS A CA  1 
ATOM   1017 C  C   . LYS A 1 163 ? 14.214  38.124  26.943 1.00 41.00 ? 371 LYS A C   1 
ATOM   1018 O  O   . LYS A 1 163 ? 14.995  38.595  27.753 1.00 43.19 ? 371 LYS A O   1 
ATOM   1019 C  CB  . LYS A 1 163 ? 12.894  40.048  26.054 1.00 44.19 ? 371 LYS A CB  1 
ATOM   1020 N  N   . GLY A 1 164 ? 14.512  37.069  26.204 1.00 40.06 ? 372 GLY A N   1 
ATOM   1021 C  CA  . GLY A 1 164 ? 15.801  36.408  26.334 1.00 39.84 ? 372 GLY A CA  1 
ATOM   1022 C  C   . GLY A 1 164 ? 15.939  35.440  27.511 1.00 39.53 ? 372 GLY A C   1 
ATOM   1023 O  O   . GLY A 1 164 ? 16.957  34.765  27.620 1.00 40.57 ? 372 GLY A O   1 
ATOM   1024 N  N   . GLY A 1 165 ? 14.934  35.343  28.377 1.00 37.90 ? 373 GLY A N   1 
ATOM   1025 C  CA  . GLY A 1 165 ? 14.965  34.372  29.487 1.00 37.54 ? 373 GLY A CA  1 
ATOM   1026 C  C   . GLY A 1 165 ? 14.810  32.912  29.036 1.00 36.04 ? 373 GLY A C   1 
ATOM   1027 O  O   . GLY A 1 165 ? 14.696  32.627  27.842 1.00 32.97 ? 373 GLY A O   1 
ATOM   1028 N  N   . SER A 1 166 ? 14.795  31.986  29.996 1.00 32.99 ? 374 SER A N   1 
ATOM   1029 C  CA  . SER A 1 166 ? 14.747  30.567  29.681 1.00 33.25 ? 374 SER A CA  1 
ATOM   1030 C  C   . SER A 1 166 ? 13.769  29.747  30.554 1.00 29.99 ? 374 SER A C   1 
ATOM   1031 O  O   . SER A 1 166 ? 13.467  30.107  31.688 1.00 28.99 ? 374 SER A O   1 
ATOM   1032 C  CB  . SER A 1 166 ? 16.160  29.977  29.766 1.00 36.19 ? 374 SER A CB  1 
ATOM   1033 O  OG  . SER A 1 166 ? 17.043  30.640  28.878 1.00 37.11 ? 374 SER A OG  1 
ATOM   1034 N  N   . VAL A 1 167 ? 13.297  28.643  29.984 1.00 29.57 ? 375 VAL A N   1 
ATOM   1035 C  CA  . VAL A 1 167 ? 12.323  27.742  30.578 1.00 30.58 ? 375 VAL A CA  1 
ATOM   1036 C  C   . VAL A 1 167 ? 12.952  26.355  30.590 1.00 29.34 ? 375 VAL A C   1 
ATOM   1037 O  O   . VAL A 1 167 ? 13.461  25.905  29.564 1.00 27.61 ? 375 VAL A O   1 
ATOM   1038 C  CB  . VAL A 1 167 ? 11.044  27.643  29.715 1.00 32.23 ? 375 VAL A CB  1 
ATOM   1039 C  CG1 . VAL A 1 167 ? 10.011  26.756  30.392 1.00 33.80 ? 375 VAL A CG1 1 
ATOM   1040 C  CG2 . VAL A 1 167 ? 10.453  29.018  29.451 1.00 34.53 ? 375 VAL A CG2 1 
ATOM   1041 N  N   . TYR A 1 168 ? 12.885  25.663  31.725 1.00 27.93 ? 376 TYR A N   1 
ATOM   1042 C  CA  . TYR A 1 168 ? 13.489  24.337  31.847 1.00 26.50 ? 376 TYR A CA  1 
ATOM   1043 C  C   . TYR A 1 168 ? 12.551  23.409  32.594 1.00 26.82 ? 376 TYR A C   1 
ATOM   1044 O  O   . TYR A 1 168 ? 11.930  23.837  33.569 1.00 26.62 ? 376 TYR A O   1 
ATOM   1045 C  CB  . TYR A 1 168 ? 14.805  24.384  32.618 1.00 26.20 ? 376 TYR A CB  1 
ATOM   1046 C  CG  . TYR A 1 168 ? 15.876  25.208  31.956 1.00 26.31 ? 376 TYR A CG  1 
ATOM   1047 C  CD1 . TYR A 1 168 ? 16.658  24.671  30.944 1.00 26.13 ? 376 TYR A CD1 1 
ATOM   1048 C  CD2 . TYR A 1 168 ? 16.124  26.513  32.359 1.00 25.98 ? 376 TYR A CD2 1 
ATOM   1049 C  CE1 . TYR A 1 168 ? 17.647  25.419  30.328 1.00 25.81 ? 376 TYR A CE1 1 
ATOM   1050 C  CE2 . TYR A 1 168 ? 17.115  27.279  31.752 1.00 27.83 ? 376 TYR A CE2 1 
ATOM   1051 C  CZ  . TYR A 1 168 ? 17.880  26.711  30.739 1.00 27.36 ? 376 TYR A CZ  1 
ATOM   1052 O  OH  . TYR A 1 168 ? 18.852  27.438  30.109 1.00 28.39 ? 376 TYR A OH  1 
ATOM   1053 N  N   . PRO A 1 169 ? 12.480  22.139  32.187 1.00 26.97 ? 377 PRO A N   1 
ATOM   1054 C  CA  . PRO A 1 169 ? 13.239  21.595  31.060 1.00 26.63 ? 377 PRO A CA  1 
ATOM   1055 C  C   . PRO A 1 169 ? 12.769  22.173  29.740 1.00 26.34 ? 377 PRO A C   1 
ATOM   1056 O  O   . PRO A 1 169 ? 11.582  22.454  29.583 1.00 27.79 ? 377 PRO A O   1 
ATOM   1057 C  CB  . PRO A 1 169 ? 12.925  20.095  31.110 1.00 27.99 ? 377 PRO A CB  1 
ATOM   1058 C  CG  . PRO A 1 169 ? 11.618  19.996  31.827 1.00 27.67 ? 377 PRO A CG  1 
ATOM   1059 C  CD  . PRO A 1 169 ? 11.609  21.126  32.812 1.00 28.58 ? 377 PRO A CD  1 
ATOM   1060 N  N   . ASP A 1 170 ? 13.689  22.369  28.807 1.00 25.91 ? 378 ASP A N   1 
ATOM   1061 C  CA  . ASP A 1 170 ? 13.369  23.100  27.592 1.00 27.16 ? 378 ASP A CA  1 
ATOM   1062 C  C   . ASP A 1 170 ? 12.903  22.226  26.428 1.00 28.07 ? 378 ASP A C   1 
ATOM   1063 O  O   . ASP A 1 170 ? 12.221  22.721  25.549 1.00 29.97 ? 378 ASP A O   1 
ATOM   1064 C  CB  . ASP A 1 170 ? 14.519  24.049  27.157 1.00 26.78 ? 378 ASP A CB  1 
ATOM   1065 C  CG  . ASP A 1 170 ? 15.889  23.386  27.116 1.00 27.31 ? 378 ASP A CG  1 
ATOM   1066 O  OD1 . ASP A 1 170 ? 16.235  22.583  28.012 1.00 28.30 ? 378 ASP A OD1 1 
ATOM   1067 O  OD2 . ASP A 1 170 ? 16.659  23.712  26.197 1.00 28.16 ? 378 ASP A OD2 1 
ATOM   1068 N  N   . ILE A 1 171 ? 13.273  20.947  26.412 1.00 26.99 ? 379 ILE A N   1 
ATOM   1069 C  CA  . ILE A 1 171 ? 12.923  20.066  25.300 1.00 28.95 ? 379 ILE A CA  1 
ATOM   1070 C  C   . ILE A 1 171 ? 12.341  18.750  25.830 1.00 29.35 ? 379 ILE A C   1 
ATOM   1071 O  O   . ILE A 1 171 ? 12.871  18.173  26.783 1.00 29.25 ? 379 ILE A O   1 
ATOM   1072 C  CB  . ILE A 1 171 ? 14.148  19.773  24.406 1.00 29.30 ? 379 ILE A CB  1 
ATOM   1073 C  CG1 . ILE A 1 171 ? 14.760  21.076  23.879 1.00 31.75 ? 379 ILE A CG1 1 
ATOM   1074 C  CG2 . ILE A 1 171 ? 13.792  18.856  23.241 1.00 29.68 ? 379 ILE A CG2 1 
ATOM   1075 C  CD1 . ILE A 1 171 ? 15.991  20.857  23.039 1.00 32.75 ? 379 ILE A CD1 1 
ATOM   1076 N  N   . CYS A 1 172 ? 11.261  18.297  25.195 1.00 28.28 ? 380 CYS A N   1 
ATOM   1077 C  CA  . CYS A 1 172 ? 10.528  17.081  25.576 1.00 30.40 ? 380 CYS A CA  1 
ATOM   1078 C  C   . CYS A 1 172 ? 10.187  16.315  24.318 1.00 30.48 ? 380 CYS A C   1 
ATOM   1079 O  O   . CYS A 1 172 ? 9.868   16.932  23.296 1.00 29.16 ? 380 CYS A O   1 
ATOM   1080 C  CB  . CYS A 1 172 ? 9.211   17.449  26.285 1.00 30.98 ? 380 CYS A CB  1 
ATOM   1081 S  SG  . CYS A 1 172 ? 9.483   18.449  27.753 1.00 39.50 ? 380 CYS A SG  1 
ATOM   1082 N  N   . THR A 1 173 ? 10.244  14.985  24.381 1.00 29.32 ? 381 THR A N   1 
ATOM   1083 C  CA  . THR A 1 173 ? 9.767   14.164  23.278 1.00 27.61 ? 381 THR A CA  1 
ATOM   1084 C  C   . THR A 1 173 ? 8.841   13.087  23.802 1.00 26.77 ? 381 THR A C   1 
ATOM   1085 O  O   . THR A 1 173 ? 8.939   12.695  24.963 1.00 26.36 ? 381 THR A O   1 
ATOM   1086 C  CB  . THR A 1 173 ? 10.897  13.492  22.486 1.00 26.71 ? 381 THR A CB  1 
ATOM   1087 O  OG1 . THR A 1 173 ? 11.598  12.572  23.323 1.00 29.53 ? 381 THR A OG1 1 
ATOM   1088 C  CG2 . THR A 1 173 ? 11.872  14.529  21.925 1.00 27.93 ? 381 THR A CG2 1 
ATOM   1089 N  N   . ILE A 1 174 ? 7.956   12.609  22.928 1.00 24.92 ? 382 ILE A N   1 
ATOM   1090 C  CA  . ILE A 1 174 ? 7.106   11.450  23.198 1.00 25.08 ? 382 ILE A CA  1 
ATOM   1091 C  C   . ILE A 1 174 ? 7.422   10.390  22.146 1.00 25.71 ? 382 ILE A C   1 
ATOM   1092 O  O   . ILE A 1 174 ? 7.585   10.723  20.950 1.00 25.26 ? 382 ILE A O   1 
ATOM   1093 C  CB  . ILE A 1 174 ? 5.610   11.811  23.107 1.00 24.68 ? 382 ILE A CB  1 
ATOM   1094 C  CG1 . ILE A 1 174 ? 5.252   12.921  24.103 1.00 25.53 ? 382 ILE A CG1 1 
ATOM   1095 C  CG2 . ILE A 1 174 ? 4.731   10.586  23.343 1.00 25.52 ? 382 ILE A CG2 1 
ATOM   1096 C  CD1 . ILE A 1 174 ? 3.881   13.534  23.881 1.00 26.43 ? 382 ILE A CD1 1 
ATOM   1097 N  N   . SER A 1 175 ? 7.462   9.133   22.583 1.00 24.71 ? 383 SER A N   1 
ATOM   1098 C  CA  . SER A 1 175 ? 7.755   7.982   21.718 1.00 25.56 ? 383 SER A CA  1 
ATOM   1099 C  C   . SER A 1 175 ? 6.731   6.865   21.913 1.00 25.55 ? 383 SER A C   1 
ATOM   1100 O  O   . SER A 1 175 ? 6.134   6.732   22.991 1.00 25.36 ? 383 SER A O   1 
ATOM   1101 C  CB  . SER A 1 175 ? 9.130   7.402   22.054 1.00 25.80 ? 383 SER A CB  1 
ATOM   1102 O  OG  . SER A 1 175 ? 10.158  8.312   21.726 1.00 26.74 ? 383 SER A OG  1 
ATOM   1103 N  N   . LEU A 1 176 ? 6.546   6.074   20.858 1.00 23.84 ? 384 LEU A N   1 
ATOM   1104 C  CA  . LEU A 1 176 ? 5.808   4.832   20.906 1.00 23.22 ? 384 LEU A CA  1 
ATOM   1105 C  C   . LEU A 1 176 ? 6.759   3.656   20.638 1.00 24.17 ? 384 LEU A C   1 
ATOM   1106 O  O   . LEU A 1 176 ? 7.806   3.828   20.004 1.00 24.68 ? 384 LEU A O   1 
ATOM   1107 C  CB  . LEU A 1 176 ? 4.698   4.850   19.861 1.00 24.06 ? 384 LEU A CB  1 
ATOM   1108 C  CG  . LEU A 1 176 ? 3.654   5.968   19.978 1.00 24.54 ? 384 LEU A CG  1 
ATOM   1109 C  CD1 . LEU A 1 176 ? 2.620   5.829   18.880 1.00 26.06 ? 384 LEU A CD1 1 
ATOM   1110 C  CD2 . LEU A 1 176 ? 2.970   5.906   21.334 1.00 23.93 ? 384 LEU A CD2 1 
ATOM   1111 N  N   . VAL A 1 177 ? 6.378   2.476   21.121 1.00 23.25 ? 385 VAL A N   1 
ATOM   1112 C  CA  . VAL A 1 177 ? 7.119   1.227   20.912 1.00 23.98 ? 385 VAL A CA  1 
ATOM   1113 C  C   . VAL A 1 177 ? 6.140   0.056   20.922 1.00 24.84 ? 385 VAL A C   1 
ATOM   1114 O  O   . VAL A 1 177 ? 5.134   0.094   21.635 1.00 24.41 ? 385 VAL A O   1 
ATOM   1115 C  CB  . VAL A 1 177 ? 8.243   1.060   21.961 1.00 25.72 ? 385 VAL A CB  1 
ATOM   1116 C  CG1 . VAL A 1 177 ? 7.700   0.974   23.390 1.00 25.61 ? 385 VAL A CG1 1 
ATOM   1117 C  CG2 . VAL A 1 177 ? 9.111   -0.150  21.645 1.00 27.01 ? 385 VAL A CG2 1 
ATOM   1118 N  N   . ALA A 1 178 ? 6.375   -0.957  20.084 1.00 24.82 ? 386 ALA A N   1 
ATOM   1119 C  CA  . ALA A 1 178 ? 5.453   -2.091  20.005 1.00 24.14 ? 386 ALA A CA  1 
ATOM   1120 C  C   . ALA A 1 178 ? 5.771   -3.095  21.103 1.00 24.32 ? 386 ALA A C   1 
ATOM   1121 O  O   . ALA A 1 178 ? 6.937   -3.235  21.484 1.00 24.67 ? 386 ALA A O   1 
ATOM   1122 C  CB  . ALA A 1 178 ? 5.519   -2.750  18.641 1.00 25.07 ? 386 ALA A CB  1 
ATOM   1123 N  N   . VAL A 1 179 ? 4.737   -3.790  21.589 1.00 24.41 ? 387 VAL A N   1 
ATOM   1124 C  CA  . VAL A 1 179 ? 4.855   -4.742  22.705 1.00 25.66 ? 387 VAL A CA  1 
ATOM   1125 C  C   . VAL A 1 179 ? 4.223   -6.075  22.318 1.00 25.87 ? 387 VAL A C   1 
ATOM   1126 O  O   . VAL A 1 179 ? 3.210   -6.090  21.628 1.00 23.46 ? 387 VAL A O   1 
ATOM   1127 C  CB  . VAL A 1 179 ? 4.136   -4.230  23.986 1.00 26.13 ? 387 VAL A CB  1 
ATOM   1128 C  CG1 . VAL A 1 179 ? 4.367   -5.156  25.164 1.00 26.93 ? 387 VAL A CG1 1 
ATOM   1129 C  CG2 . VAL A 1 179 ? 4.606   -2.836  24.359 1.00 27.63 ? 387 VAL A CG2 1 
ATOM   1130 N  N   . SER A 1 180 ? 4.845   -7.184  22.740 1.00 26.43 ? 388 SER A N   1 
ATOM   1131 C  CA  . SER A 1 180 ? 4.267   -8.521  22.595 1.00 27.23 ? 388 SER A CA  1 
ATOM   1132 C  C   . SER A 1 180 ? 4.152   -9.144  23.976 1.00 25.57 ? 388 SER A C   1 
ATOM   1133 O  O   . SER A 1 180 ? 5.154   -9.420  24.611 1.00 23.15 ? 388 SER A O   1 
ATOM   1134 C  CB  . SER A 1 180 ? 5.131   -9.453  21.741 1.00 29.29 ? 388 SER A CB  1 
ATOM   1135 O  OG  . SER A 1 180 ? 4.500   -10.734 21.613 1.00 30.77 ? 388 SER A OG  1 
ATOM   1136 N  N   . ASP A 1 181 ? 2.935   -9.340  24.445 1.00 24.78 ? 389 ASP A N   1 
ATOM   1137 C  CA  . ASP A 1 181 ? 2.729   -10.019 25.725 1.00 26.90 ? 389 ASP A CA  1 
ATOM   1138 C  C   . ASP A 1 181 ? 1.388   -10.746 25.693 1.00 26.83 ? 389 ASP A C   1 
ATOM   1139 O  O   . ASP A 1 181 ? 0.371   -10.241 26.172 1.00 26.71 ? 389 ASP A O   1 
ATOM   1140 C  CB  . ASP A 1 181 ? 2.821   -9.024  26.880 1.00 26.03 ? 389 ASP A CB  1 
ATOM   1141 C  CG  . ASP A 1 181 ? 3.147   -9.694  28.209 1.00 28.82 ? 389 ASP A CG  1 
ATOM   1142 O  OD1 . ASP A 1 181 ? 2.681   -10.831 28.439 1.00 27.09 ? 389 ASP A OD1 1 
ATOM   1143 O  OD2 . ASP A 1 181 ? 3.851   -9.058  29.029 1.00 27.63 ? 389 ASP A OD2 1 
ATOM   1144 N  N   . VAL A 1 182 ? 1.395   -11.926 25.077 1.00 28.33 ? 390 VAL A N   1 
ATOM   1145 C  CA  . VAL A 1 182 ? 0.154   -12.701 24.922 1.00 30.66 ? 390 VAL A CA  1 
ATOM   1146 C  C   . VAL A 1 182 ? -0.446  -13.113 26.270 1.00 29.76 ? 390 VAL A C   1 
ATOM   1147 O  O   . VAL A 1 182 ? -1.664  -13.157 26.416 1.00 30.17 ? 390 VAL A O   1 
ATOM   1148 C  CB  . VAL A 1 182 ? 0.321   -13.918 23.993 1.00 31.97 ? 390 VAL A CB  1 
ATOM   1149 C  CG1 . VAL A 1 182 ? 0.624   -13.455 22.568 1.00 32.72 ? 390 VAL A CG1 1 
ATOM   1150 C  CG2 . VAL A 1 182 ? 1.391   -14.869 24.513 1.00 33.01 ? 390 VAL A CG2 1 
ATOM   1151 N  N   . ASN A 1 183 ? 0.397   -13.365 27.257 1.00 29.14 ? 391 ASN A N   1 
ATOM   1152 C  CA  . ASN A 1 183 ? -0.089  -13.728 28.595 1.00 31.60 ? 391 ASN A CA  1 
ATOM   1153 C  C   . ASN A 1 183 ? -0.835  -12.599 29.260 1.00 29.92 ? 391 ASN A C   1 
ATOM   1154 O  O   . ASN A 1 183 ? -1.962  -12.781 29.748 1.00 30.45 ? 391 ASN A O   1 
ATOM   1155 C  CB  . ASN A 1 183 ? 1.059   -14.202 29.478 1.00 31.83 ? 391 ASN A CB  1 
ATOM   1156 C  CG  . ASN A 1 183 ? 1.637   -15.517 28.994 1.00 35.93 ? 391 ASN A CG  1 
ATOM   1157 O  OD1 . ASN A 1 183 ? 1.027   -16.216 28.194 1.00 39.10 ? 391 ASN A OD1 1 
ATOM   1158 N  ND2 . ASN A 1 183 ? 2.808   -15.856 29.473 1.00 38.56 ? 391 ASN A ND2 1 
ATOM   1159 N  N   . LYS A 1 184 ? -0.236  -11.415 29.238 1.00 28.75 ? 392 LYS A N   1 
ATOM   1160 C  CA  . LYS A 1 184 ? -0.926  -10.258 29.794 1.00 29.11 ? 392 LYS A CA  1 
ATOM   1161 C  C   . LYS A 1 184 ? -2.167  -9.902  29.003 1.00 27.35 ? 392 LYS A C   1 
ATOM   1162 O  O   . LYS A 1 184 ? -3.170  -9.477  29.574 1.00 27.05 ? 392 LYS A O   1 
ATOM   1163 C  CB  . LYS A 1 184 ? 0.005   -9.063  29.924 1.00 30.62 ? 392 LYS A CB  1 
ATOM   1164 C  CG  . LYS A 1 184 ? 0.975   -9.240  31.074 1.00 33.46 ? 392 LYS A CG  1 
ATOM   1165 C  CD  . LYS A 1 184 ? 1.784   -7.978  31.290 1.00 37.09 ? 392 LYS A CD  1 
ATOM   1166 C  CE  . LYS A 1 184 ? 2.875   -8.215  32.307 1.00 38.83 ? 392 LYS A CE  1 
ATOM   1167 N  NZ  . LYS A 1 184 ? 2.247   -8.520  33.617 1.00 42.02 ? 392 LYS A NZ  1 
ATOM   1168 N  N   . HIS A 1 185 ? -2.131  -10.081 27.693 1.00 26.82 ? 393 HIS A N   1 
ATOM   1169 C  CA  . HIS A 1 185 ? -3.330  -9.829  26.909 1.00 27.62 ? 393 HIS A CA  1 
ATOM   1170 C  C   . HIS A 1 185 ? -4.477  -10.763 27.340 1.00 27.49 ? 393 HIS A C   1 
ATOM   1171 O  O   . HIS A 1 185 ? -5.618  -10.330 27.536 1.00 24.53 ? 393 HIS A O   1 
ATOM   1172 C  CB  . HIS A 1 185 ? -3.061  -9.983  25.412 1.00 27.12 ? 393 HIS A CB  1 
ATOM   1173 C  CG  . HIS A 1 185 ? -4.117  -9.357  24.572 1.00 27.64 ? 393 HIS A CG  1 
ATOM   1174 N  ND1 . HIS A 1 185 ? -5.274  -10.017 24.229 1.00 28.49 ? 393 HIS A ND1 1 
ATOM   1175 C  CD2 . HIS A 1 185 ? -4.217  -8.114  24.042 1.00 28.11 ? 393 HIS A CD2 1 
ATOM   1176 C  CE1 . HIS A 1 185 ? -6.038  -9.213  23.511 1.00 28.56 ? 393 HIS A CE1 1 
ATOM   1177 N  NE2 . HIS A 1 185 ? -5.423  -8.049  23.392 1.00 28.98 ? 393 HIS A NE2 1 
ATOM   1178 N  N   . ALA A 1 186 ? -4.154  -12.044 27.491 1.00 29.36 ? 394 ALA A N   1 
ATOM   1179 C  CA  . ALA A 1 186 ? -5.116  -13.025 27.992 1.00 31.44 ? 394 ALA A CA  1 
ATOM   1180 C  C   . ALA A 1 186 ? -5.646  -12.651 29.396 1.00 32.20 ? 394 ALA A C   1 
ATOM   1181 O  O   . ALA A 1 186 ? -6.843  -12.816 29.673 1.00 32.40 ? 394 ALA A O   1 
ATOM   1182 C  CB  . ALA A 1 186 ? -4.490  -14.420 27.993 1.00 32.04 ? 394 ALA A CB  1 
ATOM   1183 N  N   . ASP A 1 187 ? -4.763  -12.130 30.255 1.00 32.85 ? 395 ASP A N   1 
ATOM   1184 C  CA  . ASP A 1 187 ? -5.137  -11.682 31.603 1.00 32.37 ? 395 ASP A CA  1 
ATOM   1185 C  C   . ASP A 1 187 ? -6.164  -10.572 31.591 1.00 30.28 ? 395 ASP A C   1 
ATOM   1186 O  O   . ASP A 1 187 ? -7.008  -10.528 32.460 1.00 30.30 ? 395 ASP A O   1 
ATOM   1187 C  CB  . ASP A 1 187 ? -3.929  -11.150 32.395 1.00 33.19 ? 395 ASP A CB  1 
ATOM   1188 C  CG  . ASP A 1 187 ? -2.983  -12.236 32.843 1.00 36.27 ? 395 ASP A CG  1 
ATOM   1189 O  OD1 . ASP A 1 187 ? -3.353  -13.429 32.808 1.00 37.88 ? 395 ASP A OD1 1 
ATOM   1190 O  OD2 . ASP A 1 187 ? -1.845  -11.879 33.229 1.00 41.31 ? 395 ASP A OD2 1 
ATOM   1191 N  N   . ARG A 1 188 ? -6.083  -9.667  30.618 1.00 29.17 ? 396 ARG A N   1 
ATOM   1192 C  CA  . ARG A 1 188 ? -7.000  -8.516  30.566 1.00 27.95 ? 396 ARG A CA  1 
ATOM   1193 C  C   . ARG A 1 188 ? -8.228  -8.737  29.705 1.00 28.38 ? 396 ARG A C   1 
ATOM   1194 O  O   . ARG A 1 188 ? -9.256  -8.069  29.910 1.00 28.32 ? 396 ARG A O   1 
ATOM   1195 C  CB  . ARG A 1 188 ? -6.272  -7.278  30.036 1.00 28.27 ? 396 ARG A CB  1 
ATOM   1196 C  CG  . ARG A 1 188 ? -5.018  -6.880  30.802 1.00 28.35 ? 396 ARG A CG  1 
ATOM   1197 C  CD  . ARG A 1 188 ? -5.272  -6.614  32.293 1.00 26.59 ? 396 ARG A CD  1 
ATOM   1198 N  NE  . ARG A 1 188 ? -6.539  -5.936  32.555 1.00 25.66 ? 396 ARG A NE  1 
ATOM   1199 C  CZ  . ARG A 1 188 ? -6.803  -4.668  32.292 1.00 24.09 ? 396 ARG A CZ  1 
ATOM   1200 N  NH1 . ARG A 1 188 ? -5.898  -3.870  31.711 1.00 26.17 ? 396 ARG A NH1 1 
ATOM   1201 N  NH2 . ARG A 1 188 ? -7.993  -4.187  32.597 1.00 24.28 ? 396 ARG A NH2 1 
ATOM   1202 N  N   . ILE A 1 189 ? -8.117  -9.633  28.720 1.00 28.22 ? 397 ILE A N   1 
ATOM   1203 C  CA  . ILE A 1 189 ? -9.131  -9.748  27.666 1.00 29.08 ? 397 ILE A CA  1 
ATOM   1204 C  C   . ILE A 1 189 ? -9.807  -11.126 27.658 1.00 28.28 ? 397 ILE A C   1 
ATOM   1205 O  O   . ILE A 1 189 ? -10.972 -11.230 28.028 1.00 29.88 ? 397 ILE A O   1 
ATOM   1206 C  CB  . ILE A 1 189 ? -8.521  -9.413  26.278 1.00 30.51 ? 397 ILE A CB  1 
ATOM   1207 C  CG1 . ILE A 1 189 ? -7.882  -8.002  26.292 1.00 29.37 ? 397 ILE A CG1 1 
ATOM   1208 C  CG2 . ILE A 1 189 ? -9.564  -9.548  25.172 1.00 29.82 ? 397 ILE A CG2 1 
ATOM   1209 C  CD1 . ILE A 1 189 ? -8.828  -6.880  26.645 1.00 30.09 ? 397 ILE A CD1 1 
ATOM   1210 N  N   . ALA A 1 190 ? -9.080  -12.170 27.266 1.00 28.45 ? 398 ALA A N   1 
ATOM   1211 C  CA  . ALA A 1 190 ? -9.622  -13.533 27.255 1.00 30.64 ? 398 ALA A CA  1 
ATOM   1212 C  C   . ALA A 1 190 ? -10.200 -13.920 28.632 1.00 31.64 ? 398 ALA A C   1 
ATOM   1213 O  O   . ALA A 1 190 ? -11.172 -14.689 28.715 1.00 30.96 ? 398 ALA A O   1 
ATOM   1214 C  CB  . ALA A 1 190 ? -8.552  -14.534 26.843 1.00 30.64 ? 398 ALA A CB  1 
ATOM   1215 N  N   . PHE A 1 191 ? -9.589  -13.382 29.691 1.00 30.81 ? 399 PHE A N   1 
ATOM   1216 C  CA  . PHE A 1 191 ? -10.079 -13.536 31.064 1.00 30.72 ? 399 PHE A CA  1 
ATOM   1217 C  C   . PHE A 1 191 ? -11.592 -13.457 31.157 1.00 30.11 ? 399 PHE A C   1 
ATOM   1218 O  O   . PHE A 1 191 ? -12.217 -14.267 31.831 1.00 30.08 ? 399 PHE A O   1 
ATOM   1219 C  CB  . PHE A 1 191 ? -9.464  -12.447 31.965 1.00 30.49 ? 399 PHE A CB  1 
ATOM   1220 C  CG  . PHE A 1 191 ? -10.099 -12.352 33.322 1.00 29.18 ? 399 PHE A CG  1 
ATOM   1221 C  CD1 . PHE A 1 191 ? -9.761  -13.248 34.328 1.00 30.13 ? 399 PHE A CD1 1 
ATOM   1222 C  CD2 . PHE A 1 191 ? -11.037 -11.365 33.598 1.00 29.45 ? 399 PHE A CD2 1 
ATOM   1223 C  CE1 . PHE A 1 191 ? -10.354 -13.166 35.584 1.00 28.89 ? 399 PHE A CE1 1 
ATOM   1224 C  CE2 . PHE A 1 191 ? -11.628 -11.279 34.852 1.00 29.87 ? 399 PHE A CE2 1 
ATOM   1225 C  CZ  . PHE A 1 191 ? -11.290 -12.183 35.837 1.00 28.85 ? 399 PHE A CZ  1 
ATOM   1226 N  N   . TRP A 1 192 ? -12.172 -12.474 30.475 1.00 28.94 ? 400 TRP A N   1 
ATOM   1227 C  CA  . TRP A 1 192 ? -13.593 -12.182 30.589 1.00 28.55 ? 400 TRP A CA  1 
ATOM   1228 C  C   . TRP A 1 192 ? -14.538 -13.205 29.935 1.00 30.64 ? 400 TRP A C   1 
ATOM   1229 O  O   . TRP A 1 192 ? -15.738 -13.134 30.145 1.00 31.25 ? 400 TRP A O   1 
ATOM   1230 C  CB  . TRP A 1 192 ? -13.897 -10.793 30.048 1.00 28.88 ? 400 TRP A CB  1 
ATOM   1231 C  CG  . TRP A 1 192 ? -13.214 -9.728  30.788 1.00 29.21 ? 400 TRP A CG  1 
ATOM   1232 C  CD1 . TRP A 1 192 ? -12.074 -9.079  30.420 1.00 30.88 ? 400 TRP A CD1 1 
ATOM   1233 C  CD2 . TRP A 1 192 ? -13.587 -9.198  32.058 1.00 30.36 ? 400 TRP A CD2 1 
ATOM   1234 N  NE1 . TRP A 1 192 ? -11.715 -8.166  31.384 1.00 30.48 ? 400 TRP A NE1 1 
ATOM   1235 C  CE2 . TRP A 1 192 ? -12.631 -8.216  32.400 1.00 29.40 ? 400 TRP A CE2 1 
ATOM   1236 C  CE3 . TRP A 1 192 ? -14.647 -9.444  32.937 1.00 30.41 ? 400 TRP A CE3 1 
ATOM   1237 C  CZ2 . TRP A 1 192 ? -12.707 -7.476  33.576 1.00 30.56 ? 400 TRP A CZ2 1 
ATOM   1238 C  CZ3 . TRP A 1 192 ? -14.717 -8.710  34.120 1.00 30.02 ? 400 TRP A CZ3 1 
ATOM   1239 C  CH2 . TRP A 1 192 ? -13.747 -7.736  34.427 1.00 31.61 ? 400 TRP A CH2 1 
ATOM   1240 N  N   . ASP A 1 193 ? -14.031 -14.151 29.156 1.00 32.48 ? 401 ASP A N   1 
ATOM   1241 C  CA  . ASP A 1 193 ? -14.938 -15.124 28.528 1.00 33.20 ? 401 ASP A CA  1 
ATOM   1242 C  C   . ASP A 1 193 ? -15.449 -16.198 29.483 1.00 34.26 ? 401 ASP A C   1 
ATOM   1243 O  O   . ASP A 1 193 ? -16.501 -16.762 29.242 1.00 33.31 ? 401 ASP A O   1 
ATOM   1244 C  CB  . ASP A 1 193 ? -14.264 -15.790 27.358 1.00 35.13 ? 401 ASP A CB  1 
ATOM   1245 C  CG  . ASP A 1 193 ? -14.004 -14.834 26.234 1.00 35.98 ? 401 ASP A CG  1 
ATOM   1246 O  OD1 . ASP A 1 193 ? -14.803 -13.883 26.034 1.00 38.46 ? 401 ASP A OD1 1 
ATOM   1247 O  OD2 . ASP A 1 193 ? -12.987 -15.044 25.573 1.00 34.70 ? 401 ASP A OD2 1 
ATOM   1248 N  N   . ASP A 1 194 ? -14.717 -16.458 30.567 1.00 34.03 ? 402 ASP A N   1 
ATOM   1249 C  CA  . ASP A 1 194 ? -15.108 -17.477 31.537 1.00 33.94 ? 402 ASP A CA  1 
ATOM   1250 C  C   . ASP A 1 194 ? -14.639 -17.045 32.927 1.00 32.18 ? 402 ASP A C   1 
ATOM   1251 O  O   . ASP A 1 194 ? -13.496 -17.290 33.311 1.00 32.46 ? 402 ASP A O   1 
ATOM   1252 C  CB  . ASP A 1 194 ? -14.492 -18.826 31.150 1.00 35.55 ? 402 ASP A CB  1 
ATOM   1253 C  CG  . ASP A 1 194 ? -14.825 -19.932 32.133 1.00 41.15 ? 402 ASP A CG  1 
ATOM   1254 O  OD1 . ASP A 1 194 ? -15.798 -19.795 32.899 1.00 41.31 ? 402 ASP A OD1 1 
ATOM   1255 O  OD2 . ASP A 1 194 ? -14.092 -20.949 32.135 1.00 47.57 ? 402 ASP A OD2 1 
ATOM   1256 N  N   . VAL A 1 195 ? -15.536 -16.391 33.651 1.00 29.59 ? 403 VAL A N   1 
ATOM   1257 C  CA  . VAL A 1 195 ? -15.304 -15.938 35.002 1.00 30.18 ? 403 VAL A CA  1 
ATOM   1258 C  C   . VAL A 1 195 ? -16.119 -16.830 35.948 1.00 30.16 ? 403 VAL A C   1 
ATOM   1259 O  O   . VAL A 1 195 ? -17.336 -16.674 36.079 1.00 29.34 ? 403 VAL A O   1 
ATOM   1260 C  CB  . VAL A 1 195 ? -15.709 -14.466 35.144 1.00 29.25 ? 403 VAL A CB  1 
ATOM   1261 C  CG1 . VAL A 1 195 ? -15.430 -13.962 36.549 1.00 29.57 ? 403 VAL A CG1 1 
ATOM   1262 C  CG2 . VAL A 1 195 ? -14.971 -13.623 34.110 1.00 30.87 ? 403 VAL A CG2 1 
ATOM   1263 N  N   . TYR A 1 196 ? -15.429 -17.775 36.576 1.00 31.43 ? 404 TYR A N   1 
ATOM   1264 C  CA  . TYR A 1 196 ? -16.021 -18.743 37.510 1.00 33.10 ? 404 TYR A CA  1 
ATOM   1265 C  C   . TYR A 1 196 ? -17.200 -19.479 36.884 1.00 33.25 ? 404 TYR A C   1 
ATOM   1266 O  O   . TYR A 1 196 ? -18.210 -19.712 37.547 1.00 33.57 ? 404 TYR A O   1 
ATOM   1267 C  CB  . TYR A 1 196 ? -16.414 -18.063 38.831 1.00 34.00 ? 404 TYR A CB  1 
ATOM   1268 C  CG  . TYR A 1 196 ? -15.199 -17.549 39.575 1.00 36.51 ? 404 TYR A CG  1 
ATOM   1269 C  CD1 . TYR A 1 196 ? -14.401 -18.410 40.327 1.00 36.65 ? 404 TYR A CD1 1 
ATOM   1270 C  CD2 . TYR A 1 196 ? -14.821 -16.218 39.482 1.00 36.30 ? 404 TYR A CD2 1 
ATOM   1271 C  CE1 . TYR A 1 196 ? -13.272 -17.945 40.980 1.00 38.50 ? 404 TYR A CE1 1 
ATOM   1272 C  CE2 . TYR A 1 196 ? -13.693 -15.744 40.138 1.00 39.12 ? 404 TYR A CE2 1 
ATOM   1273 C  CZ  . TYR A 1 196 ? -12.920 -16.615 40.878 1.00 39.52 ? 404 TYR A CZ  1 
ATOM   1274 O  OH  . TYR A 1 196 ? -11.809 -16.134 41.526 1.00 41.84 ? 404 TYR A OH  1 
ATOM   1275 N  N   . GLY A 1 197 ? -17.052 -19.826 35.603 1.00 30.35 ? 405 GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 197 ? -18.064 -20.552 34.861 1.00 31.48 ? 405 GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 197 ? -19.051 -19.668 34.111 1.00 31.52 ? 405 GLY A C   1 
ATOM   1278 O  O   . GLY A 1 197 ? -19.930 -20.189 33.448 1.00 34.98 ? 405 GLY A O   1 
ATOM   1279 N  N   . PHE A 1 198 ? -18.935 -18.345 34.211 1.00 29.96 ? 406 PHE A N   1 
ATOM   1280 C  CA  . PHE A 1 198 ? -19.884 -17.446 33.556 1.00 29.52 ? 406 PHE A CA  1 
ATOM   1281 C  C   . PHE A 1 198 ? -19.216 -16.580 32.488 1.00 31.60 ? 406 PHE A C   1 
ATOM   1282 O  O   . PHE A 1 198 ? -18.060 -16.157 32.642 1.00 33.85 ? 406 PHE A O   1 
ATOM   1283 C  CB  . PHE A 1 198 ? -20.602 -16.565 34.577 1.00 29.16 ? 406 PHE A CB  1 
ATOM   1284 C  CG  . PHE A 1 198 ? -21.352 -17.343 35.635 1.00 29.22 ? 406 PHE A CG  1 
ATOM   1285 C  CD1 . PHE A 1 198 ? -22.594 -17.883 35.362 1.00 29.10 ? 406 PHE A CD1 1 
ATOM   1286 C  CD2 . PHE A 1 198 ? -20.811 -17.532 36.901 1.00 30.68 ? 406 PHE A CD2 1 
ATOM   1287 C  CE1 . PHE A 1 198 ? -23.299 -18.595 36.329 1.00 29.14 ? 406 PHE A CE1 1 
ATOM   1288 C  CE2 . PHE A 1 198 ? -21.496 -18.258 37.871 1.00 30.19 ? 406 PHE A CE2 1 
ATOM   1289 C  CZ  . PHE A 1 198 ? -22.740 -18.795 37.582 1.00 29.44 ? 406 PHE A CZ  1 
ATOM   1290 N  N   . LYS A 1 199 ? -19.961 -16.314 31.413 1.00 29.09 ? 407 LYS A N   1 
ATOM   1291 C  CA  . LYS A 1 199 ? -19.538 -15.404 30.348 1.00 31.52 ? 407 LYS A CA  1 
ATOM   1292 C  C   . LYS A 1 199 ? -19.607 -13.945 30.785 1.00 29.88 ? 407 LYS A C   1 
ATOM   1293 O  O   . LYS A 1 199 ? -20.646 -13.489 31.292 1.00 28.26 ? 407 LYS A O   1 
ATOM   1294 C  CB  . LYS A 1 199 ? -20.448 -15.555 29.117 1.00 34.48 ? 407 LYS A CB  1 
ATOM   1295 C  CG  . LYS A 1 199 ? -20.360 -16.886 28.400 1.00 38.06 ? 407 LYS A CG  1 
ATOM   1296 C  CD  . LYS A 1 199 ? -21.491 -16.989 27.366 1.00 43.71 ? 407 LYS A CD  1 
ATOM   1297 C  CE  . LYS A 1 199 ? -21.148 -17.888 26.187 1.00 47.16 ? 407 LYS A CE  1 
ATOM   1298 N  NZ  . LYS A 1 199 ? -20.442 -19.120 26.608 1.00 48.92 ? 407 LYS A NZ  1 
ATOM   1299 N  N   . MET A 1 200 ? -18.514 -13.210 30.593 1.00 29.41 ? 408 MET A N   1 
ATOM   1300 C  CA  . MET A 1 200 ? -18.519 -11.767 30.842 1.00 30.96 ? 408 MET A CA  1 
ATOM   1301 C  C   . MET A 1 200 ? -17.880 -10.999 29.681 1.00 33.77 ? 408 MET A C   1 
ATOM   1302 O  O   . MET A 1 200 ? -17.292 -9.931  29.875 1.00 31.38 ? 408 MET A O   1 
ATOM   1303 C  CB  . MET A 1 200 ? -17.807 -11.444 32.161 1.00 30.60 ? 408 MET A CB  1 
ATOM   1304 C  CG  . MET A 1 200 ? -18.524 -11.942 33.401 1.00 31.12 ? 408 MET A CG  1 
ATOM   1305 S  SD  . MET A 1 200 ? -17.864 -11.139 34.869 1.00 32.06 ? 408 MET A SD  1 
ATOM   1306 C  CE  . MET A 1 200 ? -18.902 -11.903 36.117 1.00 32.22 ? 408 MET A CE  1 
ATOM   1307 N  N   . SER A 1 201 ? -18.069 -11.522 28.472 1.00 34.67 ? 409 SER A N   1 
ATOM   1308 C  CA  . SER A 1 201 ? -17.383 -11.036 27.278 1.00 35.67 ? 409 SER A CA  1 
ATOM   1309 C  C   . SER A 1 201 ? -17.548 -9.550  27.004 1.00 34.89 ? 409 SER A C   1 
ATOM   1310 O  O   . SER A 1 201 ? -16.603 -8.905  26.553 1.00 34.47 ? 409 SER A O   1 
ATOM   1311 C  CB  . SER A 1 201 ? -17.840 -11.860 26.069 1.00 34.68 ? 409 SER A CB  1 
ATOM   1312 O  OG  . SER A 1 201 ? -17.378 -13.180 26.271 1.00 39.10 ? 409 SER A OG  1 
ATOM   1313 N  N   . CYS A 1 202 ? -18.729 -9.013  27.297 1.00 34.87 ? 410 CYS A N   1 
ATOM   1314 C  CA  . CYS A 1 202 ? -19.022 -7.593  27.101 1.00 37.77 ? 410 CYS A CA  1 
ATOM   1315 C  C   . CYS A 1 202 ? -18.058 -6.635  27.847 1.00 38.12 ? 410 CYS A C   1 
ATOM   1316 O  O   . CYS A 1 202 ? -17.831 -5.509  27.392 1.00 36.68 ? 410 CYS A O   1 
ATOM   1317 C  CB  . CYS A 1 202 ? -20.471 -7.296  27.497 1.00 41.14 ? 410 CYS A CB  1 
ATOM   1318 S  SG  . CYS A 1 202 ? -21.024 -8.057  29.060 1.00 45.64 ? 410 CYS A SG  1 
ATOM   1319 N  N   . MET A 1 203 ? -17.491 -7.080  28.969 1.00 35.23 ? 411 MET A N   1 
ATOM   1320 C  CA  . MET A 1 203 ? -16.535 -6.260  29.734 1.00 36.37 ? 411 MET A CA  1 
ATOM   1321 C  C   . MET A 1 203 ? -15.260 -5.907  28.958 1.00 35.02 ? 411 MET A C   1 
ATOM   1322 O  O   . MET A 1 203 ? -14.600 -4.942  29.289 1.00 35.00 ? 411 MET A O   1 
ATOM   1323 C  CB  . MET A 1 203 ? -16.157 -6.961  31.042 1.00 36.91 ? 411 MET A CB  1 
ATOM   1324 C  CG  . MET A 1 203 ? -17.271 -6.929  32.076 1.00 39.46 ? 411 MET A CG  1 
ATOM   1325 S  SD  . MET A 1 203 ? -17.499 -5.291  32.797 1.00 40.75 ? 411 MET A SD  1 
ATOM   1326 C  CE  . MET A 1 203 ? -16.059 -5.193  33.856 1.00 43.27 ? 411 MET A CE  1 
ATOM   1327 N  N   . LYS A 1 204 ? -14.908 -6.695  27.942 1.00 35.90 ? 412 LYS A N   1 
ATOM   1328 C  CA  . LYS A 1 204 ? -13.757 -6.388  27.090 1.00 36.37 ? 412 LYS A CA  1 
ATOM   1329 C  C   . LYS A 1 204 ? -13.797 -4.967  26.526 1.00 37.93 ? 412 LYS A C   1 
ATOM   1330 O  O   . LYS A 1 204 ? -12.763 -4.297  26.446 1.00 34.53 ? 412 LYS A O   1 
ATOM   1331 C  CB  . LYS A 1 204 ? -13.680 -7.368  25.934 1.00 35.03 ? 412 LYS A CB  1 
ATOM   1332 C  CG  . LYS A 1 204 ? -13.307 -8.774  26.359 1.00 34.41 ? 412 LYS A CG  1 
ATOM   1333 C  CD  . LYS A 1 204 ? -13.344 -9.707  25.164 1.00 33.94 ? 412 LYS A CD  1 
ATOM   1334 C  CE  . LYS A 1 204 ? -13.258 -11.155 25.590 1.00 33.25 ? 412 LYS A CE  1 
ATOM   1335 N  NZ  . LYS A 1 204 ? -13.323 -12.081 24.423 1.00 33.58 ? 412 LYS A NZ  1 
ATOM   1336 N  N   . LYS A 1 205 ? -14.999 -4.514  26.174 1.00 39.18 ? 413 LYS A N   1 
ATOM   1337 C  CA  . LYS A 1 205 ? -15.202 -3.212  25.550 1.00 41.06 ? 413 LYS A CA  1 
ATOM   1338 C  C   . LYS A 1 205 ? -14.998 -2.075  26.521 1.00 38.03 ? 413 LYS A C   1 
ATOM   1339 O  O   . LYS A 1 205 ? -14.780 -0.944  26.109 1.00 36.61 ? 413 LYS A O   1 
ATOM   1340 C  CB  . LYS A 1 205 ? -16.617 -3.103  24.967 1.00 43.21 ? 413 LYS A CB  1 
ATOM   1341 C  CG  . LYS A 1 205 ? -16.958 -4.156  23.925 1.00 46.11 ? 413 LYS A CG  1 
ATOM   1342 C  CD  . LYS A 1 205 ? -16.005 -4.101  22.741 1.00 49.21 ? 413 LYS A CD  1 
ATOM   1343 C  CE  . LYS A 1 205 ? -16.526 -4.897  21.559 1.00 50.66 ? 413 LYS A CE  1 
ATOM   1344 N  NZ  . LYS A 1 205 ? -15.680 -4.681  20.350 1.00 51.08 ? 413 LYS A NZ  1 
ATOM   1345 N  N   . ALA A 1 206 ? -15.094 -2.354  27.812 1.00 35.83 ? 414 ALA A N   1 
ATOM   1346 C  CA  . ALA A 1 206 ? -14.805 -1.339  28.824 1.00 35.31 ? 414 ALA A CA  1 
ATOM   1347 C  C   . ALA A 1 206 ? -13.318 -1.316  29.180 1.00 32.32 ? 414 ALA A C   1 
ATOM   1348 O  O   . ALA A 1 206 ? -12.794 -0.300  29.627 1.00 32.81 ? 414 ALA A O   1 
ATOM   1349 C  CB  . ALA A 1 206 ? -15.634 -1.593  30.069 1.00 36.64 ? 414 ALA A CB  1 
ATOM   1350 N  N   . VAL A 1 207 ? -12.646 -2.448  28.999 1.00 31.01 ? 415 VAL A N   1 
ATOM   1351 C  CA  . VAL A 1 207 ? -11.219 -2.563  29.310 1.00 31.78 ? 415 VAL A CA  1 
ATOM   1352 C  C   . VAL A 1 207 ? -10.338 -1.917  28.225 1.00 31.50 ? 415 VAL A C   1 
ATOM   1353 O  O   . VAL A 1 207 ? -9.416  -1.150  28.523 1.00 28.96 ? 415 VAL A O   1 
ATOM   1354 C  CB  . VAL A 1 207 ? -10.849 -4.054  29.532 1.00 32.95 ? 415 VAL A CB  1 
ATOM   1355 C  CG1 . VAL A 1 207 ? -9.349  -4.297  29.414 1.00 33.46 ? 415 VAL A CG1 1 
ATOM   1356 C  CG2 . VAL A 1 207 ? -11.358 -4.486  30.897 1.00 34.41 ? 415 VAL A CG2 1 
ATOM   1357 N  N   . ILE A 1 208 ? -10.621 -2.224  26.963 1.00 30.52 ? 416 ILE A N   1 
ATOM   1358 C  CA  . ILE A 1 208 ? -9.744  -1.782  25.875 1.00 30.15 ? 416 ILE A CA  1 
ATOM   1359 C  C   . ILE A 1 208 ? -9.461  -0.261  25.842 1.00 28.10 ? 416 ILE A C   1 
ATOM   1360 O  O   . ILE A 1 208 ? -8.322  0.122   25.658 1.00 28.34 ? 416 ILE A O   1 
ATOM   1361 C  CB  . ILE A 1 208 ? -10.263 -2.267  24.498 1.00 30.72 ? 416 ILE A CB  1 
ATOM   1362 C  CG1 . ILE A 1 208 ? -9.988  -3.764  24.337 1.00 32.33 ? 416 ILE A CG1 1 
ATOM   1363 C  CG2 . ILE A 1 208 ? -9.633  -1.494  23.355 1.00 30.12 ? 416 ILE A CG2 1 
ATOM   1364 C  CD1 . ILE A 1 208 ? -8.517  -4.156  24.407 1.00 32.25 ? 416 ILE A CD1 1 
ATOM   1365 N  N   . PRO A 1 209 ? -10.486 0.592   26.005 1.00 26.75 ? 417 PRO A N   1 
ATOM   1366 C  CA  . PRO A 1 209 ? -10.275 2.035   25.930 1.00 27.90 ? 417 PRO A CA  1 
ATOM   1367 C  C   . PRO A 1 209 ? -9.506  2.678   27.093 1.00 26.97 ? 417 PRO A C   1 
ATOM   1368 O  O   . PRO A 1 209 ? -9.189  3.863   27.029 1.00 28.95 ? 417 PRO A O   1 
ATOM   1369 C  CB  . PRO A 1 209 ? -11.704 2.620   25.872 1.00 27.72 ? 417 PRO A CB  1 
ATOM   1370 C  CG  . PRO A 1 209 ? -12.617 1.466   25.652 1.00 28.55 ? 417 PRO A CG  1 
ATOM   1371 C  CD  . PRO A 1 209 ? -11.908 0.247   26.155 1.00 28.15 ? 417 PRO A CD  1 
ATOM   1372 N  N   . GLU A 1 210 ? -9.201  1.921   28.132 1.00 27.43 ? 418 GLU A N   1 
ATOM   1373 C  CA  A GLU A 1 210 ? -8.504  2.466   29.295 0.50 28.56 ? 418 GLU A CA  1 
ATOM   1374 C  CA  B GLU A 1 210 ? -8.507  2.462   29.285 0.50 27.46 ? 418 GLU A CA  1 
ATOM   1375 C  C   . GLU A 1 210 ? -7.009  2.222   29.169 1.00 27.03 ? 418 GLU A C   1 
ATOM   1376 O  O   . GLU A 1 210 ? -6.543  1.077   29.256 1.00 25.95 ? 418 GLU A O   1 
ATOM   1377 C  CB  A GLU A 1 210 ? -9.039  1.849   30.597 0.50 30.41 ? 418 GLU A CB  1 
ATOM   1378 C  CB  B GLU A 1 210 ? -9.071  1.838   30.562 0.50 27.83 ? 418 GLU A CB  1 
ATOM   1379 C  CG  A GLU A 1 210 ? -8.390  2.392   31.871 0.50 32.21 ? 418 GLU A CG  1 
ATOM   1380 C  CG  B GLU A 1 210 ? -10.550 2.132   30.751 0.50 28.26 ? 418 GLU A CG  1 
ATOM   1381 C  CD  A GLU A 1 210 ? -8.502  3.900   32.010 0.50 34.44 ? 418 GLU A CD  1 
ATOM   1382 O  OE1 A GLU A 1 210 ? -9.596  4.451   31.737 0.50 37.42 ? 418 GLU A OE1 1 
ATOM   1383 O  OE2 A GLU A 1 210 ? -7.492  4.535   32.395 0.50 34.93 ? 418 GLU A OE2 1 
ATOM   1384 N  N   . ALA A 1 211 ? -6.254  3.302   28.964 1.00 26.50 ? 419 ALA A N   1 
ATOM   1385 C  CA  . ALA A 1 211 ? -4.803  3.209   28.930 1.00 26.17 ? 419 ALA A CA  1 
ATOM   1386 C  C   . ALA A 1 211 ? -4.325  2.761   30.310 1.00 26.52 ? 419 ALA A C   1 
ATOM   1387 O  O   . ALA A 1 211 ? -4.923  3.114   31.324 1.00 27.20 ? 419 ALA A O   1 
ATOM   1388 C  CB  . ALA A 1 211 ? -4.178  4.543   28.554 1.00 27.47 ? 419 ALA A CB  1 
ATOM   1389 N  N   . VAL A 1 212 ? -3.273  1.953   30.332 1.00 25.85 ? 420 VAL A N   1 
ATOM   1390 C  CA  . VAL A 1 212 ? -2.719  1.425   31.568 1.00 26.77 ? 420 VAL A CA  1 
ATOM   1391 C  C   . VAL A 1 212 ? -1.388  2.090   31.856 1.00 26.77 ? 420 VAL A C   1 
ATOM   1392 O  O   . VAL A 1 212 ? -0.575  2.250   30.963 1.00 22.92 ? 420 VAL A O   1 
ATOM   1393 C  CB  . VAL A 1 212 ? -2.507  -0.087  31.449 1.00 27.68 ? 420 VAL A CB  1 
ATOM   1394 C  CG1 . VAL A 1 212 ? -1.661  -0.610  32.600 1.00 30.34 ? 420 VAL A CG1 1 
ATOM   1395 C  CG2 . VAL A 1 212 ? -3.867  -0.789  31.402 1.00 29.55 ? 420 VAL A CG2 1 
ATOM   1396 N  N   . VAL A 1 213 ? -1.169  2.454   33.114 1.00 25.75 ? 421 VAL A N   1 
ATOM   1397 C  CA  . VAL A 1 213 ? 0.103   3.011   33.533 1.00 26.83 ? 421 VAL A CA  1 
ATOM   1398 C  C   . VAL A 1 213 ? 0.828   1.957   34.364 1.00 27.73 ? 421 VAL A C   1 
ATOM   1399 O  O   . VAL A 1 213 ? 0.370   1.548   35.436 1.00 25.13 ? 421 VAL A O   1 
ATOM   1400 C  CB  . VAL A 1 213 ? -0.080  4.340   34.269 1.00 27.30 ? 421 VAL A CB  1 
ATOM   1401 C  CG1 . VAL A 1 213 ? 1.238   4.827   34.834 1.00 29.92 ? 421 VAL A CG1 1 
ATOM   1402 C  CG2 . VAL A 1 213 ? -0.664  5.375   33.322 1.00 27.98 ? 421 VAL A CG2 1 
ATOM   1403 N  N   . GLU A 1 214 ? 1.951   1.480   33.848 1.00 26.85 ? 422 GLU A N   1 
ATOM   1404 C  CA  . GLU A 1 214 ? 2.615   0.349   34.468 1.00 29.11 ? 422 GLU A CA  1 
ATOM   1405 C  C   . GLU A 1 214 ? 4.011   0.208   33.898 1.00 28.53 ? 422 GLU A C   1 
ATOM   1406 O  O   . GLU A 1 214 ? 4.268   0.596   32.744 1.00 28.19 ? 422 GLU A O   1 
ATOM   1407 C  CB  . GLU A 1 214 ? 1.797   -0.926  34.183 1.00 30.53 ? 422 GLU A CB  1 
ATOM   1408 C  CG  . GLU A 1 214 ? 2.323   -2.194  34.833 1.00 31.11 ? 422 GLU A CG  1 
ATOM   1409 C  CD  . GLU A 1 214 ? 1.401   -3.376  34.586 1.00 32.03 ? 422 GLU A CD  1 
ATOM   1410 O  OE1 . GLU A 1 214 ? 1.735   -4.235  33.747 1.00 31.19 ? 422 GLU A OE1 1 
ATOM   1411 O  OE2 . GLU A 1 214 ? 0.317   -3.421  35.205 1.00 32.25 ? 422 GLU A OE2 1 
ATOM   1412 N  N   . VAL A 1 215 ? 4.897   -0.377  34.691 1.00 27.76 ? 423 VAL A N   1 
ATOM   1413 C  CA  . VAL A 1 215 ? 6.258   -0.584  34.262 1.00 29.20 ? 423 VAL A CA  1 
ATOM   1414 C  C   . VAL A 1 215 ? 6.311   -1.844  33.412 1.00 28.01 ? 423 VAL A C   1 
ATOM   1415 O  O   . VAL A 1 215 ? 5.868   -2.901  33.843 1.00 26.87 ? 423 VAL A O   1 
ATOM   1416 C  CB  . VAL A 1 215 ? 7.241   -0.701  35.453 1.00 30.17 ? 423 VAL A CB  1 
ATOM   1417 C  CG1 . VAL A 1 215 ? 8.646   -0.974  34.942 1.00 31.51 ? 423 VAL A CG1 1 
ATOM   1418 C  CG2 . VAL A 1 215 ? 7.218   0.562   36.301 1.00 30.76 ? 423 VAL A CG2 1 
ATOM   1419 N  N   . LEU A 1 216 ? 6.875   -1.731  32.216 1.00 26.83 ? 424 LEU A N   1 
ATOM   1420 C  CA  . LEU A 1 216 ? 6.947   -2.864  31.290 1.00 28.09 ? 424 LEU A CA  1 
ATOM   1421 C  C   . LEU A 1 216 ? 8.239   -3.673  31.416 1.00 29.89 ? 424 LEU A C   1 
ATOM   1422 O  O   . LEU A 1 216 ? 9.323   -3.129  31.593 1.00 30.21 ? 424 LEU A O   1 
ATOM   1423 C  CB  . LEU A 1 216 ? 6.828   -2.380  29.844 1.00 28.67 ? 424 LEU A CB  1 
ATOM   1424 C  CG  . LEU A 1 216 ? 5.481   -1.812  29.411 1.00 29.97 ? 424 LEU A CG  1 
ATOM   1425 C  CD1 . LEU A 1 216 ? 5.613   -1.088  28.078 1.00 29.49 ? 424 LEU A CD1 1 
ATOM   1426 C  CD2 . LEU A 1 216 ? 4.429   -2.896  29.301 1.00 31.85 ? 424 LEU A CD2 1 
ATOM   1427 N  N   . ASP A 1 217 ? 8.112   -4.988  31.303 1.00 31.50 ? 425 ASP A N   1 
ATOM   1428 C  CA  . ASP A 1 217 ? 9.270   -5.857  31.148 1.00 31.09 ? 425 ASP A CA  1 
ATOM   1429 C  C   . ASP A 1 217 ? 9.876   -5.568  29.773 1.00 30.83 ? 425 ASP A C   1 
ATOM   1430 O  O   . ASP A 1 217 ? 9.231   -5.814  28.765 1.00 28.76 ? 425 ASP A O   1 
ATOM   1431 C  CB  . ASP A 1 217 ? 8.807   -7.303  31.254 1.00 33.68 ? 425 ASP A CB  1 
ATOM   1432 C  CG  . ASP A 1 217 ? 9.932   -8.307  31.126 1.00 36.47 ? 425 ASP A CG  1 
ATOM   1433 O  OD1 . ASP A 1 217 ? 11.063  -7.949  30.727 1.00 35.33 ? 425 ASP A OD1 1 
ATOM   1434 O  OD2 . ASP A 1 217 ? 9.653   -9.483  31.427 1.00 39.89 ? 425 ASP A OD2 1 
ATOM   1435 N  N   . PRO A 1 218 ? 11.115  -5.046  29.729 1.00 31.82 ? 426 PRO A N   1 
ATOM   1436 C  CA  . PRO A 1 218 ? 11.737  -4.680  28.450 1.00 33.81 ? 426 PRO A CA  1 
ATOM   1437 C  C   . PRO A 1 218 ? 11.929  -5.839  27.478 1.00 33.30 ? 426 PRO A C   1 
ATOM   1438 O  O   . PRO A 1 218 ? 11.997  -5.616  26.276 1.00 32.94 ? 426 PRO A O   1 
ATOM   1439 C  CB  . PRO A 1 218 ? 13.104  -4.084  28.864 1.00 33.88 ? 426 PRO A CB  1 
ATOM   1440 C  CG  . PRO A 1 218 ? 13.371  -4.613  30.222 1.00 34.09 ? 426 PRO A CG  1 
ATOM   1441 C  CD  . PRO A 1 218 ? 12.035  -4.852  30.869 1.00 33.17 ? 426 PRO A CD  1 
ATOM   1442 N  N   . LYS A 1 219 ? 11.975  -7.068  27.983 1.00 35.90 ? 427 LYS A N   1 
ATOM   1443 C  CA  . LYS A 1 219 ? 12.012  -8.241  27.111 1.00 36.47 ? 427 LYS A CA  1 
ATOM   1444 C  C   . LYS A 1 219 ? 10.754  -8.377  26.241 1.00 34.17 ? 427 LYS A C   1 
ATOM   1445 O  O   . LYS A 1 219 ? 10.771  -9.136  25.284 1.00 32.51 ? 427 LYS A O   1 
ATOM   1446 C  CB  . LYS A 1 219 ? 12.200  -9.527  27.925 1.00 38.47 ? 427 LYS A CB  1 
ATOM   1447 C  CG  . LYS A 1 219 ? 13.556  -9.647  28.617 1.00 40.96 ? 427 LYS A CG  1 
ATOM   1448 C  CD  . LYS A 1 219 ? 13.570  -10.820 29.594 1.00 45.21 ? 427 LYS A CD  1 
ATOM   1449 N  N   . THR A 1 220 ? 9.668   -7.671  26.571 1.00 31.52 ? 428 THR A N   1 
ATOM   1450 C  CA  . THR A 1 220 ? 8.432   -7.762  25.776 1.00 29.73 ? 428 THR A CA  1 
ATOM   1451 C  C   . THR A 1 220 ? 8.361   -6.713  24.668 1.00 28.42 ? 428 THR A C   1 
ATOM   1452 O  O   . THR A 1 220 ? 7.375   -6.654  23.936 1.00 26.71 ? 428 THR A O   1 
ATOM   1453 C  CB  . THR A 1 220 ? 7.176   -7.671  26.667 1.00 30.32 ? 428 THR A CB  1 
ATOM   1454 O  OG1 . THR A 1 220 ? 7.099   -6.373  27.277 1.00 28.74 ? 428 THR A OG1 1 
ATOM   1455 C  CG2 . THR A 1 220 ? 7.226   -8.758  27.757 1.00 30.87 ? 428 THR A CG2 1 
ATOM   1456 N  N   . LEU A 1 221 ? 9.400   -5.891  24.532 1.00 27.78 ? 429 LEU A N   1 
ATOM   1457 C  CA  . LEU A 1 221 ? 9.418   -4.881  23.491 1.00 29.41 ? 429 LEU A CA  1 
ATOM   1458 C  C   . LEU A 1 221 ? 9.814   -5.543  22.204 1.00 29.72 ? 429 LEU A C   1 
ATOM   1459 O  O   . LEU A 1 221 ? 10.791  -6.302  22.181 1.00 28.65 ? 429 LEU A O   1 
ATOM   1460 C  CB  . LEU A 1 221 ? 10.424  -3.788  23.810 1.00 30.19 ? 429 LEU A CB  1 
ATOM   1461 C  CG  . LEU A 1 221 ? 10.218  -3.022  25.112 1.00 33.07 ? 429 LEU A CG  1 
ATOM   1462 C  CD1 . LEU A 1 221 ? 11.314  -1.968  25.257 1.00 34.06 ? 429 LEU A CD1 1 
ATOM   1463 C  CD2 . LEU A 1 221 ? 8.836   -2.392  25.183 1.00 31.92 ? 429 LEU A CD2 1 
ATOM   1464 N  N   . ILE A 1 222 ? 9.083   -5.251  21.136 1.00 28.48 ? 430 ILE A N   1 
ATOM   1465 C  CA  . ILE A 1 222 ? 9.308   -5.922  19.854 1.00 28.30 ? 430 ILE A CA  1 
ATOM   1466 C  C   . ILE A 1 222 ? 9.551   -4.978  18.670 1.00 28.50 ? 430 ILE A C   1 
ATOM   1467 O  O   . ILE A 1 222 ? 9.479   -5.390  17.503 1.00 27.72 ? 430 ILE A O   1 
ATOM   1468 C  CB  . ILE A 1 222 ? 8.150   -6.888  19.525 1.00 28.96 ? 430 ILE A CB  1 
ATOM   1469 C  CG1 . ILE A 1 222 ? 6.822   -6.135  19.414 1.00 29.29 ? 430 ILE A CG1 1 
ATOM   1470 C  CG2 . ILE A 1 222 ? 8.095   -8.007  20.570 1.00 29.16 ? 430 ILE A CG2 1 
ATOM   1471 C  CD1 . ILE A 1 222 ? 5.748   -6.915  18.693 1.00 30.56 ? 430 ILE A CD1 1 
ATOM   1472 N  N   . SER A 1 223 ? 9.839   -3.715  18.953 1.00 28.47 ? 431 SER A N   1 
ATOM   1473 C  CA  . SER A 1 223 ? 10.237  -2.793  17.906 1.00 28.43 ? 431 SER A CA  1 
ATOM   1474 C  C   . SER A 1 223 ? 11.238  -1.811  18.467 1.00 30.25 ? 431 SER A C   1 
ATOM   1475 O  O   . SER A 1 223 ? 11.396  -1.684  19.684 1.00 28.44 ? 431 SER A O   1 
ATOM   1476 C  CB  . SER A 1 223 ? 9.018   -2.041  17.334 1.00 28.98 ? 431 SER A CB  1 
ATOM   1477 O  OG  . SER A 1 223 ? 8.609   -0.959  18.160 1.00 27.03 ? 431 SER A OG  1 
ATOM   1478 N  N   . GLU A 1 224 ? 11.907  -1.112  17.562 1.00 30.28 ? 432 GLU A N   1 
ATOM   1479 C  CA  . GLU A 1 224 ? 12.587  0.116   17.900 1.00 31.90 ? 432 GLU A CA  1 
ATOM   1480 C  C   . GLU A 1 224 ? 11.521  1.163   18.228 1.00 32.10 ? 432 GLU A C   1 
ATOM   1481 O  O   . GLU A 1 224 ? 10.408  1.101   17.687 1.00 31.20 ? 432 GLU A O   1 
ATOM   1482 C  CB  . GLU A 1 224 ? 13.415  0.606   16.702 1.00 33.58 ? 432 GLU A CB  1 
ATOM   1483 C  CG  . GLU A 1 224 ? 14.645  -0.237  16.435 1.00 38.23 ? 432 GLU A CG  1 
ATOM   1484 C  CD  . GLU A 1 224 ? 15.395  0.196   15.178 1.00 43.09 ? 432 GLU A CD  1 
ATOM   1485 O  OE1 . GLU A 1 224 ? 15.152  1.307   14.653 1.00 44.64 ? 432 GLU A OE1 1 
ATOM   1486 O  OE2 . GLU A 1 224 ? 16.238  -0.587  14.709 1.00 51.03 ? 432 GLU A OE2 1 
ATOM   1487 N  N   . PRO A 1 225 ? 11.863  2.141   19.089 1.00 32.53 ? 433 PRO A N   1 
ATOM   1488 C  CA  . PRO A 1 225 ? 10.907  3.221   19.355 1.00 33.23 ? 433 PRO A CA  1 
ATOM   1489 C  C   . PRO A 1 225 ? 10.781  4.175   18.177 1.00 31.82 ? 433 PRO A C   1 
ATOM   1490 O  O   . PRO A 1 225 ? 11.627  4.178   17.304 1.00 33.56 ? 433 PRO A O   1 
ATOM   1491 C  CB  . PRO A 1 225 ? 11.499  3.942   20.577 1.00 32.75 ? 433 PRO A CB  1 
ATOM   1492 C  CG  . PRO A 1 225 ? 12.952  3.586   20.596 1.00 33.45 ? 433 PRO A CG  1 
ATOM   1493 C  CD  . PRO A 1 225 ? 13.090  2.255   19.899 1.00 33.16 ? 433 PRO A CD  1 
ATOM   1494 N  N   . CYS A 1 226 ? 9.710   4.959   18.150 1.00 31.58 ? 434 CYS A N   1 
ATOM   1495 C  CA  . CYS A 1 226 ? 9.560   6.037   17.184 1.00 32.60 ? 434 CYS A CA  1 
ATOM   1496 C  C   . CYS A 1 226 ? 9.045   7.278   17.900 1.00 31.47 ? 434 CYS A C   1 
ATOM   1497 O  O   . CYS A 1 226 ? 8.011   7.227   18.568 1.00 29.51 ? 434 CYS A O   1 
ATOM   1498 C  CB  . CYS A 1 226 ? 8.615   5.639   16.048 1.00 34.77 ? 434 CYS A CB  1 
ATOM   1499 S  SG  . CYS A 1 226 ? 8.496   6.837   14.686 1.00 43.63 ? 434 CYS A SG  1 
ATOM   1500 N  N   . GLY A 1 227 ? 9.784   8.381   17.762 1.00 28.71 ? 435 GLY A N   1 
ATOM   1501 C  CA  . GLY A 1 227 ? 9.353   9.688   18.235 1.00 29.10 ? 435 GLY A CA  1 
ATOM   1502 C  C   . GLY A 1 227 ? 8.098   10.136  17.502 1.00 31.72 ? 435 GLY A C   1 
ATOM   1503 O  O   . GLY A 1 227 ? 8.030   10.084  16.277 1.00 32.47 ? 435 GLY A O   1 
ATOM   1504 N  N   . ILE A 1 228 ? 7.081   10.542  18.241 1.00 28.27 ? 436 ILE A N   1 
ATOM   1505 C  CA  . ILE A 1 228 ? 5.860   11.056  17.617 1.00 30.23 ? 436 ILE A CA  1 
ATOM   1506 C  C   . ILE A 1 228 ? 5.611   12.528  17.919 1.00 30.14 ? 436 ILE A C   1 
ATOM   1507 O  O   . ILE A 1 228 ? 4.620   13.090  17.444 1.00 29.58 ? 436 ILE A O   1 
ATOM   1508 C  CB  . ILE A 1 228 ? 4.610   10.264  18.061 1.00 29.51 ? 436 ILE A CB  1 
ATOM   1509 C  CG1 . ILE A 1 228 ? 4.424   10.338  19.589 1.00 29.63 ? 436 ILE A CG1 1 
ATOM   1510 C  CG2 . ILE A 1 228 ? 4.703   8.831   17.552 1.00 29.44 ? 436 ILE A CG2 1 
ATOM   1511 C  CD1 . ILE A 1 228 ? 3.065   9.856   20.061 1.00 28.80 ? 436 ILE A CD1 1 
ATOM   1512 N  N   . LYS A 1 229 ? 6.479   13.145  18.719 1.00 28.25 ? 437 LYS A N   1 
ATOM   1513 C  CA  . LYS A 1 229 ? 6.250   14.525  19.158 1.00 29.50 ? 437 LYS A CA  1 
ATOM   1514 C  C   . LYS A 1 229 ? 7.535   15.066  19.779 1.00 31.29 ? 437 LYS A C   1 
ATOM   1515 O  O   . LYS A 1 229 ? 8.205   14.370  20.556 1.00 27.57 ? 437 LYS A O   1 
ATOM   1516 C  CB  . LYS A 1 229 ? 5.095   14.591  20.164 1.00 31.05 ? 437 LYS A CB  1 
ATOM   1517 C  CG  . LYS A 1 229 ? 4.773   15.976  20.711 1.00 32.61 ? 437 LYS A CG  1 
ATOM   1518 C  CD  . LYS A 1 229 ? 4.387   16.943  19.591 1.00 34.18 ? 437 LYS A CD  1 
ATOM   1519 C  CE  . LYS A 1 229 ? 3.532   18.101  20.094 1.00 34.05 ? 437 LYS A CE  1 
ATOM   1520 N  NZ  . LYS A 1 229 ? 3.161   18.994  18.961 1.00 34.66 ? 437 LYS A NZ  1 
ATOM   1521 N  N   . HIS A 1 230 ? 7.876   16.291  19.379 1.00 31.40 ? 438 HIS A N   1 
ATOM   1522 C  CA  . HIS A 1 230 ? 9.003   17.050  19.895 1.00 32.07 ? 438 HIS A CA  1 
ATOM   1523 C  C   . HIS A 1 230 ? 8.484   18.423  20.308 1.00 34.13 ? 438 HIS A C   1 
ATOM   1524 O  O   . HIS A 1 230 ? 7.861   19.126  19.506 1.00 34.41 ? 438 HIS A O   1 
ATOM   1525 C  CB  . HIS A 1 230 ? 10.061  17.195  18.798 1.00 34.02 ? 438 HIS A CB  1 
ATOM   1526 C  CG  . HIS A 1 230 ? 11.250  17.999  19.208 1.00 35.91 ? 438 HIS A CG  1 
ATOM   1527 N  ND1 . HIS A 1 230 ? 11.210  19.370  19.349 1.00 37.14 ? 438 HIS A ND1 1 
ATOM   1528 C  CD2 . HIS A 1 230 ? 12.515  17.626  19.510 1.00 37.04 ? 438 HIS A CD2 1 
ATOM   1529 C  CE1 . HIS A 1 230 ? 12.398  19.809  19.717 1.00 37.40 ? 438 HIS A CE1 1 
ATOM   1530 N  NE2 . HIS A 1 230 ? 13.206  18.769  19.826 1.00 39.56 ? 438 HIS A NE2 1 
ATOM   1531 N  N   . ILE A 1 231 ? 8.752   18.803  21.549 1.00 31.86 ? 439 ILE A N   1 
ATOM   1532 C  CA  . ILE A 1 231 ? 8.272   20.055  22.128 1.00 35.04 ? 439 ILE A CA  1 
ATOM   1533 C  C   . ILE A 1 231 ? 9.480   20.866  22.598 1.00 35.33 ? 439 ILE A C   1 
ATOM   1534 O  O   . ILE A 1 231 ? 10.291  20.353  23.369 1.00 33.16 ? 439 ILE A O   1 
ATOM   1535 C  CB  . ILE A 1 231 ? 7.354   19.737  23.332 1.00 36.42 ? 439 ILE A CB  1 
ATOM   1536 C  CG1 . ILE A 1 231 ? 5.977   19.293  22.830 1.00 38.64 ? 439 ILE A CG1 1 
ATOM   1537 C  CG2 . ILE A 1 231 ? 7.199   20.925  24.263 1.00 38.82 ? 439 ILE A CG2 1 
ATOM   1538 C  CD1 . ILE A 1 231 ? 5.107   18.669  23.907 1.00 38.29 ? 439 ILE A CD1 1 
ATOM   1539 N  N   . ASP A 1 232 ? 9.646   22.087  22.091 1.00 35.00 ? 440 ASP A N   1 
ATOM   1540 C  CA  . ASP A 1 232 ? 10.582  23.035  22.703 1.00 36.95 ? 440 ASP A CA  1 
ATOM   1541 C  C   . ASP A 1 232 ? 9.736   24.036  23.446 1.00 35.73 ? 440 ASP A C   1 
ATOM   1542 O  O   . ASP A 1 232 ? 8.966   24.756  22.824 1.00 33.35 ? 440 ASP A O   1 
ATOM   1543 C  CB  . ASP A 1 232 ? 11.478  23.762  21.702 1.00 39.75 ? 440 ASP A CB  1 
ATOM   1544 C  CG  . ASP A 1 232 ? 12.605  24.559  22.404 1.00 42.96 ? 440 ASP A CG  1 
ATOM   1545 O  OD1 . ASP A 1 232 ? 12.327  25.366  23.326 1.00 42.65 ? 440 ASP A OD1 1 
ATOM   1546 O  OD2 . ASP A 1 232 ? 13.787  24.345  22.064 1.00 44.37 ? 440 ASP A OD2 1 
ATOM   1547 N  N   . CYS A 1 233 ? 9.882   24.090  24.773 1.00 36.33 ? 441 CYS A N   1 
ATOM   1548 C  CA  . CYS A 1 233 ? 8.973   24.895  25.598 1.00 39.30 ? 441 CYS A CA  1 
ATOM   1549 C  C   . CYS A 1 233 ? 9.097   26.408  25.364 1.00 40.98 ? 441 CYS A C   1 
ATOM   1550 O  O   . CYS A 1 233 ? 8.221   27.174  25.778 1.00 40.91 ? 441 CYS A O   1 
ATOM   1551 C  CB  . CYS A 1 233 ? 9.152   24.566  27.079 1.00 41.79 ? 441 CYS A CB  1 
ATOM   1552 S  SG  . CYS A 1 233 ? 8.726   22.852  27.491 1.00 45.89 ? 441 CYS A SG  1 
ATOM   1553 N  N   . HIS A 1 234 ? 10.178  26.836  24.713 1.00 40.16 ? 442 HIS A N   1 
ATOM   1554 C  CA  . HIS A 1 234 ? 10.330  28.241  24.351 1.00 43.27 ? 442 HIS A CA  1 
ATOM   1555 C  C   . HIS A 1 234 ? 9.413   28.639  23.210 1.00 45.23 ? 442 HIS A C   1 
ATOM   1556 O  O   . HIS A 1 234 ? 8.884   29.743  23.217 1.00 47.57 ? 442 HIS A O   1 
ATOM   1557 C  CB  . HIS A 1 234 ? 11.774  28.563  23.975 1.00 39.43 ? 442 HIS A CB  1 
ATOM   1558 C  CG  . HIS A 1 234 ? 12.728  28.419  25.115 1.00 39.82 ? 442 HIS A CG  1 
ATOM   1559 N  ND1 . HIS A 1 234 ? 13.508  27.295  25.292 1.00 38.65 ? 442 HIS A ND1 1 
ATOM   1560 C  CD2 . HIS A 1 234 ? 13.010  29.242  26.150 1.00 37.78 ? 442 HIS A CD2 1 
ATOM   1561 C  CE1 . HIS A 1 234 ? 14.243  27.439  26.379 1.00 39.05 ? 442 HIS A CE1 1 
ATOM   1562 N  NE2 . HIS A 1 234 ? 13.968  28.614  26.912 1.00 38.25 ? 442 HIS A NE2 1 
ATOM   1563 N  N   . THR A 1 235 ? 9.229   27.747  22.242 1.00 45.96 ? 443 THR A N   1 
ATOM   1564 C  CA  . THR A 1 235 ? 8.459   28.069  21.041 1.00 47.52 ? 443 THR A CA  1 
ATOM   1565 C  C   . THR A 1 235 ? 7.072   27.397  20.939 1.00 48.44 ? 443 THR A C   1 
ATOM   1566 O  O   . THR A 1 235 ? 6.292   27.762  20.068 1.00 49.48 ? 443 THR A O   1 
ATOM   1567 C  CB  . THR A 1 235 ? 9.273   27.708  19.793 1.00 46.87 ? 443 THR A CB  1 
ATOM   1568 O  OG1 . THR A 1 235 ? 9.668   26.343  19.877 1.00 45.36 ? 443 THR A OG1 1 
ATOM   1569 C  CG2 . THR A 1 235 ? 10.535  28.579  19.693 1.00 48.38 ? 443 THR A CG2 1 
ATOM   1570 N  N   . THR A 1 236 ? 6.754   26.440  21.813 1.00 46.54 ? 444 THR A N   1 
ATOM   1571 C  CA  A THR A 1 236 ? 5.472   25.741  21.782 0.50 45.91 ? 444 THR A CA  1 
ATOM   1572 C  CA  B THR A 1 236 ? 5.449   25.771  21.732 0.50 46.61 ? 444 THR A CA  1 
ATOM   1573 C  C   . THR A 1 236 ? 4.342   26.611  22.356 1.00 46.70 ? 444 THR A C   1 
ATOM   1574 O  O   . THR A 1 236 ? 4.560   27.347  23.316 1.00 46.12 ? 444 THR A O   1 
ATOM   1575 C  CB  A THR A 1 236 ? 5.570   24.424  22.589 0.50 44.39 ? 444 THR A CB  1 
ATOM   1576 C  CB  B THR A 1 236 ? 5.420   24.382  22.403 0.50 45.95 ? 444 THR A CB  1 
ATOM   1577 O  OG1 A THR A 1 236 ? 6.681   23.655  22.110 0.50 43.22 ? 444 THR A OG1 1 
ATOM   1578 O  OG1 B THR A 1 236 ? 5.897   24.479  23.751 0.50 44.67 ? 444 THR A OG1 1 
ATOM   1579 C  CG2 A THR A 1 236 ? 4.317   23.595  22.457 0.50 43.19 ? 444 THR A CG2 1 
ATOM   1580 C  CG2 B THR A 1 236 ? 6.250   23.381  21.607 0.50 46.19 ? 444 THR A CG2 1 
ATOM   1581 N  N   . SER A 1 237 ? 3.148   26.495  21.771 1.00 44.51 ? 445 SER A N   1 
ATOM   1582 C  CA  . SER A 1 237 ? 1.933   27.116  22.284 1.00 47.11 ? 445 SER A CA  1 
ATOM   1583 C  C   . SER A 1 237 ? 0.942   26.011  22.711 1.00 46.36 ? 445 SER A C   1 
ATOM   1584 O  O   . SER A 1 237 ? 1.152   24.818  22.427 1.00 42.67 ? 445 SER A O   1 
ATOM   1585 C  CB  . SER A 1 237 ? 1.309   28.008  21.207 1.00 48.53 ? 445 SER A CB  1 
ATOM   1586 O  OG  . SER A 1 237 ? 0.827   27.219  20.127 1.00 51.98 ? 445 SER A OG  1 
ATOM   1587 N  N   . ILE A 1 238 ? -0.136  26.405  23.381 1.00 45.94 ? 446 ILE A N   1 
ATOM   1588 C  CA  . ILE A 1 238 ? -1.109  25.435  23.895 1.00 47.45 ? 446 ILE A CA  1 
ATOM   1589 C  C   . ILE A 1 238 ? -1.784  24.632  22.765 1.00 45.24 ? 446 ILE A C   1 
ATOM   1590 O  O   . ILE A 1 238 ? -2.066  23.440  22.931 1.00 41.56 ? 446 ILE A O   1 
ATOM   1591 C  CB  . ILE A 1 238 ? -2.172  26.120  24.780 1.00 51.02 ? 446 ILE A CB  1 
ATOM   1592 C  CG1 . ILE A 1 238 ? -1.512  26.766  26.008 1.00 53.53 ? 446 ILE A CG1 1 
ATOM   1593 C  CG2 . ILE A 1 238 ? -3.225  25.117  25.235 1.00 52.47 ? 446 ILE A CG2 1 
ATOM   1594 N  N   . SER A 1 239 ? -2.002  25.265  21.613 1.00 44.02 ? 447 SER A N   1 
ATOM   1595 C  CA  . SER A 1 239 ? -2.600  24.572  20.462 1.00 45.72 ? 447 SER A CA  1 
ATOM   1596 C  C   . SER A 1 239 ? -1.689  23.460  19.907 1.00 44.67 ? 447 SER A C   1 
ATOM   1597 O  O   . SER A 1 239 ? -2.172  22.501  19.314 1.00 42.45 ? 447 SER A O   1 
ATOM   1598 C  CB  . SER A 1 239 ? -2.985  25.561  19.353 1.00 46.04 ? 447 SER A CB  1 
ATOM   1599 O  OG  . SER A 1 239 ? -1.843  26.089  18.700 1.00 48.34 ? 447 SER A OG  1 
ATOM   1600 N  N   . ASP A 1 240 ? -0.380  23.582  20.122 1.00 43.00 ? 448 ASP A N   1 
ATOM   1601 C  CA  . ASP A 1 240 ? 0.571   22.539  19.718 1.00 43.83 ? 448 ASP A CA  1 
ATOM   1602 C  C   . ASP A 1 240 ? 0.433   21.216  20.469 1.00 39.35 ? 448 ASP A C   1 
ATOM   1603 O  O   . ASP A 1 240 ? 0.921   20.189  19.997 1.00 41.15 ? 448 ASP A O   1 
ATOM   1604 C  CB  . ASP A 1 240 ? 2.000   23.035  19.891 1.00 46.30 ? 448 ASP A CB  1 
ATOM   1605 C  CG  . ASP A 1 240 ? 2.363   24.110  18.898 1.00 48.74 ? 448 ASP A CG  1 
ATOM   1606 O  OD1 . ASP A 1 240 ? 1.886   24.034  17.749 1.00 53.39 ? 448 ASP A OD1 1 
ATOM   1607 O  OD2 . ASP A 1 240 ? 3.134   25.023  19.258 1.00 50.13 ? 448 ASP A OD2 1 
ATOM   1608 N  N   . LEU A 1 241 ? -0.228  21.234  21.617 1.00 37.73 ? 449 LEU A N   1 
ATOM   1609 C  CA  . LEU A 1 241 ? -0.359  20.036  22.449 1.00 40.32 ? 449 LEU A CA  1 
ATOM   1610 C  C   . LEU A 1 241 ? -1.417  19.046  21.968 1.00 41.00 ? 449 LEU A C   1 
ATOM   1611 O  O   . LEU A 1 241 ? -1.505  17.939  22.487 1.00 40.07 ? 449 LEU A O   1 
ATOM   1612 C  CB  . LEU A 1 241 ? -0.656  20.434  23.882 1.00 41.25 ? 449 LEU A CB  1 
ATOM   1613 C  CG  . LEU A 1 241 ? 0.344   21.442  24.468 1.00 44.74 ? 449 LEU A CG  1 
ATOM   1614 C  CD1 . LEU A 1 241 ? 0.114   21.565  25.966 1.00 46.41 ? 449 LEU A CD1 1 
ATOM   1615 C  CD2 . LEU A 1 241 ? 1.786   21.040  24.167 1.00 44.79 ? 449 LEU A CD2 1 
ATOM   1616 N  N   . GLU A 1 242 ? -2.234  19.463  21.008 1.00 38.86 ? 450 GLU A N   1 
ATOM   1617 C  CA  . GLU A 1 242 ? -3.083  18.560  20.253 1.00 39.88 ? 450 GLU A CA  1 
ATOM   1618 C  C   . GLU A 1 242 ? -2.376  18.368  18.936 1.00 38.49 ? 450 GLU A C   1 
ATOM   1619 O  O   . GLU A 1 242 ? -2.053  19.341  18.274 1.00 40.77 ? 450 GLU A O   1 
ATOM   1620 C  CB  . GLU A 1 242 ? -4.450  19.193  20.009 1.00 39.89 ? 450 GLU A CB  1 
ATOM   1621 C  CG  . GLU A 1 242 ? -5.341  19.223  21.233 1.00 43.41 ? 450 GLU A CG  1 
ATOM   1622 C  CD  . GLU A 1 242 ? -6.762  19.612  20.865 1.00 46.68 ? 450 GLU A CD  1 
ATOM   1623 O  OE1 . GLU A 1 242 ? -7.698  18.877  21.224 1.00 47.77 ? 450 GLU A OE1 1 
ATOM   1624 O  OE2 . GLU A 1 242 ? -6.936  20.640  20.180 1.00 50.22 ? 450 GLU A OE2 1 
ATOM   1625 N  N   . PHE A 1 243 ? -2.105  17.129  18.555 1.00 35.18 ? 451 PHE A N   1 
ATOM   1626 C  CA  . PHE A 1 243 ? -1.306  16.883  17.368 1.00 32.13 ? 451 PHE A CA  1 
ATOM   1627 C  C   . PHE A 1 243 ? -1.554  15.490  16.798 1.00 31.45 ? 451 PHE A C   1 
ATOM   1628 O  O   . PHE A 1 243 ? -2.076  14.616  17.482 1.00 27.95 ? 451 PHE A O   1 
ATOM   1629 C  CB  . PHE A 1 243 ? 0.172   16.994  17.734 1.00 33.76 ? 451 PHE A CB  1 
ATOM   1630 C  CG  . PHE A 1 243 ? 0.640   15.892  18.643 1.00 32.44 ? 451 PHE A CG  1 
ATOM   1631 C  CD1 . PHE A 1 243 ? 0.518   16.018  20.010 1.00 33.28 ? 451 PHE A CD1 1 
ATOM   1632 C  CD2 . PHE A 1 243 ? 1.178   14.723  18.124 1.00 32.73 ? 451 PHE A CD2 1 
ATOM   1633 C  CE1 . PHE A 1 243 ? 0.925   15.002  20.853 1.00 32.77 ? 451 PHE A CE1 1 
ATOM   1634 C  CE2 . PHE A 1 243 ? 1.592   13.696  18.965 1.00 33.75 ? 451 PHE A CE2 1 
ATOM   1635 C  CZ  . PHE A 1 243 ? 1.467   13.840  20.332 1.00 31.80 ? 451 PHE A CZ  1 
ATOM   1636 N  N   . SER A 1 244 ? -1.137  15.299  15.549 1.00 30.12 ? 452 SER A N   1 
ATOM   1637 C  CA  . SER A 1 244 ? -1.227  14.022  14.861 1.00 32.57 ? 452 SER A CA  1 
ATOM   1638 C  C   . SER A 1 244 ? 0.149   13.666  14.359 1.00 33.12 ? 452 SER A C   1 
ATOM   1639 O  O   . SER A 1 244 ? 0.916   14.542  13.980 1.00 35.61 ? 452 SER A O   1 
ATOM   1640 C  CB  . SER A 1 244 ? -2.153  14.109  13.644 1.00 32.75 ? 452 SER A CB  1 
ATOM   1641 O  OG  . SER A 1 244 ? -3.488  13.926  14.008 1.00 34.65 ? 452 SER A OG  1 
ATOM   1642 N  N   . SER A 1 245 ? 0.441   12.380  14.305 1.00 31.12 ? 453 SER A N   1 
ATOM   1643 C  CA  . SER A 1 245 ? 1.701   11.931  13.777 1.00 33.83 ? 453 SER A CA  1 
ATOM   1644 C  C   . SER A 1 245 ? 1.533   10.587  13.093 1.00 32.74 ? 453 SER A C   1 
ATOM   1645 O  O   . SER A 1 245 ? 0.935   9.666   13.656 1.00 29.64 ? 453 SER A O   1 
ATOM   1646 C  CB  . SER A 1 245 ? 2.721   11.841  14.924 1.00 37.60 ? 453 SER A CB  1 
ATOM   1647 O  OG  . SER A 1 245 ? 3.951   11.302  14.482 1.00 43.54 ? 453 SER A OG  1 
ATOM   1648 N  N   . ASP A 1 246 ? 2.046   10.469  11.872 1.00 31.91 ? 454 ASP A N   1 
ATOM   1649 C  CA  . ASP A 1 246 ? 2.195   9.150   11.265 1.00 34.95 ? 454 ASP A CA  1 
ATOM   1650 C  C   . ASP A 1 246 ? 3.451   8.559   11.876 1.00 36.61 ? 454 ASP A C   1 
ATOM   1651 O  O   . ASP A 1 246 ? 4.373   9.298   12.180 1.00 43.29 ? 454 ASP A O   1 
ATOM   1652 C  CB  . ASP A 1 246 ? 2.307   9.238   9.750  1.00 36.10 ? 454 ASP A CB  1 
ATOM   1653 C  CG  . ASP A 1 246 ? 1.044   9.787   9.118  1.00 37.61 ? 454 ASP A CG  1 
ATOM   1654 O  OD1 . ASP A 1 246 ? -0.036  9.177   9.238  1.00 41.63 ? 454 ASP A OD1 1 
ATOM   1655 O  OD2 . ASP A 1 246 ? 1.123   10.849  8.506  1.00 44.62 ? 454 ASP A OD2 1 
ATOM   1656 N  N   . PHE A 1 247 ? 3.479   7.254   12.112 1.00 31.81 ? 455 PHE A N   1 
ATOM   1657 C  CA  . PHE A 1 247 ? 4.683   6.632   12.668 1.00 30.42 ? 455 PHE A CA  1 
ATOM   1658 C  C   . PHE A 1 247 ? 4.960   5.301   12.006 1.00 29.25 ? 455 PHE A C   1 
ATOM   1659 O  O   . PHE A 1 247 ? 4.055   4.646   11.453 1.00 29.66 ? 455 PHE A O   1 
ATOM   1660 C  CB  . PHE A 1 247 ? 4.576   6.463   14.199 1.00 30.37 ? 455 PHE A CB  1 
ATOM   1661 C  CG  . PHE A 1 247 ? 3.445   5.578   14.640 1.00 30.67 ? 455 PHE A CG  1 
ATOM   1662 C  CD1 . PHE A 1 247 ? 3.605   4.200   14.699 1.00 31.75 ? 455 PHE A CD1 1 
ATOM   1663 C  CD2 . PHE A 1 247 ? 2.219   6.120   14.988 1.00 30.65 ? 455 PHE A CD2 1 
ATOM   1664 C  CE1 . PHE A 1 247 ? 2.563   3.384   15.077 1.00 32.97 ? 455 PHE A CE1 1 
ATOM   1665 C  CE2 . PHE A 1 247 ? 1.171   5.307   15.372 1.00 30.32 ? 455 PHE A CE2 1 
ATOM   1666 C  CZ  . PHE A 1 247 ? 1.342   3.936   15.422 1.00 31.76 ? 455 PHE A CZ  1 
ATOM   1667 N  N   . THR A 1 248 ? 6.215   4.905   12.074 1.00 29.62 ? 456 THR A N   1 
ATOM   1668 C  CA  . THR A 1 248 ? 6.646   3.617   11.590 1.00 30.27 ? 456 THR A CA  1 
ATOM   1669 C  C   . THR A 1 248 ? 7.441   2.968   12.685 1.00 30.39 ? 456 THR A C   1 
ATOM   1670 O  O   . THR A 1 248 ? 8.396   3.563   13.184 1.00 30.11 ? 456 THR A O   1 
ATOM   1671 C  CB  . THR A 1 248 ? 7.534   3.785   10.365 1.00 32.84 ? 456 THR A CB  1 
ATOM   1672 O  OG1 . THR A 1 248 ? 6.815   4.542   9.394  1.00 32.69 ? 456 THR A OG1 1 
ATOM   1673 C  CG2 . THR A 1 248 ? 7.946   2.425   9.800  1.00 34.50 ? 456 THR A CG2 1 
ATOM   1674 N  N   . LEU A 1 249 ? 7.023   1.773   13.092 1.00 28.90 ? 457 LEU A N   1 
ATOM   1675 C  CA  . LEU A 1 249 ? 7.751   1.017   14.089 1.00 29.67 ? 457 LEU A CA  1 
ATOM   1676 C  C   . LEU A 1 249 ? 8.549   -0.097  13.384 1.00 29.92 ? 457 LEU A C   1 
ATOM   1677 O  O   . LEU A 1 249 ? 7.972   -0.960  12.709 1.00 29.46 ? 457 LEU A O   1 
ATOM   1678 C  CB  . LEU A 1 249 ? 6.779   0.433   15.107 1.00 29.07 ? 457 LEU A CB  1 
ATOM   1679 C  CG  . LEU A 1 249 ? 5.951   1.470   15.892 1.00 30.02 ? 457 LEU A CG  1 
ATOM   1680 C  CD1 . LEU A 1 249 ? 4.985   0.758   16.826 1.00 31.37 ? 457 LEU A CD1 1 
ATOM   1681 C  CD2 . LEU A 1 249 ? 6.853   2.397   16.681 1.00 30.04 ? 457 LEU A CD2 1 
ATOM   1682 N  N   . LYS A 1 250 ? 9.867   -0.050  13.524 1.00 29.06 ? 458 LYS A N   1 
ATOM   1683 C  CA  . LYS A 1 250 ? 10.744  -1.056  12.914 1.00 30.41 ? 458 LYS A CA  1 
ATOM   1684 C  C   . LYS A 1 250 ? 10.722  -2.268  13.807 1.00 27.88 ? 458 LYS A C   1 
ATOM   1685 O  O   . LYS A 1 250 ? 11.311  -2.267  14.882 1.00 28.26 ? 458 LYS A O   1 
ATOM   1686 C  CB  . LYS A 1 250 ? 12.175  -0.527  12.768 1.00 31.23 ? 458 LYS A CB  1 
ATOM   1687 N  N   . ILE A 1 251 ? 9.994   -3.287  13.380 1.00 28.09 ? 459 ILE A N   1 
ATOM   1688 C  CA  . ILE A 1 251 ? 9.823   -4.493  14.188 1.00 29.96 ? 459 ILE A CA  1 
ATOM   1689 C  C   . ILE A 1 251 ? 11.158  -5.247  14.315 1.00 30.73 ? 459 ILE A C   1 
ATOM   1690 O  O   . ILE A 1 251 ? 11.882  -5.396  13.328 1.00 31.06 ? 459 ILE A O   1 
ATOM   1691 C  CB  . ILE A 1 251 ? 8.778   -5.430  13.550 1.00 29.06 ? 459 ILE A CB  1 
ATOM   1692 C  CG1 . ILE A 1 251 ? 7.417   -4.725  13.407 1.00 31.12 ? 459 ILE A CG1 1 
ATOM   1693 C  CG2 . ILE A 1 251 ? 8.674   -6.724  14.331 1.00 29.51 ? 459 ILE A CG2 1 
ATOM   1694 C  CD1 . ILE A 1 251 ? 6.855   -4.167  14.706 1.00 29.77 ? 459 ILE A CD1 1 
ATOM   1695 N  N   . THR A 1 252 ? 11.467  -5.716  15.519 1.00 31.23 ? 460 THR A N   1 
ATOM   1696 C  CA  . THR A 1 252 ? 12.737  -6.383  15.813 1.00 33.60 ? 460 THR A CA  1 
ATOM   1697 C  C   . THR A 1 252 ? 12.567  -7.832  16.257 1.00 35.76 ? 460 THR A C   1 
ATOM   1698 O  O   . THR A 1 252 ? 13.549  -8.523  16.497 1.00 35.22 ? 460 THR A O   1 
ATOM   1699 C  CB  . THR A 1 252 ? 13.501  -5.645  16.924 1.00 32.88 ? 460 THR A CB  1 
ATOM   1700 O  OG1 . THR A 1 252 ? 12.685  -5.569  18.098 1.00 32.14 ? 460 THR A OG1 1 
ATOM   1701 C  CG2 . THR A 1 252 ? 13.861  -4.248  16.475 1.00 34.15 ? 460 THR A CG2 1 
ATOM   1702 N  N   . ARG A 1 253 ? 11.330  -8.288  16.413 1.00 35.67 ? 461 ARG A N   1 
ATOM   1703 C  CA  . ARG A 1 253 ? 11.100  -9.675  16.753 1.00 36.66 ? 461 ARG A CA  1 
ATOM   1704 C  C   . ARG A 1 253 ? 9.788   -10.136 16.193 1.00 36.75 ? 461 ARG A C   1 
ATOM   1705 O  O   . ARG A 1 253 ? 8.748   -9.471  16.362 1.00 35.75 ? 461 ARG A O   1 
ATOM   1706 C  CB  . ARG A 1 253 ? 11.129  -9.911  18.261 1.00 39.63 ? 461 ARG A CB  1 
ATOM   1707 C  CG  . ARG A 1 253 ? 10.935  -11.376 18.618 1.00 41.75 ? 461 ARG A CG  1 
ATOM   1708 C  CD  . ARG A 1 253 ? 11.441  -11.703 20.001 1.00 45.79 ? 461 ARG A CD  1 
ATOM   1709 N  NE  . ARG A 1 253 ? 10.477  -11.343 21.035 1.00 48.19 ? 461 ARG A NE  1 
ATOM   1710 C  CZ  . ARG A 1 253 ? 10.708  -10.527 22.061 1.00 48.36 ? 461 ARG A CZ  1 
ATOM   1711 N  NH1 . ARG A 1 253 ? 9.740   -10.298 22.937 1.00 45.26 ? 461 ARG A NH1 1 
ATOM   1712 N  NH2 . ARG A 1 253 ? 11.888  -9.938  22.231 1.00 50.44 ? 461 ARG A NH2 1 
ATOM   1713 N  N   . THR A 1 254 ? 9.854   -11.283 15.526 1.00 33.91 ? 462 THR A N   1 
ATOM   1714 C  CA  . THR A 1 254 ? 8.691   -11.935 14.948 1.00 34.08 ? 462 THR A CA  1 
ATOM   1715 C  C   . THR A 1 254 ? 7.866   -12.463 16.108 1.00 33.71 ? 462 THR A C   1 
ATOM   1716 O  O   . THR A 1 254 ? 8.354   -13.236 16.931 1.00 32.57 ? 462 THR A O   1 
ATOM   1717 C  CB  . THR A 1 254 ? 9.121   -13.061 13.994 1.00 35.46 ? 462 THR A CB  1 
ATOM   1718 O  OG1 . THR A 1 254 ? 9.907   -12.483 12.946 1.00 36.47 ? 462 THR A OG1 1 
ATOM   1719 C  CG2 . THR A 1 254 ? 7.927   -13.751 13.365 1.00 36.42 ? 462 THR A CG2 1 
ATOM   1720 N  N   . SER A 1 255 ? 6.631   -11.988 16.194 1.00 32.45 ? 463 SER A N   1 
ATOM   1721 C  CA  . SER A 1 255 ? 5.825   -12.183 17.383 1.00 32.69 ? 463 SER A CA  1 
ATOM   1722 C  C   . SER A 1 255 ? 4.406   -11.672 17.166 1.00 30.74 ? 463 SER A C   1 
ATOM   1723 O  O   . SER A 1 255 ? 4.093   -11.071 16.132 1.00 29.72 ? 463 SER A O   1 
ATOM   1724 C  CB  . SER A 1 255 ? 6.465   -11.421 18.554 1.00 33.24 ? 463 SER A CB  1 
ATOM   1725 O  OG  . SER A 1 255 ? 6.557   -10.049 18.228 1.00 35.31 ? 463 SER A OG  1 
ATOM   1726 N  N   . MET A 1 256 ? 3.558   -11.927 18.155 1.00 29.51 ? 464 MET A N   1 
ATOM   1727 C  CA  . MET A 1 256 ? 2.207   -11.382 18.203 1.00 30.52 ? 464 MET A CA  1 
ATOM   1728 C  C   . MET A 1 256 ? 2.234   -10.023 18.930 1.00 30.15 ? 464 MET A C   1 
ATOM   1729 O  O   . MET A 1 256 ? 2.586   -9.956  20.119 1.00 28.46 ? 464 MET A O   1 
ATOM   1730 C  CB  . MET A 1 256 ? 1.324   -12.376 18.952 1.00 34.21 ? 464 MET A CB  1 
ATOM   1731 C  CG  . MET A 1 256 ? -0.151  -12.050 18.963 1.00 37.47 ? 464 MET A CG  1 
ATOM   1732 S  SD  . MET A 1 256 ? -0.891  -12.040 17.323 1.00 40.68 ? 464 MET A SD  1 
ATOM   1733 C  CE  . MET A 1 256 ? -0.259  -13.560 16.646 1.00 37.65 ? 464 MET A CE  1 
ATOM   1734 N  N   . CYS A 1 257 ? 1.909   -8.947  18.209 1.00 29.02 ? 465 CYS A N   1 
ATOM   1735 C  CA  . CYS A 1 257 ? 1.798   -7.610  18.800 1.00 27.44 ? 465 CYS A CA  1 
ATOM   1736 C  C   . CYS A 1 257 ? 0.468   -7.486  19.548 1.00 27.26 ? 465 CYS A C   1 
ATOM   1737 O  O   . CYS A 1 257 ? -0.602  -7.670  18.953 1.00 26.15 ? 465 CYS A O   1 
ATOM   1738 C  CB  . CYS A 1 257 ? 1.883   -6.520  17.733 1.00 28.33 ? 465 CYS A CB  1 
ATOM   1739 S  SG  . CYS A 1 257 ? 1.878   -4.793  18.350 1.00 26.11 ? 465 CYS A SG  1 
ATOM   1740 N  N   . THR A 1 258 ? 0.548   -7.180  20.845 1.00 24.92 ? 466 THR A N   1 
ATOM   1741 C  CA  . THR A 1 258 ? -0.618  -7.128  21.727 1.00 25.25 ? 466 THR A CA  1 
ATOM   1742 C  C   . THR A 1 258 ? -0.936  -5.738  22.304 1.00 25.81 ? 466 THR A C   1 
ATOM   1743 O  O   . THR A 1 258 ? -2.019  -5.537  22.861 1.00 25.02 ? 466 THR A O   1 
ATOM   1744 C  CB  . THR A 1 258 ? -0.423  -8.096  22.904 1.00 25.53 ? 466 THR A CB  1 
ATOM   1745 O  OG1 . THR A 1 258 ? 0.783   -7.766  23.611 1.00 26.31 ? 466 THR A OG1 1 
ATOM   1746 C  CG2 . THR A 1 258 ? -0.326  -9.520  22.403 1.00 26.64 ? 466 THR A CG2 1 
ATOM   1747 N  N   . ALA A 1 259 ? 0.008   -4.797  22.188 1.00 25.55 ? 467 ALA A N   1 
ATOM   1748 C  CA  . ALA A 1 259 ? -0.156  -3.440  22.721 1.00 25.70 ? 467 ALA A CA  1 
ATOM   1749 C  C   . ALA A 1 259 ? 0.867   -2.500  22.100 1.00 24.48 ? 467 ALA A C   1 
ATOM   1750 O  O   . ALA A 1 259 ? 1.871   -2.939  21.562 1.00 26.14 ? 467 ALA A O   1 
ATOM   1751 C  CB  . ALA A 1 259 ? 0.018   -3.442  24.236 1.00 25.83 ? 467 ALA A CB  1 
ATOM   1752 N  N   . ILE A 1 260 ? 0.588   -1.212  22.172 1.00 24.44 ? 468 ILE A N   1 
ATOM   1753 C  CA  . ILE A 1 260 ? 1.556   -0.185  21.859 1.00 25.28 ? 468 ILE A CA  1 
ATOM   1754 C  C   . ILE A 1 260 ? 1.809   0.555   23.160 1.00 25.08 ? 468 ILE A C   1 
ATOM   1755 O  O   . ILE A 1 260 ? 0.860   0.920   23.866 1.00 26.29 ? 468 ILE A O   1 
ATOM   1756 C  CB  . ILE A 1 260 ? 1.018   0.807   20.808 1.00 25.52 ? 468 ILE A CB  1 
ATOM   1757 C  CG1 . ILE A 1 260 ? 0.723   0.098   19.490 1.00 25.77 ? 468 ILE A CG1 1 
ATOM   1758 C  CG2 . ILE A 1 260 ? 1.999   1.949   20.584 1.00 25.39 ? 468 ILE A CG2 1 
ATOM   1759 C  CD1 . ILE A 1 260 ? 1.890   -0.663  18.898 1.00 26.62 ? 468 ILE A CD1 1 
ATOM   1760 N  N   . ALA A 1 261 ? 3.076   0.785   23.475 1.00 24.07 ? 469 ALA A N   1 
ATOM   1761 C  CA  . ALA A 1 261 ? 3.426   1.499   24.685 1.00 25.22 ? 469 ALA A CA  1 
ATOM   1762 C  C   . ALA A 1 261 ? 3.919   2.898   24.359 1.00 25.28 ? 469 ALA A C   1 
ATOM   1763 O  O   . ALA A 1 261 ? 4.530   3.123   23.301 1.00 26.81 ? 469 ALA A O   1 
ATOM   1764 C  CB  . ALA A 1 261 ? 4.479   0.727   25.439 1.00 25.48 ? 469 ALA A CB  1 
ATOM   1765 N  N   . GLY A 1 262 ? 3.680   3.832   25.274 1.00 22.87 ? 470 GLY A N   1 
ATOM   1766 C  CA  . GLY A 1 262 ? 4.171   5.189   25.127 1.00 23.30 ? 470 GLY A CA  1 
ATOM   1767 C  C   . GLY A 1 262 ? 5.017   5.658   26.302 1.00 23.32 ? 470 GLY A C   1 
ATOM   1768 O  O   . GLY A 1 262 ? 4.856   5.183   27.444 1.00 23.10 ? 470 GLY A O   1 
ATOM   1769 N  N   . TYR A 1 263 ? 5.908   6.594   26.024 1.00 23.16 ? 471 TYR A N   1 
ATOM   1770 C  CA  . TYR A 1 263 ? 6.757   7.190   27.062 1.00 23.70 ? 471 TYR A CA  1 
ATOM   1771 C  C   . TYR A 1 263 ? 7.333   8.471   26.551 1.00 23.46 ? 471 TYR A C   1 
ATOM   1772 O  O   . TYR A 1 263 ? 7.045   8.876   25.421 1.00 21.80 ? 471 TYR A O   1 
ATOM   1773 C  CB  . TYR A 1 263 ? 7.874   6.247   27.481 1.00 23.97 ? 471 TYR A CB  1 
ATOM   1774 C  CG  . TYR A 1 263 ? 8.884   5.892   26.409 1.00 24.76 ? 471 TYR A CG  1 
ATOM   1775 C  CD1 . TYR A 1 263 ? 10.070  6.621   26.264 1.00 26.18 ? 471 TYR A CD1 1 
ATOM   1776 C  CD2 . TYR A 1 263 ? 8.693   4.785   25.592 1.00 25.43 ? 471 TYR A CD2 1 
ATOM   1777 C  CE1 . TYR A 1 263 ? 11.018  6.271   25.308 1.00 26.70 ? 471 TYR A CE1 1 
ATOM   1778 C  CE2 . TYR A 1 263 ? 9.631   4.430   24.648 1.00 27.60 ? 471 TYR A CE2 1 
ATOM   1779 C  CZ  . TYR A 1 263 ? 10.791  5.175   24.513 1.00 27.24 ? 471 TYR A CZ  1 
ATOM   1780 O  OH  . TYR A 1 263 ? 11.717  4.785   23.583 1.00 28.93 ? 471 TYR A OH  1 
ATOM   1781 N  N   . PHE A 1 264 ? 8.132   9.123   27.392 1.00 23.46 ? 472 PHE A N   1 
ATOM   1782 C  CA  . PHE A 1 264 ? 8.694   10.403  27.052 1.00 22.53 ? 472 PHE A CA  1 
ATOM   1783 C  C   . PHE A 1 264 ? 10.098  10.596  27.600 1.00 24.02 ? 472 PHE A C   1 
ATOM   1784 O  O   . PHE A 1 264 ? 10.514  9.939   28.567 1.00 22.98 ? 472 PHE A O   1 
ATOM   1785 C  CB  . PHE A 1 264 ? 7.759   11.521  27.506 1.00 23.57 ? 472 PHE A CB  1 
ATOM   1786 C  CG  . PHE A 1 264 ? 7.570   11.629  29.000 1.00 22.83 ? 472 PHE A CG  1 
ATOM   1787 C  CD1 . PHE A 1 264 ? 8.442   12.400  29.770 1.00 23.13 ? 472 PHE A CD1 1 
ATOM   1788 C  CD2 . PHE A 1 264 ? 6.494   11.012  29.629 1.00 22.07 ? 472 PHE A CD2 1 
ATOM   1789 C  CE1 . PHE A 1 264 ? 8.256   12.521  31.137 1.00 23.41 ? 472 PHE A CE1 1 
ATOM   1790 C  CE2 . PHE A 1 264 ? 6.310   11.125  31.003 1.00 22.77 ? 472 PHE A CE2 1 
ATOM   1791 C  CZ  . PHE A 1 264 ? 7.173   11.901  31.754 1.00 22.36 ? 472 PHE A CZ  1 
ATOM   1792 N  N   . ASP A 1 265 ? 10.815  11.509  26.958 1.00 24.89 ? 473 ASP A N   1 
ATOM   1793 C  CA  . ASP A 1 265 ? 12.157  11.911  27.344 1.00 25.12 ? 473 ASP A CA  1 
ATOM   1794 C  C   . ASP A 1 265 ? 12.167  13.399  27.626 1.00 25.09 ? 473 ASP A C   1 
ATOM   1795 O  O   . ASP A 1 265 ? 11.506  14.184  26.922 1.00 23.19 ? 473 ASP A O   1 
ATOM   1796 C  CB  . ASP A 1 265 ? 13.149  11.618  26.230 1.00 28.58 ? 473 ASP A CB  1 
ATOM   1797 C  CG  . ASP A 1 265 ? 13.266  10.139  25.926 1.00 32.45 ? 473 ASP A CG  1 
ATOM   1798 O  OD1 . ASP A 1 265 ? 12.658  9.294   26.598 1.00 36.72 ? 473 ASP A OD1 1 
ATOM   1799 O  OD2 . ASP A 1 265 ? 13.974  9.811   24.990 1.00 38.46 ? 473 ASP A OD2 1 
ATOM   1800 N  N   . ILE A 1 266 ? 12.942  13.779  28.644 1.00 24.51 ? 474 ILE A N   1 
ATOM   1801 C  CA  . ILE A 1 266 ? 13.044  15.146  29.111 1.00 24.77 ? 474 ILE A CA  1 
ATOM   1802 C  C   . ILE A 1 266 ? 14.500  15.608  28.990 1.00 25.72 ? 474 ILE A C   1 
ATOM   1803 O  O   . ILE A 1 266 ? 15.428  14.901  29.436 1.00 25.68 ? 474 ILE A O   1 
ATOM   1804 C  CB  . ILE A 1 266 ? 12.577  15.237  30.576 1.00 26.42 ? 474 ILE A CB  1 
ATOM   1805 C  CG1 . ILE A 1 266 ? 11.123  14.755  30.699 1.00 27.01 ? 474 ILE A CG1 1 
ATOM   1806 C  CG2 . ILE A 1 266 ? 12.735  16.657  31.134 1.00 26.90 ? 474 ILE A CG2 1 
ATOM   1807 C  CD1 . ILE A 1 266 ? 10.101  15.636  30.001 1.00 27.02 ? 474 ILE A CD1 1 
ATOM   1808 N  N   . TYR A 1 267 ? 14.695  16.793  28.410 1.00 26.49 ? 475 TYR A N   1 
ATOM   1809 C  CA  . TYR A 1 267 ? 16.035  17.348  28.162 1.00 26.27 ? 475 TYR A CA  1 
ATOM   1810 C  C   . TYR A 1 267 ? 16.210  18.725  28.772 1.00 25.77 ? 475 TYR A C   1 
ATOM   1811 O  O   . TYR A 1 267 ? 15.322  19.581  28.712 1.00 27.20 ? 475 TYR A O   1 
ATOM   1812 C  CB  . TYR A 1 267 ? 16.324  17.484  26.660 1.00 27.19 ? 475 TYR A CB  1 
ATOM   1813 C  CG  . TYR A 1 267 ? 16.298  16.204  25.868 1.00 27.27 ? 475 TYR A CG  1 
ATOM   1814 C  CD1 . TYR A 1 267 ? 15.093  15.650  25.448 1.00 27.69 ? 475 TYR A CD1 1 
ATOM   1815 C  CD2 . TYR A 1 267 ? 17.466  15.568  25.510 1.00 29.65 ? 475 TYR A CD2 1 
ATOM   1816 C  CE1 . TYR A 1 267 ? 15.059  14.479  24.710 1.00 29.15 ? 475 TYR A CE1 1 
ATOM   1817 C  CE2 . TYR A 1 267 ? 17.448  14.393  24.766 1.00 31.95 ? 475 TYR A CE2 1 
ATOM   1818 C  CZ  . TYR A 1 267 ? 16.239  13.853  24.375 1.00 30.64 ? 475 TYR A CZ  1 
ATOM   1819 O  OH  . TYR A 1 267 ? 16.224  12.699  23.640 1.00 33.31 ? 475 TYR A OH  1 
ATOM   1820 N  N   . PHE A 1 268 ? 17.381  18.928  29.357 1.00 26.55 ? 476 PHE A N   1 
ATOM   1821 C  CA  . PHE A 1 268 ? 17.848  20.237  29.793 1.00 26.25 ? 476 PHE A CA  1 
ATOM   1822 C  C   . PHE A 1 268 ? 19.052  20.548  28.896 1.00 27.46 ? 476 PHE A C   1 
ATOM   1823 O  O   . PHE A 1 268 ? 20.100  19.900  29.034 1.00 24.84 ? 476 PHE A O   1 
ATOM   1824 C  CB  . PHE A 1 268 ? 18.278  20.173  31.246 1.00 25.52 ? 476 PHE A CB  1 
ATOM   1825 C  CG  . PHE A 1 268 ? 17.176  19.798  32.206 1.00 26.76 ? 476 PHE A CG  1 
ATOM   1826 C  CD1 . PHE A 1 268 ? 16.855  18.462  32.432 1.00 26.12 ? 476 PHE A CD1 1 
ATOM   1827 C  CD2 . PHE A 1 268 ? 16.492  20.782  32.917 1.00 24.56 ? 476 PHE A CD2 1 
ATOM   1828 C  CE1 . PHE A 1 268 ? 15.854  18.114  33.332 1.00 27.15 ? 476 PHE A CE1 1 
ATOM   1829 C  CE2 . PHE A 1 268 ? 15.495  20.440  33.823 1.00 25.64 ? 476 PHE A CE2 1 
ATOM   1830 C  CZ  . PHE A 1 268 ? 15.162  19.110  34.018 1.00 26.01 ? 476 PHE A CZ  1 
ATOM   1831 N  N   . GLU A 1 269 ? 18.897  21.523  27.997 1.00 28.08 ? 477 GLU A N   1 
ATOM   1832 C  CA  A GLU A 1 269 ? 19.870  21.767  26.928 0.50 29.30 ? 477 GLU A CA  1 
ATOM   1833 C  CA  B GLU A 1 269 ? 19.886  21.777  26.934 0.50 29.92 ? 477 GLU A CA  1 
ATOM   1834 C  C   . GLU A 1 269 ? 20.334  23.230  26.851 1.00 29.71 ? 477 GLU A C   1 
ATOM   1835 O  O   . GLU A 1 269 ? 21.532  23.511  26.874 1.00 28.78 ? 477 GLU A O   1 
ATOM   1836 C  CB  A GLU A 1 269 ? 19.255  21.332  25.589 0.50 29.97 ? 477 GLU A CB  1 
ATOM   1837 C  CB  B GLU A 1 269 ? 19.344  21.364  25.557 0.50 31.44 ? 477 GLU A CB  1 
ATOM   1838 C  CG  A GLU A 1 269 ? 20.117  21.573  24.362 0.50 30.68 ? 477 GLU A CG  1 
ATOM   1839 C  CG  B GLU A 1 269 ? 19.012  19.893  25.431 0.50 33.39 ? 477 GLU A CG  1 
ATOM   1840 C  CD  A GLU A 1 269 ? 19.431  21.131  23.081 0.50 31.70 ? 477 GLU A CD  1 
ATOM   1841 C  CD  B GLU A 1 269 ? 19.711  19.231  24.254 0.50 34.19 ? 477 GLU A CD  1 
ATOM   1842 O  OE1 A GLU A 1 269 ? 19.041  19.949  22.983 0.50 33.45 ? 477 GLU A OE1 1 
ATOM   1843 O  OE1 B GLU A 1 269 ? 19.892  19.893  23.211 0.50 35.87 ? 477 GLU A OE1 1 
ATOM   1844 O  OE2 A GLU A 1 269 ? 19.278  21.968  22.176 0.50 31.88 ? 477 GLU A OE2 1 
ATOM   1845 O  OE2 B GLU A 1 269 ? 20.081  18.047  24.379 0.50 34.44 ? 477 GLU A OE2 1 
ATOM   1846 N  N   . LYS A 1 270 ? 19.384  24.157  26.757 1.00 29.41 ? 478 LYS A N   1 
ATOM   1847 C  CA  . LYS A 1 270 ? 19.722  25.558  26.472 1.00 30.02 ? 478 LYS A CA  1 
ATOM   1848 C  C   . LYS A 1 270 ? 20.739  26.146  27.446 1.00 29.11 ? 478 LYS A C   1 
ATOM   1849 O  O   . LYS A 1 270 ? 20.552  26.127  28.673 1.00 26.32 ? 478 LYS A O   1 
ATOM   1850 C  CB  . LYS A 1 270 ? 18.475  26.449  26.408 1.00 31.80 ? 478 LYS A CB  1 
ATOM   1851 C  CG  . LYS A 1 270 ? 18.754  27.869  25.901 1.00 33.47 ? 478 LYS A CG  1 
ATOM   1852 C  CD  . LYS A 1 270 ? 17.556  28.806  26.080 1.00 35.05 ? 478 LYS A CD  1 
ATOM   1853 C  CE  . LYS A 1 270 ? 17.942  30.278  25.884 1.00 35.12 ? 478 LYS A CE  1 
ATOM   1854 N  NZ  . LYS A 1 270 ? 16.755  31.176  25.995 1.00 36.55 ? 478 LYS A NZ  1 
ATOM   1855 N  N   . ASN A 1 271 ? 21.806  26.691  26.862 1.00 28.01 ? 479 ASN A N   1 
ATOM   1856 C  CA  . ASN A 1 271 ? 22.896  27.325  27.588 1.00 28.88 ? 479 ASN A CA  1 
ATOM   1857 C  C   . ASN A 1 271 ? 23.610  26.462  28.631 1.00 27.89 ? 479 ASN A C   1 
ATOM   1858 O  O   . ASN A 1 271 ? 24.329  26.985  29.472 1.00 29.66 ? 479 ASN A O   1 
ATOM   1859 C  CB  . ASN A 1 271 ? 22.392  28.632  28.213 1.00 30.80 ? 479 ASN A CB  1 
ATOM   1860 C  CG  . ASN A 1 271 ? 22.200  29.725  27.179 1.00 31.16 ? 479 ASN A CG  1 
ATOM   1861 O  OD1 . ASN A 1 271 ? 22.839  29.715  26.125 1.00 33.04 ? 479 ASN A OD1 1 
ATOM   1862 N  ND2 . ASN A 1 271 ? 21.329  30.676  27.477 1.00 30.74 ? 479 ASN A ND2 1 
ATOM   1863 N  N   . CYS A 1 272 ? 23.431  25.147  28.567 1.00 26.30 ? 480 CYS A N   1 
ATOM   1864 C  CA  . CYS A 1 272 ? 24.035  24.246  29.529 1.00 26.27 ? 480 CYS A CA  1 
ATOM   1865 C  C   . CYS A 1 272 ? 25.421  23.822  29.091 1.00 26.74 ? 480 CYS A C   1 
ATOM   1866 O  O   . CYS A 1 272 ? 25.628  23.432  27.939 1.00 26.83 ? 480 CYS A O   1 
ATOM   1867 C  CB  . CYS A 1 272 ? 23.203  22.970  29.683 1.00 27.37 ? 480 CYS A CB  1 
ATOM   1868 S  SG  . CYS A 1 272 ? 21.619  23.214  30.515 1.00 28.83 ? 480 CYS A SG  1 
ATOM   1869 N  N   . HIS A 1 273 ? 26.358  23.851  30.030 1.00 25.57 ? 481 HIS A N   1 
ATOM   1870 C  CA  . HIS A 1 273 ? 27.644  23.188  29.849 1.00 26.98 ? 481 HIS A CA  1 
ATOM   1871 C  C   . HIS A 1 273 ? 27.519  21.725  30.178 1.00 28.33 ? 481 HIS A C   1 
ATOM   1872 O  O   . HIS A 1 273 ? 28.215  20.900  29.587 1.00 30.24 ? 481 HIS A O   1 
ATOM   1873 C  CB  . HIS A 1 273 ? 28.703  23.840  30.728 1.00 26.98 ? 481 HIS A CB  1 
ATOM   1874 C  CG  . HIS A 1 273 ? 29.054  25.212  30.266 1.00 27.93 ? 481 HIS A CG  1 
ATOM   1875 N  ND1 . HIS A 1 273 ? 29.790  25.435  29.123 1.00 28.88 ? 481 HIS A ND1 1 
ATOM   1876 C  CD2 . HIS A 1 273 ? 28.708  26.432  30.739 1.00 28.96 ? 481 HIS A CD2 1 
ATOM   1877 C  CE1 . HIS A 1 273 ? 29.912  26.739  28.930 1.00 30.27 ? 481 HIS A CE1 1 
ATOM   1878 N  NE2 . HIS A 1 273 ? 29.259  27.365  29.892 1.00 30.51 ? 481 HIS A NE2 1 
ATOM   1879 N  N   . ASN A 1 274 ? 26.662  21.416  31.153 1.00 26.75 ? 482 ASN A N   1 
ATOM   1880 C  CA  . ASN A 1 274 ? 26.383  20.032  31.525 1.00 28.39 ? 482 ASN A CA  1 
ATOM   1881 C  C   . ASN A 1 274 ? 24.927  19.699  31.217 1.00 27.49 ? 482 ASN A C   1 
ATOM   1882 O  O   . ASN A 1 274 ? 24.045  19.907  32.059 1.00 26.51 ? 482 ASN A O   1 
ATOM   1883 C  CB  . ASN A 1 274 ? 26.678  19.834  33.009 1.00 30.08 ? 482 ASN A CB  1 
ATOM   1884 C  CG  . ASN A 1 274 ? 28.153  19.923  33.307 1.00 30.83 ? 482 ASN A CG  1 
ATOM   1885 O  OD1 . ASN A 1 274 ? 28.928  19.168  32.767 1.00 33.05 ? 482 ASN A OD1 1 
ATOM   1886 N  ND2 . ASN A 1 274 ? 28.542  20.859  34.133 1.00 32.00 ? 482 ASN A ND2 1 
ATOM   1887 N  N   A ARG A 1 275 ? 24.682  19.219  29.998 0.50 27.97 ? 483 ARG A N   1 
ATOM   1888 N  N   B ARG A 1 275 ? 24.679  19.200  30.015 0.50 26.40 ? 483 ARG A N   1 
ATOM   1889 C  CA  A ARG A 1 275 ? 23.347  18.823  29.550 0.50 29.91 ? 483 ARG A CA  1 
ATOM   1890 C  CA  B ARG A 1 275 ? 23.333  18.842  29.605 0.50 27.29 ? 483 ARG A CA  1 
ATOM   1891 C  C   A ARG A 1 275 ? 22.848  17.632  30.364 0.50 28.83 ? 483 ARG A C   1 
ATOM   1892 C  C   B ARG A 1 275 ? 22.845  17.625  30.369 0.50 27.35 ? 483 ARG A C   1 
ATOM   1893 O  O   A ARG A 1 275 ? 23.637  16.795  30.803 0.50 29.61 ? 483 ARG A O   1 
ATOM   1894 O  O   B ARG A 1 275 ? 23.631  16.771  30.778 0.50 28.23 ? 483 ARG A O   1 
ATOM   1895 C  CB  A ARG A 1 275 ? 23.362  18.414  28.077 0.50 32.35 ? 483 ARG A CB  1 
ATOM   1896 C  CB  B ARG A 1 275 ? 23.288  18.538  28.123 0.50 27.47 ? 483 ARG A CB  1 
ATOM   1897 C  CG  A ARG A 1 275 ? 23.385  19.527  27.027 0.50 35.61 ? 483 ARG A CG  1 
ATOM   1898 C  CG  B ARG A 1 275 ? 23.332  19.758  27.221 0.50 27.88 ? 483 ARG A CG  1 
ATOM   1899 C  CD  A ARG A 1 275 ? 23.602  18.825  25.695 0.50 38.25 ? 483 ARG A CD  1 
ATOM   1900 C  CD  B ARG A 1 275 ? 23.425  19.219  25.817 0.50 27.91 ? 483 ARG A CD  1 
ATOM   1901 N  NE  A ARG A 1 275 ? 23.432  19.607  24.472 0.50 41.57 ? 483 ARG A NE  1 
ATOM   1902 N  NE  B ARG A 1 275 ? 23.489  20.230  24.790 0.50 28.63 ? 483 ARG A NE  1 
ATOM   1903 C  CZ  A ARG A 1 275 ? 23.356  20.934  24.378 0.50 41.34 ? 483 ARG A CZ  1 
ATOM   1904 C  CZ  B ARG A 1 275 ? 23.568  19.933  23.495 0.50 26.04 ? 483 ARG A CZ  1 
ATOM   1905 N  NH1 A ARG A 1 275 ? 23.433  21.720  25.446 0.50 40.07 ? 483 ARG A NH1 1 
ATOM   1906 N  NH1 B ARG A 1 275 ? 23.595  18.661  23.103 0.50 24.95 ? 483 ARG A NH1 1 
ATOM   1907 N  NH2 A ARG A 1 275 ? 23.206  21.469  23.181 0.50 39.07 ? 483 ARG A NH2 1 
ATOM   1908 N  NH2 B ARG A 1 275 ? 23.616  20.897  22.614 0.50 24.23 ? 483 ARG A NH2 1 
ATOM   1909 N  N   . VAL A 1 276 ? 21.539  17.555  30.561 1.00 27.75 ? 484 VAL A N   1 
ATOM   1910 C  CA  . VAL A 1 276 ? 20.940  16.460  31.317 1.00 27.15 ? 484 VAL A CA  1 
ATOM   1911 C  C   . VAL A 1 276 ? 19.777  15.934  30.522 1.00 26.87 ? 484 VAL A C   1 
ATOM   1912 O  O   . VAL A 1 276 ? 18.998  16.703  29.959 1.00 25.46 ? 484 VAL A O   1 
ATOM   1913 C  CB  . VAL A 1 276 ? 20.515  16.936  32.734 1.00 27.43 ? 484 VAL A CB  1 
ATOM   1914 C  CG1 . VAL A 1 276 ? 19.710  15.865  33.484 1.00 28.63 ? 484 VAL A CG1 1 
ATOM   1915 C  CG2 . VAL A 1 276 ? 21.754  17.318  33.529 1.00 27.03 ? 484 VAL A CG2 1 
ATOM   1916 N  N   . VAL A 1 277 ? 19.677  14.614  30.454 1.00 27.63 ? 485 VAL A N   1 
ATOM   1917 C  CA  . VAL A 1 277 ? 18.529  13.972  29.833 1.00 28.02 ? 485 VAL A CA  1 
ATOM   1918 C  C   . VAL A 1 277 ? 18.054  12.860  30.745 1.00 27.85 ? 485 VAL A C   1 
ATOM   1919 O  O   . VAL A 1 277 ? 18.846  12.269  31.483 1.00 28.36 ? 485 VAL A O   1 
ATOM   1920 C  CB  . VAL A 1 277 ? 18.857  13.455  28.401 1.00 29.81 ? 485 VAL A CB  1 
ATOM   1921 C  CG1 . VAL A 1 277 ? 20.156  12.675  28.373 1.00 30.57 ? 485 VAL A CG1 1 
ATOM   1922 C  CG2 . VAL A 1 277 ? 17.713  12.619  27.832 1.00 30.14 ? 485 VAL A CG2 1 
ATOM   1923 N  N   . PHE A 1 278 ? 16.753  12.588  30.732 1.00 26.69 ? 486 PHE A N   1 
ATOM   1924 C  CA  . PHE A 1 278 ? 16.278  11.291  31.244 1.00 24.84 ? 486 PHE A CA  1 
ATOM   1925 C  C   . PHE A 1 278 ? 15.110  10.803  30.424 1.00 25.64 ? 486 PHE A C   1 
ATOM   1926 O  O   . PHE A 1 278 ? 14.355  11.605  29.869 1.00 24.66 ? 486 PHE A O   1 
ATOM   1927 C  CB  . PHE A 1 278 ? 15.971  11.317  32.758 1.00 25.45 ? 486 PHE A CB  1 
ATOM   1928 C  CG  . PHE A 1 278 ? 14.751  12.125  33.154 1.00 24.44 ? 486 PHE A CG  1 
ATOM   1929 C  CD1 . PHE A 1 278 ? 13.480  11.528  33.195 1.00 25.57 ? 486 PHE A CD1 1 
ATOM   1930 C  CD2 . PHE A 1 278 ? 14.874  13.439  33.538 1.00 23.64 ? 486 PHE A CD2 1 
ATOM   1931 C  CE1 . PHE A 1 278 ? 12.358  12.260  33.593 1.00 26.05 ? 486 PHE A CE1 1 
ATOM   1932 C  CE2 . PHE A 1 278 ? 13.767  14.179  33.931 1.00 25.73 ? 486 PHE A CE2 1 
ATOM   1933 C  CZ  . PHE A 1 278 ? 12.504  13.591  33.965 1.00 26.43 ? 486 PHE A CZ  1 
ATOM   1934 N  N   . SER A 1 279 ? 15.013  9.477   30.314 1.00 25.60 ? 487 SER A N   1 
ATOM   1935 C  CA  . SER A 1 279 ? 13.958  8.819   29.609 1.00 27.02 ? 487 SER A CA  1 
ATOM   1936 C  C   . SER A 1 279 ? 13.084  8.092   30.622 1.00 27.37 ? 487 SER A C   1 
ATOM   1937 O  O   . SER A 1 279 ? 13.579  7.604   31.659 1.00 28.53 ? 487 SER A O   1 
ATOM   1938 C  CB  . SER A 1 279 ? 14.562  7.827   28.598 1.00 28.70 ? 487 SER A CB  1 
ATOM   1939 O  OG  . SER A 1 279 ? 13.562  7.187   27.820 1.00 28.50 ? 487 SER A OG  1 
ATOM   1940 N  N   . THR A 1 280 ? 11.785  8.028   30.321 1.00 25.29 ? 488 THR A N   1 
ATOM   1941 C  CA  . THR A 1 280 ? 10.822  7.252   31.104 1.00 23.46 ? 488 THR A CA  1 
ATOM   1942 C  C   . THR A 1 280 ? 10.425  5.950   30.384 1.00 23.68 ? 488 THR A C   1 
ATOM   1943 O  O   . THR A 1 280 ? 9.435   5.304   30.729 1.00 21.93 ? 488 THR A O   1 
ATOM   1944 C  CB  . THR A 1 280 ? 9.575   8.102   31.449 1.00 23.75 ? 488 THR A CB  1 
ATOM   1945 O  OG1 . THR A 1 280 ? 8.874   8.500   30.262 1.00 23.73 ? 488 THR A OG1 1 
ATOM   1946 C  CG2 . THR A 1 280 ? 9.984   9.341   32.228 1.00 24.33 ? 488 THR A CG2 1 
ATOM   1947 N  N   . GLY A 1 281 ? 11.233  5.570   29.399 1.00 23.03 ? 489 GLY A N   1 
ATOM   1948 C  CA  . GLY A 1 281 ? 11.019  4.378   28.621 1.00 24.55 ? 489 GLY A CA  1 
ATOM   1949 C  C   . GLY A 1 281 ? 11.363  3.075   29.345 1.00 25.56 ? 489 GLY A C   1 
ATOM   1950 O  O   . GLY A 1 281 ? 12.073  3.057   30.355 1.00 23.29 ? 489 GLY A O   1 
ATOM   1951 N  N   . PRO A 1 282 ? 10.838  1.968   28.829 1.00 26.17 ? 490 PRO A N   1 
ATOM   1952 C  CA  . PRO A 1 282 ? 11.013  0.666   29.457 1.00 27.40 ? 490 PRO A CA  1 
ATOM   1953 C  C   . PRO A 1 282 ? 12.451  0.139   29.459 1.00 28.94 ? 490 PRO A C   1 
ATOM   1954 O  O   . PRO A 1 282 ? 12.762  -0.706  30.284 1.00 29.93 ? 490 PRO A O   1 
ATOM   1955 C  CB  . PRO A 1 282 ? 10.074  -0.247  28.678 1.00 28.12 ? 490 PRO A CB  1 
ATOM   1956 C  CG  . PRO A 1 282 ? 9.673   0.488   27.453 1.00 29.60 ? 490 PRO A CG  1 
ATOM   1957 C  CD  . PRO A 1 282 ? 10.059  1.923   27.584 1.00 27.59 ? 490 PRO A CD  1 
ATOM   1958 N  N   . GLN A 1 283 ? 13.318  0.651   28.581 1.00 30.77 ? 491 GLN A N   1 
ATOM   1959 C  CA  A GLN A 1 283 ? 14.740  0.298   28.583 0.50 32.27 ? 491 GLN A CA  1 
ATOM   1960 C  CA  B GLN A 1 283 ? 14.729  0.263   28.604 0.50 31.74 ? 491 GLN A CA  1 
ATOM   1961 C  C   . GLN A 1 283 ? 15.529  1.082   29.631 1.00 31.20 ? 491 GLN A C   1 
ATOM   1962 O  O   . GLN A 1 283 ? 16.702  0.840   29.829 1.00 30.80 ? 491 GLN A O   1 
ATOM   1963 C  CB  A GLN A 1 283 ? 15.361  0.569   27.213 0.50 34.32 ? 491 GLN A CB  1 
ATOM   1964 C  CB  B GLN A 1 283 ? 15.357  0.393   27.212 0.50 33.23 ? 491 GLN A CB  1 
ATOM   1965 C  CG  A GLN A 1 283 ? 14.761  -0.260  26.092 0.50 36.20 ? 491 GLN A CG  1 
ATOM   1966 C  CG  B GLN A 1 283 ? 14.643  -0.418  26.131 0.50 34.27 ? 491 GLN A CG  1 
ATOM   1967 C  CD  A GLN A 1 283 ? 15.324  -1.661  26.069 0.50 36.64 ? 491 GLN A CD  1 
ATOM   1968 C  CD  B GLN A 1 283 ? 15.302  -0.292  24.763 0.50 34.57 ? 491 GLN A CD  1 
ATOM   1969 O  OE1 A GLN A 1 283 ? 15.471  -2.297  27.109 0.50 38.61 ? 491 GLN A OE1 1 
ATOM   1970 O  OE1 B GLN A 1 283 ? 16.370  -0.846  24.524 0.50 33.24 ? 491 GLN A OE1 1 
ATOM   1971 N  NE2 A GLN A 1 283 ? 15.655  -2.144  24.881 0.50 36.82 ? 491 GLN A NE2 1 
ATOM   1972 N  NE2 B GLN A 1 283 ? 14.653  0.424   23.856 0.50 35.89 ? 491 GLN A NE2 1 
ATOM   1973 N  N   . SER A 1 284 ? 14.897  2.041   30.298 1.00 29.19 ? 492 SER A N   1 
ATOM   1974 C  CA  . SER A 1 284 ? 15.607  2.824   31.302 1.00 28.26 ? 492 SER A CA  1 
ATOM   1975 C  C   . SER A 1 284 ? 15.054  2.559   32.688 1.00 28.30 ? 492 SER A C   1 
ATOM   1976 O  O   . SER A 1 284 ? 13.950  2.060   32.831 1.00 28.08 ? 492 SER A O   1 
ATOM   1977 C  CB  . SER A 1 284 ? 15.522  4.300   30.976 1.00 29.76 ? 492 SER A CB  1 
ATOM   1978 O  OG  . SER A 1 284 ? 15.917  4.541   29.648 1.00 32.54 ? 492 SER A OG  1 
ATOM   1979 N  N   . THR A 1 285 ? 15.838  2.899   33.703 1.00 30.15 ? 493 THR A N   1 
ATOM   1980 C  CA  . THR A 1 285 ? 15.424  2.805   35.103 1.00 29.88 ? 493 THR A CA  1 
ATOM   1981 C  C   . THR A 1 285 ? 14.023  3.366   35.261 1.00 30.13 ? 493 THR A C   1 
ATOM   1982 O  O   . THR A 1 285 ? 13.716  4.444   34.761 1.00 28.07 ? 493 THR A O   1 
ATOM   1983 C  CB  . THR A 1 285 ? 16.350  3.651   35.984 1.00 31.55 ? 493 THR A CB  1 
ATOM   1984 O  OG1 . THR A 1 285 ? 17.703  3.285   35.717 1.00 34.09 ? 493 THR A OG1 1 
ATOM   1985 C  CG2 . THR A 1 285 ? 16.033  3.477   37.492 1.00 31.64 ? 493 THR A CG2 1 
ATOM   1986 N  N   . LYS A 1 286 ? 13.181  2.633   35.974 1.00 30.37 ? 494 LYS A N   1 
ATOM   1987 C  CA  . LYS A 1 286 ? 11.810  3.041   36.164 1.00 30.85 ? 494 LYS A CA  1 
ATOM   1988 C  C   . LYS A 1 286 ? 11.696  4.364   36.910 1.00 28.45 ? 494 LYS A C   1 
ATOM   1989 O  O   . LYS A 1 286 ? 12.539  4.689   37.755 1.00 26.90 ? 494 LYS A O   1 
ATOM   1990 C  CB  . LYS A 1 286 ? 11.042  1.951   36.914 1.00 34.90 ? 494 LYS A CB  1 
ATOM   1991 C  CG  . LYS A 1 286 ? 11.468  1.766   38.354 1.00 37.57 ? 494 LYS A CG  1 
ATOM   1992 C  CD  . LYS A 1 286 ? 10.706  0.621   38.992 1.00 41.38 ? 494 LYS A CD  1 
ATOM   1993 C  CE  . LYS A 1 286 ? 11.180  0.372   40.411 1.00 43.57 ? 494 LYS A CE  1 
ATOM   1994 N  NZ  . LYS A 1 286 ? 10.490  -0.838  40.944 1.00 46.55 ? 494 LYS A NZ  1 
ATOM   1995 N  N   . THR A 1 287 ? 10.641  5.114   36.583 1.00 26.77 ? 495 THR A N   1 
ATOM   1996 C  CA  . THR A 1 287 ? 10.300  6.374   37.249 1.00 26.41 ? 495 THR A CA  1 
ATOM   1997 C  C   . THR A 1 287 ? 8.855   6.259   37.683 1.00 25.92 ? 495 THR A C   1 
ATOM   1998 O  O   . THR A 1 287 ? 8.190   5.289   37.352 1.00 24.54 ? 495 THR A O   1 
ATOM   1999 C  CB  . THR A 1 287 ? 10.419  7.605   36.312 1.00 26.28 ? 495 THR A CB  1 
ATOM   2000 O  OG1 . THR A 1 287 ? 9.379   7.583   35.324 1.00 25.65 ? 495 THR A OG1 1 
ATOM   2001 C  CG2 . THR A 1 287 ? 11.765  7.645   35.622 1.00 26.83 ? 495 THR A CG2 1 
ATOM   2002 N  N   . HIS A 1 288 ? 8.357   7.257   38.404 1.00 26.30 ? 496 HIS A N   1 
ATOM   2003 C  CA  . HIS A 1 288 ? 6.972   7.228   38.860 1.00 26.48 ? 496 HIS A CA  1 
ATOM   2004 C  C   . HIS A 1 288 ? 5.993   7.417   37.698 1.00 26.03 ? 496 HIS A C   1 
ATOM   2005 O  O   . HIS A 1 288 ? 4.819   7.143   37.825 1.00 26.56 ? 496 HIS A O   1 
ATOM   2006 C  CB  . HIS A 1 288 ? 6.741   8.239   39.975 1.00 26.63 ? 496 HIS A CB  1 
ATOM   2007 C  CG  . HIS A 1 288 ? 6.617   9.648   39.506 1.00 26.40 ? 496 HIS A CG  1 
ATOM   2008 N  ND1 . HIS A 1 288 ? 7.706   10.418  39.155 1.00 27.36 ? 496 HIS A ND1 1 
ATOM   2009 C  CD2 . HIS A 1 288 ? 5.529   10.430  39.328 1.00 25.87 ? 496 HIS A CD2 1 
ATOM   2010 C  CE1 . HIS A 1 288 ? 7.291   11.613  38.778 1.00 25.66 ? 496 HIS A CE1 1 
ATOM   2011 N  NE2 . HIS A 1 288 ? 5.975   11.645  38.874 1.00 25.21 ? 496 HIS A NE2 1 
ATOM   2012 N  N   . TRP A 1 289 ? 6.481   7.848   36.544 1.00 24.60 ? 497 TRP A N   1 
ATOM   2013 C  CA  . TRP A 1 289 ? 5.627   7.947   35.362 1.00 24.05 ? 497 TRP A CA  1 
ATOM   2014 C  C   . TRP A 1 289 ? 5.453   6.580   34.685 1.00 23.75 ? 497 TRP A C   1 
ATOM   2015 O  O   . TRP A 1 289 ? 4.586   6.407   33.823 1.00 24.46 ? 497 TRP A O   1 
ATOM   2016 C  CB  . TRP A 1 289 ? 6.239   8.935   34.371 1.00 23.87 ? 497 TRP A CB  1 
ATOM   2017 C  CG  . TRP A 1 289 ? 6.164   10.351  34.796 1.00 23.23 ? 497 TRP A CG  1 
ATOM   2018 C  CD1 . TRP A 1 289 ? 5.040   11.129  34.835 1.00 24.21 ? 497 TRP A CD1 1 
ATOM   2019 C  CD2 . TRP A 1 289 ? 7.248   11.191  35.236 1.00 22.79 ? 497 TRP A CD2 1 
ATOM   2020 N  NE1 . TRP A 1 289 ? 5.354   12.395  35.262 1.00 23.62 ? 497 TRP A NE1 1 
ATOM   2021 C  CE2 . TRP A 1 289 ? 6.702   12.463  35.510 1.00 23.03 ? 497 TRP A CE2 1 
ATOM   2022 C  CE3 . TRP A 1 289 ? 8.622   11.000  35.398 1.00 22.20 ? 497 TRP A CE3 1 
ATOM   2023 C  CZ2 . TRP A 1 289 ? 7.481   13.542  35.944 1.00 23.07 ? 497 TRP A CZ2 1 
ATOM   2024 C  CZ3 . TRP A 1 289 ? 9.403   12.086  35.850 1.00 22.67 ? 497 TRP A CZ3 1 
ATOM   2025 C  CH2 . TRP A 1 289 ? 8.823   13.337  36.103 1.00 22.58 ? 497 TRP A CH2 1 
ATOM   2026 N  N   . LYS A 1 290 ? 6.294   5.620   35.049 1.00 23.18 ? 498 LYS A N   1 
ATOM   2027 C  CA  . LYS A 1 290 ? 6.237   4.285   34.477 1.00 24.20 ? 498 LYS A CA  1 
ATOM   2028 C  C   . LYS A 1 290 ? 6.146   4.410   32.950 1.00 24.18 ? 498 LYS A C   1 
ATOM   2029 O  O   . LYS A 1 290 ? 6.840   5.262   32.372 1.00 23.62 ? 498 LYS A O   1 
ATOM   2030 C  CB  . LYS A 1 290 ? 5.060   3.513   35.079 1.00 25.68 ? 498 LYS A CB  1 
ATOM   2031 C  CG  . LYS A 1 290 ? 5.005   3.620   36.607 1.00 28.44 ? 498 LYS A CG  1 
ATOM   2032 C  CD  . LYS A 1 290 ? 3.921   2.732   37.194 1.00 30.39 ? 498 LYS A CD  1 
ATOM   2033 C  CE  . LYS A 1 290 ? 3.645   3.145   38.624 1.00 34.71 ? 498 LYS A CE  1 
ATOM   2034 N  NZ  . LYS A 1 290 ? 2.896   2.082   39.319 1.00 38.65 ? 498 LYS A NZ  1 
ATOM   2035 N  N   . GLN A 1 291 ? 5.336   3.559   32.312 1.00 23.41 ? 499 GLN A N   1 
ATOM   2036 C  CA  . GLN A 1 291 ? 5.003   3.691   30.897 1.00 24.61 ? 499 GLN A CA  1 
ATOM   2037 C  C   . GLN A 1 291 ? 3.496   3.627   30.732 1.00 24.08 ? 499 GLN A C   1 
ATOM   2038 O  O   . GLN A 1 291 ? 2.782   3.153   31.623 1.00 23.92 ? 499 GLN A O   1 
ATOM   2039 C  CB  . GLN A 1 291 ? 5.665   2.593   30.073 1.00 24.12 ? 499 GLN A CB  1 
ATOM   2040 C  CG  . GLN A 1 291 ? 7.172   2.733   29.951 1.00 24.93 ? 499 GLN A CG  1 
ATOM   2041 C  CD  . GLN A 1 291 ? 7.957   1.965   31.013 1.00 25.39 ? 499 GLN A CD  1 
ATOM   2042 O  OE1 . GLN A 1 291 ? 7.694   0.781   31.271 1.00 25.22 ? 499 GLN A OE1 1 
ATOM   2043 N  NE2 . GLN A 1 291 ? 8.929   2.636   31.627 1.00 25.05 ? 499 GLN A NE2 1 
ATOM   2044 N  N   . THR A 1 292 ? 3.016   4.151   29.615 1.00 22.59 ? 500 THR A N   1 
ATOM   2045 C  CA  . THR A 1 292 ? 1.600   4.135   29.293 1.00 22.86 ? 500 THR A CA  1 
ATOM   2046 C  C   . THR A 1 292 ? 1.386   3.042   28.253 1.00 24.49 ? 500 THR A C   1 
ATOM   2047 O  O   . THR A 1 292 ? 2.123   2.960   27.282 1.00 24.99 ? 500 THR A O   1 
ATOM   2048 C  CB  . THR A 1 292 ? 1.140   5.532   28.799 1.00 22.80 ? 500 THR A CB  1 
ATOM   2049 O  OG1 . THR A 1 292 ? 1.384   6.497   29.821 1.00 23.94 ? 500 THR A OG1 1 
ATOM   2050 C  CG2 . THR A 1 292 ? -0.309  5.565   28.506 1.00 23.54 ? 500 THR A CG2 1 
ATOM   2051 N  N   . VAL A 1 293 ? 0.395   2.198   28.473 1.00 24.99 ? 501 VAL A N   1 
ATOM   2052 C  CA  . VAL A 1 293 ? 0.158   1.044   27.624 1.00 25.75 ? 501 VAL A CA  1 
ATOM   2053 C  C   . VAL A 1 293 ? -1.243  1.141   27.016 1.00 24.71 ? 501 VAL A C   1 
ATOM   2054 O  O   . VAL A 1 293 ? -2.224  1.371   27.721 1.00 23.15 ? 501 VAL A O   1 
ATOM   2055 C  CB  . VAL A 1 293 ? 0.320   -0.259  28.420 1.00 27.40 ? 501 VAL A CB  1 
ATOM   2056 C  CG1 . VAL A 1 293 ? 0.245   -1.462  27.497 1.00 28.76 ? 501 VAL A CG1 1 
ATOM   2057 C  CG2 . VAL A 1 293 ? 1.659   -0.259  29.164 1.00 27.73 ? 501 VAL A CG2 1 
ATOM   2058 N  N   . PHE A 1 294 ? -1.306  1.007   25.694 1.00 24.13 ? 502 PHE A N   1 
ATOM   2059 C  CA  . PHE A 1 294 ? -2.540  1.020   24.940 1.00 24.68 ? 502 PHE A CA  1 
ATOM   2060 C  C   . PHE A 1 294 ? -2.775  -0.380  24.404 1.00 26.53 ? 502 PHE A C   1 
ATOM   2061 O  O   . PHE A 1 294 ? -2.088  -0.813  23.472 1.00 25.73 ? 502 PHE A O   1 
ATOM   2062 C  CB  . PHE A 1 294 ? -2.419  1.987   23.768 1.00 25.29 ? 502 PHE A CB  1 
ATOM   2063 C  CG  . PHE A 1 294 ? -2.013  3.370   24.177 1.00 25.36 ? 502 PHE A CG  1 
ATOM   2064 C  CD1 . PHE A 1 294 ? -2.920  4.208   24.809 1.00 24.40 ? 502 PHE A CD1 1 
ATOM   2065 C  CD2 . PHE A 1 294 ? -0.731  3.837   23.924 1.00 25.31 ? 502 PHE A CD2 1 
ATOM   2066 C  CE1 . PHE A 1 294 ? -2.551  5.486   25.182 1.00 24.81 ? 502 PHE A CE1 1 
ATOM   2067 C  CE2 . PHE A 1 294 ? -0.350  5.114   24.305 1.00 25.31 ? 502 PHE A CE2 1 
ATOM   2068 C  CZ  . PHE A 1 294 ? -1.271  5.940   24.932 1.00 24.95 ? 502 PHE A CZ  1 
ATOM   2069 N  N   . LEU A 1 295 ? -3.735  -1.093  24.995 1.00 27.07 ? 503 LEU A N   1 
ATOM   2070 C  CA  . LEU A 1 295 ? -3.991  -2.476  24.617 1.00 28.11 ? 503 LEU A CA  1 
ATOM   2071 C  C   . LEU A 1 295 ? -4.627  -2.558  23.234 1.00 27.04 ? 503 LEU A C   1 
ATOM   2072 O  O   . LEU A 1 295 ? -5.520  -1.788  22.925 1.00 25.48 ? 503 LEU A O   1 
ATOM   2073 C  CB  . LEU A 1 295 ? -4.933  -3.152  25.618 1.00 29.85 ? 503 LEU A CB  1 
ATOM   2074 C  CG  . LEU A 1 295 ? -4.272  -3.748  26.854 1.00 32.53 ? 503 LEU A CG  1 
ATOM   2075 C  CD1 . LEU A 1 295 ? -3.582  -2.686  27.698 1.00 31.12 ? 503 LEU A CD1 1 
ATOM   2076 C  CD2 . LEU A 1 295 ? -5.331  -4.490  27.660 1.00 34.41 ? 503 LEU A CD2 1 
ATOM   2077 N  N   . LEU A 1 296 ? -4.214  -3.546  22.443 1.00 26.71 ? 504 LEU A N   1 
ATOM   2078 C  CA  . LEU A 1 296 ? -4.914  -3.847  21.191 1.00 27.11 ? 504 LEU A CA  1 
ATOM   2079 C  C   . LEU A 1 296 ? -6.052  -4.821  21.439 1.00 27.14 ? 504 LEU A C   1 
ATOM   2080 O  O   . LEU A 1 296 ? -5.861  -5.863  22.067 1.00 27.73 ? 504 LEU A O   1 
ATOM   2081 C  CB  . LEU A 1 296 ? -3.946  -4.449  20.174 1.00 27.71 ? 504 LEU A CB  1 
ATOM   2082 C  CG  . LEU A 1 296 ? -2.735  -3.567  19.900 1.00 27.61 ? 504 LEU A CG  1 
ATOM   2083 C  CD1 . LEU A 1 296 ? -1.881  -4.179  18.800 1.00 29.38 ? 504 LEU A CD1 1 
ATOM   2084 C  CD2 . LEU A 1 296 ? -3.160  -2.163  19.510 1.00 29.27 ? 504 LEU A CD2 1 
ATOM   2085 N  N   . GLU A 1 297 ? -7.233  -4.495  20.936 1.00 26.65 ? 505 GLU A N   1 
ATOM   2086 C  CA  . GLU A 1 297 ? -8.361  -5.412  21.038 1.00 31.96 ? 505 GLU A CA  1 
ATOM   2087 C  C   . GLU A 1 297 ? -8.089  -6.747  20.331 1.00 30.77 ? 505 GLU A C   1 
ATOM   2088 O  O   . GLU A 1 297 ? -8.306  -7.808  20.911 1.00 32.11 ? 505 GLU A O   1 
ATOM   2089 C  CB  . GLU A 1 297 ? -9.602  -4.770  20.440 1.00 36.58 ? 505 GLU A CB  1 
ATOM   2090 C  CG  . GLU A 1 297 ? -10.813 -5.681  20.478 1.00 40.50 ? 505 GLU A CG  1 
ATOM   2091 C  CD  . GLU A 1 297 ? -12.116 -4.924  20.353 1.00 46.32 ? 505 GLU A CD  1 
ATOM   2092 O  OE1 . GLU A 1 297 ? -12.091 -3.736  19.943 1.00 48.27 ? 505 GLU A OE1 1 
ATOM   2093 O  OE2 . GLU A 1 297 ? -13.165 -5.526  20.671 1.00 51.53 ? 505 GLU A OE2 1 
ATOM   2094 N  N   . LYS A 1 298 ? -7.569  -6.664  19.111 1.00 30.20 ? 506 LYS A N   1 
ATOM   2095 C  CA  . LYS A 1 298 ? -7.212  -7.836  18.297 1.00 32.13 ? 506 LYS A CA  1 
ATOM   2096 C  C   . LYS A 1 298 ? -5.693  -7.854  18.032 1.00 30.45 ? 506 LYS A C   1 
ATOM   2097 O  O   . LYS A 1 298 ? -5.207  -7.167  17.138 1.00 29.67 ? 506 LYS A O   1 
ATOM   2098 C  CB  . LYS A 1 298 ? -8.000  -7.782  16.975 1.00 32.84 ? 506 LYS A CB  1 
ATOM   2099 C  CG  . LYS A 1 298 ? -7.954  -9.051  16.135 1.00 37.43 ? 506 LYS A CG  1 
ATOM   2100 N  N   . PRO A 1 299 ? -4.927  -8.618  18.829 1.00 28.71 ? 507 PRO A N   1 
ATOM   2101 C  CA  . PRO A 1 299 ? -3.500  -8.742  18.561 1.00 28.87 ? 507 PRO A CA  1 
ATOM   2102 C  C   . PRO A 1 299 ? -3.229  -9.232  17.122 1.00 29.04 ? 507 PRO A C   1 
ATOM   2103 O  O   . PRO A 1 299 ? -4.073  -9.910  16.540 1.00 26.59 ? 507 PRO A O   1 
ATOM   2104 C  CB  . PRO A 1 299 ? -3.044  -9.788  19.578 1.00 29.70 ? 507 PRO A CB  1 
ATOM   2105 C  CG  . PRO A 1 299 ? -4.048  -9.693  20.692 1.00 31.71 ? 507 PRO A CG  1 
ATOM   2106 C  CD  . PRO A 1 299 ? -5.346  -9.420  19.992 1.00 31.00 ? 507 PRO A CD  1 
ATOM   2107 N  N   . PHE A 1 300 ? -2.086  -8.871  16.546 1.00 29.06 ? 508 PHE A N   1 
ATOM   2108 C  CA  . PHE A 1 300 ? -1.765  -9.317  15.187 1.00 29.27 ? 508 PHE A CA  1 
ATOM   2109 C  C   . PHE A 1 300 ? -0.284  -9.632  15.027 1.00 29.45 ? 508 PHE A C   1 
ATOM   2110 O  O   . PHE A 1 300 ? 0.571   -9.063  15.699 1.00 28.67 ? 508 PHE A O   1 
ATOM   2111 C  CB  . PHE A 1 300 ? -2.241  -8.286  14.148 1.00 30.09 ? 508 PHE A CB  1 
ATOM   2112 C  CG  . PHE A 1 300 ? -1.557  -6.963  14.263 1.00 30.91 ? 508 PHE A CG  1 
ATOM   2113 C  CD1 . PHE A 1 300 ? -2.011  -6.007  15.170 1.00 31.54 ? 508 PHE A CD1 1 
ATOM   2114 C  CD2 . PHE A 1 300 ? -0.445  -6.675  13.490 1.00 30.21 ? 508 PHE A CD2 1 
ATOM   2115 C  CE1 . PHE A 1 300 ? -1.355  -4.793  15.301 1.00 31.64 ? 508 PHE A CE1 1 
ATOM   2116 C  CE2 . PHE A 1 300 ? 0.208   -5.463  13.607 1.00 30.87 ? 508 PHE A CE2 1 
ATOM   2117 C  CZ  . PHE A 1 300 ? -0.242  -4.520  14.518 1.00 31.53 ? 508 PHE A CZ  1 
ATOM   2118 N  N   . SER A 1 301 ? 0.014   -10.542 14.104 1.00 30.78 ? 509 SER A N   1 
ATOM   2119 C  CA  A SER A 1 301 ? 1.380   -11.022 13.917 0.50 29.64 ? 509 SER A CA  1 
ATOM   2120 C  CA  B SER A 1 301 ? 1.377   -11.024 13.900 0.50 31.18 ? 509 SER A CA  1 
ATOM   2121 C  C   . SER A 1 301 ? 2.231   -9.998  13.190 1.00 29.54 ? 509 SER A C   1 
ATOM   2122 O  O   . SER A 1 301 ? 1.761   -9.316  12.278 1.00 31.62 ? 509 SER A O   1 
ATOM   2123 C  CB  A SER A 1 301 ? 1.381   -12.346 13.144 0.50 29.36 ? 509 SER A CB  1 
ATOM   2124 C  CB  B SER A 1 301 ? 1.361   -12.323 13.087 0.50 32.51 ? 509 SER A CB  1 
ATOM   2125 O  OG  A SER A 1 301 ? 0.747   -12.194 11.894 0.50 26.13 ? 509 SER A OG  1 
ATOM   2126 O  OG  B SER A 1 301 ? 0.751   -13.359 13.831 0.50 33.41 ? 509 SER A OG  1 
ATOM   2127 N  N   . VAL A 1 302 ? 3.483   -9.887  13.619 1.00 29.32 ? 510 VAL A N   1 
ATOM   2128 C  CA  . VAL A 1 302 ? 4.466   -9.047  12.948 1.00 30.20 ? 510 VAL A CA  1 
ATOM   2129 C  C   . VAL A 1 302 ? 5.750   -9.847  12.745 1.00 32.72 ? 510 VAL A C   1 
ATOM   2130 O  O   . VAL A 1 302 ? 5.990   -10.840 13.443 1.00 34.23 ? 510 VAL A O   1 
ATOM   2131 C  CB  . VAL A 1 302 ? 4.791   -7.756  13.740 1.00 30.73 ? 510 VAL A CB  1 
ATOM   2132 C  CG1 . VAL A 1 302 ? 3.558   -6.862  13.817 1.00 30.90 ? 510 VAL A CG1 1 
ATOM   2133 C  CG2 . VAL A 1 302 ? 5.321   -8.069  15.133 1.00 30.94 ? 510 VAL A CG2 1 
ATOM   2134 N  N   . LYS A 1 303 ? 6.575   -9.390  11.807 1.00 34.91 ? 511 LYS A N   1 
ATOM   2135 C  CA  . LYS A 1 303 ? 7.837   -10.031 11.479 1.00 35.36 ? 511 LYS A CA  1 
ATOM   2136 C  C   . LYS A 1 303 ? 9.015   -9.090  11.665 1.00 34.02 ? 511 LYS A C   1 
ATOM   2137 O  O   . LYS A 1 303 ? 8.945   -7.930  11.283 1.00 31.54 ? 511 LYS A O   1 
ATOM   2138 C  CB  . LYS A 1 303 ? 7.798   -10.503 10.015 1.00 38.25 ? 511 LYS A CB  1 
ATOM   2139 C  CG  . LYS A 1 303 ? 6.704   -11.521 9.730  1.00 41.20 ? 511 LYS A CG  1 
ATOM   2140 C  CD  . LYS A 1 303 ? 6.977   -12.276 8.430  1.00 46.12 ? 511 LYS A CD  1 
ATOM   2141 C  CE  . LYS A 1 303 ? 5.712   -12.824 7.784  1.00 48.33 ? 511 LYS A CE  1 
ATOM   2142 N  NZ  . LYS A 1 303 ? 5.977   -13.379 6.423  1.00 47.01 ? 511 LYS A NZ  1 
ATOM   2143 N  N   . ALA A 1 304 ? 10.103  -9.612  12.233 1.00 35.59 ? 512 ALA A N   1 
ATOM   2144 C  CA  . ALA A 1 304 ? 11.364  -8.876  12.363 1.00 36.79 ? 512 ALA A CA  1 
ATOM   2145 C  C   . ALA A 1 304 ? 11.751  -8.277  11.023 1.00 37.62 ? 512 ALA A C   1 
ATOM   2146 O  O   . ALA A 1 304 ? 11.631  -8.945  9.993  1.00 34.90 ? 512 ALA A O   1 
ATOM   2147 C  CB  . ALA A 1 304 ? 12.474  -9.803  12.837 1.00 38.37 ? 512 ALA A CB  1 
ATOM   2148 N  N   . GLY A 1 305 ? 12.203  -7.021  11.047 1.00 35.86 ? 513 GLY A N   1 
ATOM   2149 C  CA  . GLY A 1 305 ? 12.482  -6.268  9.835  1.00 35.50 ? 513 GLY A CA  1 
ATOM   2150 C  C   . GLY A 1 305 ? 11.296  -5.572  9.199  1.00 34.11 ? 513 GLY A C   1 
ATOM   2151 O  O   . GLY A 1 305 ? 11.469  -4.726  8.336  1.00 36.53 ? 513 GLY A O   1 
ATOM   2152 N  N   . GLU A 1 306 ? 10.082  -5.907  9.598  1.00 35.82 ? 514 GLU A N   1 
ATOM   2153 C  CA  . GLU A 1 306 ? 8.901   -5.235  9.053  1.00 37.44 ? 514 GLU A CA  1 
ATOM   2154 C  C   . GLU A 1 306 ? 8.847   -3.778  9.503  1.00 35.98 ? 514 GLU A C   1 
ATOM   2155 O  O   . GLU A 1 306 ? 9.270   -3.460  10.607 1.00 35.42 ? 514 GLU A O   1 
ATOM   2156 C  CB  . GLU A 1 306 ? 7.649   -5.969  9.527  1.00 41.58 ? 514 GLU A CB  1 
ATOM   2157 C  CG  . GLU A 1 306 ? 6.331   -5.239  9.367  1.00 42.49 ? 514 GLU A CG  1 
ATOM   2158 C  CD  . GLU A 1 306 ? 5.157   -6.084  9.839  1.00 45.09 ? 514 GLU A CD  1 
ATOM   2159 O  OE1 . GLU A 1 306 ? 5.372   -7.270  10.235 1.00 41.58 ? 514 GLU A OE1 1 
ATOM   2160 O  OE2 . GLU A 1 306 ? 4.027   -5.553  9.820  1.00 43.61 ? 514 GLU A OE2 1 
ATOM   2161 N  N   . ALA A 1 307 ? 8.333   -2.906  8.635  1.00 34.62 ? 515 ALA A N   1 
ATOM   2162 C  CA  . ALA A 1 307 ? 8.040   -1.521  8.994  1.00 35.26 ? 515 ALA A CA  1 
ATOM   2163 C  C   . ALA A 1 307 ? 6.548   -1.405  9.274  1.00 35.88 ? 515 ALA A C   1 
ATOM   2164 O  O   . ALA A 1 307 ? 5.756   -1.317  8.352  1.00 34.77 ? 515 ALA A O   1 
ATOM   2165 C  CB  . ALA A 1 307 ? 8.438   -0.563  7.881  1.00 36.49 ? 515 ALA A CB  1 
ATOM   2166 N  N   . LEU A 1 308 ? 6.180   -1.414  10.555 1.00 33.38 ? 516 LEU A N   1 
ATOM   2167 C  CA  . LEU A 1 308 ? 4.780   -1.312  10.971 1.00 32.61 ? 516 LEU A CA  1 
ATOM   2168 C  C   . LEU A 1 308 ? 4.359   0.158   11.012 1.00 31.49 ? 516 LEU A C   1 
ATOM   2169 O  O   . LEU A 1 308 ? 4.904   0.950   11.788 1.00 29.69 ? 516 LEU A O   1 
ATOM   2170 C  CB  . LEU A 1 308 ? 4.608   -1.961  12.359 1.00 32.46 ? 516 LEU A CB  1 
ATOM   2171 C  CG  . LEU A 1 308 ? 3.193   -1.947  12.925 1.00 32.57 ? 516 LEU A CG  1 
ATOM   2172 C  CD1 . LEU A 1 308 ? 2.263   -2.759  12.052 1.00 32.74 ? 516 LEU A CD1 1 
ATOM   2173 C  CD2 . LEU A 1 308 ? 3.213   -2.481  14.354 1.00 32.99 ? 516 LEU A CD2 1 
ATOM   2174 N  N   . LYS A 1 309 ? 3.405   0.523   10.163 1.00 33.26 ? 517 LYS A N   1 
ATOM   2175 C  CA  . LYS A 1 309 ? 2.973   1.915   10.008 1.00 34.00 ? 517 LYS A CA  1 
ATOM   2176 C  C   . LYS A 1 309 ? 1.634   2.168   10.694 1.00 32.02 ? 517 LYS A C   1 
ATOM   2177 O  O   . LYS A 1 309 ? 0.713   1.357   10.607 1.00 32.33 ? 517 LYS A O   1 
ATOM   2178 C  CB  . LYS A 1 309 ? 2.857   2.279   8.518  1.00 39.62 ? 517 LYS A CB  1 
ATOM   2179 C  CG  . LYS A 1 309 ? 4.187   2.195   7.774  1.00 42.13 ? 517 LYS A CG  1 
ATOM   2180 C  CD  . LYS A 1 309 ? 4.151   2.846   6.409  1.00 45.13 ? 517 LYS A CD  1 
ATOM   2181 C  CE  . LYS A 1 309 ? 5.556   2.904   5.827  1.00 48.41 ? 517 LYS A CE  1 
ATOM   2182 N  N   . GLY A 1 310 ? 1.513   3.313   11.349 1.00 31.03 ? 518 GLY A N   1 
ATOM   2183 C  CA  . GLY A 1 310 ? 0.248   3.707   11.951 1.00 29.53 ? 518 GLY A CA  1 
ATOM   2184 C  C   . GLY A 1 310 ? 0.116   5.194   12.097 1.00 28.49 ? 518 GLY A C   1 
ATOM   2185 O  O   . GLY A 1 310 ? 0.979   5.953   11.644 1.00 27.86 ? 518 GLY A O   1 
ATOM   2186 N  N   . LYS A 1 311 ? -0.971  5.610   12.740 1.00 27.21 ? 519 LYS A N   1 
ATOM   2187 C  CA  . LYS A 1 311 ? -1.198  7.017   13.004 1.00 27.34 ? 519 LYS A CA  1 
ATOM   2188 C  C   . LYS A 1 311 ? -1.739  7.239   14.402 1.00 26.79 ? 519 LYS A C   1 
ATOM   2189 O  O   . LYS A 1 311 ? -2.578  6.481   14.887 1.00 25.01 ? 519 LYS A O   1 
ATOM   2190 C  CB  . LYS A 1 311 ? -2.146  7.615   11.955 1.00 30.25 ? 519 LYS A CB  1 
ATOM   2191 C  CG  . LYS A 1 311 ? -2.271  9.125   12.038 1.00 31.71 ? 519 LYS A CG  1 
ATOM   2192 C  CD  . LYS A 1 311 ? -3.078  9.741   10.895 1.00 34.64 ? 519 LYS A CD  1 
ATOM   2193 C  CE  . LYS A 1 311 ? -2.997  11.261  10.942 1.00 33.83 ? 519 LYS A CE  1 
ATOM   2194 N  NZ  . LYS A 1 311 ? -3.674  11.914  9.785  1.00 35.12 ? 519 LYS A NZ  1 
ATOM   2195 N  N   . VAL A 1 312 ? -1.255  8.296   15.036 1.00 26.16 ? 520 VAL A N   1 
ATOM   2196 C  CA  . VAL A 1 312 ? -1.657  8.649   16.386 1.00 27.08 ? 520 VAL A CA  1 
ATOM   2197 C  C   . VAL A 1 312 ? -2.053  10.111  16.447 1.00 26.72 ? 520 VAL A C   1 
ATOM   2198 O  O   . VAL A 1 312 ? -1.389  10.976  15.862 1.00 27.44 ? 520 VAL A O   1 
ATOM   2199 C  CB  . VAL A 1 312 ? -0.544  8.351   17.408 1.00 27.91 ? 520 VAL A CB  1 
ATOM   2200 C  CG1 . VAL A 1 312 ? 0.714   9.171   17.126 1.00 29.47 ? 520 VAL A CG1 1 
ATOM   2201 C  CG2 . VAL A 1 312 ? -1.042  8.593   18.824 1.00 29.48 ? 520 VAL A CG2 1 
ATOM   2202 N  N   . THR A 1 313 ? -3.147  10.384  17.144 1.00 27.60 ? 521 THR A N   1 
ATOM   2203 C  CA  . THR A 1 313 ? -3.584  11.751  17.387 1.00 27.30 ? 521 THR A CA  1 
ATOM   2204 C  C   . THR A 1 313 ? -3.926  11.909  18.860 1.00 27.65 ? 521 THR A C   1 
ATOM   2205 O  O   . THR A 1 313 ? -4.609  11.073  19.444 1.00 26.64 ? 521 THR A O   1 
ATOM   2206 C  CB  . THR A 1 313 ? -4.793  12.142  16.511 1.00 28.12 ? 521 THR A CB  1 
ATOM   2207 O  OG1 . THR A 1 313 ? -4.443  12.040  15.117 1.00 28.01 ? 521 THR A OG1 1 
ATOM   2208 C  CG2 . THR A 1 313 ? -5.233  13.577  16.791 1.00 28.74 ? 521 THR A CG2 1 
ATOM   2209 N  N   . VAL A 1 314 ? -3.452  12.999  19.448 1.00 28.04 ? 522 VAL A N   1 
ATOM   2210 C  CA  . VAL A 1 314 ? -3.799  13.354  20.807 1.00 30.53 ? 522 VAL A CA  1 
ATOM   2211 C  C   . VAL A 1 314 ? -4.763  14.537  20.801 1.00 31.17 ? 522 VAL A C   1 
ATOM   2212 O  O   . VAL A 1 314 ? -4.490  15.549  20.165 1.00 33.30 ? 522 VAL A O   1 
ATOM   2213 C  CB  . VAL A 1 314 ? -2.538  13.717  21.600 1.00 32.52 ? 522 VAL A CB  1 
ATOM   2214 C  CG1 . VAL A 1 314 ? -2.906  14.281  22.970 1.00 33.81 ? 522 VAL A CG1 1 
ATOM   2215 C  CG2 . VAL A 1 314 ? -1.651  12.483  21.721 1.00 33.42 ? 522 VAL A CG2 1 
ATOM   2216 N  N   . HIS A 1 315 ? -5.883  14.401  21.499 1.00 31.69 ? 523 HIS A N   1 
ATOM   2217 C  CA  . HIS A 1 315 ? -6.847  15.497  21.631 1.00 35.78 ? 523 HIS A CA  1 
ATOM   2218 C  C   . HIS A 1 315 ? -7.089  15.862  23.082 1.00 39.20 ? 523 HIS A C   1 
ATOM   2219 O  O   . HIS A 1 315 ? -7.059  15.002  23.957 1.00 38.21 ? 523 HIS A O   1 
ATOM   2220 C  CB  . HIS A 1 315 ? -8.203  15.112  21.059 1.00 34.92 ? 523 HIS A CB  1 
ATOM   2221 C  CG  . HIS A 1 315 ? -8.227  14.954  19.578 1.00 35.40 ? 523 HIS A CG  1 
ATOM   2222 N  ND1 . HIS A 1 315 ? -8.412  13.728  18.971 1.00 37.47 ? 523 HIS A ND1 1 
ATOM   2223 C  CD2 . HIS A 1 315 ? -8.145  15.866  18.576 1.00 36.84 ? 523 HIS A CD2 1 
ATOM   2224 C  CE1 . HIS A 1 315 ? -8.422  13.891  17.657 1.00 38.20 ? 523 HIS A CE1 1 
ATOM   2225 N  NE2 . HIS A 1 315 ? -8.257  15.178  17.394 1.00 39.18 ? 523 HIS A NE2 1 
ATOM   2226 N  N   . LYS A 1 316 ? -7.395  17.137  23.298 1.00 47.45 ? 524 LYS A N   1 
ATOM   2227 C  CA  . LYS A 1 316 ? -7.786  17.677  24.593 1.00 54.17 ? 524 LYS A CA  1 
ATOM   2228 C  C   . LYS A 1 316 ? -9.287  17.909  24.549 1.00 59.69 ? 524 LYS A C   1 
ATOM   2229 O  O   . LYS A 1 316 ? -9.768  18.622  23.670 1.00 64.85 ? 524 LYS A O   1 
ATOM   2230 C  CB  . LYS A 1 316 ? -7.062  19.007  24.850 1.00 54.27 ? 524 LYS A CB  1 
ATOM   2231 N  N   . ASN A 1 317 ? -10.016 17.291  25.476 1.00 66.75 ? 525 ASN A N   1 
ATOM   2232 C  CA  . ASN A 1 317 ? -11.469 17.450  25.581 1.00 68.51 ? 525 ASN A CA  1 
ATOM   2233 C  C   . ASN A 1 317 ? -11.834 18.832  26.120 1.00 68.61 ? 525 ASN A C   1 
ATOM   2234 O  O   . ASN A 1 317 ? -12.843 18.999  26.803 1.00 72.56 ? 525 ASN A O   1 
ATOM   2235 C  CB  . ASN A 1 317 ? -12.064 16.359  26.484 1.00 68.19 ? 525 ASN A CB  1 
ATOM   2236 N  N   . SER A 1 323 ? -8.756  15.767  30.456 1.00 56.88 ? 531 SER A N   1 
ATOM   2237 C  CA  . SER A 1 323 ? -9.367  14.627  29.780 1.00 57.23 ? 531 SER A CA  1 
ATOM   2238 C  C   . SER A 1 323 ? -8.839  14.472  28.339 1.00 56.99 ? 531 SER A C   1 
ATOM   2239 O  O   . SER A 1 323 ? -9.635  14.423  27.382 1.00 61.56 ? 531 SER A O   1 
ATOM   2240 C  CB  . SER A 1 323 ? -10.892 14.773  29.772 1.00 55.13 ? 531 SER A CB  1 
ATOM   2241 N  N   . LEU A 1 324 ? -7.507  14.410  28.200 1.00 49.25 ? 532 LEU A N   1 
ATOM   2242 C  CA  . LEU A 1 324 ? -6.840  14.038  26.929 1.00 46.91 ? 532 LEU A CA  1 
ATOM   2243 C  C   . LEU A 1 324 ? -7.209  12.645  26.436 1.00 39.13 ? 532 LEU A C   1 
ATOM   2244 O  O   . LEU A 1 324 ? -7.347  11.725  27.221 1.00 38.91 ? 532 LEU A O   1 
ATOM   2245 C  CB  . LEU A 1 324 ? -5.312  14.010  27.068 1.00 50.49 ? 532 LEU A CB  1 
ATOM   2246 C  CG  . LEU A 1 324 ? -4.424  15.247  26.954 1.00 54.42 ? 532 LEU A CG  1 
ATOM   2247 C  CD1 . LEU A 1 324 ? -3.040  14.774  26.532 1.00 56.04 ? 532 LEU A CD1 1 
ATOM   2248 C  CD2 . LEU A 1 324 ? -4.922  16.321  25.998 1.00 55.10 ? 532 LEU A CD2 1 
ATOM   2249 N  N   . THR A 1 325 ? -7.303  12.482  25.122 1.00 33.50 ? 533 THR A N   1 
ATOM   2250 C  CA  . THR A 1 325 ? -7.510  11.165  24.542 1.00 31.10 ? 533 THR A CA  1 
ATOM   2251 C  C   . THR A 1 325 ? -6.489  10.928  23.447 1.00 28.93 ? 533 THR A C   1 
ATOM   2252 O  O   . THR A 1 325 ? -5.959  11.862  22.865 1.00 26.92 ? 533 THR A O   1 
ATOM   2253 C  CB  . THR A 1 325 ? -8.903  11.020  23.927 1.00 31.99 ? 533 THR A CB  1 
ATOM   2254 O  OG1 . THR A 1 325 ? -9.076  12.050  22.955 1.00 31.41 ? 533 THR A OG1 1 
ATOM   2255 C  CG2 . THR A 1 325 ? -9.991  11.110  24.993 1.00 33.26 ? 533 THR A CG2 1 
ATOM   2256 N  N   . VAL A 1 326 ? -6.257  9.658   23.166 1.00 27.72 ? 534 VAL A N   1 
ATOM   2257 C  CA  . VAL A 1 326 ? -5.257  9.230   22.206 1.00 26.84 ? 534 VAL A CA  1 
ATOM   2258 C  C   . VAL A 1 326 ? -5.963  8.300   21.227 1.00 25.83 ? 534 VAL A C   1 
ATOM   2259 O  O   . VAL A 1 326 ? -6.524  7.266   21.617 1.00 25.08 ? 534 VAL A O   1 
ATOM   2260 C  CB  . VAL A 1 326 ? -4.096  8.502   22.924 1.00 27.54 ? 534 VAL A CB  1 
ATOM   2261 C  CG1 . VAL A 1 326 ? -3.071  8.003   21.914 1.00 28.09 ? 534 VAL A CG1 1 
ATOM   2262 C  CG2 . VAL A 1 326 ? -3.449  9.436   23.955 1.00 27.65 ? 534 VAL A CG2 1 
ATOM   2263 N  N   . THR A 1 327 ? -5.963  8.683   19.960 1.00 24.74 ? 535 THR A N   1 
ATOM   2264 C  CA  . THR A 1 327 ? -6.562  7.877   18.917 1.00 24.76 ? 535 THR A CA  1 
ATOM   2265 C  C   . THR A 1 327 ? -5.456  7.214   18.110 1.00 24.89 ? 535 THR A C   1 
ATOM   2266 O  O   . THR A 1 327 ? -4.551  7.892   17.620 1.00 24.48 ? 535 THR A O   1 
ATOM   2267 C  CB  . THR A 1 327 ? -7.480  8.747   18.050 1.00 25.55 ? 535 THR A CB  1 
ATOM   2268 O  OG1 . THR A 1 327 ? -8.550  9.219   18.876 1.00 25.01 ? 535 THR A OG1 1 
ATOM   2269 C  CG2 . THR A 1 327 ? -8.059  7.943   16.882 1.00 26.77 ? 535 THR A CG2 1 
ATOM   2270 N  N   . LEU A 1 328 ? -5.541  5.888   18.005 1.00 25.14 ? 536 LEU A N   1 
ATOM   2271 C  CA  A LEU A 1 328 ? -4.520  5.064   17.351 0.50 26.20 ? 536 LEU A CA  1 
ATOM   2272 C  CA  B LEU A 1 328 ? -4.528  5.055   17.370 0.50 26.62 ? 536 LEU A CA  1 
ATOM   2273 C  C   . LEU A 1 328 ? -5.121  4.291   16.190 1.00 26.42 ? 536 LEU A C   1 
ATOM   2274 O  O   . LEU A 1 328 ? -6.121  3.605   16.359 1.00 24.96 ? 536 LEU A O   1 
ATOM   2275 C  CB  A LEU A 1 328 ? -3.929  4.044   18.338 0.50 27.09 ? 536 LEU A CB  1 
ATOM   2276 C  CB  B LEU A 1 328 ? -4.033  4.027   18.390 0.50 28.33 ? 536 LEU A CB  1 
ATOM   2277 C  CG  A LEU A 1 328 ? -2.653  4.418   19.083 0.50 27.77 ? 536 LEU A CG  1 
ATOM   2278 C  CG  B LEU A 1 328 ? -2.582  3.604   18.311 0.50 29.42 ? 536 LEU A CG  1 
ATOM   2279 C  CD1 A LEU A 1 328 ? -2.325  3.397   20.171 0.50 27.33 ? 536 LEU A CD1 1 
ATOM   2280 C  CD1 B LEU A 1 328 ? -1.749  4.735   18.908 0.50 31.54 ? 536 LEU A CD1 1 
ATOM   2281 C  CD2 A LEU A 1 328 ? -1.510  4.523   18.071 0.50 28.76 ? 536 LEU A CD2 1 
ATOM   2282 C  CD2 B LEU A 1 328 ? -2.368  2.307   19.075 0.50 30.09 ? 536 LEU A CD2 1 
ATOM   2283 N  N   . THR A 1 329 ? -4.502  4.403   15.016 1.00 25.96 ? 537 THR A N   1 
ATOM   2284 C  CA  . THR A 1 329 ? -4.857  3.559   13.870 1.00 26.88 ? 537 THR A CA  1 
ATOM   2285 C  C   . THR A 1 329 ? -3.650  2.670   13.545 1.00 26.64 ? 537 THR A C   1 
ATOM   2286 O  O   . THR A 1 329 ? -2.535  3.145   13.387 1.00 26.58 ? 537 THR A O   1 
ATOM   2287 C  CB  . THR A 1 329 ? -5.258  4.368   12.632 1.00 27.66 ? 537 THR A CB  1 
ATOM   2288 O  OG1 . THR A 1 329 ? -6.442  5.103   12.922 1.00 27.98 ? 537 THR A OG1 1 
ATOM   2289 C  CG2 . THR A 1 329 ? -5.508  3.449   11.410 1.00 27.85 ? 537 THR A CG2 1 
ATOM   2290 N  N   . LEU A 1 330 ? -3.908  1.378   13.447 1.00 27.41 ? 538 LEU A N   1 
ATOM   2291 C  CA  . LEU A 1 330 ? -2.877  0.367   13.314 1.00 28.76 ? 538 LEU A CA  1 
ATOM   2292 C  C   . LEU A 1 330 ? -3.546  -0.882  12.777 1.00 28.63 ? 538 LEU A C   1 
ATOM   2293 O  O   . LEU A 1 330 ? -4.613  -1.240  13.250 1.00 25.70 ? 538 LEU A O   1 
ATOM   2294 C  CB  . LEU A 1 330 ? -2.288  0.087   14.699 1.00 31.14 ? 538 LEU A CB  1 
ATOM   2295 C  CG  . LEU A 1 330 ? -1.007  -0.721  14.766 1.00 33.27 ? 538 LEU A CG  1 
ATOM   2296 C  CD1 . LEU A 1 330 ? 0.161   0.082   14.215 1.00 35.18 ? 538 LEU A CD1 1 
ATOM   2297 C  CD2 . LEU A 1 330 ? -0.744  -1.166  16.196 1.00 34.25 ? 538 LEU A CD2 1 
ATOM   2298 N  N   . ASN A 1 331 ? -2.940  -1.543  11.789 1.00 29.95 ? 539 ASN A N   1 
ATOM   2299 C  CA  . ASN A 1 331 ? -3.471  -2.816  11.276 1.00 31.54 ? 539 ASN A CA  1 
ATOM   2300 C  C   . ASN A 1 331 ? -4.940  -2.721  10.847 1.00 31.85 ? 539 ASN A C   1 
ATOM   2301 O  O   . ASN A 1 331 ? -5.727  -3.638  11.099 1.00 33.00 ? 539 ASN A O   1 
ATOM   2302 C  CB  . ASN A 1 331 ? -3.314  -3.943  12.319 1.00 32.08 ? 539 ASN A CB  1 
ATOM   2303 C  CG  . ASN A 1 331 ? -3.504  -5.341  11.713 1.00 31.32 ? 539 ASN A CG  1 
ATOM   2304 O  OD1 . ASN A 1 331 ? -2.966  -5.626  10.674 1.00 32.64 ? 539 ASN A OD1 1 
ATOM   2305 N  ND2 . ASN A 1 331 ? -4.266  -6.196  12.369 1.00 31.93 ? 539 ASN A ND2 1 
ATOM   2306 N  N   . ASN A 1 332 ? -5.303  -1.599  10.236 1.00 32.92 ? 540 ASN A N   1 
ATOM   2307 C  CA  . ASN A 1 332 ? -6.658  -1.350  9.707  1.00 35.17 ? 540 ASN A CA  1 
ATOM   2308 C  C   . ASN A 1 332 ? -7.789  -1.284  10.718 1.00 34.81 ? 540 ASN A C   1 
ATOM   2309 O  O   . ASN A 1 332 ? -8.939  -1.544  10.380 1.00 33.22 ? 540 ASN A O   1 
ATOM   2310 C  CB  . ASN A 1 332 ? -7.017  -2.363  8.612  1.00 39.41 ? 540 ASN A CB  1 
ATOM   2311 C  CG  . ASN A 1 332 ? -5.987  -2.393  7.507  1.00 42.40 ? 540 ASN A CG  1 
ATOM   2312 O  OD1 . ASN A 1 332 ? -5.709  -1.374  6.880  1.00 46.69 ? 540 ASN A OD1 1 
ATOM   2313 N  ND2 . ASN A 1 332 ? -5.402  -3.550  7.275  1.00 46.27 ? 540 ASN A ND2 1 
ATOM   2314 N  N   . SER A 1 333 ? -7.486  -0.949  11.964 1.00 33.64 ? 541 SER A N   1 
ATOM   2315 C  CA  . SER A 1 333 ? -8.549  -0.564  12.864 1.00 32.58 ? 541 SER A CA  1 
ATOM   2316 C  C   . SER A 1 333 ? -8.084  0.559   13.768 1.00 29.74 ? 541 SER A C   1 
ATOM   2317 O  O   . SER A 1 333 ? -6.890  0.814   13.919 1.00 29.66 ? 541 SER A O   1 
ATOM   2318 C  CB  . SER A 1 333 ? -9.093  -1.767  13.624 1.00 34.68 ? 541 SER A CB  1 
ATOM   2319 O  OG  . SER A 1 333 ? -8.096  -2.329  14.429 1.00 38.22 ? 541 SER A OG  1 
ATOM   2320 N  N   . THR A 1 334 ? -9.056  1.259   14.323 1.00 29.82 ? 542 THR A N   1 
ATOM   2321 C  CA  . THR A 1 334 ? -8.823  2.486   15.030 1.00 28.80 ? 542 THR A CA  1 
ATOM   2322 C  C   . THR A 1 334 ? -9.472  2.377   16.409 1.00 29.15 ? 542 THR A C   1 
ATOM   2323 O  O   . THR A 1 334 ? -10.552 1.820   16.549 1.00 28.35 ? 542 THR A O   1 
ATOM   2324 C  CB  . THR A 1 334 ? -9.404  3.658   14.231 1.00 28.19 ? 542 THR A CB  1 
ATOM   2325 O  OG1 . THR A 1 334 ? -8.682  3.794   12.991 1.00 25.63 ? 542 THR A OG1 1 
ATOM   2326 C  CG2 . THR A 1 334 ? -9.315  4.954   15.027 1.00 28.89 ? 542 THR A CG2 1 
ATOM   2327 N  N   . GLN A 1 335 ? -8.797  2.902   17.423 1.00 27.89 ? 543 GLN A N   1 
ATOM   2328 C  CA  . GLN A 1 335 ? -9.337  2.925   18.787 1.00 28.14 ? 543 GLN A CA  1 
ATOM   2329 C  C   . GLN A 1 335 ? -8.854  4.176   19.496 1.00 27.45 ? 543 GLN A C   1 
ATOM   2330 O  O   . GLN A 1 335 ? -7.681  4.563   19.373 1.00 26.04 ? 543 GLN A O   1 
ATOM   2331 C  CB  . GLN A 1 335 ? -8.889  1.664   19.551 1.00 29.43 ? 543 GLN A CB  1 
ATOM   2332 C  CG  . GLN A 1 335 ? -9.303  1.599   21.023 1.00 30.39 ? 543 GLN A CG  1 
ATOM   2333 C  CD  . GLN A 1 335 ? -10.801 1.373   21.207 1.00 30.08 ? 543 GLN A CD  1 
ATOM   2334 O  OE1 . GLN A 1 335 ? -11.375 0.433   20.655 1.00 28.59 ? 543 GLN A OE1 1 
ATOM   2335 N  NE2 . GLN A 1 335 ? -11.434 2.240   21.977 1.00 30.54 ? 543 GLN A NE2 1 
ATOM   2336 N  N   . THR A 1 336 ? -9.759  4.785   20.256 1.00 26.62 ? 544 THR A N   1 
ATOM   2337 C  CA  . THR A 1 336 ? -9.454  5.940   21.074 1.00 28.12 ? 544 THR A CA  1 
ATOM   2338 C  C   . THR A 1 336 ? -9.322  5.507   22.546 1.00 28.27 ? 544 THR A C   1 
ATOM   2339 O  O   . THR A 1 336 ? -10.121 4.734   23.063 1.00 28.83 ? 544 THR A O   1 
ATOM   2340 C  CB  . THR A 1 336 ? -10.525 7.041   20.893 1.00 30.54 ? 544 THR A CB  1 
ATOM   2341 O  OG1 . THR A 1 336 ? -10.468 7.533   19.545 1.00 30.00 ? 544 THR A OG1 1 
ATOM   2342 C  CG2 . THR A 1 336 ? -10.299 8.195   21.857 1.00 30.13 ? 544 THR A CG2 1 
ATOM   2343 N  N   . TYR A 1 337 ? -8.284  6.007   23.193 1.00 27.06 ? 545 TYR A N   1 
ATOM   2344 C  CA  . TYR A 1 337 ? -7.927  5.616   24.536 1.00 27.48 ? 545 TYR A CA  1 
ATOM   2345 C  C   . TYR A 1 337 ? -7.937  6.825   25.452 1.00 28.27 ? 545 TYR A C   1 
ATOM   2346 O  O   . TYR A 1 337 ? -7.577  7.926   25.040 1.00 29.72 ? 545 TYR A O   1 
ATOM   2347 C  CB  . TYR A 1 337 ? -6.509  5.041   24.548 1.00 26.08 ? 545 TYR A CB  1 
ATOM   2348 C  CG  . TYR A 1 337 ? -6.320  3.794   23.717 1.00 24.99 ? 545 TYR A CG  1 
ATOM   2349 C  CD1 . TYR A 1 337 ? -6.510  2.541   24.274 1.00 25.15 ? 545 TYR A CD1 1 
ATOM   2350 C  CD2 . TYR A 1 337 ? -5.939  3.869   22.371 1.00 23.64 ? 545 TYR A CD2 1 
ATOM   2351 C  CE1 . TYR A 1 337 ? -6.324  1.390   23.533 1.00 25.63 ? 545 TYR A CE1 1 
ATOM   2352 C  CE2 . TYR A 1 337 ? -5.735  2.724   21.622 1.00 23.56 ? 545 TYR A CE2 1 
ATOM   2353 C  CZ  . TYR A 1 337 ? -5.939  1.495   22.195 1.00 24.67 ? 545 TYR A CZ  1 
ATOM   2354 O  OH  . TYR A 1 337 ? -5.761  0.351   21.484 1.00 23.06 ? 545 TYR A OH  1 
ATOM   2355 N  N   . GLY A 1 338 ? -8.295  6.598   26.709 1.00 27.63 ? 546 GLY A N   1 
ATOM   2356 C  CA  . GLY A 1 338 ? -8.246  7.638   27.724 1.00 27.95 ? 546 GLY A CA  1 
ATOM   2357 C  C   . GLY A 1 338 ? -7.567  7.149   28.973 1.00 29.63 ? 546 GLY A C   1 
ATOM   2358 O  O   . GLY A 1 338 ? -7.364  5.947   29.157 1.00 28.76 ? 546 GLY A O   1 
ATOM   2359 N  N   . LEU A 1 339 ? -7.216  8.067   29.860 1.00 33.03 ? 547 LEU A N   1 
ATOM   2360 C  CA  . LEU A 1 339 ? -6.628  7.668   31.133 1.00 37.33 ? 547 LEU A CA  1 
ATOM   2361 C  C   . LEU A 1 339 ? -7.558  7.979   32.302 1.00 40.56 ? 547 LEU A C   1 
ATOM   2362 O  O   . LEU A 1 339 ? -7.913  9.136   32.500 1.00 41.96 ? 547 LEU A O   1 
ATOM   2363 C  CB  . LEU A 1 339 ? -5.290  8.364   31.326 1.00 41.60 ? 547 LEU A CB  1 
ATOM   2364 C  CG  . LEU A 1 339 ? -4.460  7.769   32.471 1.00 44.67 ? 547 LEU A CG  1 
ATOM   2365 C  CD1 . LEU A 1 339 ? -4.162  6.289   32.242 1.00 44.59 ? 547 LEU A CD1 1 
ATOM   2366 C  CD2 . LEU A 1 339 ? -3.175  8.561   32.638 1.00 47.38 ? 547 LEU A CD2 1 
HETATM 2367 O  O   . 3BQ B 2 .   ? -3.064  -4.313  31.778 1.00 30.19 ? 601 3BQ A O   1 
HETATM 2368 C  C4  . 3BQ B 2 .   ? -2.029  -4.268  32.443 1.00 31.15 ? 601 3BQ A C4  1 
HETATM 2369 N  N2  . 3BQ B 2 .   ? -0.771  -4.366  31.907 1.00 30.00 ? 601 3BQ A N2  1 
HETATM 2370 C  C5  . 3BQ B 2 .   ? -0.387  -4.856  30.639 1.00 28.32 ? 601 3BQ A C5  1 
HETATM 2371 C  C13 . 3BQ B 2 .   ? -1.272  -5.431  29.747 1.00 26.40 ? 601 3BQ A C13 1 
HETATM 2372 C  C12 . 3BQ B 2 .   ? -0.845  -5.822  28.456 1.00 24.86 ? 601 3BQ A C12 1 
HETATM 2373 C  C11 . 3BQ B 2 .   ? -1.707  -6.414  27.508 1.00 24.88 ? 601 3BQ A C11 1 
HETATM 2374 C  C10 . 3BQ B 2 .   ? -1.211  -6.771  26.289 1.00 25.65 ? 601 3BQ A C10 1 
HETATM 2375 N  N3  . 3BQ B 2 .   ? 0.064   -6.608  25.917 1.00 24.98 ? 601 3BQ A N3  1 
HETATM 2376 C  C9  . 3BQ B 2 .   ? 0.894   -6.052  26.797 1.00 25.48 ? 601 3BQ A C9  1 
HETATM 2377 C  C8  . 3BQ B 2 .   ? 0.506   -5.620  28.093 1.00 24.99 ? 601 3BQ A C8  1 
HETATM 2378 C  C7  . 3BQ B 2 .   ? 1.384   -5.031  29.031 1.00 26.21 ? 601 3BQ A C7  1 
HETATM 2379 C  C6  . 3BQ B 2 .   ? 0.945   -4.660  30.268 1.00 27.24 ? 601 3BQ A C6  1 
HETATM 2380 N  N1  . 3BQ B 2 .   ? -2.026  -4.097  33.777 1.00 33.48 ? 601 3BQ A N1  1 
HETATM 2381 C  C3  . 3BQ B 2 .   ? -3.164  -3.563  34.512 1.00 37.45 ? 601 3BQ A C3  1 
HETATM 2382 C  C2  A 3BQ B 2 .   ? -3.491  -4.522  35.629 0.50 39.53 ? 601 3BQ A C2  1 
HETATM 2383 C  C2  B 3BQ B 2 .   ? -3.506  -4.508  35.636 0.50 39.37 ? 601 3BQ A C2  1 
HETATM 2384 C  C1  A 3BQ B 2 .   ? -4.665  -4.133  36.547 0.50 41.37 ? 601 3BQ A C1  1 
HETATM 2385 C  C1  B 3BQ B 2 .   ? -4.715  -4.097  36.497 0.50 40.99 ? 601 3BQ A C1  1 
HETATM 2386 C  C   A 3BQ B 2 .   ? -4.198  -3.272  37.741 0.50 41.16 ? 601 3BQ A C   1 
HETATM 2387 C  C   B 3BQ B 2 .   ? -4.572  -2.673  37.096 0.50 40.73 ? 601 3BQ A C   1 
HETATM 2388 N  N   A 3BQ B 2 .   ? -4.598  -1.878  37.659 0.50 41.56 ? 601 3BQ A N   1 
HETATM 2389 N  N   B 3BQ B 2 .   ? -3.421  -2.463  37.960 0.50 41.51 ? 601 3BQ A N   1 
HETATM 2390 C  C18 A 3BQ B 2 .   ? -5.301  -5.420  37.100 0.50 42.49 ? 601 3BQ A C18 1 
HETATM 2391 C  C18 B 3BQ B 2 .   ? -4.836  -5.089  37.668 0.50 42.14 ? 601 3BQ A C18 1 
HETATM 2392 C  C17 A 3BQ B 2 .   ? -6.556  -5.173  37.924 0.50 42.95 ? 601 3BQ A C17 1 
HETATM 2393 C  C17 B 3BQ B 2 .   ? -6.100  -4.900  38.498 0.50 42.51 ? 601 3BQ A C17 1 
HETATM 2394 C  C16 A 3BQ B 2 .   ? -7.581  -4.375  37.137 0.50 43.06 ? 601 3BQ A C16 1 
HETATM 2395 C  C16 B 3BQ B 2 .   ? -7.341  -4.960  37.628 0.50 42.75 ? 601 3BQ A C16 1 
HETATM 2396 C  C15 A 3BQ B 2 .   ? -6.994  -3.073  36.634 0.50 42.03 ? 601 3BQ A C15 1 
HETATM 2397 C  C15 B 3BQ B 2 .   ? -7.268  -3.941  36.508 0.50 41.43 ? 601 3BQ A C15 1 
HETATM 2398 C  C14 A 3BQ B 2 .   ? -5.741  -3.321  35.805 0.50 41.43 ? 601 3BQ A C14 1 
HETATM 2399 C  C14 B 3BQ B 2 .   ? -6.012  -4.136  35.672 0.50 40.74 ? 601 3BQ A C14 1 
HETATM 2400 C  C1  . GOL C 3 .   ? 25.634  24.868  43.093 1.00 59.69 ? 602 GOL A C1  1 
HETATM 2401 O  O1  . GOL C 3 .   ? 26.337  24.799  41.853 1.00 55.52 ? 602 GOL A O1  1 
HETATM 2402 C  C2  . GOL C 3 .   ? 25.956  23.630  43.917 1.00 61.85 ? 602 GOL A C2  1 
HETATM 2403 O  O2  . GOL C 3 .   ? 27.306  23.221  43.684 1.00 62.78 ? 602 GOL A O2  1 
HETATM 2404 C  C3  . GOL C 3 .   ? 25.762  23.931  45.394 1.00 63.15 ? 602 GOL A C3  1 
HETATM 2405 O  O3  . GOL C 3 .   ? 25.759  22.707  46.130 1.00 63.37 ? 602 GOL A O3  1 
HETATM 2406 CL CL  . CL  D 4 .   ? 12.195  1.742   23.899 1.00 48.27 ? 603 CL  A CL  1 
HETATM 2407 X  UNK . UNX E 5 .   ? -0.166  24.710  40.776 1.00 30.00 1 604 UNX A UNK 1 
HETATM 2408 X  UNK . UNX F 5 .   ? 17.392  17.137  21.360 1.00 30.00 1 605 UNX A UNK 1 
HETATM 2409 X  UNK . UNX G 5 .   ? -11.981 -18.097 36.777 1.00 30.00 1 606 UNX A UNK 1 
HETATM 2410 X  UNK . UNX H 5 .   ? -15.585 -21.596 39.223 1.00 30.00 1 607 UNX A UNK 1 
HETATM 2411 X  UNK . UNX I 5 .   ? 28.641  26.940  35.100 1.00 30.00 1 608 UNX A UNK 1 
HETATM 2412 X  UNK . UNX J 5 .   ? 3.439   14.950  38.044 1.00 30.00 1 609 UNX A UNK 1 
HETATM 2413 X  UNK . UNX K 5 .   ? 5.700   23.056  19.691 1.00 30.00 1 610 UNX A UNK 1 
HETATM 2414 X  UNK . UNX L 5 .   ? 17.765  7.927   30.956 1.00 30.00 1 611 UNX A UNK 1 
HETATM 2415 X  UNK . UNX M 5 .   ? 3.326   -13.489 27.272 1.00 30.00 1 612 UNX A UNK 1 
HETATM 2416 X  UNK . UNX N 5 .   ? 11.016  41.724  29.506 1.00 30.00 1 613 UNX A UNK 1 
HETATM 2417 X  UNK . UNX O 5 .   ? -5.643  -5.179  15.087 1.00 30.00 1 614 UNX A UNK 1 
HETATM 2418 X  UNK . UNX P 5 .   ? 14.699  40.683  35.292 1.00 30.00 1 615 UNX A UNK 1 
HETATM 2419 O  O   . HOH Q 6 .   ? 4.274   -0.946  37.670 1.00 23.85 ? 701 HOH A O   1 
HETATM 2420 O  O   . HOH Q 6 .   ? 11.778  4.482   32.689 1.00 24.20 ? 702 HOH A O   1 
HETATM 2421 O  O   . HOH Q 6 .   ? 28.841  24.294  34.114 1.00 27.37 ? 703 HOH A O   1 
HETATM 2422 O  O   . HOH Q 6 .   ? 15.046  6.495   33.622 1.00 22.97 ? 704 HOH A O   1 
HETATM 2423 O  O   . HOH Q 6 .   ? 9.428   5.260   33.799 1.00 23.35 ? 705 HOH A O   1 
HETATM 2424 O  O   . HOH Q 6 .   ? 6.459   7.259   30.507 1.00 24.63 ? 706 HOH A O   1 
HETATM 2425 O  O   . HOH Q 6 .   ? 7.273   18.263  45.830 1.00 29.99 ? 707 HOH A O   1 
HETATM 2426 O  O   . HOH Q 6 .   ? 4.411   -13.907 20.326 1.00 31.45 ? 708 HOH A O   1 
HETATM 2427 O  O   . HOH Q 6 .   ? 26.830  18.490  28.250 1.00 30.42 ? 709 HOH A O   1 
HETATM 2428 O  O   . HOH Q 6 .   ? 13.047  2.672   26.652 1.00 28.19 ? 710 HOH A O   1 
HETATM 2429 O  O   . HOH Q 6 .   ? 13.356  6.708   39.506 1.00 27.22 ? 711 HOH A O   1 
HETATM 2430 O  O   . HOH Q 6 .   ? 21.898  13.150  31.533 1.00 31.60 ? 712 HOH A O   1 
HETATM 2431 O  O   . HOH Q 6 .   ? 3.952   -4.710  32.938 1.00 31.64 ? 713 HOH A O   1 
HETATM 2432 O  O   . HOH Q 6 .   ? -7.234  -1.359  30.278 1.00 28.37 ? 714 HOH A O   1 
HETATM 2433 O  O   . HOH Q 6 .   ? 10.492  9.954   23.919 1.00 28.05 ? 715 HOH A O   1 
HETATM 2434 O  O   . HOH Q 6 .   ? -5.710  0.093   26.744 1.00 24.30 ? 716 HOH A O   1 
HETATM 2435 O  O   . HOH Q 6 .   ? -0.587  -0.933  10.361 1.00 30.03 ? 717 HOH A O   1 
HETATM 2436 O  O   . HOH Q 6 .   ? 3.902   -12.562 23.774 1.00 29.62 ? 718 HOH A O   1 
HETATM 2437 O  O   . HOH Q 6 .   ? 14.100  -0.001  36.698 1.00 36.53 ? 719 HOH A O   1 
HETATM 2438 O  O   . HOH Q 6 .   ? 12.522  -12.639 15.657 1.00 32.90 ? 720 HOH A O   1 
HETATM 2439 O  O   . HOH Q 6 .   ? 22.558  30.921  23.806 1.00 26.08 ? 721 HOH A O   1 
HETATM 2440 O  O   . HOH Q 6 .   ? 11.159  -1.389  32.323 1.00 29.06 ? 722 HOH A O   1 
HETATM 2441 O  O   . HOH Q 6 .   ? 4.649   -6.411  28.591 1.00 29.21 ? 723 HOH A O   1 
HETATM 2442 O  O   . HOH Q 6 .   ? -4.047  0.780   9.313  1.00 37.04 ? 724 HOH A O   1 
HETATM 2443 O  O   . HOH Q 6 .   ? 14.069  5.990   42.138 1.00 34.09 ? 725 HOH A O   1 
HETATM 2444 O  O   . HOH Q 6 .   ? -14.336 2.299   22.532 1.00 34.66 ? 726 HOH A O   1 
HETATM 2445 O  O   . HOH Q 6 .   ? 7.779   22.500  39.781 1.00 29.69 ? 727 HOH A O   1 
HETATM 2446 O  O   . HOH Q 6 .   ? 9.255   7.050   43.851 1.00 31.05 ? 728 HOH A O   1 
HETATM 2447 O  O   . HOH Q 6 .   ? -9.014  1.955   11.108 1.00 38.72 ? 729 HOH A O   1 
HETATM 2448 O  O   . HOH Q 6 .   ? -6.704  -12.188 25.231 1.00 34.92 ? 730 HOH A O   1 
HETATM 2449 O  O   . HOH Q 6 .   ? 10.933  2.299   14.970 1.00 32.75 ? 731 HOH A O   1 
HETATM 2450 O  O   . HOH Q 6 .   ? 16.774  33.434  54.503 1.00 36.06 ? 732 HOH A O   1 
HETATM 2451 O  O   . HOH Q 6 .   ? 19.632  30.047  30.109 1.00 36.61 ? 733 HOH A O   1 
HETATM 2452 O  O   . HOH Q 6 .   ? -7.755  -2.069  19.593 1.00 34.37 ? 734 HOH A O   1 
HETATM 2453 O  O   . HOH Q 6 .   ? 11.011  1.415   33.328 1.00 28.25 ? 735 HOH A O   1 
HETATM 2454 O  O   . HOH Q 6 .   ? 13.986  11.541  23.013 1.00 32.16 ? 736 HOH A O   1 
HETATM 2455 O  O   . HOH Q 6 .   ? -10.380 -1.704  19.357 1.00 33.97 ? 737 HOH A O   1 
HETATM 2456 O  O   . HOH Q 6 .   ? -2.278  -11.854 13.012 1.00 37.78 ? 738 HOH A O   1 
HETATM 2457 O  O   . HOH Q 6 .   ? 3.883   7.464   31.372 1.00 30.17 ? 739 HOH A O   1 
HETATM 2458 O  O   . HOH Q 6 .   ? 2.951   -14.263 15.724 1.00 36.00 ? 740 HOH A O   1 
HETATM 2459 O  O   . HOH Q 6 .   ? 19.761  32.229  32.967 1.00 36.93 ? 741 HOH A O   1 
HETATM 2460 O  O   . HOH Q 6 .   ? 6.887   33.085  51.334 1.00 39.49 ? 742 HOH A O   1 
HETATM 2461 O  O   . HOH Q 6 .   ? 14.729  4.756   27.327 1.00 33.32 ? 743 HOH A O   1 
HETATM 2462 O  O   . HOH Q 6 .   ? 12.958  -0.799  21.786 1.00 41.45 ? 744 HOH A O   1 
HETATM 2463 O  O   . HOH Q 6 .   ? 9.930   22.721  43.733 1.00 31.41 ? 745 HOH A O   1 
HETATM 2464 O  O   . HOH Q 6 .   ? 5.312   -6.091  31.199 1.00 29.44 ? 746 HOH A O   1 
HETATM 2465 O  O   . HOH Q 6 .   ? 20.788  32.335  46.411 1.00 32.07 ? 747 HOH A O   1 
HETATM 2466 O  O   . HOH Q 6 .   ? 24.802  17.723  41.112 1.00 40.50 ? 748 HOH A O   1 
HETATM 2467 O  O   . HOH Q 6 .   ? 7.207   -10.939 24.437 1.00 32.95 ? 749 HOH A O   1 
HETATM 2468 O  O   . HOH Q 6 .   ? -7.164  -4.448  17.717 1.00 39.57 ? 750 HOH A O   1 
HETATM 2469 O  O   . HOH Q 6 .   ? -7.865  11.413  20.384 1.00 44.16 ? 751 HOH A O   1 
HETATM 2470 O  O   A HOH Q 6 .   ? 3.713   -12.030 30.778 0.50 27.54 ? 752 HOH A O   1 
HETATM 2471 O  O   B HOH Q 6 .   ? 3.863   -14.277 31.365 0.50 40.04 ? 752 HOH A O   1 
HETATM 2472 O  O   . HOH Q 6 .   ? 16.042  24.969  24.040 1.00 28.06 ? 753 HOH A O   1 
HETATM 2473 O  O   . HOH Q 6 .   ? 6.505   17.217  16.926 1.00 33.31 ? 754 HOH A O   1 
HETATM 2474 O  O   . HOH Q 6 .   ? 3.240   11.527  52.061 1.00 51.57 ? 755 HOH A O   1 
HETATM 2475 O  O   . HOH Q 6 .   ? 8.755   4.154   50.929 1.00 44.83 ? 756 HOH A O   1 
HETATM 2476 O  O   . HOH Q 6 .   ? -13.015 8.439   19.161 1.00 34.82 ? 757 HOH A O   1 
HETATM 2477 O  O   . HOH Q 6 .   ? 14.102  6.678   46.322 1.00 44.77 ? 758 HOH A O   1 
HETATM 2478 O  O   . HOH Q 6 .   ? 18.495  3.852   32.744 1.00 44.78 ? 759 HOH A O   1 
HETATM 2479 O  O   . HOH Q 6 .   ? 9.978   6.075   41.289 1.00 42.30 ? 760 HOH A O   1 
HETATM 2480 O  O   . HOH Q 6 .   ? 12.099  -3.010  34.140 1.00 42.67 ? 761 HOH A O   1 
HETATM 2481 O  O   . HOH Q 6 .   ? 7.914   3.108   38.997 1.00 37.17 ? 762 HOH A O   1 
HETATM 2482 O  O   . HOH Q 6 .   ? -5.551  -11.929 17.614 1.00 43.64 ? 763 HOH A O   1 
HETATM 2483 O  O   A HOH Q 6 .   ? 25.866  16.337  31.872 0.50 23.64 ? 764 HOH A O   1 
HETATM 2484 O  O   B HOH Q 6 .   ? 25.475  15.778  33.791 0.50 35.86 ? 764 HOH A O   1 
HETATM 2485 O  O   . HOH Q 6 .   ? -4.735  -10.702 14.043 1.00 44.76 ? 765 HOH A O   1 
HETATM 2486 O  O   . HOH Q 6 .   ? -0.334  -9.639  10.685 1.00 41.51 ? 766 HOH A O   1 
HETATM 2487 O  O   . HOH Q 6 .   ? 4.718   -13.290 13.713 1.00 39.59 ? 767 HOH A O   1 
HETATM 2488 O  O   . HOH Q 6 .   ? 2.356   -1.360  8.387  1.00 40.91 ? 768 HOH A O   1 
HETATM 2489 O  O   . HOH Q 6 .   ? 0.037   -2.972  8.843  1.00 46.33 ? 769 HOH A O   1 
HETATM 2490 O  O   . HOH Q 6 .   ? -3.948  14.407  11.155 1.00 39.07 ? 770 HOH A O   1 
HETATM 2491 O  O   . HOH Q 6 .   ? 23.377  36.367  32.136 1.00 43.54 ? 771 HOH A O   1 
HETATM 2492 O  O   . HOH Q 6 .   ? -6.842  1.913   8.682  1.00 39.24 ? 772 HOH A O   1 
HETATM 2493 O  O   . HOH Q 6 .   ? 21.047  29.028  22.573 1.00 48.32 ? 773 HOH A O   1 
HETATM 2494 O  O   . HOH Q 6 .   ? 24.311  34.179  36.392 1.00 49.51 ? 774 HOH A O   1 
HETATM 2495 O  O   . HOH Q 6 .   ? -0.999  -1.874  36.745 1.00 50.83 ? 775 HOH A O   1 
HETATM 2496 O  O   . HOH Q 6 .   ? 17.937  39.452  37.109 1.00 52.61 ? 776 HOH A O   1 
HETATM 2497 O  O   . HOH Q 6 .   ? 3.930   21.667  38.065 1.00 52.81 ? 777 HOH A O   1 
HETATM 2498 O  O   . HOH Q 6 .   ? 2.479   20.402  43.146 1.00 40.44 ? 778 HOH A O   1 
HETATM 2499 O  O   . HOH Q 6 .   ? 3.712   -15.127 5.960  1.00 39.76 ? 779 HOH A O   1 
HETATM 2500 O  O   . HOH Q 6 .   ? 24.099  28.998  47.948 1.00 46.19 ? 780 HOH A O   1 
HETATM 2501 O  O   . HOH Q 6 .   ? 23.502  32.919  47.429 1.00 63.45 ? 781 HOH A O   1 
HETATM 2502 O  O   . HOH Q 6 .   ? 9.474   25.637  59.811 1.00 42.96 ? 782 HOH A O   1 
HETATM 2503 O  O   . HOH Q 6 .   ? 18.467  24.673  58.280 1.00 38.54 ? 783 HOH A O   1 
HETATM 2504 O  O   . HOH Q 6 .   ? 16.771  24.202  60.917 1.00 52.96 ? 784 HOH A O   1 
HETATM 2505 O  O   . HOH Q 6 .   ? 19.269  23.336  56.107 1.00 40.22 ? 785 HOH A O   1 
HETATM 2506 O  O   . HOH Q 6 .   ? 10.831  -14.365 11.165 1.00 39.51 ? 786 HOH A O   1 
HETATM 2507 O  O   . HOH Q 6 .   ? 0.074   32.930  49.275 1.00 42.43 ? 787 HOH A O   1 
HETATM 2508 O  O   . HOH Q 6 .   ? -1.193  36.587  44.883 1.00 46.41 ? 788 HOH A O   1 
HETATM 2509 O  O   . HOH Q 6 .   ? 9.854   44.112  38.402 1.00 52.16 ? 789 HOH A O   1 
HETATM 2510 O  O   . HOH Q 6 .   ? 10.631  42.599  36.277 1.00 48.94 ? 790 HOH A O   1 
HETATM 2511 O  O   . HOH Q 6 .   ? 3.621   41.030  38.094 1.00 52.00 ? 791 HOH A O   1 
HETATM 2512 O  O   . HOH Q 6 .   ? 1.579   39.319  38.772 1.00 45.09 ? 792 HOH A O   1 
HETATM 2513 O  O   . HOH Q 6 .   ? 16.492  37.648  31.848 1.00 50.53 ? 793 HOH A O   1 
HETATM 2514 O  O   . HOH Q 6 .   ? 17.736  33.725  31.922 1.00 42.54 ? 794 HOH A O   1 
HETATM 2515 O  O   . HOH Q 6 .   ? -0.781  12.503  34.836 1.00 42.69 ? 795 HOH A O   1 
HETATM 2516 O  O   . HOH Q 6 .   ? 9.483   23.104  31.194 1.00 36.65 ? 796 HOH A O   1 
HETATM 2517 O  O   . HOH Q 6 .   ? 14.296  22.585  19.978 1.00 54.55 ? 797 HOH A O   1 
HETATM 2518 O  O   . HOH Q 6 .   ? 9.980   12.886  18.793 1.00 44.12 ? 798 HOH A O   1 
HETATM 2519 O  O   . HOH Q 6 .   ? -3.126  -14.564 24.535 1.00 47.08 ? 799 HOH A O   1 
HETATM 2520 O  O   . HOH Q 6 .   ? -5.739  -14.539 24.888 1.00 47.29 ? 800 HOH A O   1 
HETATM 2521 O  O   A HOH Q 6 .   ? -8.747  -12.747 23.277 0.50 26.59 ? 801 HOH A O   1 
HETATM 2522 O  O   B HOH Q 6 .   ? -10.779 -11.779 22.743 0.50 31.87 ? 801 HOH A O   1 
HETATM 2523 O  O   . HOH Q 6 .   ? -11.564 -15.833 33.933 1.00 38.08 ? 802 HOH A O   1 
HETATM 2524 O  O   . HOH Q 6 .   ? -11.682 -16.881 30.257 1.00 41.46 ? 803 HOH A O   1 
HETATM 2525 O  O   . HOH Q 6 .   ? -11.331 -16.963 25.630 1.00 52.18 ? 804 HOH A O   1 
HETATM 2526 O  O   . HOH Q 6 .   ? -19.716 -21.446 38.493 1.00 33.27 ? 805 HOH A O   1 
HETATM 2527 O  O   . HOH Q 6 .   ? -15.783 -11.434 22.804 1.00 43.60 ? 806 HOH A O   1 
HETATM 2528 O  O   . HOH Q 6 .   ? -14.943 -0.199  23.622 1.00 40.01 ? 807 HOH A O   1 
HETATM 2529 O  O   . HOH Q 6 .   ? 3.380   17.906  16.319 1.00 36.24 ? 808 HOH A O   1 
HETATM 2530 O  O   . HOH Q 6 .   ? 9.689   21.198  18.189 1.00 49.39 ? 809 HOH A O   1 
HETATM 2531 O  O   . HOH Q 6 .   ? -2.071  28.125  21.658 1.00 53.16 ? 810 HOH A O   1 
HETATM 2532 O  O   . HOH Q 6 .   ? -5.370  16.864  17.538 1.00 46.24 ? 811 HOH A O   1 
HETATM 2533 O  O   . HOH Q 6 .   ? -0.093  17.708  14.148 1.00 48.88 ? 812 HOH A O   1 
HETATM 2534 O  O   . HOH Q 6 .   ? 31.118  20.996  35.359 1.00 36.95 ? 813 HOH A O   1 
HETATM 2535 O  O   . HOH Q 6 .   ? -1.930  10.911  7.915  1.00 50.71 ? 814 HOH A O   1 
HETATM 2536 O  O   . HOH Q 6 .   ? 3.785   12.878  10.816 1.00 43.07 ? 815 HOH A O   1 
HETATM 2537 O  O   . HOH Q 6 .   ? 2.274   5.887   9.004  1.00 45.49 ? 816 HOH A O   1 
HETATM 2538 O  O   . HOH Q 6 .   ? 0.245   -6.692  34.859 1.00 48.66 ? 817 HOH A O   1 
HETATM 2539 O  O   . HOH Q 6 .   ? 0.532   -13.173 32.606 1.00 48.64 ? 818 HOH A O   1 
HETATM 2540 O  O   . HOH Q 6 .   ? -3.188  2.279   35.198 1.00 37.05 ? 819 HOH A O   1 
HETATM 2541 O  O   . HOH Q 6 .   ? 8.688   20.842  41.897 1.00 36.10 ? 820 HOH A O   1 
HETATM 2542 O  O   . HOH Q 6 .   ? 6.059   17.866  40.182 1.00 48.09 ? 821 HOH A O   1 
HETATM 2543 O  O   . HOH Q 6 .   ? 14.344  30.417  59.286 1.00 49.57 ? 822 HOH A O   1 
HETATM 2544 O  O   . HOH Q 6 .   ? 20.732  30.409  54.430 1.00 46.52 ? 823 HOH A O   1 
HETATM 2545 O  O   . HOH Q 6 .   ? 12.067  35.854  49.550 1.00 44.70 ? 824 HOH A O   1 
HETATM 2546 O  O   . HOH Q 6 .   ? -1.621  21.440  31.165 1.00 43.29 ? 825 HOH A O   1 
HETATM 2547 O  O   . HOH Q 6 .   ? 7.918   -10.934 30.045 1.00 56.80 ? 826 HOH A O   1 
HETATM 2548 O  O   . HOH Q 6 .   ? -7.852  -1.158  32.683 1.00 39.38 ? 827 HOH A O   1 
HETATM 2549 O  O   . HOH Q 6 .   ? 22.386  31.407  30.840 1.00 39.50 ? 828 HOH A O   1 
HETATM 2550 O  O   . HOH Q 6 .   ? 15.131  30.252  23.882 1.00 49.86 ? 829 HOH A O   1 
HETATM 2551 O  O   . HOH Q 6 .   ? 19.649  12.233  34.394 1.00 44.44 ? 830 HOH A O   1 
HETATM 2552 O  O   . HOH Q 6 .   ? 6.022   19.601  42.787 1.00 48.14 ? 831 HOH A O   1 
HETATM 2553 O  O   . HOH Q 6 .   ? 26.100  29.834  41.880 1.00 44.02 ? 832 HOH A O   1 
HETATM 2554 O  O   . HOH Q 6 .   ? -0.914  35.776  37.512 1.00 47.66 ? 833 HOH A O   1 
HETATM 2555 O  O   . HOH Q 6 .   ? 18.746  36.153  32.147 1.00 58.87 ? 834 HOH A O   1 
HETATM 2556 O  O   . HOH Q 6 .   ? 0.250   29.182  24.104 1.00 49.98 ? 835 HOH A O   1 
HETATM 2557 O  O   . HOH Q 6 .   ? 12.451  7.721   20.554 1.00 39.04 ? 836 HOH A O   1 
HETATM 2558 O  O   . HOH Q 6 .   ? -0.656  24.658  17.067 1.00 56.21 ? 837 HOH A O   1 
HETATM 2559 O  O   . HOH Q 6 .   ? 6.526   7.131   9.654  1.00 57.16 ? 838 HOH A O   1 
HETATM 2560 O  O   . HOH Q 6 .   ? 20.151  17.487  27.191 1.00 42.10 ? 839 HOH A O   1 
HETATM 2561 O  O   . HOH Q 6 .   ? -5.928  -0.446  19.109 1.00 41.76 ? 840 HOH A O   1 
HETATM 2562 O  O   . HOH Q 6 .   ? -5.042  -9.080  11.823 1.00 45.63 ? 841 HOH A O   1 
HETATM 2563 O  O   . HOH Q 6 .   ? 7.847   -3.836  6.076  1.00 51.72 ? 842 HOH A O   1 
HETATM 2564 O  O   . HOH Q 6 .   ? -13.104 2.035   17.558 1.00 56.43 ? 843 HOH A O   1 
HETATM 2565 O  O   . HOH Q 6 .   ? 5.920   5.272   41.808 1.00 54.15 ? 844 HOH A O   1 
HETATM 2566 O  O   . HOH Q 6 .   ? 7.706   -12.072 21.929 1.00 50.50 ? 845 HOH A O   1 
HETATM 2567 O  O   . HOH Q 6 .   ? 14.560  7.412   24.209 1.00 47.70 ? 846 HOH A O   1 
HETATM 2568 O  O   . HOH Q 6 .   ? 18.098  33.066  29.406 1.00 47.40 ? 847 HOH A O   1 
HETATM 2569 O  O   . HOH Q 6 .   ? -11.793 0.627   13.429 1.00 47.56 ? 848 HOH A O   1 
HETATM 2570 O  O   . HOH Q 6 .   ? 1.741   -6.753  10.509 1.00 47.87 ? 849 HOH A O   1 
HETATM 2571 O  O   . HOH Q 6 .   ? 19.738  4.567   37.416 1.00 52.67 ? 850 HOH A O   1 
HETATM 2572 O  O   . HOH Q 6 .   ? -0.261  18.868  45.958 1.00 51.13 ? 851 HOH A O   1 
HETATM 2573 O  O   . HOH Q 6 .   ? 19.163  36.085  47.841 1.00 60.06 ? 852 HOH A O   1 
HETATM 2574 O  O   . HOH Q 6 .   ? 21.276  36.110  46.342 1.00 60.75 ? 853 HOH A O   1 
HETATM 2575 O  O   . HOH Q 6 .   ? -1.773  -8.626  33.753 1.00 60.06 ? 854 HOH A O   1 
HETATM 2576 O  O   . HOH Q 6 .   ? -0.607  -5.337  9.868  1.00 59.18 ? 855 HOH A O   1 
HETATM 2577 O  O   . HOH Q 6 .   ? 20.455  17.603  24.538 0.50 43.17 ? 856 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   209 ?   ?   ?   A . n 
A 1 2   GLY 2   210 ?   ?   ?   A . n 
A 1 3   SER 3   211 ?   ?   ?   A . n 
A 1 4   SER 4   212 ?   ?   ?   A . n 
A 1 5   HIS 5   213 ?   ?   ?   A . n 
A 1 6   HIS 6   214 ?   ?   ?   A . n 
A 1 7   HIS 7   215 ?   ?   ?   A . n 
A 1 8   HIS 8   216 ?   ?   ?   A . n 
A 1 9   HIS 9   217 ?   ?   ?   A . n 
A 1 10  HIS 10  218 ?   ?   ?   A . n 
A 1 11  SER 11  219 ?   ?   ?   A . n 
A 1 12  SER 12  220 ?   ?   ?   A . n 
A 1 13  GLY 13  221 ?   ?   ?   A . n 
A 1 14  LEU 14  222 ?   ?   ?   A . n 
A 1 15  VAL 15  223 ?   ?   ?   A . n 
A 1 16  PRO 16  224 ?   ?   ?   A . n 
A 1 17  ARG 17  225 ?   ?   ?   A . n 
A 1 18  GLY 18  226 ?   ?   ?   A . n 
A 1 19  SER 19  227 ?   ?   ?   A . n 
A 1 20  ASP 20  228 ?   ?   ?   A . n 
A 1 21  LEU 21  229 ?   ?   ?   A . n 
A 1 22  GLN 22  230 ?   ?   ?   A . n 
A 1 23  GLU 23  231 ?   ?   ?   A . n 
A 1 24  ASP 24  232 ?   ?   ?   A . n 
A 1 25  GLU 25  233 ?   ?   ?   A . n 
A 1 26  ASP 26  234 ?   ?   ?   A . n 
A 1 27  GLY 27  235 ?   ?   ?   A . n 
A 1 28  VAL 28  236 ?   ?   ?   A . n 
A 1 29  TYR 29  237 ?   ?   ?   A . n 
A 1 30  PHE 30  238 ?   ?   ?   A . n 
A 1 31  SER 31  239 ?   ?   ?   A . n 
A 1 32  SER 32  240 ?   ?   ?   A . n 
A 1 33  TYR 33  241 ?   ?   ?   A . n 
A 1 34  GLY 34  242 ?   ?   ?   A . n 
A 1 35  HIS 35  243 ?   ?   ?   A . n 
A 1 36  TYR 36  244 244 TYR TYR A . n 
A 1 37  GLY 37  245 245 GLY GLY A . n 
A 1 38  ILE 38  246 246 ILE ILE A . n 
A 1 39  HIS 39  247 247 HIS HIS A . n 
A 1 40  GLU 40  248 248 GLU GLU A . n 
A 1 41  GLU 41  249 249 GLU GLU A . n 
A 1 42  MET 42  250 250 MET MET A . n 
A 1 43  LEU 43  251 251 LEU LEU A . n 
A 1 44  LYS 44  252 252 LYS LYS A . n 
A 1 45  ASP 45  253 253 ASP ASP A . n 
A 1 46  LYS 46  254 254 LYS LYS A . n 
A 1 47  ILE 47  255 255 ILE ILE A . n 
A 1 48  ARG 48  256 256 ARG ARG A . n 
A 1 49  THR 49  257 257 THR THR A . n 
A 1 50  GLU 50  258 258 GLU GLU A . n 
A 1 51  SER 51  259 259 SER SER A . n 
A 1 52  TYR 52  260 260 TYR TYR A . n 
A 1 53  ARG 53  261 261 ARG ARG A . n 
A 1 54  ASP 54  262 262 ASP ASP A . n 
A 1 55  PHE 55  263 263 PHE PHE A . n 
A 1 56  ILE 56  264 264 ILE ILE A . n 
A 1 57  TYR 57  265 265 TYR TYR A . n 
A 1 58  GLN 58  266 266 GLN GLN A . n 
A 1 59  ASN 59  267 267 ASN ASN A . n 
A 1 60  PRO 60  268 268 PRO PRO A . n 
A 1 61  HIS 61  269 269 HIS HIS A . n 
A 1 62  ILE 62  270 270 ILE ILE A . n 
A 1 63  PHE 63  271 271 PHE PHE A . n 
A 1 64  LYS 64  272 272 LYS LYS A . n 
A 1 65  ASP 65  273 273 ASP ASP A . n 
A 1 66  LYS 66  274 274 LYS LYS A . n 
A 1 67  VAL 67  275 275 VAL VAL A . n 
A 1 68  VAL 68  276 276 VAL VAL A . n 
A 1 69  LEU 69  277 277 LEU LEU A . n 
A 1 70  ASP 70  278 278 ASP ASP A . n 
A 1 71  VAL 71  279 279 VAL VAL A . n 
A 1 72  GLY 72  280 280 GLY GLY A . n 
A 1 73  CYS 73  281 281 CYS CYS A . n 
A 1 74  GLY 74  282 282 GLY GLY A . n 
A 1 75  THR 75  283 283 THR THR A . n 
A 1 76  GLY 76  284 284 GLY GLY A . n 
A 1 77  ILE 77  285 285 ILE ILE A . n 
A 1 78  LEU 78  286 286 LEU LEU A . n 
A 1 79  SER 79  287 287 SER SER A . n 
A 1 80  MET 80  288 288 MET MET A . n 
A 1 81  PHE 81  289 289 PHE PHE A . n 
A 1 82  ALA 82  290 290 ALA ALA A . n 
A 1 83  ALA 83  291 291 ALA ALA A . n 
A 1 84  LYS 84  292 292 LYS LYS A . n 
A 1 85  ALA 85  293 293 ALA ALA A . n 
A 1 86  GLY 86  294 294 GLY GLY A . n 
A 1 87  ALA 87  295 295 ALA ALA A . n 
A 1 88  LYS 88  296 296 LYS LYS A . n 
A 1 89  LYS 89  297 297 LYS LYS A . n 
A 1 90  VAL 90  298 298 VAL VAL A . n 
A 1 91  LEU 91  299 299 LEU LEU A . n 
A 1 92  GLY 92  300 300 GLY GLY A . n 
A 1 93  VAL 93  301 301 VAL VAL A . n 
A 1 94  ASP 94  302 302 ASP ASP A . n 
A 1 95  GLN 95  303 303 GLN GLN A . n 
A 1 96  SER 96  304 304 SER SER A . n 
A 1 97  GLU 97  305 305 GLU GLU A . n 
A 1 98  ILE 98  306 306 ILE ILE A . n 
A 1 99  LEU 99  307 307 LEU LEU A . n 
A 1 100 TYR 100 308 308 TYR TYR A . n 
A 1 101 GLN 101 309 309 GLN GLN A . n 
A 1 102 ALA 102 310 310 ALA ALA A . n 
A 1 103 MET 103 311 311 MET MET A . n 
A 1 104 ASP 104 312 312 ASP ASP A . n 
A 1 105 ILE 105 313 313 ILE ILE A . n 
A 1 106 ILE 106 314 314 ILE ILE A . n 
A 1 107 ARG 107 315 315 ARG ARG A . n 
A 1 108 LEU 108 316 316 LEU LEU A . n 
A 1 109 ASN 109 317 317 ASN ASN A . n 
A 1 110 LYS 110 318 318 LYS LYS A . n 
A 1 111 LEU 111 319 319 LEU LEU A . n 
A 1 112 GLU 112 320 320 GLU GLU A . n 
A 1 113 ASP 113 321 321 ASP ASP A . n 
A 1 114 THR 114 322 322 THR THR A . n 
A 1 115 ILE 115 323 323 ILE ILE A . n 
A 1 116 THR 116 324 324 THR THR A . n 
A 1 117 LEU 117 325 325 LEU LEU A . n 
A 1 118 ILE 118 326 326 ILE ILE A . n 
A 1 119 LYS 119 327 327 LYS LYS A . n 
A 1 120 GLY 120 328 328 GLY GLY A . n 
A 1 121 LYS 121 329 329 LYS LYS A . n 
A 1 122 ILE 122 330 330 ILE ILE A . n 
A 1 123 GLU 123 331 331 GLU GLU A . n 
A 1 124 GLU 124 332 332 GLU GLU A . n 
A 1 125 VAL 125 333 333 VAL VAL A . n 
A 1 126 HIS 126 334 334 HIS HIS A . n 
A 1 127 LEU 127 335 335 LEU LEU A . n 
A 1 128 PRO 128 336 336 PRO PRO A . n 
A 1 129 VAL 129 337 337 VAL VAL A . n 
A 1 130 GLU 130 338 338 GLU GLU A . n 
A 1 131 LYS 131 339 339 LYS LYS A . n 
A 1 132 VAL 132 340 340 VAL VAL A . n 
A 1 133 ASP 133 341 341 ASP ASP A . n 
A 1 134 VAL 134 342 342 VAL VAL A . n 
A 1 135 ILE 135 343 343 ILE ILE A . n 
A 1 136 ILE 136 344 344 ILE ILE A . n 
A 1 137 SER 137 345 345 SER SER A . n 
A 1 138 GLU 138 346 346 GLU GLU A . n 
A 1 139 TRP 139 347 347 TRP TRP A . n 
A 1 140 MET 140 348 348 MET MET A . n 
A 1 141 GLY 141 349 349 GLY GLY A . n 
A 1 142 TYR 142 350 350 TYR TYR A . n 
A 1 143 PHE 143 351 351 PHE PHE A . n 
A 1 144 LEU 144 352 352 LEU LEU A . n 
A 1 145 LEU 145 353 353 LEU LEU A . n 
A 1 146 PHE 146 354 354 PHE PHE A . n 
A 1 147 GLU 147 355 355 GLU GLU A . n 
A 1 148 SER 148 356 356 SER SER A . n 
A 1 149 MET 149 357 357 MET MET A . n 
A 1 150 LEU 150 358 358 LEU LEU A . n 
A 1 151 ASP 151 359 359 ASP ASP A . n 
A 1 152 SER 152 360 360 SER SER A . n 
A 1 153 VAL 153 361 361 VAL VAL A . n 
A 1 154 LEU 154 362 362 LEU LEU A . n 
A 1 155 TYR 155 363 363 TYR TYR A . n 
A 1 156 ALA 156 364 364 ALA ALA A . n 
A 1 157 LYS 157 365 365 LYS LYS A . n 
A 1 158 ASN 158 366 366 ASN ASN A . n 
A 1 159 LYS 159 367 367 LYS LYS A . n 
A 1 160 TYR 160 368 368 TYR TYR A . n 
A 1 161 LEU 161 369 369 LEU LEU A . n 
A 1 162 ALA 162 370 370 ALA ALA A . n 
A 1 163 LYS 163 371 371 LYS LYS A . n 
A 1 164 GLY 164 372 372 GLY GLY A . n 
A 1 165 GLY 165 373 373 GLY GLY A . n 
A 1 166 SER 166 374 374 SER SER A . n 
A 1 167 VAL 167 375 375 VAL VAL A . n 
A 1 168 TYR 168 376 376 TYR TYR A . n 
A 1 169 PRO 169 377 377 PRO PRO A . n 
A 1 170 ASP 170 378 378 ASP ASP A . n 
A 1 171 ILE 171 379 379 ILE ILE A . n 
A 1 172 CYS 172 380 380 CYS CYS A . n 
A 1 173 THR 173 381 381 THR THR A . n 
A 1 174 ILE 174 382 382 ILE ILE A . n 
A 1 175 SER 175 383 383 SER SER A . n 
A 1 176 LEU 176 384 384 LEU LEU A . n 
A 1 177 VAL 177 385 385 VAL VAL A . n 
A 1 178 ALA 178 386 386 ALA ALA A . n 
A 1 179 VAL 179 387 387 VAL VAL A . n 
A 1 180 SER 180 388 388 SER SER A . n 
A 1 181 ASP 181 389 389 ASP ASP A . n 
A 1 182 VAL 182 390 390 VAL VAL A . n 
A 1 183 ASN 183 391 391 ASN ASN A . n 
A 1 184 LYS 184 392 392 LYS LYS A . n 
A 1 185 HIS 185 393 393 HIS HIS A . n 
A 1 186 ALA 186 394 394 ALA ALA A . n 
A 1 187 ASP 187 395 395 ASP ASP A . n 
A 1 188 ARG 188 396 396 ARG ARG A . n 
A 1 189 ILE 189 397 397 ILE ILE A . n 
A 1 190 ALA 190 398 398 ALA ALA A . n 
A 1 191 PHE 191 399 399 PHE PHE A . n 
A 1 192 TRP 192 400 400 TRP TRP A . n 
A 1 193 ASP 193 401 401 ASP ASP A . n 
A 1 194 ASP 194 402 402 ASP ASP A . n 
A 1 195 VAL 195 403 403 VAL VAL A . n 
A 1 196 TYR 196 404 404 TYR TYR A . n 
A 1 197 GLY 197 405 405 GLY GLY A . n 
A 1 198 PHE 198 406 406 PHE PHE A . n 
A 1 199 LYS 199 407 407 LYS LYS A . n 
A 1 200 MET 200 408 408 MET MET A . n 
A 1 201 SER 201 409 409 SER SER A . n 
A 1 202 CYS 202 410 410 CYS CYS A . n 
A 1 203 MET 203 411 411 MET MET A . n 
A 1 204 LYS 204 412 412 LYS LYS A . n 
A 1 205 LYS 205 413 413 LYS LYS A . n 
A 1 206 ALA 206 414 414 ALA ALA A . n 
A 1 207 VAL 207 415 415 VAL VAL A . n 
A 1 208 ILE 208 416 416 ILE ILE A . n 
A 1 209 PRO 209 417 417 PRO PRO A . n 
A 1 210 GLU 210 418 418 GLU GLU A . n 
A 1 211 ALA 211 419 419 ALA ALA A . n 
A 1 212 VAL 212 420 420 VAL VAL A . n 
A 1 213 VAL 213 421 421 VAL VAL A . n 
A 1 214 GLU 214 422 422 GLU GLU A . n 
A 1 215 VAL 215 423 423 VAL VAL A . n 
A 1 216 LEU 216 424 424 LEU LEU A . n 
A 1 217 ASP 217 425 425 ASP ASP A . n 
A 1 218 PRO 218 426 426 PRO PRO A . n 
A 1 219 LYS 219 427 427 LYS LYS A . n 
A 1 220 THR 220 428 428 THR THR A . n 
A 1 221 LEU 221 429 429 LEU LEU A . n 
A 1 222 ILE 222 430 430 ILE ILE A . n 
A 1 223 SER 223 431 431 SER SER A . n 
A 1 224 GLU 224 432 432 GLU GLU A . n 
A 1 225 PRO 225 433 433 PRO PRO A . n 
A 1 226 CYS 226 434 434 CYS CYS A . n 
A 1 227 GLY 227 435 435 GLY GLY A . n 
A 1 228 ILE 228 436 436 ILE ILE A . n 
A 1 229 LYS 229 437 437 LYS LYS A . n 
A 1 230 HIS 230 438 438 HIS HIS A . n 
A 1 231 ILE 231 439 439 ILE ILE A . n 
A 1 232 ASP 232 440 440 ASP ASP A . n 
A 1 233 CYS 233 441 441 CYS CYS A . n 
A 1 234 HIS 234 442 442 HIS HIS A . n 
A 1 235 THR 235 443 443 THR THR A . n 
A 1 236 THR 236 444 444 THR THR A . n 
A 1 237 SER 237 445 445 SER SER A . n 
A 1 238 ILE 238 446 446 ILE ILE A . n 
A 1 239 SER 239 447 447 SER SER A . n 
A 1 240 ASP 240 448 448 ASP ASP A . n 
A 1 241 LEU 241 449 449 LEU LEU A . n 
A 1 242 GLU 242 450 450 GLU GLU A . n 
A 1 243 PHE 243 451 451 PHE PHE A . n 
A 1 244 SER 244 452 452 SER SER A . n 
A 1 245 SER 245 453 453 SER SER A . n 
A 1 246 ASP 246 454 454 ASP ASP A . n 
A 1 247 PHE 247 455 455 PHE PHE A . n 
A 1 248 THR 248 456 456 THR THR A . n 
A 1 249 LEU 249 457 457 LEU LEU A . n 
A 1 250 LYS 250 458 458 LYS LYS A . n 
A 1 251 ILE 251 459 459 ILE ILE A . n 
A 1 252 THR 252 460 460 THR THR A . n 
A 1 253 ARG 253 461 461 ARG ARG A . n 
A 1 254 THR 254 462 462 THR THR A . n 
A 1 255 SER 255 463 463 SER SER A . n 
A 1 256 MET 256 464 464 MET MET A . n 
A 1 257 CYS 257 465 465 CYS CYS A . n 
A 1 258 THR 258 466 466 THR THR A . n 
A 1 259 ALA 259 467 467 ALA ALA A . n 
A 1 260 ILE 260 468 468 ILE ILE A . n 
A 1 261 ALA 261 469 469 ALA ALA A . n 
A 1 262 GLY 262 470 470 GLY GLY A . n 
A 1 263 TYR 263 471 471 TYR TYR A . n 
A 1 264 PHE 264 472 472 PHE PHE A . n 
A 1 265 ASP 265 473 473 ASP ASP A . n 
A 1 266 ILE 266 474 474 ILE ILE A . n 
A 1 267 TYR 267 475 475 TYR TYR A . n 
A 1 268 PHE 268 476 476 PHE PHE A . n 
A 1 269 GLU 269 477 477 GLU GLU A . n 
A 1 270 LYS 270 478 478 LYS LYS A . n 
A 1 271 ASN 271 479 479 ASN ASN A . n 
A 1 272 CYS 272 480 480 CYS CYS A . n 
A 1 273 HIS 273 481 481 HIS HIS A . n 
A 1 274 ASN 274 482 482 ASN ASN A . n 
A 1 275 ARG 275 483 483 ARG ARG A . n 
A 1 276 VAL 276 484 484 VAL VAL A . n 
A 1 277 VAL 277 485 485 VAL VAL A . n 
A 1 278 PHE 278 486 486 PHE PHE A . n 
A 1 279 SER 279 487 487 SER SER A . n 
A 1 280 THR 280 488 488 THR THR A . n 
A 1 281 GLY 281 489 489 GLY GLY A . n 
A 1 282 PRO 282 490 490 PRO PRO A . n 
A 1 283 GLN 283 491 491 GLN GLN A . n 
A 1 284 SER 284 492 492 SER SER A . n 
A 1 285 THR 285 493 493 THR THR A . n 
A 1 286 LYS 286 494 494 LYS LYS A . n 
A 1 287 THR 287 495 495 THR THR A . n 
A 1 288 HIS 288 496 496 HIS HIS A . n 
A 1 289 TRP 289 497 497 TRP TRP A . n 
A 1 290 LYS 290 498 498 LYS LYS A . n 
A 1 291 GLN 291 499 499 GLN GLN A . n 
A 1 292 THR 292 500 500 THR THR A . n 
A 1 293 VAL 293 501 501 VAL VAL A . n 
A 1 294 PHE 294 502 502 PHE PHE A . n 
A 1 295 LEU 295 503 503 LEU LEU A . n 
A 1 296 LEU 296 504 504 LEU LEU A . n 
A 1 297 GLU 297 505 505 GLU GLU A . n 
A 1 298 LYS 298 506 506 LYS LYS A . n 
A 1 299 PRO 299 507 507 PRO PRO A . n 
A 1 300 PHE 300 508 508 PHE PHE A . n 
A 1 301 SER 301 509 509 SER SER A . n 
A 1 302 VAL 302 510 510 VAL VAL A . n 
A 1 303 LYS 303 511 511 LYS LYS A . n 
A 1 304 ALA 304 512 512 ALA ALA A . n 
A 1 305 GLY 305 513 513 GLY GLY A . n 
A 1 306 GLU 306 514 514 GLU GLU A . n 
A 1 307 ALA 307 515 515 ALA ALA A . n 
A 1 308 LEU 308 516 516 LEU LEU A . n 
A 1 309 LYS 309 517 517 LYS LYS A . n 
A 1 310 GLY 310 518 518 GLY GLY A . n 
A 1 311 LYS 311 519 519 LYS LYS A . n 
A 1 312 VAL 312 520 520 VAL VAL A . n 
A 1 313 THR 313 521 521 THR THR A . n 
A 1 314 VAL 314 522 522 VAL VAL A . n 
A 1 315 HIS 315 523 523 HIS HIS A . n 
A 1 316 LYS 316 524 524 LYS LYS A . n 
A 1 317 ASN 317 525 525 ASN ASN A . n 
A 1 318 LYS 318 526 ?   ?   ?   A . n 
A 1 319 LYS 319 527 ?   ?   ?   A . n 
A 1 320 ASP 320 528 ?   ?   ?   A . n 
A 1 321 PRO 321 529 ?   ?   ?   A . n 
A 1 322 ARG 322 530 ?   ?   ?   A . n 
A 1 323 SER 323 531 531 SER SER A . n 
A 1 324 LEU 324 532 532 LEU LEU A . n 
A 1 325 THR 325 533 533 THR THR A . n 
A 1 326 VAL 326 534 534 VAL VAL A . n 
A 1 327 THR 327 535 535 THR THR A . n 
A 1 328 LEU 328 536 536 LEU LEU A . n 
A 1 329 THR 329 537 537 THR THR A . n 
A 1 330 LEU 330 538 538 LEU LEU A . n 
A 1 331 ASN 331 539 539 ASN ASN A . n 
A 1 332 ASN 332 540 540 ASN ASN A . n 
A 1 333 SER 333 541 541 SER SER A . n 
A 1 334 THR 334 542 542 THR THR A . n 
A 1 335 GLN 335 543 543 GLN GLN A . n 
A 1 336 THR 336 544 544 THR THR A . n 
A 1 337 TYR 337 545 545 TYR TYR A . n 
A 1 338 GLY 338 546 546 GLY GLY A . n 
A 1 339 LEU 339 547 547 LEU LEU A . n 
A 1 340 GLN 340 548 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 3BQ 1   601 1000 3BQ 3BQ A . 
C 3 GOL 1   602 3001 GOL GOL A . 
D 4 CL  1   603 1000 CL  CL  A . 
E 5 UNX 1   604 1    UNX UNX A . 
F 5 UNX 1   605 2    UNX UNX A . 
G 5 UNX 1   606 3    UNX UNX A . 
H 5 UNX 1   607 4    UNX UNX A . 
I 5 UNX 1   608 5    UNX UNX A . 
J 5 UNX 1   609 6    UNX UNX A . 
K 5 UNX 1   610 7    UNX UNX A . 
L 5 UNX 1   611 8    UNX UNX A . 
M 5 UNX 1   612 9    UNX UNX A . 
N 5 UNX 1   613 10   UNX UNX A . 
O 5 UNX 1   614 11   UNX UNX A . 
P 5 UNX 1   615 12   UNX UNX A . 
Q 6 HOH 1   701 1    HOH HOH A . 
Q 6 HOH 2   702 2    HOH HOH A . 
Q 6 HOH 3   703 3    HOH HOH A . 
Q 6 HOH 4   704 4    HOH HOH A . 
Q 6 HOH 5   705 5    HOH HOH A . 
Q 6 HOH 6   706 6    HOH HOH A . 
Q 6 HOH 7   707 7    HOH HOH A . 
Q 6 HOH 8   708 8    HOH HOH A . 
Q 6 HOH 9   709 9    HOH HOH A . 
Q 6 HOH 10  710 10   HOH HOH A . 
Q 6 HOH 11  711 11   HOH HOH A . 
Q 6 HOH 12  712 12   HOH HOH A . 
Q 6 HOH 13  713 13   HOH HOH A . 
Q 6 HOH 14  714 14   HOH HOH A . 
Q 6 HOH 15  715 15   HOH HOH A . 
Q 6 HOH 16  716 16   HOH HOH A . 
Q 6 HOH 17  717 17   HOH HOH A . 
Q 6 HOH 18  718 18   HOH HOH A . 
Q 6 HOH 19  719 19   HOH HOH A . 
Q 6 HOH 20  720 20   HOH HOH A . 
Q 6 HOH 21  721 21   HOH HOH A . 
Q 6 HOH 22  722 22   HOH HOH A . 
Q 6 HOH 23  723 23   HOH HOH A . 
Q 6 HOH 24  724 24   HOH HOH A . 
Q 6 HOH 25  725 25   HOH HOH A . 
Q 6 HOH 26  726 26   HOH HOH A . 
Q 6 HOH 27  727 27   HOH HOH A . 
Q 6 HOH 28  728 28   HOH HOH A . 
Q 6 HOH 29  729 29   HOH HOH A . 
Q 6 HOH 30  730 30   HOH HOH A . 
Q 6 HOH 31  731 31   HOH HOH A . 
Q 6 HOH 32  732 32   HOH HOH A . 
Q 6 HOH 33  733 33   HOH HOH A . 
Q 6 HOH 34  734 34   HOH HOH A . 
Q 6 HOH 35  735 35   HOH HOH A . 
Q 6 HOH 36  736 36   HOH HOH A . 
Q 6 HOH 37  737 37   HOH HOH A . 
Q 6 HOH 38  738 38   HOH HOH A . 
Q 6 HOH 39  739 39   HOH HOH A . 
Q 6 HOH 40  740 40   HOH HOH A . 
Q 6 HOH 41  741 41   HOH HOH A . 
Q 6 HOH 42  742 42   HOH HOH A . 
Q 6 HOH 43  743 43   HOH HOH A . 
Q 6 HOH 44  744 44   HOH HOH A . 
Q 6 HOH 45  745 45   HOH HOH A . 
Q 6 HOH 46  746 46   HOH HOH A . 
Q 6 HOH 47  747 47   HOH HOH A . 
Q 6 HOH 48  748 48   HOH HOH A . 
Q 6 HOH 49  749 49   HOH HOH A . 
Q 6 HOH 50  750 50   HOH HOH A . 
Q 6 HOH 51  751 51   HOH HOH A . 
Q 6 HOH 52  752 52   HOH HOH A . 
Q 6 HOH 53  753 53   HOH HOH A . 
Q 6 HOH 54  754 54   HOH HOH A . 
Q 6 HOH 55  755 55   HOH HOH A . 
Q 6 HOH 56  756 56   HOH HOH A . 
Q 6 HOH 57  757 57   HOH HOH A . 
Q 6 HOH 58  758 58   HOH HOH A . 
Q 6 HOH 59  759 59   HOH HOH A . 
Q 6 HOH 60  760 60   HOH HOH A . 
Q 6 HOH 61  761 61   HOH HOH A . 
Q 6 HOH 62  762 62   HOH HOH A . 
Q 6 HOH 63  763 63   HOH HOH A . 
Q 6 HOH 64  764 64   HOH HOH A . 
Q 6 HOH 65  765 65   HOH HOH A . 
Q 6 HOH 66  766 66   HOH HOH A . 
Q 6 HOH 67  767 67   HOH HOH A . 
Q 6 HOH 68  768 68   HOH HOH A . 
Q 6 HOH 69  769 69   HOH HOH A . 
Q 6 HOH 70  770 70   HOH HOH A . 
Q 6 HOH 71  771 71   HOH HOH A . 
Q 6 HOH 72  772 72   HOH HOH A . 
Q 6 HOH 73  773 73   HOH HOH A . 
Q 6 HOH 74  774 74   HOH HOH A . 
Q 6 HOH 75  775 75   HOH HOH A . 
Q 6 HOH 76  776 76   HOH HOH A . 
Q 6 HOH 77  777 77   HOH HOH A . 
Q 6 HOH 78  778 78   HOH HOH A . 
Q 6 HOH 79  779 79   HOH HOH A . 
Q 6 HOH 80  780 80   HOH HOH A . 
Q 6 HOH 81  781 81   HOH HOH A . 
Q 6 HOH 82  782 82   HOH HOH A . 
Q 6 HOH 83  783 83   HOH HOH A . 
Q 6 HOH 84  784 84   HOH HOH A . 
Q 6 HOH 85  785 85   HOH HOH A . 
Q 6 HOH 86  786 86   HOH HOH A . 
Q 6 HOH 87  787 87   HOH HOH A . 
Q 6 HOH 88  788 88   HOH HOH A . 
Q 6 HOH 89  789 89   HOH HOH A . 
Q 6 HOH 90  790 90   HOH HOH A . 
Q 6 HOH 91  791 91   HOH HOH A . 
Q 6 HOH 92  792 92   HOH HOH A . 
Q 6 HOH 93  793 93   HOH HOH A . 
Q 6 HOH 94  794 94   HOH HOH A . 
Q 6 HOH 95  795 95   HOH HOH A . 
Q 6 HOH 96  796 96   HOH HOH A . 
Q 6 HOH 97  797 97   HOH HOH A . 
Q 6 HOH 98  798 98   HOH HOH A . 
Q 6 HOH 99  799 99   HOH HOH A . 
Q 6 HOH 100 800 100  HOH HOH A . 
Q 6 HOH 101 801 101  HOH HOH A . 
Q 6 HOH 102 802 102  HOH HOH A . 
Q 6 HOH 103 803 103  HOH HOH A . 
Q 6 HOH 104 804 104  HOH HOH A . 
Q 6 HOH 105 805 105  HOH HOH A . 
Q 6 HOH 106 806 106  HOH HOH A . 
Q 6 HOH 107 807 107  HOH HOH A . 
Q 6 HOH 108 808 108  HOH HOH A . 
Q 6 HOH 109 809 109  HOH HOH A . 
Q 6 HOH 110 810 110  HOH HOH A . 
Q 6 HOH 111 811 111  HOH HOH A . 
Q 6 HOH 112 812 112  HOH HOH A . 
Q 6 HOH 113 813 113  HOH HOH A . 
Q 6 HOH 114 814 114  HOH HOH A . 
Q 6 HOH 115 815 115  HOH HOH A . 
Q 6 HOH 116 816 116  HOH HOH A . 
Q 6 HOH 117 817 117  HOH HOH A . 
Q 6 HOH 118 818 118  HOH HOH A . 
Q 6 HOH 119 819 119  HOH HOH A . 
Q 6 HOH 120 820 120  HOH HOH A . 
Q 6 HOH 121 821 121  HOH HOH A . 
Q 6 HOH 122 822 122  HOH HOH A . 
Q 6 HOH 123 823 123  HOH HOH A . 
Q 6 HOH 124 824 124  HOH HOH A . 
Q 6 HOH 125 825 125  HOH HOH A . 
Q 6 HOH 126 826 126  HOH HOH A . 
Q 6 HOH 127 827 127  HOH HOH A . 
Q 6 HOH 128 828 128  HOH HOH A . 
Q 6 HOH 129 829 129  HOH HOH A . 
Q 6 HOH 130 830 130  HOH HOH A . 
Q 6 HOH 131 831 131  HOH HOH A . 
Q 6 HOH 132 832 132  HOH HOH A . 
Q 6 HOH 133 833 133  HOH HOH A . 
Q 6 HOH 134 834 134  HOH HOH A . 
Q 6 HOH 135 835 135  HOH HOH A . 
Q 6 HOH 136 836 136  HOH HOH A . 
Q 6 HOH 137 837 137  HOH HOH A . 
Q 6 HOH 138 838 138  HOH HOH A . 
Q 6 HOH 139 839 139  HOH HOH A . 
Q 6 HOH 140 840 140  HOH HOH A . 
Q 6 HOH 141 841 141  HOH HOH A . 
Q 6 HOH 142 842 142  HOH HOH A . 
Q 6 HOH 143 843 143  HOH HOH A . 
Q 6 HOH 144 844 144  HOH HOH A . 
Q 6 HOH 145 845 145  HOH HOH A . 
Q 6 HOH 146 846 146  HOH HOH A . 
Q 6 HOH 147 847 147  HOH HOH A . 
Q 6 HOH 148 848 148  HOH HOH A . 
Q 6 HOH 149 849 149  HOH HOH A . 
Q 6 HOH 150 850 150  HOH HOH A . 
Q 6 HOH 151 851 151  HOH HOH A . 
Q 6 HOH 152 852 152  HOH HOH A . 
Q 6 HOH 153 853 153  HOH HOH A . 
Q 6 HOH 154 854 154  HOH HOH A . 
Q 6 HOH 155 855 155  HOH HOH A . 
Q 6 HOH 156 856 157  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4070  ? 
1 MORE         -57   ? 
1 'SSA (A^2)'  25030 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 86.4590000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-09-17 
2 'Structure model' 1 1 2018-05-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.journal_volume'          
7  2 'Structure model' '_citation.page_first'              
8  2 'Structure model' '_citation.page_last'               
9  2 'Structure model' '_citation.pdbx_database_id_DOI'    
10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 2 'Structure model' '_citation.title'                   
12 2 'Structure model' '_citation.year'                    
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .        ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 REFMAC      5.8.0073 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.14     'Dec. 10, 2013' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 HKL-3000    .        ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
5 HKL-3000    .        ?               ?       ?                    ?                        'data scaling'    ? ?          ? 
6 MOLREP      11.1.03  ?               ?       ?                    ?                        phasing           ? ?          ? 
7 Coot        0.7.2    ?               ?       ?                    ?                        'model building'  ? ?          ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   CG2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   THR 
_pdbx_validate_close_contact.auth_seq_id_1    444 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   B 
_pdbx_validate_close_contact.auth_atom_id_2   UNK 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   UNX 
_pdbx_validate_close_contact.auth_seq_id_2    610 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.02 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 352 ? ? 69.51   -50.89  
2 1 ASP A 389 ? ? -150.53 80.99   
3 1 GLU A 477 ? ? -128.43 -53.74  
4 1 GLU A 477 ? ? -128.78 -52.82  
5 1 ASN A 479 ? ? 57.07   16.61   
6 1 LYS A 498 ? ? 47.82   -140.50 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 272 ? NZ  ? A LYS 64  NZ  
2  1 Y 1 A LYS 292 ? CE  ? A LYS 84  CE  
3  1 Y 1 A LYS 292 ? NZ  ? A LYS 84  NZ  
4  1 Y 1 A GLU 305 ? CG  ? A GLU 97  CG  
5  1 Y 1 A GLU 305 ? CD  ? A GLU 97  CD  
6  1 Y 1 A GLU 305 ? OE1 ? A GLU 97  OE1 
7  1 Y 1 A GLU 305 ? OE2 ? A GLU 97  OE2 
8  1 Y 1 A LYS 367 ? CE  ? A LYS 159 CE  
9  1 Y 1 A LYS 367 ? NZ  ? A LYS 159 NZ  
10 1 Y 1 A LYS 371 ? CG  ? A LYS 163 CG  
11 1 Y 1 A LYS 371 ? CD  ? A LYS 163 CD  
12 1 Y 1 A LYS 371 ? CE  ? A LYS 163 CE  
13 1 Y 1 A LYS 371 ? NZ  ? A LYS 163 NZ  
14 1 Y 1 A LYS 427 ? CE  ? A LYS 219 CE  
15 1 Y 1 A LYS 427 ? NZ  ? A LYS 219 NZ  
16 1 Y 1 A ILE 446 ? CD1 ? A ILE 238 CD1 
17 1 Y 1 A LYS 458 ? CG  ? A LYS 250 CG  
18 1 Y 1 A LYS 458 ? CD  ? A LYS 250 CD  
19 1 Y 1 A LYS 458 ? CE  ? A LYS 250 CE  
20 1 Y 1 A LYS 458 ? NZ  ? A LYS 250 NZ  
21 1 Y 1 A LYS 506 ? CD  ? A LYS 298 CD  
22 1 Y 1 A LYS 506 ? CE  ? A LYS 298 CE  
23 1 Y 1 A LYS 506 ? NZ  ? A LYS 298 NZ  
24 1 Y 1 A LYS 517 ? NZ  ? A LYS 309 NZ  
25 1 Y 1 A LYS 524 ? CG  ? A LYS 316 CG  
26 1 Y 1 A LYS 524 ? CD  ? A LYS 316 CD  
27 1 Y 1 A LYS 524 ? CE  ? A LYS 316 CE  
28 1 Y 1 A LYS 524 ? NZ  ? A LYS 316 NZ  
29 1 Y 1 A ASN 525 ? CG  ? A ASN 317 CG  
30 1 Y 1 A ASN 525 ? OD1 ? A ASN 317 OD1 
31 1 Y 1 A ASN 525 ? ND2 ? A ASN 317 ND2 
32 1 Y 1 A SER 531 ? OG  ? A SER 323 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 209 ? A MET 1   
2  1 Y 1 A GLY 210 ? A GLY 2   
3  1 Y 1 A SER 211 ? A SER 3   
4  1 Y 1 A SER 212 ? A SER 4   
5  1 Y 1 A HIS 213 ? A HIS 5   
6  1 Y 1 A HIS 214 ? A HIS 6   
7  1 Y 1 A HIS 215 ? A HIS 7   
8  1 Y 1 A HIS 216 ? A HIS 8   
9  1 Y 1 A HIS 217 ? A HIS 9   
10 1 Y 1 A HIS 218 ? A HIS 10  
11 1 Y 1 A SER 219 ? A SER 11  
12 1 Y 1 A SER 220 ? A SER 12  
13 1 Y 1 A GLY 221 ? A GLY 13  
14 1 Y 1 A LEU 222 ? A LEU 14  
15 1 Y 1 A VAL 223 ? A VAL 15  
16 1 Y 1 A PRO 224 ? A PRO 16  
17 1 Y 1 A ARG 225 ? A ARG 17  
18 1 Y 1 A GLY 226 ? A GLY 18  
19 1 Y 1 A SER 227 ? A SER 19  
20 1 Y 1 A ASP 228 ? A ASP 20  
21 1 Y 1 A LEU 229 ? A LEU 21  
22 1 Y 1 A GLN 230 ? A GLN 22  
23 1 Y 1 A GLU 231 ? A GLU 23  
24 1 Y 1 A ASP 232 ? A ASP 24  
25 1 Y 1 A GLU 233 ? A GLU 25  
26 1 Y 1 A ASP 234 ? A ASP 26  
27 1 Y 1 A GLY 235 ? A GLY 27  
28 1 Y 1 A VAL 236 ? A VAL 28  
29 1 Y 1 A TYR 237 ? A TYR 29  
30 1 Y 1 A PHE 238 ? A PHE 30  
31 1 Y 1 A SER 239 ? A SER 31  
32 1 Y 1 A SER 240 ? A SER 32  
33 1 Y 1 A TYR 241 ? A TYR 33  
34 1 Y 1 A GLY 242 ? A GLY 34  
35 1 Y 1 A HIS 243 ? A HIS 35  
36 1 Y 1 A LYS 526 ? A LYS 318 
37 1 Y 1 A LYS 527 ? A LYS 319 
38 1 Y 1 A ASP 528 ? A ASP 320 
39 1 Y 1 A PRO 529 ? A PRO 321 
40 1 Y 1 A ARG 530 ? A ARG 322 
41 1 Y 1 A GLN 548 ? A GLN 340 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1-{2-[1-(aminomethyl)cyclohexyl]ethyl}-3-isoquinolin-6-ylurea' 3BQ 
3 GLYCEROL                                                        GOL 
4 'CHLORIDE ION'                                                  CL  
5 'UNKNOWN ATOM OR ION'                                           UNX 
6 water                                                           HOH 
#