data_4RER
# 
_entry.id   4RER 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4RER         
RCSB  RCSB087254   
WWPDB D_1000087254 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4RED 'Crystal structure of human AMPK alpha1 KD-AID with K43A mutation' unspecified 
PDB 4REW .                                                                  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4RER 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhou, X.E.'    1  
'Ke, J.'        2  
'Li, X.'        3  
'Wang, L.'      4  
'Gu, X.'        5  
'de Waal, P.W.' 6  
'Tan, M.H.E.'   7  
'Wang, D.'      8  
'Wu, D.'        9  
'Xu, H.E.'      10 
'Melcher, K.'   11 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of AMPK regulation by adenine nucleotides and glycogen.' 
_citation.journal_abbrev            'Cell Res.' 
_citation.journal_volume            25 
_citation.page_first                50 
_citation.page_last                 66 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   CN 
_citation.journal_id_ISSN           1001-0602 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25412657 
_citation.pdbx_database_id_DOI      10.1038/cr.2014.150 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, X.'        1  ? 
primary 'Wang, L.'      2  ? 
primary 'Zhou, X.E.'    3  ? 
primary 'Ke, J.'        4  ? 
primary 'de Waal, P.W.' 5  ? 
primary 'Gu, X.'        6  ? 
primary 'Tan, M.H.'     7  ? 
primary 'Wang, D.'      8  ? 
primary 'Wu, D.'        9  ? 
primary 'Xu, H.E.'      10 ? 
primary 'Melcher, K.'   11 ? 
# 
_cell.entry_id           4RER 
_cell.length_a           132.566 
_cell.length_b           132.566 
_cell.length_c           195.392 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4RER 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;5'-AMP-activated protein kinase catalytic subunit alpha-1
;
61566.129 1 '2.7.11.1, 2.7.11.27, 2.7.11.31, 2.7.11.26' 'E471G, E474A, K476A' 'Human AMPK alpha1 subunit [G11-Q550]' ? 
2 polymer     man 
;5'-AMP-activated protein kinase subunit beta-2
;
22449.506 1 ?                                           ?                     'Human AMPK beta2 subunit [A76-I272]'  ? 
3 polymer     man 
;5'-AMP-activated protein kinase subunit gamma-1
;
34645.109 1 ?                                           ?                     'Human AMPK gamma1 subunit [S24-G327]' ? 
4 branched    man 'Cycloheptakis-(1-4)-(alpha-D-glucopyranose)'               1153.001  1 ? ?                     ? ? 
5 non-polymer syn STAUROSPORINE                                               466.531   1 ? ?                     ? ? 
6 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'       238.305   1 ? ?                     ? ? 
7 non-polymer syn 'ADENOSINE MONOPHOSPHATE'                                   347.221   3 ? ?                     ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;AMPK subunit alpha-1, Acetyl-CoA carboxylase kinase, ACACA kinase, Hydroxymethylglutaryl-CoA reductase kinase, HMGCR kinase, Tau-protein kinase PRKAA1
;
2 'AMPK subunit beta-2' 
3 'AMPK gamma1, AMPK subunit gamma-1, AMPKg' 
4 beta-cyclodextrin 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;GSVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSD
IFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGE
FLR(TPO)SCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISL
LKHMLQVDPMKRASIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAY
HLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQS
RPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDGITAAASGTATPQRSG
SVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
;
;GSVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSD
IFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGE
FLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHM
LQVDPMKRASIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLII
DNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPND
IMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDGITAAASGTATPQRSGSVSN
YRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
;
A ? 
2 'polypeptide(L)' no yes 
;ARPTVIRWSEGGKEVFISGSFNNWSTKIPLIK(SEP)HNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINN
LIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLP
EPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
;
;ARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHV
KKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNH
VMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
;
B ? 
3 'polypeptide(L)' no no  
;SNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSAL
VQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEF
PKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVT
KALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGG
;
;SNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSAL
VQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEF
PKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVT
KALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGG
;
G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   VAL n 
1 4   LYS n 
1 5   ILE n 
1 6   GLY n 
1 7   HIS n 
1 8   TYR n 
1 9   ILE n 
1 10  LEU n 
1 11  GLY n 
1 12  ASP n 
1 13  THR n 
1 14  LEU n 
1 15  GLY n 
1 16  VAL n 
1 17  GLY n 
1 18  THR n 
1 19  PHE n 
1 20  GLY n 
1 21  LYS n 
1 22  VAL n 
1 23  LYS n 
1 24  VAL n 
1 25  GLY n 
1 26  LYS n 
1 27  HIS n 
1 28  GLU n 
1 29  LEU n 
1 30  THR n 
1 31  GLY n 
1 32  HIS n 
1 33  LYS n 
1 34  VAL n 
1 35  ALA n 
1 36  VAL n 
1 37  LYS n 
1 38  ILE n 
1 39  LEU n 
1 40  ASN n 
1 41  ARG n 
1 42  GLN n 
1 43  LYS n 
1 44  ILE n 
1 45  ARG n 
1 46  SER n 
1 47  LEU n 
1 48  ASP n 
1 49  VAL n 
1 50  VAL n 
1 51  GLY n 
1 52  LYS n 
1 53  ILE n 
1 54  ARG n 
1 55  ARG n 
1 56  GLU n 
1 57  ILE n 
1 58  GLN n 
1 59  ASN n 
1 60  LEU n 
1 61  LYS n 
1 62  LEU n 
1 63  PHE n 
1 64  ARG n 
1 65  HIS n 
1 66  PRO n 
1 67  HIS n 
1 68  ILE n 
1 69  ILE n 
1 70  LYS n 
1 71  LEU n 
1 72  TYR n 
1 73  GLN n 
1 74  VAL n 
1 75  ILE n 
1 76  SER n 
1 77  THR n 
1 78  PRO n 
1 79  SER n 
1 80  ASP n 
1 81  ILE n 
1 82  PHE n 
1 83  MET n 
1 84  VAL n 
1 85  MET n 
1 86  GLU n 
1 87  TYR n 
1 88  VAL n 
1 89  SER n 
1 90  GLY n 
1 91  GLY n 
1 92  GLU n 
1 93  LEU n 
1 94  PHE n 
1 95  ASP n 
1 96  TYR n 
1 97  ILE n 
1 98  CYS n 
1 99  LYS n 
1 100 ASN n 
1 101 GLY n 
1 102 ARG n 
1 103 LEU n 
1 104 ASP n 
1 105 GLU n 
1 106 LYS n 
1 107 GLU n 
1 108 SER n 
1 109 ARG n 
1 110 ARG n 
1 111 LEU n 
1 112 PHE n 
1 113 GLN n 
1 114 GLN n 
1 115 ILE n 
1 116 LEU n 
1 117 SER n 
1 118 GLY n 
1 119 VAL n 
1 120 ASP n 
1 121 TYR n 
1 122 CYS n 
1 123 HIS n 
1 124 ARG n 
1 125 HIS n 
1 126 MET n 
1 127 VAL n 
1 128 VAL n 
1 129 HIS n 
1 130 ARG n 
1 131 ASP n 
1 132 LEU n 
1 133 LYS n 
1 134 PRO n 
1 135 GLU n 
1 136 ASN n 
1 137 VAL n 
1 138 LEU n 
1 139 LEU n 
1 140 ASP n 
1 141 ALA n 
1 142 HIS n 
1 143 MET n 
1 144 ASN n 
1 145 ALA n 
1 146 LYS n 
1 147 ILE n 
1 148 ALA n 
1 149 ASP n 
1 150 PHE n 
1 151 GLY n 
1 152 LEU n 
1 153 SER n 
1 154 ASN n 
1 155 MET n 
1 156 MET n 
1 157 SER n 
1 158 ASP n 
1 159 GLY n 
1 160 GLU n 
1 161 PHE n 
1 162 LEU n 
1 163 ARG n 
1 164 TPO n 
1 165 SER n 
1 166 CYS n 
1 167 GLY n 
1 168 SER n 
1 169 PRO n 
1 170 ASN n 
1 171 TYR n 
1 172 ALA n 
1 173 ALA n 
1 174 PRO n 
1 175 GLU n 
1 176 VAL n 
1 177 ILE n 
1 178 SER n 
1 179 GLY n 
1 180 ARG n 
1 181 LEU n 
1 182 TYR n 
1 183 ALA n 
1 184 GLY n 
1 185 PRO n 
1 186 GLU n 
1 187 VAL n 
1 188 ASP n 
1 189 ILE n 
1 190 TRP n 
1 191 SER n 
1 192 SER n 
1 193 GLY n 
1 194 VAL n 
1 195 ILE n 
1 196 LEU n 
1 197 TYR n 
1 198 ALA n 
1 199 LEU n 
1 200 LEU n 
1 201 CYS n 
1 202 GLY n 
1 203 THR n 
1 204 LEU n 
1 205 PRO n 
1 206 PHE n 
1 207 ASP n 
1 208 ASP n 
1 209 ASP n 
1 210 HIS n 
1 211 VAL n 
1 212 PRO n 
1 213 THR n 
1 214 LEU n 
1 215 PHE n 
1 216 LYS n 
1 217 LYS n 
1 218 ILE n 
1 219 CYS n 
1 220 ASP n 
1 221 GLY n 
1 222 ILE n 
1 223 PHE n 
1 224 TYR n 
1 225 THR n 
1 226 PRO n 
1 227 GLN n 
1 228 TYR n 
1 229 LEU n 
1 230 ASN n 
1 231 PRO n 
1 232 SER n 
1 233 VAL n 
1 234 ILE n 
1 235 SER n 
1 236 LEU n 
1 237 LEU n 
1 238 LYS n 
1 239 HIS n 
1 240 MET n 
1 241 LEU n 
1 242 GLN n 
1 243 VAL n 
1 244 ASP n 
1 245 PRO n 
1 246 MET n 
1 247 LYS n 
1 248 ARG n 
1 249 ALA n 
1 250 SER n 
1 251 ILE n 
1 252 LYS n 
1 253 ASP n 
1 254 ILE n 
1 255 ARG n 
1 256 GLU n 
1 257 HIS n 
1 258 GLU n 
1 259 TRP n 
1 260 PHE n 
1 261 LYS n 
1 262 GLN n 
1 263 ASP n 
1 264 LEU n 
1 265 PRO n 
1 266 LYS n 
1 267 TYR n 
1 268 LEU n 
1 269 PHE n 
1 270 PRO n 
1 271 GLU n 
1 272 ASP n 
1 273 PRO n 
1 274 SER n 
1 275 TYR n 
1 276 SER n 
1 277 SER n 
1 278 THR n 
1 279 MET n 
1 280 ILE n 
1 281 ASP n 
1 282 ASP n 
1 283 GLU n 
1 284 ALA n 
1 285 LEU n 
1 286 LYS n 
1 287 GLU n 
1 288 VAL n 
1 289 CYS n 
1 290 GLU n 
1 291 LYS n 
1 292 PHE n 
1 293 GLU n 
1 294 CYS n 
1 295 SER n 
1 296 GLU n 
1 297 GLU n 
1 298 GLU n 
1 299 VAL n 
1 300 LEU n 
1 301 SER n 
1 302 CYS n 
1 303 LEU n 
1 304 TYR n 
1 305 ASN n 
1 306 ARG n 
1 307 ASN n 
1 308 HIS n 
1 309 GLN n 
1 310 ASP n 
1 311 PRO n 
1 312 LEU n 
1 313 ALA n 
1 314 VAL n 
1 315 ALA n 
1 316 TYR n 
1 317 HIS n 
1 318 LEU n 
1 319 ILE n 
1 320 ILE n 
1 321 ASP n 
1 322 ASN n 
1 323 ARG n 
1 324 ARG n 
1 325 ILE n 
1 326 MET n 
1 327 ASN n 
1 328 GLU n 
1 329 ALA n 
1 330 LYS n 
1 331 ASP n 
1 332 PHE n 
1 333 TYR n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 SER n 
1 338 PRO n 
1 339 PRO n 
1 340 ASP n 
1 341 SER n 
1 342 PHE n 
1 343 LEU n 
1 344 ASP n 
1 345 ASP n 
1 346 HIS n 
1 347 HIS n 
1 348 LEU n 
1 349 THR n 
1 350 ARG n 
1 351 PRO n 
1 352 HIS n 
1 353 PRO n 
1 354 GLU n 
1 355 ARG n 
1 356 VAL n 
1 357 PRO n 
1 358 PHE n 
1 359 LEU n 
1 360 VAL n 
1 361 ALA n 
1 362 GLU n 
1 363 THR n 
1 364 PRO n 
1 365 ARG n 
1 366 ALA n 
1 367 ARG n 
1 368 HIS n 
1 369 THR n 
1 370 LEU n 
1 371 ASP n 
1 372 GLU n 
1 373 LEU n 
1 374 ASN n 
1 375 PRO n 
1 376 GLN n 
1 377 LYS n 
1 378 SER n 
1 379 LYS n 
1 380 HIS n 
1 381 GLN n 
1 382 GLY n 
1 383 VAL n 
1 384 ARG n 
1 385 LYS n 
1 386 ALA n 
1 387 LYS n 
1 388 TRP n 
1 389 HIS n 
1 390 LEU n 
1 391 GLY n 
1 392 ILE n 
1 393 ARG n 
1 394 SER n 
1 395 GLN n 
1 396 SER n 
1 397 ARG n 
1 398 PRO n 
1 399 ASN n 
1 400 ASP n 
1 401 ILE n 
1 402 MET n 
1 403 ALA n 
1 404 GLU n 
1 405 VAL n 
1 406 CYS n 
1 407 ARG n 
1 408 ALA n 
1 409 ILE n 
1 410 LYS n 
1 411 GLN n 
1 412 LEU n 
1 413 ASP n 
1 414 TYR n 
1 415 GLU n 
1 416 TRP n 
1 417 LYS n 
1 418 VAL n 
1 419 VAL n 
1 420 ASN n 
1 421 PRO n 
1 422 TYR n 
1 423 TYR n 
1 424 LEU n 
1 425 ARG n 
1 426 VAL n 
1 427 ARG n 
1 428 ARG n 
1 429 LYS n 
1 430 ASN n 
1 431 PRO n 
1 432 VAL n 
1 433 THR n 
1 434 SER n 
1 435 THR n 
1 436 TYR n 
1 437 SER n 
1 438 LYS n 
1 439 MET n 
1 440 SER n 
1 441 LEU n 
1 442 GLN n 
1 443 LEU n 
1 444 TYR n 
1 445 GLN n 
1 446 VAL n 
1 447 ASP n 
1 448 SER n 
1 449 ARG n 
1 450 THR n 
1 451 TYR n 
1 452 LEU n 
1 453 LEU n 
1 454 ASP n 
1 455 PHE n 
1 456 ARG n 
1 457 SER n 
1 458 ILE n 
1 459 ASP n 
1 460 ASP n 
1 461 GLY n 
1 462 ILE n 
1 463 THR n 
1 464 ALA n 
1 465 ALA n 
1 466 ALA n 
1 467 SER n 
1 468 GLY n 
1 469 THR n 
1 470 ALA n 
1 471 THR n 
1 472 PRO n 
1 473 GLN n 
1 474 ARG n 
1 475 SER n 
1 476 GLY n 
1 477 SER n 
1 478 VAL n 
1 479 SER n 
1 480 ASN n 
1 481 TYR n 
1 482 ARG n 
1 483 SER n 
1 484 CYS n 
1 485 GLN n 
1 486 ARG n 
1 487 SER n 
1 488 ASP n 
1 489 SER n 
1 490 ASP n 
1 491 ALA n 
1 492 GLU n 
1 493 ALA n 
1 494 GLN n 
1 495 GLY n 
1 496 LYS n 
1 497 SER n 
1 498 SER n 
1 499 GLU n 
1 500 VAL n 
1 501 SER n 
1 502 LEU n 
1 503 THR n 
1 504 SER n 
1 505 SER n 
1 506 VAL n 
1 507 THR n 
1 508 SER n 
1 509 LEU n 
1 510 ASP n 
1 511 SER n 
1 512 SER n 
1 513 PRO n 
1 514 VAL n 
1 515 ASP n 
1 516 LEU n 
1 517 THR n 
1 518 PRO n 
1 519 ARG n 
1 520 PRO n 
1 521 GLY n 
1 522 SER n 
1 523 HIS n 
1 524 THR n 
1 525 ILE n 
1 526 GLU n 
1 527 PHE n 
1 528 PHE n 
1 529 GLU n 
1 530 MET n 
1 531 CYS n 
1 532 ALA n 
1 533 ASN n 
1 534 LEU n 
1 535 ILE n 
1 536 LYS n 
1 537 ILE n 
1 538 LEU n 
1 539 ALA n 
1 540 GLN n 
2 1   ALA n 
2 2   ARG n 
2 3   PRO n 
2 4   THR n 
2 5   VAL n 
2 6   ILE n 
2 7   ARG n 
2 8   TRP n 
2 9   SER n 
2 10  GLU n 
2 11  GLY n 
2 12  GLY n 
2 13  LYS n 
2 14  GLU n 
2 15  VAL n 
2 16  PHE n 
2 17  ILE n 
2 18  SER n 
2 19  GLY n 
2 20  SER n 
2 21  PHE n 
2 22  ASN n 
2 23  ASN n 
2 24  TRP n 
2 25  SER n 
2 26  THR n 
2 27  LYS n 
2 28  ILE n 
2 29  PRO n 
2 30  LEU n 
2 31  ILE n 
2 32  LYS n 
2 33  SEP n 
2 34  HIS n 
2 35  ASN n 
2 36  ASP n 
2 37  PHE n 
2 38  VAL n 
2 39  ALA n 
2 40  ILE n 
2 41  LEU n 
2 42  ASP n 
2 43  LEU n 
2 44  PRO n 
2 45  GLU n 
2 46  GLY n 
2 47  GLU n 
2 48  HIS n 
2 49  GLN n 
2 50  TYR n 
2 51  LYS n 
2 52  PHE n 
2 53  PHE n 
2 54  VAL n 
2 55  ASP n 
2 56  GLY n 
2 57  GLN n 
2 58  TRP n 
2 59  VAL n 
2 60  HIS n 
2 61  ASP n 
2 62  PRO n 
2 63  SER n 
2 64  GLU n 
2 65  PRO n 
2 66  VAL n 
2 67  VAL n 
2 68  THR n 
2 69  SER n 
2 70  GLN n 
2 71  LEU n 
2 72  GLY n 
2 73  THR n 
2 74  ILE n 
2 75  ASN n 
2 76  ASN n 
2 77  LEU n 
2 78  ILE n 
2 79  HIS n 
2 80  VAL n 
2 81  LYS n 
2 82  LYS n 
2 83  SER n 
2 84  ASP n 
2 85  PHE n 
2 86  GLU n 
2 87  VAL n 
2 88  PHE n 
2 89  ASP n 
2 90  ALA n 
2 91  LEU n 
2 92  LYS n 
2 93  LEU n 
2 94  ASP n 
2 95  SER n 
2 96  MET n 
2 97  GLU n 
2 98  SER n 
2 99  SER n 
2 100 GLU n 
2 101 THR n 
2 102 SER n 
2 103 CYS n 
2 104 ARG n 
2 105 ASP n 
2 106 LEU n 
2 107 SER n 
2 108 SER n 
2 109 SER n 
2 110 PRO n 
2 111 PRO n 
2 112 GLY n 
2 113 PRO n 
2 114 TYR n 
2 115 GLY n 
2 116 GLN n 
2 117 GLU n 
2 118 MET n 
2 119 TYR n 
2 120 ALA n 
2 121 PHE n 
2 122 ARG n 
2 123 SER n 
2 124 GLU n 
2 125 GLU n 
2 126 ARG n 
2 127 PHE n 
2 128 LYS n 
2 129 SER n 
2 130 PRO n 
2 131 PRO n 
2 132 ILE n 
2 133 LEU n 
2 134 PRO n 
2 135 PRO n 
2 136 HIS n 
2 137 LEU n 
2 138 LEU n 
2 139 GLN n 
2 140 VAL n 
2 141 ILE n 
2 142 LEU n 
2 143 ASN n 
2 144 LYS n 
2 145 ASP n 
2 146 THR n 
2 147 ASN n 
2 148 ILE n 
2 149 SER n 
2 150 CYS n 
2 151 ASP n 
2 152 PRO n 
2 153 ALA n 
2 154 LEU n 
2 155 LEU n 
2 156 PRO n 
2 157 GLU n 
2 158 PRO n 
2 159 ASN n 
2 160 HIS n 
2 161 VAL n 
2 162 MET n 
2 163 LEU n 
2 164 ASN n 
2 165 HIS n 
2 166 LEU n 
2 167 TYR n 
2 168 ALA n 
2 169 LEU n 
2 170 SER n 
2 171 ILE n 
2 172 LYS n 
2 173 ASP n 
2 174 SER n 
2 175 VAL n 
2 176 MET n 
2 177 VAL n 
2 178 LEU n 
2 179 SER n 
2 180 ALA n 
2 181 THR n 
2 182 HIS n 
2 183 ARG n 
2 184 TYR n 
2 185 LYS n 
2 186 LYS n 
2 187 LYS n 
2 188 TYR n 
2 189 VAL n 
2 190 THR n 
2 191 THR n 
2 192 LEU n 
2 193 LEU n 
2 194 TYR n 
2 195 LYS n 
2 196 PRO n 
2 197 ILE n 
3 1   SER n 
3 2   ASN n 
3 3   ASN n 
3 4   SER n 
3 5   VAL n 
3 6   TYR n 
3 7   THR n 
3 8   SER n 
3 9   PHE n 
3 10  MET n 
3 11  LYS n 
3 12  SER n 
3 13  HIS n 
3 14  ARG n 
3 15  CYS n 
3 16  TYR n 
3 17  ASP n 
3 18  LEU n 
3 19  ILE n 
3 20  PRO n 
3 21  THR n 
3 22  SER n 
3 23  SER n 
3 24  LYS n 
3 25  LEU n 
3 26  VAL n 
3 27  VAL n 
3 28  PHE n 
3 29  ASP n 
3 30  THR n 
3 31  SER n 
3 32  LEU n 
3 33  GLN n 
3 34  VAL n 
3 35  LYS n 
3 36  LYS n 
3 37  ALA n 
3 38  PHE n 
3 39  PHE n 
3 40  ALA n 
3 41  LEU n 
3 42  VAL n 
3 43  THR n 
3 44  ASN n 
3 45  GLY n 
3 46  VAL n 
3 47  ARG n 
3 48  ALA n 
3 49  ALA n 
3 50  PRO n 
3 51  LEU n 
3 52  TRP n 
3 53  ASP n 
3 54  SER n 
3 55  LYS n 
3 56  LYS n 
3 57  GLN n 
3 58  SER n 
3 59  PHE n 
3 60  VAL n 
3 61  GLY n 
3 62  MET n 
3 63  LEU n 
3 64  THR n 
3 65  ILE n 
3 66  THR n 
3 67  ASP n 
3 68  PHE n 
3 69  ILE n 
3 70  ASN n 
3 71  ILE n 
3 72  LEU n 
3 73  HIS n 
3 74  ARG n 
3 75  TYR n 
3 76  TYR n 
3 77  LYS n 
3 78  SER n 
3 79  ALA n 
3 80  LEU n 
3 81  VAL n 
3 82  GLN n 
3 83  ILE n 
3 84  TYR n 
3 85  GLU n 
3 86  LEU n 
3 87  GLU n 
3 88  GLU n 
3 89  HIS n 
3 90  LYS n 
3 91  ILE n 
3 92  GLU n 
3 93  THR n 
3 94  TRP n 
3 95  ARG n 
3 96  GLU n 
3 97  VAL n 
3 98  TYR n 
3 99  LEU n 
3 100 GLN n 
3 101 ASP n 
3 102 SER n 
3 103 PHE n 
3 104 LYS n 
3 105 PRO n 
3 106 LEU n 
3 107 VAL n 
3 108 CYS n 
3 109 ILE n 
3 110 SER n 
3 111 PRO n 
3 112 ASN n 
3 113 ALA n 
3 114 SER n 
3 115 LEU n 
3 116 PHE n 
3 117 ASP n 
3 118 ALA n 
3 119 VAL n 
3 120 SER n 
3 121 SER n 
3 122 LEU n 
3 123 ILE n 
3 124 ARG n 
3 125 ASN n 
3 126 LYS n 
3 127 ILE n 
3 128 HIS n 
3 129 ARG n 
3 130 LEU n 
3 131 PRO n 
3 132 VAL n 
3 133 ILE n 
3 134 ASP n 
3 135 PRO n 
3 136 GLU n 
3 137 SER n 
3 138 GLY n 
3 139 ASN n 
3 140 THR n 
3 141 LEU n 
3 142 TYR n 
3 143 ILE n 
3 144 LEU n 
3 145 THR n 
3 146 HIS n 
3 147 LYS n 
3 148 ARG n 
3 149 ILE n 
3 150 LEU n 
3 151 LYS n 
3 152 PHE n 
3 153 LEU n 
3 154 LYS n 
3 155 LEU n 
3 156 PHE n 
3 157 ILE n 
3 158 THR n 
3 159 GLU n 
3 160 PHE n 
3 161 PRO n 
3 162 LYS n 
3 163 PRO n 
3 164 GLU n 
3 165 PHE n 
3 166 MET n 
3 167 SER n 
3 168 LYS n 
3 169 SER n 
3 170 LEU n 
3 171 GLU n 
3 172 GLU n 
3 173 LEU n 
3 174 GLN n 
3 175 ILE n 
3 176 GLY n 
3 177 THR n 
3 178 TYR n 
3 179 ALA n 
3 180 ASN n 
3 181 ILE n 
3 182 ALA n 
3 183 MET n 
3 184 VAL n 
3 185 ARG n 
3 186 THR n 
3 187 THR n 
3 188 THR n 
3 189 PRO n 
3 190 VAL n 
3 191 TYR n 
3 192 VAL n 
3 193 ALA n 
3 194 LEU n 
3 195 GLY n 
3 196 ILE n 
3 197 PHE n 
3 198 VAL n 
3 199 GLN n 
3 200 HIS n 
3 201 ARG n 
3 202 VAL n 
3 203 SER n 
3 204 ALA n 
3 205 LEU n 
3 206 PRO n 
3 207 VAL n 
3 208 VAL n 
3 209 ASP n 
3 210 GLU n 
3 211 LYS n 
3 212 GLY n 
3 213 ARG n 
3 214 VAL n 
3 215 VAL n 
3 216 ASP n 
3 217 ILE n 
3 218 TYR n 
3 219 SER n 
3 220 LYS n 
3 221 PHE n 
3 222 ASP n 
3 223 VAL n 
3 224 ILE n 
3 225 ASN n 
3 226 LEU n 
3 227 ALA n 
3 228 ALA n 
3 229 GLU n 
3 230 LYS n 
3 231 THR n 
3 232 TYR n 
3 233 ASN n 
3 234 ASN n 
3 235 LEU n 
3 236 ASP n 
3 237 VAL n 
3 238 SER n 
3 239 VAL n 
3 240 THR n 
3 241 LYS n 
3 242 ALA n 
3 243 LEU n 
3 244 GLN n 
3 245 HIS n 
3 246 ARG n 
3 247 SER n 
3 248 HIS n 
3 249 TYR n 
3 250 PHE n 
3 251 GLU n 
3 252 GLY n 
3 253 VAL n 
3 254 LEU n 
3 255 LYS n 
3 256 CYS n 
3 257 TYR n 
3 258 LEU n 
3 259 HIS n 
3 260 GLU n 
3 261 THR n 
3 262 LEU n 
3 263 GLU n 
3 264 THR n 
3 265 ILE n 
3 266 ILE n 
3 267 ASN n 
3 268 ARG n 
3 269 LEU n 
3 270 VAL n 
3 271 GLU n 
3 272 ALA n 
3 273 GLU n 
3 274 VAL n 
3 275 HIS n 
3 276 ARG n 
3 277 LEU n 
3 278 VAL n 
3 279 VAL n 
3 280 VAL n 
3 281 ASP n 
3 282 GLU n 
3 283 ASN n 
3 284 ASP n 
3 285 VAL n 
3 286 VAL n 
3 287 LYS n 
3 288 GLY n 
3 289 ILE n 
3 290 VAL n 
3 291 SER n 
3 292 LEU n 
3 293 SER n 
3 294 ASP n 
3 295 ILE n 
3 296 LEU n 
3 297 GLN n 
3 298 ALA n 
3 299 LEU n 
3 300 VAL n 
3 301 LEU n 
3 302 THR n 
3 303 GLY n 
3 304 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'AMPK1, Human holo-AMPK alpha1 subunit, PRKAA1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PET28 ? ? 
2 1 sample ? ? ? human ? 'Human holo-AMPK beta2 subunit, PRKAB2'         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PET28 ? ? 
3 1 sample ? ? ? human ? 'Human holo-AMPK gamma1 subunit, PRKAG1'        ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? PET28 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP AAPK1_HUMAN Q13131 1 
;GRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSD
IFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGE
FLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHM
LQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLII
DNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPND
IMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSN
YRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
;
20 ? 
2 UNP AAKB2_HUMAN O43741 2 
;ARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHV
KKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNH
VMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
;
76 ? 
3 UNP AAKG1_HUMAN P54619 3 
;SNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSAL
VQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEF
PKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVT
KALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGG
;
24 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4RER A 1 ? 540 ? Q13131 20 ? 559 ? 11 550 
2 2 4RER B 1 ? 197 ? O43741 76 ? 272 ? 76 272 
3 3 4RER G 1 ? 304 ? P54619 24 ? 327 ? 24 327 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4RER SER A 2   ? UNP Q13131 ARG 21  conflict              12  1 
1 4RER SER A 250 ? UNP Q13131 THR 269 conflict              260 2 
1 4RER GLY A 461 ? UNP Q13131 GLU 480 'engineered mutation' 471 3 
1 4RER ALA A 464 ? UNP Q13131 GLU 483 'engineered mutation' 474 4 
1 4RER ALA A 466 ? UNP Q13131 LYS 485 'engineered mutation' 476 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                               ?                  'C3 H7 N O2'      
89.093  
AMP non-polymer                   . 'ADENOSINE MONOPHOSPHATE'                             ?                  'C10 H14 N5 O7 P' 
347.221 
ARG 'L-peptide linking'           y ARGININE                                              ?                  'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                            ?                  'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                       ?                  'C4 H7 N O4'      
133.103 
CYS 'L-peptide linking'           y CYSTEINE                                              ?                  'C3 H7 N O2 S'    
121.158 
EPE non-polymer                   . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES              'C8 H18 N2 O4 S'  
238.305 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose                                 ?                  'C6 H12 O6'       
180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                             ?                  'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                       ?                  'C5 H9 N O4'      
147.129 
GLY 'peptide linking'             y GLYCINE                                               ?                  'C2 H5 N O2'      
75.067  
HIS 'L-peptide linking'           y HISTIDINE                                             ?                  'C6 H10 N3 O2 1'  
156.162 
ILE 'L-peptide linking'           y ISOLEUCINE                                            ?                  'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking'           y LEUCINE                                               ?                  'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking'           y LYSINE                                                ?                  'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking'           y METHIONINE                                            ?                  'C5 H11 N O2 S'   
149.211 
PHE 'L-peptide linking'           y PHENYLALANINE                                         ?                  'C9 H11 N O2'     
165.189 
PRO 'L-peptide linking'           y PROLINE                                               ?                  'C5 H9 N O2'      
115.130 
SEP 'L-peptide linking'           n PHOSPHOSERINE                                         PHOSPHONOSERINE    'C3 H8 N O6 P'    
185.072 
SER 'L-peptide linking'           y SERINE                                                ?                  'C3 H7 N O3'      
105.093 
STU non-polymer                   . STAUROSPORINE                                         ?                  'C28 H26 N4 O3'   
466.531 
THR 'L-peptide linking'           y THREONINE                                             ?                  'C4 H9 N O3'      
119.119 
TPO 'L-peptide linking'           n PHOSPHOTHREONINE                                      PHOSPHONOTHREONINE 'C4 H10 N O6 P'   
199.099 
TRP 'L-peptide linking'           y TRYPTOPHAN                                            ?                  'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking'           y TYROSINE                                              ?                  'C9 H11 N O3'     
181.189 
VAL 'L-peptide linking'           y VALINE                                                ?                  'C5 H11 N O2'     
117.146 
# 
_exptl.entry_id          4RER 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.18 
_exptl_crystal.density_percent_sol   70.55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    
;12% PEG 4000,0.1 M HEPES, pH7.8, 10% 2-propanol (v/v) and 0.19 mM 7-cyclohexyl-1-heptyl-D-maltoside, VAPOR DIFFUSION, SITTING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2012-07-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Ni FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
# 
_reflns.entry_id                     4RER 
_reflns.observed_criterion_sigma_I   . 
_reflns.observed_criterion_sigma_F   . 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            4.05 
_reflns.number_obs                   16621 
_reflns.number_all                   16738 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.186 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             4.05 
_reflns_shell.d_res_low              4.19 
_reflns_shell.percent_possible_all   93 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4RER 
_refine.ls_number_reflns_obs                     16566 
_refine.ls_number_reflns_all                     16725 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.657 
_refine.ls_d_res_high                            4.047 
_refine.ls_percent_reflns_obs                    99.05 
_refine.ls_R_factor_obs                          0.2271 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2244 
_refine.ls_R_factor_R_free                       0.2595 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.32 
_refine.ls_number_reflns_R_free                  1213 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2Y94' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MAXIMUM-LIKELIHOOD 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.55 
_refine.pdbx_overall_phase_error                 28.23 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7602 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         196 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7798 
_refine_hist.d_res_high                       4.047 
_refine_hist.d_res_low                        39.657 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.005  ? ? 8005  ? 'X-RAY DIFFRACTION' 
f_angle_d          0.964  ? ? 10885 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 17.872 ? ? 2982  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.040  ? ? 1226  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.006  ? ? 1337  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 4.0469 4.2088  1555 0.3169 93.00  0.3535 . . 143 . . . . 'X-RAY DIFFRACTION' 
. 4.2088 4.4001  1707 0.2896 100.00 0.3320 . . 111 . . . . 'X-RAY DIFFRACTION' 
. 4.4001 4.6318  1705 0.2532 100.00 0.3375 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 4.6318 4.9215  1706 0.2257 100.00 0.2919 . . 117 . . . . 'X-RAY DIFFRACTION' 
. 4.9215 5.3006  1726 0.2225 100.00 0.2653 . . 109 . . . . 'X-RAY DIFFRACTION' 
. 5.3006 5.8326  1683 0.2224 100.00 0.2535 . . 156 . . . . 'X-RAY DIFFRACTION' 
. 5.8326 6.6731  1733 0.2291 100.00 0.2291 . . 120 . . . . 'X-RAY DIFFRACTION' 
. 6.6731 8.3942  1728 0.2219 100.00 0.2266 . . 168 . . . . 'X-RAY DIFFRACTION' 
. 8.3942 39.6586 1810 0.1812 100.00 0.2279 . . 159 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4RER 
_struct.title                     
'Crystal structure of the phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex bound to AMP and cyclodextrin' 
_struct.pdbx_descriptor           
;5'-AMP-activated protein kinase catalytic subunit alpha-1 (E.C.2.7.11.1, 2.7.11.27, 2.7.11.31, 2.7.11.26), 5'-AMP-activated protein kinase subunit beta-2, 5'-AMP-activated protein kinase subunit gamma-1
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4RER 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;human alpha1 beta2 gamma1 holo-AMPK complex, serine/threonine protein kinase, axin, CaMKKbeta, LKB1, glycogen, Phosphorylation, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'The heterotrimeric serine/threonine protein kinase' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 41  ? LEU A 47  ? ARG A 51  LEU A 57  1 ? 7  
HELX_P HELX_P2  2  VAL A 49  ? LEU A 62  ? VAL A 59  LEU A 72  1 ? 14 
HELX_P HELX_P3  3  LEU A 93  ? GLY A 101 ? LEU A 103 GLY A 111 1 ? 9  
HELX_P HELX_P4  4  ASP A 104 ? HIS A 125 ? ASP A 114 HIS A 135 1 ? 22 
HELX_P HELX_P5  5  GLY A 184 ? LEU A 199 ? GLY A 194 LEU A 209 1 ? 16 
HELX_P HELX_P6  6  PRO A 212 ? ASP A 220 ? PRO A 222 ASP A 230 1 ? 9  
HELX_P HELX_P7  7  ASN A 230 ? LEU A 241 ? ASN A 240 LEU A 251 1 ? 12 
HELX_P HELX_P8  8  SER A 250 ? GLU A 256 ? SER A 260 GLU A 266 1 ? 7  
HELX_P HELX_P9  9  HIS A 257 ? GLN A 262 ? HIS A 267 GLN A 272 1 ? 6  
HELX_P HELX_P10 10 ASP A 282 ? LYS A 286 ? ASP A 292 LYS A 296 5 ? 5  
HELX_P HELX_P11 11 GLU A 287 ? PHE A 292 ? GLU A 297 PHE A 302 1 ? 6  
HELX_P HELX_P12 12 VAL A 299 ? ASN A 305 ? VAL A 309 ASN A 315 1 ? 7  
HELX_P HELX_P13 13 TYR A 316 ? GLU A 328 ? TYR A 326 GLU A 338 1 ? 13 
HELX_P HELX_P14 14 HIS A 352 ? GLU A 354 ? HIS A 362 GLU A 364 5 ? 3  
HELX_P HELX_P15 15 ARG A 355 ? THR A 363 ? ARG A 365 THR A 373 1 ? 9  
HELX_P HELX_P16 16 ARG A 397 ? LEU A 412 ? ARG A 407 LEU A 422 1 ? 16 
HELX_P HELX_P17 17 SER A 522 ? GLN A 540 ? SER A 532 GLN A 550 1 ? 19 
HELX_P HELX_P18 18 PRO B 134 ? GLN B 139 ? PRO B 209 GLN B 214 1 ? 6  
HELX_P HELX_P19 19 ASN B 159 ? LEU B 163 ? ASN B 234 LEU B 238 5 ? 5  
HELX_P HELX_P20 20 VAL C 5   ? SER C 12  ? VAL G 28  SER G 35  1 ? 8  
HELX_P HELX_P21 21 ARG C 14  ? ILE C 19  ? ARG G 37  ILE G 42  5 ? 6  
HELX_P HELX_P22 22 GLN C 33  ? GLY C 45  ? GLN G 56  GLY G 68  1 ? 13 
HELX_P HELX_P23 23 ILE C 65  ? TYR C 75  ? ILE G 88  TYR G 98  1 ? 11 
HELX_P HELX_P24 24 ILE C 83  ? GLU C 88  ? ILE G 106 GLU G 111 1 ? 6  
HELX_P HELX_P25 25 LYS C 90  ? LEU C 99  ? LYS G 113 LEU G 122 1 ? 10 
HELX_P HELX_P26 26 SER C 114 ? ASN C 125 ? SER G 137 ASN G 148 1 ? 12 
HELX_P HELX_P27 27 THR C 145 ? ILE C 157 ? THR G 168 ILE G 180 1 ? 13 
HELX_P HELX_P28 28 SER C 169 ? GLN C 174 ? SER G 192 GLN G 197 1 ? 6  
HELX_P HELX_P29 29 PRO C 189 ? HIS C 200 ? PRO G 212 HIS G 223 1 ? 12 
HELX_P HELX_P30 30 VAL C 223 ? GLU C 229 ? VAL G 246 GLU G 252 1 ? 7  
HELX_P HELX_P31 31 SER C 238 ? LEU C 243 ? SER G 261 LEU G 266 1 ? 6  
HELX_P HELX_P32 32 GLN C 244 ? ARG C 246 ? GLN G 267 ARG G 269 5 ? 3  
HELX_P HELX_P33 33 THR C 261 ? GLU C 273 ? THR G 284 GLU G 296 1 ? 13 
HELX_P HELX_P34 34 LEU C 292 ? LEU C 301 ? LEU G 315 LEU G 324 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A ARG 163 C  ? ? ? 1_555 A TPO 164 N  ? ? A ARG 173 A TPO 174 1_555 ? ? ? ? ? ? ? 1.336 ?    ? 
covale2  covale both ? A TPO 164 C  ? ? ? 1_555 A SER 165 N  ? ? A TPO 174 A SER 175 1_555 ? ? ? ? ? ? ? 1.327 ?    ? 
covale3  covale both ? B LYS 32  C  ? ? ? 1_555 B SEP 33  N  ? ? B LYS 107 B SEP 108 1_555 ? ? ? ? ? ? ? 1.331 ?    ? 
covale4  covale both ? B SEP 33  C  ? ? ? 1_555 B HIS 34  N  ? ? B SEP 108 B HIS 109 1_555 ? ? ? ? ? ? ? 1.330 ?    ? 
covale5  covale both ? D GLC .   O4 ? ? ? 1_555 D GLC .   C1 ? ? C GLC 1   C GLC 2   1_555 ? ? ? ? ? ? ? 1.462 sing ? 
covale6  covale both ? D GLC .   C1 ? ? ? 1_555 D GLC .   O4 ? ? C GLC 1   C GLC 7   1_555 ? ? ? ? ? ? ? 1.435 sing ? 
covale7  covale both ? D GLC .   O4 ? ? ? 1_555 D GLC .   C1 ? ? C GLC 2   C GLC 3   1_555 ? ? ? ? ? ? ? 1.402 sing ? 
covale8  covale both ? D GLC .   O4 ? ? ? 1_555 D GLC .   C1 ? ? C GLC 3   C GLC 4   1_555 ? ? ? ? ? ? ? 1.430 sing ? 
covale9  covale both ? D GLC .   O4 ? ? ? 1_555 D GLC .   C1 ? ? C GLC 4   C GLC 5   1_555 ? ? ? ? ? ? ? 1.383 sing ? 
covale10 covale both ? D GLC .   O4 ? ? ? 1_555 D GLC .   C1 ? ? C GLC 5   C GLC 6   1_555 ? ? ? ? ? ? ? 1.408 sing ? 
covale11 covale both ? D GLC .   O4 ? ? ? 1_555 D GLC .   C1 ? ? C GLC 6   C GLC 7   1_555 ? ? ? ? ? ? ? 1.421 sing ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           211 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            221 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    212 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     222 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
G ? 3 ? 
H ? 6 ? 
I ? 2 ? 
J ? 3 ? 
K ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 4   ? ILE A 5   ? LYS A 14  ILE A 15  
A 2 TYR A 8   ? GLY A 15  ? TYR A 18  GLY A 25  
A 3 VAL A 22  ? HIS A 27  ? VAL A 32  HIS A 37  
A 4 LYS A 33  ? ASN A 40  ? LYS A 43  ASN A 50  
A 5 ASP A 80  ? GLU A 86  ? ASP A 90  GLU A 96  
A 6 LEU A 71  ? GLN A 73  ? LEU A 81  GLN A 83  
B 1 GLY A 91  ? GLU A 92  ? GLY A 101 GLU A 102 
B 2 VAL A 137 ? LEU A 139 ? VAL A 147 LEU A 149 
B 3 LYS A 146 ? ILE A 147 ? LYS A 156 ILE A 157 
C 1 VAL A 127 ? VAL A 128 ? VAL A 137 VAL A 138 
C 2 ASN A 154 ? MET A 155 ? ASN A 164 MET A 165 
D 1 ILE A 392 ? SER A 394 ? ILE A 402 SER A 404 
D 2 THR A 450 ? ARG A 456 ? THR A 460 ARG A 466 
D 3 TYR A 436 ? ASP A 447 ? TYR A 446 ASP A 457 
D 4 TYR A 423 ? LYS A 429 ? TYR A 433 LYS A 439 
D 5 GLU A 415 ? ASN A 420 ? GLU A 425 ASN A 430 
E 1 THR B 4   ? ILE B 6   ? THR B 79  ILE B 81  
E 2 PHE B 37  ? LEU B 41  ? PHE B 112 LEU B 116 
E 3 ILE B 31  ? LYS B 32  ? ILE B 106 LYS B 107 
F 1 ILE B 28  ? PRO B 29  ? ILE B 103 PRO B 104 
F 2 VAL B 15  ? ILE B 17  ? VAL B 90  ILE B 92  
F 3 PHE B 52  ? VAL B 54  ? PHE B 127 VAL B 129 
F 4 GLN B 57  ? VAL B 59  ? GLN B 132 VAL B 134 
G 1 GLN B 49  ? TYR B 50  ? GLN B 124 TYR B 125 
G 2 ILE B 74  ? LEU B 77  ? ILE B 149 LEU B 152 
G 3 VAL B 66  ? THR B 68  ? VAL B 141 THR B 143 
H 1 LEU B 166 ? LEU B 169 ? LEU B 241 LEU B 244 
H 2 VAL B 175 ? ARG B 183 ? VAL B 250 ARG B 258 
H 3 TYR B 188 ? PRO B 196 ? TYR B 263 PRO B 271 
H 4 SER C 22  ? ASP C 29  ? SER G 45  ASP G 52  
H 5 ALA C 48  ? ASP C 53  ? ALA G 71  ASP G 76  
H 6 SER C 58  ? THR C 64  ? SER G 81  THR G 87  
I 1 LEU C 130 ? ILE C 133 ? LEU G 153 ILE G 156 
I 2 THR C 140 ? LEU C 144 ? THR G 163 LEU G 167 
J 1 VAL C 184 ? ARG C 185 ? VAL G 207 ARG G 208 
J 2 ALA C 204 ? VAL C 208 ? ALA G 227 VAL G 231 
J 3 VAL C 214 ? SER C 219 ? VAL G 237 SER G 242 
K 1 LYS C 255 ? TYR C 257 ? LYS G 278 TYR G 280 
K 2 ARG C 276 ? VAL C 280 ? ARG G 299 VAL G 303 
K 3 VAL C 286 ? SER C 291 ? VAL G 309 SER G 314 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 5   ? N ILE A 15  O TYR A 8   ? O TYR A 18  
A 2 3 N GLY A 11  ? N GLY A 21  O VAL A 24  ? O VAL A 34  
A 3 4 N GLY A 25  ? N GLY A 35  O VAL A 34  ? O VAL A 44  
A 4 5 N LEU A 39  ? N LEU A 49  O ILE A 81  ? O ILE A 91  
A 5 6 O VAL A 84  ? O VAL A 94  N GLN A 73  ? N GLN A 83  
B 1 2 N GLY A 91  ? N GLY A 101 O LEU A 139 ? O LEU A 149 
B 2 3 N LEU A 138 ? N LEU A 148 O LYS A 146 ? O LYS A 156 
C 1 2 N VAL A 128 ? N VAL A 138 O ASN A 154 ? O ASN A 164 
D 1 2 N ILE A 392 ? N ILE A 402 O LEU A 453 ? O LEU A 463 
D 2 3 O LEU A 452 ? O LEU A 462 N TYR A 444 ? N TYR A 454 
D 3 4 O MET A 439 ? O MET A 449 N VAL A 426 ? N VAL A 436 
D 4 5 O ARG A 425 ? O ARG A 435 N LYS A 417 ? N LYS A 427 
E 1 2 N THR B 4   ? N THR B 79  O LEU B 41  ? O LEU B 116 
E 2 3 O VAL B 38  ? O VAL B 113 N ILE B 31  ? N ILE B 106 
F 1 2 O ILE B 28  ? O ILE B 103 N ILE B 17  ? N ILE B 92  
F 2 3 N PHE B 16  ? N PHE B 91  O PHE B 53  ? O PHE B 128 
F 3 4 N PHE B 52  ? N PHE B 127 O VAL B 59  ? O VAL B 134 
G 1 2 N TYR B 50  ? N TYR B 125 O ASN B 76  ? O ASN B 151 
G 2 3 O ASN B 75  ? O ASN B 150 N VAL B 67  ? N VAL B 142 
H 1 2 N TYR B 167 ? N TYR B 242 O SER B 179 ? O SER B 254 
H 2 3 N MET B 176 ? N MET B 251 O LYS B 195 ? O LYS B 270 
H 3 4 N LEU B 192 ? N LEU B 267 O LEU C 25  ? O LEU G 48  
H 4 5 N PHE C 28  ? N PHE G 51  O TRP C 52  ? O TRP G 75  
H 5 6 N LEU C 51  ? N LEU G 74  O GLY C 61  ? O GLY G 84  
I 1 2 N VAL C 132 ? N VAL G 155 O TYR C 142 ? O TYR G 165 
J 1 2 N VAL C 184 ? N VAL G 207 O VAL C 208 ? O VAL G 231 
J 2 3 N LEU C 205 ? N LEU G 228 O TYR C 218 ? O TYR G 241 
K 1 2 N CYS C 256 ? N CYS G 279 O VAL C 280 ? O VAL G 303 
K 2 3 N LEU C 277 ? N LEU G 300 O VAL C 290 ? O VAL G 313 
# 
_database_PDB_matrix.entry_id          4RER 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4RER 
_atom_sites.fract_transf_matrix[1][1]   0.007543 
_atom_sites.fract_transf_matrix[1][2]   0.004355 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008710 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005118 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLY A 1 1   ? 31.099  -36.034 -15.229 1.00 176.46 ? 11  GLY A N     1 
ATOM   2    C CA    . GLY A 1 1   ? 30.333  -35.645 -14.058 1.00 174.75 ? 11  GLY A CA    1 
ATOM   3    C C     . GLY A 1 1   ? 31.197  -35.040 -12.964 1.00 170.41 ? 11  GLY A C     1 
ATOM   4    O O     . GLY A 1 1   ? 31.860  -34.023 -13.178 1.00 169.07 ? 11  GLY A O     1 
ATOM   5    N N     . SER A 1 2   ? 31.184  -35.664 -11.787 1.00 186.78 ? 12  SER A N     1 
ATOM   6    C CA    . SER A 1 2   ? 31.990  -35.208 -10.650 1.00 182.80 ? 12  SER A CA    1 
ATOM   7    C C     . SER A 1 2   ? 32.539  -36.384 -9.840  1.00 181.28 ? 12  SER A C     1 
ATOM   8    O O     . SER A 1 2   ? 31.837  -37.366 -9.600  1.00 182.89 ? 12  SER A O     1 
ATOM   9    C CB    . SER A 1 2   ? 31.169  -34.290 -9.740  1.00 215.22 ? 12  SER A CB    1 
ATOM   10   O OG    . SER A 1 2   ? 30.031  -34.959 -9.224  1.00 216.72 ? 12  SER A OG    1 
ATOM   11   N N     . VAL A 1 3   ? 33.795  -36.271 -9.413  1.00 158.82 ? 13  VAL A N     1 
ATOM   12   C CA    . VAL A 1 3   ? 34.476  -37.352 -8.705  1.00 157.34 ? 13  VAL A CA    1 
ATOM   13   C C     . VAL A 1 3   ? 33.877  -37.575 -7.327  1.00 156.05 ? 13  VAL A C     1 
ATOM   14   O O     . VAL A 1 3   ? 33.504  -36.619 -6.651  1.00 154.69 ? 13  VAL A O     1 
ATOM   15   C CB    . VAL A 1 3   ? 35.984  -37.066 -8.567  1.00 154.58 ? 13  VAL A CB    1 
ATOM   16   C CG1   . VAL A 1 3   ? 36.713  -37.395 -9.857  1.00 156.25 ? 13  VAL A CG1   1 
ATOM   17   C CG2   . VAL A 1 3   ? 36.205  -35.617 -8.209  1.00 152.57 ? 13  VAL A CG2   1 
ATOM   18   N N     . LYS A 1 4   ? 33.764  -38.839 -6.922  1.00 197.76 ? 14  LYS A N     1 
ATOM   19   C CA    . LYS A 1 4   ? 33.322  -39.173 -5.570  1.00 196.66 ? 14  LYS A CA    1 
ATOM   20   C C     . LYS A 1 4   ? 33.868  -40.522 -5.103  1.00 196.50 ? 14  LYS A C     1 
ATOM   21   O O     . LYS A 1 4   ? 34.121  -41.412 -5.914  1.00 198.42 ? 14  LYS A O     1 
ATOM   22   C CB    . LYS A 1 4   ? 31.795  -39.181 -5.490  1.00 158.24 ? 14  LYS A CB    1 
ATOM   23   C CG    . LYS A 1 4   ? 31.129  -40.283 -6.283  1.00 162.02 ? 14  LYS A CG    1 
ATOM   24   C CD    . LYS A 1 4   ? 29.705  -40.490 -5.796  1.00 164.28 ? 14  LYS A CD    1 
ATOM   25   C CE    . LYS A 1 4   ? 29.020  -41.629 -6.533  1.00 168.39 ? 14  LYS A CE    1 
ATOM   26   N NZ    . LYS A 1 4   ? 27.713  -41.995 -5.916  1.00 170.71 ? 14  LYS A NZ    1 
ATOM   27   N N     . ILE A 1 5   ? 34.041  -40.663 -3.788  1.00 153.41 ? 15  ILE A N     1 
ATOM   28   C CA    . ILE A 1 5   ? 34.514  -41.907 -3.183  1.00 153.25 ? 15  ILE A CA    1 
ATOM   29   C C     . ILE A 1 5   ? 33.485  -42.388 -2.180  1.00 154.37 ? 15  ILE A C     1 
ATOM   30   O O     . ILE A 1 5   ? 33.152  -41.661 -1.245  1.00 152.86 ? 15  ILE A O     1 
ATOM   31   C CB    . ILE A 1 5   ? 35.869  -41.739 -2.460  1.00 149.75 ? 15  ILE A CB    1 
ATOM   32   C CG1   . ILE A 1 5   ? 36.680  -40.605 -3.081  1.00 148.00 ? 15  ILE A CG1   1 
ATOM   33   C CG2   . ILE A 1 5   ? 36.652  -43.040 -2.490  1.00 150.14 ? 15  ILE A CG2   1 
ATOM   34   C CD1   . ILE A 1 5   ? 37.930  -40.262 -2.314  1.00 144.68 ? 15  ILE A CD1   1 
ATOM   35   N N     . GLY A 1 6   ? 32.983  -43.604 -2.367  1.00 157.27 ? 16  GLY A N     1 
ATOM   36   C CA    . GLY A 1 6   ? 31.950  -44.126 -1.493  1.00 158.96 ? 16  GLY A CA    1 
ATOM   37   C C     . GLY A 1 6   ? 30.717  -43.251 -1.570  1.00 160.21 ? 16  GLY A C     1 
ATOM   38   O O     . GLY A 1 6   ? 30.148  -43.063 -2.641  1.00 162.46 ? 16  GLY A O     1 
ATOM   39   N N     . HIS A 1 7   ? 30.292  -42.732 -0.426  1.00 158.97 ? 17  HIS A N     1 
ATOM   40   C CA    . HIS A 1 7   ? 29.217  -41.754 -0.382  1.00 159.77 ? 17  HIS A CA    1 
ATOM   41   C C     . HIS A 1 7   ? 29.723  -40.309 -0.304  1.00 156.71 ? 17  HIS A C     1 
ATOM   42   O O     . HIS A 1 7   ? 28.930  -39.381 -0.149  1.00 157.03 ? 17  HIS A O     1 
ATOM   43   C CB    . HIS A 1 7   ? 28.295  -42.055 0.792   1.00 160.95 ? 17  HIS A CB    1 
ATOM   44   C CG    . HIS A 1 7   ? 27.196  -43.014 0.459   1.00 165.21 ? 17  HIS A CG    1 
ATOM   45   N ND1   . HIS A 1 7   ? 26.091  -42.644 -0.273  1.00 167.96 ? 17  HIS A ND1   1 
ATOM   46   C CD2   . HIS A 1 7   ? 27.029  -44.324 0.758   1.00 167.45 ? 17  HIS A CD2   1 
ATOM   47   C CE1   . HIS A 1 7   ? 25.287  -43.684 -0.408  1.00 171.73 ? 17  HIS A CE1   1 
ATOM   48   N NE2   . HIS A 1 7   ? 25.833  -44.716 0.208   1.00 171.55 ? 17  HIS A NE2   1 
ATOM   49   N N     . TYR A 1 8   ? 31.037  -40.122 -0.389  1.00 153.96 ? 18  TYR A N     1 
ATOM   50   C CA    . TYR A 1 8   ? 31.635  -38.787 -0.314  1.00 151.23 ? 18  TYR A CA    1 
ATOM   51   C C     . TYR A 1 8   ? 32.002  -38.212 -1.685  1.00 151.57 ? 18  TYR A C     1 
ATOM   52   O O     . TYR A 1 8   ? 32.754  -38.832 -2.435  1.00 151.80 ? 18  TYR A O     1 
ATOM   53   C CB    . TYR A 1 8   ? 32.884  -38.816 0.566   1.00 155.75 ? 18  TYR A CB    1 
ATOM   54   C CG    . TYR A 1 8   ? 32.605  -38.889 2.046   1.00 154.87 ? 18  TYR A CG    1 
ATOM   55   C CD1   . TYR A 1 8   ? 32.109  -37.790 2.727   1.00 154.09 ? 18  TYR A CD1   1 
ATOM   56   C CD2   . TYR A 1 8   ? 32.854  -40.050 2.768   1.00 155.01 ? 18  TYR A CD2   1 
ATOM   57   C CE1   . TYR A 1 8   ? 31.857  -37.842 4.081   1.00 153.52 ? 18  TYR A CE1   1 
ATOM   58   C CE2   . TYR A 1 8   ? 32.605  -40.115 4.127   1.00 154.44 ? 18  TYR A CE2   1 
ATOM   59   C CZ    . TYR A 1 8   ? 32.106  -39.004 4.779   1.00 153.70 ? 18  TYR A CZ    1 
ATOM   60   O OH    . TYR A 1 8   ? 31.856  -39.042 6.132   1.00 153.36 ? 18  TYR A OH    1 
ATOM   61   N N     . ILE A 1 9   ? 31.484  -37.024 -1.999  1.00 151.77 ? 19  ILE A N     1 
ATOM   62   C CA    . ILE A 1 9   ? 31.822  -36.338 -3.249  1.00 152.20 ? 19  ILE A CA    1 
ATOM   63   C C     . ILE A 1 9   ? 32.932  -35.310 -3.032  1.00 149.23 ? 19  ILE A C     1 
ATOM   64   O O     . ILE A 1 9   ? 32.949  -34.598 -2.024  1.00 147.42 ? 19  ILE A O     1 
ATOM   65   C CB    . ILE A 1 9   ? 30.583  -35.649 -3.876  1.00 154.69 ? 19  ILE A CB    1 
ATOM   66   C CG1   . ILE A 1 9   ? 30.054  -34.517 -2.989  1.00 153.60 ? 19  ILE A CG1   1 
ATOM   67   C CG2   . ILE A 1 9   ? 29.493  -36.665 -4.122  1.00 157.94 ? 19  ILE A CG2   1 
ATOM   68   C CD1   . ILE A 1 9   ? 30.409  -33.123 -3.484  1.00 152.72 ? 19  ILE A CD1   1 
ATOM   69   N N     . LEU A 1 10  ? 33.868  -35.241 -3.971  1.00 148.97 ? 20  LEU A N     1 
ATOM   70   C CA    . LEU A 1 10  ? 35.014  -34.355 -3.808  1.00 146.44 ? 20  LEU A CA    1 
ATOM   71   C C     . LEU A 1 10  ? 34.631  -32.918 -4.160  1.00 146.80 ? 20  LEU A C     1 
ATOM   72   O O     . LEU A 1 10  ? 33.939  -32.657 -5.146  1.00 149.16 ? 20  LEU A O     1 
ATOM   73   C CB    . LEU A 1 10  ? 36.205  -34.820 -4.649  1.00 146.21 ? 20  LEU A CB    1 
ATOM   74   C CG    . LEU A 1 10  ? 36.534  -36.318 -4.694  1.00 146.75 ? 20  LEU A CG    1 
ATOM   75   C CD1   . LEU A 1 10  ? 37.949  -36.522 -5.194  1.00 145.71 ? 20  LEU A CD1   1 
ATOM   76   C CD2   . LEU A 1 10  ? 36.355  -37.002 -3.358  1.00 145.56 ? 20  LEU A CD2   1 
ATOM   77   N N     . GLY A 1 11  ? 35.033  -32.015 -3.275  1.00 155.66 ? 21  GLY A N     1 
ATOM   78   C CA    . GLY A 1 11  ? 34.807  -30.583 -3.365  1.00 155.71 ? 21  GLY A CA    1 
ATOM   79   C C     . GLY A 1 11  ? 36.005  -29.721 -3.730  1.00 154.50 ? 21  GLY A C     1 
ATOM   80   O O     . GLY A 1 11  ? 36.816  -30.031 -4.610  1.00 154.79 ? 21  GLY A O     1 
ATOM   81   N N     . ASP A 1 12  ? 36.051  -28.576 -3.055  1.00 142.46 ? 22  ASP A N     1 
ATOM   82   C CA    . ASP A 1 12  ? 37.155  -27.626 -3.118  1.00 141.32 ? 22  ASP A CA    1 
ATOM   83   C C     . ASP A 1 12  ? 38.489  -28.227 -2.662  1.00 139.15 ? 22  ASP A C     1 
ATOM   84   O O     . ASP A 1 12  ? 38.520  -29.131 -1.829  1.00 137.95 ? 22  ASP A O     1 
ATOM   85   C CB    . ASP A 1 12  ? 36.815  -26.405 -2.261  1.00 198.64 ? 22  ASP A CB    1 
ATOM   86   C CG    . ASP A 1 12  ? 37.736  -25.238 -2.520  1.00 198.35 ? 22  ASP A CG    1 
ATOM   87   O OD1   . ASP A 1 12  ? 38.124  -25.035 -3.689  1.00 199.61 ? 22  ASP A OD1   1 
ATOM   88   O OD2   . ASP A 1 12  ? 38.071  -24.524 -1.553  1.00 197.10 ? 22  ASP A OD2   1 
ATOM   89   N N     . THR A 1 13  ? 39.587  -27.715 -3.210  1.00 138.85 ? 23  THR A N     1 
ATOM   90   C CA    . THR A 1 13  ? 40.934  -28.166 -2.856  1.00 136.99 ? 23  THR A CA    1 
ATOM   91   C C     . THR A 1 13  ? 41.434  -27.597 -1.528  1.00 134.94 ? 23  THR A C     1 
ATOM   92   O O     . THR A 1 13  ? 41.318  -26.400 -1.273  1.00 135.13 ? 23  THR A O     1 
ATOM   93   C CB    . THR A 1 13  ? 41.935  -27.785 -3.953  1.00 137.77 ? 23  THR A CB    1 
ATOM   94   O OG1   . THR A 1 13  ? 41.576  -28.450 -5.167  1.00 139.76 ? 23  THR A OG1   1 
ATOM   95   C CG2   . THR A 1 13  ? 43.341  -28.192 -3.567  1.00 136.00 ? 23  THR A CG2   1 
ATOM   96   N N     . LEU A 1 14  ? 41.958  -28.468 -0.671  1.00 133.21 ? 24  LEU A N     1 
ATOM   97   C CA    . LEU A 1 14  ? 42.575  -28.035 0.576   1.00 131.37 ? 24  LEU A CA    1 
ATOM   98   C C     . LEU A 1 14  ? 44.032  -27.598 0.414   1.00 130.56 ? 24  LEU A C     1 
ATOM   99   O O     . LEU A 1 14  ? 44.432  -26.566 0.951   1.00 130.13 ? 24  LEU A O     1 
ATOM   100  C CB    . LEU A 1 14  ? 42.481  -29.147 1.618   1.00 130.09 ? 24  LEU A CB    1 
ATOM   101  C CG    . LEU A 1 14  ? 41.085  -29.397 2.183   1.00 130.80 ? 24  LEU A CG    1 
ATOM   102  C CD1   . LEU A 1 14  ? 41.113  -30.565 3.146   1.00 129.81 ? 24  LEU A CD1   1 
ATOM   103  C CD2   . LEU A 1 14  ? 40.564  -28.146 2.872   1.00 130.89 ? 24  LEU A CD2   1 
ATOM   104  N N     . GLY A 1 15  ? 44.820  -28.372 -0.332  1.00 130.61 ? 25  GLY A N     1 
ATOM   105  C CA    . GLY A 1 15  ? 46.247  -28.105 -0.449  1.00 129.94 ? 25  GLY A CA    1 
ATOM   106  C C     . GLY A 1 15  ? 47.019  -29.053 -1.349  1.00 130.30 ? 25  GLY A C     1 
ATOM   107  O O     . GLY A 1 15  ? 46.460  -30.016 -1.868  1.00 131.06 ? 25  GLY A O     1 
ATOM   108  N N     . VAL A 1 16  ? 48.305  -28.766 -1.547  1.00 161.54 ? 26  VAL A N     1 
ATOM   109  C CA    . VAL A 1 16  ? 49.135  -29.526 -2.482  1.00 162.19 ? 26  VAL A CA    1 
ATOM   110  C C     . VAL A 1 16  ? 49.698  -30.829 -1.903  1.00 160.78 ? 26  VAL A C     1 
ATOM   111  O O     . VAL A 1 16  ? 49.799  -31.831 -2.611  1.00 161.55 ? 26  VAL A O     1 
ATOM   112  C CB    . VAL A 1 16  ? 50.306  -28.662 -3.013  1.00 203.23 ? 26  VAL A CB    1 
ATOM   113  C CG1   . VAL A 1 16  ? 49.772  -27.462 -3.784  1.00 205.14 ? 26  VAL A CG1   1 
ATOM   114  C CG2   . VAL A 1 16  ? 51.214  -28.205 -1.879  1.00 201.58 ? 26  VAL A CG2   1 
ATOM   115  N N     . GLY A 1 17  ? 50.071  -30.814 -0.627  1.00 178.75 ? 27  GLY A N     1 
ATOM   116  C CA    . GLY A 1 17  ? 50.581  -32.005 0.032   1.00 177.47 ? 27  GLY A CA    1 
ATOM   117  C C     . GLY A 1 17  ? 51.975  -32.416 -0.400  1.00 177.42 ? 27  GLY A C     1 
ATOM   118  O O     . GLY A 1 17  ? 52.686  -31.653 -1.052  1.00 178.22 ? 27  GLY A O     1 
ATOM   119  N N     . THR A 1 18  ? 52.364  -33.634 -0.034  1.00 207.90 ? 28  THR A N     1 
ATOM   120  C CA    . THR A 1 18  ? 53.698  -34.150 -0.338  1.00 207.85 ? 28  THR A CA    1 
ATOM   121  C C     . THR A 1 18  ? 53.718  -34.858 -1.696  1.00 209.68 ? 28  THR A C     1 
ATOM   122  O O     . THR A 1 18  ? 54.408  -34.444 -2.632  1.00 210.88 ? 28  THR A O     1 
ATOM   123  C CB    . THR A 1 18  ? 54.188  -35.128 0.766   1.00 136.21 ? 28  THR A CB    1 
ATOM   124  O OG1   . THR A 1 18  ? 53.860  -34.601 2.060   1.00 134.80 ? 28  THR A OG1   1 
ATOM   125  C CG2   . THR A 1 18  ? 55.705  -35.359 0.670   1.00 135.97 ? 28  THR A CG2   1 
ATOM   126  N N     . PHE A 1 19  ? 52.948  -35.934 -1.778  1.00 196.39 ? 29  PHE A N     1 
ATOM   127  C CA    . PHE A 1 19  ? 52.886  -36.795 -2.952  1.00 198.30 ? 29  PHE A CA    1 
ATOM   128  C C     . PHE A 1 19  ? 51.820  -36.300 -3.927  1.00 200.15 ? 29  PHE A C     1 
ATOM   129  O O     . PHE A 1 19  ? 52.093  -36.092 -5.110  1.00 201.94 ? 29  PHE A O     1 
ATOM   130  C CB    . PHE A 1 19  ? 52.640  -38.244 -2.529  1.00 185.02 ? 29  PHE A CB    1 
ATOM   131  C CG    . PHE A 1 19  ? 53.610  -38.736 -1.487  1.00 183.27 ? 29  PHE A CG    1 
ATOM   132  C CD1   . PHE A 1 19  ? 54.869  -39.196 -1.848  1.00 183.50 ? 29  PHE A CD1   1 
ATOM   133  C CD2   . PHE A 1 19  ? 53.265  -38.725 -0.146  1.00 181.59 ? 29  PHE A CD2   1 
ATOM   134  C CE1   . PHE A 1 19  ? 55.761  -39.643 -0.890  1.00 182.02 ? 29  PHE A CE1   1 
ATOM   135  C CE2   . PHE A 1 19  ? 54.151  -39.171 0.814   1.00 180.17 ? 29  PHE A CE2   1 
ATOM   136  C CZ    . PHE A 1 19  ? 55.401  -39.631 0.441   1.00 180.35 ? 29  PHE A CZ    1 
ATOM   137  N N     . GLY A 1 20  ? 50.594  -36.156 -3.435  1.00 189.96 ? 30  GLY A N     1 
ATOM   138  C CA    . GLY A 1 20  ? 49.502  -35.679 -4.262  1.00 191.73 ? 30  GLY A CA    1 
ATOM   139  C C     . GLY A 1 20  ? 48.574  -34.773 -3.477  1.00 190.86 ? 30  GLY A C     1 
ATOM   140  O O     . GLY A 1 20  ? 48.659  -34.695 -2.249  1.00 188.99 ? 30  GLY A O     1 
ATOM   141  N N     . LYS A 1 21  ? 47.694  -34.075 -4.191  1.00 133.54 ? 31  LYS A N     1 
ATOM   142  C CA    . LYS A 1 21  ? 46.922  -32.996 -3.589  1.00 133.00 ? 31  LYS A CA    1 
ATOM   143  C C     . LYS A 1 21  ? 45.829  -33.533 -2.670  1.00 132.48 ? 31  LYS A C     1 
ATOM   144  O O     . LYS A 1 21  ? 45.615  -34.742 -2.588  1.00 132.78 ? 31  LYS A O     1 
ATOM   145  C CB    . LYS A 1 21  ? 46.313  -32.110 -4.683  1.00 155.28 ? 31  LYS A CB    1 
ATOM   146  C CG    . LYS A 1 21  ? 45.263  -32.798 -5.538  1.00 157.44 ? 31  LYS A CG    1 
ATOM   147  C CD    . LYS A 1 21  ? 44.877  -31.941 -6.730  1.00 159.68 ? 31  LYS A CD    1 
ATOM   148  C CE    . LYS A 1 21  ? 46.003  -31.886 -7.747  1.00 160.73 ? 31  LYS A CE    1 
ATOM   149  N NZ    . LYS A 1 21  ? 45.668  -31.016 -8.909  1.00 163.15 ? 31  LYS A NZ    1 
ATOM   150  N N     . VAL A 1 22  ? 45.132  -32.624 -1.989  1.00 131.97 ? 32  VAL A N     1 
ATOM   151  C CA    . VAL A 1 22  ? 44.070  -32.997 -1.059  1.00 131.67 ? 32  VAL A CA    1 
ATOM   152  C C     . VAL A 1 22  ? 42.842  -32.100 -1.206  1.00 132.85 ? 32  VAL A C     1 
ATOM   153  O O     . VAL A 1 22  ? 42.967  -30.886 -1.368  1.00 132.90 ? 32  VAL A O     1 
ATOM   154  C CB    . VAL A 1 22  ? 44.562  -32.940 0.383   1.00 129.49 ? 32  VAL A CB    1 
ATOM   155  C CG1   . VAL A 1 22  ? 45.623  -33.993 0.602   1.00 128.51 ? 32  VAL A CG1   1 
ATOM   156  C CG2   . VAL A 1 22  ? 45.115  -31.564 0.684   1.00 128.65 ? 32  VAL A CG2   1 
ATOM   157  N N     . LYS A 1 23  ? 41.657  -32.702 -1.172  1.00 134.04 ? 33  LYS A N     1 
ATOM   158  C CA    . LYS A 1 23  ? 40.409  -31.949 -1.296  1.00 135.37 ? 33  LYS A CA    1 
ATOM   159  C C     . LYS A 1 23  ? 39.443  -32.313 -0.171  1.00 135.16 ? 33  LYS A C     1 
ATOM   160  O O     . LYS A 1 23  ? 39.730  -33.203 0.630   1.00 134.15 ? 33  LYS A O     1 
ATOM   161  C CB    . LYS A 1 23  ? 39.742  -32.207 -2.653  1.00 176.67 ? 33  LYS A CB    1 
ATOM   162  C CG    . LYS A 1 23  ? 40.612  -31.925 -3.867  1.00 177.40 ? 33  LYS A CG    1 
ATOM   163  C CD    . LYS A 1 23  ? 39.752  -31.631 -5.086  1.00 180.10 ? 33  LYS A CD    1 
ATOM   164  C CE    . LYS A 1 23  ? 40.496  -31.907 -6.389  1.00 181.47 ? 33  LYS A CE    1 
ATOM   165  N NZ    . LYS A 1 23  ? 41.716  -31.070 -6.570  1.00 180.50 ? 33  LYS A NZ    1 
ATOM   166  N N     . VAL A 1 24  ? 38.294  -31.639 -0.124  1.00 136.34 ? 34  VAL A N     1 
ATOM   167  C CA    . VAL A 1 24  ? 37.268  -31.943 0.872   1.00 136.62 ? 34  VAL A CA    1 
ATOM   168  C C     . VAL A 1 24  ? 36.218  -32.887 0.298   1.00 138.92 ? 34  VAL A C     1 
ATOM   169  O O     . VAL A 1 24  ? 35.764  -32.719 -0.830  1.00 140.76 ? 34  VAL A O     1 
ATOM   170  C CB    . VAL A 1 24  ? 36.559  -30.663 1.412   1.00 136.76 ? 34  VAL A CB    1 
ATOM   171  C CG1   . VAL A 1 24  ? 37.551  -29.736 2.052   1.00 134.81 ? 34  VAL A CG1   1 
ATOM   172  C CG2   . VAL A 1 24  ? 35.808  -29.932 0.318   1.00 138.78 ? 34  VAL A CG2   1 
ATOM   173  N N     . GLY A 1 25  ? 35.856  -33.908 1.061   1.00 143.75 ? 35  GLY A N     1 
ATOM   174  C CA    . GLY A 1 25  ? 34.751  -34.765 0.677   1.00 146.25 ? 35  GLY A CA    1 
ATOM   175  C C     . GLY A 1 25  ? 33.473  -34.310 1.348   1.00 147.34 ? 35  GLY A C     1 
ATOM   176  O O     . GLY A 1 25  ? 33.518  -33.654 2.387   1.00 145.95 ? 35  GLY A O     1 
ATOM   177  N N     . LYS A 1 26  ? 32.329  -34.644 0.765   1.00 145.34 ? 36  LYS A N     1 
ATOM   178  C CA    . LYS A 1 26  ? 31.057  -34.339 1.402   1.00 146.74 ? 36  LYS A CA    1 
ATOM   179  C C     . LYS A 1 26  ? 30.086  -35.499 1.237   1.00 149.51 ? 36  LYS A C     1 
ATOM   180  O O     . LYS A 1 26  ? 29.818  -35.927 0.118   1.00 151.48 ? 36  LYS A O     1 
ATOM   181  C CB    . LYS A 1 26  ? 30.466  -33.052 0.827   1.00 152.11 ? 36  LYS A CB    1 
ATOM   182  C CG    . LYS A 1 26  ? 29.387  -32.436 1.697   1.00 152.91 ? 36  LYS A CG    1 
ATOM   183  C CD    . LYS A 1 26  ? 29.159  -30.967 1.360   1.00 152.96 ? 36  LYS A CD    1 
ATOM   184  C CE    . LYS A 1 26  ? 28.334  -30.276 2.443   1.00 153.28 ? 36  LYS A CE    1 
ATOM   185  N NZ    . LYS A 1 26  ? 28.202  -28.810 2.212   1.00 153.30 ? 36  LYS A NZ    1 
ATOM   186  N N     . HIS A 1 27  ? 29.564  -36.007 2.350   1.00 149.91 ? 37  HIS A N     1 
ATOM   187  C CA    . HIS A 1 27  ? 28.658  -37.154 2.323   1.00 152.79 ? 37  HIS A CA    1 
ATOM   188  C C     . HIS A 1 27  ? 27.368  -36.804 1.576   1.00 155.77 ? 37  HIS A C     1 
ATOM   189  O O     . HIS A 1 27  ? 26.722  -35.800 1.872   1.00 155.92 ? 37  HIS A O     1 
ATOM   190  C CB    . HIS A 1 27  ? 28.351  -37.625 3.751   1.00 152.75 ? 37  HIS A CB    1 
ATOM   191  C CG    . HIS A 1 27  ? 27.907  -39.054 3.844   1.00 155.20 ? 37  HIS A CG    1 
ATOM   192  N ND1   . HIS A 1 27  ? 26.585  -39.430 3.748   1.00 158.64 ? 37  HIS A ND1   1 
ATOM   193  C CD2   . HIS A 1 27  ? 28.609  -40.197 4.036   1.00 154.94 ? 37  HIS A CD2   1 
ATOM   194  C CE1   . HIS A 1 27  ? 26.492  -40.743 3.868   1.00 160.49 ? 37  HIS A CE1   1 
ATOM   195  N NE2   . HIS A 1 27  ? 27.706  -41.232 4.045   1.00 158.28 ? 37  HIS A NE2   1 
ATOM   196  N N     . GLU A 1 28  ? 27.009  -37.634 0.602   1.00 158.31 ? 38  GLU A N     1 
ATOM   197  C CA    . GLU A 1 28  ? 25.840  -37.389 -0.231  1.00 161.43 ? 38  GLU A CA    1 
ATOM   198  C C     . GLU A 1 28  ? 24.577  -37.175 0.592   1.00 163.21 ? 38  GLU A C     1 
ATOM   199  O O     . GLU A 1 28  ? 23.733  -36.352 0.246   1.00 164.60 ? 38  GLU A O     1 
ATOM   200  C CB    . GLU A 1 28  ? 25.631  -38.552 -1.202  1.00 239.77 ? 38  GLU A CB    1 
ATOM   201  C CG    . GLU A 1 28  ? 26.688  -38.660 -2.293  1.00 238.86 ? 38  GLU A CG    1 
ATOM   202  C CD    . GLU A 1 28  ? 26.498  -39.885 -3.176  1.00 241.94 ? 38  GLU A CD    1 
ATOM   203  O OE1   . GLU A 1 28  ? 25.978  -40.904 -2.674  1.00 243.87 ? 38  GLU A OE1   1 
ATOM   204  O OE2   . GLU A 1 28  ? 26.863  -39.830 -4.371  1.00 242.69 ? 38  GLU A OE2   1 
ATOM   205  N N     . LEU A 1 29  ? 24.466  -37.912 1.691   1.00 163.30 ? 39  LEU A N     1 
ATOM   206  C CA    . LEU A 1 29  ? 23.250  -37.924 2.494   1.00 165.53 ? 39  LEU A CA    1 
ATOM   207  C C     . LEU A 1 29  ? 23.328  -36.937 3.653   1.00 163.33 ? 39  LEU A C     1 
ATOM   208  O O     . LEU A 1 29  ? 22.639  -35.919 3.664   1.00 163.88 ? 39  LEU A O     1 
ATOM   209  C CB    . LEU A 1 29  ? 22.974  -39.333 3.030   1.00 167.60 ? 39  LEU A CB    1 
ATOM   210  C CG    . LEU A 1 29  ? 22.615  -40.460 2.054   1.00 170.88 ? 39  LEU A CG    1 
ATOM   211  C CD1   . LEU A 1 29  ? 23.813  -40.921 1.253   1.00 169.27 ? 39  LEU A CD1   1 
ATOM   212  C CD2   . LEU A 1 29  ? 22.020  -41.635 2.796   1.00 173.61 ? 39  LEU A CD2   1 
ATOM   213  N N     . THR A 1 30  ? 24.177  -37.244 4.625   1.00 161.01 ? 40  THR A N     1 
ATOM   214  C CA    . THR A 1 30  ? 24.294  -36.443 5.839   1.00 159.19 ? 40  THR A CA    1 
ATOM   215  C C     . THR A 1 30  ? 24.940  -35.091 5.615   1.00 156.53 ? 40  THR A C     1 
ATOM   216  O O     . THR A 1 30  ? 24.460  -34.071 6.109   1.00 156.49 ? 40  THR A O     1 
ATOM   217  C CB    . THR A 1 30  ? 25.123  -37.159 6.888   1.00 157.50 ? 40  THR A CB    1 
ATOM   218  O OG1   . THR A 1 30  ? 26.474  -37.265 6.416   1.00 154.78 ? 40  THR A OG1   1 
ATOM   219  C CG2   . THR A 1 30  ? 24.566  -38.536 7.136   1.00 160.28 ? 40  THR A CG2   1 
ATOM   220  N N     . GLY A 1 31  ? 26.029  -35.080 4.860   1.00 154.55 ? 41  GLY A N     1 
ATOM   221  C CA    . GLY A 1 31  ? 26.795  -33.864 4.703   1.00 152.06 ? 41  GLY A CA    1 
ATOM   222  C C     . GLY A 1 31  ? 28.021  -33.765 5.585   1.00 148.95 ? 41  GLY A C     1 
ATOM   223  O O     . GLY A 1 31  ? 28.462  -32.665 5.897   1.00 147.24 ? 41  GLY A O     1 
ATOM   224  N N     . HIS A 1 32  ? 28.550  -34.901 6.024   1.00 148.46 ? 42  HIS A N     1 
ATOM   225  C CA    . HIS A 1 32  ? 29.799  -34.902 6.783   1.00 145.61 ? 42  HIS A CA    1 
ATOM   226  C C     . HIS A 1 32  ? 30.982  -34.476 5.911   1.00 143.54 ? 42  HIS A C     1 
ATOM   227  O O     . HIS A 1 32  ? 30.959  -34.655 4.697   1.00 144.46 ? 42  HIS A O     1 
ATOM   228  C CB    . HIS A 1 32  ? 30.064  -36.282 7.386   1.00 145.88 ? 42  HIS A CB    1 
ATOM   229  C CG    . HIS A 1 32  ? 31.282  -36.336 8.253   1.00 143.21 ? 42  HIS A CG    1 
ATOM   230  N ND1   . HIS A 1 32  ? 32.402  -37.067 7.922   1.00 141.84 ? 42  HIS A ND1   1 
ATOM   231  C CD2   . HIS A 1 32  ? 31.560  -35.735 9.433   1.00 141.83 ? 42  HIS A CD2   1 
ATOM   232  C CE1   . HIS A 1 32  ? 33.316  -36.919 8.865   1.00 139.70 ? 42  HIS A CE1   1 
ATOM   233  N NE2   . HIS A 1 32  ? 32.830  -36.116 9.794   1.00 139.67 ? 42  HIS A NE2   1 
ATOM   234  N N     . LYS A 1 33  ? 32.015  -33.920 6.536   1.00 141.01 ? 43  LYS A N     1 
ATOM   235  C CA    . LYS A 1 33  ? 33.189  -33.432 5.819   1.00 139.15 ? 43  LYS A CA    1 
ATOM   236  C C     . LYS A 1 33  ? 34.421  -34.281 6.123   1.00 137.38 ? 43  LYS A C     1 
ATOM   237  O O     . LYS A 1 33  ? 34.731  -34.531 7.287   1.00 136.39 ? 43  LYS A O     1 
ATOM   238  C CB    . LYS A 1 33  ? 33.463  -31.972 6.186   1.00 185.58 ? 43  LYS A CB    1 
ATOM   239  C CG    . LYS A 1 33  ? 32.241  -31.066 6.150   1.00 187.31 ? 43  LYS A CG    1 
ATOM   240  C CD    . LYS A 1 33  ? 31.754  -30.848 4.733   1.00 188.91 ? 43  LYS A CD    1 
ATOM   241  C CE    . LYS A 1 33  ? 32.824  -30.180 3.888   1.00 187.61 ? 43  LYS A CE    1 
ATOM   242  N NZ    . LYS A 1 33  ? 33.273  -28.886 4.468   1.00 186.34 ? 43  LYS A NZ    1 
ATOM   243  N N     . VAL A 1 34  ? 35.121  -34.728 5.087   1.00 137.17 ? 44  VAL A N     1 
ATOM   244  C CA    . VAL A 1 34  ? 36.356  -35.484 5.275   1.00 135.56 ? 44  VAL A CA    1 
ATOM   245  C C     . VAL A 1 34  ? 37.449  -34.999 4.333   1.00 134.38 ? 44  VAL A C     1 
ATOM   246  O O     . VAL A 1 34  ? 37.178  -34.623 3.198   1.00 135.50 ? 44  VAL A O     1 
ATOM   247  C CB    . VAL A 1 34  ? 36.147  -37.001 5.062   1.00 137.02 ? 44  VAL A CB    1 
ATOM   248  C CG1   . VAL A 1 34  ? 35.224  -37.563 6.111   1.00 138.25 ? 44  VAL A CG1   1 
ATOM   249  C CG2   . VAL A 1 34  ? 35.585  -37.280 3.691   1.00 139.16 ? 44  VAL A CG2   1 
ATOM   250  N N     . ALA A 1 35  ? 38.689  -35.002 4.803   1.00 132.33 ? 45  ALA A N     1 
ATOM   251  C CA    . ALA A 1 35  ? 39.813  -34.612 3.965   1.00 131.36 ? 45  ALA A CA    1 
ATOM   252  C C     . ALA A 1 35  ? 40.421  -35.836 3.287   1.00 131.73 ? 45  ALA A C     1 
ATOM   253  O O     . ALA A 1 35  ? 40.791  -36.791 3.968   1.00 131.19 ? 45  ALA A O     1 
ATOM   254  C CB    . ALA A 1 35  ? 40.854  -33.890 4.789   1.00 207.25 ? 45  ALA A CB    1 
ATOM   255  N N     . VAL A 1 36  ? 40.529  -35.808 1.955   1.00 132.83 ? 46  VAL A N     1 
ATOM   256  C CA    . VAL A 1 36  ? 41.093  -36.931 1.198   1.00 133.54 ? 46  VAL A CA    1 
ATOM   257  C C     . VAL A 1 36  ? 42.463  -36.625 0.600   1.00 132.45 ? 46  VAL A C     1 
ATOM   258  O O     . VAL A 1 36  ? 42.699  -35.547 0.061   1.00 132.32 ? 46  VAL A O     1 
ATOM   259  C CB    . VAL A 1 36  ? 40.159  -37.375 0.062   1.00 136.24 ? 46  VAL A CB    1 
ATOM   260  C CG1   . VAL A 1 36  ? 38.918  -38.000 0.634   1.00 137.67 ? 46  VAL A CG1   1 
ATOM   261  C CG2   . VAL A 1 36  ? 39.790  -36.201 -0.807  1.00 137.01 ? 46  VAL A CG2   1 
ATOM   262  N N     . LYS A 1 37  ? 43.375  -37.579 0.723   1.00 131.85 ? 47  LYS A N     1 
ATOM   263  C CA    . LYS A 1 37  ? 44.692  -37.431 0.131   1.00 131.11 ? 47  LYS A CA    1 
ATOM   264  C C     . LYS A 1 37  ? 44.726  -38.293 -1.112  1.00 133.12 ? 47  LYS A C     1 
ATOM   265  O O     . LYS A 1 37  ? 44.697  -39.521 -1.027  1.00 133.86 ? 47  LYS A O     1 
ATOM   266  C CB    . LYS A 1 37  ? 45.801  -37.830 1.115   1.00 138.96 ? 47  LYS A CB    1 
ATOM   267  C CG    . LYS A 1 37  ? 47.210  -37.406 0.687   1.00 138.02 ? 47  LYS A CG    1 
ATOM   268  C CD    . LYS A 1 37  ? 48.278  -37.849 1.684   1.00 136.25 ? 47  LYS A CD    1 
ATOM   269  C CE    . LYS A 1 37  ? 49.665  -37.420 1.224   1.00 135.60 ? 47  LYS A CE    1 
ATOM   270  N NZ    . LYS A 1 37  ? 50.734  -37.920 2.128   1.00 134.10 ? 47  LYS A NZ    1 
ATOM   271  N N     . ILE A 1 38  ? 44.769  -37.644 -2.269  1.00 134.26 ? 48  ILE A N     1 
ATOM   272  C CA    . ILE A 1 38  ? 44.751  -38.353 -3.538  1.00 136.53 ? 48  ILE A CA    1 
ATOM   273  C C     . ILE A 1 38  ? 46.166  -38.585 -4.041  1.00 136.15 ? 48  ILE A C     1 
ATOM   274  O O     . ILE A 1 38  ? 46.846  -37.642 -4.443  1.00 135.69 ? 48  ILE A O     1 
ATOM   275  C CB    . ILE A 1 38  ? 43.960  -37.577 -4.611  1.00 138.49 ? 48  ILE A CB    1 
ATOM   276  C CG1   . ILE A 1 38  ? 42.570  -37.200 -4.103  1.00 138.90 ? 48  ILE A CG1   1 
ATOM   277  C CG2   . ILE A 1 38  ? 43.844  -38.393 -5.880  1.00 141.19 ? 48  ILE A CG2   1 
ATOM   278  C CD1   . ILE A 1 38  ? 42.465  -35.775 -3.619  1.00 137.53 ? 48  ILE A CD1   1 
ATOM   279  N N     . LEU A 1 39  ? 46.601  -39.841 -4.030  1.00 171.48 ? 49  LEU A N     1 
ATOM   280  C CA    . LEU A 1 39  ? 47.912  -40.198 -4.557  1.00 171.47 ? 49  LEU A CA    1 
ATOM   281  C C     . LEU A 1 39  ? 47.741  -40.920 -5.885  1.00 174.39 ? 49  LEU A C     1 
ATOM   282  O O     . LEU A 1 39  ? 47.298  -42.067 -5.923  1.00 175.80 ? 49  LEU A O     1 
ATOM   283  C CB    . LEU A 1 39  ? 48.686  -41.074 -3.569  1.00 184.05 ? 49  LEU A CB    1 
ATOM   284  C CG    . LEU A 1 39  ? 48.895  -40.516 -2.158  1.00 181.37 ? 49  LEU A CG    1 
ATOM   285  C CD1   . LEU A 1 39  ? 47.794  -40.985 -1.224  1.00 181.31 ? 49  LEU A CD1   1 
ATOM   286  C CD2   . LEU A 1 39  ? 50.258  -40.904 -1.613  1.00 179.87 ? 49  LEU A CD2   1 
ATOM   287  N N     . ASN A 1 40  ? 48.105  -40.246 -6.972  1.00 177.96 ? 50  ASN A N     1 
ATOM   288  C CA    . ASN A 1 40  ? 47.901  -40.776 -8.314  1.00 181.05 ? 50  ASN A CA    1 
ATOM   289  C C     . ASN A 1 40  ? 48.838  -41.945 -8.599  1.00 181.85 ? 50  ASN A C     1 
ATOM   290  O O     . ASN A 1 40  ? 50.043  -41.855 -8.367  1.00 180.45 ? 50  ASN A O     1 
ATOM   291  C CB    . ASN A 1 40  ? 48.087  -39.663 -9.353  1.00 222.85 ? 50  ASN A CB    1 
ATOM   292  C CG    . ASN A 1 40  ? 47.881  -40.144 -10.779 1.00 226.31 ? 50  ASN A CG    1 
ATOM   293  O OD1   . ASN A 1 40  ? 48.621  -39.766 -11.689 1.00 227.51 ? 50  ASN A OD1   1 
ATOM   294  N ND2   . ASN A 1 40  ? 46.875  -40.986 -10.978 1.00 228.19 ? 50  ASN A ND2   1 
ATOM   295  N N     . ARG A 1 41  ? 48.268  -43.044 -9.084  1.00 173.54 ? 51  ARG A N     1 
ATOM   296  C CA    . ARG A 1 41  ? 49.040  -44.240 -9.398  1.00 174.78 ? 51  ARG A CA    1 
ATOM   297  C C     . ARG A 1 41  ? 50.168  -43.939 -10.383 1.00 175.68 ? 51  ARG A C     1 
ATOM   298  O O     . ARG A 1 41  ? 51.309  -44.324 -10.146 1.00 174.79 ? 51  ARG A O     1 
ATOM   299  C CB    . ARG A 1 41  ? 48.127  -45.333 -9.959  1.00 180.44 ? 51  ARG A CB    1 
ATOM   300  C CG    . ARG A 1 41  ? 47.276  -46.054 -8.921  1.00 180.00 ? 51  ARG A CG    1 
ATOM   301  C CD    . ARG A 1 41  ? 48.047  -47.185 -8.249  1.00 179.43 ? 51  ARG A CD    1 
ATOM   302  N NE    . ARG A 1 41  ? 47.148  -48.235 -7.769  1.00 180.91 ? 51  ARG A NE    1 
ATOM   303  C CZ    . ARG A 1 41  ? 46.717  -49.256 -8.508  1.00 184.42 ? 51  ARG A CZ    1 
ATOM   304  N NH1   . ARG A 1 41  ? 47.103  -49.377 -9.770  1.00 186.76 ? 51  ARG A NH1   1 
ATOM   305  N NH2   . ARG A 1 41  ? 45.897  -50.160 -7.988  1.00 185.85 ? 51  ARG A NH2   1 
ATOM   306  N N     . GLN A 1 42  ? 49.848  -43.240 -11.473 1.00 195.71 ? 52  GLN A N     1 
ATOM   307  C CA    . GLN A 1 42  ? 50.838  -42.885 -12.491 1.00 197.04 ? 52  GLN A CA    1 
ATOM   308  C C     . GLN A 1 42  ? 52.046  -42.150 -11.910 1.00 194.39 ? 52  GLN A C     1 
ATOM   309  O O     . GLN A 1 42  ? 53.183  -42.398 -12.315 1.00 194.97 ? 52  GLN A O     1 
ATOM   310  C CB    . GLN A 1 42  ? 50.199  -42.028 -13.588 1.00 205.96 ? 52  GLN A CB    1 
ATOM   311  C CG    . GLN A 1 42  ? 49.389  -42.816 -14.606 1.00 209.69 ? 52  GLN A CG    1 
ATOM   312  C CD    . GLN A 1 42  ? 49.140  -42.032 -15.886 1.00 212.39 ? 52  GLN A CD    1 
ATOM   313  O OE1   . GLN A 1 42  ? 49.199  -40.802 -15.894 1.00 211.34 ? 52  GLN A OE1   1 
ATOM   314  N NE2   . GLN A 1 42  ? 48.871  -42.744 -16.979 1.00 216.11 ? 52  GLN A NE2   1 
ATOM   315  N N     . LYS A 1 43  ? 51.794  -41.256 -10.956 1.00 147.02 ? 53  LYS A N     1 
ATOM   316  C CA    . LYS A 1 43  ? 52.858  -40.464 -10.340 1.00 144.64 ? 53  LYS A CA    1 
ATOM   317  C C     . LYS A 1 43  ? 53.677  -41.276 -9.339  1.00 142.69 ? 53  LYS A C     1 
ATOM   318  O O     . LYS A 1 43  ? 54.907  -41.219 -9.344  1.00 142.21 ? 53  LYS A O     1 
ATOM   319  C CB    . LYS A 1 43  ? 52.277  -39.220 -9.657  1.00 208.12 ? 53  LYS A CB    1 
ATOM   320  C CG    . LYS A 1 43  ? 51.752  -38.169 -10.631 1.00 209.92 ? 53  LYS A CG    1 
ATOM   321  C CD    . LYS A 1 43  ? 51.359  -36.877 -9.926  1.00 208.11 ? 53  LYS A CD    1 
ATOM   322  C CE    . LYS A 1 43  ? 51.155  -35.741 -10.923 1.00 210.00 ? 53  LYS A CE    1 
ATOM   323  N NZ    . LYS A 1 43  ? 50.204  -36.101 -12.012 1.00 212.91 ? 53  LYS A NZ    1 
ATOM   324  N N     . ILE A 1 44  ? 52.996  -42.036 -8.486  1.00 234.05 ? 54  ILE A N     1 
ATOM   325  C CA    . ILE A 1 44  ? 53.678  -42.802 -7.447  1.00 232.26 ? 54  ILE A CA    1 
ATOM   326  C C     . ILE A 1 44  ? 54.377  -44.036 -8.021  1.00 234.09 ? 54  ILE A C     1 
ATOM   327  O O     . ILE A 1 44  ? 55.301  -44.570 -7.409  1.00 232.96 ? 54  ILE A O     1 
ATOM   328  C CB    . ILE A 1 44  ? 52.700  -43.227 -6.318  1.00 233.32 ? 54  ILE A CB    1 
ATOM   329  C CG1   . ILE A 1 44  ? 51.638  -44.204 -6.836  1.00 235.82 ? 54  ILE A CG1   1 
ATOM   330  C CG2   . ILE A 1 44  ? 52.047  -41.998 -5.689  1.00 231.56 ? 54  ILE A CG2   1 
ATOM   331  C CD1   . ILE A 1 44  ? 51.894  -45.659 -6.477  1.00 236.50 ? 54  ILE A CD1   1 
ATOM   332  N N     . ARG A 1 45  ? 53.937  -44.482 -9.195  1.00 196.72 ? 55  ARG A N     1 
ATOM   333  C CA    . ARG A 1 45  ? 54.583  -45.601 -9.876  1.00 198.96 ? 55  ARG A CA    1 
ATOM   334  C C     . ARG A 1 45  ? 55.969  -45.213 -10.369 1.00 199.06 ? 55  ARG A C     1 
ATOM   335  O O     . ARG A 1 45  ? 56.892  -46.027 -10.344 1.00 199.48 ? 55  ARG A O     1 
ATOM   336  C CB    . ARG A 1 45  ? 53.741  -46.086 -11.059 1.00 161.76 ? 55  ARG A CB    1 
ATOM   337  C CG    . ARG A 1 45  ? 52.635  -47.070 -10.714 1.00 162.79 ? 55  ARG A CG    1 
ATOM   338  C CD    . ARG A 1 45  ? 51.652  -47.183 -11.881 1.00 166.23 ? 55  ARG A CD    1 
ATOM   339  N NE    . ARG A 1 45  ? 50.662  -48.242 -11.693 1.00 167.96 ? 55  ARG A NE    1 
ATOM   340  C CZ    . ARG A 1 45  ? 49.655  -48.487 -12.530 1.00 171.08 ? 55  ARG A CZ    1 
ATOM   341  N NH1   . ARG A 1 45  ? 49.495  -47.745 -13.617 1.00 172.75 ? 55  ARG A NH1   1 
ATOM   342  N NH2   . ARG A 1 45  ? 48.804  -49.474 -12.276 1.00 172.77 ? 55  ARG A NH2   1 
ATOM   343  N N     . SER A 1 46  ? 56.101  -43.967 -10.820 1.00 268.69 ? 56  SER A N     1 
ATOM   344  C CA    . SER A 1 46  ? 57.353  -43.469 -11.383 1.00 269.23 ? 56  SER A CA    1 
ATOM   345  C C     . SER A 1 46  ? 58.499  -43.645 -10.396 1.00 266.92 ? 56  SER A C     1 
ATOM   346  O O     . SER A 1 46  ? 59.498  -44.301 -10.693 1.00 267.94 ? 56  SER A O     1 
ATOM   347  C CB    . SER A 1 46  ? 57.212  -41.994 -11.773 1.00 233.91 ? 56  SER A CB    1 
ATOM   348  O OG    . SER A 1 46  ? 58.417  -41.482 -12.315 1.00 234.73 ? 56  SER A OG    1 
ATOM   349  N N     . LEU A 1 47  ? 58.346  -43.046 -9.223  1.00 217.87 ? 57  LEU A N     1 
ATOM   350  C CA    . LEU A 1 47  ? 59.287  -43.221 -8.127  1.00 215.57 ? 57  LEU A CA    1 
ATOM   351  C C     . LEU A 1 47  ? 59.071  -44.561 -7.424  1.00 215.16 ? 57  LEU A C     1 
ATOM   352  O O     . LEU A 1 47  ? 58.033  -45.200 -7.585  1.00 216.24 ? 57  LEU A O     1 
ATOM   353  C CB    . LEU A 1 47  ? 59.175  -42.070 -7.123  1.00 161.77 ? 57  LEU A CB    1 
ATOM   354  C CG    . LEU A 1 47  ? 59.659  -40.680 -7.561  1.00 161.94 ? 57  LEU A CG    1 
ATOM   355  C CD1   . LEU A 1 47  ? 58.718  -40.014 -8.580  1.00 163.77 ? 57  LEU A CD1   1 
ATOM   356  C CD2   . LEU A 1 47  ? 59.871  -39.786 -6.339  1.00 159.25 ? 57  LEU A CD2   1 
ATOM   357  N N     . ASP A 1 48  ? 60.077  -44.983 -6.669  1.00 245.61 ? 58  ASP A N     1 
ATOM   358  C CA    . ASP A 1 48  ? 60.030  -46.191 -5.846  1.00 245.08 ? 58  ASP A CA    1 
ATOM   359  C C     . ASP A 1 48  ? 59.534  -45.899 -4.426  1.00 242.34 ? 58  ASP A C     1 
ATOM   360  O O     . ASP A 1 48  ? 59.843  -46.625 -3.482  1.00 241.31 ? 58  ASP A O     1 
ATOM   361  C CB    . ASP A 1 48  ? 61.377  -46.905 -5.839  1.00 263.79 ? 58  ASP A CB    1 
ATOM   362  C CG    . ASP A 1 48  ? 61.495  -47.899 -6.985  1.00 266.98 ? 58  ASP A CG    1 
ATOM   363  O OD1   . ASP A 1 48  ? 60.536  -48.676 -7.200  1.00 268.40 ? 58  ASP A OD1   1 
ATOM   364  O OD2   . ASP A 1 48  ? 62.524  -47.885 -7.690  1.00 268.31 ? 58  ASP A OD2   1 
ATOM   365  N N     . VAL A 1 49  ? 58.825  -44.783 -4.283  1.00 189.85 ? 59  VAL A N     1 
ATOM   366  C CA    . VAL A 1 49  ? 58.270  -44.349 -3.004  1.00 187.51 ? 59  VAL A CA    1 
ATOM   367  C C     . VAL A 1 49  ? 57.045  -45.173 -2.582  1.00 187.91 ? 59  VAL A C     1 
ATOM   368  O O     . VAL A 1 49  ? 56.362  -44.819 -1.622  1.00 186.40 ? 59  VAL A O     1 
ATOM   369  C CB    . VAL A 1 49  ? 57.868  -42.860 -3.037  1.00 157.88 ? 59  VAL A CB    1 
ATOM   370  C CG1   . VAL A 1 49  ? 59.075  -41.991 -3.340  1.00 157.63 ? 59  VAL A CG1   1 
ATOM   371  C CG2   . VAL A 1 49  ? 56.754  -42.624 -4.055  1.00 159.70 ? 59  VAL A CG2   1 
ATOM   372  N N     . VAL A 1 50  ? 56.737  -46.233 -3.329  1.00 196.61 ? 60  VAL A N     1 
ATOM   373  C CA    . VAL A 1 50  ? 55.680  -47.174 -2.940  1.00 197.48 ? 60  VAL A CA    1 
ATOM   374  C C     . VAL A 1 50  ? 55.807  -47.647 -1.479  1.00 195.70 ? 60  VAL A C     1 
ATOM   375  O O     . VAL A 1 50  ? 54.801  -47.890 -0.809  1.00 195.60 ? 60  VAL A O     1 
ATOM   376  C CB    . VAL A 1 50  ? 55.653  -48.422 -3.872  1.00 185.91 ? 60  VAL A CB    1 
ATOM   377  C CG1   . VAL A 1 50  ? 55.338  -48.017 -5.300  1.00 188.06 ? 60  VAL A CG1   1 
ATOM   378  C CG2   . VAL A 1 50  ? 56.970  -49.192 -3.818  1.00 186.10 ? 60  VAL A CG2   1 
ATOM   379  N N     . GLY A 1 51  ? 57.039  -47.772 -0.991  1.00 161.00 ? 61  GLY A N     1 
ATOM   380  C CA    . GLY A 1 51  ? 57.282  -48.120 0.397   1.00 159.35 ? 61  GLY A CA    1 
ATOM   381  C C     . GLY A 1 51  ? 57.106  -46.915 1.299   1.00 156.95 ? 61  GLY A C     1 
ATOM   382  O O     . GLY A 1 51  ? 56.673  -47.051 2.440   1.00 155.92 ? 61  GLY A O     1 
ATOM   383  N N     . LYS A 1 52  ? 57.444  -45.735 0.783   1.00 198.81 ? 62  LYS A N     1 
ATOM   384  C CA    . LYS A 1 52  ? 57.277  -44.480 1.514   1.00 196.87 ? 62  LYS A CA    1 
ATOM   385  C C     . LYS A 1 52  ? 55.817  -44.239 1.889   1.00 196.84 ? 62  LYS A C     1 
ATOM   386  O O     . LYS A 1 52  ? 55.510  -43.752 2.979   1.00 195.36 ? 62  LYS A O     1 
ATOM   387  C CB    . LYS A 1 52  ? 57.791  -43.303 0.681   1.00 190.67 ? 62  LYS A CB    1 
ATOM   388  C CG    . LYS A 1 52  ? 58.792  -42.415 1.392   1.00 188.96 ? 62  LYS A CG    1 
ATOM   389  C CD    . LYS A 1 52  ? 60.185  -42.600 0.816   1.00 189.56 ? 62  LYS A CD    1 
ATOM   390  C CE    . LYS A 1 52  ? 61.224  -41.798 1.594   1.00 188.10 ? 62  LYS A CE    1 
ATOM   391  N NZ    . LYS A 1 52  ? 61.538  -42.394 2.928   1.00 186.76 ? 62  LYS A NZ    1 
ATOM   392  N N     . ILE A 1 53  ? 54.925  -44.565 0.961   1.00 151.68 ? 63  ILE A N     1 
ATOM   393  C CA    . ILE A 1 53  ? 53.491  -44.416 1.178   1.00 152.10 ? 63  ILE A CA    1 
ATOM   394  C C     . ILE A 1 53  ? 52.923  -45.585 1.983   1.00 152.66 ? 63  ILE A C     1 
ATOM   395  O O     . ILE A 1 53  ? 52.001  -45.413 2.784   1.00 152.26 ? 63  ILE A O     1 
ATOM   396  C CB    . ILE A 1 53  ? 52.745  -44.292 -0.159  1.00 155.46 ? 63  ILE A CB    1 
ATOM   397  C CG1   . ILE A 1 53  ? 53.363  -43.168 -0.995  1.00 155.25 ? 63  ILE A CG1   1 
ATOM   398  C CG2   . ILE A 1 53  ? 51.260  -44.036 0.073   1.00 155.95 ? 63  ILE A CG2   1 
ATOM   399  C CD1   . ILE A 1 53  ? 52.997  -43.217 -2.462  1.00 157.63 ? 63  ILE A CD1   1 
ATOM   400  N N     . ARG A 1 54  ? 53.479  -46.773 1.767   1.00 139.25 ? 64  ARG A N     1 
ATOM   401  C CA    . ARG A 1 54  ? 53.050  -47.961 2.498   1.00 140.13 ? 64  ARG A CA    1 
ATOM   402  C C     . ARG A 1 54  ? 53.214  -47.785 4.008   1.00 138.19 ? 64  ARG A C     1 
ATOM   403  O O     . ARG A 1 54  ? 52.271  -48.004 4.772   1.00 138.48 ? 64  ARG A O     1 
ATOM   404  C CB    . ARG A 1 54  ? 53.831  -49.192 2.031   1.00 221.09 ? 64  ARG A CB    1 
ATOM   405  C CG    . ARG A 1 54  ? 53.561  -50.426 2.874   1.00 222.07 ? 64  ARG A CG    1 
ATOM   406  C CD    . ARG A 1 54  ? 54.419  -51.611 2.466   1.00 223.63 ? 64  ARG A CD    1 
ATOM   407  N NE    . ARG A 1 54  ? 54.978  -52.293 3.632   1.00 222.97 ? 64  ARG A NE    1 
ATOM   408  C CZ    . ARG A 1 54  ? 54.284  -53.073 4.456   1.00 223.97 ? 64  ARG A CZ    1 
ATOM   409  N NH1   . ARG A 1 54  ? 52.989  -53.280 4.256   1.00 225.69 ? 64  ARG A NH1   1 
ATOM   410  N NH2   . ARG A 1 54  ? 54.887  -53.647 5.489   1.00 223.44 ? 64  ARG A NH2   1 
ATOM   411  N N     . ARG A 1 55  ? 54.414  -47.383 4.426   1.00 197.06 ? 65  ARG A N     1 
ATOM   412  C CA    . ARG A 1 55  ? 54.729  -47.210 5.840   1.00 195.36 ? 65  ARG A CA    1 
ATOM   413  C C     . ARG A 1 55  ? 53.817  -46.170 6.477   1.00 194.34 ? 65  ARG A C     1 
ATOM   414  O O     . ARG A 1 55  ? 53.414  -46.313 7.630   1.00 193.93 ? 65  ARG A O     1 
ATOM   415  C CB    . ARG A 1 55  ? 56.198  -46.804 6.027   1.00 184.49 ? 65  ARG A CB    1 
ATOM   416  C CG    . ARG A 1 55  ? 56.546  -45.433 5.456   1.00 183.49 ? 65  ARG A CG    1 
ATOM   417  C CD    . ARG A 1 55  ? 57.891  -44.911 5.944   1.00 182.02 ? 65  ARG A CD    1 
ATOM   418  N NE    . ARG A 1 55  ? 59.003  -45.380 5.121   1.00 182.75 ? 65  ARG A NE    1 
ATOM   419  C CZ    . ARG A 1 55  ? 60.204  -44.808 5.089   1.00 182.01 ? 65  ARG A CZ    1 
ATOM   420  N NH1   . ARG A 1 55  ? 60.452  -43.736 5.829   1.00 180.55 ? 65  ARG A NH1   1 
ATOM   421  N NH2   . ARG A 1 55  ? 61.156  -45.302 4.310   1.00 182.96 ? 65  ARG A NH2   1 
ATOM   422  N N     . GLU A 1 56  ? 53.485  -45.135 5.712   1.00 123.86 ? 66  GLU A N     1 
ATOM   423  C CA    . GLU A 1 56  ? 52.679  -44.033 6.217   1.00 122.99 ? 66  GLU A CA    1 
ATOM   424  C C     . GLU A 1 56  ? 51.291  -44.505 6.616   1.00 124.18 ? 66  GLU A C     1 
ATOM   425  O O     . GLU A 1 56  ? 50.855  -44.301 7.749   1.00 123.55 ? 66  GLU A O     1 
ATOM   426  C CB    . GLU A 1 56  ? 52.571  -42.925 5.171   1.00 143.51 ? 66  GLU A CB    1 
ATOM   427  C CG    . GLU A 1 56  ? 51.674  -41.771 5.586   1.00 142.92 ? 66  GLU A CG    1 
ATOM   428  C CD    . GLU A 1 56  ? 51.507  -40.736 4.489   1.00 143.31 ? 66  GLU A CD    1 
ATOM   429  O OE1   . GLU A 1 56  ? 50.833  -39.711 4.739   1.00 142.95 ? 66  GLU A OE1   1 
ATOM   430  O OE2   . GLU A 1 56  ? 52.050  -40.946 3.381   1.00 144.15 ? 66  GLU A OE2   1 
ATOM   431  N N     . ILE A 1 57  ? 50.605  -45.145 5.676   1.00 134.20 ? 67  ILE A N     1 
ATOM   432  C CA    . ILE A 1 57  ? 49.255  -45.645 5.907   1.00 135.81 ? 67  ILE A CA    1 
ATOM   433  C C     . ILE A 1 57  ? 49.251  -46.734 6.984   1.00 136.29 ? 67  ILE A C     1 
ATOM   434  O O     . ILE A 1 57  ? 48.340  -46.802 7.815   1.00 136.78 ? 67  ILE A O     1 
ATOM   435  C CB    . ILE A 1 57  ? 48.637  -46.180 4.593   1.00 141.49 ? 67  ILE A CB    1 
ATOM   436  C CG1   . ILE A 1 57  ? 48.488  -45.037 3.586   1.00 141.26 ? 67  ILE A CG1   1 
ATOM   437  C CG2   . ILE A 1 57  ? 47.288  -46.838 4.847   1.00 143.55 ? 67  ILE A CG2   1 
ATOM   438  C CD1   . ILE A 1 57  ? 47.818  -45.433 2.299   1.00 143.71 ? 67  ILE A CD1   1 
ATOM   439  N N     . GLN A 1 58  ? 50.286  -47.568 6.974   1.00 196.47 ? 68  GLN A N     1 
ATOM   440  C CA    . GLN A 1 58  ? 50.430  -48.635 7.956   1.00 197.06 ? 68  GLN A CA    1 
ATOM   441  C C     . GLN A 1 58  ? 50.424  -48.083 9.379   1.00 195.50 ? 68  GLN A C     1 
ATOM   442  O O     . GLN A 1 58  ? 49.766  -48.631 10.264  1.00 196.49 ? 68  GLN A O     1 
ATOM   443  C CB    . GLN A 1 58  ? 51.719  -49.419 7.700   1.00 185.87 ? 68  GLN A CB    1 
ATOM   444  C CG    . GLN A 1 58  ? 51.935  -50.601 8.630   1.00 186.77 ? 68  GLN A CG    1 
ATOM   445  C CD    . GLN A 1 58  ? 53.297  -51.246 8.443   1.00 186.58 ? 68  GLN A CD    1 
ATOM   446  O OE1   . GLN A 1 58  ? 53.918  -51.116 7.387   1.00 186.57 ? 68  GLN A OE1   1 
ATOM   447  N NE2   . GLN A 1 58  ? 53.771  -51.939 9.472   1.00 186.60 ? 68  GLN A NE2   1 
ATOM   448  N N     . ASN A 1 59  ? 51.155  -46.991 9.587   1.00 142.38 ? 69  ASN A N     1 
ATOM   449  C CA    . ASN A 1 59  ? 51.258  -46.364 10.902  1.00 140.96 ? 69  ASN A CA    1 
ATOM   450  C C     . ASN A 1 59  ? 50.018  -45.564 11.292  1.00 141.11 ? 69  ASN A C     1 
ATOM   451  O O     . ASN A 1 59  ? 49.481  -45.720 12.391  1.00 141.49 ? 69  ASN A O     1 
ATOM   452  C CB    . ASN A 1 59  ? 52.488  -45.457 10.951  1.00 128.85 ? 69  ASN A CB    1 
ATOM   453  C CG    . ASN A 1 59  ? 53.769  -46.200 10.634  1.00 128.74 ? 69  ASN A CG    1 
ATOM   454  O OD1   . ASN A 1 59  ? 53.828  -47.426 10.741  1.00 129.98 ? 69  ASN A OD1   1 
ATOM   455  N ND2   . ASN A 1 59  ? 54.805  -45.462 10.242  1.00 127.48 ? 69  ASN A ND2   1 
ATOM   456  N N     . LEU A 1 60  ? 49.565  -44.711 10.380  1.00 123.73 ? 70  LEU A N     1 
ATOM   457  C CA    . LEU A 1 60  ? 48.427  -43.835 10.634  1.00 123.89 ? 70  LEU A CA    1 
ATOM   458  C C     . LEU A 1 60  ? 47.121  -44.594 10.869  1.00 125.99 ? 70  LEU A C     1 
ATOM   459  O O     . LEU A 1 60  ? 46.184  -44.053 11.458  1.00 126.31 ? 70  LEU A O     1 
ATOM   460  C CB    . LEU A 1 60  ? 48.247  -42.860 9.467   1.00 126.86 ? 70  LEU A CB    1 
ATOM   461  C CG    . LEU A 1 60  ? 48.718  -41.414 9.638   1.00 125.15 ? 70  LEU A CG    1 
ATOM   462  C CD1   . LEU A 1 60  ? 48.732  -40.686 8.288   1.00 125.32 ? 70  LEU A CD1   1 
ATOM   463  C CD2   . LEU A 1 60  ? 47.838  -40.681 10.646  1.00 125.04 ? 70  LEU A CD2   1 
ATOM   464  N N     . LYS A 1 61  ? 47.062  -45.839 10.405  1.00 181.71 ? 71  LYS A N     1 
ATOM   465  C CA    . LYS A 1 61  ? 45.841  -46.641 10.481  1.00 184.18 ? 71  LYS A CA    1 
ATOM   466  C C     . LYS A 1 61  ? 45.399  -46.890 11.926  1.00 184.62 ? 71  LYS A C     1 
ATOM   467  O O     . LYS A 1 61  ? 44.243  -46.661 12.291  1.00 185.80 ? 71  LYS A O     1 
ATOM   468  C CB    . LYS A 1 61  ? 46.045  -47.978 9.759   1.00 139.18 ? 71  LYS A CB    1 
ATOM   469  C CG    . LYS A 1 61  ? 44.776  -48.807 9.587   1.00 142.20 ? 71  LYS A CG    1 
ATOM   470  C CD    . LYS A 1 61  ? 43.773  -48.121 8.665   1.00 143.03 ? 71  LYS A CD    1 
ATOM   471  C CE    . LYS A 1 61  ? 42.506  -48.953 8.504   1.00 146.32 ? 71  LYS A CE    1 
ATOM   472  N NZ    . LYS A 1 61  ? 41.484  -48.261 7.670   1.00 147.26 ? 71  LYS A NZ    1 
ATOM   473  N N     . LEU A 1 62  ? 46.339  -47.344 12.744  1.00 135.87 ? 72  LEU A N     1 
ATOM   474  C CA    . LEU A 1 62  ? 46.057  -47.732 14.121  1.00 136.57 ? 72  LEU A CA    1 
ATOM   475  C C     . LEU A 1 62  ? 46.272  -46.563 15.094  1.00 134.69 ? 72  LEU A C     1 
ATOM   476  O O     . LEU A 1 62  ? 46.417  -46.766 16.300  1.00 134.82 ? 72  LEU A O     1 
ATOM   477  C CB    . LEU A 1 62  ? 46.895  -48.949 14.520  1.00 171.68 ? 72  LEU A CB    1 
ATOM   478  C CG    . LEU A 1 62  ? 46.277  -49.848 15.602  1.00 173.87 ? 72  LEU A CG    1 
ATOM   479  C CD1   . LEU A 1 62  ? 44.835  -50.238 15.267  1.00 176.58 ? 72  LEU A CD1   1 
ATOM   480  C CD2   . LEU A 1 62  ? 47.132  -51.089 15.839  1.00 174.70 ? 72  LEU A CD2   1 
ATOM   481  N N     . PHE A 1 63  ? 46.389  -45.352 14.554  1.00 126.97 ? 73  PHE A N     1 
ATOM   482  C CA    . PHE A 1 63  ? 46.575  -44.148 15.371  1.00 125.42 ? 73  PHE A CA    1 
ATOM   483  C C     . PHE A 1 63  ? 45.286  -43.439 15.797  1.00 126.31 ? 73  PHE A C     1 
ATOM   484  O O     . PHE A 1 63  ? 44.552  -42.920 14.957  1.00 126.69 ? 73  PHE A O     1 
ATOM   485  C CB    . PHE A 1 63  ? 47.447  -43.155 14.612  1.00 132.21 ? 73  PHE A CB    1 
ATOM   486  C CG    . PHE A 1 63  ? 48.851  -43.106 15.097  1.00 130.66 ? 73  PHE A CG    1 
ATOM   487  C CD1   . PHE A 1 63  ? 49.478  -44.254 15.545  1.00 131.07 ? 73  PHE A CD1   1 
ATOM   488  C CD2   . PHE A 1 63  ? 49.551  -41.913 15.102  1.00 129.02 ? 73  PHE A CD2   1 
ATOM   489  C CE1   . PHE A 1 63  ? 50.774  -44.210 15.995  1.00 129.78 ? 73  PHE A CE1   1 
ATOM   490  C CE2   . PHE A 1 63  ? 50.848  -41.862 15.548  1.00 127.83 ? 73  PHE A CE2   1 
ATOM   491  C CZ    . PHE A 1 63  ? 51.458  -43.009 16.001  1.00 128.16 ? 73  PHE A CZ    1 
ATOM   492  N N     . ARG A 1 64  ? 45.023  -43.415 17.103  1.00 131.09 ? 74  ARG A N     1 
ATOM   493  C CA    . ARG A 1 64  ? 43.904  -42.653 17.665  1.00 131.95 ? 74  ARG A CA    1 
ATOM   494  C C     . ARG A 1 64  ? 44.372  -41.641 18.707  1.00 130.71 ? 74  ARG A C     1 
ATOM   495  O O     . ARG A 1 64  ? 44.787  -42.016 19.802  1.00 130.91 ? 74  ARG A O     1 
ATOM   496  C CB    . ARG A 1 64  ? 42.880  -43.594 18.302  1.00 206.52 ? 74  ARG A CB    1 
ATOM   497  C CG    . ARG A 1 64  ? 41.736  -43.989 17.393  1.00 208.41 ? 74  ARG A CG    1 
ATOM   498  C CD    . ARG A 1 64  ? 40.794  -44.965 18.084  1.00 211.28 ? 74  ARG A CD    1 
ATOM   499  N NE    . ARG A 1 64  ? 41.450  -46.232 18.398  1.00 211.98 ? 74  ARG A NE    1 
ATOM   500  C CZ    . ARG A 1 64  ? 41.604  -47.230 17.532  1.00 212.90 ? 74  ARG A CZ    1 
ATOM   501  N NH1   . ARG A 1 64  ? 41.155  -47.110 16.290  1.00 213.23 ? 74  ARG A NH1   1 
ATOM   502  N NH2   . ARG A 1 64  ? 42.212  -48.349 17.906  1.00 213.69 ? 74  ARG A NH2   1 
ATOM   503  N N     . HIS A 1 65  ? 44.309  -40.361 18.365  1.00 146.52 ? 75  HIS A N     1 
ATOM   504  C CA    . HIS A 1 65  ? 44.643  -39.301 19.302  1.00 145.71 ? 75  HIS A CA    1 
ATOM   505  C C     . HIS A 1 65  ? 43.825  -38.070 18.942  1.00 145.86 ? 75  HIS A C     1 
ATOM   506  O O     . HIS A 1 65  ? 43.621  -37.804 17.761  1.00 145.59 ? 75  HIS A O     1 
ATOM   507  C CB    . HIS A 1 65  ? 46.139  -39.023 19.233  1.00 122.63 ? 75  HIS A CB    1 
ATOM   508  C CG    . HIS A 1 65  ? 46.670  -38.213 20.368  1.00 122.13 ? 75  HIS A CG    1 
ATOM   509  N ND1   . HIS A 1 65  ? 46.229  -36.939 20.648  1.00 122.21 ? 75  HIS A ND1   1 
ATOM   510  C CD2   . HIS A 1 65  ? 47.642  -38.484 21.269  1.00 121.69 ? 75  HIS A CD2   1 
ATOM   511  C CE1   . HIS A 1 65  ? 46.892  -36.467 21.690  1.00 121.95 ? 75  HIS A CE1   1 
ATOM   512  N NE2   . HIS A 1 65  ? 47.757  -37.384 22.086  1.00 121.61 ? 75  HIS A NE2   1 
ATOM   513  N N     . PRO A 1 66  ? 43.369  -37.304 19.943  1.00 126.21 ? 76  PRO A N     1 
ATOM   514  C CA    . PRO A 1 66  ? 42.591  -36.088 19.679  1.00 126.54 ? 76  PRO A CA    1 
ATOM   515  C C     . PRO A 1 66  ? 43.329  -35.050 18.857  1.00 124.96 ? 76  PRO A C     1 
ATOM   516  O O     . PRO A 1 66  ? 42.692  -34.327 18.095  1.00 125.26 ? 76  PRO A O     1 
ATOM   517  C CB    . PRO A 1 66  ? 42.310  -35.551 21.074  1.00 126.52 ? 76  PRO A CB    1 
ATOM   518  C CG    . PRO A 1 66  ? 42.210  -36.768 21.891  1.00 127.63 ? 76  PRO A CG    1 
ATOM   519  C CD    . PRO A 1 66  ? 43.229  -37.732 21.340  1.00 126.43 ? 76  PRO A CD    1 
ATOM   520  N N     . HIS A 1 67  ? 44.643  -34.963 19.036  1.00 126.21 ? 77  HIS A N     1 
ATOM   521  C CA    . HIS A 1 67  ? 45.465  -34.036 18.260  1.00 124.93 ? 77  HIS A CA    1 
ATOM   522  C C     . HIS A 1 67  ? 46.236  -34.621 17.065  1.00 123.94 ? 77  HIS A C     1 
ATOM   523  O O     . HIS A 1 67  ? 46.975  -33.901 16.391  1.00 123.07 ? 77  HIS A O     1 
ATOM   524  C CB    . HIS A 1 67  ? 46.436  -33.357 19.199  1.00 120.72 ? 77  HIS A CB    1 
ATOM   525  C CG    . HIS A 1 67  ? 45.777  -32.805 20.416  1.00 121.88 ? 77  HIS A CG    1 
ATOM   526  N ND1   . HIS A 1 67  ? 46.284  -32.993 21.681  1.00 122.10 ? 77  HIS A ND1   1 
ATOM   527  C CD2   . HIS A 1 67  ? 44.640  -32.087 20.566  1.00 123.10 ? 77  HIS A CD2   1 
ATOM   528  C CE1   . HIS A 1 67  ? 45.492  -32.407 22.561  1.00 123.45 ? 77  HIS A CE1   1 
ATOM   529  N NE2   . HIS A 1 67  ? 44.489  -31.846 21.909  1.00 124.06 ? 77  HIS A NE2   1 
ATOM   530  N N     . ILE A 1 68  ? 46.079  -35.918 16.814  1.00 125.31 ? 78  ILE A N     1 
ATOM   531  C CA    . ILE A 1 68  ? 46.625  -36.542 15.610  1.00 124.80 ? 78  ILE A CA    1 
ATOM   532  C C     . ILE A 1 68  ? 45.499  -36.771 14.609  1.00 125.97 ? 78  ILE A C     1 
ATOM   533  O O     . ILE A 1 68  ? 44.465  -37.348 14.957  1.00 127.34 ? 78  ILE A O     1 
ATOM   534  C CB    . ILE A 1 68  ? 47.319  -37.884 15.922  1.00 120.08 ? 78  ILE A CB    1 
ATOM   535  C CG1   . ILE A 1 68  ? 48.495  -37.678 16.876  1.00 119.03 ? 78  ILE A CG1   1 
ATOM   536  C CG2   . ILE A 1 68  ? 47.793  -38.547 14.649  1.00 119.88 ? 78  ILE A CG2   1 
ATOM   537  C CD1   . ILE A 1 68  ? 49.645  -36.942 16.272  1.00 117.75 ? 78  ILE A CD1   1 
ATOM   538  N N     . ILE A 1 69  ? 45.684  -36.314 13.374  1.00 121.10 ? 79  ILE A N     1 
ATOM   539  C CA    . ILE A 1 69  ? 44.621  -36.457 12.399  1.00 122.38 ? 79  ILE A CA    1 
ATOM   540  C C     . ILE A 1 69  ? 44.370  -37.941 12.195  1.00 123.37 ? 79  ILE A C     1 
ATOM   541  O O     . ILE A 1 69  ? 45.228  -38.674 11.703  1.00 122.94 ? 79  ILE A O     1 
ATOM   542  C CB    . ILE A 1 69  ? 44.981  -35.780 11.069  1.00 122.06 ? 79  ILE A CB    1 
ATOM   543  C CG1   . ILE A 1 69  ? 44.947  -34.257 11.221  1.00 121.68 ? 79  ILE A CG1   1 
ATOM   544  C CG2   . ILE A 1 69  ? 44.040  -36.224 9.967   1.00 123.55 ? 79  ILE A CG2   1 
ATOM   545  C CD1   . ILE A 1 69  ? 43.571  -33.679 11.440  1.00 122.90 ? 79  ILE A CD1   1 
ATOM   546  N N     . LYS A 1 70  ? 43.154  -38.357 12.527  1.00 146.64 ? 80  LYS A N     1 
ATOM   547  C CA    . LYS A 1 70  ? 42.821  -39.769 12.617  1.00 148.00 ? 80  LYS A CA    1 
ATOM   548  C C     . LYS A 1 70  ? 42.480  -40.280 11.224  1.00 149.13 ? 80  LYS A C     1 
ATOM   549  O O     . LYS A 1 70  ? 41.672  -39.682 10.514  1.00 149.93 ? 80  LYS A O     1 
ATOM   550  C CB    . LYS A 1 70  ? 41.656  -39.979 13.604  1.00 177.57 ? 80  LYS A CB    1 
ATOM   551  C CG    . LYS A 1 70  ? 41.510  -41.391 14.205  1.00 178.98 ? 80  LYS A CG    1 
ATOM   552  C CD    . LYS A 1 70  ? 40.681  -42.319 13.315  1.00 181.17 ? 80  LYS A CD    1 
ATOM   553  C CE    . LYS A 1 70  ? 40.191  -43.554 14.064  1.00 183.27 ? 80  LYS A CE    1 
ATOM   554  N NZ    . LYS A 1 70  ? 39.140  -43.215 15.062  1.00 184.60 ? 80  LYS A NZ    1 
ATOM   555  N N     . LEU A 1 71  ? 43.103  -41.384 10.830  1.00 127.71 ? 81  LEU A N     1 
ATOM   556  C CA    . LEU A 1 71  ? 42.872  -41.946 9.508   1.00 129.02 ? 81  LEU A CA    1 
ATOM   557  C C     . LEU A 1 71  ? 41.706  -42.925 9.553   1.00 131.61 ? 81  LEU A C     1 
ATOM   558  O O     . LEU A 1 71  ? 41.798  -43.980 10.178  1.00 132.44 ? 81  LEU A O     1 
ATOM   559  C CB    . LEU A 1 71  ? 44.135  -42.641 9.007   1.00 128.30 ? 81  LEU A CB    1 
ATOM   560  C CG    . LEU A 1 71  ? 44.057  -43.391 7.682   1.00 129.87 ? 81  LEU A CG    1 
ATOM   561  C CD1   . LEU A 1 71  ? 43.680  -42.434 6.582   1.00 130.05 ? 81  LEU A CD1   1 
ATOM   562  C CD2   . LEU A 1 71  ? 45.385  -44.049 7.377   1.00 129.13 ? 81  LEU A CD2   1 
ATOM   563  N N     . TYR A 1 72  ? 40.607  -42.562 8.898   1.00 133.09 ? 82  TYR A N     1 
ATOM   564  C CA    . TYR A 1 72  ? 39.386  -43.363 8.948   1.00 135.86 ? 82  TYR A CA    1 
ATOM   565  C C     . TYR A 1 72  ? 39.453  -44.619 8.080   1.00 137.75 ? 82  TYR A C     1 
ATOM   566  O O     . TYR A 1 72  ? 39.232  -45.731 8.562   1.00 139.41 ? 82  TYR A O     1 
ATOM   567  C CB    . TYR A 1 72  ? 38.187  -42.506 8.535   1.00 136.96 ? 82  TYR A CB    1 
ATOM   568  C CG    . TYR A 1 72  ? 37.908  -41.347 9.469   1.00 135.74 ? 82  TYR A CG    1 
ATOM   569  C CD1   . TYR A 1 72  ? 37.770  -41.548 10.838  1.00 135.75 ? 82  TYR A CD1   1 
ATOM   570  C CD2   . TYR A 1 72  ? 37.792  -40.049 8.986   1.00 134.81 ? 82  TYR A CD2   1 
ATOM   571  C CE1   . TYR A 1 72  ? 37.518  -40.488 11.698  1.00 134.89 ? 82  TYR A CE1   1 
ATOM   572  C CE2   . TYR A 1 72  ? 37.539  -38.984 9.837   1.00 133.94 ? 82  TYR A CE2   1 
ATOM   573  C CZ    . TYR A 1 72  ? 37.404  -39.209 11.192  1.00 133.99 ? 82  TYR A CZ    1 
ATOM   574  O OH    . TYR A 1 72  ? 37.155  -38.156 12.044  1.00 133.38 ? 82  TYR A OH    1 
ATOM   575  N N     . GLN A 1 73  ? 39.760  -44.436 6.799   1.00 161.15 ? 83  GLN A N     1 
ATOM   576  C CA    . GLN A 1 73  ? 39.919  -45.557 5.874   1.00 163.03 ? 83  GLN A CA    1 
ATOM   577  C C     . GLN A 1 73  ? 40.745  -45.145 4.662   1.00 162.11 ? 83  GLN A C     1 
ATOM   578  O O     . GLN A 1 73  ? 40.948  -43.956 4.414   1.00 160.47 ? 83  GLN A O     1 
ATOM   579  C CB    . GLN A 1 73  ? 38.558  -46.106 5.424   1.00 144.00 ? 83  GLN A CB    1 
ATOM   580  C CG    . GLN A 1 73  ? 37.848  -45.287 4.343   1.00 144.83 ? 83  GLN A CG    1 
ATOM   581  C CD    . GLN A 1 73  ? 36.505  -45.883 3.942   1.00 148.40 ? 83  GLN A CD    1 
ATOM   582  O OE1   . GLN A 1 73  ? 36.312  -47.086 4.003   1.00 150.64 ? 83  GLN A OE1   1 
ATOM   583  N NE2   . GLN A 1 73  ? 35.574  -45.036 3.541   1.00 149.14 ? 83  GLN A NE2   1 
ATOM   584  N N     . VAL A 1 74  ? 41.246  -46.129 3.925   1.00 139.95 ? 84  VAL A N     1 
ATOM   585  C CA    . VAL A 1 74  ? 41.986  -45.846 2.705   1.00 139.61 ? 84  VAL A CA    1 
ATOM   586  C C     . VAL A 1 74  ? 41.464  -46.682 1.540   1.00 142.78 ? 84  VAL A C     1 
ATOM   587  O O     . VAL A 1 74  ? 41.631  -47.897 1.508   1.00 144.43 ? 84  VAL A O     1 
ATOM   588  C CB    . VAL A 1 74  ? 43.499  -46.090 2.903   1.00 137.65 ? 84  VAL A CB    1 
ATOM   589  C CG1   . VAL A 1 74  ? 44.083  -45.008 3.783   1.00 134.64 ? 84  VAL A CG1   1 
ATOM   590  C CG2   . VAL A 1 74  ? 43.758  -47.454 3.527   1.00 138.63 ? 84  VAL A CG2   1 
ATOM   591  N N     . ILE A 1 75  ? 40.838  -46.017 0.574   1.00 143.82 ? 85  ILE A N     1 
ATOM   592  C CA    . ILE A 1 75  ? 40.286  -46.690 -0.598  1.00 147.07 ? 85  ILE A CA    1 
ATOM   593  C C     . ILE A 1 75  ? 41.200  -46.447 -1.784  1.00 146.88 ? 85  ILE A C     1 
ATOM   594  O O     . ILE A 1 75  ? 41.757  -45.360 -1.920  1.00 144.72 ? 85  ILE A O     1 
ATOM   595  C CB    . ILE A 1 75  ? 38.868  -46.191 -0.935  1.00 148.96 ? 85  ILE A CB    1 
ATOM   596  C CG1   . ILE A 1 75  ? 38.018  -46.110 0.334   1.00 148.70 ? 85  ILE A CG1   1 
ATOM   597  C CG2   . ILE A 1 75  ? 38.217  -47.104 -1.958  1.00 152.81 ? 85  ILE A CG2   1 
ATOM   598  C CD1   . ILE A 1 75  ? 36.703  -45.375 0.167   1.00 150.01 ? 85  ILE A CD1   1 
ATOM   599  N N     . SER A 1 76  ? 41.364  -47.451 -2.639  1.00 152.58 ? 86  SER A N     1 
ATOM   600  C CA    . SER A 1 76  ? 42.250  -47.301 -3.788  1.00 152.79 ? 86  SER A CA    1 
ATOM   601  C C     . SER A 1 76  ? 41.771  -48.048 -5.033  1.00 156.63 ? 86  SER A C     1 
ATOM   602  O O     . SER A 1 76  ? 41.005  -49.006 -4.954  1.00 159.25 ? 86  SER A O     1 
ATOM   603  C CB    . SER A 1 76  ? 43.659  -47.754 -3.420  1.00 268.26 ? 86  SER A CB    1 
ATOM   604  O OG    . SER A 1 76  ? 44.238  -48.508 -4.471  1.00 270.33 ? 86  SER A OG    1 
ATOM   605  N N     . THR A 1 77  ? 42.215  -47.556 -6.185  1.00 193.22 ? 87  THR A N     1 
ATOM   606  C CA    . THR A 1 77  ? 41.801  -48.060 -7.488  1.00 196.94 ? 87  THR A CA    1 
ATOM   607  C C     . THR A 1 77  ? 42.950  -47.882 -8.496  1.00 196.99 ? 87  THR A C     1 
ATOM   608  O O     . THR A 1 77  ? 43.845  -47.067 -8.265  1.00 194.14 ? 87  THR A O     1 
ATOM   609  C CB    . THR A 1 77  ? 40.511  -47.342 -7.951  1.00 159.23 ? 87  THR A CB    1 
ATOM   610  O OG1   . THR A 1 77  ? 40.467  -47.278 -9.382  1.00 161.95 ? 87  THR A OG1   1 
ATOM   611  C CG2   . THR A 1 77  ? 40.460  -45.930 -7.390  1.00 156.08 ? 87  THR A CG2   1 
ATOM   612  N N     . PRO A 1 78  ? 42.942  -48.648 -9.607  1.00 236.42 ? 88  PRO A N     1 
ATOM   613  C CA    . PRO A 1 78  ? 43.947  -48.505 -10.672 1.00 237.10 ? 88  PRO A CA    1 
ATOM   614  C C     . PRO A 1 78  ? 44.209  -47.062 -11.117 1.00 235.48 ? 88  PRO A C     1 
ATOM   615  O O     . PRO A 1 78  ? 45.298  -46.772 -11.615 1.00 234.90 ? 88  PRO A O     1 
ATOM   616  C CB    . PRO A 1 78  ? 43.334  -49.307 -11.821 1.00 214.92 ? 88  PRO A CB    1 
ATOM   617  C CG    . PRO A 1 78  ? 42.603  -50.397 -11.139 1.00 216.36 ? 88  PRO A CG    1 
ATOM   618  C CD    . PRO A 1 78  ? 42.095  -49.835 -9.828  1.00 213.29 ? 88  PRO A CD    1 
ATOM   619  N N     . SER A 1 79  ? 43.230  -46.179 -10.945 1.00 181.97 ? 89  SER A N     1 
ATOM   620  C CA    . SER A 1 79  ? 43.408  -44.764 -11.256 1.00 180.49 ? 89  SER A CA    1 
ATOM   621  C C     . SER A 1 79  ? 44.274  -44.061 -10.205 1.00 176.39 ? 89  SER A C     1 
ATOM   622  O O     . SER A 1 79  ? 45.363  -43.580 -10.517 1.00 175.33 ? 89  SER A O     1 
ATOM   623  C CB    . SER A 1 79  ? 42.050  -44.066 -11.379 1.00 276.55 ? 89  SER A CB    1 
ATOM   624  O OG    . SER A 1 79  ? 41.250  -44.289 -10.232 1.00 275.44 ? 89  SER A OG    1 
ATOM   625  N N     . ASP A 1 80  ? 43.788  -43.989 -8.966  1.00 206.02 ? 90  ASP A N     1 
ATOM   626  C CA    . ASP A 1 80  ? 44.523  -43.301 -7.903  1.00 202.35 ? 90  ASP A CA    1 
ATOM   627  C C     . ASP A 1 80  ? 44.170  -43.795 -6.493  1.00 200.74 ? 90  ASP A C     1 
ATOM   628  O O     . ASP A 1 80  ? 43.089  -44.338 -6.269  1.00 202.28 ? 90  ASP A O     1 
ATOM   629  C CB    . ASP A 1 80  ? 44.282  -41.790 -8.007  1.00 245.72 ? 90  ASP A CB    1 
ATOM   630  C CG    . ASP A 1 80  ? 43.016  -41.453 -8.776  1.00 248.23 ? 90  ASP A CG    1 
ATOM   631  O OD1   . ASP A 1 80  ? 41.938  -41.961 -8.404  1.00 249.30 ? 90  ASP A OD1   1 
ATOM   632  O OD2   . ASP A 1 80  ? 43.099  -40.678 -9.754  1.00 249.33 ? 90  ASP A OD2   1 
ATOM   633  N N     . ILE A 1 81  ? 45.096  -43.602 -5.553  1.00 162.82 ? 91  ILE A N     1 
ATOM   634  C CA    . ILE A 1 81  ? 44.897  -43.943 -4.143  1.00 161.12 ? 91  ILE A CA    1 
ATOM   635  C C     . ILE A 1 81  ? 44.160  -42.827 -3.407  1.00 159.58 ? 91  ILE A C     1 
ATOM   636  O O     . ILE A 1 81  ? 44.343  -41.653 -3.726  1.00 158.67 ? 91  ILE A O     1 
ATOM   637  C CB    . ILE A 1 81  ? 46.237  -44.191 -3.426  1.00 140.01 ? 91  ILE A CB    1 
ATOM   638  C CG1   . ILE A 1 81  ? 47.162  -45.058 -4.276  1.00 141.40 ? 91  ILE A CG1   1 
ATOM   639  C CG2   . ILE A 1 81  ? 46.015  -44.839 -2.088  1.00 139.02 ? 91  ILE A CG2   1 
ATOM   640  C CD1   . ILE A 1 81  ? 46.636  -46.426 -4.548  1.00 144.11 ? 91  ILE A CD1   1 
ATOM   641  N N     . PHE A 1 82  ? 43.333  -43.189 -2.427  1.00 153.41 ? 92  PHE A N     1 
ATOM   642  C CA    . PHE A 1 82  ? 42.638  -42.205 -1.595  1.00 152.05 ? 92  PHE A CA    1 
ATOM   643  C C     . PHE A 1 82  ? 42.862  -42.465 -0.106  1.00 150.15 ? 92  PHE A C     1 
ATOM   644  O O     . PHE A 1 82  ? 42.950  -43.615 0.325   1.00 150.79 ? 92  PHE A O     1 
ATOM   645  C CB    . PHE A 1 82  ? 41.136  -42.204 -1.896  1.00 141.65 ? 92  PHE A CB    1 
ATOM   646  C CG    . PHE A 1 82  ? 40.803  -41.848 -3.311  1.00 143.70 ? 92  PHE A CG    1 
ATOM   647  C CD1   . PHE A 1 82  ? 41.125  -40.601 -3.818  1.00 142.77 ? 92  PHE A CD1   1 
ATOM   648  C CD2   . PHE A 1 82  ? 40.159  -42.754 -4.134  1.00 146.83 ? 92  PHE A CD2   1 
ATOM   649  C CE1   . PHE A 1 82  ? 40.821  -40.269 -5.123  1.00 144.87 ? 92  PHE A CE1   1 
ATOM   650  C CE2   . PHE A 1 82  ? 39.851  -42.427 -5.439  1.00 148.94 ? 92  PHE A CE2   1 
ATOM   651  C CZ    . PHE A 1 82  ? 40.182  -41.183 -5.934  1.00 147.93 ? 92  PHE A CZ    1 
ATOM   652  N N     . MET A 1 83  ? 42.994  -41.400 0.676   1.00 144.80 ? 93  MET A N     1 
ATOM   653  C CA    . MET A 1 83  ? 42.989  -41.537 2.128   1.00 143.35 ? 93  MET A CA    1 
ATOM   654  C C     . MET A 1 83  ? 42.041  -40.534 2.784   1.00 142.96 ? 93  MET A C     1 
ATOM   655  O O     . MET A 1 83  ? 42.373  -39.355 2.862   1.00 141.50 ? 93  MET A O     1 
ATOM   656  C CB    . MET A 1 83  ? 44.403  -41.341 2.672   1.00 131.41 ? 93  MET A CB    1 
ATOM   657  C CG    . MET A 1 83  ? 45.448  -42.220 2.015   1.00 131.73 ? 93  MET A CG    1 
ATOM   658  S SD    . MET A 1 83  ? 47.130  -41.717 2.420   1.00 129.13 ? 93  MET A SD    1 
ATOM   659  C CE    . MET A 1 83  ? 47.075  -41.682 4.210   1.00 127.42 ? 93  MET A CE    1 
ATOM   660  N N     . VAL A 1 84  ? 40.911  -40.993 3.325   1.00 154.15 ? 94  VAL A N     1 
ATOM   661  C CA    . VAL A 1 84  ? 39.979  -40.068 3.977   1.00 154.01 ? 94  VAL A CA    1 
ATOM   662  C C     . VAL A 1 84  ? 40.468  -39.769 5.389   1.00 151.96 ? 94  VAL A C     1 
ATOM   663  O O     . VAL A 1 84  ? 41.012  -40.641 6.063   1.00 151.51 ? 94  VAL A O     1 
ATOM   664  C CB    . VAL A 1 84  ? 38.530  -40.611 4.033   1.00 137.25 ? 94  VAL A CB    1 
ATOM   665  C CG1   . VAL A 1 84  ? 37.999  -40.862 2.644   1.00 139.54 ? 94  VAL A CG1   1 
ATOM   666  C CG2   . VAL A 1 84  ? 38.464  -41.873 4.847   1.00 138.04 ? 94  VAL A CG2   1 
ATOM   667  N N     . MET A 1 85  ? 40.298  -38.525 5.823   1.00 151.33 ? 95  MET A N     1 
ATOM   668  C CA    . MET A 1 85  ? 40.802  -38.078 7.119   1.00 149.52 ? 95  MET A CA    1 
ATOM   669  C C     . MET A 1 85  ? 39.803  -37.159 7.799   1.00 149.89 ? 95  MET A C     1 
ATOM   670  O O     . MET A 1 85  ? 38.821  -36.745 7.187   1.00 151.32 ? 95  MET A O     1 
ATOM   671  C CB    . MET A 1 85  ? 42.140  -37.358 6.963   1.00 143.31 ? 95  MET A CB    1 
ATOM   672  C CG    . MET A 1 85  ? 43.256  -38.226 6.433   1.00 142.85 ? 95  MET A CG    1 
ATOM   673  S SD    . MET A 1 85  ? 44.769  -37.275 6.242   1.00 140.81 ? 95  MET A SD    1 
ATOM   674  C CE    . MET A 1 85  ? 45.956  -38.571 5.900   1.00 140.55 ? 95  MET A CE    1 
ATOM   675  N N     . GLU A 1 86  ? 40.044  -36.840 9.063   1.00 129.03 ? 96  GLU A N     1 
ATOM   676  C CA    . GLU A 1 86  ? 39.177  -35.894 9.747   1.00 129.44 ? 96  GLU A CA    1 
ATOM   677  C C     . GLU A 1 86  ? 39.461  -34.476 9.259   1.00 128.61 ? 96  GLU A C     1 
ATOM   678  O O     . GLU A 1 86  ? 40.586  -33.984 9.350   1.00 126.98 ? 96  GLU A O     1 
ATOM   679  C CB    . GLU A 1 86  ? 39.349  -35.991 11.269  1.00 163.50 ? 96  GLU A CB    1 
ATOM   680  C CG    . GLU A 1 86  ? 40.791  -35.998 11.766  1.00 161.47 ? 96  GLU A CG    1 
ATOM   681  C CD    . GLU A 1 86  ? 40.898  -35.724 13.260  1.00 161.03 ? 96  GLU A CD    1 
ATOM   682  O OE1   . GLU A 1 86  ? 41.630  -36.463 13.954  1.00 160.39 ? 96  GLU A OE1   1 
ATOM   683  O OE2   . GLU A 1 86  ? 40.256  -34.765 13.739  1.00 161.47 ? 96  GLU A OE2   1 
ATOM   684  N N     . TYR A 1 87  ? 38.430  -33.826 8.732   1.00 152.39 ? 97  TYR A N     1 
ATOM   685  C CA    . TYR A 1 87  ? 38.555  -32.462 8.240   1.00 152.05 ? 97  TYR A CA    1 
ATOM   686  C C     . TYR A 1 87  ? 38.378  -31.465 9.377   1.00 151.67 ? 97  TYR A C     1 
ATOM   687  O O     . TYR A 1 87  ? 37.578  -31.684 10.290  1.00 152.49 ? 97  TYR A O     1 
ATOM   688  C CB    . TYR A 1 87  ? 37.536  -32.191 7.132   1.00 131.44 ? 97  TYR A CB    1 
ATOM   689  C CG    . TYR A 1 87  ? 37.380  -30.726 6.793   1.00 131.59 ? 97  TYR A CG    1 
ATOM   690  C CD1   . TYR A 1 87  ? 38.415  -30.022 6.198   1.00 130.58 ? 97  TYR A CD1   1 
ATOM   691  C CD2   . TYR A 1 87  ? 36.198  -30.046 7.068   1.00 132.98 ? 97  TYR A CD2   1 
ATOM   692  C CE1   . TYR A 1 87  ? 38.280  -28.681 5.887   1.00 131.01 ? 97  TYR A CE1   1 
ATOM   693  C CE2   . TYR A 1 87  ? 36.052  -28.703 6.759   1.00 133.32 ? 97  TYR A CE2   1 
ATOM   694  C CZ    . TYR A 1 87  ? 37.097  -28.027 6.169   1.00 132.37 ? 97  TYR A CZ    1 
ATOM   695  O OH    . TYR A 1 87  ? 36.962  -26.692 5.857   1.00 132.99 ? 97  TYR A OH    1 
ATOM   696  N N     . VAL A 1 88  ? 39.140  -30.377 9.324   1.00 128.23 ? 98  VAL A N     1 
ATOM   697  C CA    . VAL A 1 88  ? 39.059  -29.333 10.340  1.00 128.07 ? 98  VAL A CA    1 
ATOM   698  C C     . VAL A 1 88  ? 39.014  -27.939 9.710   1.00 128.53 ? 98  VAL A C     1 
ATOM   699  O O     . VAL A 1 88  ? 39.593  -27.707 8.649   1.00 128.31 ? 98  VAL A O     1 
ATOM   700  C CB    . VAL A 1 88  ? 40.239  -29.421 11.314  1.00 126.48 ? 98  VAL A CB    1 
ATOM   701  C CG1   . VAL A 1 88  ? 40.108  -30.661 12.178  1.00 126.40 ? 98  VAL A CG1   1 
ATOM   702  C CG2   . VAL A 1 88  ? 41.543  -29.442 10.552  1.00 125.23 ? 98  VAL A CG2   1 
ATOM   703  N N     . SER A 1 89  ? 38.307  -27.022 10.367  1.00 160.61 ? 99  SER A N     1 
ATOM   704  C CA    . SER A 1 89  ? 38.028  -25.697 9.811   1.00 161.54 ? 99  SER A CA    1 
ATOM   705  C C     . SER A 1 89  ? 39.141  -24.656 9.965   1.00 160.78 ? 99  SER A C     1 
ATOM   706  O O     . SER A 1 89  ? 39.361  -23.863 9.053   1.00 161.29 ? 99  SER A O     1 
ATOM   707  C CB    . SER A 1 89  ? 36.746  -25.144 10.429  1.00 134.47 ? 99  SER A CB    1 
ATOM   708  O OG    . SER A 1 89  ? 36.786  -25.275 11.836  1.00 134.15 ? 99  SER A OG    1 
ATOM   709  N N     . GLY A 1 90  ? 39.821  -24.645 11.111  1.00 165.17 ? 100 GLY A N     1 
ATOM   710  C CA    . GLY A 1 90  ? 40.810  -23.620 11.421  1.00 164.81 ? 100 GLY A CA    1 
ATOM   711  C C     . GLY A 1 90  ? 41.951  -23.439 10.429  1.00 164.15 ? 100 GLY A C     1 
ATOM   712  O O     . GLY A 1 90  ? 42.463  -22.331 10.269  1.00 164.67 ? 100 GLY A O     1 
ATOM   713  N N     . GLY A 1 91  ? 42.353  -24.517 9.760   1.00 128.06 ? 101 GLY A N     1 
ATOM   714  C CA    . GLY A 1 91  ? 43.442  -24.451 8.798   1.00 127.60 ? 101 GLY A CA    1 
ATOM   715  C C     . GLY A 1 91  ? 44.776  -24.675 9.479   1.00 126.24 ? 101 GLY A C     1 
ATOM   716  O O     . GLY A 1 91  ? 44.813  -25.081 10.637  1.00 125.57 ? 101 GLY A O     1 
ATOM   717  N N     . GLU A 1 92  ? 45.873  -24.409 8.779   1.00 130.39 ? 102 GLU A N     1 
ATOM   718  C CA    . GLU A 1 92  ? 47.191  -24.629 9.366   1.00 129.26 ? 102 GLU A CA    1 
ATOM   719  C C     . GLU A 1 92  ? 47.524  -23.570 10.434  1.00 129.61 ? 102 GLU A C     1 
ATOM   720  O O     . GLU A 1 92  ? 46.976  -22.468 10.428  1.00 130.90 ? 102 GLU A O     1 
ATOM   721  C CB    . GLU A 1 92  ? 48.268  -24.673 8.270   1.00 147.47 ? 102 GLU A CB    1 
ATOM   722  C CG    . GLU A 1 92  ? 48.134  -23.628 7.182   1.00 149.00 ? 102 GLU A CG    1 
ATOM   723  C CD    . GLU A 1 92  ? 49.232  -23.731 6.131   1.00 149.18 ? 102 GLU A CD    1 
ATOM   724  O OE1   . GLU A 1 92  ? 49.758  -24.847 5.909   1.00 148.19 ? 102 GLU A OE1   1 
ATOM   725  O OE2   . GLU A 1 92  ? 49.570  -22.689 5.526   1.00 150.51 ? 102 GLU A OE2   1 
ATOM   726  N N     . LEU A 1 93  ? 48.404  -23.930 11.366  1.00 122.93 ? 103 LEU A N     1 
ATOM   727  C CA    . LEU A 1 93  ? 48.781  -23.051 12.469  1.00 123.40 ? 103 LEU A CA    1 
ATOM   728  C C     . LEU A 1 93  ? 49.536  -21.810 12.001  1.00 124.54 ? 103 LEU A C     1 
ATOM   729  O O     . LEU A 1 93  ? 49.440  -20.758 12.626  1.00 125.70 ? 103 LEU A O     1 
ATOM   730  C CB    . LEU A 1 93  ? 49.632  -23.820 13.481  1.00 122.22 ? 103 LEU A CB    1 
ATOM   731  C CG    . LEU A 1 93  ? 50.079  -23.107 14.757  1.00 122.75 ? 103 LEU A CG    1 
ATOM   732  C CD1   . LEU A 1 93  ? 48.887  -22.792 15.631  1.00 123.58 ? 103 LEU A CD1   1 
ATOM   733  C CD2   . LEU A 1 93  ? 51.077  -23.948 15.527  1.00 121.64 ? 103 LEU A CD2   1 
ATOM   734  N N     . PHE A 1 94  ? 50.286  -21.937 10.906  1.00 124.45 ? 104 PHE A N     1 
ATOM   735  C CA    . PHE A 1 94  ? 51.050  -20.816 10.351  1.00 125.82 ? 104 PHE A CA    1 
ATOM   736  C C     . PHE A 1 94  ? 50.126  -19.702 9.867   1.00 127.58 ? 104 PHE A C     1 
ATOM   737  O O     . PHE A 1 94  ? 50.495  -18.526 9.867   1.00 129.17 ? 104 PHE A O     1 
ATOM   738  C CB    . PHE A 1 94  ? 51.950  -21.285 9.206   1.00 208.93 ? 104 PHE A CB    1 
ATOM   739  C CG    . PHE A 1 94  ? 53.097  -20.360 8.923   1.00 210.22 ? 104 PHE A CG    1 
ATOM   740  C CD1   . PHE A 1 94  ? 54.065  -20.123 9.891   1.00 210.17 ? 104 PHE A CD1   1 
ATOM   741  C CD2   . PHE A 1 94  ? 53.214  -19.731 7.696   1.00 211.73 ? 104 PHE A CD2   1 
ATOM   742  C CE1   . PHE A 1 94  ? 55.126  -19.271 9.644   1.00 211.65 ? 104 PHE A CE1   1 
ATOM   743  C CE2   . PHE A 1 94  ? 54.270  -18.880 7.438   1.00 213.24 ? 104 PHE A CE2   1 
ATOM   744  C CZ    . PHE A 1 94  ? 55.230  -18.649 8.416   1.00 213.22 ? 104 PHE A CZ    1 
ATOM   745  N N     . ASP A 1 95  ? 48.923  -20.083 9.449   1.00 139.02 ? 105 ASP A N     1 
ATOM   746  C CA    . ASP A 1 95  ? 47.885  -19.112 9.132   1.00 140.69 ? 105 ASP A CA    1 
ATOM   747  C C     . ASP A 1 95  ? 47.420  -18.436 10.414  1.00 141.30 ? 105 ASP A C     1 
ATOM   748  O O     . ASP A 1 95  ? 47.168  -17.239 10.422  1.00 143.08 ? 105 ASP A O     1 
ATOM   749  C CB    . ASP A 1 95  ? 46.695  -19.773 8.422   1.00 179.59 ? 105 ASP A CB    1 
ATOM   750  C CG    . ASP A 1 95  ? 46.989  -20.114 6.968   1.00 179.81 ? 105 ASP A CG    1 
ATOM   751  O OD1   . ASP A 1 95  ? 47.819  -19.420 6.344   1.00 180.77 ? 105 ASP A OD1   1 
ATOM   752  O OD2   . ASP A 1 95  ? 46.379  -21.073 6.447   1.00 179.27 ? 105 ASP A OD2   1 
ATOM   753  N N     . TYR A 1 96  ? 47.317  -19.206 11.496  1.00 128.52 ? 106 TYR A N     1 
ATOM   754  C CA    . TYR A 1 96  ? 46.883  -18.669 12.789  1.00 129.21 ? 106 TYR A CA    1 
ATOM   755  C C     . TYR A 1 96  ? 47.948  -17.798 13.460  1.00 130.04 ? 106 TYR A C     1 
ATOM   756  O O     . TYR A 1 96  ? 47.633  -16.788 14.092  1.00 131.65 ? 106 TYR A O     1 
ATOM   757  C CB    . TYR A 1 96  ? 46.488  -19.804 13.733  1.00 150.03 ? 106 TYR A CB    1 
ATOM   758  C CG    . TYR A 1 96  ? 45.990  -19.339 15.090  1.00 150.92 ? 106 TYR A CG    1 
ATOM   759  C CD1   . TYR A 1 96  ? 44.845  -18.561 15.202  1.00 152.51 ? 106 TYR A CD1   1 
ATOM   760  C CD2   . TYR A 1 96  ? 46.655  -19.693 16.259  1.00 150.34 ? 106 TYR A CD2   1 
ATOM   761  C CE1   . TYR A 1 96  ? 44.382  -18.142 16.437  1.00 153.56 ? 106 TYR A CE1   1 
ATOM   762  C CE2   . TYR A 1 96  ? 46.196  -19.279 17.499  1.00 151.41 ? 106 TYR A CE2   1 
ATOM   763  C CZ    . TYR A 1 96  ? 45.060  -18.505 17.580  1.00 153.03 ? 106 TYR A CZ    1 
ATOM   764  O OH    . TYR A 1 96  ? 44.599  -18.091 18.808  1.00 154.32 ? 106 TYR A OH    1 
ATOM   765  N N     . ILE A 1 97  ? 49.207  -18.203 13.336  1.00 129.13 ? 107 ILE A N     1 
ATOM   766  C CA    . ILE A 1 97  ? 50.313  -17.417 13.869  1.00 130.11 ? 107 ILE A CA    1 
ATOM   767  C C     . ILE A 1 97  ? 50.378  -16.041 13.201  1.00 132.38 ? 107 ILE A C     1 
ATOM   768  O O     . ILE A 1 97  ? 50.283  -15.011 13.866  1.00 134.16 ? 107 ILE A O     1 
ATOM   769  C CB    . ILE A 1 97  ? 51.666  -18.139 13.669  1.00 133.96 ? 107 ILE A CB    1 
ATOM   770  C CG1   . ILE A 1 97  ? 51.721  -19.435 14.484  1.00 132.02 ? 107 ILE A CG1   1 
ATOM   771  C CG2   . ILE A 1 97  ? 52.825  -17.221 14.042  1.00 135.41 ? 107 ILE A CG2   1 
ATOM   772  C CD1   . ILE A 1 97  ? 51.881  -19.214 15.965  1.00 132.43 ? 107 ILE A CD1   1 
ATOM   773  N N     . CYS A 1 98  ? 50.518  -16.042 11.878  1.00 132.54 ? 108 CYS A N     1 
ATOM   774  C CA    . CYS A 1 98  ? 50.690  -14.816 11.107  1.00 134.85 ? 108 CYS A CA    1 
ATOM   775  C C     . CYS A 1 98  ? 49.503  -13.875 11.270  1.00 136.57 ? 108 CYS A C     1 
ATOM   776  O O     . CYS A 1 98  ? 49.680  -12.681 11.505  1.00 138.82 ? 108 CYS A O     1 
ATOM   777  C CB    . CYS A 1 98  ? 50.896  -15.150 9.626   1.00 195.89 ? 108 CYS A CB    1 
ATOM   778  S SG    . CYS A 1 98  ? 51.149  -13.719 8.543   1.00 199.00 ? 108 CYS A SG    1 
ATOM   779  N N     . LYS A 1 99  ? 48.298  -14.427 11.147  1.00 135.70 ? 109 LYS A N     1 
ATOM   780  C CA    . LYS A 1 99  ? 47.063  -13.651 11.262  1.00 137.29 ? 109 LYS A CA    1 
ATOM   781  C C     . LYS A 1 99  ? 46.913  -13.045 12.652  1.00 138.25 ? 109 LYS A C     1 
ATOM   782  O O     . LYS A 1 99  ? 46.456  -11.912 12.799  1.00 140.51 ? 109 LYS A O     1 
ATOM   783  C CB    . LYS A 1 99  ? 45.852  -14.533 10.936  1.00 183.01 ? 109 LYS A CB    1 
ATOM   784  C CG    . LYS A 1 99  ? 44.494  -13.851 11.021  1.00 184.62 ? 109 LYS A CG    1 
ATOM   785  C CD    . LYS A 1 99  ? 43.385  -14.834 10.669  1.00 183.53 ? 109 LYS A CD    1 
ATOM   786  C CE    . LYS A 1 99  ? 42.013  -14.210 10.832  1.00 185.20 ? 109 LYS A CE    1 
ATOM   787  N NZ    . LYS A 1 99  ? 40.927  -15.188 10.553  1.00 184.38 ? 109 LYS A NZ    1 
ATOM   788  N N     . ASN A 1 100 ? 47.299  -13.809 13.669  1.00 136.73 ? 110 ASN A N     1 
ATOM   789  C CA    . ASN A 1 100 ? 47.190  -13.353 15.047  1.00 137.69 ? 110 ASN A CA    1 
ATOM   790  C C     . ASN A 1 100 ? 48.486  -12.740 15.576  1.00 138.72 ? 110 ASN A C     1 
ATOM   791  O O     . ASN A 1 100 ? 48.570  -12.377 16.751  1.00 139.67 ? 110 ASN A O     1 
ATOM   792  C CB    . ASN A 1 100 ? 46.743  -14.500 15.951  1.00 173.32 ? 110 ASN A CB    1 
ATOM   793  C CG    . ASN A 1 100 ? 45.972  -14.017 17.157  1.00 174.72 ? 110 ASN A CG    1 
ATOM   794  O OD1   . ASN A 1 100 ? 46.407  -14.187 18.294  1.00 174.68 ? 110 ASN A OD1   1 
ATOM   795  N ND2   . ASN A 1 100 ? 44.827  -13.390 16.914  1.00 176.19 ? 110 ASN A ND2   1 
ATOM   796  N N     . GLY A 1 101 ? 49.489  -12.602 14.711  1.00 138.80 ? 111 GLY A N     1 
ATOM   797  C CA    . GLY A 1 101 ? 50.755  -12.046 15.155  1.00 139.99 ? 111 GLY A CA    1 
ATOM   798  C C     . GLY A 1 101 ? 51.520  -12.969 16.085  1.00 138.26 ? 111 GLY A C     1 
ATOM   799  O O     . GLY A 1 101 ? 52.021  -14.016 15.677  1.00 136.15 ? 111 GLY A O     1 
ATOM   800  N N     . ARG A 1 102 ? 51.704  -12.520 17.317  1.00 139.47 ? 112 ARG A N     1 
ATOM   801  C CA    . ARG A 1 102 ? 52.365  -13.315 18.340  1.00 138.21 ? 112 ARG A CA    1 
ATOM   802  C C     . ARG A 1 102 ? 51.340  -13.847 19.349  1.00 137.50 ? 112 ARG A C     1 
ATOM   803  O O     . ARG A 1 102 ? 50.369  -13.162 19.668  1.00 139.03 ? 112 ARG A O     1 
ATOM   804  C CB    . ARG A 1 102 ? 53.428  -12.479 19.057  1.00 247.58 ? 112 ARG A CB    1 
ATOM   805  C CG    . ARG A 1 102 ? 54.599  -12.014 18.191  1.00 248.55 ? 112 ARG A CG    1 
ATOM   806  C CD    . ARG A 1 102 ? 54.230  -10.914 17.198  1.00 250.65 ? 112 ARG A CD    1 
ATOM   807  N NE    . ARG A 1 102 ? 53.370  -9.892  17.791  1.00 252.98 ? 112 ARG A NE    1 
ATOM   808  C CZ    . ARG A 1 102 ? 52.784  -8.918  17.103  1.00 254.98 ? 112 ARG A CZ    1 
ATOM   809  N NH1   . ARG A 1 102 ? 52.959  -8.829  15.790  1.00 254.98 ? 112 ARG A NH1   1 
ATOM   810  N NH2   . ARG A 1 102 ? 52.018  -8.031  17.725  1.00 257.18 ? 112 ARG A NH2   1 
ATOM   811  N N     . LEU A 1 103 ? 51.552  -15.060 19.853  1.00 135.42 ? 113 LEU A N     1 
ATOM   812  C CA    . LEU A 1 103 ? 50.633  -15.647 20.831  1.00 134.93 ? 113 LEU A CA    1 
ATOM   813  C C     . LEU A 1 103 ? 51.168  -15.492 22.245  1.00 136.03 ? 113 LEU A C     1 
ATOM   814  O O     . LEU A 1 103 ? 52.373  -15.611 22.470  1.00 135.90 ? 113 LEU A O     1 
ATOM   815  C CB    . LEU A 1 103 ? 50.385  -17.126 20.534  1.00 132.29 ? 113 LEU A CB    1 
ATOM   816  C CG    . LEU A 1 103 ? 49.366  -17.454 19.443  1.00 131.44 ? 113 LEU A CG    1 
ATOM   817  C CD1   . LEU A 1 103 ? 48.045  -16.771 19.746  1.00 133.03 ? 113 LEU A CD1   1 
ATOM   818  C CD2   . LEU A 1 103 ? 49.868  -17.075 18.054  1.00 131.38 ? 113 LEU A CD2   1 
ATOM   819  N N     . ASP A 1 104 ? 50.267  -15.231 23.193  1.00 137.30 ? 114 ASP A N     1 
ATOM   820  C CA    . ASP A 1 104 ? 50.644  -15.041 24.595  1.00 138.75 ? 114 ASP A CA    1 
ATOM   821  C C     . ASP A 1 104 ? 50.930  -16.365 25.293  1.00 136.96 ? 114 ASP A C     1 
ATOM   822  O O     . ASP A 1 104 ? 50.781  -17.432 24.701  1.00 134.66 ? 114 ASP A O     1 
ATOM   823  C CB    . ASP A 1 104 ? 49.549  -14.286 25.355  1.00 199.59 ? 114 ASP A CB    1 
ATOM   824  C CG    . ASP A 1 104 ? 48.205  -14.987 25.297  1.00 198.57 ? 114 ASP A CG    1 
ATOM   825  O OD1   . ASP A 1 104 ? 47.850  -15.508 24.217  1.00 196.78 ? 114 ASP A OD1   1 
ATOM   826  O OD2   . ASP A 1 104 ? 47.506  -15.014 26.333  1.00 199.80 ? 114 ASP A OD2   1 
ATOM   827  N N     . GLU A 1 105 ? 51.323  -16.293 26.560  1.00 138.27 ? 115 GLU A N     1 
ATOM   828  C CA    . GLU A 1 105 ? 51.717  -17.489 27.299  1.00 136.94 ? 115 GLU A CA    1 
ATOM   829  C C     . GLU A 1 105 ? 50.529  -18.411 27.574  1.00 136.03 ? 115 GLU A C     1 
ATOM   830  O O     . GLU A 1 105 ? 50.639  -19.628 27.445  1.00 134.04 ? 115 GLU A O     1 
ATOM   831  C CB    . GLU A 1 105 ? 52.401  -17.103 28.616  1.00 174.58 ? 115 GLU A CB    1 
ATOM   832  C CG    . GLU A 1 105 ? 53.635  -16.221 28.448  1.00 175.88 ? 115 GLU A CG    1 
ATOM   833  C CD    . GLU A 1 105 ? 54.508  -16.181 29.693  1.00 177.47 ? 115 GLU A CD    1 
ATOM   834  O OE1   . GLU A 1 105 ? 55.662  -15.713 29.593  1.00 178.34 ? 115 GLU A OE1   1 
ATOM   835  O OE2   . GLU A 1 105 ? 54.043  -16.620 30.768  1.00 178.06 ? 115 GLU A OE2   1 
ATOM   836  N N     . LYS A 1 106 ? 49.396  -17.825 27.947  1.00 240.19 ? 116 LYS A N     1 
ATOM   837  C CA    . LYS A 1 106 ? 48.194  -18.594 28.256  1.00 239.86 ? 116 LYS A CA    1 
ATOM   838  C C     . LYS A 1 106 ? 47.742  -19.444 27.069  1.00 237.51 ? 116 LYS A C     1 
ATOM   839  O O     . LYS A 1 106 ? 47.247  -20.558 27.239  1.00 236.51 ? 116 LYS A O     1 
ATOM   840  C CB    . LYS A 1 106 ? 47.062  -17.657 28.689  1.00 156.90 ? 116 LYS A CB    1 
ATOM   841  C CG    . LYS A 1 106 ? 47.313  -16.887 29.988  1.00 159.67 ? 116 LYS A CG    1 
ATOM   842  C CD    . LYS A 1 106 ? 46.842  -17.658 31.221  1.00 160.43 ? 116 LYS A CD    1 
ATOM   843  C CE    . LYS A 1 106 ? 47.920  -18.589 31.767  1.00 159.30 ? 116 LYS A CE    1 
ATOM   844  N NZ    . LYS A 1 106 ? 49.123  -17.843 32.238  1.00 160.61 ? 116 LYS A NZ    1 
ATOM   845  N N     . GLU A 1 107 ? 47.921  -18.907 25.868  1.00 134.43 ? 117 GLU A N     1 
ATOM   846  C CA    . GLU A 1 107 ? 47.539  -19.590 24.637  1.00 132.51 ? 117 GLU A CA    1 
ATOM   847  C C     . GLU A 1 107 ? 48.638  -20.540 24.157  1.00 130.36 ? 117 GLU A C     1 
ATOM   848  O O     . GLU A 1 107 ? 48.401  -21.734 23.985  1.00 128.87 ? 117 GLU A O     1 
ATOM   849  C CB    . GLU A 1 107 ? 47.197  -18.571 23.544  1.00 159.59 ? 117 GLU A CB    1 
ATOM   850  C CG    . GLU A 1 107 ? 46.741  -19.175 22.216  1.00 157.98 ? 117 GLU A CG    1 
ATOM   851  C CD    . GLU A 1 107 ? 45.338  -19.757 22.265  1.00 158.03 ? 117 GLU A CD    1 
ATOM   852  O OE1   . GLU A 1 107 ? 44.858  -20.226 21.212  1.00 157.06 ? 117 GLU A OE1   1 
ATOM   853  O OE2   . GLU A 1 107 ? 44.711  -19.748 23.345  1.00 159.27 ? 117 GLU A OE2   1 
ATOM   854  N N     . SER A 1 108 ? 49.819  -19.987 23.893  1.00 130.42 ? 118 SER A N     1 
ATOM   855  C CA    . SER A 1 108 ? 50.960  -20.756 23.401  1.00 128.65 ? 118 SER A CA    1 
ATOM   856  C C     . SER A 1 108 ? 51.222  -22.010 24.227  1.00 127.64 ? 118 SER A C     1 
ATOM   857  O O     . SER A 1 108 ? 51.506  -23.075 23.679  1.00 125.87 ? 118 SER A O     1 
ATOM   858  C CB    . SER A 1 108 ? 52.215  -19.886 23.389  1.00 161.78 ? 118 SER A CB    1 
ATOM   859  O OG    . SER A 1 108 ? 52.560  -19.507 24.709  1.00 163.34 ? 118 SER A OG    1 
ATOM   860  N N     . ARG A 1 109 ? 51.128  -21.878 25.546  1.00 128.97 ? 119 ARG A N     1 
ATOM   861  C CA    . ARG A 1 109 ? 51.328  -23.011 26.440  1.00 128.43 ? 119 ARG A CA    1 
ATOM   862  C C     . ARG A 1 109 ? 50.295  -24.095 26.148  1.00 127.40 ? 119 ARG A C     1 
ATOM   863  O O     . ARG A 1 109 ? 50.623  -25.281 26.098  1.00 126.07 ? 119 ARG A O     1 
ATOM   864  C CB    . ARG A 1 109 ? 51.245  -22.565 27.903  1.00 137.77 ? 119 ARG A CB    1 
ATOM   865  C CG    . ARG A 1 109 ? 51.620  -23.624 28.928  1.00 137.61 ? 119 ARG A CG    1 
ATOM   866  C CD    . ARG A 1 109 ? 51.309  -23.144 30.340  1.00 140.04 ? 119 ARG A CD    1 
ATOM   867  N NE    . ARG A 1 109 ? 52.085  -21.964 30.709  1.00 141.68 ? 119 ARG A NE    1 
ATOM   868  C CZ    . ARG A 1 109 ? 51.732  -21.104 31.658  1.00 144.23 ? 119 ARG A CZ    1 
ATOM   869  N NH1   . ARG A 1 109 ? 50.604  -21.284 32.332  1.00 145.38 ? 119 ARG A NH1   1 
ATOM   870  N NH2   . ARG A 1 109 ? 52.502  -20.057 31.925  1.00 145.88 ? 119 ARG A NH2   1 
ATOM   871  N N     . ARG A 1 110 ? 49.051  -23.673 25.939  1.00 128.21 ? 120 ARG A N     1 
ATOM   872  C CA    . ARG A 1 110 ? 47.957  -24.596 25.650  1.00 127.69 ? 120 ARG A CA    1 
ATOM   873  C C     . ARG A 1 110 ? 48.255  -25.441 24.416  1.00 125.69 ? 120 ARG A C     1 
ATOM   874  O O     . ARG A 1 110 ? 48.200  -26.670 24.461  1.00 124.84 ? 120 ARG A O     1 
ATOM   875  C CB    . ARG A 1 110 ? 46.644  -23.828 25.454  1.00 138.02 ? 120 ARG A CB    1 
ATOM   876  C CG    . ARG A 1 110 ? 45.448  -24.707 25.108  1.00 137.81 ? 120 ARG A CG    1 
ATOM   877  C CD    . ARG A 1 110 ? 44.190  -23.886 24.838  1.00 139.23 ? 120 ARG A CD    1 
ATOM   878  N NE    . ARG A 1 110 ? 44.292  -23.115 23.606  1.00 138.74 ? 120 ARG A NE    1 
ATOM   879  C CZ    . ARG A 1 110 ? 44.059  -23.618 22.401  1.00 137.55 ? 120 ARG A CZ    1 
ATOM   880  N NH1   . ARG A 1 110 ? 43.714  -24.893 22.273  1.00 136.77 ? 120 ARG A NH1   1 
ATOM   881  N NH2   . ARG A 1 110 ? 44.175  -22.849 21.328  1.00 137.40 ? 120 ARG A NH2   1 
ATOM   882  N N     . LEU A 1 111 ? 48.588  -24.774 23.320  1.00 125.18 ? 121 LEU A N     1 
ATOM   883  C CA    . LEU A 1 111 ? 48.802  -25.459 22.059  1.00 123.60 ? 121 LEU A CA    1 
ATOM   884  C C     . LEU A 1 111 ? 50.026  -26.362 22.096  1.00 122.28 ? 121 LEU A C     1 
ATOM   885  O O     . LEU A 1 111 ? 49.981  -27.479 21.585  1.00 121.20 ? 121 LEU A O     1 
ATOM   886  C CB    . LEU A 1 111 ? 48.933  -24.445 20.923  1.00 123.73 ? 121 LEU A CB    1 
ATOM   887  C CG    . LEU A 1 111 ? 47.654  -23.724 20.479  1.00 124.82 ? 121 LEU A CG    1 
ATOM   888  C CD1   . LEU A 1 111 ? 47.949  -22.657 19.422  1.00 125.20 ? 121 LEU A CD1   1 
ATOM   889  C CD2   . LEU A 1 111 ? 46.617  -24.716 19.964  1.00 124.32 ? 121 LEU A CD2   1 
ATOM   890  N N     . PHE A 1 112 ? 51.113  -25.885 22.697  1.00 122.56 ? 122 PHE A N     1 
ATOM   891  C CA    . PHE A 1 112 ? 52.348  -26.665 22.761  1.00 121.48 ? 122 PHE A CA    1 
ATOM   892  C C     . PHE A 1 112 ? 52.143  -27.979 23.504  1.00 121.09 ? 122 PHE A C     1 
ATOM   893  O O     . PHE A 1 112 ? 52.693  -29.013 23.119  1.00 119.93 ? 122 PHE A O     1 
ATOM   894  C CB    . PHE A 1 112 ? 53.469  -25.870 23.427  1.00 122.27 ? 122 PHE A CB    1 
ATOM   895  C CG    . PHE A 1 112 ? 54.754  -26.638 23.563  1.00 121.37 ? 122 PHE A CG    1 
ATOM   896  C CD1   . PHE A 1 112 ? 55.620  -26.765 22.491  1.00 120.40 ? 122 PHE A CD1   1 
ATOM   897  C CD2   . PHE A 1 112 ? 55.092  -27.244 24.760  1.00 121.67 ? 122 PHE A CD2   1 
ATOM   898  C CE1   . PHE A 1 112 ? 56.802  -27.476 22.611  1.00 119.70 ? 122 PHE A CE1   1 
ATOM   899  C CE2   . PHE A 1 112 ? 56.273  -27.954 24.884  1.00 120.96 ? 122 PHE A CE2   1 
ATOM   900  C CZ    . PHE A 1 112 ? 57.128  -28.069 23.808  1.00 119.95 ? 122 PHE A CZ    1 
ATOM   901  N N     . GLN A 1 113 ? 51.356  -27.932 24.573  1.00 122.30 ? 123 GLN A N     1 
ATOM   902  C CA    . GLN A 1 113 ? 51.010  -29.129 25.328  1.00 122.39 ? 123 GLN A CA    1 
ATOM   903  C C     . GLN A 1 113 ? 50.298  -30.155 24.446  1.00 121.56 ? 123 GLN A C     1 
ATOM   904  O O     . GLN A 1 113 ? 50.570  -31.355 24.518  1.00 121.00 ? 123 GLN A O     1 
ATOM   905  C CB    . GLN A 1 113 ? 50.137  -28.761 26.525  1.00 124.21 ? 123 GLN A CB    1 
ATOM   906  C CG    . GLN A 1 113 ? 50.869  -27.983 27.592  1.00 125.36 ? 123 GLN A CG    1 
ATOM   907  C CD    . GLN A 1 113 ? 49.921  -27.289 28.533  1.00 127.43 ? 123 GLN A CD    1 
ATOM   908  O OE1   . GLN A 1 113 ? 48.734  -27.150 28.239  1.00 127.93 ? 123 GLN A OE1   1 
ATOM   909  N NE2   . GLN A 1 113 ? 50.435  -26.847 29.674  1.00 128.83 ? 123 GLN A NE2   1 
ATOM   910  N N     . GLN A 1 114 ? 49.397  -29.668 23.602  1.00 121.69 ? 124 GLN A N     1 
ATOM   911  C CA    . GLN A 1 114 ? 48.621  -30.534 22.727  1.00 121.27 ? 124 GLN A CA    1 
ATOM   912  C C     . GLN A 1 114 ? 49.495  -31.183 21.666  1.00 119.79 ? 124 GLN A C     1 
ATOM   913  O O     . GLN A 1 114 ? 49.360  -32.371 21.384  1.00 119.44 ? 124 GLN A O     1 
ATOM   914  C CB    . GLN A 1 114 ? 47.488  -29.746 22.072  1.00 121.95 ? 124 GLN A CB    1 
ATOM   915  C CG    . GLN A 1 114 ? 46.485  -29.182 23.069  1.00 123.65 ? 124 GLN A CG    1 
ATOM   916  C CD    . GLN A 1 114 ? 45.258  -28.594 22.400  1.00 124.45 ? 124 GLN A CD    1 
ATOM   917  O OE1   . GLN A 1 114 ? 45.099  -28.688 21.183  1.00 123.77 ? 124 GLN A OE1   1 
ATOM   918  N NE2   . GLN A 1 114 ? 44.381  -27.985 23.194  1.00 126.08 ? 124 GLN A NE2   1 
ATOM   919  N N     . ILE A 1 115 ? 50.395  -30.400 21.083  1.00 119.17 ? 125 ILE A N     1 
ATOM   920  C CA    . ILE A 1 115 ? 51.276  -30.899 20.038  1.00 117.99 ? 125 ILE A CA    1 
ATOM   921  C C     . ILE A 1 115 ? 52.301  -31.871 20.610  1.00 117.38 ? 125 ILE A C     1 
ATOM   922  O O     . ILE A 1 115 ? 52.593  -32.910 20.013  1.00 116.70 ? 125 ILE A O     1 
ATOM   923  C CB    . ILE A 1 115 ? 51.999  -29.751 19.324  1.00 117.85 ? 125 ILE A CB    1 
ATOM   924  C CG1   . ILE A 1 115 ? 50.992  -28.748 18.774  1.00 118.64 ? 125 ILE A CG1   1 
ATOM   925  C CG2   . ILE A 1 115 ? 52.833  -30.280 18.190  1.00 116.89 ? 125 ILE A CG2   1 
ATOM   926  C CD1   . ILE A 1 115 ? 51.634  -27.624 18.004  1.00 118.82 ? 125 ILE A CD1   1 
ATOM   927  N N     . LEU A 1 116 ? 52.838  -31.535 21.777  1.00 117.83 ? 126 LEU A N     1 
ATOM   928  C CA    . LEU A 1 116 ? 53.850  -32.373 22.400  1.00 117.45 ? 126 LEU A CA    1 
ATOM   929  C C     . LEU A 1 116 ? 53.248  -33.703 22.837  1.00 117.67 ? 126 LEU A C     1 
ATOM   930  O O     . LEU A 1 116 ? 53.942  -34.717 22.864  1.00 117.19 ? 126 LEU A O     1 
ATOM   931  C CB    . LEU A 1 116 ? 54.498  -31.659 23.585  1.00 118.20 ? 126 LEU A CB    1 
ATOM   932  C CG    . LEU A 1 116 ? 55.633  -32.410 24.284  1.00 118.00 ? 126 LEU A CG    1 
ATOM   933  C CD1   . LEU A 1 116 ? 56.821  -32.634 23.373  1.00 116.94 ? 126 LEU A CD1   1 
ATOM   934  C CD2   . LEU A 1 116 ? 56.058  -31.647 25.504  1.00 119.15 ? 126 LEU A CD2   1 
ATOM   935  N N     . SER A 1 117 ? 51.957  -33.706 23.165  1.00 118.61 ? 127 SER A N     1 
ATOM   936  C CA    . SER A 1 117 ? 51.274  -34.949 23.525  1.00 119.20 ? 127 SER A CA    1 
ATOM   937  C C     . SER A 1 117 ? 51.094  -35.799 22.281  1.00 118.56 ? 127 SER A C     1 
ATOM   938  O O     . SER A 1 117 ? 51.051  -37.029 22.345  1.00 118.81 ? 127 SER A O     1 
ATOM   939  C CB    . SER A 1 117 ? 49.921  -34.674 24.172  1.00 120.67 ? 127 SER A CB    1 
ATOM   940  O OG    . SER A 1 117 ? 49.039  -34.089 23.233  1.00 120.68 ? 127 SER A OG    1 
ATOM   941  N N     . GLY A 1 118 ? 50.992  -35.121 21.146  1.00 117.97 ? 128 GLY A N     1 
ATOM   942  C CA    . GLY A 1 118 ? 50.904  -35.786 19.866  1.00 117.50 ? 128 GLY A CA    1 
ATOM   943  C C     . GLY A 1 118 ? 52.197  -36.492 19.519  1.00 116.59 ? 128 GLY A C     1 
ATOM   944  O O     . GLY A 1 118 ? 52.190  -37.671 19.171  1.00 116.69 ? 128 GLY A O     1 
ATOM   945  N N     . VAL A 1 119 ? 53.314  -35.781 19.614  1.00 115.90 ? 129 VAL A N     1 
ATOM   946  C CA    . VAL A 1 119 ? 54.592  -36.375 19.243  1.00 115.15 ? 129 VAL A CA    1 
ATOM   947  C C     . VAL A 1 119 ? 55.026  -37.421 20.271  1.00 115.39 ? 129 VAL A C     1 
ATOM   948  O O     . VAL A 1 119 ? 55.789  -38.336 19.953  1.00 115.06 ? 129 VAL A O     1 
ATOM   949  C CB    . VAL A 1 119 ? 55.695  -35.313 19.084  1.00 114.66 ? 129 VAL A CB    1 
ATOM   950  C CG1   . VAL A 1 119 ? 55.279  -34.263 18.076  1.00 114.69 ? 129 VAL A CG1   1 
ATOM   951  C CG2   . VAL A 1 119 ? 55.986  -34.661 20.400  1.00 115.09 ? 129 VAL A CG2   1 
ATOM   952  N N     . ASP A 1 120 ? 54.534  -37.286 21.500  1.00 116.16 ? 130 ASP A N     1 
ATOM   953  C CA    . ASP A 1 120 ? 54.808  -38.262 22.548  1.00 116.73 ? 130 ASP A CA    1 
ATOM   954  C C     . ASP A 1 120 ? 54.117  -39.566 22.196  1.00 117.30 ? 130 ASP A C     1 
ATOM   955  O O     . ASP A 1 120 ? 54.710  -40.640 22.283  1.00 117.39 ? 130 ASP A O     1 
ATOM   956  C CB    . ASP A 1 120 ? 54.332  -37.754 23.911  1.00 136.65 ? 130 ASP A CB    1 
ATOM   957  C CG    . ASP A 1 120 ? 54.584  -38.749 25.033  1.00 137.52 ? 130 ASP A CG    1 
ATOM   958  O OD1   . ASP A 1 120 ? 55.715  -39.273 25.132  1.00 137.09 ? 130 ASP A OD1   1 
ATOM   959  O OD2   . ASP A 1 120 ? 53.647  -39.006 25.820  1.00 138.83 ? 130 ASP A OD2   1 
ATOM   960  N N     . TYR A 1 121 ? 52.854  -39.451 21.796  1.00 117.89 ? 131 TYR A N     1 
ATOM   961  C CA    . TYR A 1 121 ? 52.058  -40.579 21.333  1.00 118.75 ? 131 TYR A CA    1 
ATOM   962  C C     . TYR A 1 121 ? 52.765  -41.287 20.186  1.00 118.08 ? 131 TYR A C     1 
ATOM   963  O O     . TYR A 1 121 ? 52.817  -42.515 20.128  1.00 118.78 ? 131 TYR A O     1 
ATOM   964  C CB    . TYR A 1 121 ? 50.672  -40.092 20.901  1.00 119.44 ? 131 TYR A CB    1 
ATOM   965  C CG    . TYR A 1 121 ? 49.698  -41.175 20.511  1.00 120.76 ? 131 TYR A CG    1 
ATOM   966  C CD1   . TYR A 1 121 ? 48.959  -41.855 21.464  1.00 122.41 ? 131 TYR A CD1   1 
ATOM   967  C CD2   . TYR A 1 121 ? 49.494  -41.497 19.190  1.00 120.67 ? 131 TYR A CD2   1 
ATOM   968  C CE1   . TYR A 1 121 ? 48.061  -42.840 21.105  1.00 123.97 ? 131 TYR A CE1   1 
ATOM   969  C CE2   . TYR A 1 121 ? 48.602  -42.473 18.824  1.00 122.17 ? 131 TYR A CE2   1 
ATOM   970  C CZ    . TYR A 1 121 ? 47.889  -43.143 19.782  1.00 123.84 ? 131 TYR A CZ    1 
ATOM   971  O OH    . TYR A 1 121 ? 46.998  -44.122 19.402  1.00 125.66 ? 131 TYR A OH    1 
ATOM   972  N N     . CYS A 1 122 ? 53.324  -40.497 19.282  1.00 116.97 ? 132 CYS A N     1 
ATOM   973  C CA    . CYS A 1 122 ? 54.038  -41.033 18.136  1.00 116.47 ? 132 CYS A CA    1 
ATOM   974  C C     . CYS A 1 122 ? 55.306  -41.754 18.563  1.00 116.16 ? 132 CYS A C     1 
ATOM   975  O O     . CYS A 1 122 ? 55.574  -42.873 18.125  1.00 116.56 ? 132 CYS A O     1 
ATOM   976  C CB    . CYS A 1 122 ? 54.372  -39.916 17.153  1.00 115.61 ? 132 CYS A CB    1 
ATOM   977  S SG    . CYS A 1 122 ? 52.921  -39.104 16.466  1.00 116.11 ? 132 CYS A SG    1 
ATOM   978  N N     . HIS A 1 123 ? 56.085  -41.111 19.424  1.00 115.63 ? 133 HIS A N     1 
ATOM   979  C CA    . HIS A 1 123 ? 57.351  -41.681 19.868  1.00 115.40 ? 133 HIS A CA    1 
ATOM   980  C C     . HIS A 1 123 ? 57.152  -42.986 20.637  1.00 116.43 ? 133 HIS A C     1 
ATOM   981  O O     . HIS A 1 123 ? 57.963  -43.910 20.530  1.00 116.55 ? 133 HIS A O     1 
ATOM   982  C CB    . HIS A 1 123 ? 58.115  -40.671 20.726  1.00 114.97 ? 133 HIS A CB    1 
ATOM   983  C CG    . HIS A 1 123 ? 58.655  -39.511 19.951  1.00 114.19 ? 133 HIS A CG    1 
ATOM   984  N ND1   . HIS A 1 123 ? 59.478  -38.558 20.509  1.00 114.01 ? 133 HIS A ND1   1 
ATOM   985  C CD2   . HIS A 1 123 ? 58.492  -39.151 18.658  1.00 113.83 ? 133 HIS A CD2   1 
ATOM   986  C CE1   . HIS A 1 123 ? 59.795  -37.662 19.596  1.00 113.61 ? 133 HIS A CE1   1 
ATOM   987  N NE2   . HIS A 1 123 ? 59.208  -37.997 18.463  1.00 113.47 ? 133 HIS A NE2   1 
ATOM   988  N N     . ARG A 1 124 ? 56.068  -43.060 21.404  1.00 131.55 ? 134 ARG A N     1 
ATOM   989  C CA    . ARG A 1 124 ? 55.770  -44.258 22.180  1.00 132.92 ? 134 ARG A CA    1 
ATOM   990  C C     . ARG A 1 124 ? 55.283  -45.378 21.274  1.00 133.72 ? 134 ARG A C     1 
ATOM   991  O O     . ARG A 1 124 ? 55.349  -46.546 21.642  1.00 134.90 ? 134 ARG A O     1 
ATOM   992  C CB    . ARG A 1 124 ? 54.733  -43.959 23.267  1.00 178.20 ? 134 ARG A CB    1 
ATOM   993  C CG    . ARG A 1 124 ? 55.343  -43.706 24.637  1.00 178.49 ? 134 ARG A CG    1 
ATOM   994  C CD    . ARG A 1 124 ? 54.570  -42.660 25.427  1.00 178.96 ? 134 ARG A CD    1 
ATOM   995  N NE    . ARG A 1 124 ? 53.130  -42.890 25.402  1.00 180.21 ? 134 ARG A NE    1 
ATOM   996  C CZ    . ARG A 1 124 ? 52.254  -42.216 26.141  1.00 181.13 ? 134 ARG A CZ    1 
ATOM   997  N NH1   . ARG A 1 124 ? 52.671  -41.273 26.977  1.00 180.99 ? 134 ARG A NH1   1 
ATOM   998  N NH2   . ARG A 1 124 ? 50.961  -42.493 26.047  1.00 182.42 ? 134 ARG A NH2   1 
ATOM   999  N N     . HIS A 1 125 ? 54.797  -45.019 20.090  1.00 119.16 ? 135 HIS A N     1 
ATOM   1000 C CA    . HIS A 1 125 ? 54.341  -46.003 19.116  1.00 120.10 ? 135 HIS A CA    1 
ATOM   1001 C C     . HIS A 1 125 ? 55.443  -46.351 18.123  1.00 119.41 ? 135 HIS A C     1 
ATOM   1002 O O     . HIS A 1 125 ? 55.192  -47.016 17.118  1.00 120.13 ? 135 HIS A O     1 
ATOM   1003 C CB    . HIS A 1 125 ? 53.097  -45.507 18.385  1.00 120.47 ? 135 HIS A CB    1 
ATOM   1004 C CG    . HIS A 1 125 ? 51.826  -45.707 19.150  1.00 121.98 ? 135 HIS A CG    1 
ATOM   1005 N ND1   . HIS A 1 125 ? 51.356  -46.954 19.500  1.00 123.88 ? 135 HIS A ND1   1 
ATOM   1006 C CD2   . HIS A 1 125 ? 50.921  -44.819 19.622  1.00 122.13 ? 135 HIS A CD2   1 
ATOM   1007 C CE1   . HIS A 1 125 ? 50.220  -46.826 20.160  1.00 125.15 ? 135 HIS A CE1   1 
ATOM   1008 N NE2   . HIS A 1 125 ? 49.932  -45.539 20.246  1.00 124.08 ? 135 HIS A NE2   1 
ATOM   1009 N N     . MET A 1 126 ? 56.648  -45.853 18.387  1.00 119.71 ? 136 MET A N     1 
ATOM   1010 C CA    . MET A 1 126 ? 57.817  -46.131 17.555  1.00 119.16 ? 136 MET A CA    1 
ATOM   1011 C C     . MET A 1 126 ? 57.668  -45.595 16.125  1.00 118.74 ? 136 MET A C     1 
ATOM   1012 O O     . MET A 1 126 ? 58.083  -46.249 15.162  1.00 119.14 ? 136 MET A O     1 
ATOM   1013 C CB    . MET A 1 126 ? 58.107  -47.639 17.508  1.00 157.98 ? 136 MET A CB    1 
ATOM   1014 C CG    . MET A 1 126 ? 58.263  -48.309 18.856  1.00 158.76 ? 136 MET A CG    1 
ATOM   1015 S SD    . MET A 1 126 ? 59.616  -47.616 19.817  1.00 157.55 ? 136 MET A SD    1 
ATOM   1016 C CE    . MET A 1 126 ? 59.769  -48.852 21.105  1.00 159.09 ? 136 MET A CE    1 
ATOM   1017 N N     . VAL A 1 127 ? 57.066  -44.414 15.988  1.00 116.61 ? 137 VAL A N     1 
ATOM   1018 C CA    . VAL A 1 127 ? 56.992  -43.723 14.695  1.00 116.26 ? 137 VAL A CA    1 
ATOM   1019 C C     . VAL A 1 127 ? 57.299  -42.231 14.848  1.00 115.19 ? 137 VAL A C     1 
ATOM   1020 O O     . VAL A 1 127 ? 56.697  -41.536 15.664  1.00 115.05 ? 137 VAL A O     1 
ATOM   1021 C CB    . VAL A 1 127 ? 55.609  -43.898 14.028  1.00 148.30 ? 137 VAL A CB    1 
ATOM   1022 C CG1   . VAL A 1 127 ? 55.373  -45.359 13.665  1.00 149.70 ? 137 VAL A CG1   1 
ATOM   1023 C CG2   . VAL A 1 127 ? 54.514  -43.401 14.932  1.00 148.50 ? 137 VAL A CG2   1 
ATOM   1024 N N     . VAL A 1 128 ? 58.256  -41.739 14.072  1.00 114.69 ? 138 VAL A N     1 
ATOM   1025 C CA    . VAL A 1 128 ? 58.675  -40.350 14.208  1.00 114.00 ? 138 VAL A CA    1 
ATOM   1026 C C     . VAL A 1 128 ? 58.142  -39.491 13.085  1.00 114.14 ? 138 VAL A C     1 
ATOM   1027 O O     . VAL A 1 128 ? 58.036  -39.935 11.948  1.00 114.63 ? 138 VAL A O     1 
ATOM   1028 C CB    . VAL A 1 128 ? 60.206  -40.214 14.243  1.00 113.61 ? 138 VAL A CB    1 
ATOM   1029 C CG1   . VAL A 1 128 ? 60.734  -40.763 15.524  1.00 113.50 ? 138 VAL A CG1   1 
ATOM   1030 C CG2   . VAL A 1 128 ? 60.837  -40.945 13.084  1.00 113.98 ? 138 VAL A CG2   1 
ATOM   1031 N N     . HIS A 1 129 ? 57.808  -38.253 13.401  1.00 130.88 ? 139 HIS A N     1 
ATOM   1032 C CA    . HIS A 1 129 ? 57.341  -37.331 12.389  1.00 131.15 ? 139 HIS A CA    1 
ATOM   1033 C C     . HIS A 1 129 ? 58.457  -36.331 12.130  1.00 130.99 ? 139 HIS A C     1 
ATOM   1034 O O     . HIS A 1 129 ? 58.649  -35.407 12.913  1.00 130.82 ? 139 HIS A O     1 
ATOM   1035 C CB    . HIS A 1 129 ? 56.068  -36.651 12.887  1.00 135.28 ? 139 HIS A CB    1 
ATOM   1036 C CG    . HIS A 1 129 ? 55.387  -35.798 11.869  1.00 135.76 ? 139 HIS A CG    1 
ATOM   1037 N ND1   . HIS A 1 129 ? 55.970  -35.459 10.669  1.00 136.03 ? 139 HIS A ND1   1 
ATOM   1038 C CD2   . HIS A 1 129 ? 54.167  -35.210 11.881  1.00 136.20 ? 139 HIS A CD2   1 
ATOM   1039 C CE1   . HIS A 1 129 ? 55.135  -34.701 9.979   1.00 136.62 ? 139 HIS A CE1   1 
ATOM   1040 N NE2   . HIS A 1 129 ? 54.036  -34.533 10.693  1.00 136.69 ? 139 HIS A NE2   1 
ATOM   1041 N N     . ARG A 1 130 ? 59.163  -36.479 11.015  1.00 114.33 ? 140 ARG A N     1 
ATOM   1042 C CA    . ARG A 1 130 ? 60.392  -35.715 10.825  1.00 114.43 ? 140 ARG A CA    1 
ATOM   1043 C C     . ARG A 1 130 ? 60.106  -34.276 10.448  1.00 114.91 ? 140 ARG A C     1 
ATOM   1044 O O     . ARG A 1 130 ? 60.802  -33.356 10.885  1.00 115.06 ? 140 ARG A O     1 
ATOM   1045 C CB    . ARG A 1 130 ? 61.275  -36.356 9.758   1.00 115.33 ? 140 ARG A CB    1 
ATOM   1046 C CG    . ARG A 1 130 ? 62.213  -37.421 10.282  1.00 115.03 ? 140 ARG A CG    1 
ATOM   1047 C CD    . ARG A 1 130 ? 61.568  -38.794 10.269  1.00 115.04 ? 140 ARG A CD    1 
ATOM   1048 N NE    . ARG A 1 130 ? 61.319  -39.278 8.912   1.00 115.89 ? 140 ARG A NE    1 
ATOM   1049 C CZ    . ARG A 1 130 ? 62.247  -39.814 8.120   1.00 116.51 ? 140 ARG A CZ    1 
ATOM   1050 N NH1   . ARG A 1 130 ? 63.498  -39.932 8.537   1.00 116.33 ? 140 ARG A NH1   1 
ATOM   1051 N NH2   . ARG A 1 130 ? 61.925  -40.228 6.902   1.00 117.52 ? 140 ARG A NH2   1 
ATOM   1052 N N     . ASP A 1 131 ? 59.076  -34.078 9.638   1.00 115.35 ? 141 ASP A N     1 
ATOM   1053 C CA    . ASP A 1 131 ? 58.768  -32.739 9.174   1.00 116.03 ? 141 ASP A CA    1 
ATOM   1054 C C     . ASP A 1 131 ? 57.736  -32.125 10.112  1.00 115.82 ? 141 ASP A C     1 
ATOM   1055 O O     . ASP A 1 131 ? 56.541  -32.330 9.959   1.00 115.92 ? 141 ASP A O     1 
ATOM   1056 C CB    . ASP A 1 131 ? 58.250  -32.816 7.726   1.00 152.48 ? 141 ASP A CB    1 
ATOM   1057 C CG    . ASP A 1 131 ? 57.987  -31.453 7.101   1.00 153.47 ? 141 ASP A CG    1 
ATOM   1058 O OD1   . ASP A 1 131 ? 58.595  -30.455 7.544   1.00 153.70 ? 141 ASP A OD1   1 
ATOM   1059 O OD2   . ASP A 1 131 ? 57.176  -31.392 6.146   1.00 154.22 ? 141 ASP A OD2   1 
ATOM   1060 N N     . LEU A 1 132 ? 58.203  -31.273 11.016  1.00 115.81 ? 142 LEU A N     1 
ATOM   1061 C CA    . LEU A 1 132 ? 57.341  -30.675 12.023  1.00 115.80 ? 142 LEU A CA    1 
ATOM   1062 C C     . LEU A 1 132 ? 57.379  -29.174 11.830  1.00 116.77 ? 142 LEU A C     1 
ATOM   1063 O O     . LEU A 1 132 ? 58.452  -28.589 11.686  1.00 117.28 ? 142 LEU A O     1 
ATOM   1064 C CB    . LEU A 1 132 ? 57.790  -31.063 13.435  1.00 115.23 ? 142 LEU A CB    1 
ATOM   1065 C CG    . LEU A 1 132 ? 56.857  -31.918 14.296  1.00 114.79 ? 142 LEU A CG    1 
ATOM   1066 C CD1   . LEU A 1 132 ? 56.181  -32.983 13.474  1.00 114.65 ? 142 LEU A CD1   1 
ATOM   1067 C CD2   . LEU A 1 132 ? 57.629  -32.566 15.431  1.00 114.35 ? 142 LEU A CD2   1 
ATOM   1068 N N     . LYS A 1 133 ? 56.206  -28.554 11.838  1.00 117.23 ? 143 LYS A N     1 
ATOM   1069 C CA    . LYS A 1 133 ? 56.080  -27.139 11.518  1.00 118.41 ? 143 LYS A CA    1 
ATOM   1070 C C     . LYS A 1 133 ? 54.642  -26.692 11.729  1.00 118.81 ? 143 LYS A C     1 
ATOM   1071 O O     . LYS A 1 133 ? 53.728  -27.515 11.687  1.00 118.32 ? 143 LYS A O     1 
ATOM   1072 C CB    . LYS A 1 133 ? 56.522  -26.866 10.074  1.00 146.37 ? 143 LYS A CB    1 
ATOM   1073 C CG    . LYS A 1 133 ? 55.847  -27.740 9.018   1.00 146.17 ? 143 LYS A CG    1 
ATOM   1074 C CD    . LYS A 1 133 ? 56.424  -27.475 7.620   1.00 147.18 ? 143 LYS A CD    1 
ATOM   1075 C CE    . LYS A 1 133 ? 55.829  -28.398 6.555   1.00 147.23 ? 143 LYS A CE    1 
ATOM   1076 N NZ    . LYS A 1 133 ? 56.536  -28.308 5.246   1.00 148.32 ? 143 LYS A NZ    1 
ATOM   1077 N N     . PRO A 1 134 ? 54.437  -25.389 11.978  1.00 119.91 ? 144 PRO A N     1 
ATOM   1078 C CA    . PRO A 1 134 ? 53.079  -24.860 12.138  1.00 120.54 ? 144 PRO A CA    1 
ATOM   1079 C C     . PRO A 1 134 ? 52.271  -25.016 10.858  1.00 120.88 ? 144 PRO A C     1 
ATOM   1080 O O     . PRO A 1 134 ? 51.044  -25.084 10.898  1.00 121.11 ? 144 PRO A O     1 
ATOM   1081 C CB    . PRO A 1 134 ? 53.312  -23.383 12.471  1.00 121.95 ? 144 PRO A CB    1 
ATOM   1082 C CG    . PRO A 1 134 ? 54.673  -23.089 11.962  1.00 122.33 ? 144 PRO A CG    1 
ATOM   1083 C CD    . PRO A 1 134 ? 55.451  -24.342 12.159  1.00 120.89 ? 144 PRO A CD    1 
ATOM   1084 N N     . GLU A 1 135 ? 52.970  -25.083 9.732   1.00 125.83 ? 145 GLU A N     1 
ATOM   1085 C CA    . GLU A 1 135 ? 52.337  -25.320 8.446   1.00 126.33 ? 145 GLU A CA    1 
ATOM   1086 C C     . GLU A 1 135 ? 51.858  -26.765 8.319   1.00 125.36 ? 145 GLU A C     1 
ATOM   1087 O O     . GLU A 1 135 ? 51.138  -27.092 7.375   1.00 125.87 ? 145 GLU A O     1 
ATOM   1088 C CB    . GLU A 1 135 ? 53.309  -24.981 7.313   1.00 191.84 ? 145 GLU A CB    1 
ATOM   1089 C CG    . GLU A 1 135 ? 53.725  -23.520 7.282   1.00 193.30 ? 145 GLU A CG    1 
ATOM   1090 C CD    . GLU A 1 135 ? 55.055  -23.293 6.595   1.00 194.03 ? 145 GLU A CD    1 
ATOM   1091 O OE1   . GLU A 1 135 ? 55.145  -22.360 5.769   1.00 195.74 ? 145 GLU A OE1   1 
ATOM   1092 O OE2   . GLU A 1 135 ? 56.014  -24.037 6.888   1.00 193.09 ? 145 GLU A OE2   1 
ATOM   1093 N N     . ASN A 1 136 ? 52.317  -27.634 9.226   1.00 119.47 ? 146 ASN A N     1 
ATOM   1094 C CA    . ASN A 1 136 ? 51.863  -29.027 9.282   1.00 118.76 ? 146 ASN A CA    1 
ATOM   1095 C C     . ASN A 1 136 ? 50.826  -29.372 10.348  1.00 118.55 ? 146 ASN A C     1 
ATOM   1096 O O     . ASN A 1 136 ? 50.312  -30.491 10.354  1.00 118.34 ? 146 ASN A O     1 
ATOM   1097 C CB    . ASN A 1 136 ? 53.063  -29.959 9.468   1.00 124.82 ? 146 ASN A CB    1 
ATOM   1098 C CG    . ASN A 1 136 ? 53.633  -30.452 8.148   1.00 125.14 ? 146 ASN A CG    1 
ATOM   1099 O OD1   . ASN A 1 136 ? 53.096  -30.169 7.073   1.00 126.07 ? 146 ASN A OD1   1 
ATOM   1100 N ND2   . ASN A 1 136 ? 54.736  -31.187 8.221   1.00 124.54 ? 146 ASN A ND2   1 
ATOM   1101 N N     . VAL A 1 137 ? 50.499  -28.430 11.231  1.00 118.86 ? 147 VAL A N     1 
ATOM   1102 C CA    . VAL A 1 137 ? 49.529  -28.717 12.287  1.00 118.91 ? 147 VAL A CA    1 
ATOM   1103 C C     . VAL A 1 137 ? 48.274  -27.870 12.137  1.00 120.04 ? 147 VAL A C     1 
ATOM   1104 O O     . VAL A 1 137 ? 48.334  -26.645 12.041  1.00 120.74 ? 147 VAL A O     1 
ATOM   1105 C CB    . VAL A 1 137 ? 50.122  -28.514 13.700  1.00 118.53 ? 147 VAL A CB    1 
ATOM   1106 C CG1   . VAL A 1 137 ? 51.226  -29.512 13.945  1.00 117.51 ? 147 VAL A CG1   1 
ATOM   1107 C CG2   . VAL A 1 137 ? 50.646  -27.116 13.884  1.00 119.13 ? 147 VAL A CG2   1 
ATOM   1108 N N     . LEU A 1 138 ? 47.132  -28.545 12.107  1.00 120.42 ? 148 LEU A N     1 
ATOM   1109 C CA    . LEU A 1 138 ? 45.851  -27.901 11.854  1.00 121.63 ? 148 LEU A CA    1 
ATOM   1110 C C     . LEU A 1 138 ? 45.137  -27.504 13.138  1.00 122.17 ? 148 LEU A C     1 
ATOM   1111 O O     . LEU A 1 138 ? 45.625  -27.772 14.235  1.00 121.64 ? 148 LEU A O     1 
ATOM   1112 C CB    . LEU A 1 138 ? 44.956  -28.829 11.047  1.00 122.13 ? 148 LEU A CB    1 
ATOM   1113 C CG    . LEU A 1 138 ? 45.558  -29.414 9.778   1.00 121.87 ? 148 LEU A CG    1 
ATOM   1114 C CD1   . LEU A 1 138 ? 44.824  -30.688 9.407   1.00 122.33 ? 148 LEU A CD1   1 
ATOM   1115 C CD2   . LEU A 1 138 ? 45.453  -28.389 8.676   1.00 122.74 ? 148 LEU A CD2   1 
ATOM   1116 N N     . LEU A 1 139 ? 43.969  -26.882 12.991  1.00 123.41 ? 149 LEU A N     1 
ATOM   1117 C CA    . LEU A 1 139 ? 43.132  -26.499 14.127  1.00 124.29 ? 149 LEU A CA    1 
ATOM   1118 C C     . LEU A 1 139 ? 41.670  -26.778 13.824  1.00 125.51 ? 149 LEU A C     1 
ATOM   1119 O O     . LEU A 1 139 ? 41.180  -26.416 12.760  1.00 126.17 ? 149 LEU A O     1 
ATOM   1120 C CB    . LEU A 1 139 ? 43.305  -25.018 14.467  1.00 125.01 ? 149 LEU A CB    1 
ATOM   1121 C CG    . LEU A 1 139 ? 44.709  -24.508 14.795  1.00 124.31 ? 149 LEU A CG    1 
ATOM   1122 C CD1   . LEU A 1 139 ? 45.421  -23.986 13.550  1.00 124.20 ? 149 LEU A CD1   1 
ATOM   1123 C CD2   . LEU A 1 139 ? 44.654  -23.443 15.885  1.00 125.33 ? 149 LEU A CD2   1 
ATOM   1124 N N     . ASP A 1 140 ? 40.967  -27.410 14.756  1.00 126.03 ? 150 ASP A N     1 
ATOM   1125 C CA    . ASP A 1 140 ? 39.548  -27.677 14.556  1.00 127.48 ? 150 ASP A CA    1 
ATOM   1126 C C     . ASP A 1 140 ? 38.723  -26.420 14.830  1.00 128.89 ? 150 ASP A C     1 
ATOM   1127 O O     . ASP A 1 140 ? 39.280  -25.346 15.049  1.00 128.76 ? 150 ASP A O     1 
ATOM   1128 C CB    . ASP A 1 140 ? 39.084  -28.842 15.437  1.00 127.89 ? 150 ASP A CB    1 
ATOM   1129 C CG    . ASP A 1 140 ? 39.424  -28.648 16.907  1.00 127.85 ? 150 ASP A CG    1 
ATOM   1130 O OD1   . ASP A 1 140 ? 39.769  -27.516 17.302  1.00 127.85 ? 150 ASP A OD1   1 
ATOM   1131 O OD2   . ASP A 1 140 ? 39.331  -29.632 17.673  1.00 128.05 ? 150 ASP A OD2   1 
ATOM   1132 N N     . ALA A 1 141 ? 37.399  -26.559 14.817  1.00 130.45 ? 151 ALA A N     1 
ATOM   1133 C CA    . ALA A 1 141 ? 36.495  -25.434 15.054  1.00 132.06 ? 151 ALA A CA    1 
ATOM   1134 C C     . ALA A 1 141 ? 36.688  -24.827 16.437  1.00 132.40 ? 151 ALA A C     1 
ATOM   1135 O O     . ALA A 1 141 ? 36.353  -23.667 16.660  1.00 133.50 ? 151 ALA A O     1 
ATOM   1136 C CB    . ALA A 1 141 ? 35.049  -25.871 14.871  1.00 211.90 ? 151 ALA A CB    1 
ATOM   1137 N N     . HIS A 1 142 ? 37.230  -25.618 17.359  1.00 131.66 ? 152 HIS A N     1 
ATOM   1138 C CA    . HIS A 1 142 ? 37.465  -25.177 18.732  1.00 132.13 ? 152 HIS A CA    1 
ATOM   1139 C C     . HIS A 1 142 ? 38.871  -24.601 18.915  1.00 130.84 ? 152 HIS A C     1 
ATOM   1140 O O     . HIS A 1 142 ? 39.284  -24.304 20.038  1.00 131.14 ? 152 HIS A O     1 
ATOM   1141 C CB    . HIS A 1 142 ? 37.243  -26.334 19.708  1.00 176.87 ? 152 HIS A CB    1 
ATOM   1142 C CG    . HIS A 1 142 ? 35.888  -26.962 19.599  1.00 178.46 ? 152 HIS A CG    1 
ATOM   1143 N ND1   . HIS A 1 142 ? 35.539  -27.801 18.562  1.00 178.25 ? 152 HIS A ND1   1 
ATOM   1144 C CD2   . HIS A 1 142 ? 34.795  -26.869 20.394  1.00 180.54 ? 152 HIS A CD2   1 
ATOM   1145 C CE1   . HIS A 1 142 ? 34.290  -28.201 18.724  1.00 180.15 ? 152 HIS A CE1   1 
ATOM   1146 N NE2   . HIS A 1 142 ? 33.816  -27.650 19.828  1.00 181.55 ? 152 HIS A NE2   1 
ATOM   1147 N N     . MET A 1 143 ? 39.598  -24.474 17.806  1.00 129.63 ? 153 MET A N     1 
ATOM   1148 C CA    . MET A 1 143 ? 40.969  -23.957 17.787  1.00 128.55 ? 153 MET A CA    1 
ATOM   1149 C C     . MET A 1 143 ? 41.912  -24.785 18.664  1.00 127.43 ? 153 MET A C     1 
ATOM   1150 O O     . MET A 1 143 ? 42.757  -24.242 19.373  1.00 127.36 ? 153 MET A O     1 
ATOM   1151 C CB    . MET A 1 143 ? 40.999  -22.481 18.204  1.00 171.08 ? 153 MET A CB    1 
ATOM   1152 C CG    . MET A 1 143 ? 40.381  -21.540 17.172  1.00 172.09 ? 153 MET A CG    1 
ATOM   1153 S SD    . MET A 1 143 ? 41.346  -21.447 15.646  1.00 170.91 ? 153 MET A SD    1 
ATOM   1154 C CE    . MET A 1 143 ? 40.104  -20.952 14.449  1.00 172.28 ? 153 MET A CE    1 
ATOM   1155 N N     . ASN A 1 144 ? 41.757  -26.105 18.601  1.00 126.79 ? 154 ASN A N     1 
ATOM   1156 C CA    . ASN A 1 144 ? 42.683  -27.035 19.236  1.00 125.70 ? 154 ASN A CA    1 
ATOM   1157 C C     . ASN A 1 144 ? 43.829  -27.345 18.286  1.00 124.09 ? 154 ASN A C     1 
ATOM   1158 O O     . ASN A 1 144 ? 43.950  -26.711 17.245  1.00 123.96 ? 154 ASN A O     1 
ATOM   1159 C CB    . ASN A 1 144 ? 41.969  -28.325 19.643  1.00 134.37 ? 154 ASN A CB    1 
ATOM   1160 C CG    . ASN A 1 144 ? 40.925  -28.107 20.733  1.00 136.18 ? 154 ASN A CG    1 
ATOM   1161 O OD1   . ASN A 1 144 ? 41.096  -27.273 21.626  1.00 136.85 ? 154 ASN A OD1   1 
ATOM   1162 N ND2   . ASN A 1 144 ? 39.838  -28.869 20.666  1.00 137.22 ? 154 ASN A ND2   1 
ATOM   1163 N N     . ALA A 1 145 ? 44.664  -28.319 18.630  1.00 123.06 ? 155 ALA A N     1 
ATOM   1164 C CA    . ALA A 1 145 ? 45.787  -28.683 17.770  1.00 121.68 ? 155 ALA A CA    1 
ATOM   1165 C C     . ALA A 1 145 ? 45.526  -29.999 17.050  1.00 121.27 ? 155 ALA A C     1 
ATOM   1166 O O     . ALA A 1 145 ? 44.997  -30.932 17.644  1.00 121.69 ? 155 ALA A O     1 
ATOM   1167 C CB    . ALA A 1 145 ? 47.066  -28.772 18.581  1.00 274.06 ? 155 ALA A CB    1 
ATOM   1168 N N     . LYS A 1 146 ? 45.858  -30.062 15.765  1.00 120.74 ? 156 LYS A N     1 
ATOM   1169 C CA    . LYS A 1 146 ? 45.784  -31.317 15.017  1.00 120.48 ? 156 LYS A CA    1 
ATOM   1170 C C     . LYS A 1 146 ? 47.020  -31.522 14.132  1.00 119.42 ? 156 LYS A C     1 
ATOM   1171 O O     . LYS A 1 146 ? 47.226  -30.775 13.177  1.00 119.47 ? 156 LYS A O     1 
ATOM   1172 C CB    . LYS A 1 146 ? 44.518  -31.353 14.151  1.00 121.58 ? 156 LYS A CB    1 
ATOM   1173 C CG    . LYS A 1 146 ? 43.202  -31.264 14.909  1.00 122.90 ? 156 LYS A CG    1 
ATOM   1174 C CD    . LYS A 1 146 ? 42.676  -32.635 15.269  1.00 123.50 ? 156 LYS A CD    1 
ATOM   1175 C CE    . LYS A 1 146 ? 41.290  -32.526 15.873  1.00 125.17 ? 156 LYS A CE    1 
ATOM   1176 N NZ    . LYS A 1 146 ? 40.763  -33.847 16.303  1.00 126.14 ? 156 LYS A NZ    1 
ATOM   1177 N N     . ILE A 1 147 ? 47.818  -32.547 14.421  1.00 118.69 ? 157 ILE A N     1 
ATOM   1178 C CA    . ILE A 1 147 ? 48.977  -32.875 13.586  1.00 117.87 ? 157 ILE A CA    1 
ATOM   1179 C C     . ILE A 1 147 ? 48.540  -33.602 12.318  1.00 118.34 ? 157 ILE A C     1 
ATOM   1180 O O     . ILE A 1 147 ? 47.856  -34.621 12.395  1.00 118.90 ? 157 ILE A O     1 
ATOM   1181 C CB    . ILE A 1 147 ? 49.993  -33.745 14.336  1.00 117.09 ? 157 ILE A CB    1 
ATOM   1182 C CG1   . ILE A 1 147 ? 50.650  -32.943 15.458  1.00 116.75 ? 157 ILE A CG1   1 
ATOM   1183 C CG2   . ILE A 1 147 ? 51.044  -34.278 13.375  1.00 116.51 ? 157 ILE A CG2   1 
ATOM   1184 C CD1   . ILE A 1 147 ? 51.712  -33.703 16.201  1.00 116.10 ? 157 ILE A CD1   1 
ATOM   1185 N N     . ALA A 1 148 ? 48.947  -33.093 11.155  1.00 118.36 ? 158 ALA A N     1 
ATOM   1186 C CA    . ALA A 1 148 ? 48.377  -33.557 9.891   1.00 119.18 ? 158 ALA A CA    1 
ATOM   1187 C C     . ALA A 1 148 ? 49.282  -34.486 9.086   1.00 118.96 ? 158 ALA A C     1 
ATOM   1188 O O     . ALA A 1 148 ? 49.039  -35.690 9.032   1.00 119.31 ? 158 ALA A O     1 
ATOM   1189 C CB    . ALA A 1 148 ? 47.983  -32.363 9.030   1.00 235.01 ? 158 ALA A CB    1 
ATOM   1190 N N     . ASP A 1 149 ? 50.314  -33.926 8.459   1.00 146.59 ? 159 ASP A N     1 
ATOM   1191 C CA    . ASP A 1 149 ? 51.101  -34.648 7.452   1.00 146.76 ? 159 ASP A CA    1 
ATOM   1192 C C     . ASP A 1 149 ? 51.952  -35.744 8.070   1.00 146.01 ? 159 ASP A C     1 
ATOM   1193 O O     . ASP A 1 149 ? 52.668  -35.490 9.024   1.00 145.10 ? 159 ASP A O     1 
ATOM   1194 C CB    . ASP A 1 149 ? 52.000  -33.671 6.692   1.00 142.04 ? 159 ASP A CB    1 
ATOM   1195 C CG    . ASP A 1 149 ? 52.558  -34.260 5.417   1.00 142.74 ? 159 ASP A CG    1 
ATOM   1196 O OD1   . ASP A 1 149 ? 52.470  -35.493 5.234   1.00 142.96 ? 159 ASP A OD1   1 
ATOM   1197 O OD2   . ASP A 1 149 ? 53.090  -33.484 4.596   1.00 143.29 ? 159 ASP A OD2   1 
ATOM   1198 N N     . PHE A 1 150 ? 51.785  -36.982 7.619   1.00 118.62 ? 160 PHE A N     1 
ATOM   1199 C CA    . PHE A 1 150 ? 52.723  -38.047 7.974   1.00 118.18 ? 160 PHE A CA    1 
ATOM   1200 C C     . PHE A 1 150 ? 53.600  -38.594 6.847   1.00 118.66 ? 160 PHE A C     1 
ATOM   1201 O O     . PHE A 1 150 ? 54.255  -39.614 7.028   1.00 118.60 ? 160 PHE A O     1 
ATOM   1202 C CB    . PHE A 1 150 ? 51.973  -39.169 8.688   1.00 118.61 ? 160 PHE A CB    1 
ATOM   1203 C CG    . PHE A 1 150 ? 51.901  -38.957 10.182  1.00 117.82 ? 160 PHE A CG    1 
ATOM   1204 C CD1   . PHE A 1 150 ? 52.947  -39.356 10.996  1.00 117.01 ? 160 PHE A CD1   1 
ATOM   1205 C CD2   . PHE A 1 150 ? 50.828  -38.299 10.764  1.00 118.05 ? 160 PHE A CD2   1 
ATOM   1206 C CE1   . PHE A 1 150 ? 52.908  -39.138 12.353  1.00 116.51 ? 160 PHE A CE1   1 
ATOM   1207 C CE2   . PHE A 1 150 ? 50.789  -38.082 12.126  1.00 117.57 ? 160 PHE A CE2   1 
ATOM   1208 C CZ    . PHE A 1 150 ? 51.829  -38.503 12.917  1.00 116.83 ? 160 PHE A CZ    1 
ATOM   1209 N N     . GLY A 1 151 ? 53.554  -37.973 5.673   1.00 150.14 ? 161 GLY A N     1 
ATOM   1210 C CA    . GLY A 1 151 ? 54.236  -38.506 4.499   1.00 151.02 ? 161 GLY A CA    1 
ATOM   1211 C C     . GLY A 1 151 ? 55.746  -38.558 4.608   1.00 150.37 ? 161 GLY A C     1 
ATOM   1212 O O     . GLY A 1 151 ? 56.411  -39.354 3.941   1.00 151.05 ? 161 GLY A O     1 
ATOM   1213 N N     . LEU A 1 152 ? 56.287  -37.684 5.442   1.00 142.05 ? 162 LEU A N     1 
ATOM   1214 C CA    . LEU A 1 152 ? 57.722  -37.596 5.633   1.00 141.55 ? 162 LEU A CA    1 
ATOM   1215 C C     . LEU A 1 152 ? 58.145  -38.375 6.868   1.00 140.59 ? 162 LEU A C     1 
ATOM   1216 O O     . LEU A 1 152 ? 59.301  -38.316 7.279   1.00 140.10 ? 162 LEU A O     1 
ATOM   1217 C CB    . LEU A 1 152 ? 58.156  -36.134 5.737   1.00 146.23 ? 162 LEU A CB    1 
ATOM   1218 C CG    . LEU A 1 152 ? 57.578  -35.196 4.672   1.00 147.29 ? 162 LEU A CG    1 
ATOM   1219 C CD1   . LEU A 1 152 ? 56.247  -34.580 5.114   1.00 147.14 ? 162 LEU A CD1   1 
ATOM   1220 C CD2   . LEU A 1 152 ? 58.573  -34.109 4.304   1.00 147.76 ? 162 LEU A CD2   1 
ATOM   1221 N N     . SER A 1 153 ? 57.194  -39.078 7.476   1.00 116.99 ? 163 SER A N     1 
ATOM   1222 C CA    . SER A 1 153 ? 57.454  -39.845 8.691   1.00 116.34 ? 163 SER A CA    1 
ATOM   1223 C C     . SER A 1 153 ? 58.238  -41.141 8.460   1.00 116.76 ? 163 SER A C     1 
ATOM   1224 O O     . SER A 1 153 ? 58.514  -41.521 7.321   1.00 117.64 ? 163 SER A O     1 
ATOM   1225 C CB    . SER A 1 153 ? 56.128  -40.175 9.373   1.00 116.52 ? 163 SER A CB    1 
ATOM   1226 O OG    . SER A 1 153 ? 56.292  -41.183 10.349  1.00 116.40 ? 163 SER A OG    1 
ATOM   1227 N N     . ASN A 1 154 ? 58.562  -41.827 9.554   1.00 116.31 ? 164 ASN A N     1 
ATOM   1228 C CA    . ASN A 1 154 ? 59.324  -43.074 9.516   1.00 116.78 ? 164 ASN A CA    1 
ATOM   1229 C C     . ASN A 1 154 ? 59.015  -43.943 10.738  1.00 116.76 ? 164 ASN A C     1 
ATOM   1230 O O     . ASN A 1 154 ? 58.446  -43.473 11.721  1.00 116.23 ? 164 ASN A O     1 
ATOM   1231 C CB    . ASN A 1 154 ? 60.827  -42.785 9.439   1.00 116.90 ? 164 ASN A CB    1 
ATOM   1232 C CG    . ASN A 1 154 ? 61.609  -43.911 8.785   1.00 117.80 ? 164 ASN A CG    1 
ATOM   1233 O OD1   . ASN A 1 154 ? 61.205  -45.074 8.827   1.00 118.59 ? 164 ASN A OD1   1 
ATOM   1234 N ND2   . ASN A 1 154 ? 62.733  -43.566 8.166   1.00 117.93 ? 164 ASN A ND2   1 
ATOM   1235 N N     . MET A 1 155 ? 59.378  -45.217 10.671  1.00 144.06 ? 165 MET A N     1 
ATOM   1236 C CA    . MET A 1 155 ? 59.151  -46.120 11.787  1.00 144.38 ? 165 MET A CA    1 
ATOM   1237 C C     . MET A 1 155 ? 60.465  -46.421 12.508  1.00 143.88 ? 165 MET A C     1 
ATOM   1238 O O     . MET A 1 155 ? 61.496  -46.616 11.865  1.00 143.98 ? 165 MET A O     1 
ATOM   1239 C CB    . MET A 1 155 ? 58.491  -47.403 11.292  1.00 143.69 ? 165 MET A CB    1 
ATOM   1240 C CG    . MET A 1 155 ? 58.141  -48.381 12.383  1.00 144.45 ? 165 MET A CG    1 
ATOM   1241 S SD    . MET A 1 155 ? 56.854  -49.526 11.860  1.00 146.75 ? 165 MET A SD    1 
ATOM   1242 C CE    . MET A 1 155 ? 57.456  -50.035 10.249  1.00 147.74 ? 165 MET A CE    1 
ATOM   1243 N N     . MET A 1 156 ? 60.427  -46.452 13.840  1.00 136.21 ? 166 MET A N     1 
ATOM   1244 C CA    . MET A 1 156 ? 61.627  -46.681 14.652  1.00 135.85 ? 166 MET A CA    1 
ATOM   1245 C C     . MET A 1 156 ? 61.845  -48.159 14.962  1.00 137.03 ? 166 MET A C     1 
ATOM   1246 O O     . MET A 1 156 ? 61.038  -48.789 15.648  1.00 137.84 ? 166 MET A O     1 
ATOM   1247 C CB    . MET A 1 156 ? 61.545  -45.901 15.962  1.00 144.63 ? 166 MET A CB    1 
ATOM   1248 C CG    . MET A 1 156 ? 60.915  -44.536 15.831  1.00 143.87 ? 166 MET A CG    1 
ATOM   1249 S SD    . MET A 1 156 ? 60.713  -43.740 17.432  1.00 143.45 ? 166 MET A SD    1 
ATOM   1250 C CE    . MET A 1 156 ? 62.375  -43.150 17.685  1.00 142.81 ? 166 MET A CE    1 
ATOM   1251 N N     . SER A 1 157 ? 62.947  -48.703 14.460  1.00 127.38 ? 167 SER A N     1 
ATOM   1252 C CA    . SER A 1 157 ? 63.274  -50.112 14.658  1.00 128.69 ? 167 SER A CA    1 
ATOM   1253 C C     . SER A 1 157 ? 64.257  -50.266 15.811  1.00 128.41 ? 167 SER A C     1 
ATOM   1254 O O     . SER A 1 157 ? 65.082  -49.384 16.051  1.00 127.33 ? 167 SER A O     1 
ATOM   1255 C CB    . SER A 1 157 ? 63.849  -50.725 13.377  1.00 242.69 ? 167 SER A CB    1 
ATOM   1256 O OG    . SER A 1 157 ? 62.887  -50.765 12.336  1.00 243.38 ? 167 SER A OG    1 
ATOM   1257 N N     . ASP A 1 158 ? 64.142  -51.369 16.544  1.00 120.38 ? 168 ASP A N     1 
ATOM   1258 C CA    . ASP A 1 158 ? 65.023  -51.623 17.681  1.00 120.42 ? 168 ASP A CA    1 
ATOM   1259 C C     . ASP A 1 158 ? 66.478  -51.783 17.248  1.00 120.33 ? 168 ASP A C     1 
ATOM   1260 O O     . ASP A 1 158 ? 66.801  -52.612 16.395  1.00 121.32 ? 168 ASP A O     1 
ATOM   1261 C CB    . ASP A 1 158 ? 64.571  -52.872 18.447  1.00 148.26 ? 168 ASP A CB    1 
ATOM   1262 C CG    . ASP A 1 158 ? 63.326  -52.633 19.286  1.00 148.49 ? 168 ASP A CG    1 
ATOM   1263 O OD1   . ASP A 1 158 ? 62.484  -51.796 18.894  1.00 147.71 ? 168 ASP A OD1   1 
ATOM   1264 O OD2   . ASP A 1 158 ? 63.188  -53.288 20.339  1.00 149.63 ? 168 ASP A OD2   1 
ATOM   1265 N N     . GLY A 1 159 ? 67.352  -50.992 17.858  1.00 119.37 ? 169 GLY A N     1 
ATOM   1266 C CA    . GLY A 1 159 ? 68.770  -51.039 17.560  1.00 119.39 ? 169 GLY A CA    1 
ATOM   1267 C C     . GLY A 1 159 ? 69.112  -50.469 16.199  1.00 118.98 ? 169 GLY A C     1 
ATOM   1268 O O     . GLY A 1 159 ? 70.135  -50.826 15.617  1.00 119.53 ? 169 GLY A O     1 
ATOM   1269 N N     . GLU A 1 160 ? 68.263  -49.575 15.697  1.00 118.19 ? 170 GLU A N     1 
ATOM   1270 C CA    . GLU A 1 160 ? 68.436  -49.004 14.362  1.00 118.03 ? 170 GLU A CA    1 
ATOM   1271 C C     . GLU A 1 160 ? 68.344  -47.484 14.376  1.00 116.86 ? 170 GLU A C     1 
ATOM   1272 O O     . GLU A 1 160 ? 67.509  -46.910 15.073  1.00 116.21 ? 170 GLU A O     1 
ATOM   1273 C CB    . GLU A 1 160 ? 67.387  -49.566 13.396  1.00 165.72 ? 170 GLU A CB    1 
ATOM   1274 C CG    . GLU A 1 160 ? 67.395  -51.085 13.246  1.00 167.28 ? 170 GLU A CG    1 
ATOM   1275 C CD    . GLU A 1 160 ? 68.629  -51.605 12.533  1.00 168.14 ? 170 GLU A CD    1 
ATOM   1276 O OE1   . GLU A 1 160 ? 69.147  -50.893 11.647  1.00 167.88 ? 170 GLU A OE1   1 
ATOM   1277 O OE2   . GLU A 1 160 ? 69.083  -52.723 12.860  1.00 169.27 ? 170 GLU A OE2   1 
ATOM   1278 N N     . PHE A 1 161 ? 69.194  -46.834 13.591  1.00 116.84 ? 171 PHE A N     1 
ATOM   1279 C CA    . PHE A 1 161 ? 69.138  -45.383 13.465  1.00 116.09 ? 171 PHE A CA    1 
ATOM   1280 C C     . PHE A 1 161 ? 68.500  -44.962 12.143  1.00 116.26 ? 171 PHE A C     1 
ATOM   1281 O O     . PHE A 1 161 ? 68.183  -45.807 11.310  1.00 117.02 ? 171 PHE A O     1 
ATOM   1282 C CB    . PHE A 1 161 ? 70.537  -44.787 13.584  1.00 123.46 ? 171 PHE A CB    1 
ATOM   1283 C CG    . PHE A 1 161 ? 71.188  -45.032 14.915  1.00 123.40 ? 171 PHE A CG    1 
ATOM   1284 C CD1   . PHE A 1 161 ? 70.854  -44.263 16.015  1.00 122.79 ? 171 PHE A CD1   1 
ATOM   1285 C CD2   . PHE A 1 161 ? 72.143  -46.024 15.063  1.00 124.15 ? 171 PHE A CD2   1 
ATOM   1286 C CE1   . PHE A 1 161 ? 71.457  -44.484 17.235  1.00 122.96 ? 171 PHE A CE1   1 
ATOM   1287 C CE2   . PHE A 1 161 ? 72.750  -46.245 16.282  1.00 124.26 ? 171 PHE A CE2   1 
ATOM   1288 C CZ    . PHE A 1 161 ? 72.406  -45.476 17.368  1.00 123.69 ? 171 PHE A CZ    1 
ATOM   1289 N N     . LEU A 1 162 ? 68.327  -43.657 11.946  1.00 129.94 ? 172 LEU A N     1 
ATOM   1290 C CA    . LEU A 1 162 ? 67.736  -43.137 10.715  1.00 130.24 ? 172 LEU A CA    1 
ATOM   1291 C C     . LEU A 1 162 ? 68.728  -42.247 9.979   1.00 130.75 ? 172 LEU A C     1 
ATOM   1292 O O     . LEU A 1 162 ? 69.243  -41.286 10.552  1.00 130.46 ? 172 LEU A O     1 
ATOM   1293 C CB    . LEU A 1 162 ? 66.455  -42.359 11.009  1.00 115.39 ? 172 LEU A CB    1 
ATOM   1294 C CG    . LEU A 1 162 ? 65.321  -43.142 11.663  1.00 115.17 ? 172 LEU A CG    1 
ATOM   1295 C CD1   . LEU A 1 162 ? 64.135  -42.244 11.894  1.00 114.66 ? 172 LEU A CD1   1 
ATOM   1296 C CD2   . LEU A 1 162 ? 64.924  -44.302 10.794  1.00 116.09 ? 172 LEU A CD2   1 
ATOM   1297 N N     . ARG A 1 163 ? 69.021  -42.604 8.726   1.00 118.50 ? 173 ARG A N     1 
ATOM   1298 C CA    . ARG A 1 163 ? 69.950  -41.857 7.868   1.00 119.42 ? 173 ARG A CA    1 
ATOM   1299 C C     . ARG A 1 163 ? 69.306  -40.667 7.138   1.00 119.61 ? 173 ARG A C     1 
ATOM   1300 O O     . ARG A 1 163 ? 69.920  -39.600 7.029   1.00 120.02 ? 173 ARG A O     1 
ATOM   1301 C CB    . ARG A 1 163 ? 70.597  -42.813 6.854   1.00 188.52 ? 173 ARG A CB    1 
ATOM   1302 C CG    . ARG A 1 163 ? 71.511  -42.152 5.819   1.00 189.89 ? 173 ARG A CG    1 
ATOM   1303 C CD    . ARG A 1 163 ? 72.595  -41.286 6.453   1.00 189.90 ? 173 ARG A CD    1 
ATOM   1304 N NE    . ARG A 1 163 ? 73.901  -41.507 5.835   1.00 191.45 ? 173 ARG A NE    1 
ATOM   1305 C CZ    . ARG A 1 163 ? 74.865  -40.595 5.768   1.00 192.35 ? 173 ARG A CZ    1 
ATOM   1306 N NH1   . ARG A 1 163 ? 74.674  -39.383 6.270   1.00 191.89 ? 173 ARG A NH1   1 
ATOM   1307 N NH2   . ARG A 1 163 ? 76.021  -40.893 5.189   1.00 193.96 ? 173 ARG A NH2   1 
HETATM 1308 N N     . TPO A 1 164 ? 68.081  -40.868 6.644   1.00 124.84 ? 174 TPO A N     1 
HETATM 1309 C CA    . TPO A 1 164 ? 67.365  -39.883 5.820   1.00 125.24 ? 174 TPO A CA    1 
HETATM 1310 C CB    . TPO A 1 164 ? 66.012  -40.430 5.386   1.00 137.37 ? 174 TPO A CB    1 
HETATM 1311 C CG2   . TPO A 1 164 ? 65.512  -39.605 4.201   1.00 138.35 ? 174 TPO A CG2   1 
HETATM 1312 O OG1   . TPO A 1 164 ? 66.167  -41.784 4.976   1.00 138.10 ? 174 TPO A OG1   1 
HETATM 1313 P P     . TPO A 1 164 ? 64.939  -42.661 5.531   1.00 137.58 ? 174 TPO A P     1 
HETATM 1314 O O1P   . TPO A 1 164 ? 63.719  -42.397 4.728   1.00 138.14 ? 174 TPO A O1P   1 
HETATM 1315 O O2P   . TPO A 1 164 ? 64.675  -42.306 7.076   1.00 136.04 ? 174 TPO A O2P   1 
HETATM 1316 O O3P   . TPO A 1 164 ? 65.371  -44.209 5.416   1.00 138.44 ? 174 TPO A O3P   1 
HETATM 1317 C C     . TPO A 1 164 ? 67.171  -38.558 6.528   1.00 124.54 ? 174 TPO A C     1 
HETATM 1318 O O     . TPO A 1 164 ? 66.744  -38.523 7.677   1.00 123.42 ? 174 TPO A O     1 
ATOM   1319 N N     . SER A 1 165 ? 67.500  -37.472 5.840   1.00 123.22 ? 175 SER A N     1 
ATOM   1320 C CA    . SER A 1 165 ? 67.301  -36.138 6.388   1.00 122.95 ? 175 SER A CA    1 
ATOM   1321 C C     . SER A 1 165 ? 66.116  -35.490 5.691   1.00 123.24 ? 175 SER A C     1 
ATOM   1322 O O     . SER A 1 165 ? 66.178  -35.190 4.499   1.00 124.53 ? 175 SER A O     1 
ATOM   1323 C CB    . SER A 1 165 ? 68.564  -35.284 6.229   1.00 120.14 ? 175 SER A CB    1 
ATOM   1324 O OG    . SER A 1 165 ? 68.937  -35.146 4.869   1.00 121.74 ? 175 SER A OG    1 
ATOM   1325 N N     . CYS A 1 166 ? 65.033  -35.280 6.432   1.00 118.25 ? 176 CYS A N     1 
ATOM   1326 C CA    . CYS A 1 166 ? 63.800  -34.782 5.835   1.00 118.52 ? 176 CYS A CA    1 
ATOM   1327 C C     . CYS A 1 166 ? 63.167  -33.673 6.666   1.00 118.03 ? 176 CYS A C     1 
ATOM   1328 O O     . CYS A 1 166 ? 63.466  -33.536 7.850   1.00 117.28 ? 176 CYS A O     1 
ATOM   1329 C CB    . CYS A 1 166 ? 62.809  -35.930 5.655   1.00 209.94 ? 176 CYS A CB    1 
ATOM   1330 S SG    . CYS A 1 166 ? 61.627  -35.695 4.319   1.00 211.04 ? 176 CYS A SG    1 
ATOM   1331 N N     . GLY A 1 167 ? 62.263  -32.915 6.047   1.00 126.59 ? 177 GLY A N     1 
ATOM   1332 C CA    . GLY A 1 167 ? 61.617  -31.773 6.681   1.00 126.48 ? 177 GLY A CA    1 
ATOM   1333 C C     . GLY A 1 167 ? 62.002  -30.387 6.173   1.00 127.84 ? 177 GLY A C     1 
ATOM   1334 O O     . GLY A 1 167 ? 62.760  -30.246 5.213   1.00 129.04 ? 177 GLY A O     1 
ATOM   1335 N N     . SER A 1 168 ? 61.448  -29.361 6.819   1.00 119.93 ? 178 SER A N     1 
ATOM   1336 C CA    . SER A 1 168 ? 61.664  -27.965 6.437   1.00 121.46 ? 178 SER A CA    1 
ATOM   1337 C C     . SER A 1 168 ? 63.116  -27.526 6.626   1.00 122.33 ? 178 SER A C     1 
ATOM   1338 O O     . SER A 1 168 ? 63.865  -28.151 7.365   1.00 121.53 ? 178 SER A O     1 
ATOM   1339 C CB    . SER A 1 168 ? 60.726  -27.062 7.244   1.00 159.39 ? 178 SER A CB    1 
ATOM   1340 O OG    . SER A 1 168 ? 59.413  -27.115 6.720   1.00 159.35 ? 178 SER A OG    1 
ATOM   1341 N N     . PRO A 1 169 ? 63.528  -26.458 5.937   1.00 124.21 ? 179 PRO A N     1 
ATOM   1342 C CA    . PRO A 1 169 ? 64.914  -25.997 6.072   1.00 125.45 ? 179 PRO A CA    1 
ATOM   1343 C C     . PRO A 1 169 ? 65.252  -25.420 7.447   1.00 125.29 ? 179 PRO A C     1 
ATOM   1344 O O     . PRO A 1 169 ? 66.356  -25.661 7.928   1.00 125.41 ? 179 PRO A O     1 
ATOM   1345 C CB    . PRO A 1 169 ? 65.025  -24.917 4.998   1.00 194.35 ? 179 PRO A CB    1 
ATOM   1346 C CG    . PRO A 1 169 ? 63.627  -24.435 4.811   1.00 194.22 ? 179 PRO A CG    1 
ATOM   1347 C CD    . PRO A 1 169 ? 62.762  -25.635 4.987   1.00 192.11 ? 179 PRO A CD    1 
ATOM   1348 N N     . ASN A 1 170 ? 64.343  -24.649 8.044   1.00 125.26 ? 180 ASN A N     1 
ATOM   1349 C CA    . ASN A 1 170 ? 64.578  -24.029 9.353   1.00 125.43 ? 180 ASN A CA    1 
ATOM   1350 C C     . ASN A 1 170 ? 64.296  -24.965 10.527  1.00 123.42 ? 180 ASN A C     1 
ATOM   1351 O O     . ASN A 1 170 ? 64.889  -24.832 11.596  1.00 123.51 ? 180 ASN A O     1 
ATOM   1352 C CB    . ASN A 1 170 ? 63.731  -22.761 9.511   1.00 135.79 ? 180 ASN A CB    1 
ATOM   1353 C CG    . ASN A 1 170 ? 63.209  -22.235 8.188   1.00 137.01 ? 180 ASN A CG    1 
ATOM   1354 O OD1   . ASN A 1 170 ? 62.313  -22.829 7.588   1.00 136.02 ? 180 ASN A OD1   1 
ATOM   1355 N ND2   . ASN A 1 170 ? 63.757  -21.110 7.731   1.00 139.42 ? 180 ASN A ND2   1 
ATOM   1356 N N     . TYR A 1 171 ? 63.379  -25.903 10.322  1.00 121.87 ? 181 TYR A N     1 
ATOM   1357 C CA    . TYR A 1 171 ? 62.902  -26.777 11.386  1.00 120.22 ? 181 TYR A CA    1 
ATOM   1358 C C     . TYR A 1 171 ? 63.729  -28.053 11.510  1.00 119.23 ? 181 TYR A C     1 
ATOM   1359 O O     . TYR A 1 171 ? 63.570  -28.820 12.460  1.00 118.11 ? 181 TYR A O     1 
ATOM   1360 C CB    . TYR A 1 171 ? 61.436  -27.125 11.146  1.00 119.39 ? 181 TYR A CB    1 
ATOM   1361 C CG    . TYR A 1 171 ? 60.520  -25.934 11.259  1.00 120.28 ? 181 TYR A CG    1 
ATOM   1362 C CD1   . TYR A 1 171 ? 60.548  -24.918 10.321  1.00 121.81 ? 181 TYR A CD1   1 
ATOM   1363 C CD2   . TYR A 1 171 ? 59.626  -25.824 12.304  1.00 119.81 ? 181 TYR A CD2   1 
ATOM   1364 C CE1   . TYR A 1 171 ? 59.715  -23.823 10.427  1.00 122.80 ? 181 TYR A CE1   1 
ATOM   1365 C CE2   . TYR A 1 171 ? 58.789  -24.733 12.421  1.00 120.79 ? 181 TYR A CE2   1 
ATOM   1366 C CZ    . TYR A 1 171 ? 58.833  -23.735 11.478  1.00 122.25 ? 181 TYR A CZ    1 
ATOM   1367 O OH    . TYR A 1 171 ? 57.997  -22.643 11.589  1.00 123.39 ? 181 TYR A OH    1 
ATOM   1368 N N     . ALA A 1 172 ? 64.614  -28.276 10.547  1.00 119.86 ? 182 ALA A N     1 
ATOM   1369 C CA    . ALA A 1 172 ? 65.463  -29.456 10.561  1.00 119.19 ? 182 ALA A CA    1 
ATOM   1370 C C     . ALA A 1 172 ? 66.479  -29.353 11.696  1.00 119.35 ? 182 ALA A C     1 
ATOM   1371 O O     . ALA A 1 172 ? 67.118  -28.315 11.868  1.00 120.72 ? 182 ALA A O     1 
ATOM   1372 C CB    . ALA A 1 172 ? 66.159  -29.627 9.219   1.00 262.47 ? 182 ALA A CB    1 
ATOM   1373 N N     . ALA A 1 173 ? 66.604  -30.431 12.467  1.00 121.09 ? 183 ALA A N     1 
ATOM   1374 C CA    . ALA A 1 173 ? 67.521  -30.515 13.606  1.00 121.20 ? 183 ALA A CA    1 
ATOM   1375 C C     . ALA A 1 173 ? 68.976  -30.289 13.206  1.00 122.48 ? 183 ALA A C     1 
ATOM   1376 O O     . ALA A 1 173 ? 69.348  -30.520 12.062  1.00 122.94 ? 183 ALA A O     1 
ATOM   1377 C CB    . ALA A 1 173 ? 67.376  -31.868 14.282  1.00 140.87 ? 183 ALA A CB    1 
ATOM   1378 N N     . PRO A 1 174 ? 69.809  -29.842 14.156  1.00 120.36 ? 184 PRO A N     1 
ATOM   1379 C CA    . PRO A 1 174 ? 71.206  -29.539 13.833  1.00 121.90 ? 184 PRO A CA    1 
ATOM   1380 C C     . PRO A 1 174 ? 71.979  -30.763 13.370  1.00 121.47 ? 184 PRO A C     1 
ATOM   1381 O O     . PRO A 1 174 ? 72.985  -30.619 12.680  1.00 122.80 ? 184 PRO A O     1 
ATOM   1382 C CB    . PRO A 1 174 ? 71.769  -29.012 15.156  1.00 169.84 ? 184 PRO A CB    1 
ATOM   1383 C CG    . PRO A 1 174 ? 70.576  -28.551 15.922  1.00 169.22 ? 184 PRO A CG    1 
ATOM   1384 C CD    . PRO A 1 174 ? 69.476  -29.483 15.544  1.00 167.36 ? 184 PRO A CD    1 
ATOM   1385 N N     . GLU A 1 175 ? 71.542  -31.948 13.776  1.00 119.88 ? 185 GLU A N     1 
ATOM   1386 C CA    . GLU A 1 175 ? 72.199  -33.170 13.342  1.00 119.57 ? 185 GLU A CA    1 
ATOM   1387 C C     . GLU A 1 175 ? 71.712  -33.666 11.975  1.00 119.35 ? 185 GLU A C     1 
ATOM   1388 O O     . GLU A 1 175 ? 72.469  -34.314 11.252  1.00 119.89 ? 185 GLU A O     1 
ATOM   1389 C CB    . GLU A 1 175 ? 72.031  -34.257 14.398  1.00 118.35 ? 185 GLU A CB    1 
ATOM   1390 C CG    . GLU A 1 175 ? 70.596  -34.624 14.679  1.00 117.02 ? 185 GLU A CG    1 
ATOM   1391 C CD    . GLU A 1 175 ? 70.353  -34.919 16.145  1.00 116.46 ? 185 GLU A CD    1 
ATOM   1392 O OE1   . GLU A 1 175 ? 70.118  -33.956 16.901  1.00 116.84 ? 185 GLU A OE1   1 
ATOM   1393 O OE2   . GLU A 1 175 ? 70.398  -36.105 16.544  1.00 115.86 ? 185 GLU A OE2   1 
ATOM   1394 N N     . VAL A 1 176 ? 70.456  -33.399 11.626  1.00 118.73 ? 186 VAL A N     1 
ATOM   1395 C CA    . VAL A 1 176 ? 69.944  -33.863 10.335  1.00 118.74 ? 186 VAL A CA    1 
ATOM   1396 C C     . VAL A 1 176 ? 70.342  -32.943 9.185   1.00 120.35 ? 186 VAL A C     1 
ATOM   1397 O O     . VAL A 1 176 ? 70.461  -33.401 8.050   1.00 120.94 ? 186 VAL A O     1 
ATOM   1398 C CB    . VAL A 1 176 ? 68.405  -34.036 10.328  1.00 123.61 ? 186 VAL A CB    1 
ATOM   1399 C CG1   . VAL A 1 176 ? 67.977  -34.942 11.455  1.00 122.34 ? 186 VAL A CG1   1 
ATOM   1400 C CG2   . VAL A 1 176 ? 67.694  -32.702 10.407  1.00 123.96 ? 186 VAL A CG2   1 
ATOM   1401 N N     . ILE A 1 177 ? 70.546  -31.657 9.464   1.00 121.32 ? 187 ILE A N     1 
ATOM   1402 C CA    . ILE A 1 177 ? 70.979  -30.733 8.420   1.00 123.21 ? 187 ILE A CA    1 
ATOM   1403 C C     . ILE A 1 177 ? 72.390  -31.086 7.974   1.00 124.51 ? 187 ILE A C     1 
ATOM   1404 O O     . ILE A 1 177 ? 72.759  -30.862 6.825   1.00 126.04 ? 187 ILE A O     1 
ATOM   1405 C CB    . ILE A 1 177 ? 70.943  -29.251 8.873   1.00 128.17 ? 187 ILE A CB    1 
ATOM   1406 C CG1   . ILE A 1 177 ? 71.802  -29.039 10.120  1.00 128.42 ? 187 ILE A CG1   1 
ATOM   1407 C CG2   . ILE A 1 177 ? 69.523  -28.792 9.124   1.00 127.25 ? 187 ILE A CG2   1 
ATOM   1408 C CD1   . ILE A 1 177 ? 73.190  -28.481 9.834   1.00 130.66 ? 187 ILE A CD1   1 
ATOM   1409 N N     . SER A 1 178 ? 73.177  -31.644 8.885   1.00 124.09 ? 188 SER A N     1 
ATOM   1410 C CA    . SER A 1 178 ? 74.550  -32.003 8.572   1.00 125.40 ? 188 SER A CA    1 
ATOM   1411 C C     . SER A 1 178 ? 74.608  -33.367 7.909   1.00 124.81 ? 188 SER A C     1 
ATOM   1412 O O     . SER A 1 178 ? 75.649  -33.761 7.388   1.00 126.05 ? 188 SER A O     1 
ATOM   1413 C CB    . SER A 1 178 ? 75.412  -31.995 9.831   1.00 125.46 ? 188 SER A CB    1 
ATOM   1414 O OG    . SER A 1 178 ? 74.841  -32.825 10.824  1.00 123.48 ? 188 SER A OG    1 
ATOM   1415 N N     . GLY A 1 179 ? 73.485  -34.081 7.921   1.00 127.65 ? 189 GLY A N     1 
ATOM   1416 C CA    . GLY A 1 179 ? 73.420  -35.416 7.351   1.00 127.22 ? 189 GLY A CA    1 
ATOM   1417 C C     . GLY A 1 179 ? 74.096  -36.473 8.204   1.00 126.57 ? 189 GLY A C     1 
ATOM   1418 O O     . GLY A 1 179 ? 74.931  -37.242 7.728   1.00 127.38 ? 189 GLY A O     1 
ATOM   1419 N N     . ARG A 1 180 ? 73.740  -36.503 9.479   1.00 120.80 ? 190 ARG A N     1 
ATOM   1420 C CA    . ARG A 1 180 ? 74.311  -37.461 10.408  1.00 120.26 ? 190 ARG A CA    1 
ATOM   1421 C C     . ARG A 1 180 ? 73.219  -38.411 10.890  1.00 118.75 ? 190 ARG A C     1 
ATOM   1422 O O     . ARG A 1 180 ? 72.040  -38.057 10.869  1.00 118.00 ? 190 ARG A O     1 
ATOM   1423 C CB    . ARG A 1 180 ? 74.963  -36.732 11.580  1.00 148.74 ? 190 ARG A CB    1 
ATOM   1424 C CG    . ARG A 1 180 ? 75.791  -37.612 12.486  1.00 148.64 ? 190 ARG A CG    1 
ATOM   1425 C CD    . ARG A 1 180 ? 76.408  -36.805 13.612  1.00 149.17 ? 190 ARG A CD    1 
ATOM   1426 N NE    . ARG A 1 180 ? 77.161  -35.652 13.117  1.00 150.86 ? 190 ARG A NE    1 
ATOM   1427 C CZ    . ARG A 1 180 ? 78.386  -35.717 12.601  1.00 152.43 ? 190 ARG A CZ    1 
ATOM   1428 N NH1   . ARG A 1 180 ? 79.004  -36.884 12.499  1.00 152.43 ? 190 ARG A NH1   1 
ATOM   1429 N NH2   . ARG A 1 180 ? 78.995  -34.615 12.181  1.00 154.22 ? 190 ARG A NH2   1 
ATOM   1430 N N     . LEU A 1 181 ? 73.610  -39.618 11.303  1.00 126.96 ? 191 LEU A N     1 
ATOM   1431 C CA    . LEU A 1 181 ? 72.669  -40.604 11.834  1.00 125.88 ? 191 LEU A CA    1 
ATOM   1432 C C     . LEU A 1 181 ? 72.013  -40.113 13.115  1.00 124.94 ? 191 LEU A C     1 
ATOM   1433 O O     . LEU A 1 181 ? 72.659  -39.473 13.947  1.00 125.16 ? 191 LEU A O     1 
ATOM   1434 C CB    . LEU A 1 181 ? 73.371  -41.935 12.100  1.00 117.74 ? 191 LEU A CB    1 
ATOM   1435 C CG    . LEU A 1 181 ? 73.889  -42.688 10.882  1.00 118.80 ? 191 LEU A CG    1 
ATOM   1436 C CD1   . LEU A 1 181 ? 74.734  -43.872 11.306  1.00 119.28 ? 191 LEU A CD1   1 
ATOM   1437 C CD2   . LEU A 1 181 ? 72.719  -43.142 10.048  1.00 118.64 ? 191 LEU A CD2   1 
ATOM   1438 N N     . TYR A 1 182 ? 70.731  -40.420 13.277  1.00 125.61 ? 192 TYR A N     1 
ATOM   1439 C CA    . TYR A 1 182 ? 70.003  -40.006 14.472  1.00 124.90 ? 192 TYR A CA    1 
ATOM   1440 C C     . TYR A 1 182 ? 69.011  -41.071 14.932  1.00 124.38 ? 192 TYR A C     1 
ATOM   1441 O O     . TYR A 1 182 ? 68.644  -41.960 14.165  1.00 124.54 ? 192 TYR A O     1 
ATOM   1442 C CB    . TYR A 1 182 ? 69.278  -38.680 14.223  1.00 114.86 ? 192 TYR A CB    1 
ATOM   1443 C CG    . TYR A 1 182 ? 68.300  -38.703 13.070  1.00 114.78 ? 192 TYR A CG    1 
ATOM   1444 C CD1   . TYR A 1 182 ? 68.705  -38.384 11.783  1.00 115.52 ? 192 TYR A CD1   1 
ATOM   1445 C CD2   . TYR A 1 182 ? 66.969  -39.035 13.272  1.00 114.20 ? 192 TYR A CD2   1 
ATOM   1446 C CE1   . TYR A 1 182 ? 67.811  -38.400 10.727  1.00 115.65 ? 192 TYR A CE1   1 
ATOM   1447 C CE2   . TYR A 1 182 ? 66.069  -39.052 12.225  1.00 114.32 ? 192 TYR A CE2   1 
ATOM   1448 C CZ    . TYR A 1 182 ? 66.494  -38.736 10.955  1.00 115.03 ? 192 TYR A CZ    1 
ATOM   1449 O OH    . TYR A 1 182 ? 65.595  -38.755 9.911   1.00 115.34 ? 192 TYR A OH    1 
ATOM   1450 N N     . ALA A 1 183 ? 68.589  -40.967 16.190  1.00 114.12 ? 193 ALA A N     1 
ATOM   1451 C CA    . ALA A 1 183 ? 67.645  -41.904 16.793  1.00 113.92 ? 193 ALA A CA    1 
ATOM   1452 C C     . ALA A 1 183 ? 66.230  -41.664 16.291  1.00 113.63 ? 193 ALA A C     1 
ATOM   1453 O O     . ALA A 1 183 ? 65.512  -42.599 15.929  1.00 113.81 ? 193 ALA A O     1 
ATOM   1454 C CB    . ALA A 1 183 ? 67.687  -41.780 18.299  1.00 291.04 ? 193 ALA A CB    1 
ATOM   1455 N N     . GLY A 1 184 ? 65.872  -40.385 16.238  1.00 155.73 ? 194 GLY A N     1 
ATOM   1456 C CA    . GLY A 1 184 ? 64.552  -39.917 15.853  1.00 155.54 ? 194 GLY A CA    1 
ATOM   1457 C C     . GLY A 1 184 ? 63.622  -39.289 16.884  1.00 155.38 ? 194 GLY A C     1 
ATOM   1458 O O     . GLY A 1 184 ? 62.746  -38.520 16.498  1.00 155.32 ? 194 GLY A O     1 
ATOM   1459 N N     . PRO A 1 185 ? 63.795  -39.569 18.186  1.00 113.14 ? 195 PRO A N     1 
ATOM   1460 C CA    . PRO A 1 185 ? 63.035  -38.711 19.097  1.00 113.23 ? 195 PRO A CA    1 
ATOM   1461 C C     . PRO A 1 185 ? 63.582  -37.285 19.138  1.00 113.36 ? 195 PRO A C     1 
ATOM   1462 O O     . PRO A 1 185 ? 62.815  -36.325 19.141  1.00 113.46 ? 195 PRO A O     1 
ATOM   1463 C CB    . PRO A 1 185 ? 63.202  -39.401 20.454  1.00 164.51 ? 195 PRO A CB    1 
ATOM   1464 C CG    . PRO A 1 185 ? 63.614  -40.791 20.131  1.00 164.58 ? 195 PRO A CG    1 
ATOM   1465 C CD    . PRO A 1 185 ? 64.440  -40.674 18.904  1.00 164.29 ? 195 PRO A CD    1 
ATOM   1466 N N     . GLU A 1 186 ? 64.904  -37.156 19.154  1.00 113.56 ? 196 GLU A N     1 
ATOM   1467 C CA    . GLU A 1 186 ? 65.536  -35.863 19.396  1.00 114.09 ? 196 GLU A CA    1 
ATOM   1468 C C     . GLU A 1 186 ? 65.301  -34.890 18.247  1.00 114.19 ? 196 GLU A C     1 
ATOM   1469 O O     . GLU A 1 186 ? 65.276  -33.674 18.448  1.00 114.78 ? 196 GLU A O     1 
ATOM   1470 C CB    . GLU A 1 186 ? 67.042  -36.036 19.645  1.00 114.54 ? 196 GLU A CB    1 
ATOM   1471 C CG    . GLU A 1 186 ? 67.874  -36.428 18.430  1.00 114.51 ? 196 GLU A CG    1 
ATOM   1472 C CD    . GLU A 1 186 ? 67.750  -37.899 18.053  1.00 114.02 ? 196 GLU A CD    1 
ATOM   1473 O OE1   . GLU A 1 186 ? 66.612  -38.417 17.976  1.00 113.58 ? 196 GLU A OE1   1 
ATOM   1474 O OE2   . GLU A 1 186 ? 68.800  -38.537 17.825  1.00 114.29 ? 196 GLU A OE2   1 
ATOM   1475 N N     . VAL A 1 187 ? 65.114  -35.429 17.046  1.00 118.62 ? 197 VAL A N     1 
ATOM   1476 C CA    . VAL A 1 187 ? 64.952  -34.588 15.870  1.00 118.92 ? 197 VAL A CA    1 
ATOM   1477 C C     . VAL A 1 187 ? 63.570  -33.942 15.853  1.00 118.84 ? 197 VAL A C     1 
ATOM   1478 O O     . VAL A 1 187 ? 63.417  -32.826 15.358  1.00 119.39 ? 197 VAL A O     1 
ATOM   1479 C CB    . VAL A 1 187 ? 65.189  -35.377 14.561  1.00 114.07 ? 197 VAL A CB    1 
ATOM   1480 C CG1   . VAL A 1 187 ? 66.603  -35.884 14.518  1.00 114.38 ? 197 VAL A CG1   1 
ATOM   1481 C CG2   . VAL A 1 187 ? 64.231  -36.534 14.441  1.00 113.53 ? 197 VAL A CG2   1 
ATOM   1482 N N     . ASP A 1 188 ? 62.572  -34.627 16.405  1.00 113.61 ? 198 ASP A N     1 
ATOM   1483 C CA    . ASP A 1 188 ? 61.227  -34.066 16.495  1.00 113.68 ? 198 ASP A CA    1 
ATOM   1484 C C     . ASP A 1 188 ? 61.156  -33.074 17.644  1.00 114.16 ? 198 ASP A C     1 
ATOM   1485 O O     . ASP A 1 188 ? 60.428  -32.088 17.583  1.00 114.59 ? 198 ASP A O     1 
ATOM   1486 C CB    . ASP A 1 188 ? 60.173  -35.160 16.682  1.00 143.19 ? 198 ASP A CB    1 
ATOM   1487 C CG    . ASP A 1 188 ? 60.128  -36.130 15.520  1.00 143.03 ? 198 ASP A CG    1 
ATOM   1488 O OD1   . ASP A 1 188 ? 60.861  -35.915 14.534  1.00 143.13 ? 198 ASP A OD1   1 
ATOM   1489 O OD2   . ASP A 1 188 ? 59.353  -37.106 15.589  1.00 143.04 ? 198 ASP A OD2   1 
ATOM   1490 N N     . ILE A 1 189 ? 61.919  -33.340 18.695  1.00 114.28 ? 199 ILE A N     1 
ATOM   1491 C CA    . ILE A 1 189 ? 61.934  -32.468 19.857  1.00 115.01 ? 199 ILE A CA    1 
ATOM   1492 C C     . ILE A 1 189 ? 62.535  -31.117 19.478  1.00 115.83 ? 199 ILE A C     1 
ATOM   1493 O O     . ILE A 1 189 ? 62.072  -30.074 19.935  1.00 116.63 ? 199 ILE A O     1 
ATOM   1494 C CB    . ILE A 1 189 ? 62.714  -33.112 21.020  1.00 115.18 ? 199 ILE A CB    1 
ATOM   1495 C CG1   . ILE A 1 189 ? 61.960  -34.336 21.541  1.00 114.78 ? 199 ILE A CG1   1 
ATOM   1496 C CG2   . ILE A 1 189 ? 62.918  -32.134 22.153  1.00 116.26 ? 199 ILE A CG2   1 
ATOM   1497 C CD1   . ILE A 1 189 ? 62.818  -35.287 22.338  1.00 114.87 ? 199 ILE A CD1   1 
ATOM   1498 N N     . TRP A 1 190 ? 63.550  -31.135 18.619  1.00 115.87 ? 200 TRP A N     1 
ATOM   1499 C CA    . TRP A 1 190 ? 64.173  -29.893 18.175  1.00 116.96 ? 200 TRP A CA    1 
ATOM   1500 C C     . TRP A 1 190 ? 63.209  -29.120 17.287  1.00 117.18 ? 200 TRP A C     1 
ATOM   1501 O O     . TRP A 1 190 ? 63.139  -27.890 17.344  1.00 118.32 ? 200 TRP A O     1 
ATOM   1502 C CB    . TRP A 1 190 ? 65.482  -30.163 17.431  1.00 138.84 ? 200 TRP A CB    1 
ATOM   1503 C CG    . TRP A 1 190 ? 66.360  -28.947 17.321  1.00 140.40 ? 200 TRP A CG    1 
ATOM   1504 C CD1   . TRP A 1 190 ? 67.358  -28.568 18.180  1.00 141.45 ? 200 TRP A CD1   1 
ATOM   1505 C CD2   . TRP A 1 190 ? 66.310  -27.947 16.300  1.00 141.38 ? 200 TRP A CD2   1 
ATOM   1506 N NE1   . TRP A 1 190 ? 67.932  -27.395 17.749  1.00 143.09 ? 200 TRP A NE1   1 
ATOM   1507 C CE2   . TRP A 1 190 ? 67.307  -26.994 16.602  1.00 143.09 ? 200 TRP A CE2   1 
ATOM   1508 C CE3   . TRP A 1 190 ? 65.521  -27.768 15.162  1.00 141.20 ? 200 TRP A CE3   1 
ATOM   1509 C CZ2   . TRP A 1 190 ? 67.532  -25.879 15.801  1.00 144.67 ? 200 TRP A CZ2   1 
ATOM   1510 C CZ3   . TRP A 1 190 ? 65.746  -26.660 14.371  1.00 142.68 ? 200 TRP A CZ3   1 
ATOM   1511 C CH2   . TRP A 1 190 ? 66.744  -25.728 14.693  1.00 144.42 ? 200 TRP A CH2   1 
ATOM   1512 N N     . SER A 1 191 ? 62.464  -29.852 16.468  1.00 116.30 ? 201 SER A N     1 
ATOM   1513 C CA    . SER A 1 191 ? 61.445  -29.248 15.621  1.00 116.53 ? 201 SER A CA    1 
ATOM   1514 C C     . SER A 1 191 ? 60.302  -28.708 16.484  1.00 116.76 ? 201 SER A C     1 
ATOM   1515 O O     . SER A 1 191 ? 59.626  -27.752 16.113  1.00 117.47 ? 201 SER A O     1 
ATOM   1516 C CB    . SER A 1 191 ? 60.922  -30.261 14.596  1.00 115.74 ? 201 SER A CB    1 
ATOM   1517 O OG    . SER A 1 191 ? 61.952  -30.733 13.740  1.00 115.75 ? 201 SER A OG    1 
ATOM   1518 N N     . SER A 1 192 ? 60.095  -29.324 17.643  1.00 116.36 ? 202 SER A N     1 
ATOM   1519 C CA    . SER A 1 192 ? 59.037  -28.894 18.539  1.00 116.78 ? 202 SER A CA    1 
ATOM   1520 C C     . SER A 1 192 ? 59.468  -27.613 19.196  1.00 118.08 ? 202 SER A C     1 
ATOM   1521 O O     . SER A 1 192 ? 58.656  -26.730 19.449  1.00 118.92 ? 202 SER A O     1 
ATOM   1522 C CB    . SER A 1 192 ? 58.734  -29.957 19.591  1.00 116.29 ? 202 SER A CB    1 
ATOM   1523 O OG    . SER A 1 192 ? 58.330  -31.168 18.986  1.00 115.38 ? 202 SER A OG    1 
ATOM   1524 N N     . GLY A 1 193 ? 60.765  -27.517 19.461  1.00 118.45 ? 203 GLY A N     1 
ATOM   1525 C CA    . GLY A 1 193 ? 61.323  -26.366 20.145  1.00 119.99 ? 203 GLY A CA    1 
ATOM   1526 C C     . GLY A 1 193 ? 61.182  -25.095 19.341  1.00 121.15 ? 203 GLY A C     1 
ATOM   1527 O O     . GLY A 1 193 ? 60.875  -24.030 19.880  1.00 122.57 ? 203 GLY A O     1 
ATOM   1528 N N     . VAL A 1 194 ? 61.404  -25.205 18.040  1.00 120.77 ? 204 VAL A N     1 
ATOM   1529 C CA    . VAL A 1 194 ? 61.293  -24.042 17.180  1.00 122.05 ? 204 VAL A CA    1 
ATOM   1530 C C     . VAL A 1 194 ? 59.823  -23.701 16.943  1.00 122.00 ? 204 VAL A C     1 
ATOM   1531 O O     . VAL A 1 194 ? 59.493  -22.556 16.644  1.00 123.40 ? 204 VAL A O     1 
ATOM   1532 C CB    . VAL A 1 194 ? 62.014  -24.255 15.841  1.00 121.97 ? 204 VAL A CB    1 
ATOM   1533 C CG1   . VAL A 1 194 ? 63.492  -24.498 16.074  1.00 122.33 ? 204 VAL A CG1   1 
ATOM   1534 C CG2   . VAL A 1 194 ? 61.421  -25.416 15.108  1.00 120.33 ? 204 VAL A CG2   1 
ATOM   1535 N N     . ILE A 1 195 ? 58.943  -24.687 17.092  1.00 120.60 ? 205 ILE A N     1 
ATOM   1536 C CA    . ILE A 1 195 ? 57.506  -24.441 17.006  1.00 120.67 ? 205 ILE A CA    1 
ATOM   1537 C C     . ILE A 1 195 ? 57.050  -23.659 18.229  1.00 121.79 ? 205 ILE A C     1 
ATOM   1538 O O     . ILE A 1 195 ? 56.257  -22.719 18.125  1.00 122.87 ? 205 ILE A O     1 
ATOM   1539 C CB    . ILE A 1 195 ? 56.706  -25.749 16.891  1.00 119.20 ? 205 ILE A CB    1 
ATOM   1540 C CG1   . ILE A 1 195 ? 56.904  -26.365 15.509  1.00 118.50 ? 205 ILE A CG1   1 
ATOM   1541 C CG2   . ILE A 1 195 ? 55.227  -25.494 17.110  1.00 119.54 ? 205 ILE A CG2   1 
ATOM   1542 C CD1   . ILE A 1 195 ? 56.393  -27.783 15.383  1.00 117.28 ? 205 ILE A CD1   1 
ATOM   1543 N N     . LEU A 1 196 ? 57.569  -24.049 19.389  1.00 121.71 ? 206 LEU A N     1 
ATOM   1544 C CA    . LEU A 1 196 ? 57.285  -23.342 20.632  1.00 123.05 ? 206 LEU A CA    1 
ATOM   1545 C C     . LEU A 1 196 ? 57.781  -21.908 20.545  1.00 124.98 ? 206 LEU A C     1 
ATOM   1546 O O     . LEU A 1 196 ? 57.159  -20.999 21.089  1.00 126.45 ? 206 LEU A O     1 
ATOM   1547 C CB    . LEU A 1 196 ? 57.928  -24.052 21.827  1.00 122.82 ? 206 LEU A CB    1 
ATOM   1548 C CG    . LEU A 1 196 ? 57.772  -23.392 23.198  1.00 124.45 ? 206 LEU A CG    1 
ATOM   1549 C CD1   . LEU A 1 196 ? 56.305  -23.199 23.521  1.00 124.85 ? 206 LEU A CD1   1 
ATOM   1550 C CD2   . LEU A 1 196 ? 58.445  -24.238 24.258  1.00 124.20 ? 206 LEU A CD2   1 
ATOM   1551 N N     . TYR A 1 197 ? 58.899  -21.712 19.851  1.00 125.20 ? 207 TYR A N     1 
ATOM   1552 C CA    . TYR A 1 197 ? 59.474  -20.385 19.667  1.00 127.33 ? 207 TYR A CA    1 
ATOM   1553 C C     . TYR A 1 197 ? 58.572  -19.536 18.784  1.00 128.13 ? 207 TYR A C     1 
ATOM   1554 O O     . TYR A 1 197 ? 58.327  -18.363 19.066  1.00 130.13 ? 207 TYR A O     1 
ATOM   1555 C CB    . TYR A 1 197 ? 60.873  -20.492 19.060  1.00 127.48 ? 207 TYR A CB    1 
ATOM   1556 C CG    . TYR A 1 197 ? 61.620  -19.184 18.967  1.00 130.02 ? 207 TYR A CG    1 
ATOM   1557 C CD1   . TYR A 1 197 ? 61.381  -18.304 17.929  1.00 131.23 ? 207 TYR A CD1   1 
ATOM   1558 C CD2   . TYR A 1 197 ? 62.578  -18.841 19.904  1.00 131.47 ? 207 TYR A CD2   1 
ATOM   1559 C CE1   . TYR A 1 197 ? 62.060  -17.116 17.833  1.00 133.87 ? 207 TYR A CE1   1 
ATOM   1560 C CE2   . TYR A 1 197 ? 63.267  -17.652 19.815  1.00 134.12 ? 207 TYR A CE2   1 
ATOM   1561 C CZ    . TYR A 1 197 ? 63.003  -16.792 18.778  1.00 135.34 ? 207 TYR A CZ    1 
ATOM   1562 O OH    . TYR A 1 197 ? 63.687  -15.601 18.685  1.00 138.31 ? 207 TYR A OH    1 
ATOM   1563 N N     . ALA A 1 198 ? 58.074  -20.143 17.715  1.00 126.73 ? 208 ALA A N     1 
ATOM   1564 C CA    . ALA A 1 198 ? 57.212  -19.447 16.774  1.00 127.45 ? 208 ALA A CA    1 
ATOM   1565 C C     . ALA A 1 198 ? 55.853  -19.164 17.397  1.00 127.75 ? 208 ALA A C     1 
ATOM   1566 O O     . ALA A 1 198 ? 55.147  -18.252 16.980  1.00 129.05 ? 208 ALA A O     1 
ATOM   1567 C CB    . ALA A 1 198 ? 57.057  -20.259 15.500  1.00 286.56 ? 208 ALA A CB    1 
ATOM   1568 N N     . LEU A 1 199 ? 55.490  -19.953 18.397  1.00 126.74 ? 209 LEU A N     1 
ATOM   1569 C CA    . LEU A 1 199 ? 54.234  -19.753 19.106  1.00 127.22 ? 209 LEU A CA    1 
ATOM   1570 C C     . LEU A 1 199 ? 54.307  -18.578 20.084  1.00 129.44 ? 209 LEU A C     1 
ATOM   1571 O O     . LEU A 1 199 ? 53.318  -18.237 20.734  1.00 130.30 ? 209 LEU A O     1 
ATOM   1572 C CB    . LEU A 1 199 ? 53.845  -21.028 19.856  1.00 125.70 ? 209 LEU A CB    1 
ATOM   1573 C CG    . LEU A 1 199 ? 53.162  -22.138 19.061  1.00 124.01 ? 209 LEU A CG    1 
ATOM   1574 C CD1   . LEU A 1 199 ? 53.166  -23.426 19.857  1.00 122.80 ? 209 LEU A CD1   1 
ATOM   1575 C CD2   . LEU A 1 199 ? 51.743  -21.730 18.735  1.00 124.64 ? 209 LEU A CD2   1 
ATOM   1576 N N     . LEU A 1 200 ? 55.489  -17.982 20.207  1.00 130.59 ? 210 LEU A N     1 
ATOM   1577 C CA    . LEU A 1 200 ? 55.710  -16.915 21.178  1.00 132.98 ? 210 LEU A CA    1 
ATOM   1578 C C     . LEU A 1 200 ? 56.196  -15.639 20.506  1.00 135.14 ? 210 LEU A C     1 
ATOM   1579 O O     . LEU A 1 200 ? 55.534  -14.603 20.566  1.00 137.06 ? 210 LEU A O     1 
ATOM   1580 C CB    . LEU A 1 200 ? 56.710  -17.367 22.245  1.00 132.98 ? 210 LEU A CB    1 
ATOM   1581 C CG    . LEU A 1 200 ? 56.220  -18.530 23.109  1.00 131.42 ? 210 LEU A CG    1 
ATOM   1582 C CD1   . LEU A 1 200 ? 57.375  -19.274 23.756  1.00 130.83 ? 210 LEU A CD1   1 
ATOM   1583 C CD2   . LEU A 1 200 ? 55.270  -18.007 24.159  1.00 132.98 ? 210 LEU A CD2   1 
ATOM   1584 N N     . CYS A 1 201 ? 57.362  -15.720 19.877  1.00 174.74 ? 211 CYS A N     1 
ATOM   1585 C CA    . CYS A 1 201 ? 57.979  -14.560 19.247  1.00 177.08 ? 211 CYS A CA    1 
ATOM   1586 C C     . CYS A 1 201 ? 57.314  -14.163 17.931  1.00 177.23 ? 211 CYS A C     1 
ATOM   1587 O O     . CYS A 1 201 ? 57.457  -13.029 17.475  1.00 179.62 ? 211 CYS A O     1 
ATOM   1588 C CB    . CYS A 1 201 ? 59.461  -14.830 19.006  1.00 137.39 ? 211 CYS A CB    1 
ATOM   1589 S SG    . CYS A 1 201 ? 60.356  -15.319 20.480  1.00 137.40 ? 211 CYS A SG    1 
ATOM   1590 N N     . GLY A 1 202 ? 56.602  -15.101 17.314  1.00 135.19 ? 212 GLY A N     1 
ATOM   1591 C CA    . GLY A 1 202 ? 55.947  -14.841 16.043  1.00 135.29 ? 212 GLY A CA    1 
ATOM   1592 C C     . GLY A 1 202 ? 56.902  -14.902 14.864  1.00 135.42 ? 212 GLY A C     1 
ATOM   1593 O O     . GLY A 1 202 ? 56.481  -14.807 13.709  1.00 135.49 ? 212 GLY A O     1 
ATOM   1594 N N     . THR A 1 203 ? 58.191  -15.056 15.162  1.00 135.64 ? 213 THR A N     1 
ATOM   1595 C CA    . THR A 1 203 ? 59.232  -15.196 14.147  1.00 135.88 ? 213 THR A CA    1 
ATOM   1596 C C     . THR A 1 203 ? 60.004  -16.491 14.371  1.00 133.68 ? 213 THR A C     1 
ATOM   1597 O O     . THR A 1 203 ? 59.936  -17.072 15.449  1.00 132.50 ? 213 THR A O     1 
ATOM   1598 C CB    . THR A 1 203 ? 60.218  -14.024 14.173  1.00 138.93 ? 213 THR A CB    1 
ATOM   1599 O OG1   . THR A 1 203 ? 61.040  -14.125 15.341  1.00 139.20 ? 213 THR A OG1   1 
ATOM   1600 C CG2   . THR A 1 203 ? 59.471  -12.695 14.182  1.00 141.44 ? 213 THR A CG2   1 
ATOM   1601 N N     . LEU A 1 204 ? 60.732  -16.946 13.357  1.00 133.31 ? 214 LEU A N     1 
ATOM   1602 C CA    . LEU A 1 204 ? 61.483  -18.191 13.471  1.00 131.39 ? 214 LEU A CA    1 
ATOM   1603 C C     . LEU A 1 204 ? 62.796  -17.936 14.193  1.00 132.59 ? 214 LEU A C     1 
ATOM   1604 O O     . LEU A 1 204 ? 63.403  -16.883 14.009  1.00 135.11 ? 214 LEU A O     1 
ATOM   1605 C CB    . LEU A 1 204 ? 61.733  -18.806 12.095  1.00 130.73 ? 214 LEU A CB    1 
ATOM   1606 C CG    . LEU A 1 204 ? 60.634  -19.732 11.565  1.00 128.69 ? 214 LEU A CG    1 
ATOM   1607 C CD1   . LEU A 1 204 ? 59.295  -19.010 11.378  1.00 129.33 ? 214 LEU A CD1   1 
ATOM   1608 C CD2   . LEU A 1 204 ? 61.087  -20.380 10.271  1.00 128.35 ? 214 LEU A CD2   1 
ATOM   1609 N N     . PRO A 1 205 ? 63.220  -18.887 15.044  1.00 131.03 ? 215 PRO A N     1 
ATOM   1610 C CA    . PRO A 1 205 ? 64.458  -18.743 15.819  1.00 132.15 ? 215 PRO A CA    1 
ATOM   1611 C C     . PRO A 1 205 ? 65.696  -18.781 14.940  1.00 133.08 ? 215 PRO A C     1 
ATOM   1612 O O     . PRO A 1 205 ? 66.632  -18.012 15.140  1.00 135.39 ? 215 PRO A O     1 
ATOM   1613 C CB    . PRO A 1 205 ? 64.422  -19.943 16.766  1.00 129.96 ? 215 PRO A CB    1 
ATOM   1614 C CG    . PRO A 1 205 ? 63.618  -20.955 16.050  1.00 127.66 ? 215 PRO A CG    1 
ATOM   1615 C CD    . PRO A 1 205 ? 62.587  -20.199 15.262  1.00 128.32 ? 215 PRO A CD    1 
ATOM   1616 N N     . PHE A 1 206 ? 65.699  -19.683 13.972  1.00 151.35 ? 216 PHE A N     1 
ATOM   1617 C CA    . PHE A 1 206 ? 66.785  -19.749 13.016  1.00 152.36 ? 216 PHE A CA    1 
ATOM   1618 C C     . PHE A 1 206 ? 66.245  -19.422 11.637  1.00 152.91 ? 216 PHE A C     1 
ATOM   1619 O O     . PHE A 1 206 ? 65.527  -20.226 11.043  1.00 151.08 ? 216 PHE A O     1 
ATOM   1620 C CB    . PHE A 1 206 ? 67.424  -21.134 13.027  1.00 130.60 ? 216 PHE A CB    1 
ATOM   1621 C CG    . PHE A 1 206 ? 67.880  -21.580 14.380  1.00 129.95 ? 216 PHE A CG    1 
ATOM   1622 C CD1   . PHE A 1 206 ? 66.980  -22.088 15.300  1.00 128.22 ? 216 PHE A CD1   1 
ATOM   1623 C CD2   . PHE A 1 206 ? 69.214  -21.505 14.727  1.00 131.28 ? 216 PHE A CD2   1 
ATOM   1624 C CE1   . PHE A 1 206 ? 67.406  -22.500 16.543  1.00 127.85 ? 216 PHE A CE1   1 
ATOM   1625 C CE2   . PHE A 1 206 ? 69.647  -21.919 15.969  1.00 130.85 ? 216 PHE A CE2   1 
ATOM   1626 C CZ    . PHE A 1 206 ? 68.744  -22.417 16.878  1.00 129.14 ? 216 PHE A CZ    1 
ATOM   1627 N N     . ASP A 1 207 ? 66.584  -18.244 11.124  1.00 135.84 ? 217 ASP A N     1 
ATOM   1628 C CA    . ASP A 1 207 ? 66.096  -17.837 9.810   1.00 136.80 ? 217 ASP A CA    1 
ATOM   1629 C C     . ASP A 1 207 ? 67.144  -17.034 9.055   1.00 139.88 ? 217 ASP A C     1 
ATOM   1630 O O     . ASP A 1 207 ? 67.777  -16.143 9.622   1.00 142.15 ? 217 ASP A O     1 
ATOM   1631 C CB    . ASP A 1 207 ? 64.806  -17.023 9.944   1.00 190.45 ? 217 ASP A CB    1 
ATOM   1632 C CG    . ASP A 1 207 ? 64.113  -16.794 8.608   1.00 191.03 ? 217 ASP A CG    1 
ATOM   1633 O OD1   . ASP A 1 207 ? 64.243  -17.649 7.705   1.00 190.01 ? 217 ASP A OD1   1 
ATOM   1634 O OD2   . ASP A 1 207 ? 63.433  -15.756 8.463   1.00 192.68 ? 217 ASP A OD2   1 
ATOM   1635 N N     . ASP A 1 208 ? 67.338  -17.371 7.781   1.00 140.18 ? 218 ASP A N     1 
ATOM   1636 C CA    . ASP A 1 208 ? 68.250  -16.635 6.912   1.00 143.37 ? 218 ASP A CA    1 
ATOM   1637 C C     . ASP A 1 208 ? 67.889  -16.870 5.445   1.00 143.67 ? 218 ASP A C     1 
ATOM   1638 O O     . ASP A 1 208 ? 67.304  -17.895 5.100   1.00 141.23 ? 218 ASP A O     1 
ATOM   1639 C CB    . ASP A 1 208 ? 69.698  -17.052 7.187   1.00 161.13 ? 218 ASP A CB    1 
ATOM   1640 C CG    . ASP A 1 208 ? 70.698  -15.964 6.844   1.00 165.09 ? 218 ASP A CG    1 
ATOM   1641 O OD1   . ASP A 1 208 ? 70.657  -14.890 7.481   1.00 167.07 ? 218 ASP A OD1   1 
ATOM   1642 O OD2   . ASP A 1 208 ? 71.540  -16.189 5.952   1.00 166.46 ? 218 ASP A OD2   1 
ATOM   1643 N N     . ASP A 1 209 ? 68.251  -15.926 4.583   1.00 146.92 ? 219 ASP A N     1 
ATOM   1644 C CA    . ASP A 1 209 ? 67.972  -16.055 3.159   1.00 147.76 ? 219 ASP A CA    1 
ATOM   1645 C C     . ASP A 1 209 ? 69.009  -16.951 2.494   1.00 147.80 ? 219 ASP A C     1 
ATOM   1646 O O     . ASP A 1 209 ? 68.691  -17.797 1.660   1.00 146.63 ? 219 ASP A O     1 
ATOM   1647 C CB    . ASP A 1 209 ? 67.950  -14.678 2.492   1.00 152.17 ? 219 ASP A CB    1 
ATOM   1648 C CG    . ASP A 1 209 ? 66.922  -13.742 3.110   1.00 152.46 ? 219 ASP A CG    1 
ATOM   1649 O OD1   . ASP A 1 209 ? 65.758  -14.158 3.305   1.00 149.97 ? 219 ASP A OD1   1 
ATOM   1650 O OD2   . ASP A 1 209 ? 67.283  -12.584 3.405   1.00 155.40 ? 219 ASP A OD2   1 
ATOM   1651 N N     . HIS A 1 210 ? 70.258  -16.755 2.887   1.00 202.90 ? 220 HIS A N     1 
ATOM   1652 C CA    . HIS A 1 210 ? 71.377  -17.471 2.302   1.00 203.51 ? 220 HIS A CA    1 
ATOM   1653 C C     . HIS A 1 210 ? 71.699  -18.717 3.129   1.00 200.37 ? 220 HIS A C     1 
ATOM   1654 O O     . HIS A 1 210 ? 71.713  -18.667 4.359   1.00 199.17 ? 220 HIS A O     1 
ATOM   1655 C CB    . HIS A 1 210 ? 72.579  -16.520 2.201   1.00 160.13 ? 220 HIS A CB    1 
ATOM   1656 C CG    . HIS A 1 210 ? 73.872  -17.183 1.843   1.00 161.01 ? 220 HIS A CG    1 
ATOM   1657 N ND1   . HIS A 1 210 ? 73.974  -18.162 0.877   1.00 160.25 ? 220 HIS A ND1   1 
ATOM   1658 C CD2   . HIS A 1 210 ? 75.129  -16.987 2.309   1.00 162.88 ? 220 HIS A CD2   1 
ATOM   1659 C CE1   . HIS A 1 210 ? 75.231  -18.548 0.775   1.00 161.51 ? 220 HIS A CE1   1 
ATOM   1660 N NE2   . HIS A 1 210 ? 75.954  -17.851 1.635   1.00 163.10 ? 220 HIS A NE2   1 
ATOM   1661 N N     . VAL A 1 211 ? 71.928  -19.839 2.451   1.00 160.82 ? 221 VAL A N     1 
ATOM   1662 C CA    . VAL A 1 211 ? 72.335  -21.080 3.111   1.00 158.22 ? 221 VAL A CA    1 
ATOM   1663 C C     . VAL A 1 211 ? 73.666  -21.547 2.523   1.00 159.84 ? 221 VAL A C     1 
ATOM   1664 O O     . VAL A 1 211 ? 74.014  -21.156 1.413   1.00 162.45 ? 221 VAL A O     1 
ATOM   1665 C CB    . VAL A 1 211 ? 71.265  -22.179 2.957   1.00 139.94 ? 221 VAL A CB    1 
ATOM   1666 C CG1   . VAL A 1 211 ? 69.971  -21.724 3.576   1.00 138.52 ? 221 VAL A CG1   1 
ATOM   1667 C CG2   . VAL A 1 211 ? 71.052  -22.518 1.497   1.00 140.88 ? 221 VAL A CG2   1 
ATOM   1668 N N     . PRO A 1 212 ? 74.430  -22.379 3.250   1.00 188.34 ? 222 PRO A N     1 
ATOM   1669 C CA    . PRO A 1 212 ? 74.278  -23.025 4.561   1.00 185.55 ? 222 PRO A CA    1 
ATOM   1670 C C     . PRO A 1 212 ? 74.287  -22.082 5.767   1.00 186.04 ? 222 PRO A C     1 
ATOM   1671 O O     . PRO A 1 212 ? 74.153  -22.587 6.877   1.00 183.96 ? 222 PRO A O     1 
ATOM   1672 C CB    . PRO A 1 212 ? 75.462  -23.997 4.616   1.00 175.19 ? 222 PRO A CB    1 
ATOM   1673 C CG    . PRO A 1 212 ? 76.471  -23.421 3.725   1.00 178.63 ? 222 PRO A CG    1 
ATOM   1674 C CD    . PRO A 1 212 ? 75.709  -22.756 2.616   1.00 179.98 ? 222 PRO A CD    1 
ATOM   1675 N N     . THR A 1 213 ? 74.535  -20.787 5.583   1.00 144.07 ? 223 THR A N     1 
ATOM   1676 C CA    . THR A 1 213 ? 74.598  -19.860 6.716   1.00 144.99 ? 223 THR A CA    1 
ATOM   1677 C C     . THR A 1 213 ? 73.441  -20.052 7.695   1.00 142.17 ? 223 THR A C     1 
ATOM   1678 O O     . THR A 1 213 ? 73.617  -19.860 8.892   1.00 141.95 ? 223 THR A O     1 
ATOM   1679 C CB    . THR A 1 213 ? 74.595  -18.393 6.260   1.00 151.31 ? 223 THR A CB    1 
ATOM   1680 O OG1   . THR A 1 213 ? 74.149  -18.325 4.905   1.00 152.07 ? 223 THR A OG1   1 
ATOM   1681 C CG2   . THR A 1 213 ? 75.989  -17.787 6.360   1.00 154.76 ? 223 THR A CG2   1 
ATOM   1682 N N     . LEU A 1 214 ? 72.269  -20.435 7.200   1.00 140.25 ? 224 LEU A N     1 
ATOM   1683 C CA    . LEU A 1 214 ? 71.174  -20.810 8.088   1.00 137.51 ? 224 LEU A CA    1 
ATOM   1684 C C     . LEU A 1 214 ? 71.538  -22.074 8.857   1.00 135.13 ? 224 LEU A C     1 
ATOM   1685 O O     . LEU A 1 214 ? 71.315  -22.156 10.061  1.00 134.00 ? 224 LEU A O     1 
ATOM   1686 C CB    . LEU A 1 214 ? 69.873  -21.018 7.308   1.00 136.21 ? 224 LEU A CB    1 
ATOM   1687 C CG    . LEU A 1 214 ? 68.540  -21.033 8.069   1.00 134.22 ? 224 LEU A CG    1 
ATOM   1688 C CD1   . LEU A 1 214 ? 67.395  -20.714 7.137   1.00 134.32 ? 224 LEU A CD1   1 
ATOM   1689 C CD2   . LEU A 1 214 ? 68.277  -22.364 8.718   1.00 131.27 ? 224 LEU A CD2   1 
ATOM   1690 N N     . PHE A 1 215 ? 72.085  -23.064 8.158   1.00 178.12 ? 225 PHE A N     1 
ATOM   1691 C CA    . PHE A 1 215 ? 72.486  -24.318 8.795   1.00 176.11 ? 225 PHE A CA    1 
ATOM   1692 C C     . PHE A 1 215 ? 73.653  -24.086 9.751   1.00 177.26 ? 225 PHE A C     1 
ATOM   1693 O O     . PHE A 1 215 ? 73.764  -24.756 10.778  1.00 175.73 ? 225 PHE A O     1 
ATOM   1694 C CB    . PHE A 1 215 ? 72.870  -25.368 7.748   1.00 155.10 ? 225 PHE A CB    1 
ATOM   1695 C CG    . PHE A 1 215 ? 71.797  -25.637 6.731   1.00 154.32 ? 225 PHE A CG    1 
ATOM   1696 C CD1   . PHE A 1 215 ? 70.473  -25.775 7.114   1.00 152.42 ? 225 PHE A CD1   1 
ATOM   1697 C CD2   . PHE A 1 215 ? 72.113  -25.744 5.388   1.00 155.74 ? 225 PHE A CD2   1 
ATOM   1698 C CE1   . PHE A 1 215 ? 69.488  -26.020 6.175   1.00 151.92 ? 225 PHE A CE1   1 
ATOM   1699 C CE2   . PHE A 1 215 ? 71.133  -25.986 4.448   1.00 155.27 ? 225 PHE A CE2   1 
ATOM   1700 C CZ    . PHE A 1 215 ? 69.820  -26.125 4.842   1.00 153.34 ? 225 PHE A CZ    1 
ATOM   1701 N N     . LYS A 1 216 ? 74.527  -23.144 9.406   1.00 136.63 ? 226 LYS A N     1 
ATOM   1702 C CA    . LYS A 1 216 ? 75.614  -22.750 10.299  1.00 138.27 ? 226 LYS A CA    1 
ATOM   1703 C C     . LYS A 1 216 ? 75.045  -21.986 11.494  1.00 138.27 ? 226 LYS A C     1 
ATOM   1704 O O     . LYS A 1 216 ? 75.579  -22.048 12.604  1.00 138.42 ? 226 LYS A O     1 
ATOM   1705 C CB    . LYS A 1 216 ? 76.653  -21.896 9.564   1.00 141.84 ? 226 LYS A CB    1 
ATOM   1706 C CG    . LYS A 1 216 ? 77.300  -22.580 8.374   1.00 142.35 ? 226 LYS A CG    1 
ATOM   1707 C CD    . LYS A 1 216 ? 78.165  -23.751 8.803   1.00 141.21 ? 226 LYS A CD    1 
ATOM   1708 C CE    . LYS A 1 216 ? 78.495  -24.643 7.615   1.00 141.08 ? 226 LYS A CE    1 
ATOM   1709 N NZ    . LYS A 1 216 ? 79.484  -25.705 7.950   1.00 140.57 ? 226 LYS A NZ    1 
ATOM   1710 N N     . LYS A 1 217 ? 73.953  -21.266 11.258  1.00 138.27 ? 227 LYS A N     1 
ATOM   1711 C CA    . LYS A 1 217 ? 73.241  -20.575 12.325  1.00 138.22 ? 227 LYS A CA    1 
ATOM   1712 C C     . LYS A 1 217 ? 72.569  -21.604 13.228  1.00 135.11 ? 227 LYS A C     1 
ATOM   1713 O O     . LYS A 1 217 ? 72.437  -21.387 14.427  1.00 135.05 ? 227 LYS A O     1 
ATOM   1714 C CB    . LYS A 1 217 ? 72.207  -19.607 11.744  1.00 139.06 ? 227 LYS A CB    1 
ATOM   1715 C CG    . LYS A 1 217 ? 72.100  -18.262 12.442  1.00 141.46 ? 227 LYS A CG    1 
ATOM   1716 C CD    . LYS A 1 217 ? 71.247  -17.311 11.615  1.00 142.75 ? 227 LYS A CD    1 
ATOM   1717 C CE    . LYS A 1 217 ? 71.279  -15.906 12.180  1.00 145.77 ? 227 LYS A CE    1 
ATOM   1718 N NZ    . LYS A 1 217 ? 70.531  -14.953 11.317  1.00 147.39 ? 227 LYS A NZ    1 
ATOM   1719 N N     . ILE A 1 218 ? 72.145  -22.720 12.637  1.00 132.80 ? 228 ILE A N     1 
ATOM   1720 C CA    . ILE A 1 218 ? 71.520  -23.812 13.376  1.00 130.04 ? 228 ILE A CA    1 
ATOM   1721 C C     . ILE A 1 218 ? 72.549  -24.649 14.131  1.00 129.62 ? 228 ILE A C     1 
ATOM   1722 O O     . ILE A 1 218 ? 72.343  -24.964 15.300  1.00 128.69 ? 228 ILE A O     1 
ATOM   1723 C CB    . ILE A 1 218 ? 70.705  -24.726 12.445  1.00 128.07 ? 228 ILE A CB    1 
ATOM   1724 C CG1   . ILE A 1 218 ? 69.345  -24.099 12.146  1.00 127.81 ? 228 ILE A CG1   1 
ATOM   1725 C CG2   . ILE A 1 218 ? 70.490  -26.081 13.073  1.00 125.70 ? 228 ILE A CG2   1 
ATOM   1726 C CD1   . ILE A 1 218 ? 68.459  -24.967 11.289  1.00 126.09 ? 228 ILE A CD1   1 
ATOM   1727 N N     . CYS A 1 219 ? 73.649  -25.006 13.472  1.00 138.52 ? 229 CYS A N     1 
ATOM   1728 C CA    . CYS A 1 219 ? 74.732  -25.747 14.123  1.00 138.48 ? 229 CYS A CA    1 
ATOM   1729 C C     . CYS A 1 219 ? 75.200  -25.053 15.396  1.00 139.89 ? 229 CYS A C     1 
ATOM   1730 O O     . CYS A 1 219 ? 75.495  -25.703 16.398  1.00 139.10 ? 229 CYS A O     1 
ATOM   1731 C CB    . CYS A 1 219 ? 75.917  -25.926 13.176  1.00 200.61 ? 229 CYS A CB    1 
ATOM   1732 S SG    . CYS A 1 219 ? 75.690  -27.205 11.939  1.00 198.93 ? 229 CYS A SG    1 
ATOM   1733 N N     . ASP A 1 220 ? 75.270  -23.728 15.346  1.00 134.19 ? 230 ASP A N     1 
ATOM   1734 C CA    . ASP A 1 220 ? 75.530  -22.931 16.536  1.00 135.83 ? 230 ASP A CA    1 
ATOM   1735 C C     . ASP A 1 220 ? 74.241  -22.764 17.339  1.00 134.45 ? 230 ASP A C     1 
ATOM   1736 O O     . ASP A 1 220 ? 73.175  -22.547 16.773  1.00 133.55 ? 230 ASP A O     1 
ATOM   1737 C CB    . ASP A 1 220 ? 76.105  -21.568 16.152  1.00 143.11 ? 230 ASP A CB    1 
ATOM   1738 C CG    . ASP A 1 220 ? 77.430  -21.680 15.417  1.00 144.92 ? 230 ASP A CG    1 
ATOM   1739 O OD1   . ASP A 1 220 ? 77.815  -22.811 15.048  1.00 143.36 ? 230 ASP A OD1   1 
ATOM   1740 O OD2   . ASP A 1 220 ? 78.082  -20.633 15.202  1.00 148.13 ? 230 ASP A OD2   1 
ATOM   1741 N N     . GLY A 1 221 ? 74.344  -22.825 18.660  1.00 163.75 ? 231 GLY A N     1 
ATOM   1742 C CA    . GLY A 1 221 ? 73.171  -22.822 19.513  1.00 162.50 ? 231 GLY A CA    1 
ATOM   1743 C C     . GLY A 1 221 ? 72.705  -21.425 19.831  1.00 164.61 ? 231 GLY A C     1 
ATOM   1744 O O     . GLY A 1 221 ? 72.107  -21.188 20.877  1.00 164.68 ? 231 GLY A O     1 
ATOM   1745 N N     . ILE A 1 222 ? 73.022  -20.487 18.948  1.00 137.44 ? 232 ILE A N     1 
ATOM   1746 C CA    . ILE A 1 222 ? 72.709  -19.089 19.185  1.00 139.98 ? 232 ILE A CA    1 
ATOM   1747 C C     . ILE A 1 222 ? 71.378  -18.707 18.536  1.00 139.06 ? 232 ILE A C     1 
ATOM   1748 O O     . ILE A 1 222 ? 71.114  -19.031 17.378  1.00 137.94 ? 232 ILE A O     1 
ATOM   1749 C CB    . ILE A 1 222 ? 73.858  -18.179 18.684  1.00 176.49 ? 232 ILE A CB    1 
ATOM   1750 C CG1   . ILE A 1 222 ? 73.715  -16.760 19.238  1.00 179.66 ? 232 ILE A CG1   1 
ATOM   1751 C CG2   . ILE A 1 222 ? 73.967  -18.194 17.161  1.00 176.46 ? 232 ILE A CG2   1 
ATOM   1752 C CD1   . ILE A 1 222 ? 74.988  -15.935 19.125  1.00 183.46 ? 232 ILE A CD1   1 
ATOM   1753 N N     . PHE A 1 223 ? 70.513  -18.076 19.322  1.00 140.37 ? 233 PHE A N     1 
ATOM   1754 C CA    . PHE A 1 223 ? 69.210  -17.631 18.841  1.00 139.80 ? 233 PHE A CA    1 
ATOM   1755 C C     . PHE A 1 223 ? 68.691  -16.463 19.679  1.00 142.02 ? 233 PHE A C     1 
ATOM   1756 O O     . PHE A 1 223 ? 68.987  -16.373 20.870  1.00 142.95 ? 233 PHE A O     1 
ATOM   1757 C CB    . PHE A 1 223 ? 68.208  -18.788 18.846  1.00 138.75 ? 233 PHE A CB    1 
ATOM   1758 C CG    . PHE A 1 223 ? 68.007  -19.421 20.192  1.00 137.68 ? 233 PHE A CG    1 
ATOM   1759 C CD1   . PHE A 1 223 ? 68.973  -20.252 20.735  1.00 137.17 ? 233 PHE A CD1   1 
ATOM   1760 C CD2   . PHE A 1 223 ? 66.840  -19.208 20.898  1.00 137.33 ? 233 PHE A CD2   1 
ATOM   1761 C CE1   . PHE A 1 223 ? 68.790  -20.836 21.965  1.00 136.41 ? 233 PHE A CE1   1 
ATOM   1762 C CE2   . PHE A 1 223 ? 66.649  -19.797 22.125  1.00 136.61 ? 233 PHE A CE2   1 
ATOM   1763 C CZ    . PHE A 1 223 ? 67.627  -20.610 22.662  1.00 136.17 ? 233 PHE A CZ    1 
ATOM   1764 N N     . TYR A 1 224 ? 67.912  -15.580 19.059  1.00 164.09 ? 234 TYR A N     1 
ATOM   1765 C CA    . TYR A 1 224 ? 67.395  -14.390 19.735  1.00 166.54 ? 234 TYR A CA    1 
ATOM   1766 C C     . TYR A 1 224 ? 66.347  -14.761 20.781  1.00 165.02 ? 234 TYR A C     1 
ATOM   1767 O O     . TYR A 1 224 ? 65.325  -15.363 20.457  1.00 162.59 ? 234 TYR A O     1 
ATOM   1768 C CB    . TYR A 1 224 ? 66.795  -13.421 18.708  1.00 182.00 ? 234 TYR A CB    1 
ATOM   1769 C CG    . TYR A 1 224 ? 66.203  -12.142 19.276  1.00 184.77 ? 234 TYR A CG    1 
ATOM   1770 C CD1   . TYR A 1 224 ? 66.667  -11.593 20.468  1.00 187.10 ? 234 TYR A CD1   1 
ATOM   1771 C CD2   . TYR A 1 224 ? 65.178  -11.481 18.608  1.00 185.26 ? 234 TYR A CD2   1 
ATOM   1772 C CE1   . TYR A 1 224 ? 66.120  -10.423 20.980  1.00 189.88 ? 234 TYR A CE1   1 
ATOM   1773 C CE2   . TYR A 1 224 ? 64.627  -10.313 19.109  1.00 187.95 ? 234 TYR A CE2   1 
ATOM   1774 C CZ    . TYR A 1 224 ? 65.102  -9.787  20.295  1.00 190.28 ? 234 TYR A CZ    1 
ATOM   1775 O OH    . TYR A 1 224 ? 64.557  -8.624  20.798  1.00 193.22 ? 234 TYR A OH    1 
ATOM   1776 N N     . THR A 1 225 ? 66.600  -14.367 22.027  1.00 147.36 ? 235 THR A N     1 
ATOM   1777 C CA    . THR A 1 225 ? 65.693  -14.638 23.139  1.00 146.52 ? 235 THR A CA    1 
ATOM   1778 C C     . THR A 1 225 ? 65.203  -13.324 23.717  1.00 149.60 ? 235 THR A C     1 
ATOM   1779 O O     . THR A 1 225 ? 65.770  -12.834 24.690  1.00 152.03 ? 235 THR A O     1 
ATOM   1780 C CB    . THR A 1 225 ? 66.369  -15.460 24.268  1.00 143.53 ? 235 THR A CB    1 
ATOM   1781 O OG1   . THR A 1 225 ? 67.516  -14.758 24.760  1.00 146.59 ? 235 THR A OG1   1 
ATOM   1782 C CG2   . THR A 1 225 ? 66.809  -16.809 23.764  1.00 140.56 ? 235 THR A CG2   1 
ATOM   1783 N N     . PRO A 1 226 ? 64.158  -12.737 23.114  1.00 176.03 ? 236 PRO A N     1 
ATOM   1784 C CA    . PRO A 1 226 ? 63.676  -11.418 23.539  1.00 179.23 ? 236 PRO A CA    1 
ATOM   1785 C C     . PRO A 1 226 ? 63.159  -11.421 24.973  1.00 179.87 ? 236 PRO A C     1 
ATOM   1786 O O     . PRO A 1 226 ? 62.832  -12.487 25.495  1.00 177.37 ? 236 PRO A O     1 
ATOM   1787 C CB    . PRO A 1 226 ? 62.543  -11.121 22.549  1.00 149.73 ? 236 PRO A CB    1 
ATOM   1788 C CG    . PRO A 1 226 ? 62.094  -12.449 22.078  1.00 145.80 ? 236 PRO A CG    1 
ATOM   1789 C CD    . PRO A 1 226 ? 63.328  -13.303 22.038  1.00 144.64 ? 236 PRO A CD    1 
ATOM   1790 N N     . GLN A 1 227 ? 63.076  -10.239 25.584  1.00 154.72 ? 237 GLN A N     1 
ATOM   1791 C CA    . GLN A 1 227 ? 62.580  -10.083 26.955  1.00 156.01 ? 237 GLN A CA    1 
ATOM   1792 C C     . GLN A 1 227 ? 61.065  -10.312 27.015  1.00 154.37 ? 237 GLN A C     1 
ATOM   1793 O O     . GLN A 1 227 ? 60.456  -10.280 28.086  1.00 155.18 ? 237 GLN A O     1 
ATOM   1794 C CB    . GLN A 1 227 ? 62.959  -8.707  27.518  1.00 175.02 ? 237 GLN A CB    1 
ATOM   1795 C CG    . GLN A 1 227 ? 61.911  -7.623  27.364  1.00 177.11 ? 237 GLN A CG    1 
ATOM   1796 C CD    . GLN A 1 227 ? 61.247  -7.267  28.684  1.00 179.07 ? 237 GLN A CD    1 
ATOM   1797 O OE1   . GLN A 1 227 ? 61.105  -8.109  29.573  1.00 177.60 ? 237 GLN A OE1   1 
ATOM   1798 N NE2   . GLN A 1 227 ? 60.845  -6.010  28.822  1.00 182.65 ? 237 GLN A NE2   1 
ATOM   1799 N N     . TYR A 1 228 ? 60.493  -10.584 25.845  1.00 152.70 ? 238 TYR A N     1 
ATOM   1800 C CA    . TYR A 1 228 ? 59.074  -10.868 25.639  1.00 150.96 ? 238 TYR A CA    1 
ATOM   1801 C C     . TYR A 1 228 ? 58.494  -11.782 26.725  1.00 149.47 ? 238 TYR A C     1 
ATOM   1802 O O     . TYR A 1 228 ? 57.389  -11.553 27.219  1.00 150.06 ? 238 TYR A O     1 
ATOM   1803 C CB    . TYR A 1 228 ? 58.920  -11.539 24.261  1.00 158.00 ? 238 TYR A CB    1 
ATOM   1804 C CG    . TYR A 1 228 ? 57.667  -11.229 23.476  1.00 157.54 ? 238 TYR A CG    1 
ATOM   1805 C CD1   . TYR A 1 228 ? 56.411  -11.329 24.055  1.00 157.24 ? 238 TYR A CD1   1 
ATOM   1806 C CD2   . TYR A 1 228 ? 57.749  -10.857 22.140  1.00 157.57 ? 238 TYR A CD2   1 
ATOM   1807 C CE1   . TYR A 1 228 ? 55.270  -11.055 23.329  1.00 156.95 ? 238 TYR A CE1   1 
ATOM   1808 C CE2   . TYR A 1 228 ? 56.618  -10.579 21.408  1.00 157.30 ? 238 TYR A CE2   1 
ATOM   1809 C CZ    . TYR A 1 228 ? 55.379  -10.679 22.007  1.00 156.96 ? 238 TYR A CZ    1 
ATOM   1810 O OH    . TYR A 1 228 ? 54.247  -10.401 21.278  1.00 156.83 ? 238 TYR A OH    1 
ATOM   1811 N N     . LEU A 1 229 ? 59.271  -12.787 27.125  1.00 154.89 ? 239 LEU A N     1 
ATOM   1812 C CA    . LEU A 1 229 ? 58.809  -13.804 28.065  1.00 153.36 ? 239 LEU A CA    1 
ATOM   1813 C C     . LEU A 1 229 ? 59.789  -14.036 29.217  1.00 154.57 ? 239 LEU A C     1 
ATOM   1814 O O     . LEU A 1 229 ? 60.914  -13.537 29.200  1.00 156.25 ? 239 LEU A O     1 
ATOM   1815 C CB    . LEU A 1 229 ? 58.545  -15.119 27.327  1.00 142.07 ? 239 LEU A CB    1 
ATOM   1816 C CG    . LEU A 1 229 ? 59.620  -15.665 26.381  1.00 140.42 ? 239 LEU A CG    1 
ATOM   1817 C CD1   . LEU A 1 229 ? 60.726  -16.352 27.139  1.00 140.22 ? 239 LEU A CD1   1 
ATOM   1818 C CD2   . LEU A 1 229 ? 59.002  -16.626 25.389  1.00 137.35 ? 239 LEU A CD2   1 
ATOM   1819 N N     . ASN A 1 230 ? 59.337  -14.795 30.214  1.00 163.71 ? 240 ASN A N     1 
ATOM   1820 C CA    . ASN A 1 230 ? 60.110  -15.101 31.419  1.00 164.94 ? 240 ASN A CA    1 
ATOM   1821 C C     . ASN A 1 230 ? 61.248  -16.102 31.176  1.00 162.98 ? 240 ASN A C     1 
ATOM   1822 O O     . ASN A 1 230 ? 61.269  -16.778 30.152  1.00 160.29 ? 240 ASN A O     1 
ATOM   1823 C CB    . ASN A 1 230 ? 59.167  -15.638 32.499  1.00 152.31 ? 240 ASN A CB    1 
ATOM   1824 C CG    . ASN A 1 230 ? 58.441  -16.893 32.062  1.00 148.94 ? 240 ASN A CG    1 
ATOM   1825 O OD1   . ASN A 1 230 ? 59.060  -17.926 31.808  1.00 146.77 ? 240 ASN A OD1   1 
ATOM   1826 N ND2   . ASN A 1 230 ? 57.119  -16.812 31.979  1.00 148.71 ? 240 ASN A ND2   1 
ATOM   1827 N N     . PRO A 1 231 ? 62.196  -16.209 32.123  1.00 155.19 ? 241 PRO A N     1 
ATOM   1828 C CA    . PRO A 1 231 ? 63.318  -17.139 31.944  1.00 153.59 ? 241 PRO A CA    1 
ATOM   1829 C C     . PRO A 1 231 ? 62.951  -18.620 31.988  1.00 150.51 ? 241 PRO A C     1 
ATOM   1830 O O     . PRO A 1 231 ? 63.716  -19.427 31.459  1.00 148.66 ? 241 PRO A O     1 
ATOM   1831 C CB    . PRO A 1 231 ? 64.239  -16.799 33.114  1.00 148.48 ? 241 PRO A CB    1 
ATOM   1832 C CG    . PRO A 1 231 ? 63.336  -16.212 34.124  1.00 150.72 ? 241 PRO A CG    1 
ATOM   1833 C CD    . PRO A 1 231 ? 62.365  -15.403 33.340  1.00 150.76 ? 241 PRO A CD    1 
ATOM   1834 N N     . SER A 1 232 ? 61.831  -18.973 32.614  1.00 146.80 ? 242 SER A N     1 
ATOM   1835 C CA    . SER A 1 232 ? 61.412  -20.374 32.681  1.00 144.24 ? 242 SER A CA    1 
ATOM   1836 C C     . SER A 1 232 ? 61.267  -20.967 31.281  1.00 141.28 ? 242 SER A C     1 
ATOM   1837 O O     . SER A 1 232 ? 61.714  -22.084 31.020  1.00 139.30 ? 242 SER A O     1 
ATOM   1838 C CB    . SER A 1 232 ? 60.099  -20.514 33.456  1.00 215.26 ? 242 SER A CB    1 
ATOM   1839 O OG    . SER A 1 232 ? 60.244  -20.068 34.795  1.00 218.13 ? 242 SER A OG    1 
ATOM   1840 N N     . VAL A 1 233 ? 60.659  -20.203 30.379  1.00 136.61 ? 243 VAL A N     1 
ATOM   1841 C CA    . VAL A 1 233 ? 60.499  -20.629 28.999  1.00 134.22 ? 243 VAL A CA    1 
ATOM   1842 C C     . VAL A 1 233 ? 61.845  -20.645 28.293  1.00 133.88 ? 243 VAL A C     1 
ATOM   1843 O O     . VAL A 1 233 ? 62.110  -21.521 27.477  1.00 131.71 ? 243 VAL A O     1 
ATOM   1844 C CB    . VAL A 1 233 ? 59.529  -19.720 28.238  1.00 134.62 ? 243 VAL A CB    1 
ATOM   1845 C CG1   . VAL A 1 233 ? 59.369  -20.193 26.816  1.00 132.34 ? 243 VAL A CG1   1 
ATOM   1846 C CG2   . VAL A 1 233 ? 58.188  -19.711 28.921  1.00 135.10 ? 243 VAL A CG2   1 
ATOM   1847 N N     . ILE A 1 234 ? 62.702  -19.685 28.616  1.00 136.27 ? 244 ILE A N     1 
ATOM   1848 C CA    . ILE A 1 234 ? 64.019  -19.616 27.991  1.00 136.43 ? 244 ILE A CA    1 
ATOM   1849 C C     . ILE A 1 234 ? 64.881  -20.817 28.377  1.00 135.16 ? 244 ILE A C     1 
ATOM   1850 O O     . ILE A 1 234 ? 65.580  -21.387 27.533  1.00 133.75 ? 244 ILE A O     1 
ATOM   1851 C CB    . ILE A 1 234 ? 64.750  -18.312 28.361  1.00 139.76 ? 244 ILE A CB    1 
ATOM   1852 C CG1   . ILE A 1 234 ? 63.958  -17.110 27.856  1.00 141.16 ? 244 ILE A CG1   1 
ATOM   1853 C CG2   . ILE A 1 234 ? 66.149  -18.284 27.763  1.00 140.19 ? 244 ILE A CG2   1 
ATOM   1854 C CD1   . ILE A 1 234 ? 64.558  -15.773 28.213  1.00 144.81 ? 244 ILE A CD1   1 
ATOM   1855 N N     . SER A 1 235 ? 64.821  -21.203 29.648  1.00 156.65 ? 245 SER A N     1 
ATOM   1856 C CA    . SER A 1 235 ? 65.560  -22.365 30.133  1.00 155.66 ? 245 SER A CA    1 
ATOM   1857 C C     . SER A 1 235 ? 65.030  -23.635 29.480  1.00 152.64 ? 245 SER A C     1 
ATOM   1858 O O     . SER A 1 235 ? 65.787  -24.568 29.215  1.00 151.36 ? 245 SER A O     1 
ATOM   1859 C CB    . SER A 1 235 ? 65.470  -22.477 31.654  1.00 170.39 ? 245 SER A CB    1 
ATOM   1860 O OG    . SER A 1 235 ? 64.131  -22.677 32.067  1.00 169.95 ? 245 SER A OG    1 
ATOM   1861 N N     . LEU A 1 236 ? 63.726  -23.662 29.224  1.00 130.91 ? 246 LEU A N     1 
ATOM   1862 C CA    . LEU A 1 236 ? 63.102  -24.769 28.508  1.00 128.36 ? 246 LEU A CA    1 
ATOM   1863 C C     . LEU A 1 236 ? 63.576  -24.817 27.053  1.00 127.04 ? 246 LEU A C     1 
ATOM   1864 O O     . LEU A 1 236 ? 64.073  -25.842 26.574  1.00 125.48 ? 246 LEU A O     1 
ATOM   1865 C CB    . LEU A 1 236 ? 61.578  -24.646 28.571  1.00 128.13 ? 246 LEU A CB    1 
ATOM   1866 C CG    . LEU A 1 236 ? 60.752  -25.655 27.772  1.00 125.87 ? 246 LEU A CG    1 
ATOM   1867 C CD1   . LEU A 1 236 ? 60.993  -27.068 28.257  1.00 124.83 ? 246 LEU A CD1   1 
ATOM   1868 C CD2   . LEU A 1 236 ? 59.274  -25.320 27.837  1.00 126.14 ? 246 LEU A CD2   1 
ATOM   1869 N N     . LEU A 1 237 ? 63.428  -23.693 26.361  1.00 127.92 ? 247 LEU A N     1 
ATOM   1870 C CA    . LEU A 1 237 ? 63.798  -23.600 24.959  1.00 127.08 ? 247 LEU A CA    1 
ATOM   1871 C C     . LEU A 1 237 ? 65.275  -23.908 24.763  1.00 127.24 ? 247 LEU A C     1 
ATOM   1872 O O     . LEU A 1 237 ? 65.636  -24.607 23.825  1.00 125.81 ? 247 LEU A O     1 
ATOM   1873 C CB    . LEU A 1 237 ? 63.456  -22.216 24.400  1.00 128.60 ? 247 LEU A CB    1 
ATOM   1874 C CG    . LEU A 1 237 ? 61.972  -21.952 24.120  1.00 128.15 ? 247 LEU A CG    1 
ATOM   1875 C CD1   . LEU A 1 237 ? 61.704  -20.479 23.933  1.00 130.28 ? 247 LEU A CD1   1 
ATOM   1876 C CD2   . LEU A 1 237 ? 61.510  -22.709 22.897  1.00 126.04 ? 247 LEU A CD2   1 
ATOM   1877 N N     . LYS A 1 238 ? 66.128  -23.409 25.651  1.00 129.16 ? 248 LYS A N     1 
ATOM   1878 C CA    . LYS A 1 238 ? 67.560  -23.669 25.541  1.00 129.61 ? 248 LYS A CA    1 
ATOM   1879 C C     . LYS A 1 238 ? 67.887  -25.144 25.734  1.00 127.78 ? 248 LYS A C     1 
ATOM   1880 O O     . LYS A 1 238 ? 68.717  -25.703 25.021  1.00 127.04 ? 248 LYS A O     1 
ATOM   1881 C CB    . LYS A 1 238 ? 68.340  -22.833 26.546  1.00 132.34 ? 248 LYS A CB    1 
ATOM   1882 C CG    . LYS A 1 238 ? 68.699  -21.453 26.043  1.00 134.61 ? 248 LYS A CG    1 
ATOM   1883 C CD    . LYS A 1 238 ? 69.469  -20.676 27.096  1.00 137.61 ? 248 LYS A CD    1 
ATOM   1884 C CE    . LYS A 1 238 ? 70.189  -19.475 26.494  1.00 140.15 ? 248 LYS A CE    1 
ATOM   1885 N NZ    . LYS A 1 238 ? 69.267  -18.521 25.810  1.00 140.66 ? 248 LYS A NZ    1 
ATOM   1886 N N     . HIS A 1 239 ? 67.233  -25.772 26.702  1.00 127.26 ? 249 HIS A N     1 
ATOM   1887 C CA    . HIS A 1 239 ? 67.442  -27.192 26.970  1.00 125.78 ? 249 HIS A CA    1 
ATOM   1888 C C     . HIS A 1 239 ? 66.812  -28.054 25.872  1.00 123.51 ? 249 HIS A C     1 
ATOM   1889 O O     . HIS A 1 239 ? 67.294  -29.148 25.577  1.00 122.35 ? 249 HIS A O     1 
ATOM   1890 C CB    . HIS A 1 239 ? 66.869  -27.558 28.348  1.00 135.95 ? 249 HIS A CB    1 
ATOM   1891 C CG    . HIS A 1 239 ? 67.034  -28.999 28.727  1.00 134.79 ? 249 HIS A CG    1 
ATOM   1892 N ND1   . HIS A 1 239 ? 68.069  -29.786 28.264  1.00 134.03 ? 249 HIS A ND1   1 
ATOM   1893 C CD2   . HIS A 1 239 ? 66.294  -29.795 29.536  1.00 134.50 ? 249 HIS A CD2   1 
ATOM   1894 C CE1   . HIS A 1 239 ? 67.956  -31.001 28.768  1.00 133.30 ? 249 HIS A CE1   1 
ATOM   1895 N NE2   . HIS A 1 239 ? 66.886  -31.034 29.543  1.00 133.61 ? 249 HIS A NE2   1 
ATOM   1896 N N     . MET A 1 240 ? 65.736  -27.553 25.273  1.00 123.10 ? 250 MET A N     1 
ATOM   1897 C CA    . MET A 1 240 ? 65.035  -28.275 24.214  1.00 121.26 ? 250 MET A CA    1 
ATOM   1898 C C     . MET A 1 240 ? 65.732  -28.133 22.852  1.00 120.91 ? 250 MET A C     1 
ATOM   1899 O O     . MET A 1 240 ? 65.735  -29.061 22.040  1.00 119.55 ? 250 MET A O     1 
ATOM   1900 C CB    . MET A 1 240 ? 63.591  -27.785 24.117  1.00 121.18 ? 250 MET A CB    1 
ATOM   1901 C CG    . MET A 1 240 ? 62.621  -28.844 23.673  1.00 119.57 ? 250 MET A CG    1 
ATOM   1902 S SD    . MET A 1 240 ? 61.020  -28.162 23.223  1.00 119.60 ? 250 MET A SD    1 
ATOM   1903 C CE    . MET A 1 240 ? 60.587  -27.232 24.679  1.00 121.42 ? 250 MET A CE    1 
ATOM   1904 N N     . LEU A 1 241 ? 66.300  -26.954 22.615  1.00 122.42 ? 251 LEU A N     1 
ATOM   1905 C CA    . LEU A 1 241 ? 67.010  -26.617 21.377  1.00 122.67 ? 251 LEU A CA    1 
ATOM   1906 C C     . LEU A 1 241 ? 68.525  -26.823 21.468  1.00 123.45 ? 251 LEU A C     1 
ATOM   1907 O O     . LEU A 1 241 ? 69.267  -26.271 20.661  1.00 124.44 ? 251 LEU A O     1 
ATOM   1908 C CB    . LEU A 1 241 ? 66.701  -25.180 20.951  1.00 124.20 ? 251 LEU A CB    1 
ATOM   1909 C CG    . LEU A 1 241 ? 65.244  -24.935 20.550  1.00 123.51 ? 251 LEU A CG    1 
ATOM   1910 C CD1   . LEU A 1 241 ? 65.001  -23.467 20.282  1.00 125.35 ? 251 LEU A CD1   1 
ATOM   1911 C CD2   . LEU A 1 241 ? 64.856  -25.763 19.340  1.00 121.84 ? 251 LEU A CD2   1 
ATOM   1912 N N     . GLN A 1 242 ? 68.986  -27.507 22.512  1.00 123.38 ? 252 GLN A N     1 
ATOM   1913 C CA    . GLN A 1 242 ? 70.414  -27.787 22.695  1.00 124.19 ? 252 GLN A CA    1 
ATOM   1914 C C     . GLN A 1 242 ? 71.054  -28.438 21.462  1.00 123.39 ? 252 GLN A C     1 
ATOM   1915 O O     . GLN A 1 242 ? 70.545  -29.430 20.938  1.00 121.66 ? 252 GLN A O     1 
ATOM   1916 C CB    . GLN A 1 242 ? 70.616  -28.687 23.918  1.00 157.79 ? 252 GLN A CB    1 
ATOM   1917 C CG    . GLN A 1 242 ? 71.986  -28.582 24.564  1.00 159.41 ? 252 GLN A CG    1 
ATOM   1918 C CD    . GLN A 1 242 ? 72.110  -27.360 25.447  1.00 161.67 ? 252 GLN A CD    1 
ATOM   1919 O OE1   . GLN A 1 242 ? 72.126  -26.235 24.970  1.00 162.95 ? 252 GLN A OE1   1 
ATOM   1920 N NE2   . GLN A 1 242 ? 72.183  -27.579 26.742  1.00 162.41 ? 252 GLN A NE2   1 
ATOM   1921 N N     . VAL A 1 243 ? 72.174  -27.879 21.009  1.00 124.91 ? 253 VAL A N     1 
ATOM   1922 C CA    . VAL A 1 243 ? 72.837  -28.360 19.798  1.00 124.60 ? 253 VAL A CA    1 
ATOM   1923 C C     . VAL A 1 243 ? 73.313  -29.802 19.923  1.00 123.35 ? 253 VAL A C     1 
ATOM   1924 O O     . VAL A 1 243 ? 73.292  -30.558 18.956  1.00 122.33 ? 253 VAL A O     1 
ATOM   1925 C CB    . VAL A 1 243 ? 74.045  -27.480 19.419  1.00 126.91 ? 253 VAL A CB    1 
ATOM   1926 C CG1   . VAL A 1 243 ? 73.576  -26.137 18.952  1.00 128.25 ? 253 VAL A CG1   1 
ATOM   1927 C CG2   . VAL A 1 243 ? 75.000  -27.326 20.595  1.00 128.43 ? 253 VAL A CG2   1 
ATOM   1928 N N     . ASP A 1 244 ? 73.752  -30.175 21.117  1.00 123.65 ? 254 ASP A N     1 
ATOM   1929 C CA    . ASP A 1 244 ? 74.205  -31.532 21.375  1.00 122.72 ? 254 ASP A CA    1 
ATOM   1930 C C     . ASP A 1 244 ? 72.984  -32.406 21.611  1.00 120.88 ? 254 ASP A C     1 
ATOM   1931 O O     . ASP A 1 244 ? 72.186  -32.122 22.495  1.00 120.84 ? 254 ASP A O     1 
ATOM   1932 C CB    . ASP A 1 244 ? 75.146  -31.554 22.582  1.00 142.94 ? 254 ASP A CB    1 
ATOM   1933 C CG    . ASP A 1 244 ? 75.959  -32.828 22.673  1.00 142.53 ? 254 ASP A CG    1 
ATOM   1934 O OD1   . ASP A 1 244 ? 75.364  -33.924 22.648  1.00 140.97 ? 254 ASP A OD1   1 
ATOM   1935 O OD2   . ASP A 1 244 ? 77.202  -32.728 22.772  1.00 143.96 ? 254 ASP A OD2   1 
ATOM   1936 N N     . PRO A 1 245 ? 72.825  -33.469 20.819  1.00 119.62 ? 255 PRO A N     1 
ATOM   1937 C CA    . PRO A 1 245 ? 71.652  -34.340 20.950  1.00 118.15 ? 255 PRO A CA    1 
ATOM   1938 C C     . PRO A 1 245 ? 71.643  -35.122 22.266  1.00 118.10 ? 255 PRO A C     1 
ATOM   1939 O O     . PRO A 1 245 ? 70.582  -35.518 22.752  1.00 117.44 ? 255 PRO A O     1 
ATOM   1940 C CB    . PRO A 1 245 ? 71.785  -35.280 19.754  1.00 117.37 ? 255 PRO A CB    1 
ATOM   1941 C CG    . PRO A 1 245 ? 73.254  -35.336 19.506  1.00 118.36 ? 255 PRO A CG    1 
ATOM   1942 C CD    . PRO A 1 245 ? 73.774  -33.964 19.811  1.00 119.78 ? 255 PRO A CD    1 
ATOM   1943 N N     . MET A 1 246 ? 72.821  -35.340 22.838  1.00 119.02 ? 256 MET A N     1 
ATOM   1944 C CA    . MET A 1 246 ? 72.924  -36.051 24.102  1.00 119.29 ? 256 MET A CA    1 
ATOM   1945 C C     . MET A 1 246 ? 72.481  -35.156 25.250  1.00 120.20 ? 256 MET A C     1 
ATOM   1946 O O     . MET A 1 246 ? 71.968  -35.641 26.252  1.00 120.25 ? 256 MET A O     1 
ATOM   1947 C CB    . MET A 1 246 ? 74.352  -36.547 24.333  1.00 131.83 ? 256 MET A CB    1 
ATOM   1948 C CG    . MET A 1 246 ? 74.880  -37.437 23.222  1.00 131.23 ? 256 MET A CG    1 
ATOM   1949 S SD    . MET A 1 246 ? 73.853  -38.899 22.991  1.00 129.79 ? 256 MET A SD    1 
ATOM   1950 C CE    . MET A 1 246 ? 74.259  -39.834 24.461  1.00 130.51 ? 256 MET A CE    1 
ATOM   1951 N N     . LYS A 1 247 ? 72.675  -33.849 25.100  1.00 121.15 ? 257 LYS A N     1 
ATOM   1952 C CA    . LYS A 1 247 ? 72.259  -32.891 26.119  1.00 122.31 ? 257 LYS A CA    1 
ATOM   1953 C C     . LYS A 1 247 ? 70.841  -32.373 25.893  1.00 121.61 ? 257 LYS A C     1 
ATOM   1954 O O     . LYS A 1 247 ? 70.336  -31.572 26.674  1.00 122.58 ? 257 LYS A O     1 
ATOM   1955 C CB    . LYS A 1 247 ? 73.219  -31.703 26.171  1.00 133.40 ? 257 LYS A CB    1 
ATOM   1956 C CG    . LYS A 1 247 ? 74.590  -32.004 26.751  1.00 134.71 ? 257 LYS A CG    1 
ATOM   1957 C CD    . LYS A 1 247 ? 75.157  -30.769 27.449  1.00 137.11 ? 257 LYS A CD    1 
ATOM   1958 C CE    . LYS A 1 247 ? 76.673  -30.825 27.557  1.00 138.67 ? 257 LYS A CE    1 
ATOM   1959 N NZ    . LYS A 1 247 ? 77.311  -30.755 26.210  1.00 138.44 ? 257 LYS A NZ    1 
ATOM   1960 N N     . ARG A 1 248 ? 70.201  -32.825 24.824  1.00 120.11 ? 258 ARG A N     1 
ATOM   1961 C CA    . ARG A 1 248 ? 68.884  -32.316 24.465  1.00 119.53 ? 258 ARG A CA    1 
ATOM   1962 C C     . ARG A 1 248 ? 67.826  -32.836 25.413  1.00 119.26 ? 258 ARG A C     1 
ATOM   1963 O O     . ARG A 1 248 ? 68.005  -33.878 26.030  1.00 119.09 ? 258 ARG A O     1 
ATOM   1964 C CB    . ARG A 1 248 ? 68.535  -32.709 23.030  1.00 118.24 ? 258 ARG A CB    1 
ATOM   1965 C CG    . ARG A 1 248 ? 67.315  -31.999 22.436  1.00 117.89 ? 258 ARG A CG    1 
ATOM   1966 C CD    . ARG A 1 248 ? 67.234  -32.200 20.934  1.00 117.09 ? 258 ARG A CD    1 
ATOM   1967 N NE    . ARG A 1 248 ? 68.405  -31.652 20.268  1.00 117.91 ? 258 ARG A NE    1 
ATOM   1968 C CZ    . ARG A 1 248 ? 68.798  -32.004 19.054  1.00 117.58 ? 258 ARG A CZ    1 
ATOM   1969 N NH1   . ARG A 1 248 ? 68.112  -32.910 18.369  1.00 116.43 ? 258 ARG A NH1   1 
ATOM   1970 N NH2   . ARG A 1 248 ? 69.879  -31.453 18.529  1.00 118.65 ? 258 ARG A NH2   1 
ATOM   1971 N N     . ALA A 1 249 ? 66.721  -32.109 25.518  1.00 122.53 ? 259 ALA A N     1 
ATOM   1972 C CA    . ALA A 1 249 ? 65.613  -32.501 26.373  1.00 122.52 ? 259 ALA A CA    1 
ATOM   1973 C C     . ALA A 1 249 ? 64.865  -33.704 25.803  1.00 121.14 ? 259 ALA A C     1 
ATOM   1974 O O     . ALA A 1 249 ? 64.723  -33.829 24.584  1.00 120.18 ? 259 ALA A O     1 
ATOM   1975 C CB    . ALA A 1 249 ? 64.665  -31.330 26.563  1.00 120.13 ? 259 ALA A CB    1 
ATOM   1976 N N     . SER A 1 250 ? 64.393  -34.587 26.686  1.00 118.20 ? 260 SER A N     1 
ATOM   1977 C CA    . SER A 1 250 ? 63.532  -35.697 26.281  1.00 117.35 ? 260 SER A CA    1 
ATOM   1978 C C     . SER A 1 250 ? 62.082  -35.299 26.458  1.00 117.58 ? 260 SER A C     1 
ATOM   1979 O O     . SER A 1 250 ? 61.799  -34.259 27.053  1.00 118.48 ? 260 SER A O     1 
ATOM   1980 C CB    . SER A 1 250 ? 63.823  -36.949 27.105  1.00 120.47 ? 260 SER A CB    1 
ATOM   1981 O OG    . SER A 1 250 ? 65.179  -37.322 26.984  1.00 120.39 ? 260 SER A OG    1 
ATOM   1982 N N     . ILE A 1 251 ? 61.165  -36.150 26.002  1.00 141.59 ? 261 ILE A N     1 
ATOM   1983 C CA    . ILE A 1 251 ? 59.739  -35.860 26.121  1.00 141.94 ? 261 ILE A CA    1 
ATOM   1984 C C     . ILE A 1 251 ? 59.401  -35.774 27.603  1.00 143.35 ? 261 ILE A C     1 
ATOM   1985 O O     . ILE A 1 251 ? 58.540  -35.001 28.028  1.00 144.14 ? 261 ILE A O     1 
ATOM   1986 C CB    . ILE A 1 251 ? 58.842  -36.935 25.443  1.00 116.93 ? 261 ILE A CB    1 
ATOM   1987 C CG1   . ILE A 1 251 ? 59.636  -37.805 24.461  1.00 115.99 ? 261 ILE A CG1   1 
ATOM   1988 C CG2   . ILE A 1 251 ? 57.648  -36.284 24.756  1.00 116.81 ? 261 ILE A CG2   1 
ATOM   1989 C CD1   . ILE A 1 251 ? 58.839  -38.989 23.901  1.00 115.93 ? 261 ILE A CD1   1 
ATOM   1990 N N     . LYS A 1 252 ? 60.112  -36.574 28.386  1.00 145.98 ? 262 LYS A N     1 
ATOM   1991 C CA    . LYS A 1 252 ? 59.921  -36.615 29.822  1.00 147.56 ? 262 LYS A CA    1 
ATOM   1992 C C     . LYS A 1 252 ? 60.428  -35.331 30.464  1.00 148.47 ? 262 LYS A C     1 
ATOM   1993 O O     . LYS A 1 252 ? 59.775  -34.773 31.343  1.00 149.83 ? 262 LYS A O     1 
ATOM   1994 C CB    . LYS A 1 252 ? 60.635  -37.832 30.409  1.00 177.92 ? 262 LYS A CB    1 
ATOM   1995 C CG    . LYS A 1 252 ? 60.410  -38.036 31.893  1.00 179.80 ? 262 LYS A CG    1 
ATOM   1996 C CD    . LYS A 1 252 ? 61.191  -39.235 32.408  1.00 180.29 ? 262 LYS A CD    1 
ATOM   1997 C CE    . LYS A 1 252 ? 60.729  -40.529 31.748  1.00 179.73 ? 262 LYS A CE    1 
ATOM   1998 N NZ    . LYS A 1 252 ? 61.483  -41.716 32.250  1.00 180.42 ? 262 LYS A NZ    1 
ATOM   1999 N N     . ASP A 1 253 ? 61.587  -34.861 30.009  1.00 121.27 ? 263 ASP A N     1 
ATOM   2000 C CA    . ASP A 1 253 ? 62.210  -33.664 30.572  1.00 122.40 ? 263 ASP A CA    1 
ATOM   2001 C C     . ASP A 1 253 ? 61.313  -32.449 30.425  1.00 122.88 ? 263 ASP A C     1 
ATOM   2002 O O     . ASP A 1 253 ? 61.331  -31.546 31.264  1.00 124.46 ? 263 ASP A O     1 
ATOM   2003 C CB    . ASP A 1 253 ? 63.558  -33.389 29.904  1.00 132.14 ? 263 ASP A CB    1 
ATOM   2004 C CG    . ASP A 1 253 ? 64.634  -34.365 30.328  1.00 132.24 ? 263 ASP A CG    1 
ATOM   2005 O OD1   . ASP A 1 253 ? 64.883  -34.484 31.549  1.00 133.67 ? 263 ASP A OD1   1 
ATOM   2006 O OD2   . ASP A 1 253 ? 65.232  -35.008 29.437  1.00 131.05 ? 263 ASP A OD2   1 
ATOM   2007 N N     . ILE A 1 254 ? 60.538  -32.427 29.346  1.00 121.69 ? 264 ILE A N     1 
ATOM   2008 C CA    . ILE A 1 254 ? 59.616  -31.329 29.108  1.00 122.13 ? 264 ILE A CA    1 
ATOM   2009 C C     . ILE A 1 254 ? 58.405  -31.472 30.013  1.00 123.24 ? 264 ILE A C     1 
ATOM   2010 O O     . ILE A 1 254 ? 57.846  -30.479 30.473  1.00 124.50 ? 264 ILE A O     1 
ATOM   2011 C CB    . ILE A 1 254 ? 59.159  -31.267 27.651  1.00 120.69 ? 264 ILE A CB    1 
ATOM   2012 C CG1   . ILE A 1 254 ? 60.359  -31.398 26.718  1.00 119.67 ? 264 ILE A CG1   1 
ATOM   2013 C CG2   . ILE A 1 254 ? 58.431  -29.957 27.390  1.00 121.37 ? 264 ILE A CG2   1 
ATOM   2014 C CD1   . ILE A 1 254 ? 59.984  -31.849 25.334  1.00 118.25 ? 264 ILE A CD1   1 
ATOM   2015 N N     . ARG A 1 255 ? 58.010  -32.711 30.284  1.00 123.01 ? 265 ARG A N     1 
ATOM   2016 C CA    . ARG A 1 255 ? 56.899  -32.964 31.197  1.00 124.37 ? 265 ARG A CA    1 
ATOM   2017 C C     . ARG A 1 255 ? 57.250  -32.535 32.635  1.00 126.38 ? 265 ARG A C     1 
ATOM   2018 O O     . ARG A 1 255 ? 56.384  -32.100 33.402  1.00 127.98 ? 265 ARG A O     1 
ATOM   2019 C CB    . ARG A 1 255 ? 56.505  -34.446 31.154  1.00 170.43 ? 265 ARG A CB    1 
ATOM   2020 C CG    . ARG A 1 255 ? 55.191  -34.765 31.863  1.00 171.89 ? 265 ARG A CG    1 
ATOM   2021 C CD    . ARG A 1 255 ? 55.001  -36.263 32.091  1.00 172.15 ? 265 ARG A CD    1 
ATOM   2022 N NE    . ARG A 1 255 ? 54.862  -37.017 30.847  1.00 170.60 ? 265 ARG A NE    1 
ATOM   2023 C CZ    . ARG A 1 255 ? 54.583  -38.317 30.789  1.00 170.85 ? 265 ARG A CZ    1 
ATOM   2024 N NH1   . ARG A 1 255 ? 54.412  -39.013 31.906  1.00 172.56 ? 265 ARG A NH1   1 
ATOM   2025 N NH2   . ARG A 1 255 ? 54.474  -38.922 29.615  1.00 169.63 ? 265 ARG A NH2   1 
ATOM   2026 N N     . GLU A 1 256 ? 58.529  -32.645 32.985  1.00 149.81 ? 266 GLU A N     1 
ATOM   2027 C CA    . GLU A 1 256 ? 58.990  -32.322 34.330  1.00 151.86 ? 266 GLU A CA    1 
ATOM   2028 C C     . GLU A 1 256 ? 59.361  -30.849 34.489  1.00 152.94 ? 266 GLU A C     1 
ATOM   2029 O O     . GLU A 1 256 ? 59.683  -30.407 35.590  1.00 154.97 ? 266 GLU A O     1 
ATOM   2030 C CB    . GLU A 1 256 ? 60.190  -33.198 34.703  1.00 189.86 ? 266 GLU A CB    1 
ATOM   2031 C CG    . GLU A 1 256 ? 59.869  -34.309 35.692  1.00 191.01 ? 266 GLU A CG    1 
ATOM   2032 C CD    . GLU A 1 256 ? 58.926  -35.351 35.122  1.00 190.02 ? 266 GLU A CD    1 
ATOM   2033 O OE1   . GLU A 1 256 ? 59.229  -35.899 34.043  1.00 188.14 ? 266 GLU A OE1   1 
ATOM   2034 O OE2   . GLU A 1 256 ? 57.880  -35.622 35.751  1.00 191.34 ? 266 GLU A OE2   1 
ATOM   2035 N N     . HIS A 1 257 ? 59.320  -30.089 33.400  1.00 128.51 ? 267 HIS A N     1 
ATOM   2036 C CA    . HIS A 1 257 ? 59.648  -28.667 33.464  1.00 129.74 ? 267 HIS A CA    1 
ATOM   2037 C C     . HIS A 1 257 ? 58.504  -27.874 34.080  1.00 131.47 ? 267 HIS A C     1 
ATOM   2038 O O     . HIS A 1 257 ? 57.351  -28.287 34.000  1.00 131.14 ? 267 HIS A O     1 
ATOM   2039 C CB    . HIS A 1 257 ? 59.971  -28.125 32.078  1.00 131.81 ? 267 HIS A CB    1 
ATOM   2040 C CG    . HIS A 1 257 ? 60.480  -26.718 32.087  1.00 133.28 ? 267 HIS A CG    1 
ATOM   2041 N ND1   . HIS A 1 257 ? 59.643  -25.623 32.150  1.00 134.53 ? 267 HIS A ND1   1 
ATOM   2042 C CD2   . HIS A 1 257 ? 61.741  -26.228 32.040  1.00 133.93 ? 267 HIS A CD2   1 
ATOM   2043 C CE1   . HIS A 1 257 ? 60.368  -24.519 32.142  1.00 135.95 ? 267 HIS A CE1   1 
ATOM   2044 N NE2   . HIS A 1 257 ? 61.644  -24.857 32.074  1.00 135.65 ? 267 HIS A NE2   1 
ATOM   2045 N N     . GLU A 1 258 ? 58.827  -26.718 34.655  1.00 133.94 ? 268 GLU A N     1 
ATOM   2046 C CA    . GLU A 1 258 ? 57.872  -25.940 35.442  1.00 136.12 ? 268 GLU A CA    1 
ATOM   2047 C C     . GLU A 1 258 ? 56.817  -25.283 34.562  1.00 135.54 ? 268 GLU A C     1 
ATOM   2048 O O     . GLU A 1 258 ? 55.628  -25.558 34.716  1.00 135.70 ? 268 GLU A O     1 
ATOM   2049 C CB    . GLU A 1 258 ? 58.595  -24.876 36.277  1.00 197.26 ? 268 GLU A CB    1 
ATOM   2050 C CG    . GLU A 1 258 ? 57.665  -23.897 36.987  1.00 199.78 ? 268 GLU A CG    1 
ATOM   2051 C CD    . GLU A 1 258 ? 56.637  -24.591 37.858  1.00 200.64 ? 268 GLU A CD    1 
ATOM   2052 O OE1   . GLU A 1 258 ? 55.459  -24.182 37.813  1.00 201.27 ? 268 GLU A OE1   1 
ATOM   2053 O OE2   . GLU A 1 258 ? 57.007  -25.540 38.584  1.00 200.87 ? 268 GLU A OE2   1 
ATOM   2054 N N     . TRP A 1 259 ? 57.251  -24.405 33.659  1.00 137.09 ? 269 TRP A N     1 
ATOM   2055 C CA    . TRP A 1 259 ? 56.346  -23.679 32.760  1.00 136.71 ? 269 TRP A CA    1 
ATOM   2056 C C     . TRP A 1 259 ? 55.357  -24.588 32.025  1.00 134.71 ? 269 TRP A C     1 
ATOM   2057 O O     . TRP A 1 259 ? 54.217  -24.206 31.755  1.00 135.01 ? 269 TRP A O     1 
ATOM   2058 C CB    . TRP A 1 259 ? 57.157  -22.880 31.737  1.00 133.81 ? 269 TRP A CB    1 
ATOM   2059 C CG    . TRP A 1 259 ? 56.317  -22.051 30.801  1.00 133.70 ? 269 TRP A CG    1 
ATOM   2060 C CD1   . TRP A 1 259 ? 55.770  -20.821 31.051  1.00 135.83 ? 269 TRP A CD1   1 
ATOM   2061 C CD2   . TRP A 1 259 ? 55.943  -22.389 29.463  1.00 131.58 ? 269 TRP A CD2   1 
ATOM   2062 N NE1   . TRP A 1 259 ? 55.077  -20.377 29.952  1.00 135.10 ? 269 TRP A NE1   1 
ATOM   2063 C CE2   . TRP A 1 259 ? 55.167  -21.323 28.963  1.00 132.50 ? 269 TRP A CE2   1 
ATOM   2064 C CE3   . TRP A 1 259 ? 56.186  -23.490 28.640  1.00 129.17 ? 269 TRP A CE3   1 
ATOM   2065 C CZ2   . TRP A 1 259 ? 54.636  -21.326 27.682  1.00 131.11 ? 269 TRP A CZ2   1 
ATOM   2066 C CZ3   . TRP A 1 259 ? 55.658  -23.492 27.369  1.00 127.85 ? 269 TRP A CZ3   1 
ATOM   2067 C CH2   . TRP A 1 259 ? 54.890  -22.418 26.901  1.00 128.80 ? 269 TRP A CH2   1 
ATOM   2068 N N     . PHE A 1 260 ? 55.805  -25.795 31.712  1.00 130.45 ? 270 PHE A N     1 
ATOM   2069 C CA    . PHE A 1 260 ? 54.970  -26.765 31.029  1.00 128.77 ? 270 PHE A CA    1 
ATOM   2070 C C     . PHE A 1 260 ? 53.854  -27.305 31.919  1.00 129.87 ? 270 PHE A C     1 
ATOM   2071 O O     . PHE A 1 260 ? 52.745  -27.539 31.448  1.00 129.48 ? 270 PHE A O     1 
ATOM   2072 C CB    . PHE A 1 260 ? 55.832  -27.914 30.522  1.00 126.90 ? 270 PHE A CB    1 
ATOM   2073 C CG    . PHE A 1 260 ? 55.099  -28.883 29.650  1.00 125.28 ? 270 PHE A CG    1 
ATOM   2074 C CD1   . PHE A 1 260 ? 54.753  -28.543 28.358  1.00 124.15 ? 270 PHE A CD1   1 
ATOM   2075 C CD2   . PHE A 1 260 ? 54.769  -30.145 30.115  1.00 125.14 ? 270 PHE A CD2   1 
ATOM   2076 C CE1   . PHE A 1 260 ? 54.084  -29.438 27.550  1.00 122.91 ? 270 PHE A CE1   1 
ATOM   2077 C CE2   . PHE A 1 260 ? 54.104  -31.046 29.305  1.00 123.95 ? 270 PHE A CE2   1 
ATOM   2078 C CZ    . PHE A 1 260 ? 53.756  -30.690 28.027  1.00 122.85 ? 270 PHE A CZ    1 
ATOM   2079 N N     . LYS A 1 261 ? 54.149  -27.507 33.200  1.00 131.46 ? 271 LYS A N     1 
ATOM   2080 C CA    . LYS A 1 261 ? 53.167  -28.040 34.142  1.00 132.91 ? 271 LYS A CA    1 
ATOM   2081 C C     . LYS A 1 261 ? 51.948  -27.130 34.314  1.00 134.48 ? 271 LYS A C     1 
ATOM   2082 O O     . LYS A 1 261 ? 50.821  -27.614 34.452  1.00 134.96 ? 271 LYS A O     1 
ATOM   2083 C CB    . LYS A 1 261 ? 53.817  -28.275 35.509  1.00 148.54 ? 271 LYS A CB    1 
ATOM   2084 C CG    . LYS A 1 261 ? 54.815  -29.422 35.570  1.00 147.41 ? 271 LYS A CG    1 
ATOM   2085 C CD    . LYS A 1 261 ? 55.603  -29.371 36.878  1.00 149.42 ? 271 LYS A CD    1 
ATOM   2086 C CE    . LYS A 1 261 ? 56.658  -30.465 36.955  1.00 148.45 ? 271 LYS A CE    1 
ATOM   2087 N NZ    . LYS A 1 261 ? 57.574  -30.273 38.119  1.00 150.43 ? 271 LYS A NZ    1 
ATOM   2088 N N     . GLN A 1 262 ? 52.184  -25.819 34.303  1.00 135.48 ? 272 GLN A N     1 
ATOM   2089 C CA    . GLN A 1 262 ? 51.155  -24.835 34.632  1.00 137.46 ? 272 GLN A CA    1 
ATOM   2090 C C     . GLN A 1 262 ? 49.923  -24.994 33.761  1.00 136.54 ? 272 GLN A C     1 
ATOM   2091 O O     . GLN A 1 262 ? 50.023  -25.000 32.538  1.00 134.57 ? 272 GLN A O     1 
ATOM   2092 C CB    . GLN A 1 262 ? 51.698  -23.410 34.492  1.00 170.36 ? 272 GLN A CB    1 
ATOM   2093 C CG    . GLN A 1 262 ? 52.763  -23.025 35.505  1.00 172.13 ? 272 GLN A CG    1 
ATOM   2094 C CD    . GLN A 1 262 ? 53.083  -21.540 35.473  1.00 173.89 ? 272 GLN A CD    1 
ATOM   2095 O OE1   . GLN A 1 262 ? 52.184  -20.703 35.369  1.00 175.13 ? 272 GLN A OE1   1 
ATOM   2096 N NE2   . GLN A 1 262 ? 54.368  -21.207 35.555  1.00 174.20 ? 272 GLN A NE2   1 
ATOM   2097 N N     . ASP A 1 263 ? 48.769  -25.123 34.411  1.00 138.20 ? 273 ASP A N     1 
ATOM   2098 C CA    . ASP A 1 263 ? 47.480  -25.244 33.738  1.00 137.88 ? 273 ASP A CA    1 
ATOM   2099 C C     . ASP A 1 263 ? 47.508  -26.304 32.648  1.00 135.31 ? 273 ASP A C     1 
ATOM   2100 O O     . ASP A 1 263 ? 47.098  -26.053 31.520  1.00 134.13 ? 273 ASP A O     1 
ATOM   2101 C CB    . ASP A 1 263 ? 47.056  -23.895 33.154  1.00 152.68 ? 273 ASP A CB    1 
ATOM   2102 C CG    . ASP A 1 263 ? 47.071  -22.782 34.187  1.00 155.48 ? 273 ASP A CG    1 
ATOM   2103 O OD1   . ASP A 1 263 ? 46.834  -23.067 35.383  1.00 157.42 ? 273 ASP A OD1   1 
ATOM   2104 O OD2   . ASP A 1 263 ? 47.326  -21.621 33.803  1.00 155.96 ? 273 ASP A OD2   1 
ATOM   2105 N N     . LEU A 1 264 ? 47.999  -27.488 32.991  1.00 134.64 ? 274 LEU A N     1 
ATOM   2106 C CA    . LEU A 1 264 ? 48.082  -28.586 32.040  1.00 132.50 ? 274 LEU A CA    1 
ATOM   2107 C C     . LEU A 1 264 ? 47.023  -29.646 32.310  1.00 133.28 ? 274 LEU A C     1 
ATOM   2108 O O     . LEU A 1 264 ? 47.095  -30.329 33.327  1.00 134.52 ? 274 LEU A O     1 
ATOM   2109 C CB    . LEU A 1 264 ? 49.471  -29.220 32.093  1.00 131.20 ? 274 LEU A CB    1 
ATOM   2110 C CG    . LEU A 1 264 ? 49.728  -30.412 31.171  1.00 129.15 ? 274 LEU A CG    1 
ATOM   2111 C CD1   . LEU A 1 264 ? 51.066  -30.258 30.491  1.00 127.41 ? 274 LEU A CD1   1 
ATOM   2112 C CD2   . LEU A 1 264 ? 49.686  -31.726 31.930  1.00 129.78 ? 274 LEU A CD2   1 
ATOM   2113 N N     . PRO A 1 265 ? 46.033  -29.786 31.408  1.00 140.80 ? 275 PRO A N     1 
ATOM   2114 C CA    . PRO A 1 265 ? 45.021  -30.845 31.524  1.00 141.67 ? 275 PRO A CA    1 
ATOM   2115 C C     . PRO A 1 265 ? 45.643  -32.237 31.545  1.00 140.80 ? 275 PRO A C     1 
ATOM   2116 O O     . PRO A 1 265 ? 46.629  -32.480 30.850  1.00 138.79 ? 275 PRO A O     1 
ATOM   2117 C CB    . PRO A 1 265 ? 44.163  -30.649 30.276  1.00 132.91 ? 275 PRO A CB    1 
ATOM   2118 C CG    . PRO A 1 265 ? 44.300  -29.205 29.965  1.00 132.76 ? 275 PRO A CG    1 
ATOM   2119 C CD    . PRO A 1 265 ? 45.716  -28.848 30.321  1.00 131.99 ? 275 PRO A CD    1 
ATOM   2120 N N     . LYS A 1 266 ? 45.063  -33.136 32.336  1.00 182.80 ? 276 LYS A N     1 
ATOM   2121 C CA    . LYS A 1 266 ? 45.654  -34.447 32.578  1.00 182.53 ? 276 LYS A CA    1 
ATOM   2122 C C     . LYS A 1 266 ? 45.158  -35.496 31.588  1.00 181.80 ? 276 LYS A C     1 
ATOM   2123 O O     . LYS A 1 266 ? 45.413  -36.688 31.762  1.00 182.04 ? 276 LYS A O     1 
ATOM   2124 C CB    . LYS A 1 266 ? 45.381  -34.898 34.014  1.00 190.10 ? 276 LYS A CB    1 
ATOM   2125 C CG    . LYS A 1 266 ? 46.564  -35.607 34.668  1.00 189.92 ? 276 LYS A CG    1 
ATOM   2126 C CD    . LYS A 1 266 ? 46.468  -35.560 36.190  1.00 192.66 ? 276 LYS A CD    1 
ATOM   2127 C CE    . LYS A 1 266 ? 47.646  -36.262 36.856  1.00 192.66 ? 276 LYS A CE    1 
ATOM   2128 N NZ    . LYS A 1 266 ? 47.755  -37.692 36.445  1.00 192.14 ? 276 LYS A NZ    1 
ATOM   2129 N N     . TYR A 1 267 ? 44.418  -35.054 30.573  1.00 175.10 ? 277 TYR A N     1 
ATOM   2130 C CA    . TYR A 1 267 ? 43.932  -35.957 29.531  1.00 174.55 ? 277 TYR A CA    1 
ATOM   2131 C C     . TYR A 1 267 ? 44.953  -36.168 28.408  1.00 172.00 ? 277 TYR A C     1 
ATOM   2132 O O     . TYR A 1 267 ? 44.728  -36.969 27.500  1.00 171.51 ? 277 TYR A O     1 
ATOM   2133 C CB    . TYR A 1 267 ? 42.615  -35.435 28.946  1.00 160.08 ? 277 TYR A CB    1 
ATOM   2134 C CG    . TYR A 1 267 ? 42.764  -34.502 27.760  1.00 158.26 ? 277 TYR A CG    1 
ATOM   2135 C CD1   . TYR A 1 267 ? 43.302  -33.229 27.911  1.00 157.60 ? 277 TYR A CD1   1 
ATOM   2136 C CD2   . TYR A 1 267 ? 42.345  -34.884 26.490  1.00 157.51 ? 277 TYR A CD2   1 
ATOM   2137 C CE1   . TYR A 1 267 ? 43.432  -32.367 26.827  1.00 156.24 ? 277 TYR A CE1   1 
ATOM   2138 C CE2   . TYR A 1 267 ? 42.471  -34.025 25.399  1.00 156.09 ? 277 TYR A CE2   1 
ATOM   2139 C CZ    . TYR A 1 267 ? 43.017  -32.769 25.577  1.00 155.46 ? 277 TYR A CZ    1 
ATOM   2140 O OH    . TYR A 1 267 ? 43.147  -31.907 24.513  1.00 154.34 ? 277 TYR A OH    1 
ATOM   2141 N N     . LEU A 1 268 ? 46.074  -35.456 28.478  1.00 149.08 ? 278 LEU A N     1 
ATOM   2142 C CA    . LEU A 1 268 ? 47.117  -35.554 27.460  1.00 146.87 ? 278 LEU A CA    1 
ATOM   2143 C C     . LEU A 1 268 ? 47.916  -36.836 27.618  1.00 146.50 ? 278 LEU A C     1 
ATOM   2144 O O     . LEU A 1 268 ? 47.942  -37.679 26.723  1.00 145.80 ? 278 LEU A O     1 
ATOM   2145 C CB    . LEU A 1 268 ? 48.051  -34.351 27.526  1.00 125.32 ? 278 LEU A CB    1 
ATOM   2146 C CG    . LEU A 1 268 ? 47.391  -32.992 27.310  1.00 125.74 ? 278 LEU A CG    1 
ATOM   2147 C CD1   . LEU A 1 268 ? 48.415  -31.886 27.519  1.00 125.24 ? 278 LEU A CD1   1 
ATOM   2148 C CD2   . LEU A 1 268 ? 46.744  -32.900 25.929  1.00 124.97 ? 278 LEU A CD2   1 
ATOM   2149 N N     . PHE A 1 269 ? 48.589  -36.961 28.754  1.00 154.03 ? 279 PHE A N     1 
ATOM   2150 C CA    . PHE A 1 269 ? 49.348  -38.163 29.067  1.00 154.00 ? 279 PHE A CA    1 
ATOM   2151 C C     . PHE A 1 269 ? 48.499  -39.056 29.971  1.00 156.29 ? 279 PHE A C     1 
ATOM   2152 O O     . PHE A 1 269 ? 48.031  -38.614 31.018  1.00 157.96 ? 279 PHE A O     1 
ATOM   2153 C CB    . PHE A 1 269 ? 50.679  -37.800 29.729  1.00 138.74 ? 279 PHE A CB    1 
ATOM   2154 C CG    . PHE A 1 269 ? 51.397  -36.648 29.061  1.00 137.14 ? 279 PHE A CG    1 
ATOM   2155 C CD1   . PHE A 1 269 ? 51.441  -36.540 27.681  1.00 135.58 ? 279 PHE A CD1   1 
ATOM   2156 C CD2   . PHE A 1 269 ? 52.019  -35.667 29.818  1.00 137.49 ? 279 PHE A CD2   1 
ATOM   2157 C CE1   . PHE A 1 269 ? 52.094  -35.483 27.072  1.00 134.42 ? 279 PHE A CE1   1 
ATOM   2158 C CE2   . PHE A 1 269 ? 52.675  -34.607 29.207  1.00 136.37 ? 279 PHE A CE2   1 
ATOM   2159 C CZ    . PHE A 1 269 ? 52.709  -34.518 27.835  1.00 134.84 ? 279 PHE A CZ    1 
ATOM   2160 N N     . PRO A 1 270 ? 48.301  -40.319 29.571  1.00 188.32 ? 280 PRO A N     1 
ATOM   2161 C CA    . PRO A 1 270 ? 47.267  -41.181 30.159  1.00 190.77 ? 280 PRO A CA    1 
ATOM   2162 C C     . PRO A 1 270 ? 47.598  -41.733 31.549  1.00 192.59 ? 280 PRO A C     1 
ATOM   2163 O O     . PRO A 1 270 ? 48.111  -42.845 31.685  1.00 192.99 ? 280 PRO A O     1 
ATOM   2164 C CB    . PRO A 1 270 ? 47.149  -42.312 29.141  1.00 149.67 ? 280 PRO A CB    1 
ATOM   2165 C CG    . PRO A 1 270 ? 48.516  -42.416 28.562  1.00 147.47 ? 280 PRO A CG    1 
ATOM   2166 C CD    . PRO A 1 270 ? 49.085  -41.021 28.542  1.00 145.86 ? 280 PRO A CD    1 
ATOM   2167 N N     . GLU A 1 271 ? 47.317  -40.929 32.568  1.00 184.78 ? 281 GLU A N     1 
ATOM   2168 C CA    . GLU A 1 271 ? 47.332  -41.375 33.957  1.00 187.17 ? 281 GLU A CA    1 
ATOM   2169 C C     . GLU A 1 271 ? 45.919  -41.266 34.521  1.00 189.82 ? 281 GLU A C     1 
ATOM   2170 O O     . GLU A 1 271 ? 45.334  -42.252 34.970  1.00 192.11 ? 281 GLU A O     1 
ATOM   2171 C CB    . GLU A 1 271 ? 48.320  -40.562 34.795  1.00 144.37 ? 281 GLU A CB    1 
ATOM   2172 C CG    . GLU A 1 271 ? 49.750  -41.102 34.762  1.00 143.02 ? 281 GLU A CG    1 
ATOM   2173 C CD    . GLU A 1 271 ? 50.471  -40.808 33.450  1.00 140.05 ? 281 GLU A CD    1 
ATOM   2174 O OE1   . GLU A 1 271 ? 50.155  -39.776 32.823  1.00 138.94 ? 281 GLU A OE1   1 
ATOM   2175 O OE2   . GLU A 1 271 ? 51.354  -41.599 33.044  1.00 139.00 ? 281 GLU A OE2   1 
ATOM   2176 N N     . ASP A 1 272 ? 45.394  -40.045 34.514  1.00 203.74 ? 282 ASP A N     1 
ATOM   2177 C CA    . ASP A 1 272 ? 44.023  -39.767 34.935  1.00 206.16 ? 282 ASP A CA    1 
ATOM   2178 C C     . ASP A 1 272 ? 43.000  -40.089 33.828  1.00 206.02 ? 282 ASP A C     1 
ATOM   2179 O O     . ASP A 1 272 ? 43.391  -40.469 32.724  1.00 203.99 ? 282 ASP A O     1 
ATOM   2180 C CB    . ASP A 1 272 ? 43.927  -38.300 35.364  1.00 159.61 ? 282 ASP A CB    1 
ATOM   2181 C CG    . ASP A 1 272 ? 44.209  -38.111 36.840  1.00 161.79 ? 282 ASP A CG    1 
ATOM   2182 O OD1   . ASP A 1 272 ? 45.157  -38.746 37.350  1.00 161.76 ? 282 ASP A OD1   1 
ATOM   2183 O OD2   . ASP A 1 272 ? 43.481  -37.328 37.488  1.00 163.70 ? 282 ASP A OD2   1 
ATOM   2184 N N     . PRO A 1 273 ? 41.686  -39.943 34.115  1.00 220.63 ? 283 PRO A N     1 
ATOM   2185 C CA    . PRO A 1 273 ? 40.694  -40.244 33.071  1.00 220.76 ? 283 PRO A CA    1 
ATOM   2186 C C     . PRO A 1 273 ? 40.756  -39.336 31.842  1.00 218.13 ? 283 PRO A C     1 
ATOM   2187 O O     . PRO A 1 273 ? 41.557  -38.402 31.789  1.00 216.21 ? 283 PRO A O     1 
ATOM   2188 C CB    . PRO A 1 273 ? 39.352  -40.053 33.799  1.00 222.39 ? 283 PRO A CB    1 
ATOM   2189 C CG    . PRO A 1 273 ? 39.676  -39.258 35.026  1.00 223.33 ? 283 PRO A CG    1 
ATOM   2190 C CD    . PRO A 1 273 ? 41.029  -39.740 35.419  1.00 222.12 ? 283 PRO A CD    1 
ATOM   2191 N N     . SER A 1 274 ? 39.893  -39.620 30.868  1.00 326.99 ? 284 SER A N     1 
ATOM   2192 C CA    . SER A 1 274 ? 39.860  -38.887 29.605  1.00 324.82 ? 284 SER A CA    1 
ATOM   2193 C C     . SER A 1 274 ? 38.817  -37.768 29.636  1.00 325.84 ? 284 SER A C     1 
ATOM   2194 O O     . SER A 1 274 ? 37.748  -37.924 30.228  1.00 328.54 ? 284 SER A O     1 
ATOM   2195 C CB    . SER A 1 274 ? 39.576  -39.846 28.444  1.00 152.28 ? 284 SER A CB    1 
ATOM   2196 O OG    . SER A 1 274 ? 39.734  -39.202 27.191  1.00 150.09 ? 284 SER A OG    1 
ATOM   2197 N N     . TYR A 1 275 ? 39.137  -36.642 29.001  1.00 236.44 ? 285 TYR A N     1 
ATOM   2198 C CA    . TYR A 1 275 ? 38.249  -35.479 28.978  1.00 237.30 ? 285 TYR A CA    1 
ATOM   2199 C C     . TYR A 1 275 ? 37.595  -35.271 27.611  1.00 236.60 ? 285 TYR A C     1 
ATOM   2200 O O     . TYR A 1 275 ? 36.383  -35.436 27.463  1.00 238.54 ? 285 TYR A O     1 
ATOM   2201 C CB    . TYR A 1 275 ? 39.017  -34.217 29.384  1.00 241.46 ? 285 TYR A CB    1 
ATOM   2202 C CG    . TYR A 1 275 ? 38.690  -33.709 30.772  1.00 243.73 ? 285 TYR A CG    1 
ATOM   2203 C CD1   . TYR A 1 275 ? 37.371  -33.591 31.202  1.00 246.42 ? 285 TYR A CD1   1 
ATOM   2204 C CD2   . TYR A 1 275 ? 39.699  -33.350 31.656  1.00 243.43 ? 285 TYR A CD2   1 
ATOM   2205 C CE1   . TYR A 1 275 ? 37.067  -33.125 32.472  1.00 248.75 ? 285 TYR A CE1   1 
ATOM   2206 C CE2   . TYR A 1 275 ? 39.406  -32.886 32.928  1.00 245.76 ? 285 TYR A CE2   1 
ATOM   2207 C CZ    . TYR A 1 275 ? 38.089  -32.775 33.331  1.00 248.43 ? 285 TYR A CZ    1 
ATOM   2208 O OH    . TYR A 1 275 ? 37.794  -32.313 34.595  1.00 250.99 ? 285 TYR A OH    1 
ATOM   2209 N N     . SER A 1 276 ? 38.402  -34.904 26.618  1.00 275.47 ? 286 SER A N     1 
ATOM   2210 C CA    . SER A 1 276 ? 37.898  -34.625 25.273  1.00 274.77 ? 286 SER A CA    1 
ATOM   2211 C C     . SER A 1 276 ? 38.084  -35.812 24.332  1.00 274.10 ? 286 SER A C     1 
ATOM   2212 O O     . SER A 1 276 ? 37.799  -36.954 24.689  1.00 275.49 ? 286 SER A O     1 
ATOM   2213 C CB    . SER A 1 276 ? 38.591  -33.393 24.688  1.00 211.12 ? 286 SER A CB    1 
ATOM   2214 O OG    . SER A 1 276 ? 38.427  -32.266 25.530  1.00 211.97 ? 286 SER A OG    1 
ATOM   2215 N N     . ASP A 1 281 ? 40.600  -45.305 26.635  1.00 199.20 ? 291 ASP A N     1 
ATOM   2216 C CA    . ASP A 1 281 ? 41.486  -46.004 25.709  1.00 197.69 ? 291 ASP A CA    1 
ATOM   2217 C C     . ASP A 1 281 ? 42.926  -45.526 25.853  1.00 194.86 ? 291 ASP A C     1 
ATOM   2218 O O     . ASP A 1 281 ? 43.192  -44.325 25.818  1.00 193.01 ? 291 ASP A O     1 
ATOM   2219 C CB    . ASP A 1 281 ? 41.010  -45.812 24.267  1.00 20.00  ? 291 ASP A CB    1 
ATOM   2220 C CG    . ASP A 1 281 ? 41.840  -46.598 23.271  1.00 20.00  ? 291 ASP A CG    1 
ATOM   2221 O OD1   . ASP A 1 281 ? 42.773  -47.307 23.701  1.00 20.00  ? 291 ASP A OD1   1 
ATOM   2222 O OD2   . ASP A 1 281 ? 41.632  -46.569 22.040  1.00 20.00  ? 291 ASP A OD2   1 
ATOM   2223 N N     . ASP A 1 282 ? 43.847  -46.474 26.023  1.00 207.45 ? 292 ASP A N     1 
ATOM   2224 C CA    . ASP A 1 282 ? 45.275  -46.178 26.151  1.00 205.05 ? 292 ASP A CA    1 
ATOM   2225 C C     . ASP A 1 282 ? 46.116  -47.438 25.910  1.00 205.22 ? 292 ASP A C     1 
ATOM   2226 O O     . ASP A 1 282 ? 45.603  -48.451 25.438  1.00 206.94 ? 292 ASP A O     1 
ATOM   2227 C CB    . ASP A 1 282 ? 45.588  -45.578 27.523  1.00 249.78 ? 292 ASP A CB    1 
ATOM   2228 C CG    . ASP A 1 282 ? 45.294  -46.532 28.655  1.00 252.58 ? 292 ASP A CG    1 
ATOM   2229 O OD1   . ASP A 1 282 ? 44.147  -47.016 28.746  1.00 255.05 ? 292 ASP A OD1   1 
ATOM   2230 O OD2   . ASP A 1 282 ? 46.214  -46.794 29.456  1.00 252.49 ? 292 ASP A OD2   1 
ATOM   2231 N N     . GLU A 1 283 ? 47.410  -47.359 26.211  1.00 206.14 ? 293 GLU A N     1 
ATOM   2232 C CA    . GLU A 1 283 ? 48.323  -48.485 26.017  1.00 206.22 ? 293 GLU A CA    1 
ATOM   2233 C C     . GLU A 1 283 ? 47.944  -49.698 26.868  1.00 209.20 ? 293 GLU A C     1 
ATOM   2234 O O     . GLU A 1 283 ? 48.285  -50.831 26.528  1.00 210.13 ? 293 GLU A O     1 
ATOM   2235 C CB    . GLU A 1 283 ? 49.762  -48.070 26.334  1.00 221.17 ? 293 GLU A CB    1 
ATOM   2236 C CG    . GLU A 1 283 ? 50.815  -49.039 25.813  1.00 220.72 ? 293 GLU A CG    1 
ATOM   2237 C CD    . GLU A 1 283 ? 52.199  -48.755 26.362  1.00 219.27 ? 293 GLU A CD    1 
ATOM   2238 O OE1   . GLU A 1 283 ? 53.187  -49.025 25.644  1.00 217.98 ? 293 GLU A OE1   1 
ATOM   2239 O OE2   . GLU A 1 283 ? 52.298  -48.273 27.512  1.00 219.63 ? 293 GLU A OE2   1 
ATOM   2240 N N     . ALA A 1 284 ? 47.226  -49.459 27.964  1.00 291.29 ? 294 ALA A N     1 
ATOM   2241 C CA    . ALA A 1 284 ? 46.782  -50.531 28.856  1.00 294.52 ? 294 ALA A CA    1 
ATOM   2242 C C     . ALA A 1 284 ? 45.810  -51.471 28.153  1.00 296.79 ? 294 ALA A C     1 
ATOM   2243 O O     . ALA A 1 284 ? 45.446  -52.521 28.686  1.00 299.79 ? 294 ALA A O     1 
ATOM   2244 C CB    . ALA A 1 284 ? 46.145  -49.954 30.111  1.00 153.99 ? 294 ALA A CB    1 
ATOM   2245 N N     . LEU A 1 285 ? 45.383  -51.074 26.959  1.00 287.60 ? 295 LEU A N     1 
ATOM   2246 C CA    . LEU A 1 285 ? 44.534  -51.904 26.121  1.00 289.63 ? 295 LEU A CA    1 
ATOM   2247 C C     . LEU A 1 285 ? 45.215  -53.218 25.743  1.00 290.56 ? 295 LEU A C     1 
ATOM   2248 O O     . LEU A 1 285 ? 44.524  -54.190 25.426  1.00 293.34 ? 295 LEU A O     1 
ATOM   2249 C CB    . LEU A 1 285 ? 44.122  -51.139 24.857  1.00 203.64 ? 295 LEU A CB    1 
ATOM   2250 C CG    . LEU A 1 285 ? 43.315  -51.859 23.770  1.00 205.45 ? 295 LEU A CG    1 
ATOM   2251 C CD1   . LEU A 1 285 ? 42.000  -52.405 24.317  1.00 209.22 ? 295 LEU A CD1   1 
ATOM   2252 C CD2   . LEU A 1 285 ? 43.071  -50.932 22.587  1.00 203.42 ? 295 LEU A CD2   1 
ATOM   2253 N N     . LYS A 1 286 ? 46.546  -53.303 25.811  1.00 216.59 ? 296 LYS A N     1 
ATOM   2254 C CA    . LYS A 1 286 ? 47.110  -54.557 25.349  1.00 217.70 ? 296 LYS A CA    1 
ATOM   2255 C C     . LYS A 1 286 ? 47.318  -55.434 26.566  1.00 220.14 ? 296 LYS A C     1 
ATOM   2256 O O     . LYS A 1 286 ? 48.443  -55.667 27.009  1.00 219.25 ? 296 LYS A O     1 
ATOM   2257 C CB    . LYS A 1 286 ? 48.461  -54.304 24.647  1.00 160.85 ? 296 LYS A CB    1 
ATOM   2258 C CG    . LYS A 1 286 ? 48.542  -52.999 23.828  1.00 157.77 ? 296 LYS A CG    1 
ATOM   2259 C CD    . LYS A 1 286 ? 49.986  -52.507 23.633  1.00 154.83 ? 296 LYS A CD    1 
ATOM   2260 C CE    . LYS A 1 286 ? 50.043  -51.216 22.809  1.00 152.16 ? 296 LYS A CE    1 
ATOM   2261 N NZ    . LYS A 1 286 ? 51.425  -50.649 22.688  1.00 149.57 ? 296 LYS A NZ    1 
ATOM   2262 N N     . GLU A 1 287 ? 46.206  -55.992 27.038  1.00 245.90 ? 297 GLU A N     1 
ATOM   2263 C CA    . GLU A 1 287 ? 46.163  -57.112 27.963  1.00 249.30 ? 297 GLU A CA    1 
ATOM   2264 C C     . GLU A 1 287 ? 45.481  -58.326 27.335  1.00 252.64 ? 297 GLU A C     1 
ATOM   2265 O O     . GLU A 1 287 ? 45.334  -59.370 27.972  1.00 256.04 ? 297 GLU A O     1 
ATOM   2266 C CB    . GLU A 1 287 ? 45.460  -56.706 29.258  1.00 364.21 ? 297 GLU A CB    1 
ATOM   2267 C CG    . GLU A 1 287 ? 45.912  -57.499 30.474  1.00 366.59 ? 297 GLU A CG    1 
ATOM   2268 C CD    . GLU A 1 287 ? 44.750  -57.963 31.323  1.00 370.87 ? 297 GLU A CD    1 
ATOM   2269 O OE1   . GLU A 1 287 ? 44.991  -58.553 32.397  1.00 373.24 ? 297 GLU A OE1   1 
ATOM   2270 O OE2   . GLU A 1 287 ? 43.593  -57.740 30.910  1.00 372.04 ? 297 GLU A OE2   1 
ATOM   2271 N N     . VAL A 1 288 ? 45.003  -58.158 26.106  1.00 268.41 ? 298 VAL A N     1 
ATOM   2272 C CA    . VAL A 1 288 ? 44.071  -59.117 25.526  1.00 271.96 ? 298 VAL A CA    1 
ATOM   2273 C C     . VAL A 1 288 ? 44.773  -60.372 25.020  1.00 273.37 ? 298 VAL A C     1 
ATOM   2274 O O     . VAL A 1 288 ? 44.243  -61.472 25.157  1.00 277.39 ? 298 VAL A O     1 
ATOM   2275 C CB    . VAL A 1 288 ? 43.244  -58.480 24.376  1.00 223.65 ? 298 VAL A CB    1 
ATOM   2276 C CG1   . VAL A 1 288 ? 42.421  -57.322 24.907  1.00 222.90 ? 298 VAL A CG1   1 
ATOM   2277 C CG2   . VAL A 1 288 ? 44.139  -58.009 23.237  1.00 220.03 ? 298 VAL A CG2   1 
ATOM   2278 N N     . CYS A 1 289 ? 45.973  -60.201 24.472  1.00 323.85 ? 299 CYS A N     1 
ATOM   2279 C CA    . CYS A 1 289 ? 46.723  -61.292 23.854  1.00 324.86 ? 299 CYS A CA    1 
ATOM   2280 C C     . CYS A 1 289 ? 46.804  -62.522 24.751  1.00 328.59 ? 299 CYS A C     1 
ATOM   2281 O O     . CYS A 1 289 ? 46.714  -63.656 24.279  1.00 331.55 ? 299 CYS A O     1 
ATOM   2282 C CB    . CYS A 1 289 ? 48.131  -60.818 23.491  1.00 226.91 ? 299 CYS A CB    1 
ATOM   2283 S SG    . CYS A 1 289 ? 48.174  -59.300 22.507  1.00 222.57 ? 299 CYS A SG    1 
ATOM   2284 N N     . GLU A 1 290 ? 46.986  -62.289 26.046  1.00 283.14 ? 300 GLU A N     1 
ATOM   2285 C CA    . GLU A 1 290 ? 47.040  -63.371 27.021  1.00 286.83 ? 300 GLU A CA    1 
ATOM   2286 C C     . GLU A 1 290 ? 45.663  -63.906 27.430  1.00 291.35 ? 300 GLU A C     1 
ATOM   2287 O O     . GLU A 1 290 ? 45.430  -65.115 27.416  1.00 295.33 ? 300 GLU A O     1 
ATOM   2288 C CB    . GLU A 1 290 ? 47.795  -62.900 28.266  1.00 213.82 ? 300 GLU A CB    1 
ATOM   2289 C CG    . GLU A 1 290 ? 48.005  -63.974 29.327  1.00 217.49 ? 300 GLU A CG    1 
ATOM   2290 C CD    . GLU A 1 290 ? 49.163  -64.911 29.009  1.00 217.68 ? 300 GLU A CD    1 
ATOM   2291 O OE1   . GLU A 1 290 ? 49.640  -64.911 27.853  1.00 215.69 ? 300 GLU A OE1   1 
ATOM   2292 O OE2   . GLU A 1 290 ? 49.600  -65.644 29.923  1.00 219.99 ? 300 GLU A OE2   1 
ATOM   2293 N N     . LYS A 1 291 ? 44.757  -63.002 27.794  1.00 357.09 ? 301 LYS A N     1 
ATOM   2294 C CA    . LYS A 1 291 ? 43.463  -63.392 28.354  1.00 361.44 ? 301 LYS A CA    1 
ATOM   2295 C C     . LYS A 1 291 ? 42.468  -63.967 27.339  1.00 364.22 ? 301 LYS A C     1 
ATOM   2296 O O     . LYS A 1 291 ? 41.980  -65.086 27.509  1.00 368.84 ? 301 LYS A O     1 
ATOM   2297 C CB    . LYS A 1 291 ? 42.825  -62.191 29.062  1.00 179.43 ? 301 LYS A CB    1 
ATOM   2298 C CG    . LYS A 1 291 ? 42.942  -62.201 30.586  1.00 181.02 ? 301 LYS A CG    1 
ATOM   2299 C CD    . LYS A 1 291 ? 41.933  -63.152 31.218  1.00 186.71 ? 301 LYS A CD    1 
ATOM   2300 C CE    . LYS A 1 291 ? 41.787  -62.897 32.712  1.00 188.35 ? 301 LYS A CE    1 
ATOM   2301 N NZ    . LYS A 1 291 ? 41.168  -61.572 32.996  1.00 186.44 ? 301 LYS A NZ    1 
ATOM   2302 N N     . PHE A 1 292 ? 42.183  -63.212 26.279  1.00 264.74 ? 302 PHE A N     1 
ATOM   2303 C CA    . PHE A 1 292 ? 41.091  -63.558 25.365  1.00 267.38 ? 302 PHE A CA    1 
ATOM   2304 C C     . PHE A 1 292 ? 41.362  -63.078 23.932  1.00 264.27 ? 302 PHE A C     1 
ATOM   2305 O O     . PHE A 1 292 ? 42.453  -62.612 23.616  1.00 260.35 ? 302 PHE A O     1 
ATOM   2306 C CB    . PHE A 1 292 ? 39.769  -62.965 25.884  1.00 205.21 ? 302 PHE A CB    1 
ATOM   2307 C CG    . PHE A 1 292 ? 38.627  -63.959 25.960  1.00 210.98 ? 302 PHE A CG    1 
ATOM   2308 C CD1   . PHE A 1 292 ? 38.800  -65.201 26.555  1.00 215.00 ? 302 PHE A CD1   1 
ATOM   2309 C CD2   . PHE A 1 292 ? 37.372  -63.632 25.463  1.00 212.62 ? 302 PHE A CD2   1 
ATOM   2310 C CE1   . PHE A 1 292 ? 37.750  -66.107 26.632  1.00 220.64 ? 302 PHE A CE1   1 
ATOM   2311 C CE2   . PHE A 1 292 ? 36.319  -64.532 25.539  1.00 218.19 ? 302 PHE A CE2   1 
ATOM   2312 C CZ    . PHE A 1 292 ? 36.509  -65.770 26.124  1.00 222.26 ? 302 PHE A CZ    1 
ATOM   2313 N N     . GLU A 1 293 ? 40.354  -63.194 23.073  1.00 316.40 ? 303 GLU A N     1 
ATOM   2314 C CA    . GLU A 1 293 ? 40.443  -62.773 21.671  1.00 314.14 ? 303 GLU A CA    1 
ATOM   2315 C C     . GLU A 1 293 ? 40.579  -61.250 21.586  1.00 309.44 ? 303 GLU A C     1 
ATOM   2316 O O     . GLU A 1 293 ? 40.413  -60.565 22.590  1.00 308.49 ? 303 GLU A O     1 
ATOM   2317 C CB    . GLU A 1 293 ? 39.233  -63.268 20.869  1.00 208.99 ? 303 GLU A CB    1 
ATOM   2318 C CG    . GLU A 1 293 ? 39.472  -63.331 19.356  1.00 208.02 ? 303 GLU A CG    1 
ATOM   2319 C CD    . GLU A 1 293 ? 38.537  -64.288 18.635  1.00 212.92 ? 303 GLU A CD    1 
ATOM   2320 O OE1   . GLU A 1 293 ? 37.590  -64.804 19.267  1.00 217.04 ? 303 GLU A OE1   1 
ATOM   2321 O OE2   . GLU A 1 293 ? 38.757  -64.530 17.430  1.00 212.88 ? 303 GLU A OE2   1 
ATOM   2322 N N     . CYS A 1 294 ? 40.883  -60.740 20.391  1.00 294.81 ? 304 CYS A N     1 
ATOM   2323 C CA    . CYS A 1 294 ? 41.365  -59.373 20.162  1.00 290.06 ? 304 CYS A CA    1 
ATOM   2324 C C     . CYS A 1 294 ? 40.695  -58.300 21.016  1.00 289.09 ? 304 CYS A C     1 
ATOM   2325 O O     . CYS A 1 294 ? 41.381  -57.439 21.574  1.00 285.86 ? 304 CYS A O     1 
ATOM   2326 C CB    . CYS A 1 294 ? 41.154  -59.012 18.693  1.00 289.92 ? 304 CYS A CB    1 
ATOM   2327 S SG    . CYS A 1 294 ? 39.407  -59.082 18.193  1.00 293.62 ? 304 CYS A SG    1 
ATOM   2328 N N     . SER A 1 295 ? 39.366  -58.341 21.084  1.00 296.62 ? 305 SER A N     1 
ATOM   2329 C CA    . SER A 1 295 ? 38.589  -57.604 22.086  1.00 297.01 ? 305 SER A CA    1 
ATOM   2330 C C     . SER A 1 295 ? 38.483  -56.089 21.862  1.00 293.41 ? 305 SER A C     1 
ATOM   2331 O O     . SER A 1 295 ? 37.688  -55.425 22.525  1.00 293.99 ? 305 SER A O     1 
ATOM   2332 C CB    . SER A 1 295 ? 39.175  -57.872 23.478  1.00 312.79 ? 305 SER A CB    1 
ATOM   2333 O OG    . SER A 1 295 ? 38.354  -57.369 24.505  1.00 314.12 ? 305 SER A OG    1 
ATOM   2334 N N     . GLU A 1 296 ? 39.265  -55.545 20.933  1.00 361.92 ? 306 GLU A N     1 
ATOM   2335 C CA    . GLU A 1 296 ? 39.250  -54.102 20.687  1.00 358.60 ? 306 GLU A CA    1 
ATOM   2336 C C     . GLU A 1 296 ? 37.871  -53.614 20.240  1.00 360.18 ? 306 GLU A C     1 
ATOM   2337 O O     . GLU A 1 296 ? 37.417  -52.546 20.651  1.00 359.08 ? 306 GLU A O     1 
ATOM   2338 C CB    . GLU A 1 296 ? 40.302  -53.720 19.641  1.00 233.21 ? 306 GLU A CB    1 
ATOM   2339 C CG    . GLU A 1 296 ? 41.739  -53.754 20.149  1.00 230.77 ? 306 GLU A CG    1 
ATOM   2340 C CD    . GLU A 1 296 ? 42.731  -53.168 19.155  1.00 227.41 ? 306 GLU A CD    1 
ATOM   2341 O OE1   . GLU A 1 296 ? 42.545  -53.359 17.934  1.00 227.77 ? 306 GLU A OE1   1 
ATOM   2342 O OE2   . GLU A 1 296 ? 43.695  -52.508 19.596  1.00 224.63 ? 306 GLU A OE2   1 
ATOM   2343 N N     . GLU A 1 297 ? 37.224  -54.393 19.380  1.00 316.54 ? 307 GLU A N     1 
ATOM   2344 C CA    . GLU A 1 297 ? 35.884  -54.073 18.897  1.00 318.57 ? 307 GLU A CA    1 
ATOM   2345 C C     . GLU A 1 297 ? 34.788  -54.514 19.869  1.00 322.50 ? 307 GLU A C     1 
ATOM   2346 O O     . GLU A 1 297 ? 33.757  -53.854 19.999  1.00 323.46 ? 307 GLU A O     1 
ATOM   2347 C CB    . GLU A 1 297 ? 35.651  -54.715 17.525  1.00 232.05 ? 307 GLU A CB    1 
ATOM   2348 C CG    . GLU A 1 297 ? 36.733  -54.415 16.484  1.00 228.73 ? 307 GLU A CG    1 
ATOM   2349 C CD    . GLU A 1 297 ? 36.555  -53.073 15.788  1.00 226.02 ? 307 GLU A CD    1 
ATOM   2350 O OE1   . GLU A 1 297 ? 36.048  -52.121 16.420  1.00 225.17 ? 307 GLU A OE1   1 
ATOM   2351 O OE2   . GLU A 1 297 ? 36.922  -52.971 14.597  1.00 224.95 ? 307 GLU A OE2   1 
ATOM   2352 N N     . GLU A 1 298 ? 35.017  -55.638 20.541  1.00 384.77 ? 308 GLU A N     1 
ATOM   2353 C CA    . GLU A 1 298 ? 33.980  -56.280 21.344  1.00 389.30 ? 308 GLU A CA    1 
ATOM   2354 C C     . GLU A 1 298 ? 33.689  -55.583 22.676  1.00 389.14 ? 308 GLU A C     1 
ATOM   2355 O O     . GLU A 1 298 ? 32.531  -55.328 23.003  1.00 391.64 ? 308 GLU A O     1 
ATOM   2356 C CB    . GLU A 1 298 ? 34.358  -57.742 21.604  1.00 270.35 ? 308 GLU A CB    1 
ATOM   2357 C CG    . GLU A 1 298 ? 34.381  -58.618 20.355  1.00 271.96 ? 308 GLU A CG    1 
ATOM   2358 C CD    . GLU A 1 298 ? 32.999  -58.852 19.770  1.00 275.83 ? 308 GLU A CD    1 
ATOM   2359 O OE1   . GLU A 1 298 ? 32.084  -59.235 20.531  1.00 279.69 ? 308 GLU A OE1   1 
ATOM   2360 O OE2   . GLU A 1 298 ? 32.827  -58.650 18.550  1.00 275.21 ? 308 GLU A OE2   1 
ATOM   2361 N N     . VAL A 1 299 ? 34.731  -55.276 23.442  1.00 322.37 ? 309 VAL A N     1 
ATOM   2362 C CA    . VAL A 1 299 ? 34.538  -54.802 24.812  1.00 322.83 ? 309 VAL A CA    1 
ATOM   2363 C C     . VAL A 1 299 ? 34.499  -53.285 24.945  1.00 319.59 ? 309 VAL A C     1 
ATOM   2364 O O     . VAL A 1 299 ? 34.520  -52.760 26.059  1.00 319.44 ? 309 VAL A O     1 
ATOM   2365 C CB    . VAL A 1 299 ? 35.616  -55.354 25.753  1.00 201.57 ? 309 VAL A CB    1 
ATOM   2366 C CG1   . VAL A 1 299 ? 35.672  -56.853 25.604  1.00 204.95 ? 309 VAL A CG1   1 
ATOM   2367 C CG2   . VAL A 1 299 ? 36.973  -54.710 25.479  1.00 196.70 ? 309 VAL A CG2   1 
ATOM   2368 N N     . LEU A 1 300 ? 34.481  -52.582 23.818  1.00 265.43 ? 310 LEU A N     1 
ATOM   2369 C CA    . LEU A 1 300 ? 34.235  -51.145 23.847  1.00 263.03 ? 310 LEU A CA    1 
ATOM   2370 C C     . LEU A 1 300 ? 32.911  -50.856 24.555  1.00 266.15 ? 310 LEU A C     1 
ATOM   2371 O O     . LEU A 1 300 ? 32.839  -49.976 25.409  1.00 265.36 ? 310 LEU A O     1 
ATOM   2372 C CB    . LEU A 1 300 ? 34.229  -50.561 22.433  1.00 183.36 ? 310 LEU A CB    1 
ATOM   2373 C CG    . LEU A 1 300 ? 35.587  -50.103 21.888  1.00 179.09 ? 310 LEU A CG    1 
ATOM   2374 C CD1   . LEU A 1 300 ? 35.473  -49.661 20.435  1.00 177.65 ? 310 LEU A CD1   1 
ATOM   2375 C CD2   . LEU A 1 300 ? 36.172  -48.984 22.744  1.00 176.38 ? 310 LEU A CD2   1 
ATOM   2376 N N     . SER A 1 301 ? 31.875  -51.616 24.212  1.00 311.80 ? 311 SER A N     1 
ATOM   2377 C CA    . SER A 1 301 ? 30.572  -51.479 24.857  1.00 315.37 ? 311 SER A CA    1 
ATOM   2378 C C     . SER A 1 301 ? 30.631  -51.886 26.326  1.00 317.57 ? 311 SER A C     1 
ATOM   2379 O O     . SER A 1 301 ? 29.882  -51.371 27.156  1.00 319.31 ? 311 SER A O     1 
ATOM   2380 C CB    . SER A 1 301 ? 29.522  -52.318 24.126  1.00 225.75 ? 311 SER A CB    1 
ATOM   2381 O OG    . SER A 1 301 ? 29.893  -53.686 24.100  1.00 227.94 ? 311 SER A OG    1 
ATOM   2382 N N     . CYS A 1 302 ? 31.528  -52.816 26.637  1.00 391.58 ? 312 CYS A N     1 
ATOM   2383 C CA    . CYS A 1 302 ? 31.690  -53.291 28.004  1.00 393.78 ? 312 CYS A CA    1 
ATOM   2384 C C     . CYS A 1 302 ? 32.375  -52.252 28.889  1.00 390.81 ? 312 CYS A C     1 
ATOM   2385 O O     . CYS A 1 302 ? 32.259  -52.313 30.112  1.00 392.82 ? 312 CYS A O     1 
ATOM   2386 C CB    . CYS A 1 302 ? 32.482  -54.602 28.024  1.00 286.42 ? 312 CYS A CB    1 
ATOM   2387 S SG    . CYS A 1 302 ? 31.691  -55.971 27.145  1.00 290.86 ? 312 CYS A SG    1 
ATOM   2388 N N     . LEU A 1 303 ? 33.174  -51.369 28.292  1.00 325.66 ? 313 LEU A N     1 
ATOM   2389 C CA    . LEU A 1 303 ? 33.682  -50.204 29.022  1.00 323.02 ? 313 LEU A CA    1 
ATOM   2390 C C     . LEU A 1 303 ? 33.050  -48.835 28.680  1.00 321.51 ? 313 LEU A C     1 
ATOM   2391 O O     . LEU A 1 303 ? 33.351  -47.842 29.344  1.00 319.89 ? 313 LEU A O     1 
ATOM   2392 C CB    . LEU A 1 303 ? 35.202  -50.123 28.848  1.00 162.23 ? 313 LEU A CB    1 
ATOM   2393 C CG    . LEU A 1 303 ? 35.788  -49.992 27.443  1.00 159.03 ? 313 LEU A CG    1 
ATOM   2394 C CD1   . LEU A 1 303 ? 36.134  -48.540 27.147  1.00 155.37 ? 313 LEU A CD1   1 
ATOM   2395 C CD2   . LEU A 1 303 ? 37.011  -50.883 27.283  1.00 157.88 ? 313 LEU A CD2   1 
ATOM   2396 N N     . TYR A 1 304 ? 32.189  -48.773 27.665  1.00 346.56 ? 314 TYR A N     1 
ATOM   2397 C CA    . TYR A 1 304 ? 31.539  -47.506 27.294  1.00 345.40 ? 314 TYR A CA    1 
ATOM   2398 C C     . TYR A 1 304 ? 30.347  -47.226 28.199  1.00 348.90 ? 314 TYR A C     1 
ATOM   2399 O O     . TYR A 1 304 ? 30.044  -46.076 28.516  1.00 348.08 ? 314 TYR A O     1 
ATOM   2400 C CB    . TYR A 1 304 ? 31.079  -47.515 25.830  1.00 256.54 ? 314 TYR A CB    1 
ATOM   2401 C CG    . TYR A 1 304 ? 32.071  -46.949 24.827  1.00 252.21 ? 314 TYR A CG    1 
ATOM   2402 C CD1   . TYR A 1 304 ? 32.877  -45.858 25.141  1.00 248.89 ? 314 TYR A CD1   1 
ATOM   2403 C CD2   . TYR A 1 304 ? 32.191  -47.505 23.558  1.00 251.77 ? 314 TYR A CD2   1 
ATOM   2404 C CE1   . TYR A 1 304 ? 33.779  -45.343 24.216  1.00 245.27 ? 314 TYR A CE1   1 
ATOM   2405 C CE2   . TYR A 1 304 ? 33.087  -47.000 22.632  1.00 248.13 ? 314 TYR A CE2   1 
ATOM   2406 C CZ    . TYR A 1 304 ? 33.877  -45.921 22.964  1.00 244.90 ? 314 TYR A CZ    1 
ATOM   2407 O OH    . TYR A 1 304 ? 34.766  -45.423 22.037  1.00 241.59 ? 314 TYR A OH    1 
ATOM   2408 N N     . ASN A 1 305 ? 29.689  -48.297 28.627  1.00 389.04 ? 315 ASN A N     1 
ATOM   2409 C CA    . ASN A 1 305 ? 28.471  -48.200 29.420  1.00 393.07 ? 315 ASN A CA    1 
ATOM   2410 C C     . ASN A 1 305 ? 28.787  -47.975 30.894  1.00 393.89 ? 315 ASN A C     1 
ATOM   2411 O O     . ASN A 1 305 ? 27.889  -47.985 31.737  1.00 397.57 ? 315 ASN A O     1 
ATOM   2412 C CB    . ASN A 1 305 ? 27.617  -49.460 29.250  1.00 219.23 ? 315 ASN A CB    1 
ATOM   2413 C CG    . ASN A 1 305 ? 27.057  -49.604 27.846  1.00 219.27 ? 315 ASN A CG    1 
ATOM   2414 O OD1   . ASN A 1 305 ? 26.922  -48.623 27.116  1.00 216.76 ? 315 ASN A OD1   1 
ATOM   2415 N ND2   . ASN A 1 305 ? 26.719  -50.832 27.466  1.00 222.39 ? 315 ASN A ND2   1 
ATOM   2416 N N     . ARG A 1 306 ? 30.076  -47.808 31.188  1.00 318.54 ? 316 ARG A N     1 
ATOM   2417 C CA    . ARG A 1 306 ? 30.574  -47.592 32.545  1.00 318.98 ? 316 ARG A CA    1 
ATOM   2418 C C     . ARG A 1 306 ? 30.302  -48.805 33.426  1.00 323.33 ? 316 ARG A C     1 
ATOM   2419 O O     . ARG A 1 306 ? 30.140  -48.677 34.640  1.00 325.59 ? 316 ARG A O     1 
ATOM   2420 C CB    . ARG A 1 306 ? 29.959  -46.332 33.170  1.00 261.39 ? 316 ARG A CB    1 
ATOM   2421 C CG    . ARG A 1 306 ? 30.275  -45.039 32.432  1.00 257.33 ? 316 ARG A CG    1 
ATOM   2422 C CD    . ARG A 1 306 ? 31.765  -44.718 32.467  1.00 253.32 ? 316 ARG A CD    1 
ATOM   2423 N NE    . ARG A 1 306 ? 32.084  -43.521 31.689  1.00 249.69 ? 316 ARG A NE    1 
ATOM   2424 C CZ    . ARG A 1 306 ? 33.317  -43.074 31.467  1.00 246.01 ? 316 ARG A CZ    1 
ATOM   2425 N NH1   . ARG A 1 306 ? 33.510  -41.978 30.744  1.00 243.20 ? 316 ARG A NH1   1 
ATOM   2426 N NH2   . ARG A 1 306 ? 34.360  -43.724 31.965  1.00 245.33 ? 316 ARG A NH2   1 
ATOM   2427 N N     . ASN A 1 307 ? 30.263  -49.985 32.813  1.00 280.61 ? 317 ASN A N     1 
ATOM   2428 C CA    . ASN A 1 307 ? 30.070  -51.212 33.572  1.00 284.88 ? 317 ASN A CA    1 
ATOM   2429 C C     . ASN A 1 307 ? 31.416  -51.816 33.936  1.00 283.23 ? 317 ASN A C     1 
ATOM   2430 O O     . ASN A 1 307 ? 32.111  -52.368 33.086  1.00 281.22 ? 317 ASN A O     1 
ATOM   2431 C CB    . ASN A 1 307 ? 29.229  -52.216 32.776  1.00 535.91 ? 317 ASN A CB    1 
ATOM   2432 C CG    . ASN A 1 307 ? 29.273  -51.963 31.276  1.00 532.91 ? 317 ASN A CG    1 
ATOM   2433 O OD1   . ASN A 1 307 ? 30.026  -51.115 30.798  1.00 528.35 ? 317 ASN A OD1   1 
ATOM   2434 N ND2   . ASN A 1 307 ? 28.459  -52.699 30.527  1.00 535.74 ? 317 ASN A ND2   1 
ATOM   2435 N N     . HIS A 1 308 ? 31.766  -51.716 35.214  1.00 369.46 ? 318 HIS A N     1 
ATOM   2436 C CA    . HIS A 1 308 ? 33.074  -52.139 35.695  1.00 367.88 ? 318 HIS A CA    1 
ATOM   2437 C C     . HIS A 1 308 ? 33.058  -53.528 36.331  1.00 372.09 ? 318 HIS A C     1 
ATOM   2438 O O     . HIS A 1 308 ? 34.078  -53.987 36.840  1.00 371.48 ? 318 HIS A O     1 
ATOM   2439 C CB    . HIS A 1 308 ? 33.630  -51.108 36.686  1.00 271.91 ? 318 HIS A CB    1 
ATOM   2440 C CG    . HIS A 1 308 ? 32.647  -50.676 37.732  1.00 275.54 ? 318 HIS A CG    1 
ATOM   2441 N ND1   . HIS A 1 308 ? 32.295  -51.474 38.800  1.00 280.21 ? 318 HIS A ND1   1 
ATOM   2442 C CD2   . HIS A 1 308 ? 31.949  -49.524 37.879  1.00 275.37 ? 318 HIS A CD2   1 
ATOM   2443 C CE1   . HIS A 1 308 ? 31.420  -50.834 39.557  1.00 282.79 ? 318 HIS A CE1   1 
ATOM   2444 N NE2   . HIS A 1 308 ? 31.193  -49.649 39.019  1.00 279.91 ? 318 HIS A NE2   1 
ATOM   2445 N N     . GLN A 1 309 ? 31.894  -54.173 36.344  1.00 254.59 ? 319 GLN A N     1 
ATOM   2446 C CA    . GLN A 1 309 ? 31.781  -55.533 36.872  1.00 259.14 ? 319 GLN A CA    1 
ATOM   2447 C C     . GLN A 1 309 ? 31.769  -56.619 35.788  1.00 259.88 ? 319 GLN A C     1 
ATOM   2448 O O     . GLN A 1 309 ? 31.635  -57.805 36.096  1.00 263.91 ? 319 GLN A O     1 
ATOM   2449 C CB    . GLN A 1 309 ? 30.535  -55.658 37.753  1.00 248.50 ? 319 GLN A CB    1 
ATOM   2450 C CG    . GLN A 1 309 ? 30.667  -54.940 39.093  1.00 249.11 ? 319 GLN A CG    1 
ATOM   2451 C CD    . GLN A 1 309 ? 29.739  -55.498 40.157  1.00 255.41 ? 319 GLN A CD    1 
ATOM   2452 O OE1   . GLN A 1 309 ? 28.545  -55.687 39.924  1.00 258.86 ? 319 GLN A OE1   1 
ATOM   2453 N NE2   . GLN A 1 309 ? 30.290  -55.774 41.334  1.00 257.16 ? 319 GLN A NE2   1 
ATOM   2454 N N     . ASP A 1 310 ? 31.896  -56.215 34.526  1.00 527.42 ? 320 ASP A N     1 
ATOM   2455 C CA    . ASP A 1 310 ? 31.966  -57.166 33.415  1.00 527.83 ? 320 ASP A CA    1 
ATOM   2456 C C     . ASP A 1 310 ? 33.270  -57.956 33.470  1.00 526.48 ? 320 ASP A C     1 
ATOM   2457 O O     . ASP A 1 310 ? 34.284  -57.433 33.927  1.00 523.20 ? 320 ASP A O     1 
ATOM   2458 C CB    . ASP A 1 310 ? 31.847  -56.437 32.073  1.00 289.99 ? 320 ASP A CB    1 
ATOM   2459 C CG    . ASP A 1 310 ? 30.501  -55.773 31.889  1.00 291.69 ? 320 ASP A CG    1 
ATOM   2460 O OD1   . ASP A 1 310 ? 29.833  -55.507 32.908  1.00 294.46 ? 320 ASP A OD1   1 
ATOM   2461 O OD2   . ASP A 1 310 ? 30.115  -55.513 30.730  1.00 290.41 ? 320 ASP A OD2   1 
ATOM   2462 N N     . PRO A 1 311 ? 33.253  -59.216 32.995  1.00 203.62 ? 321 PRO A N     1 
ATOM   2463 C CA    . PRO A 1 311 ? 34.458  -60.054 33.055  1.00 202.84 ? 321 PRO A CA    1 
ATOM   2464 C C     . PRO A 1 311 ? 35.610  -59.474 32.245  1.00 197.02 ? 321 PRO A C     1 
ATOM   2465 O O     . PRO A 1 311 ? 36.771  -59.745 32.552  1.00 195.29 ? 321 PRO A O     1 
ATOM   2466 C CB    . PRO A 1 311 ? 33.991  -61.389 32.463  1.00 349.08 ? 321 PRO A CB    1 
ATOM   2467 C CG    . PRO A 1 311 ? 32.802  -61.046 31.633  1.00 350.10 ? 321 PRO A CG    1 
ATOM   2468 C CD    . PRO A 1 311 ? 32.128  -59.918 32.353  1.00 349.75 ? 321 PRO A CD    1 
ATOM   2469 N N     . LEU A 1 312 ? 35.280  -58.714 31.204  1.00 232.23 ? 322 LEU A N     1 
ATOM   2470 C CA    . LEU A 1 312 ? 36.275  -58.016 30.392  1.00 226.83 ? 322 LEU A CA    1 
ATOM   2471 C C     . LEU A 1 312 ? 36.685  -56.677 31.017  1.00 223.33 ? 322 LEU A C     1 
ATOM   2472 O O     . LEU A 1 312 ? 37.826  -56.233 30.877  1.00 219.41 ? 322 LEU A O     1 
ATOM   2473 C CB    . LEU A 1 312 ? 35.744  -57.803 28.972  1.00 220.79 ? 322 LEU A CB    1 
ATOM   2474 C CG    . LEU A 1 312 ? 35.185  -59.021 28.218  1.00 224.52 ? 322 LEU A CG    1 
ATOM   2475 C CD1   . LEU A 1 312 ? 35.942  -60.310 28.541  1.00 226.55 ? 322 LEU A CD1   1 
ATOM   2476 C CD2   . LEU A 1 312 ? 33.677  -59.186 28.425  1.00 229.09 ? 322 LEU A CD2   1 
ATOM   2477 N N     . ALA A 1 313 ? 35.739  -56.038 31.700  1.00 311.77 ? 323 ALA A N     1 
ATOM   2478 C CA    . ALA A 1 313 ? 35.982  -54.750 32.341  1.00 309.11 ? 323 ALA A CA    1 
ATOM   2479 C C     . ALA A 1 313 ? 36.792  -54.902 33.624  1.00 309.53 ? 323 ALA A C     1 
ATOM   2480 O O     . ALA A 1 313 ? 37.649  -54.070 33.924  1.00 306.20 ? 323 ALA A O     1 
ATOM   2481 C CB    . ALA A 1 313 ? 34.669  -54.053 32.630  1.00 329.08 ? 323 ALA A CB    1 
ATOM   2482 N N     . VAL A 1 314 ? 36.521  -55.965 34.378  1.00 303.86 ? 324 VAL A N     1 
ATOM   2483 C CA    . VAL A 1 314 ? 37.273  -56.232 35.601  1.00 304.78 ? 324 VAL A CA    1 
ATOM   2484 C C     . VAL A 1 314 ? 38.696  -56.677 35.280  1.00 301.96 ? 324 VAL A C     1 
ATOM   2485 O O     . VAL A 1 314 ? 39.514  -56.819 36.181  1.00 302.01 ? 324 VAL A O     1 
ATOM   2486 C CB    . VAL A 1 314 ? 36.604  -57.317 36.488  1.00 336.98 ? 324 VAL A CB    1 
ATOM   2487 C CG1   . VAL A 1 314 ? 35.221  -56.877 36.942  1.00 340.18 ? 324 VAL A CG1   1 
ATOM   2488 C CG2   . VAL A 1 314 ? 36.546  -58.656 35.764  1.00 339.24 ? 324 VAL A CG2   1 
ATOM   2489 N N     . ALA A 1 315 ? 38.967  -56.963 34.008  1.00 238.55 ? 325 ALA A N     1 
ATOM   2490 C CA    . ALA A 1 315 ? 40.328  -57.249 33.558  1.00 235.50 ? 325 ALA A CA    1 
ATOM   2491 C C     . ALA A 1 315 ? 41.044  -56.035 32.955  1.00 230.26 ? 325 ALA A C     1 
ATOM   2492 O O     . ALA A 1 315 ? 42.254  -56.073 32.733  1.00 227.54 ? 325 ALA A O     1 
ATOM   2493 C CB    . ALA A 1 315 ? 40.310  -58.389 32.553  1.00 279.09 ? 325 ALA A CB    1 
ATOM   2494 N N     . TYR A 1 316 ? 40.300  -54.963 32.701  1.00 284.22 ? 326 TYR A N     1 
ATOM   2495 C CA    . TYR A 1 316 ? 40.841  -53.789 32.012  1.00 279.64 ? 326 TYR A CA    1 
ATOM   2496 C C     . TYR A 1 316 ? 41.253  -52.696 32.991  1.00 278.09 ? 326 TYR A C     1 
ATOM   2497 O O     . TYR A 1 316 ? 42.402  -52.252 32.993  1.00 275.04 ? 326 TYR A O     1 
ATOM   2498 C CB    . TYR A 1 316 ? 39.832  -53.235 30.997  1.00 190.13 ? 326 TYR A CB    1 
ATOM   2499 C CG    . TYR A 1 316 ? 40.305  -51.987 30.263  1.00 185.76 ? 326 TYR A CG    1 
ATOM   2500 C CD1   . TYR A 1 316 ? 41.487  -51.987 29.523  1.00 182.53 ? 326 TYR A CD1   1 
ATOM   2501 C CD2   . TYR A 1 316 ? 39.560  -50.813 30.302  1.00 185.13 ? 326 TYR A CD2   1 
ATOM   2502 C CE1   . TYR A 1 316 ? 41.915  -50.846 28.853  1.00 178.88 ? 326 TYR A CE1   1 
ATOM   2503 C CE2   . TYR A 1 316 ? 39.978  -49.673 29.634  1.00 181.46 ? 326 TYR A CE2   1 
ATOM   2504 C CZ    . TYR A 1 316 ? 41.153  -49.693 28.913  1.00 178.39 ? 326 TYR A CZ    1 
ATOM   2505 O OH    . TYR A 1 316 ? 41.559  -48.555 28.256  1.00 175.08 ? 326 TYR A OH    1 
ATOM   2506 N N     . HIS A 1 317 ? 40.292  -52.229 33.780  1.00 249.01 ? 327 HIS A N     1 
ATOM   2507 C CA    . HIS A 1 317 ? 40.512  -51.123 34.709  1.00 248.03 ? 327 HIS A CA    1 
ATOM   2508 C C     . HIS A 1 317 ? 41.644  -51.371 35.714  1.00 247.96 ? 327 HIS A C     1 
ATOM   2509 O O     . HIS A 1 317 ? 42.397  -50.453 36.030  1.00 245.50 ? 327 HIS A O     1 
ATOM   2510 C CB    . HIS A 1 317 ? 39.213  -50.811 35.461  1.00 196.84 ? 327 HIS A CB    1 
ATOM   2511 C CG    . HIS A 1 317 ? 39.100  -49.381 35.905  1.00 195.39 ? 327 HIS A CG    1 
ATOM   2512 N ND1   . HIS A 1 317 ? 40.188  -48.631 36.284  1.00 192.69 ? 327 HIS A ND1   1 
ATOM   2513 C CD2   . HIS A 1 317 ? 38.018  -48.572 36.021  1.00 196.51 ? 327 HIS A CD2   1 
ATOM   2514 C CE1   . HIS A 1 317 ? 39.785  -47.414 36.620  1.00 192.26 ? 327 HIS A CE1   1 
ATOM   2515 N NE2   . HIS A 1 317 ? 38.477  -47.355 36.469  1.00 194.49 ? 327 HIS A NE2   1 
ATOM   2516 N N     . LEU A 1 318 ? 41.773  -52.598 36.216  1.00 219.28 ? 328 LEU A N     1 
ATOM   2517 C CA    . LEU A 1 318 ? 42.797  -52.884 37.223  1.00 219.64 ? 328 LEU A CA    1 
ATOM   2518 C C     . LEU A 1 318 ? 44.218  -52.832 36.653  1.00 215.86 ? 328 LEU A C     1 
ATOM   2519 O O     . LEU A 1 318 ? 45.193  -52.867 37.404  1.00 215.53 ? 328 LEU A O     1 
ATOM   2520 C CB    . LEU A 1 318 ? 42.553  -54.247 37.888  1.00 202.86 ? 328 LEU A CB    1 
ATOM   2521 C CG    . LEU A 1 318 ? 42.093  -55.475 37.096  1.00 204.86 ? 328 LEU A CG    1 
ATOM   2522 C CD1   . LEU A 1 318 ? 42.935  -55.738 35.860  1.00 201.53 ? 328 LEU A CD1   1 
ATOM   2523 C CD2   . LEU A 1 318 ? 42.092  -56.704 37.999  1.00 209.23 ? 328 LEU A CD2   1 
ATOM   2524 N N     . ILE A 1 319 ? 44.331  -52.757 35.330  1.00 220.11 ? 329 ILE A N     1 
ATOM   2525 C CA    . ILE A 1 319 ? 45.635  -52.659 34.682  1.00 216.59 ? 329 ILE A CA    1 
ATOM   2526 C C     . ILE A 1 319 ? 46.172  -51.228 34.752  1.00 213.37 ? 329 ILE A C     1 
ATOM   2527 O O     . ILE A 1 319 ? 47.380  -51.017 34.873  1.00 211.32 ? 329 ILE A O     1 
ATOM   2528 C CB    . ILE A 1 319 ? 45.575  -53.123 33.209  1.00 234.59 ? 329 ILE A CB    1 
ATOM   2529 C CG1   . ILE A 1 319 ? 45.064  -54.563 33.122  1.00 238.09 ? 329 ILE A CG1   1 
ATOM   2530 C CG2   . ILE A 1 319 ? 46.944  -53.016 32.549  1.00 231.17 ? 329 ILE A CG2   1 
ATOM   2531 C CD1   . ILE A 1 319 ? 45.931  -55.573 33.849  1.00 239.67 ? 329 ILE A CD1   1 
ATOM   2532 N N     . ILE A 1 320 ? 45.279  -50.243 34.685  1.00 264.83 ? 330 ILE A N     1 
ATOM   2533 C CA    . ILE A 1 320 ? 45.702  -48.848 34.783  1.00 262.23 ? 330 ILE A CA    1 
ATOM   2534 C C     . ILE A 1 320 ? 46.088  -48.519 36.227  1.00 263.60 ? 330 ILE A C     1 
ATOM   2535 O O     . ILE A 1 320 ? 46.931  -47.656 36.470  1.00 261.61 ? 330 ILE A O     1 
ATOM   2536 C CB    . ILE A 1 320 ? 44.602  -47.864 34.290  1.00 171.78 ? 330 ILE A CB    1 
ATOM   2537 C CG1   . ILE A 1 320 ? 45.221  -46.532 33.846  1.00 168.38 ? 330 ILE A CG1   1 
ATOM   2538 C CG2   . ILE A 1 320 ? 43.534  -47.631 35.358  1.00 175.00 ? 330 ILE A CG2   1 
ATOM   2539 C CD1   . ILE A 1 320 ? 46.078  -46.624 32.604  1.00 165.33 ? 330 ILE A CD1   1 
ATOM   2540 N N     . ASP A 1 321 ? 45.479  -49.221 37.179  1.00 193.70 ? 331 ASP A N     1 
ATOM   2541 C CA    . ASP A 1 321 ? 45.805  -49.046 38.588  1.00 195.57 ? 331 ASP A CA    1 
ATOM   2542 C C     . ASP A 1 321 ? 47.161  -49.688 38.856  1.00 194.86 ? 331 ASP A C     1 
ATOM   2543 O O     . ASP A 1 321 ? 47.960  -49.182 39.644  1.00 194.50 ? 331 ASP A O     1 
ATOM   2544 C CB    . ASP A 1 321 ? 44.721  -49.665 39.477  1.00 224.56 ? 331 ASP A CB    1 
ATOM   2545 C CG    . ASP A 1 321 ? 44.665  -49.042 40.866  1.00 226.64 ? 331 ASP A CG    1 
ATOM   2546 O OD1   . ASP A 1 321 ? 45.707  -48.557 41.357  1.00 225.27 ? 331 ASP A OD1   1 
ATOM   2547 O OD2   . ASP A 1 321 ? 43.571  -49.041 41.469  1.00 229.87 ? 331 ASP A OD2   1 
ATOM   2548 N N     . ASN A 1 322 ? 47.411  -50.804 38.180  1.00 219.88 ? 332 ASN A N     1 
ATOM   2549 C CA    . ASN A 1 322 ? 48.680  -51.512 38.282  1.00 219.22 ? 332 ASN A CA    1 
ATOM   2550 C C     . ASN A 1 322 ? 49.853  -50.638 37.841  1.00 215.39 ? 332 ASN A C     1 
ATOM   2551 O O     . ASN A 1 322 ? 50.910  -50.646 38.468  1.00 215.12 ? 332 ASN A O     1 
ATOM   2552 C CB    . ASN A 1 322 ? 48.633  -52.799 37.448  1.00 214.00 ? 332 ASN A CB    1 
ATOM   2553 C CG    . ASN A 1 322 ? 49.912  -53.616 37.550  1.00 213.65 ? 332 ASN A CG    1 
ATOM   2554 O OD1   . ASN A 1 322 ? 50.581  -53.615 38.581  1.00 214.56 ? 332 ASN A OD1   1 
ATOM   2555 N ND2   . ASN A 1 322 ? 50.255  -54.319 36.475  1.00 212.49 ? 332 ASN A ND2   1 
ATOM   2556 N N     . ARG A 1 323 ? 49.657  -49.876 36.768  1.00 194.67 ? 333 ARG A N     1 
ATOM   2557 C CA    . ARG A 1 323 ? 50.721  -49.035 36.225  1.00 191.21 ? 333 ARG A CA    1 
ATOM   2558 C C     . ARG A 1 323 ? 50.941  -47.771 37.059  1.00 190.85 ? 333 ARG A C     1 
ATOM   2559 O O     . ARG A 1 323 ? 52.021  -47.178 37.024  1.00 188.86 ? 333 ARG A O     1 
ATOM   2560 C CB    . ARG A 1 323 ? 50.420  -48.659 34.770  1.00 194.45 ? 333 ARG A CB    1 
ATOM   2561 C CG    . ARG A 1 323 ? 50.491  -49.832 33.804  1.00 194.41 ? 333 ARG A CG    1 
ATOM   2562 C CD    . ARG A 1 323 ? 51.022  -49.406 32.443  1.00 191.21 ? 333 ARG A CD    1 
ATOM   2563 N NE    . ARG A 1 323 ? 49.986  -48.846 31.580  1.00 190.61 ? 333 ARG A NE    1 
ATOM   2564 C CZ    . ARG A 1 323 ? 49.738  -47.547 31.442  1.00 189.12 ? 333 ARG A CZ    1 
ATOM   2565 N NH1   . ARG A 1 323 ? 50.449  -46.653 32.115  1.00 188.15 ? 333 ARG A NH1   1 
ATOM   2566 N NH2   . ARG A 1 323 ? 48.775  -47.140 30.625  1.00 188.81 ? 333 ARG A NH2   1 
ATOM   2567 N N     . ARG A 1 324 ? 49.920  -47.364 37.807  1.00 213.19 ? 334 ARG A N     1 
ATOM   2568 C CA    . ARG A 1 324 ? 50.032  -46.193 38.670  1.00 213.41 ? 334 ARG A CA    1 
ATOM   2569 C C     . ARG A 1 324 ? 50.871  -46.515 39.901  1.00 215.13 ? 334 ARG A C     1 
ATOM   2570 O O     . ARG A 1 324 ? 51.659  -45.688 40.360  1.00 214.32 ? 334 ARG A O     1 
ATOM   2571 C CB    . ARG A 1 324 ? 48.648  -45.691 39.092  1.00 197.76 ? 334 ARG A CB    1 
ATOM   2572 C CG    . ARG A 1 324 ? 48.674  -44.392 39.889  1.00 198.09 ? 334 ARG A CG    1 
ATOM   2573 C CD    . ARG A 1 324 ? 47.293  -44.032 40.411  1.00 200.71 ? 334 ARG A CD    1 
ATOM   2574 N NE    . ARG A 1 324 ? 46.762  -45.070 41.288  1.00 204.33 ? 334 ARG A NE    1 
ATOM   2575 C CZ    . ARG A 1 324 ? 45.587  -45.001 41.901  1.00 207.37 ? 334 ARG A CZ    1 
ATOM   2576 N NH1   . ARG A 1 324 ? 44.810  -43.937 41.737  1.00 207.16 ? 334 ARG A NH1   1 
ATOM   2577 N NH2   . ARG A 1 324 ? 45.191  -45.998 42.680  1.00 210.84 ? 334 ARG A NH2   1 
ATOM   2578 N N     . ILE A 1 325 ? 50.694  -47.724 40.429  1.00 215.48 ? 335 ILE A N     1 
ATOM   2579 C CA    . ILE A 1 325 ? 51.437  -48.173 41.604  1.00 217.52 ? 335 ILE A CA    1 
ATOM   2580 C C     . ILE A 1 325 ? 52.875  -48.538 41.220  1.00 215.38 ? 335 ILE A C     1 
ATOM   2581 O O     . ILE A 1 325 ? 53.770  -48.529 42.063  1.00 216.15 ? 335 ILE A O     1 
ATOM   2582 C CB    . ILE A 1 325 ? 50.735  -49.377 42.291  1.00 203.85 ? 335 ILE A CB    1 
ATOM   2583 C CG1   . ILE A 1 325 ? 49.291  -49.019 42.656  1.00 206.20 ? 335 ILE A CG1   1 
ATOM   2584 C CG2   . ILE A 1 325 ? 51.476  -49.816 43.549  1.00 206.26 ? 335 ILE A CG2   1 
ATOM   2585 C CD1   . ILE A 1 325 ? 49.164  -47.856 43.625  1.00 207.16 ? 335 ILE A CD1   1 
ATOM   2586 N N     . MET A 1 326 ? 53.102  -48.841 39.944  1.00 164.88 ? 336 MET A N     1 
ATOM   2587 C CA    . MET A 1 326 ? 54.459  -49.089 39.454  1.00 162.71 ? 336 MET A CA    1 
ATOM   2588 C C     . MET A 1 326 ? 55.325  -47.831 39.557  1.00 160.67 ? 336 MET A C     1 
ATOM   2589 O O     . MET A 1 326 ? 56.526  -47.914 39.821  1.00 160.15 ? 336 MET A O     1 
ATOM   2590 C CB    . MET A 1 326 ? 54.435  -49.590 38.006  1.00 211.73 ? 336 MET A CB    1 
ATOM   2591 C CG    . MET A 1 326 ? 54.087  -51.067 37.860  1.00 213.74 ? 336 MET A CG    1 
ATOM   2592 S SD    . MET A 1 326 ? 53.913  -51.605 36.145  1.00 211.73 ? 336 MET A SD    1 
ATOM   2593 C CE    . MET A 1 326 ? 55.607  -51.514 35.571  1.00 208.84 ? 336 MET A CE    1 
ATOM   2594 N N     . ASN A 1 327 ? 54.709  -46.671 39.346  1.00 214.14 ? 337 ASN A N     1 
ATOM   2595 C CA    . ASN A 1 327 ? 55.400  -45.396 39.505  1.00 212.72 ? 337 ASN A CA    1 
ATOM   2596 C C     . ASN A 1 327 ? 55.637  -45.069 40.976  1.00 215.22 ? 337 ASN A C     1 
ATOM   2597 O O     . ASN A 1 327 ? 56.669  -44.503 41.336  1.00 214.71 ? 337 ASN A O     1 
ATOM   2598 C CB    . ASN A 1 327 ? 54.613  -44.269 38.836  1.00 200.29 ? 337 ASN A CB    1 
ATOM   2599 C CG    . ASN A 1 327 ? 54.603  -44.386 37.327  1.00 197.60 ? 337 ASN A CG    1 
ATOM   2600 O OD1   . ASN A 1 327 ? 54.472  -45.479 36.776  1.00 197.60 ? 337 ASN A OD1   1 
ATOM   2601 N ND2   . ASN A 1 327 ? 54.757  -43.256 36.647  1.00 195.53 ? 337 ASN A ND2   1 
ATOM   2602 N N     . GLU A 1 328 ? 54.676  -45.421 41.824  1.00 177.35 ? 338 GLU A N     1 
ATOM   2603 C CA    . GLU A 1 328 ? 54.879  -45.331 43.262  1.00 180.25 ? 338 GLU A CA    1 
ATOM   2604 C C     . GLU A 1 328 ? 55.980  -46.311 43.662  1.00 180.92 ? 338 GLU A C     1 
ATOM   2605 O O     . GLU A 1 328 ? 55.874  -47.510 43.400  1.00 181.49 ? 338 GLU A O     1 
ATOM   2606 C CB    . GLU A 1 328 ? 53.580  -45.633 44.016  1.00 220.24 ? 338 GLU A CB    1 
ATOM   2607 C CG    . GLU A 1 328 ? 52.783  -44.407 44.434  1.00 221.11 ? 338 GLU A CG    1 
ATOM   2608 C CD    . GLU A 1 328 ? 53.303  -43.787 45.716  1.00 223.24 ? 338 GLU A CD    1 
ATOM   2609 O OE1   . GLU A 1 328 ? 53.596  -44.540 46.671  1.00 225.87 ? 338 GLU A OE1   1 
ATOM   2610 O OE2   . GLU A 1 328 ? 53.422  -42.546 45.764  1.00 222.49 ? 338 GLU A OE2   1 
ATOM   2611 N N     . ALA A 1 329 ? 57.022  -45.795 44.312  1.00 237.01 ? 339 ALA A N     1 
ATOM   2612 C CA    . ALA A 1 329 ? 58.227  -46.571 44.601  1.00 237.30 ? 339 ALA A CA    1 
ATOM   2613 C C     . ALA A 1 329 ? 58.781  -47.192 43.314  1.00 234.44 ? 339 ALA A C     1 
ATOM   2614 O O     . ALA A 1 329 ? 58.978  -48.403 43.226  1.00 235.16 ? 339 ALA A O     1 
ATOM   2615 C CB    . ALA A 1 329 ? 57.946  -47.647 45.656  1.00 154.22 ? 339 ALA A CB    1 
ATOM   2616 N N     . LYS A 1 330 ? 59.021  -46.342 42.318  1.00 163.87 ? 340 LYS A N     1 
ATOM   2617 C CA    . LYS A 1 330 ? 59.553  -46.766 41.022  1.00 161.13 ? 340 LYS A CA    1 
ATOM   2618 C C     . LYS A 1 330 ? 60.980  -47.306 41.118  1.00 160.84 ? 340 LYS A C     1 
ATOM   2619 O O     . LYS A 1 330 ? 61.535  -47.782 40.126  1.00 158.94 ? 340 LYS A O     1 
ATOM   2620 C CB    . LYS A 1 330 ? 59.502  -45.606 40.021  1.00 176.71 ? 340 LYS A CB    1 
ATOM   2621 C CG    . LYS A 1 330 ? 60.202  -44.335 40.492  1.00 176.46 ? 340 LYS A CG    1 
ATOM   2622 C CD    . LYS A 1 330 ? 59.536  -43.086 39.925  1.00 175.11 ? 340 LYS A CD    1 
ATOM   2623 C CE    . LYS A 1 330 ? 59.858  -41.858 40.766  1.00 176.16 ? 340 LYS A CE    1 
ATOM   2624 N NZ    . LYS A 1 330 ? 59.074  -40.667 40.336  1.00 175.37 ? 340 LYS A NZ    1 
ATOM   2625 N N     . ASP A 1 331 ? 61.574  -47.207 42.306  1.00 201.21 ? 341 ASP A N     1 
ATOM   2626 C CA    . ASP A 1 331 ? 62.889  -47.783 42.579  1.00 201.53 ? 341 ASP A CA    1 
ATOM   2627 C C     . ASP A 1 331 ? 62.862  -49.305 42.515  1.00 202.67 ? 341 ASP A C     1 
ATOM   2628 O O     . ASP A 1 331 ? 63.904  -49.943 42.595  1.00 202.88 ? 341 ASP A O     1 
ATOM   2629 C CB    . ASP A 1 331 ? 63.401  -47.348 43.957  1.00 189.43 ? 341 ASP A CB    1 
ATOM   2630 C CG    . ASP A 1 331 ? 63.620  -45.854 44.056  1.00 188.62 ? 341 ASP A CG    1 
ATOM   2631 O OD1   . ASP A 1 331 ? 64.350  -45.301 43.206  1.00 186.19 ? 341 ASP A OD1   1 
ATOM   2632 O OD2   . ASP A 1 331 ? 63.053  -45.233 44.981  1.00 190.64 ? 341 ASP A OD2   1 
ATOM   2633 N N     . PHE A 1 332 ? 61.666  -49.880 42.420  1.00 172.27 ? 342 PHE A N     1 
ATOM   2634 C CA    . PHE A 1 332 ? 61.499  -51.328 42.294  1.00 173.66 ? 342 PHE A CA    1 
ATOM   2635 C C     . PHE A 1 332 ? 61.714  -51.835 40.863  1.00 171.20 ? 342 PHE A C     1 
ATOM   2636 O O     . PHE A 1 332 ? 62.379  -52.850 40.650  1.00 171.57 ? 342 PHE A O     1 
ATOM   2637 C CB    . PHE A 1 332 ? 60.109  -51.725 42.790  1.00 155.75 ? 342 PHE A CB    1 
ATOM   2638 C CG    . PHE A 1 332 ? 59.951  -53.190 43.074  1.00 158.37 ? 342 PHE A CG    1 
ATOM   2639 C CD1   . PHE A 1 332 ? 60.826  -53.849 43.921  1.00 160.39 ? 342 PHE A CD1   1 
ATOM   2640 C CD2   . PHE A 1 332 ? 58.901  -53.897 42.522  1.00 159.13 ? 342 PHE A CD2   1 
ATOM   2641 C CE1   . PHE A 1 332 ? 60.667  -55.193 44.191  1.00 163.08 ? 342 PHE A CE1   1 
ATOM   2642 C CE2   . PHE A 1 332 ? 58.736  -55.236 42.790  1.00 161.89 ? 342 PHE A CE2   1 
ATOM   2643 C CZ    . PHE A 1 332 ? 59.618  -55.885 43.628  1.00 163.88 ? 342 PHE A CZ    1 
ATOM   2644 N N     . TYR A 1 333 ? 61.095  -51.162 39.895  1.00 142.92 ? 343 TYR A N     1 
ATOM   2645 C CA    . TYR A 1 333 ? 61.223  -51.519 38.479  1.00 140.64 ? 343 TYR A CA    1 
ATOM   2646 C C     . TYR A 1 333 ? 62.414  -50.915 37.718  1.00 137.88 ? 343 TYR A C     1 
ATOM   2647 O O     . TYR A 1 333 ? 62.957  -51.551 36.818  1.00 136.78 ? 343 TYR A O     1 
ATOM   2648 C CB    . TYR A 1 333 ? 59.915  -51.183 37.763  1.00 145.11 ? 343 TYR A CB    1 
ATOM   2649 C CG    . TYR A 1 333 ? 58.832  -52.204 38.057  1.00 147.78 ? 343 TYR A CG    1 
ATOM   2650 C CD1   . TYR A 1 333 ? 58.110  -52.161 39.244  1.00 150.51 ? 343 TYR A CD1   1 
ATOM   2651 C CD2   . TYR A 1 333 ? 58.553  -53.230 37.160  1.00 147.88 ? 343 TYR A CD2   1 
ATOM   2652 C CE1   . TYR A 1 333 ? 57.132  -53.102 39.521  1.00 153.28 ? 343 TYR A CE1   1 
ATOM   2653 C CE2   . TYR A 1 333 ? 57.574  -54.174 37.431  1.00 150.67 ? 343 TYR A CE2   1 
ATOM   2654 C CZ    . TYR A 1 333 ? 56.869  -54.104 38.611  1.00 153.36 ? 343 TYR A CZ    1 
ATOM   2655 O OH    . TYR A 1 333 ? 55.899  -55.038 38.882  1.00 156.42 ? 343 TYR A OH    1 
ATOM   2656 N N     . LEU A 1 334 ? 62.807  -49.692 38.063  1.00 137.01 ? 344 LEU A N     1 
ATOM   2657 C CA    . LEU A 1 334 ? 63.897  -49.015 37.360  1.00 134.68 ? 344 LEU A CA    1 
ATOM   2658 C C     . LEU A 1 334 ? 64.926  -48.440 38.321  1.00 135.45 ? 344 LEU A C     1 
ATOM   2659 O O     . LEU A 1 334 ? 64.581  -48.029 39.425  1.00 137.24 ? 344 LEU A O     1 
ATOM   2660 C CB    . LEU A 1 334 ? 63.351  -47.892 36.477  1.00 140.46 ? 344 LEU A CB    1 
ATOM   2661 C CG    . LEU A 1 334 ? 62.643  -48.273 35.177  1.00 139.06 ? 344 LEU A CG    1 
ATOM   2662 C CD1   . LEU A 1 334 ? 62.012  -47.048 34.517  1.00 137.39 ? 344 LEU A CD1   1 
ATOM   2663 C CD2   . LEU A 1 334 ? 63.612  -48.955 34.224  1.00 137.84 ? 344 LEU A CD2   1 
ATOM   2664 N N     . ALA A 1 335 ? 66.187  -48.397 37.898  1.00 134.31 ? 345 ALA A N     1 
ATOM   2665 C CA    . ALA A 1 335 ? 67.245  -47.827 38.728  1.00 135.12 ? 345 ALA A CA    1 
ATOM   2666 C C     . ALA A 1 335 ? 67.255  -46.304 38.663  1.00 134.13 ? 345 ALA A C     1 
ATOM   2667 O O     . ALA A 1 335 ? 66.849  -45.710 37.669  1.00 132.18 ? 345 ALA A O     1 
ATOM   2668 C CB    . ALA A 1 335 ? 68.597  -48.373 38.322  1.00 161.72 ? 345 ALA A CB    1 
ATOM   2669 N N     . THR A 1 336 ? 67.743  -45.682 39.730  1.00 196.60 ? 346 THR A N     1 
ATOM   2670 C CA    . THR A 1 336 ? 67.758  -44.231 39.841  1.00 196.28 ? 346 THR A CA    1 
ATOM   2671 C C     . THR A 1 336 ? 69.179  -43.702 39.643  1.00 195.80 ? 346 THR A C     1 
ATOM   2672 O O     . THR A 1 336 ? 70.153  -44.382 39.963  1.00 196.62 ? 346 THR A O     1 
ATOM   2673 C CB    . THR A 1 336 ? 67.199  -43.777 41.215  1.00 199.86 ? 346 THR A CB    1 
ATOM   2674 O OG1   . THR A 1 336 ? 65.896  -44.341 41.412  1.00 200.60 ? 346 THR A OG1   1 
ATOM   2675 C CG2   . THR A 1 336 ? 67.102  -42.259 41.309  1.00 199.76 ? 346 THR A CG2   1 
ATOM   2676 N N     . SER A 1 337 ? 69.287  -42.501 39.086  1.00 251.91 ? 347 SER A N     1 
ATOM   2677 C CA    . SER A 1 337 ? 70.567  -41.818 38.924  1.00 251.82 ? 347 SER A CA    1 
ATOM   2678 C C     . SER A 1 337 ? 71.157  -41.426 40.287  1.00 254.46 ? 347 SER A C     1 
ATOM   2679 O O     . SER A 1 337 ? 70.445  -41.441 41.291  1.00 256.22 ? 347 SER A O     1 
ATOM   2680 C CB    . SER A 1 337 ? 70.379  -40.586 38.034  1.00 162.68 ? 347 SER A CB    1 
ATOM   2681 O OG    . SER A 1 337 ? 69.999  -40.962 36.722  1.00 160.39 ? 347 SER A OG    1 
ATOM   2682 N N     . PRO A 1 338 ? 72.463  -41.088 40.332  1.00 169.97 ? 348 PRO A N     1 
ATOM   2683 C CA    . PRO A 1 338 ? 73.086  -40.705 41.608  1.00 172.72 ? 348 PRO A CA    1 
ATOM   2684 C C     . PRO A 1 338 ? 72.408  -39.513 42.287  1.00 174.12 ? 348 PRO A C     1 
ATOM   2685 O O     . PRO A 1 338 ? 71.807  -38.684 41.599  1.00 172.78 ? 348 PRO A O     1 
ATOM   2686 C CB    . PRO A 1 338 ? 74.527  -40.350 41.204  1.00 204.33 ? 348 PRO A CB    1 
ATOM   2687 C CG    . PRO A 1 338 ? 74.489  -40.158 39.717  1.00 201.59 ? 348 PRO A CG    1 
ATOM   2688 C CD    . PRO A 1 338 ? 73.451  -41.117 39.239  1.00 200.02 ? 348 PRO A CD    1 
ATOM   2689 N N     . PRO A 1 339 ? 72.504  -39.432 43.629  1.00 186.59 ? 349 PRO A N     1 
ATOM   2690 C CA    . PRO A 1 339 ? 71.855  -38.367 44.400  1.00 188.42 ? 349 PRO A CA    1 
ATOM   2691 C C     . PRO A 1 339 ? 72.551  -37.020 44.231  1.00 188.96 ? 349 PRO A C     1 
ATOM   2692 O O     . PRO A 1 339 ? 72.033  -36.015 44.716  1.00 190.40 ? 349 PRO A O     1 
ATOM   2693 C CB    . PRO A 1 339 ? 71.973  -38.863 45.843  1.00 204.98 ? 349 PRO A CB    1 
ATOM   2694 C CG    . PRO A 1 339 ? 73.219  -39.672 45.844  1.00 205.16 ? 349 PRO A CG    1 
ATOM   2695 C CD    . PRO A 1 339 ? 73.263  -40.350 44.499  1.00 201.93 ? 349 PRO A CD    1 
ATOM   2696 N N     . ASP A 1 344 ? 72.243  -30.622 46.479  1.00 254.46 ? 354 ASP A N     1 
ATOM   2697 C CA    . ASP A 1 344 ? 72.712  -29.515 47.307  1.00 258.13 ? 354 ASP A CA    1 
ATOM   2698 C C     . ASP A 1 344 ? 73.215  -30.050 48.639  1.00 261.18 ? 354 ASP A C     1 
ATOM   2699 O O     . ASP A 1 344 ? 73.922  -31.059 48.658  1.00 260.50 ? 354 ASP A O     1 
ATOM   2700 C CB    . ASP A 1 344 ? 71.604  -28.489 47.523  1.00 270.12 ? 354 ASP A CB    1 
ATOM   2701 C CG    . ASP A 1 344 ? 72.143  -27.082 47.682  1.00 272.85 ? 354 ASP A CG    1 
ATOM   2702 O OD1   . ASP A 1 344 ? 73.026  -26.690 46.890  1.00 272.10 ? 354 ASP A OD1   1 
ATOM   2703 O OD2   . ASP A 1 344 ? 71.691  -26.369 48.601  1.00 275.99 ? 354 ASP A OD2   1 
ATOM   2704 N N     . ASP A 1 345 ? 72.837  -29.431 49.759  1.00 288.25 ? 355 ASP A N     1 
ATOM   2705 C CA    . ASP A 1 345 ? 73.364  -29.962 51.003  1.00 291.33 ? 355 ASP A CA    1 
ATOM   2706 C C     . ASP A 1 345 ? 72.386  -31.027 51.443  1.00 290.71 ? 355 ASP A C     1 
ATOM   2707 O O     . ASP A 1 345 ? 71.490  -30.801 52.258  1.00 292.84 ? 355 ASP A O     1 
ATOM   2708 C CB    . ASP A 1 345 ? 73.490  -28.860 52.063  1.00 331.95 ? 355 ASP A CB    1 
ATOM   2709 C CG    . ASP A 1 345 ? 74.182  -27.617 51.535  1.00 332.73 ? 355 ASP A CG    1 
ATOM   2710 O OD1   . ASP A 1 345 ? 75.396  -27.695 51.259  1.00 332.81 ? 355 ASP A OD1   1 
ATOM   2711 O OD2   . ASP A 1 345 ? 73.521  -26.562 51.402  1.00 333.47 ? 355 ASP A OD2   1 
ATOM   2712 N N     . HIS A 1 346 ? 72.666  -32.228 50.953  1.00 353.66 ? 356 HIS A N     1 
ATOM   2713 C CA    . HIS A 1 346 ? 71.833  -33.396 51.158  1.00 352.71 ? 356 HIS A CA    1 
ATOM   2714 C C     . HIS A 1 346 ? 72.762  -34.596 51.179  1.00 352.17 ? 356 HIS A C     1 
ATOM   2715 O O     . HIS A 1 346 ? 73.501  -34.826 50.220  1.00 349.71 ? 356 HIS A O     1 
ATOM   2716 C CB    . HIS A 1 346 ? 70.781  -33.517 50.051  1.00 285.03 ? 356 HIS A CB    1 
ATOM   2717 C CG    . HIS A 1 346 ? 69.399  -33.804 50.553  1.00 285.72 ? 356 HIS A CG    1 
ATOM   2718 N ND1   . HIS A 1 346 ? 68.619  -32.855 51.179  1.00 288.04 ? 356 HIS A ND1   1 
ATOM   2719 C CD2   . HIS A 1 346 ? 68.655  -34.935 50.514  1.00 284.63 ? 356 HIS A CD2   1 
ATOM   2720 C CE1   . HIS A 1 346 ? 67.456  -33.389 51.507  1.00 288.32 ? 356 HIS A CE1   1 
ATOM   2721 N NE2   . HIS A 1 346 ? 67.453  -34.651 51.114  1.00 286.31 ? 356 HIS A NE2   1 
ATOM   2722 N N     . HIS A 1 347 ? 72.698  -35.387 52.236  1.00 386.12 ? 357 HIS A N     1 
ATOM   2723 C CA    . HIS A 1 347 ? 73.699  -36.419 52.446  1.00 386.44 ? 357 HIS A CA    1 
ATOM   2724 C C     . HIS A 1 347 ? 73.101  -37.815 52.457  1.00 385.39 ? 357 HIS A C     1 
ATOM   2725 O O     . HIS A 1 347 ? 73.517  -38.669 51.673  1.00 382.90 ? 357 HIS A O     1 
ATOM   2726 C CB    . HIS A 1 347 ? 74.472  -36.177 53.739  1.00 265.82 ? 357 HIS A CB    1 
ATOM   2727 C CG    . HIS A 1 347 ? 75.419  -37.285 54.080  1.00 266.57 ? 357 HIS A CG    1 
ATOM   2728 N ND1   . HIS A 1 347 ? 75.196  -38.156 55.123  1.00 269.10 ? 357 HIS A ND1   1 
ATOM   2729 C CD2   . HIS A 1 347 ? 76.578  -37.678 53.501  1.00 265.25 ? 357 HIS A CD2   1 
ATOM   2730 C CE1   . HIS A 1 347 ? 76.183  -39.031 55.182  1.00 269.30 ? 357 HIS A CE1   1 
ATOM   2731 N NE2   . HIS A 1 347 ? 77.035  -38.764 54.208  1.00 266.97 ? 357 HIS A NE2   1 
ATOM   2732 N N     . LEU A 1 348 ? 72.146  -38.041 53.359  1.00 382.42 ? 358 LEU A N     1 
ATOM   2733 C CA    . LEU A 1 348 ? 71.727  -39.388 53.727  1.00 382.86 ? 358 LEU A CA    1 
ATOM   2734 C C     . LEU A 1 348 ? 71.410  -40.248 52.511  1.00 378.96 ? 358 LEU A C     1 
ATOM   2735 O O     . LEU A 1 348 ? 70.599  -39.891 51.657  1.00 376.45 ? 358 LEU A O     1 
ATOM   2736 C CB    . LEU A 1 348 ? 70.500  -39.326 54.663  1.00 252.12 ? 358 LEU A CB    1 
ATOM   2737 C CG    . LEU A 1 348 ? 69.081  -38.874 54.240  1.00 250.81 ? 358 LEU A CG    1 
ATOM   2738 C CD1   . LEU A 1 348 ? 69.054  -37.661 53.298  1.00 248.40 ? 358 LEU A CD1   1 
ATOM   2739 C CD2   . LEU A 1 348 ? 68.242  -40.024 53.670  1.00 248.78 ? 358 LEU A CD2   1 
ATOM   2740 N N     . THR A 1 349 ? 72.124  -41.363 52.416  1.00 208.84 ? 359 THR A N     1 
ATOM   2741 C CA    . THR A 1 349 ? 71.808  -42.400 51.455  1.00 205.94 ? 359 THR A CA    1 
ATOM   2742 C C     . THR A 1 349 ? 71.945  -43.756 52.140  1.00 207.91 ? 359 THR A C     1 
ATOM   2743 O O     . THR A 1 349 ? 73.059  -44.249 52.317  1.00 208.62 ? 359 THR A O     1 
ATOM   2744 C CB    . THR A 1 349 ? 72.754  -42.323 50.240  1.00 196.72 ? 359 THR A CB    1 
ATOM   2745 O OG1   . THR A 1 349 ? 74.101  -42.168 50.706  1.00 198.38 ? 359 THR A OG1   1 
ATOM   2746 C CG2   . THR A 1 349 ? 72.407  -41.133 49.350  1.00 194.42 ? 359 THR A CG2   1 
ATOM   2747 N N     . ARG A 1 350 ? 70.824  -44.405 52.435  1.00 198.73 ? 360 ARG A N     1 
ATOM   2748 C CA    . ARG A 1 350 ? 70.881  -45.691 53.118  1.00 201.00 ? 360 ARG A CA    1 
ATOM   2749 C C     . ARG A 1 350 ? 71.013  -46.777 52.066  1.00 198.32 ? 360 ARG A C     1 
ATOM   2750 O O     . ARG A 1 350 ? 70.094  -47.000 51.280  1.00 196.26 ? 360 ARG A O     1 
ATOM   2751 C CB    . ARG A 1 350 ? 69.651  -45.916 54.010  1.00 177.21 ? 360 ARG A CB    1 
ATOM   2752 C CG    . ARG A 1 350 ? 68.322  -45.462 53.417  1.00 175.47 ? 360 ARG A CG    1 
ATOM   2753 C CD    . ARG A 1 350 ? 67.186  -45.597 54.435  1.00 178.85 ? 360 ARG A CD    1 
ATOM   2754 N NE    . ARG A 1 350 ? 66.190  -44.533 54.295  1.00 178.33 ? 360 ARG A NE    1 
ATOM   2755 C CZ    . ARG A 1 350 ? 65.169  -44.343 55.127  1.00 181.20 ? 360 ARG A CZ    1 
ATOM   2756 N NH1   . ARG A 1 350 ? 64.999  -45.150 56.167  1.00 184.88 ? 360 ARG A NH1   1 
ATOM   2757 N NH2   . ARG A 1 350 ? 64.317  -43.345 54.921  1.00 180.59 ? 360 ARG A NH2   1 
ATOM   2758 N N     . PRO A 1 351 ? 72.175  -47.445 52.032  1.00 164.99 ? 361 PRO A N     1 
ATOM   2759 C CA    . PRO A 1 351 ? 72.465  -48.402 50.965  1.00 162.47 ? 361 PRO A CA    1 
ATOM   2760 C C     . PRO A 1 351 ? 71.632  -49.669 51.067  1.00 163.48 ? 361 PRO A C     1 
ATOM   2761 O O     . PRO A 1 351 ? 71.241  -50.064 52.160  1.00 166.81 ? 361 PRO A O     1 
ATOM   2762 C CB    . PRO A 1 351 ? 73.947  -48.712 51.172  1.00 163.30 ? 361 PRO A CB    1 
ATOM   2763 C CG    . PRO A 1 351 ? 74.162  -48.518 52.605  1.00 167.22 ? 361 PRO A CG    1 
ATOM   2764 C CD    . PRO A 1 351 ? 73.267  -47.380 53.015  1.00 167.84 ? 361 PRO A CD    1 
ATOM   2765 N N     . HIS A 1 352 ? 71.354  -50.283 49.925  1.00 160.84 ? 362 HIS A N     1 
ATOM   2766 C CA    . HIS A 1 352 ? 70.695  -51.580 49.874  1.00 161.80 ? 362 HIS A CA    1 
ATOM   2767 C C     . HIS A 1 352 ? 71.547  -52.598 50.617  1.00 164.54 ? 362 HIS A C     1 
ATOM   2768 O O     . HIS A 1 352 ? 72.768  -52.583 50.498  1.00 164.07 ? 362 HIS A O     1 
ATOM   2769 C CB    . HIS A 1 352 ? 70.485  -51.997 48.420  1.00 158.46 ? 362 HIS A CB    1 
ATOM   2770 C CG    . HIS A 1 352 ? 69.627  -53.210 48.243  1.00 159.39 ? 362 HIS A CG    1 
ATOM   2771 N ND1   . HIS A 1 352 ? 70.150  -54.477 48.097  1.00 160.26 ? 362 HIS A ND1   1 
ATOM   2772 C CD2   . HIS A 1 352 ? 68.284  -53.345 48.160  1.00 159.76 ? 362 HIS A CD2   1 
ATOM   2773 C CE1   . HIS A 1 352 ? 69.164  -55.342 47.941  1.00 161.23 ? 362 HIS A CE1   1 
ATOM   2774 N NE2   . HIS A 1 352 ? 68.021  -54.682 47.977  1.00 160.95 ? 362 HIS A NE2   1 
ATOM   2775 N N     . PRO A 1 353 ? 70.911  -53.478 51.397  1.00 167.63 ? 363 PRO A N     1 
ATOM   2776 C CA    . PRO A 1 353 ? 71.661  -54.434 52.220  1.00 170.74 ? 363 PRO A CA    1 
ATOM   2777 C C     . PRO A 1 353 ? 72.654  -55.277 51.420  1.00 169.27 ? 363 PRO A C     1 
ATOM   2778 O O     . PRO A 1 353 ? 73.690  -55.663 51.955  1.00 171.02 ? 363 PRO A O     1 
ATOM   2779 C CB    . PRO A 1 353 ? 70.563  -55.312 52.835  1.00 173.78 ? 363 PRO A CB    1 
ATOM   2780 C CG    . PRO A 1 353 ? 69.297  -54.953 52.113  1.00 171.75 ? 363 PRO A CG    1 
ATOM   2781 C CD    . PRO A 1 353 ? 69.463  -53.559 51.636  1.00 168.78 ? 363 PRO A CD    1 
ATOM   2782 N N     . GLU A 1 354 ? 72.353  -55.539 50.154  1.00 166.23 ? 364 GLU A N     1 
ATOM   2783 C CA    . GLU A 1 354 ? 73.263  -56.296 49.307  1.00 164.79 ? 364 GLU A CA    1 
ATOM   2784 C C     . GLU A 1 354 ? 74.276  -55.382 48.614  1.00 161.91 ? 364 GLU A C     1 
ATOM   2785 O O     . GLU A 1 354 ? 75.093  -55.843 47.817  1.00 160.46 ? 364 GLU A O     1 
ATOM   2786 C CB    . GLU A 1 354 ? 72.478  -57.100 48.266  1.00 165.62 ? 364 GLU A CB    1 
ATOM   2787 C CG    . GLU A 1 354 ? 71.597  -58.196 48.855  1.00 168.82 ? 364 GLU A CG    1 
ATOM   2788 C CD    . GLU A 1 354 ? 70.831  -58.976 47.799  1.00 167.63 ? 364 GLU A CD    1 
ATOM   2789 O OE1   . GLU A 1 354 ? 71.090  -58.771 46.590  1.00 164.35 ? 364 GLU A OE1   1 
ATOM   2790 O OE2   . GLU A 1 354 ? 69.970  -59.796 48.184  1.00 170.23 ? 364 GLU A OE2   1 
ATOM   2791 N N     . ARG A 1 355 ? 74.179  -54.082 48.873  1.00 161.20 ? 365 ARG A N     1 
ATOM   2792 C CA    . ARG A 1 355 ? 75.149  -53.116 48.354  1.00 159.06 ? 365 ARG A CA    1 
ATOM   2793 C C     . ARG A 1 355 ? 76.186  -52.685 49.403  1.00 161.46 ? 365 ARG A C     1 
ATOM   2794 O O     . ARG A 1 355 ? 77.064  -51.865 49.123  1.00 160.33 ? 365 ARG A O     1 
ATOM   2795 C CB    . ARG A 1 355 ? 74.418  -51.888 47.800  1.00 161.01 ? 365 ARG A CB    1 
ATOM   2796 C CG    . ARG A 1 355 ? 75.262  -50.991 46.899  1.00 158.33 ? 365 ARG A CG    1 
ATOM   2797 C CD    . ARG A 1 355 ? 74.941  -51.195 45.438  1.00 155.07 ? 365 ARG A CD    1 
ATOM   2798 N NE    . ARG A 1 355 ? 73.637  -50.641 45.104  1.00 153.78 ? 365 ARG A NE    1 
ATOM   2799 C CZ    . ARG A 1 355 ? 73.260  -50.315 43.876  1.00 150.86 ? 365 ARG A CZ    1 
ATOM   2800 N NH1   . ARG A 1 355 ? 72.051  -49.813 43.669  1.00 150.01 ? 365 ARG A NH1   1 
ATOM   2801 N NH2   . ARG A 1 355 ? 74.093  -50.482 42.856  1.00 148.96 ? 365 ARG A NH2   1 
ATOM   2802 N N     . VAL A 1 356 ? 76.087  -53.229 50.612  1.00 322.08 ? 366 VAL A N     1 
ATOM   2803 C CA    . VAL A 1 356 ? 76.931  -52.755 51.711  1.00 324.78 ? 366 VAL A CA    1 
ATOM   2804 C C     . VAL A 1 356 ? 78.458  -52.972 51.602  1.00 325.00 ? 366 VAL A C     1 
ATOM   2805 O O     . VAL A 1 356 ? 79.189  -52.121 52.061  1.00 325.90 ? 366 VAL A O     1 
ATOM   2806 C CB    . VAL A 1 356 ? 76.468  -53.347 53.078  1.00 285.97 ? 366 VAL A CB    1 
ATOM   2807 C CG1   . VAL A 1 356 ? 75.046  -52.908 53.391  1.00 286.39 ? 366 VAL A CG1   1 
ATOM   2808 C CG2   . VAL A 1 356 ? 76.586  -54.861 53.115  1.00 287.44 ? 366 VAL A CG2   1 
ATOM   2809 N N     . PRO A 1 357 ? 78.947  -54.106 51.047  1.00 283.77 ? 367 PRO A N     1 
ATOM   2810 C CA    . PRO A 1 357 ? 80.393  -54.351 51.174  1.00 284.78 ? 367 PRO A CA    1 
ATOM   2811 C C     . PRO A 1 357 ? 81.326  -53.520 50.281  1.00 282.21 ? 367 PRO A C     1 
ATOM   2812 O O     . PRO A 1 357 ? 82.472  -53.278 50.662  1.00 283.61 ? 367 PRO A O     1 
ATOM   2813 C CB    . PRO A 1 357 ? 80.512  -55.826 50.796  1.00 232.77 ? 367 PRO A CB    1 
ATOM   2814 C CG    . PRO A 1 357 ? 79.474  -56.004 49.763  1.00 229.98 ? 367 PRO A CG    1 
ATOM   2815 C CD    . PRO A 1 357 ? 78.330  -55.089 50.135  1.00 229.76 ? 367 PRO A CD    1 
ATOM   2816 N N     . PHE A 1 358 ? 80.850  -53.113 49.108  1.00 269.19 ? 368 PHE A N     1 
ATOM   2817 C CA    . PHE A 1 358 ? 81.735  -52.583 48.072  1.00 266.78 ? 368 PHE A CA    1 
ATOM   2818 C C     . PHE A 1 358 ? 82.164  -51.141 48.320  1.00 266.84 ? 368 PHE A C     1 
ATOM   2819 O O     . PHE A 1 358 ? 83.346  -50.816 48.209  1.00 267.20 ? 368 PHE A O     1 
ATOM   2820 C CB    . PHE A 1 358 ? 81.060  -52.696 46.703  1.00 219.47 ? 368 PHE A CB    1 
ATOM   2821 C CG    . PHE A 1 358 ? 80.268  -53.962 46.525  1.00 219.61 ? 368 PHE A CG    1 
ATOM   2822 C CD1   . PHE A 1 358 ? 80.903  -55.192 46.441  1.00 220.73 ? 368 PHE A CD1   1 
ATOM   2823 C CD2   . PHE A 1 358 ? 78.884  -53.922 46.458  1.00 218.92 ? 368 PHE A CD2   1 
ATOM   2824 C CE1   . PHE A 1 358 ? 80.171  -56.359 46.283  1.00 221.21 ? 368 PHE A CE1   1 
ATOM   2825 C CE2   . PHE A 1 358 ? 78.146  -55.084 46.299  1.00 219.39 ? 368 PHE A CE2   1 
ATOM   2826 C CZ    . PHE A 1 358 ? 78.791  -56.304 46.212  1.00 220.59 ? 368 PHE A CZ    1 
ATOM   2827 N N     . LEU A 1 359 ? 81.205  -50.282 48.658  1.00 453.91 ? 369 LEU A N     1 
ATOM   2828 C CA    . LEU A 1 359 ? 81.489  -48.869 48.898  1.00 454.19 ? 369 LEU A CA    1 
ATOM   2829 C C     . LEU A 1 359 ? 82.488  -48.688 50.036  1.00 457.65 ? 369 LEU A C     1 
ATOM   2830 O O     . LEU A 1 359 ? 83.261  -47.731 50.049  1.00 458.10 ? 369 LEU A O     1 
ATOM   2831 C CB    . LEU A 1 359 ? 80.203  -48.093 49.210  1.00 169.97 ? 369 LEU A CB    1 
ATOM   2832 C CG    . LEU A 1 359 ? 79.556  -48.281 50.587  1.00 173.21 ? 369 LEU A CG    1 
ATOM   2833 C CD1   . LEU A 1 359 ? 78.830  -47.019 51.045  1.00 173.79 ? 369 LEU A CD1   1 
ATOM   2834 C CD2   . LEU A 1 359 ? 78.601  -49.455 50.561  1.00 173.10 ? 369 LEU A CD2   1 
ATOM   2835 N N     . VAL A 1 360 ? 82.470  -49.616 50.987  1.00 384.68 ? 370 VAL A N     1 
ATOM   2836 C CA    . VAL A 1 360 ? 83.355  -49.541 52.142  1.00 388.33 ? 370 VAL A CA    1 
ATOM   2837 C C     . VAL A 1 360 ? 84.779  -49.922 51.809  1.00 388.60 ? 370 VAL A C     1 
ATOM   2838 O O     . VAL A 1 360 ? 85.724  -49.271 52.244  1.00 390.40 ? 370 VAL A O     1 
ATOM   2839 C CB    . VAL A 1 360 ? 82.910  -50.460 53.269  1.00 276.44 ? 370 VAL A CB    1 
ATOM   2840 C CG1   . VAL A 1 360 ? 82.977  -49.731 54.535  1.00 279.87 ? 370 VAL A CG1   1 
ATOM   2841 C CG2   . VAL A 1 360 ? 81.528  -50.919 53.051  1.00 275.21 ? 370 VAL A CG2   1 
ATOM   2842 N N     . ALA A 1 361 ? 84.924  -51.012 51.068  1.00 450.19 ? 371 ALA A N     1 
ATOM   2843 C CA    . ALA A 1 361 ? 86.238  -51.489 50.670  1.00 450.40 ? 371 ALA A CA    1 
ATOM   2844 C C     . ALA A 1 361 ? 86.917  -50.459 49.773  1.00 448.43 ? 371 ALA A C     1 
ATOM   2845 O O     . ALA A 1 361 ? 88.141  -50.331 49.776  1.00 449.59 ? 371 ALA A O     1 
ATOM   2846 C CB    . ALA A 1 361 ? 86.124  -52.831 49.968  1.00 173.62 ? 371 ALA A CB    1 
ATOM   2847 N N     . GLU A 1 362 ? 86.110  -49.720 49.016  1.00 458.36 ? 372 GLU A N     1 
ATOM   2848 C CA    . GLU A 1 362 ? 86.611  -48.646 48.163  1.00 456.63 ? 372 GLU A CA    1 
ATOM   2849 C C     . GLU A 1 362 ? 87.170  -47.496 48.999  1.00 459.15 ? 372 GLU A C     1 
ATOM   2850 O O     . GLU A 1 362 ? 88.259  -46.991 48.725  1.00 459.71 ? 372 GLU A O     1 
ATOM   2851 C CB    . GLU A 1 362 ? 85.502  -48.135 47.239  1.00 253.52 ? 372 GLU A CB    1 
ATOM   2852 C CG    . GLU A 1 362 ? 85.067  -49.130 46.169  1.00 250.86 ? 372 GLU A CG    1 
ATOM   2853 C CD    . GLU A 1 362 ? 85.795  -48.939 44.849  1.00 248.66 ? 372 GLU A CD    1 
ATOM   2854 O OE1   . GLU A 1 362 ? 86.358  -49.925 44.325  1.00 248.32 ? 372 GLU A OE1   1 
ATOM   2855 O OE2   . GLU A 1 362 ? 85.793  -47.804 44.327  1.00 247.46 ? 372 GLU A OE2   1 
ATOM   2856 N N     . THR A 1 363 ? 86.414  -47.085 50.013  1.00 433.18 ? 373 THR A N     1 
ATOM   2857 C CA    . THR A 1 363 ? 86.853  -46.043 50.938  1.00 436.11 ? 373 THR A CA    1 
ATOM   2858 C C     . THR A 1 363 ? 86.820  -46.541 52.381  1.00 439.83 ? 373 THR A C     1 
ATOM   2859 O O     . THR A 1 363 ? 85.873  -46.260 53.116  1.00 440.95 ? 373 THR A O     1 
ATOM   2860 C CB    . THR A 1 363 ? 85.980  -44.772 50.828  1.00 246.53 ? 373 THR A CB    1 
ATOM   2861 O OG1   . THR A 1 363 ? 84.615  -45.143 50.597  1.00 244.51 ? 373 THR A OG1   1 
ATOM   2862 C CG2   . THR A 1 363 ? 86.458  -43.888 49.685  1.00 244.39 ? 373 THR A CG2   1 
ATOM   2863 N N     . PRO A 1 364 ? 87.856  -47.293 52.789  1.00 324.39 ? 374 PRO A N     1 
ATOM   2864 C CA    . PRO A 1 364 ? 87.907  -47.847 54.146  1.00 328.19 ? 374 PRO A CA    1 
ATOM   2865 C C     . PRO A 1 364 ? 88.389  -46.828 55.174  1.00 331.76 ? 374 PRO A C     1 
ATOM   2866 O O     . PRO A 1 364 ? 87.683  -45.852 55.423  1.00 331.93 ? 374 PRO A O     1 
ATOM   2867 C CB    . PRO A 1 364 ? 88.904  -48.997 54.009  1.00 321.89 ? 374 PRO A CB    1 
ATOM   2868 C CG    . PRO A 1 364 ? 89.841  -48.531 52.949  1.00 319.98 ? 374 PRO A CG    1 
ATOM   2869 C CD    . PRO A 1 364 ? 89.016  -47.711 51.981  1.00 316.49 ? 374 PRO A CD    1 
ATOM   2870 N N     . ARG A 1 384 ? 87.448  -49.897 41.239  1.00 241.84 ? 394 ARG A N     1 
ATOM   2871 C CA    . ARG A 1 384 ? 88.628  -49.226 40.707  1.00 242.11 ? 394 ARG A CA    1 
ATOM   2872 C C     . ARG A 1 384 ? 88.472  -49.004 39.210  1.00 239.44 ? 394 ARG A C     1 
ATOM   2873 O O     . ARG A 1 384 ? 88.051  -47.932 38.776  1.00 238.18 ? 394 ARG A O     1 
ATOM   2874 C CB    . ARG A 1 384 ? 89.902  -50.029 40.991  1.00 233.51 ? 394 ARG A CB    1 
ATOM   2875 C CG    . ARG A 1 384 ? 90.364  -50.023 42.448  1.00 236.67 ? 394 ARG A CG    1 
ATOM   2876 C CD    . ARG A 1 384 ? 89.441  -50.849 43.336  1.00 237.39 ? 394 ARG A CD    1 
ATOM   2877 N NE    . ARG A 1 384 ? 90.139  -51.492 44.445  1.00 240.53 ? 394 ARG A NE    1 
ATOM   2878 C CZ    . ARG A 1 384 ? 89.587  -52.403 45.240  1.00 241.82 ? 394 ARG A CZ    1 
ATOM   2879 N NH1   . ARG A 1 384 ? 88.329  -52.779 45.046  1.00 240.26 ? 394 ARG A NH1   1 
ATOM   2880 N NH2   . ARG A 1 384 ? 90.292  -52.942 46.226  1.00 244.87 ? 394 ARG A NH2   1 
ATOM   2881 N N     . LYS A 1 385 ? 88.820  -50.015 38.419  1.00 255.75 ? 395 LYS A N     1 
ATOM   2882 C CA    . LYS A 1 385 ? 88.671  -49.903 36.975  1.00 253.44 ? 395 LYS A CA    1 
ATOM   2883 C C     . LYS A 1 385 ? 87.768  -50.974 36.359  1.00 251.85 ? 395 LYS A C     1 
ATOM   2884 O O     . LYS A 1 385 ? 88.148  -52.140 36.252  1.00 252.57 ? 395 LYS A O     1 
ATOM   2885 C CB    . LYS A 1 385 ? 90.050  -49.949 36.309  1.00 189.43 ? 395 LYS A CB    1 
ATOM   2886 C CG    . LYS A 1 385 ? 90.839  -48.657 36.450  1.00 190.54 ? 395 LYS A CG    1 
ATOM   2887 C CD    . LYS A 1 385 ? 92.063  -48.637 35.549  1.00 191.10 ? 395 LYS A CD    1 
ATOM   2888 C CE    . LYS A 1 385 ? 92.479  -47.206 35.244  1.00 191.47 ? 395 LYS A CE    1 
ATOM   2889 N NZ    . LYS A 1 385 ? 93.798  -47.129 34.560  1.00 192.74 ? 395 LYS A NZ    1 
ATOM   2890 N N     . ALA A 1 386 ? 86.575  -50.558 35.943  1.00 241.69 ? 396 ALA A N     1 
ATOM   2891 C CA    . ALA A 1 386 ? 85.738  -51.351 35.053  1.00 240.00 ? 396 ALA A CA    1 
ATOM   2892 C C     . ALA A 1 386 ? 85.170  -50.439 33.969  1.00 237.77 ? 396 ALA A C     1 
ATOM   2893 O O     . ALA A 1 386 ? 84.326  -49.590 34.249  1.00 237.01 ? 396 ALA A O     1 
ATOM   2894 C CB    . ALA A 1 386 ? 84.618  -52.034 35.829  1.00 139.07 ? 396 ALA A CB    1 
ATOM   2895 N N     . LYS A 1 387 ? 85.603  -50.638 32.728  1.00 135.63 ? 397 LYS A N     1 
ATOM   2896 C CA    . LYS A 1 387 ? 85.173  -49.784 31.623  1.00 133.76 ? 397 LYS A CA    1 
ATOM   2897 C C     . LYS A 1 387 ? 84.797  -50.602 30.404  1.00 132.55 ? 397 LYS A C     1 
ATOM   2898 O O     . LYS A 1 387 ? 85.635  -51.312 29.859  1.00 133.21 ? 397 LYS A O     1 
ATOM   2899 C CB    . LYS A 1 387 ? 86.273  -48.798 31.232  1.00 190.56 ? 397 LYS A CB    1 
ATOM   2900 C CG    . LYS A 1 387 ? 86.222  -47.456 31.933  1.00 191.01 ? 397 LYS A CG    1 
ATOM   2901 C CD    . LYS A 1 387 ? 86.497  -46.322 30.947  1.00 190.36 ? 397 LYS A CD    1 
ATOM   2902 C CE    . LYS A 1 387 ? 87.284  -45.180 31.587  1.00 192.08 ? 397 LYS A CE    1 
ATOM   2903 N NZ    . LYS A 1 387 ? 88.755  -45.446 31.617  1.00 194.01 ? 397 LYS A NZ    1 
ATOM   2904 N N     . TRP A 1 388 ? 83.552  -50.484 29.954  1.00 151.22 ? 398 TRP A N     1 
ATOM   2905 C CA    . TRP A 1 388 ? 83.106  -51.222 28.774  1.00 150.23 ? 398 TRP A CA    1 
ATOM   2906 C C     . TRP A 1 388 ? 83.323  -50.428 27.483  1.00 149.11 ? 398 TRP A C     1 
ATOM   2907 O O     . TRP A 1 388 ? 82.817  -49.317 27.345  1.00 148.11 ? 398 TRP A O     1 
ATOM   2908 C CB    . TRP A 1 388 ? 81.626  -51.600 28.898  1.00 152.26 ? 398 TRP A CB    1 
ATOM   2909 C CG    . TRP A 1 388 ? 81.345  -52.655 29.917  1.00 153.60 ? 398 TRP A CG    1 
ATOM   2910 C CD1   . TRP A 1 388 ? 81.223  -54.002 29.709  1.00 154.38 ? 398 TRP A CD1   1 
ATOM   2911 C CD2   . TRP A 1 388 ? 81.139  -52.446 31.317  1.00 154.62 ? 398 TRP A CD2   1 
ATOM   2912 N NE1   . TRP A 1 388 ? 80.960  -54.642 30.897  1.00 155.85 ? 398 TRP A NE1   1 
ATOM   2913 C CE2   . TRP A 1 388 ? 80.903  -53.711 31.900  1.00 156.01 ? 398 TRP A CE2   1 
ATOM   2914 C CE3   . TRP A 1 388 ? 81.135  -51.309 32.139  1.00 154.73 ? 398 TRP A CE3   1 
ATOM   2915 C CZ2   . TRP A 1 388 ? 80.665  -53.869 33.278  1.00 157.50 ? 398 TRP A CZ2   1 
ATOM   2916 C CZ3   . TRP A 1 388 ? 80.898  -51.469 33.510  1.00 156.20 ? 398 TRP A CZ3   1 
ATOM   2917 C CH2   . TRP A 1 388 ? 80.666  -52.741 34.061  1.00 157.55 ? 398 TRP A CH2   1 
ATOM   2918 N N     . HIS A 1 389 ? 84.076  -51.003 26.546  1.00 129.23 ? 399 HIS A N     1 
ATOM   2919 C CA    . HIS A 1 389 ? 84.254  -50.418 25.218  1.00 128.45 ? 399 HIS A CA    1 
ATOM   2920 C C     . HIS A 1 389 ? 82.977  -50.588 24.405  1.00 126.96 ? 399 HIS A C     1 
ATOM   2921 O O     . HIS A 1 389 ? 82.116  -51.400 24.752  1.00 126.81 ? 399 HIS A O     1 
ATOM   2922 C CB    . HIS A 1 389 ? 85.440  -51.060 24.488  1.00 219.12 ? 399 HIS A CB    1 
ATOM   2923 C CG    . HIS A 1 389 ? 86.614  -50.147 24.308  1.00 219.98 ? 399 HIS A CG    1 
ATOM   2924 N ND1   . HIS A 1 389 ? 87.028  -49.262 25.281  1.00 220.61 ? 399 HIS A ND1   1 
ATOM   2925 C CD2   . HIS A 1 389 ? 87.468  -49.990 23.269  1.00 220.63 ? 399 HIS A CD2   1 
ATOM   2926 C CE1   . HIS A 1 389 ? 88.083  -48.596 24.847  1.00 221.62 ? 399 HIS A CE1   1 
ATOM   2927 N NE2   . HIS A 1 389 ? 88.371  -49.019 23.629  1.00 221.64 ? 399 HIS A NE2   1 
ATOM   2928 N N     . LEU A 1 390 ? 82.845  -49.803 23.340  1.00 139.61 ? 400 LEU A N     1 
ATOM   2929 C CA    . LEU A 1 390 ? 81.692  -49.906 22.446  1.00 138.37 ? 400 LEU A CA    1 
ATOM   2930 C C     . LEU A 1 390 ? 81.648  -51.229 21.687  1.00 138.88 ? 400 LEU A C     1 
ATOM   2931 O O     . LEU A 1 390 ? 80.627  -51.909 21.669  1.00 138.52 ? 400 LEU A O     1 
ATOM   2932 C CB    . LEU A 1 390 ? 81.689  -48.753 21.446  1.00 151.86 ? 400 LEU A CB    1 
ATOM   2933 C CG    . LEU A 1 390 ? 80.663  -48.828 20.312  1.00 150.83 ? 400 LEU A CG    1 
ATOM   2934 C CD1   . LEU A 1 390 ? 79.249  -49.056 20.825  1.00 149.87 ? 400 LEU A CD1   1 
ATOM   2935 C CD2   . LEU A 1 390 ? 80.721  -47.537 19.545  1.00 150.38 ? 400 LEU A CD2   1 
ATOM   2936 N N     . GLY A 1 391 ? 82.756  -51.588 21.056  1.00 126.43 ? 401 GLY A N     1 
ATOM   2937 C CA    . GLY A 1 391 ? 82.829  -52.803 20.271  1.00 127.23 ? 401 GLY A CA    1 
ATOM   2938 C C     . GLY A 1 391 ? 84.283  -53.043 19.945  1.00 128.72 ? 401 GLY A C     1 
ATOM   2939 O O     . GLY A 1 391 ? 85.163  -52.513 20.625  1.00 129.27 ? 401 GLY A O     1 
ATOM   2940 N N     . ILE A 1 392 ? 84.555  -53.858 18.933  1.00 129.62 ? 402 ILE A N     1 
ATOM   2941 C CA    . ILE A 1 392 ? 85.930  -54.021 18.474  1.00 131.18 ? 402 ILE A CA    1 
ATOM   2942 C C     . ILE A 1 392 ? 86.416  -52.762 17.731  1.00 130.97 ? 402 ILE A C     1 
ATOM   2943 O O     . ILE A 1 392 ? 85.799  -52.290 16.770  1.00 130.21 ? 402 ILE A O     1 
ATOM   2944 C CB    . ILE A 1 392 ? 86.082  -55.278 17.578  1.00 182.73 ? 402 ILE A CB    1 
ATOM   2945 C CG1   . ILE A 1 392 ? 87.556  -55.562 17.293  1.00 184.63 ? 402 ILE A CG1   1 
ATOM   2946 C CG2   . ILE A 1 392 ? 85.302  -55.144 16.283  1.00 182.16 ? 402 ILE A CG2   1 
ATOM   2947 C CD1   . ILE A 1 392 ? 87.792  -56.912 16.669  1.00 186.29 ? 402 ILE A CD1   1 
ATOM   2948 N N     . ARG A 1 393 ? 87.524  -52.203 18.206  1.00 151.08 ? 403 ARG A N     1 
ATOM   2949 C CA    . ARG A 1 393 ? 88.060  -50.971 17.636  1.00 151.28 ? 403 ARG A CA    1 
ATOM   2950 C C     . ARG A 1 393 ? 89.429  -51.204 17.030  1.00 153.35 ? 403 ARG A C     1 
ATOM   2951 O O     . ARG A 1 393 ? 90.285  -51.843 17.643  1.00 154.65 ? 403 ARG A O     1 
ATOM   2952 C CB    . ARG A 1 393 ? 88.150  -49.863 18.694  1.00 155.51 ? 403 ARG A CB    1 
ATOM   2953 C CG    . ARG A 1 393 ? 86.983  -48.890 18.664  1.00 153.74 ? 403 ARG A CG    1 
ATOM   2954 C CD    . ARG A 1 393 ? 87.242  -47.626 19.472  1.00 153.80 ? 403 ARG A CD    1 
ATOM   2955 N NE    . ARG A 1 393 ? 86.334  -47.511 20.610  1.00 152.64 ? 403 ARG A NE    1 
ATOM   2956 C CZ    . ARG A 1 393 ? 86.002  -46.362 21.191  1.00 152.20 ? 403 ARG A CZ    1 
ATOM   2957 N NH1   . ARG A 1 393 ? 86.493  -45.218 20.733  1.00 152.84 ? 403 ARG A NH1   1 
ATOM   2958 N NH2   . ARG A 1 393 ? 85.170  -46.358 22.228  1.00 151.35 ? 403 ARG A NH2   1 
ATOM   2959 N N     . SER A 1 394 ? 89.625  -50.688 15.820  1.00 134.62 ? 404 SER A N     1 
ATOM   2960 C CA    . SER A 1 394 ? 90.918  -50.757 15.145  1.00 136.81 ? 404 SER A CA    1 
ATOM   2961 C C     . SER A 1 394 ? 91.086  -49.557 14.219  1.00 137.22 ? 404 SER A C     1 
ATOM   2962 O O     . SER A 1 394 ? 90.103  -49.008 13.715  1.00 135.86 ? 404 SER A O     1 
ATOM   2963 C CB    . SER A 1 394 ? 91.059  -52.069 14.362  1.00 201.92 ? 404 SER A CB    1 
ATOM   2964 O OG    . SER A 1 394 ? 90.065  -52.187 13.361  1.00 201.07 ? 404 SER A OG    1 
ATOM   2965 N N     . GLN A 1 395 ? 92.328  -49.129 14.016  1.00 139.26 ? 405 GLN A N     1 
ATOM   2966 C CA    . GLN A 1 395 ? 92.565  -48.005 13.128  1.00 140.11 ? 405 GLN A CA    1 
ATOM   2967 C C     . GLN A 1 395 ? 93.332  -48.422 11.880  1.00 142.29 ? 405 GLN A C     1 
ATOM   2968 O O     . GLN A 1 395 ? 94.561  -48.397 11.843  1.00 144.55 ? 405 GLN A O     1 
ATOM   2969 C CB    . GLN A 1 395 ? 93.337  -46.916 13.882  1.00 163.18 ? 405 GLN A CB    1 
ATOM   2970 C CG    . GLN A 1 395 ? 94.510  -47.461 14.712  1.00 164.82 ? 405 GLN A CG    1 
ATOM   2971 C CD    . GLN A 1 395 ? 95.255  -46.392 15.497  1.00 166.04 ? 405 GLN A CD    1 
ATOM   2972 O OE1   . GLN A 1 395 ? 94.833  -45.236 15.562  1.00 165.53 ? 405 GLN A OE1   1 
ATOM   2973 N NE2   . GLN A 1 395 ? 96.372  -46.781 16.103  1.00 167.88 ? 405 GLN A NE2   1 
ATOM   2974 N N     . SER A 1 396 ? 92.582  -48.662 10.814  1.00 161.73 ? 406 SER A N     1 
ATOM   2975 C CA    . SER A 1 396 ? 93.132  -48.994 9.509   1.00 163.86 ? 406 SER A CA    1 
ATOM   2976 C C     . SER A 1 396 ? 92.137  -48.444 8.500   1.00 163.04 ? 406 SER A C     1 
ATOM   2977 O O     . SER A 1 396 ? 91.170  -47.799 8.891   1.00 160.97 ? 406 SER A O     1 
ATOM   2978 C CB    . SER A 1 396 ? 93.353  -50.501 9.342   1.00 144.73 ? 406 SER A CB    1 
ATOM   2979 O OG    . SER A 1 396 ? 93.605  -50.837 7.986   1.00 146.61 ? 406 SER A OG    1 
ATOM   2980 N N     . ARG A 1 397 ? 92.357  -48.686 7.214   1.00 144.88 ? 407 ARG A N     1 
ATOM   2981 C CA    . ARG A 1 397 ? 91.561  -48.029 6.178   1.00 144.63 ? 407 ARG A CA    1 
ATOM   2982 C C     . ARG A 1 397 ? 90.138  -48.588 6.077   1.00 142.44 ? 407 ARG A C     1 
ATOM   2983 O O     . ARG A 1 397 ? 89.918  -49.763 6.352   1.00 142.03 ? 407 ARG A O     1 
ATOM   2984 C CB    . ARG A 1 397 ? 92.267  -48.154 4.833   1.00 179.37 ? 407 ARG A CB    1 
ATOM   2985 C CG    . ARG A 1 397 ? 93.774  -48.132 4.918   1.00 182.01 ? 407 ARG A CG    1 
ATOM   2986 C CD    . ARG A 1 397 ? 94.365  -48.142 3.521   1.00 185.05 ? 407 ARG A CD    1 
ATOM   2987 N NE    . ARG A 1 397 ? 95.821  -48.092 3.539   1.00 187.90 ? 407 ARG A NE    1 
ATOM   2988 C CZ    . ARG A 1 397 ? 96.567  -47.747 2.495   1.00 191.02 ? 407 ARG A CZ    1 
ATOM   2989 N NH1   . ARG A 1 397 ? 95.994  -47.413 1.346   1.00 191.67 ? 407 ARG A NH1   1 
ATOM   2990 N NH2   . ARG A 1 397 ? 97.889  -47.730 2.604   1.00 193.67 ? 407 ARG A NH2   1 
ATOM   2991 N N     . PRO A 1 398 ? 89.172  -47.751 5.657   1.00 141.28 ? 408 PRO A N     1 
ATOM   2992 C CA    . PRO A 1 398 ? 87.763  -48.154 5.723   1.00 139.12 ? 408 PRO A CA    1 
ATOM   2993 C C     . PRO A 1 398 ? 87.432  -49.342 4.816   1.00 140.06 ? 408 PRO A C     1 
ATOM   2994 O O     . PRO A 1 398 ? 86.691  -50.227 5.242   1.00 138.83 ? 408 PRO A O     1 
ATOM   2995 C CB    . PRO A 1 398 ? 87.018  -46.891 5.275   1.00 275.58 ? 408 PRO A CB    1 
ATOM   2996 C CG    . PRO A 1 398 ? 87.981  -46.179 4.397   1.00 278.09 ? 408 PRO A CG    1 
ATOM   2997 C CD    . PRO A 1 398 ? 89.350  -46.475 4.937   1.00 279.59 ? 408 PRO A CD    1 
ATOM   2998 N N     . ASN A 1 399 ? 87.967  -49.354 3.593   1.00 155.51 ? 409 ASN A N     1 
ATOM   2999 C CA    . ASN A 1 399 ? 87.777  -50.475 2.666   1.00 156.96 ? 409 ASN A CA    1 
ATOM   3000 C C     . ASN A 1 399 ? 88.734  -51.616 2.990   1.00 158.40 ? 409 ASN A C     1 
ATOM   3001 O O     . ASN A 1 399 ? 88.464  -52.779 2.689   1.00 159.11 ? 409 ASN A O     1 
ATOM   3002 C CB    . ASN A 1 399 ? 87.971  -50.032 1.206   1.00 201.40 ? 409 ASN A CB    1 
ATOM   3003 C CG    . ASN A 1 399 ? 86.794  -49.225 0.667   1.00 200.25 ? 409 ASN A CG    1 
ATOM   3004 O OD1   . ASN A 1 399 ? 85.654  -49.400 1.100   1.00 198.06 ? 409 ASN A OD1   1 
ATOM   3005 N ND2   . ASN A 1 399 ? 87.070  -48.340 -0.286  1.00 201.95 ? 409 ASN A ND2   1 
ATOM   3006 N N     . ASP A 1 400 ? 89.854  -51.269 3.612   1.00 159.39 ? 410 ASP A N     1 
ATOM   3007 C CA    . ASP A 1 400 ? 90.881  -52.244 3.951   1.00 160.97 ? 410 ASP A CA    1 
ATOM   3008 C C     . ASP A 1 400 ? 90.472  -53.091 5.157   1.00 159.19 ? 410 ASP A C     1 
ATOM   3009 O O     . ASP A 1 400 ? 90.725  -54.296 5.182   1.00 160.30 ? 410 ASP A O     1 
ATOM   3010 C CB    . ASP A 1 400 ? 92.212  -51.535 4.224   1.00 211.50 ? 410 ASP A CB    1 
ATOM   3011 C CG    . ASP A 1 400 ? 93.421  -52.401 3.909   1.00 214.35 ? 410 ASP A CG    1 
ATOM   3012 O OD1   . ASP A 1 400 ? 93.411  -53.597 4.265   1.00 214.42 ? 410 ASP A OD1   1 
ATOM   3013 O OD2   . ASP A 1 400 ? 94.385  -51.882 3.305   1.00 216.72 ? 410 ASP A OD2   1 
ATOM   3014 N N     . ILE A 1 401 ? 89.842  -52.471 6.154   1.00 148.32 ? 411 ILE A N     1 
ATOM   3015 C CA    . ILE A 1 401 ? 89.451  -53.207 7.359   1.00 146.80 ? 411 ILE A CA    1 
ATOM   3016 C C     . ILE A 1 401 ? 88.346  -54.225 7.089   1.00 146.28 ? 411 ILE A C     1 
ATOM   3017 O O     . ILE A 1 401 ? 88.443  -55.367 7.531   1.00 146.83 ? 411 ILE A O     1 
ATOM   3018 C CB    . ILE A 1 401 ? 88.985  -52.270 8.506   1.00 200.64 ? 411 ILE A CB    1 
ATOM   3019 C CG1   . ILE A 1 401 ? 87.871  -51.326 8.053   1.00 199.07 ? 411 ILE A CG1   1 
ATOM   3020 C CG2   . ILE A 1 401 ? 90.143  -51.481 9.059   1.00 201.40 ? 411 ILE A CG2   1 
ATOM   3021 C CD1   . ILE A 1 401 ? 87.676  -50.151 8.977   1.00 197.41 ? 411 ILE A CD1   1 
ATOM   3022 N N     . MET A 1 402 ? 87.304  -53.816 6.365   1.00 140.39 ? 412 MET A N     1 
ATOM   3023 C CA    . MET A 1 402 ? 86.172  -54.696 6.088   1.00 140.04 ? 412 MET A CA    1 
ATOM   3024 C C     . MET A 1 402 ? 86.621  -55.899 5.271   1.00 142.64 ? 412 MET A C     1 
ATOM   3025 O O     . MET A 1 402 ? 86.101  -57.000 5.434   1.00 142.97 ? 412 MET A O     1 
ATOM   3026 C CB    . MET A 1 402 ? 85.058  -53.949 5.349   1.00 182.81 ? 412 MET A CB    1 
ATOM   3027 C CG    . MET A 1 402 ? 84.508  -52.753 6.086   1.00 180.40 ? 412 MET A CG    1 
ATOM   3028 S SD    . MET A 1 402 ? 84.079  -53.154 7.782   1.00 178.42 ? 412 MET A SD    1 
ATOM   3029 C CE    . MET A 1 402 ? 82.788  -54.356 7.539   1.00 178.39 ? 412 MET A CE    1 
ATOM   3030 N N     . ALA A 1 403 ? 87.593  -55.681 4.391   1.00 144.74 ? 413 ALA A N     1 
ATOM   3031 C CA    . ALA A 1 403 ? 88.174  -56.767 3.614   1.00 147.57 ? 413 ALA A CA    1 
ATOM   3032 C C     . ALA A 1 403 ? 88.928  -57.734 4.525   1.00 148.27 ? 413 ALA A C     1 
ATOM   3033 O O     . ALA A 1 403 ? 88.845  -58.949 4.354   1.00 149.76 ? 413 ALA A O     1 
ATOM   3034 C CB    . ALA A 1 403 ? 89.097  -56.216 2.534   1.00 317.20 ? 413 ALA A CB    1 
ATOM   3035 N N     . GLU A 1 404 ? 89.656  -57.183 5.496   1.00 156.54 ? 414 GLU A N     1 
ATOM   3036 C CA    . GLU A 1 404 ? 90.407  -57.985 6.462   1.00 157.17 ? 414 GLU A CA    1 
ATOM   3037 C C     . GLU A 1 404 ? 89.463  -58.749 7.397   1.00 155.70 ? 414 GLU A C     1 
ATOM   3038 O O     . GLU A 1 404 ? 89.779  -59.849 7.860   1.00 156.88 ? 414 GLU A O     1 
ATOM   3039 C CB    . GLU A 1 404 ? 91.356  -57.092 7.267   1.00 209.66 ? 414 GLU A CB    1 
ATOM   3040 C CG    . GLU A 1 404 ? 92.333  -57.854 8.147   1.00 210.82 ? 414 GLU A CG    1 
ATOM   3041 C CD    . GLU A 1 404 ? 93.309  -56.942 8.868   1.00 210.71 ? 414 GLU A CD    1 
ATOM   3042 O OE1   . GLU A 1 404 ? 93.184  -55.706 8.731   1.00 209.69 ? 414 GLU A OE1   1 
ATOM   3043 O OE2   . GLU A 1 404 ? 94.202  -57.463 9.570   1.00 211.85 ? 414 GLU A OE2   1 
ATOM   3044 N N     . VAL A 1 405 ? 88.302  -58.155 7.663   1.00 144.18 ? 415 VAL A N     1 
ATOM   3045 C CA    . VAL A 1 405 ? 87.253  -58.799 8.450   1.00 142.91 ? 415 VAL A CA    1 
ATOM   3046 C C     . VAL A 1 405 ? 86.520  -59.853 7.629   1.00 144.32 ? 415 VAL A C     1 
ATOM   3047 O O     . VAL A 1 405 ? 86.174  -60.922 8.137   1.00 144.91 ? 415 VAL A O     1 
ATOM   3048 C CB    . VAL A 1 405 ? 86.228  -57.770 8.970   1.00 140.11 ? 415 VAL A CB    1 
ATOM   3049 C CG1   . VAL A 1 405 ? 85.066  -58.468 9.666   1.00 139.15 ? 415 VAL A CG1   1 
ATOM   3050 C CG2   . VAL A 1 405 ? 86.900  -56.778 9.904   1.00 138.93 ? 415 VAL A CG2   1 
ATOM   3051 N N     . CYS A 1 406 ? 86.302  -59.540 6.351   1.00 145.11 ? 416 CYS A N     1 
ATOM   3052 C CA    . CYS A 1 406 ? 85.605  -60.424 5.418   1.00 146.74 ? 416 CYS A CA    1 
ATOM   3053 C C     . CYS A 1 406 ? 86.363  -61.736 5.200   1.00 149.67 ? 416 CYS A C     1 
ATOM   3054 O O     . CYS A 1 406 ? 85.801  -62.722 4.720   1.00 151.30 ? 416 CYS A O     1 
ATOM   3055 C CB    . CYS A 1 406 ? 85.379  -59.714 4.082   1.00 221.58 ? 416 CYS A CB    1 
ATOM   3056 S SG    . CYS A 1 406 ? 84.280  -60.582 2.952   1.00 223.36 ? 416 CYS A SG    1 
ATOM   3057 N N     . ARG A 1 407 ? 87.646  -61.736 5.551   1.00 159.47 ? 417 ARG A N     1 
ATOM   3058 C CA    . ARG A 1 407 ? 88.461  -62.945 5.541   1.00 162.18 ? 417 ARG A CA    1 
ATOM   3059 C C     . ARG A 1 407 ? 88.119  -63.832 6.732   1.00 161.79 ? 417 ARG A C     1 
ATOM   3060 O O     . ARG A 1 407 ? 87.883  -65.032 6.588   1.00 163.78 ? 417 ARG A O     1 
ATOM   3061 C CB    . ARG A 1 407 ? 89.946  -62.580 5.566   1.00 187.20 ? 417 ARG A CB    1 
ATOM   3062 C CG    . ARG A 1 407 ? 90.886  -63.762 5.617   1.00 190.06 ? 417 ARG A CG    1 
ATOM   3063 C CD    . ARG A 1 407 ? 91.830  -63.654 6.803   1.00 189.58 ? 417 ARG A CD    1 
ATOM   3064 N NE    . ARG A 1 407 ? 93.140  -64.228 6.504   1.00 192.51 ? 417 ARG A NE    1 
ATOM   3065 C CZ    . ARG A 1 407 ? 94.035  -64.583 7.423   1.00 193.16 ? 417 ARG A CZ    1 
ATOM   3066 N NH1   . ARG A 1 407 ? 93.758  -64.437 8.711   1.00 191.11 ? 417 ARG A NH1   1 
ATOM   3067 N NH2   . ARG A 1 407 ? 95.204  -65.095 7.053   1.00 196.03 ? 417 ARG A NH2   1 
ATOM   3068 N N     . ALA A 1 408 ? 88.082  -63.220 7.910   1.00 185.66 ? 418 ALA A N     1 
ATOM   3069 C CA    . ALA A 1 408 ? 87.829  -63.938 9.150   1.00 185.31 ? 418 ALA A CA    1 
ATOM   3070 C C     . ALA A 1 408 ? 86.412  -64.499 9.212   1.00 184.92 ? 418 ALA A C     1 
ATOM   3071 O O     . ALA A 1 408 ? 86.192  -65.605 9.702   1.00 186.28 ? 418 ALA A O     1 
ATOM   3072 C CB    . ALA A 1 408 ? 88.082  -63.030 10.331  1.00 236.85 ? 418 ALA A CB    1 
ATOM   3073 N N     . ILE A 1 409 ? 85.454  -63.726 8.716   1.00 148.10 ? 419 ILE A N     1 
ATOM   3074 C CA    . ILE A 1 409 ? 84.061  -64.146 8.713   1.00 147.76 ? 419 ILE A CA    1 
ATOM   3075 C C     . ILE A 1 409 ? 83.858  -65.419 7.882   1.00 150.82 ? 419 ILE A C     1 
ATOM   3076 O O     . ILE A 1 409 ? 82.991  -66.242 8.185   1.00 151.59 ? 419 ILE A O     1 
ATOM   3077 C CB    . ILE A 1 409 ? 83.163  -63.016 8.190   1.00 168.01 ? 419 ILE A CB    1 
ATOM   3078 C CG1   . ILE A 1 409 ? 81.701  -63.330 8.435   1.00 167.38 ? 419 ILE A CG1   1 
ATOM   3079 C CG2   . ILE A 1 409 ? 83.383  -62.762 6.710   1.00 169.31 ? 419 ILE A CG2   1 
ATOM   3080 C CD1   . ILE A 1 409 ? 80.873  -62.158 8.162   1.00 165.12 ? 419 ILE A CD1   1 
ATOM   3081 N N     . LYS A 1 410 ? 84.680  -65.579 6.846   1.00 155.86 ? 420 LYS A N     1 
ATOM   3082 C CA    . LYS A 1 410 ? 84.648  -66.761 5.995   1.00 159.17 ? 420 LYS A CA    1 
ATOM   3083 C C     . LYS A 1 410 ? 85.326  -67.920 6.685   1.00 161.23 ? 420 LYS A C     1 
ATOM   3084 O O     . LYS A 1 410 ? 84.825  -69.044 6.690   1.00 163.33 ? 420 LYS A O     1 
ATOM   3085 C CB    . LYS A 1 410 ? 85.343  -66.493 4.658   1.00 185.37 ? 420 LYS A CB    1 
ATOM   3086 C CG    . LYS A 1 410 ? 85.071  -67.546 3.589   1.00 188.80 ? 420 LYS A CG    1 
ATOM   3087 C CD    . LYS A 1 410 ? 85.731  -67.170 2.272   1.00 190.46 ? 420 LYS A CD    1 
ATOM   3088 C CE    . LYS A 1 410 ? 85.093  -67.890 1.098   1.00 193.34 ? 420 LYS A CE    1 
ATOM   3089 N NZ    . LYS A 1 410 ? 85.572  -67.336 -0.197  1.00 194.72 ? 420 LYS A NZ    1 
ATOM   3090 N N     . GLN A 1 411 ? 86.479  -67.618 7.267   1.00 157.76 ? 421 GLN A N     1 
ATOM   3091 C CA    . GLN A 1 411 ? 87.376  -68.627 7.801   1.00 159.98 ? 421 GLN A CA    1 
ATOM   3092 C C     . GLN A 1 411 ? 86.674  -69.560 8.774   1.00 160.44 ? 421 GLN A C     1 
ATOM   3093 O O     . GLN A 1 411 ? 86.982  -70.750 8.835   1.00 163.30 ? 421 GLN A O     1 
ATOM   3094 C CB    . GLN A 1 411 ? 88.564  -67.958 8.487   1.00 182.09 ? 421 GLN A CB    1 
ATOM   3095 C CG    . GLN A 1 411 ? 89.865  -68.717 8.333   1.00 185.01 ? 421 GLN A CG    1 
ATOM   3096 C CD    . GLN A 1 411 ? 90.910  -68.281 9.337   1.00 184.13 ? 421 GLN A CD    1 
ATOM   3097 O OE1   . GLN A 1 411 ? 90.894  -68.713 10.489  1.00 183.87 ? 421 GLN A OE1   1 
ATOM   3098 N NE2   . GLN A 1 411 ? 91.823  -67.417 8.909   1.00 183.90 ? 421 GLN A NE2   1 
ATOM   3099 N N     . LEU A 1 412 ? 85.721  -69.013 9.522   1.00 162.52 ? 422 LEU A N     1 
ATOM   3100 C CA    . LEU A 1 412 ? 85.002  -69.778 10.531  1.00 162.88 ? 422 LEU A CA    1 
ATOM   3101 C C     . LEU A 1 412 ? 84.097  -70.853 9.941   1.00 165.42 ? 422 LEU A C     1 
ATOM   3102 O O     . LEU A 1 412 ? 83.792  -71.823 10.638  1.00 167.06 ? 422 LEU A O     1 
ATOM   3103 C CB    . LEU A 1 412 ? 84.162  -68.850 11.406  1.00 154.92 ? 422 LEU A CB    1 
ATOM   3104 C CG    . LEU A 1 412 ? 84.786  -68.041 12.541  1.00 152.71 ? 422 LEU A CG    1 
ATOM   3105 C CD1   . LEU A 1 412 ? 83.678  -67.395 13.361  1.00 150.19 ? 422 LEU A CD1   1 
ATOM   3106 C CD2   . LEU A 1 412 ? 85.677  -68.910 13.418  1.00 154.56 ? 422 LEU A CD2   1 
ATOM   3107 N N     . ASP A 1 413 ? 83.737  -70.691 8.660   1.00 161.39 ? 423 ASP A N     1 
ATOM   3108 C CA    . ASP A 1 413 ? 82.698  -71.468 7.945   1.00 163.56 ? 423 ASP A CA    1 
ATOM   3109 C C     . ASP A 1 413 ? 81.294  -70.857 8.057   1.00 161.39 ? 423 ASP A C     1 
ATOM   3110 O O     . ASP A 1 413 ? 80.315  -71.466 7.622   1.00 163.10 ? 423 ASP A O     1 
ATOM   3111 C CB    . ASP A 1 413 ? 82.657  -72.936 8.396   1.00 178.53 ? 423 ASP A CB    1 
ATOM   3112 C CG    . ASP A 1 413 ? 82.511  -73.904 7.235   1.00 182.34 ? 423 ASP A CG    1 
ATOM   3113 O OD1   . ASP A 1 413 ? 81.529  -73.782 6.471   1.00 182.58 ? 423 ASP A OD1   1 
ATOM   3114 O OD2   . ASP A 1 413 ? 83.385  -74.785 7.084   1.00 185.27 ? 423 ASP A OD2   1 
ATOM   3115 N N     . TYR A 1 414 ? 81.188  -69.694 8.691   1.00 157.87 ? 424 TYR A N     1 
ATOM   3116 C CA    . TYR A 1 414 ? 79.934  -68.938 8.714   1.00 155.63 ? 424 TYR A CA    1 
ATOM   3117 C C     . TYR A 1 414 ? 79.785  -68.202 7.371   1.00 155.21 ? 424 TYR A C     1 
ATOM   3118 O O     . TYR A 1 414 ? 80.728  -68.180 6.588   1.00 156.36 ? 424 TYR A O     1 
ATOM   3119 C CB    . TYR A 1 414 ? 79.928  -67.948 9.893   1.00 253.86 ? 424 TYR A CB    1 
ATOM   3120 C CG    . TYR A 1 414 ? 80.106  -68.577 11.278  1.00 254.26 ? 424 TYR A CG    1 
ATOM   3121 C CD1   . TYR A 1 414 ? 81.000  -69.613 11.498  1.00 256.81 ? 424 TYR A CD1   1 
ATOM   3122 C CD2   . TYR A 1 414 ? 79.404  -68.107 12.367  1.00 252.23 ? 424 TYR A CD2   1 
ATOM   3123 C CE1   . TYR A 1 414 ? 81.164  -70.182 12.750  1.00 257.37 ? 424 TYR A CE1   1 
ATOM   3124 C CE2   . TYR A 1 414 ? 79.541  -68.688 13.628  1.00 252.87 ? 424 TYR A CE2   1 
ATOM   3125 C CZ    . TYR A 1 414 ? 80.422  -69.720 13.811  1.00 255.43 ? 424 TYR A CZ    1 
ATOM   3126 O OH    . TYR A 1 414 ? 80.568  -70.278 15.065  1.00 256.21 ? 424 TYR A OH    1 
ATOM   3127 N N     . GLU A 1 415 ? 78.648  -67.557 7.115   1.00 169.58 ? 425 GLU A N     1 
ATOM   3128 C CA    . GLU A 1 415 ? 78.421  -66.933 5.803   1.00 169.58 ? 425 GLU A CA    1 
ATOM   3129 C C     . GLU A 1 415 ? 77.891  -65.505 5.904   1.00 166.20 ? 425 GLU A C     1 
ATOM   3130 O O     . GLU A 1 415 ? 77.337  -65.123 6.933   1.00 164.10 ? 425 GLU A O     1 
ATOM   3131 C CB    . GLU A 1 415 ? 77.461  -67.784 4.964   1.00 158.58 ? 425 GLU A CB    1 
ATOM   3132 C CG    . GLU A 1 415 ? 76.337  -68.443 5.755   1.00 159.04 ? 425 GLU A CG    1 
ATOM   3133 C CD    . GLU A 1 415 ? 75.485  -69.375 4.901   1.00 162.33 ? 425 GLU A CD    1 
ATOM   3134 O OE1   . GLU A 1 415 ? 74.291  -69.556 5.225   1.00 162.42 ? 425 GLU A OE1   1 
ATOM   3135 O OE2   . GLU A 1 415 ? 76.012  -69.930 3.911   1.00 165.04 ? 425 GLU A OE2   1 
ATOM   3136 N N     . TRP A 1 416 ? 78.056  -64.724 4.833   1.00 149.98 ? 426 TRP A N     1 
ATOM   3137 C CA    . TRP A 1 416 ? 77.677  -63.310 4.850   1.00 147.02 ? 426 TRP A CA    1 
ATOM   3138 C C     . TRP A 1 416 ? 77.100  -62.818 3.533   1.00 147.56 ? 426 TRP A C     1 
ATOM   3139 O O     . TRP A 1 416 ? 77.489  -63.280 2.465   1.00 150.06 ? 426 TRP A O     1 
ATOM   3140 C CB    . TRP A 1 416 ? 78.880  -62.433 5.215   1.00 171.92 ? 426 TRP A CB    1 
ATOM   3141 C CG    . TRP A 1 416 ? 79.927  -62.369 4.158   1.00 173.66 ? 426 TRP A CG    1 
ATOM   3142 C CD1   . TRP A 1 416 ? 80.131  -61.358 3.269   1.00 173.22 ? 426 TRP A CD1   1 
ATOM   3143 C CD2   . TRP A 1 416 ? 80.919  -63.358 3.877   1.00 176.37 ? 426 TRP A CD2   1 
ATOM   3144 N NE1   . TRP A 1 416 ? 81.190  -61.657 2.448   1.00 175.55 ? 426 TRP A NE1   1 
ATOM   3145 C CE2   . TRP A 1 416 ? 81.692  -62.884 2.802   1.00 177.48 ? 426 TRP A CE2   1 
ATOM   3146 C CE3   . TRP A 1 416 ? 81.229  -64.602 4.431   1.00 178.16 ? 426 TRP A CE3   1 
ATOM   3147 C CZ2   . TRP A 1 416 ? 82.753  -63.609 2.266   1.00 180.29 ? 426 TRP A CZ2   1 
ATOM   3148 C CZ3   . TRP A 1 416 ? 82.277  -65.319 3.900   1.00 180.88 ? 426 TRP A CZ3   1 
ATOM   3149 C CH2   . TRP A 1 416 ? 83.029  -64.822 2.829   1.00 181.91 ? 426 TRP A CH2   1 
ATOM   3150 N N     . LYS A 1 417 ? 76.163  -61.879 3.626   1.00 184.85 ? 427 LYS A N     1 
ATOM   3151 C CA    . LYS A 1 417 ? 75.725  -61.099 2.474   1.00 184.85 ? 427 LYS A CA    1 
ATOM   3152 C C     . LYS A 1 417 ? 75.970  -59.621 2.776   1.00 181.98 ? 427 LYS A C     1 
ATOM   3153 O O     . LYS A 1 417 ? 75.669  -59.155 3.873   1.00 179.67 ? 427 LYS A O     1 
ATOM   3154 C CB    . LYS A 1 417 ? 74.247  -61.360 2.142   1.00 145.91 ? 427 LYS A CB    1 
ATOM   3155 C CG    . LYS A 1 417 ? 73.221  -60.820 3.140   1.00 143.36 ? 427 LYS A CG    1 
ATOM   3156 C CD    . LYS A 1 417 ? 71.837  -60.730 2.502   1.00 143.88 ? 427 LYS A CD    1 
ATOM   3157 C CE    . LYS A 1 417 ? 70.857  -61.727 3.107   1.00 144.98 ? 427 LYS A CE    1 
ATOM   3158 N NZ    . LYS A 1 417 ? 70.121  -61.193 4.294   1.00 142.48 ? 427 LYS A NZ    1 
ATOM   3159 N N     . VAL A 1 418 ? 76.535  -58.885 1.822   1.00 145.36 ? 428 VAL A N     1 
ATOM   3160 C CA    . VAL A 1 418 ? 76.874  -57.485 2.074   1.00 143.08 ? 428 VAL A CA    1 
ATOM   3161 C C     . VAL A 1 418 ? 75.846  -56.537 1.455   1.00 142.15 ? 428 VAL A C     1 
ATOM   3162 O O     . VAL A 1 418 ? 75.437  -56.703 0.306   1.00 143.92 ? 428 VAL A O     1 
ATOM   3163 C CB    . VAL A 1 418 ? 78.295  -57.148 1.563   1.00 141.70 ? 428 VAL A CB    1 
ATOM   3164 C CG1   . VAL A 1 418 ? 79.295  -58.101 2.168   1.00 142.76 ? 428 VAL A CG1   1 
ATOM   3165 C CG2   . VAL A 1 418 ? 78.375  -57.240 0.059   1.00 144.19 ? 428 VAL A CG2   1 
ATOM   3166 N N     . VAL A 1 419 ? 75.414  -55.555 2.239   1.00 144.37 ? 429 VAL A N     1 
ATOM   3167 C CA    . VAL A 1 419 ? 74.374  -54.622 1.817   1.00 143.32 ? 429 VAL A CA    1 
ATOM   3168 C C     . VAL A 1 419 ? 75.000  -53.362 1.232   1.00 143.00 ? 429 VAL A C     1 
ATOM   3169 O O     . VAL A 1 419 ? 74.797  -53.041 0.061   1.00 144.31 ? 429 VAL A O     1 
ATOM   3170 C CB    . VAL A 1 419 ? 73.440  -54.246 2.983   1.00 179.01 ? 429 VAL A CB    1 
ATOM   3171 C CG1   . VAL A 1 419 ? 72.349  -53.296 2.511   1.00 178.12 ? 429 VAL A CG1   1 
ATOM   3172 C CG2   . VAL A 1 419 ? 72.832  -55.497 3.598   1.00 179.63 ? 429 VAL A CG2   1 
ATOM   3173 N N     . ASN A 1 420 ? 75.746  -52.643 2.063   1.00 134.17 ? 430 ASN A N     1 
ATOM   3174 C CA    . ASN A 1 420 ? 76.534  -51.495 1.627   1.00 134.21 ? 430 ASN A CA    1 
ATOM   3175 C C     . ASN A 1 420 ? 77.996  -51.796 1.950   1.00 135.05 ? 430 ASN A C     1 
ATOM   3176 O O     . ASN A 1 420 ? 78.251  -52.676 2.767   1.00 134.89 ? 430 ASN A O     1 
ATOM   3177 C CB    . ASN A 1 420 ? 76.041  -50.212 2.306   1.00 239.53 ? 430 ASN A CB    1 
ATOM   3178 C CG    . ASN A 1 420 ? 75.176  -49.365 1.387   1.00 239.61 ? 430 ASN A CG    1 
ATOM   3179 O OD1   . ASN A 1 420 ? 74.148  -49.824 0.888   1.00 240.05 ? 430 ASN A OD1   1 
ATOM   3180 N ND2   . ASN A 1 420 ? 75.590  -48.122 1.160   1.00 239.42 ? 430 ASN A ND2   1 
ATOM   3181 N N     . PRO A 1 421 ? 78.957  -51.093 1.310   1.00 136.19 ? 431 PRO A N     1 
ATOM   3182 C CA    . PRO A 1 421 ? 80.372  -51.479 1.449   1.00 137.53 ? 431 PRO A CA    1 
ATOM   3183 C C     . PRO A 1 421 ? 80.831  -51.742 2.885   1.00 136.11 ? 431 PRO A C     1 
ATOM   3184 O O     . PRO A 1 421 ? 81.659  -52.625 3.107   1.00 137.28 ? 431 PRO A O     1 
ATOM   3185 C CB    . PRO A 1 421 ? 81.116  -50.270 0.877   1.00 176.47 ? 431 PRO A CB    1 
ATOM   3186 C CG    . PRO A 1 421 ? 80.180  -49.705 -0.128  1.00 176.77 ? 431 PRO A CG    1 
ATOM   3187 C CD    . PRO A 1 421 ? 78.798  -49.922 0.423   1.00 174.75 ? 431 PRO A CD    1 
ATOM   3188 N N     . TYR A 1 422 ? 80.329  -50.957 3.833   1.00 149.65 ? 432 TYR A N     1 
ATOM   3189 C CA    . TYR A 1 422 ? 80.668  -51.118 5.244   1.00 148.34 ? 432 TYR A CA    1 
ATOM   3190 C C     . TYR A 1 422 ? 79.609  -51.826 6.109   1.00 146.97 ? 432 TYR A C     1 
ATOM   3191 O O     . TYR A 1 422 ? 79.764  -51.907 7.326   1.00 145.89 ? 432 TYR A O     1 
ATOM   3192 C CB    . TYR A 1 422 ? 81.004  -49.749 5.825   1.00 145.76 ? 432 TYR A CB    1 
ATOM   3193 C CG    . TYR A 1 422 ? 81.946  -48.975 4.930   1.00 147.37 ? 432 TYR A CG    1 
ATOM   3194 C CD1   . TYR A 1 422 ? 83.212  -49.463 4.631   1.00 149.37 ? 432 TYR A CD1   1 
ATOM   3195 C CD2   . TYR A 1 422 ? 81.564  -47.770 4.369   1.00 147.15 ? 432 TYR A CD2   1 
ATOM   3196 C CE1   . TYR A 1 422 ? 84.073  -48.760 3.804   1.00 151.15 ? 432 TYR A CE1   1 
ATOM   3197 C CE2   . TYR A 1 422 ? 82.416  -47.063 3.545   1.00 148.95 ? 432 TYR A CE2   1 
ATOM   3198 C CZ    . TYR A 1 422 ? 83.669  -47.557 3.264   1.00 150.97 ? 432 TYR A CZ    1 
ATOM   3199 O OH    . TYR A 1 422 ? 84.511  -46.842 2.441   1.00 153.03 ? 432 TYR A OH    1 
ATOM   3200 N N     . TYR A 1 423 ? 78.528  -52.301 5.499   1.00 153.60 ? 433 TYR A N     1 
ATOM   3201 C CA    . TYR A 1 423 ? 77.433  -52.936 6.241   1.00 152.60 ? 433 TYR A CA    1 
ATOM   3202 C C     . TYR A 1 423 ? 77.250  -54.394 5.811   1.00 154.46 ? 433 TYR A C     1 
ATOM   3203 O O     . TYR A 1 423 ? 76.994  -54.658 4.639   1.00 155.95 ? 433 TYR A O     1 
ATOM   3204 C CB    . TYR A 1 423 ? 76.137  -52.141 6.024   1.00 129.04 ? 433 TYR A CB    1 
ATOM   3205 C CG    . TYR A 1 423 ? 74.919  -52.607 6.803   1.00 128.04 ? 433 TYR A CG    1 
ATOM   3206 C CD1   . TYR A 1 423 ? 74.209  -53.741 6.422   1.00 129.31 ? 433 TYR A CD1   1 
ATOM   3207 C CD2   . TYR A 1 423 ? 74.451  -51.884 7.895   1.00 126.08 ? 433 TYR A CD2   1 
ATOM   3208 C CE1   . TYR A 1 423 ? 73.088  -54.159 7.121   1.00 128.70 ? 433 TYR A CE1   1 
ATOM   3209 C CE2   . TYR A 1 423 ? 73.328  -52.293 8.601   1.00 125.41 ? 433 TYR A CE2   1 
ATOM   3210 C CZ    . TYR A 1 423 ? 72.652  -53.431 8.209   1.00 126.73 ? 433 TYR A CZ    1 
ATOM   3211 O OH    . TYR A 1 423 ? 71.537  -53.841 8.906   1.00 126.36 ? 433 TYR A OH    1 
ATOM   3212 N N     . LEU A 1 424 ? 77.367  -55.337 6.746   1.00 132.36 ? 434 LEU A N     1 
ATOM   3213 C CA    . LEU A 1 424 ? 77.194  -56.758 6.423   1.00 134.38 ? 434 LEU A CA    1 
ATOM   3214 C C     . LEU A 1 424 ? 76.056  -57.412 7.192   1.00 133.96 ? 434 LEU A C     1 
ATOM   3215 O O     . LEU A 1 424 ? 75.730  -57.001 8.297   1.00 132.21 ? 434 LEU A O     1 
ATOM   3216 C CB    . LEU A 1 424 ? 78.479  -57.540 6.688   1.00 135.84 ? 434 LEU A CB    1 
ATOM   3217 C CG    . LEU A 1 424 ? 79.602  -57.331 5.679   1.00 137.36 ? 434 LEU A CG    1 
ATOM   3218 C CD1   . LEU A 1 424 ? 80.358  -56.068 5.994   1.00 135.98 ? 434 LEU A CD1   1 
ATOM   3219 C CD2   . LEU A 1 424 ? 80.531  -58.533 5.634   1.00 139.66 ? 434 LEU A CD2   1 
ATOM   3220 N N     . ARG A 1 425 ? 75.452  -58.433 6.594   1.00 151.18 ? 435 ARG A N     1 
ATOM   3221 C CA    . ARG A 1 425 ? 74.430  -59.233 7.257   1.00 151.47 ? 435 ARG A CA    1 
ATOM   3222 C C     . ARG A 1 425 ? 74.894  -60.677 7.284   1.00 154.00 ? 435 ARG A C     1 
ATOM   3223 O O     . ARG A 1 425 ? 74.989  -61.313 6.236   1.00 156.24 ? 435 ARG A O     1 
ATOM   3224 C CB    . ARG A 1 425 ? 73.092  -59.122 6.533   1.00 136.40 ? 435 ARG A CB    1 
ATOM   3225 C CG    . ARG A 1 425 ? 72.507  -57.729 6.508   1.00 134.08 ? 435 ARG A CG    1 
ATOM   3226 C CD    . ARG A 1 425 ? 71.365  -57.614 7.495   1.00 132.79 ? 435 ARG A CD    1 
ATOM   3227 N NE    . ARG A 1 425 ? 70.326  -58.609 7.241   1.00 134.61 ? 435 ARG A NE    1 
ATOM   3228 C CZ    . ARG A 1 425 ? 69.348  -58.457 6.355   1.00 135.23 ? 435 ARG A CZ    1 
ATOM   3229 N NH1   . ARG A 1 425 ? 69.279  -57.348 5.628   1.00 134.14 ? 435 ARG A NH1   1 
ATOM   3230 N NH2   . ARG A 1 425 ? 68.444  -59.416 6.193   1.00 137.19 ? 435 ARG A NH2   1 
ATOM   3231 N N     . VAL A 1 426 ? 75.190  -61.200 8.468   1.00 138.54 ? 436 VAL A N     1 
ATOM   3232 C CA    . VAL A 1 426 ? 75.862  -62.493 8.561   1.00 140.99 ? 436 VAL A CA    1 
ATOM   3233 C C     . VAL A 1 426 ? 75.099  -63.488 9.420   1.00 142.04 ? 436 VAL A C     1 
ATOM   3234 O O     . VAL A 1 426 ? 74.255  -63.102 10.223  1.00 140.55 ? 436 VAL A O     1 
ATOM   3235 C CB    . VAL A 1 426 ? 77.281  -62.315 9.107   1.00 159.18 ? 436 VAL A CB    1 
ATOM   3236 C CG1   . VAL A 1 426 ? 77.827  -61.000 8.613   1.00 157.50 ? 436 VAL A CG1   1 
ATOM   3237 C CG2   . VAL A 1 426 ? 77.281  -62.324 10.616  1.00 157.98 ? 436 VAL A CG2   1 
ATOM   3238 N N     . ARG A 1 427 ? 75.373  -64.772 9.229   1.00 178.93 ? 437 ARG A N     1 
ATOM   3239 C CA    . ARG A 1 427 ? 74.703  -65.794 10.018  1.00 180.45 ? 437 ARG A CA    1 
ATOM   3240 C C     . ARG A 1 427 ? 75.488  -67.090 10.041  1.00 183.42 ? 437 ARG A C     1 
ATOM   3241 O O     . ARG A 1 427 ? 76.319  -67.345 9.166   1.00 184.80 ? 437 ARG A O     1 
ATOM   3242 C CB    . ARG A 1 427 ? 73.292  -66.052 9.479   1.00 147.42 ? 437 ARG A CB    1 
ATOM   3243 C CG    . ARG A 1 427 ? 73.185  -67.210 8.498   1.00 150.99 ? 437 ARG A CG    1 
ATOM   3244 C CD    . ARG A 1 427 ? 71.808  -67.270 7.866   1.00 151.90 ? 437 ARG A CD    1 
ATOM   3245 N NE    . ARG A 1 427 ? 71.638  -68.477 7.066   1.00 155.75 ? 437 ARG A NE    1 
ATOM   3246 C CZ    . ARG A 1 427 ? 70.611  -68.689 6.253   1.00 157.40 ? 437 ARG A CZ    1 
ATOM   3247 N NH1   . ARG A 1 427 ? 69.667  -67.767 6.131   1.00 155.41 ? 437 ARG A NH1   1 
ATOM   3248 N NH2   . ARG A 1 427 ? 70.529  -69.817 5.558   1.00 161.22 ? 437 ARG A NH2   1 
ATOM   3249 N N     . ARG A 1 428 ? 75.201  -67.906 11.052  1.00 151.81 ? 438 ARG A N     1 
ATOM   3250 C CA    . ARG A 1 428 ? 75.736  -69.256 11.136  1.00 155.06 ? 438 ARG A CA    1 
ATOM   3251 C C     . ARG A 1 428 ? 74.711  -70.301 11.427  1.00 157.61 ? 438 ARG A C     1 
ATOM   3252 O O     . ARG A 1 428 ? 73.669  -70.022 12.010  1.00 156.64 ? 438 ARG A O     1 
ATOM   3253 C CB    . ARG A 1 428 ? 76.760  -69.374 12.222  1.00 209.96 ? 438 ARG A CB    1 
ATOM   3254 C CG    . ARG A 1 428 ? 76.238  -69.465 13.639  1.00 209.37 ? 438 ARG A CG    1 
ATOM   3255 C CD    . ARG A 1 428 ? 76.760  -70.746 14.266  1.00 212.34 ? 438 ARG A CD    1 
ATOM   3256 N NE    . ARG A 1 428 ? 76.963  -70.657 15.708  1.00 211.51 ? 438 ARG A NE    1 
ATOM   3257 C CZ    . ARG A 1 428 ? 77.899  -71.332 16.371  1.00 213.06 ? 438 ARG A CZ    1 
ATOM   3258 N NH1   . ARG A 1 428 ? 78.730  -72.138 15.724  1.00 215.44 ? 438 ARG A NH1   1 
ATOM   3259 N NH2   . ARG A 1 428 ? 78.011  -71.195 17.683  1.00 212.37 ? 438 ARG A NH2   1 
ATOM   3260 N N     . LYS A 1 429 ? 75.057  -71.531 11.079  1.00 173.13 ? 439 LYS A N     1 
ATOM   3261 C CA    . LYS A 1 429 ? 74.232  -72.660 11.445  1.00 176.18 ? 439 LYS A CA    1 
ATOM   3262 C C     . LYS A 1 429 ? 74.684  -73.229 12.786  1.00 176.88 ? 439 LYS A C     1 
ATOM   3263 O O     . LYS A 1 429 ? 75.865  -73.517 12.994  1.00 177.38 ? 439 LYS A O     1 
ATOM   3264 C CB    . LYS A 1 429 ? 74.271  -73.729 10.358  1.00 166.82 ? 439 LYS A CB    1 
ATOM   3265 C CG    . LYS A 1 429 ? 73.397  -74.928 10.662  1.00 170.48 ? 439 LYS A CG    1 
ATOM   3266 C CD    . LYS A 1 429 ? 73.225  -75.803 9.438   1.00 174.30 ? 439 LYS A CD    1 
ATOM   3267 C CE    . LYS A 1 429 ? 72.578  -77.125 9.800   1.00 178.58 ? 439 LYS A CE    1 
ATOM   3268 N NZ    . LYS A 1 429 ? 73.498  -77.980 10.599  1.00 180.44 ? 439 LYS A NZ    1 
ATOM   3269 N N     . ASN A 1 430 ? 73.727  -73.364 13.697  1.00 233.56 ? 440 ASN A N     1 
ATOM   3270 C CA    . ASN A 1 430 ? 73.964  -73.946 15.011  1.00 234.63 ? 440 ASN A CA    1 
ATOM   3271 C C     . ASN A 1 430 ? 74.526  -75.360 14.882  1.00 238.82 ? 440 ASN A C     1 
ATOM   3272 O O     . ASN A 1 430 ? 73.958  -76.193 14.180  1.00 241.94 ? 440 ASN A O     1 
ATOM   3273 C CB    . ASN A 1 430 ? 72.660  -73.948 15.814  1.00 165.00 ? 440 ASN A CB    1 
ATOM   3274 C CG    . ASN A 1 430 ? 72.848  -74.398 17.248  1.00 165.93 ? 440 ASN A CG    1 
ATOM   3275 O OD1   . ASN A 1 430 ? 73.940  -74.311 17.801  1.00 165.15 ? 440 ASN A OD1   1 
ATOM   3276 N ND2   . ASN A 1 430 ? 71.770  -74.875 17.863  1.00 167.79 ? 440 ASN A ND2   1 
ATOM   3277 N N     . PRO A 1 431 ? 75.669  -75.627 15.530  1.00 169.26 ? 441 PRO A N     1 
ATOM   3278 C CA    . PRO A 1 431 ? 76.264  -76.965 15.434  1.00 173.35 ? 441 PRO A CA    1 
ATOM   3279 C C     . PRO A 1 431 ? 75.417  -78.076 16.056  1.00 177.00 ? 441 PRO A C     1 
ATOM   3280 O O     . PRO A 1 431 ? 75.372  -79.168 15.493  1.00 180.91 ? 441 PRO A O     1 
ATOM   3281 C CB    . PRO A 1 431 ? 77.593  -76.814 16.187  1.00 172.33 ? 441 PRO A CB    1 
ATOM   3282 C CG    . PRO A 1 431 ? 77.440  -75.586 17.015  1.00 168.31 ? 441 PRO A CG    1 
ATOM   3283 C CD    . PRO A 1 431 ? 76.558  -74.682 16.220  1.00 165.97 ? 441 PRO A CD    1 
ATOM   3284 N N     . VAL A 1 432 ? 74.785  -77.819 17.198  1.00 201.00 ? 442 VAL A N     1 
ATOM   3285 C CA    . VAL A 1 432 ? 74.030  -78.863 17.896  1.00 204.71 ? 442 VAL A CA    1 
ATOM   3286 C C     . VAL A 1 432 ? 72.577  -79.059 17.426  1.00 206.24 ? 442 VAL A C     1 
ATOM   3287 O O     . VAL A 1 432 ? 71.995  -80.126 17.638  1.00 210.35 ? 442 VAL A O     1 
ATOM   3288 C CB    . VAL A 1 432 ? 74.021  -78.601 19.411  1.00 178.70 ? 442 VAL A CB    1 
ATOM   3289 C CG1   . VAL A 1 432 ? 75.446  -78.576 19.943  1.00 177.98 ? 442 VAL A CG1   1 
ATOM   3290 C CG2   . VAL A 1 432 ? 73.309  -77.298 19.721  1.00 174.68 ? 442 VAL A CG2   1 
ATOM   3291 N N     . THR A 1 433 ? 71.998  -78.044 16.787  1.00 251.34 ? 443 THR A N     1 
ATOM   3292 C CA    . THR A 1 433 ? 70.613  -78.113 16.313  1.00 252.56 ? 443 THR A CA    1 
ATOM   3293 C C     . THR A 1 433 ? 70.503  -77.499 14.920  1.00 250.96 ? 443 THR A C     1 
ATOM   3294 O O     . THR A 1 433 ? 71.430  -76.849 14.452  1.00 248.40 ? 443 THR A O     1 
ATOM   3295 C CB    . THR A 1 433 ? 69.634  -77.386 17.272  1.00 177.42 ? 443 THR A CB    1 
ATOM   3296 O OG1   . THR A 1 433 ? 70.129  -77.454 18.612  1.00 177.14 ? 443 THR A OG1   1 
ATOM   3297 C CG2   . THR A 1 433 ? 68.242  -78.015 17.219  1.00 180.69 ? 443 THR A CG2   1 
ATOM   3298 N N     . SER A 1 434 ? 69.360  -77.687 14.268  1.00 205.91 ? 444 SER A N     1 
ATOM   3299 C CA    . SER A 1 434 ? 69.153  -77.179 12.915  1.00 204.94 ? 444 SER A CA    1 
ATOM   3300 C C     . SER A 1 434 ? 68.757  -75.703 12.936  1.00 200.21 ? 444 SER A C     1 
ATOM   3301 O O     . SER A 1 434 ? 68.432  -75.127 11.898  1.00 199.12 ? 444 SER A O     1 
ATOM   3302 C CB    . SER A 1 434 ? 68.086  -77.999 12.185  1.00 211.75 ? 444 SER A CB    1 
ATOM   3303 O OG    . SER A 1 434 ? 68.492  -79.348 12.027  1.00 216.40 ? 444 SER A OG    1 
ATOM   3304 N N     . THR A 1 435 ? 68.759  -75.107 14.126  1.00 188.56 ? 445 THR A N     1 
ATOM   3305 C CA    . THR A 1 435 ? 68.483  -73.680 14.286  1.00 184.11 ? 445 THR A CA    1 
ATOM   3306 C C     . THR A 1 435 ? 69.585  -72.815 13.677  1.00 181.06 ? 445 THR A C     1 
ATOM   3307 O O     . THR A 1 435 ? 70.694  -73.286 13.427  1.00 182.03 ? 445 THR A O     1 
ATOM   3308 C CB    . THR A 1 435 ? 68.327  -73.293 15.766  1.00 205.75 ? 445 THR A CB    1 
ATOM   3309 O OG1   . THR A 1 435 ? 69.578  -73.469 16.440  1.00 205.34 ? 445 THR A OG1   1 
ATOM   3310 C CG2   . THR A 1 435 ? 67.265  -74.150 16.435  1.00 209.05 ? 445 THR A CG2   1 
ATOM   3311 N N     . TYR A 1 436 ? 69.262  -71.553 13.416  1.00 169.40 ? 446 TYR A N     1 
ATOM   3312 C CA    . TYR A 1 436 ? 70.218  -70.628 12.818  1.00 166.60 ? 446 TYR A CA    1 
ATOM   3313 C C     . TYR A 1 436 ? 70.095  -69.235 13.429  1.00 162.53 ? 446 TYR A C     1 
ATOM   3314 O O     . TYR A 1 436 ? 69.007  -68.663 13.478  1.00 161.45 ? 446 TYR A O     1 
ATOM   3315 C CB    . TYR A 1 436 ? 70.025  -70.571 11.294  1.00 247.44 ? 446 TYR A CB    1 
ATOM   3316 C CG    . TYR A 1 436 ? 68.710  -69.970 10.829  1.00 246.66 ? 446 TYR A CG    1 
ATOM   3317 C CD1   . TYR A 1 436 ? 67.495  -70.583 11.121  1.00 248.87 ? 446 TYR A CD1   1 
ATOM   3318 C CD2   . TYR A 1 436 ? 68.686  -68.798 10.081  1.00 243.99 ? 446 TYR A CD2   1 
ATOM   3319 C CE1   . TYR A 1 436 ? 66.294  -70.037 10.697  1.00 248.31 ? 446 TYR A CE1   1 
ATOM   3320 C CE2   . TYR A 1 436 ? 67.490  -68.245 9.649   1.00 243.39 ? 446 TYR A CE2   1 
ATOM   3321 C CZ    . TYR A 1 436 ? 66.298  -68.869 9.960   1.00 245.53 ? 446 TYR A CZ    1 
ATOM   3322 O OH    . TYR A 1 436 ? 65.108  -68.325 9.532   1.00 245.09 ? 446 TYR A OH    1 
ATOM   3323 N N     . SER A 1 437 ? 71.216  -68.693 13.897  1.00 151.49 ? 447 SER A N     1 
ATOM   3324 C CA    . SER A 1 437 ? 71.243  -67.344 14.457  1.00 147.86 ? 447 SER A CA    1 
ATOM   3325 C C     . SER A 1 437 ? 72.043  -66.406 13.562  1.00 145.80 ? 447 SER A C     1 
ATOM   3326 O O     . SER A 1 437 ? 72.992  -66.827 12.901  1.00 146.96 ? 447 SER A O     1 
ATOM   3327 C CB    . SER A 1 437 ? 71.825  -67.358 15.870  1.00 175.22 ? 447 SER A CB    1 
ATOM   3328 O OG    . SER A 1 437 ? 72.831  -68.347 15.989  1.00 177.39 ? 447 SER A OG    1 
ATOM   3329 N N     . LYS A 1 438 ? 71.650  -65.135 13.541  1.00 152.12 ? 448 LYS A N     1 
ATOM   3330 C CA    . LYS A 1 438 ? 72.272  -64.159 12.653  1.00 150.34 ? 448 LYS A CA    1 
ATOM   3331 C C     . LYS A 1 438 ? 72.654  -62.880 13.396  1.00 147.30 ? 448 LYS A C     1 
ATOM   3332 O O     . LYS A 1 438 ? 72.375  -62.745 14.585  1.00 146.55 ? 448 LYS A O     1 
ATOM   3333 C CB    . LYS A 1 438 ? 71.333  -63.834 11.481  1.00 181.71 ? 448 LYS A CB    1 
ATOM   3334 C CG    . LYS A 1 438 ? 69.980  -64.557 11.525  1.00 183.52 ? 448 LYS A CG    1 
ATOM   3335 C CD    . LYS A 1 438 ? 69.442  -64.899 10.127  1.00 185.37 ? 448 LYS A CD    1 
ATOM   3336 C CE    . LYS A 1 438 ? 68.715  -63.729 9.467   1.00 183.41 ? 448 LYS A CE    1 
ATOM   3337 N NZ    . LYS A 1 438 ? 68.506  -63.938 8.002   1.00 185.14 ? 448 LYS A NZ    1 
ATOM   3338 N N     . MET A 1 439 ? 73.286  -61.946 12.686  1.00 136.67 ? 449 MET A N     1 
ATOM   3339 C CA    . MET A 1 439 ? 73.670  -60.648 13.243  1.00 134.04 ? 449 MET A CA    1 
ATOM   3340 C C     . MET A 1 439 ? 74.096  -59.678 12.140  1.00 133.02 ? 449 MET A C     1 
ATOM   3341 O O     . MET A 1 439 ? 74.211  -60.063 10.979  1.00 134.40 ? 449 MET A O     1 
ATOM   3342 C CB    . MET A 1 439 ? 74.806  -60.815 14.249  1.00 134.03 ? 449 MET A CB    1 
ATOM   3343 C CG    . MET A 1 439 ? 75.874  -61.754 13.759  1.00 136.10 ? 449 MET A CG    1 
ATOM   3344 S SD    . MET A 1 439 ? 77.424  -61.662 14.661  1.00 135.94 ? 449 MET A SD    1 
ATOM   3345 C CE    . MET A 1 439 ? 77.857  -59.942 14.437  1.00 133.34 ? 449 MET A CE    1 
ATOM   3346 N N     . SER A 1 440 ? 74.373  -58.433 12.509  1.00 130.87 ? 450 SER A N     1 
ATOM   3347 C CA    . SER A 1 440 ? 74.725  -57.406 11.533  1.00 130.00 ? 450 SER A CA    1 
ATOM   3348 C C     . SER A 1 440 ? 75.982  -56.661 11.950  1.00 129.14 ? 450 SER A C     1 
ATOM   3349 O O     . SER A 1 440 ? 76.158  -56.349 13.123  1.00 128.16 ? 450 SER A O     1 
ATOM   3350 C CB    . SER A 1 440 ? 73.578  -56.409 11.355  1.00 128.41 ? 450 SER A CB    1 
ATOM   3351 O OG    . SER A 1 440 ? 72.389  -57.047 10.927  1.00 129.36 ? 450 SER A OG    1 
ATOM   3352 N N     . LEU A 1 441 ? 76.849  -56.362 10.992  1.00 129.72 ? 451 LEU A N     1 
ATOM   3353 C CA    . LEU A 1 441 ? 78.067  -55.623 11.288  1.00 129.24 ? 451 LEU A CA    1 
ATOM   3354 C C     . LEU A 1 441 ? 78.116  -54.312 10.524  1.00 128.34 ? 451 LEU A C     1 
ATOM   3355 O O     . LEU A 1 441 ? 78.328  -54.296 9.316   1.00 129.39 ? 451 LEU A O     1 
ATOM   3356 C CB    . LEU A 1 441 ? 79.298  -56.459 10.948  1.00 131.19 ? 451 LEU A CB    1 
ATOM   3357 C CG    . LEU A 1 441 ? 79.543  -57.741 11.742  1.00 132.41 ? 451 LEU A CG    1 
ATOM   3358 C CD1   . LEU A 1 441 ? 78.719  -58.893 11.217  1.00 133.91 ? 451 LEU A CD1   1 
ATOM   3359 C CD2   . LEU A 1 441 ? 81.014  -58.090 11.717  1.00 133.81 ? 451 LEU A CD2   1 
ATOM   3360 N N     . GLN A 1 442 ? 77.958  -53.207 11.232  1.00 126.66 ? 452 GLN A N     1 
ATOM   3361 C CA    . GLN A 1 442 ? 78.001  -51.905 10.596  1.00 125.97 ? 452 GLN A CA    1 
ATOM   3362 C C     . GLN A 1 442 ? 79.236  -51.174 11.073  1.00 125.97 ? 452 GLN A C     1 
ATOM   3363 O O     . GLN A 1 442 ? 79.400  -50.948 12.265  1.00 125.19 ? 452 GLN A O     1 
ATOM   3364 C CB    . GLN A 1 442 ? 76.733  -51.109 10.914  1.00 131.40 ? 452 GLN A CB    1 
ATOM   3365 C CG    . GLN A 1 442 ? 76.780  -49.629 10.547  1.00 130.61 ? 452 GLN A CG    1 
ATOM   3366 C CD    . GLN A 1 442 ? 76.693  -49.378 9.056   1.00 131.51 ? 452 GLN A CD    1 
ATOM   3367 O OE1   . GLN A 1 442 ? 77.537  -49.833 8.287   1.00 133.04 ? 452 GLN A OE1   1 
ATOM   3368 N NE2   . GLN A 1 442 ? 75.666  -48.643 8.638   1.00 130.72 ? 452 GLN A NE2   1 
ATOM   3369 N N     . LEU A 1 443 ? 80.120  -50.818 10.157  1.00 127.09 ? 453 LEU A N     1 
ATOM   3370 C CA    . LEU A 1 443 ? 81.315  -50.083 10.526  1.00 127.44 ? 453 LEU A CA    1 
ATOM   3371 C C     . LEU A 1 443 ? 81.049  -48.584 10.589  1.00 126.41 ? 453 LEU A C     1 
ATOM   3372 O O     . LEU A 1 443 ? 80.416  -48.029 9.694   1.00 126.24 ? 453 LEU A O     1 
ATOM   3373 C CB    . LEU A 1 443 ? 82.428  -50.372 9.536   1.00 129.47 ? 453 LEU A CB    1 
ATOM   3374 C CG    . LEU A 1 443 ? 83.684  -49.528 9.687   1.00 130.27 ? 453 LEU A CG    1 
ATOM   3375 C CD1   . LEU A 1 443 ? 84.628  -50.191 10.658  1.00 130.88 ? 453 LEU A CD1   1 
ATOM   3376 C CD2   . LEU A 1 443 ? 84.332  -49.320 8.332   1.00 132.13 ? 453 LEU A CD2   1 
ATOM   3377 N N     . TYR A 1 444 ? 81.533  -47.933 11.646  1.00 125.93 ? 454 TYR A N     1 
ATOM   3378 C CA    . TYR A 1 444 ? 81.394  -46.488 11.790  1.00 125.30 ? 454 TYR A CA    1 
ATOM   3379 C C     . TYR A 1 444 ? 82.759  -45.818 11.802  1.00 126.69 ? 454 TYR A C     1 
ATOM   3380 O O     . TYR A 1 444 ? 83.790  -46.486 11.781  1.00 128.00 ? 454 TYR A O     1 
ATOM   3381 C CB    . TYR A 1 444 ? 80.635  -46.135 13.072  1.00 123.74 ? 454 TYR A CB    1 
ATOM   3382 C CG    . TYR A 1 444 ? 79.222  -46.672 13.141  1.00 122.50 ? 454 TYR A CG    1 
ATOM   3383 C CD1   . TYR A 1 444 ? 78.966  -47.947 13.617  1.00 122.51 ? 454 TYR A CD1   1 
ATOM   3384 C CD2   . TYR A 1 444 ? 78.145  -45.899 12.741  1.00 121.56 ? 454 TYR A CD2   1 
ATOM   3385 C CE1   . TYR A 1 444 ? 77.679  -48.438 13.683  1.00 121.70 ? 454 TYR A CE1   1 
ATOM   3386 C CE2   . TYR A 1 444 ? 76.856  -46.384 12.804  1.00 120.65 ? 454 TYR A CE2   1 
ATOM   3387 C CZ    . TYR A 1 444 ? 76.629  -47.651 13.275  1.00 120.77 ? 454 TYR A CZ    1 
ATOM   3388 O OH    . TYR A 1 444 ? 75.345  -48.136 13.335  1.00 120.16 ? 454 TYR A OH    1 
ATOM   3389 N N     . GLN A 1 445 ? 82.762  -44.493 11.844  1.00 126.61 ? 455 GLN A N     1 
ATOM   3390 C CA    . GLN A 1 445 ? 84.005  -43.748 11.953  1.00 128.15 ? 455 GLN A CA    1 
ATOM   3391 C C     . GLN A 1 445 ? 83.960  -42.861 13.182  1.00 127.55 ? 455 GLN A C     1 
ATOM   3392 O O     . GLN A 1 445 ? 83.255  -41.854 13.184  1.00 126.88 ? 455 GLN A O     1 
ATOM   3393 C CB    . GLN A 1 445 ? 84.230  -42.909 10.694  1.00 140.12 ? 455 GLN A CB    1 
ATOM   3394 C CG    . GLN A 1 445 ? 85.505  -42.087 10.686  1.00 142.14 ? 455 GLN A CG    1 
ATOM   3395 C CD    . GLN A 1 445 ? 85.726  -41.340 9.372   1.00 143.76 ? 455 GLN A CD    1 
ATOM   3396 O OE1   . GLN A 1 445 ? 85.272  -41.768 8.306   1.00 143.86 ? 455 GLN A OE1   1 
ATOM   3397 N NE2   . GLN A 1 445 ? 86.427  -40.215 9.449   1.00 145.29 ? 455 GLN A NE2   1 
ATOM   3398 N N     . VAL A 1 446 ? 84.736  -43.207 14.208  1.00 134.80 ? 456 VAL A N     1 
ATOM   3399 C CA    . VAL A 1 446 ? 84.690  -42.467 15.467  1.00 134.45 ? 456 VAL A CA    1 
ATOM   3400 C C     . VAL A 1 446 ? 85.436  -41.149 15.312  1.00 136.01 ? 456 VAL A C     1 
ATOM   3401 O O     . VAL A 1 446 ? 85.089  -40.149 15.939  1.00 135.78 ? 456 VAL A O     1 
ATOM   3402 C CB    . VAL A 1 446 ? 85.284  -43.277 16.652  1.00 147.64 ? 456 VAL A CB    1 
ATOM   3403 C CG1   . VAL A 1 446 ? 84.446  -44.518 16.936  1.00 146.28 ? 456 VAL A CG1   1 
ATOM   3404 C CG2   . VAL A 1 446 ? 86.728  -43.658 16.384  1.00 149.63 ? 456 VAL A CG2   1 
ATOM   3405 N N     . ASP A 1 447 ? 86.456  -41.161 14.459  1.00 174.15 ? 457 ASP A N     1 
ATOM   3406 C CA    . ASP A 1 447 ? 87.189  -39.956 14.100  1.00 176.08 ? 457 ASP A CA    1 
ATOM   3407 C C     . ASP A 1 447 ? 88.036  -40.240 12.865  1.00 177.92 ? 457 ASP A C     1 
ATOM   3408 O O     . ASP A 1 447 ? 88.024  -41.352 12.342  1.00 177.61 ? 457 ASP A O     1 
ATOM   3409 C CB    . ASP A 1 447 ? 88.063  -39.469 15.264  1.00 171.37 ? 457 ASP A CB    1 
ATOM   3410 C CG    . ASP A 1 447 ? 89.200  -40.419 15.583  1.00 172.57 ? 457 ASP A CG    1 
ATOM   3411 O OD1   . ASP A 1 447 ? 89.047  -41.637 15.355  1.00 171.72 ? 457 ASP A OD1   1 
ATOM   3412 O OD2   . ASP A 1 447 ? 90.252  -39.942 16.062  1.00 174.56 ? 457 ASP A OD2   1 
ATOM   3413 N N     . SER A 1 448 ? 88.772  -39.235 12.402  1.00 176.34 ? 458 SER A N     1 
ATOM   3414 C CA    . SER A 1 448 ? 89.599  -39.383 11.210  1.00 178.48 ? 458 SER A CA    1 
ATOM   3415 C C     . SER A 1 448 ? 90.743  -40.375 11.418  1.00 179.76 ? 458 SER A C     1 
ATOM   3416 O O     . SER A 1 448 ? 91.254  -40.949 10.459  1.00 181.08 ? 458 SER A O     1 
ATOM   3417 C CB    . SER A 1 448 ? 90.159  -38.024 10.782  1.00 168.08 ? 458 SER A CB    1 
ATOM   3418 O OG    . SER A 1 448 ? 90.888  -37.415 11.833  1.00 169.27 ? 458 SER A OG    1 
ATOM   3419 N N     . ARG A 1 449 ? 91.153  -40.555 12.670  1.00 152.59 ? 459 ARG A N     1 
ATOM   3420 C CA    . ARG A 1 449 ? 92.257  -41.452 12.999  1.00 153.91 ? 459 ARG A CA    1 
ATOM   3421 C C     . ARG A 1 449 ? 91.855  -42.912 13.254  1.00 152.25 ? 459 ARG A C     1 
ATOM   3422 O O     . ARG A 1 449 ? 92.707  -43.798 13.216  1.00 153.47 ? 459 ARG A O     1 
ATOM   3423 C CB    . ARG A 1 449 ? 92.998  -40.917 14.227  1.00 213.73 ? 459 ARG A CB    1 
ATOM   3424 C CG    . ARG A 1 449 ? 93.309  -39.428 14.165  1.00 215.49 ? 459 ARG A CG    1 
ATOM   3425 C CD    . ARG A 1 449 ? 93.497  -38.846 15.564  1.00 215.75 ? 459 ARG A CD    1 
ATOM   3426 N NE    . ARG A 1 449 ? 93.457  -37.384 15.571  1.00 217.06 ? 459 ARG A NE    1 
ATOM   3427 C CZ    . ARG A 1 449 ? 93.367  -36.638 16.670  1.00 217.31 ? 459 ARG A CZ    1 
ATOM   3428 N NH1   . ARG A 1 449 ? 93.302  -37.209 17.866  1.00 216.29 ? 459 ARG A NH1   1 
ATOM   3429 N NH2   . ARG A 1 449 ? 93.337  -35.315 16.574  1.00 218.80 ? 459 ARG A NH2   1 
ATOM   3430 N N     . THR A 1 450 ? 90.573  -43.170 13.502  1.00 137.37 ? 460 THR A N     1 
ATOM   3431 C CA    . THR A 1 450 ? 90.143  -44.509 13.918  1.00 135.99 ? 460 THR A CA    1 
ATOM   3432 C C     . THR A 1 450 ? 88.729  -44.858 13.447  1.00 133.88 ? 460 THR A C     1 
ATOM   3433 O O     . THR A 1 450 ? 87.885  -43.978 13.283  1.00 132.84 ? 460 THR A O     1 
ATOM   3434 C CB    . THR A 1 450 ? 90.193  -44.656 15.460  1.00 137.81 ? 460 THR A CB    1 
ATOM   3435 O OG1   . THR A 1 450 ? 91.431  -44.132 15.962  1.00 139.87 ? 460 THR A OG1   1 
ATOM   3436 C CG2   . THR A 1 450 ? 90.045  -46.120 15.884  1.00 137.16 ? 460 THR A CG2   1 
ATOM   3437 N N     . TYR A 1 451 ? 88.480  -46.150 13.236  1.00 133.48 ? 461 TYR A N     1 
ATOM   3438 C CA    . TYR A 1 451 ? 87.151  -46.650 12.898  1.00 131.73 ? 461 TYR A CA    1 
ATOM   3439 C C     . TYR A 1 451 ? 86.678  -47.669 13.935  1.00 130.63 ? 461 TYR A C     1 
ATOM   3440 O O     . TYR A 1 451 ? 87.485  -48.235 14.675  1.00 131.47 ? 461 TYR A O     1 
ATOM   3441 C CB    . TYR A 1 451 ? 87.145  -47.282 11.502  1.00 132.66 ? 461 TYR A CB    1 
ATOM   3442 C CG    . TYR A 1 451 ? 87.509  -46.325 10.385  1.00 133.95 ? 461 TYR A CG    1 
ATOM   3443 C CD1   . TYR A 1 451 ? 86.535  -45.578 9.735   1.00 133.07 ? 461 TYR A CD1   1 
ATOM   3444 C CD2   . TYR A 1 451 ? 88.827  -46.170 9.979   1.00 136.28 ? 461 TYR A CD2   1 
ATOM   3445 C CE1   . TYR A 1 451 ? 86.867  -44.701 8.713   1.00 134.50 ? 461 TYR A CE1   1 
ATOM   3446 C CE2   . TYR A 1 451 ? 89.167  -45.296 8.957   1.00 137.78 ? 461 TYR A CE2   1 
ATOM   3447 C CZ    . TYR A 1 451 ? 88.181  -44.565 8.330   1.00 136.90 ? 461 TYR A CZ    1 
ATOM   3448 O OH    . TYR A 1 451 ? 88.502  -43.692 7.317   1.00 138.60 ? 461 TYR A OH    1 
ATOM   3449 N N     . LEU A 1 452 ? 85.368  -47.899 13.979  1.00 128.96 ? 462 LEU A N     1 
ATOM   3450 C CA    . LEU A 1 452 ? 84.768  -48.825 14.939  1.00 128.06 ? 462 LEU A CA    1 
ATOM   3451 C C     . LEU A 1 452 ? 83.786  -49.773 14.257  1.00 127.60 ? 462 LEU A C     1 
ATOM   3452 O O     . LEU A 1 452 ? 82.935  -49.344 13.479  1.00 126.88 ? 462 LEU A O     1 
ATOM   3453 C CB    . LEU A 1 452 ? 84.064  -48.041 16.056  1.00 126.65 ? 462 LEU A CB    1 
ATOM   3454 C CG    . LEU A 1 452 ? 83.211  -48.722 17.135  1.00 125.66 ? 462 LEU A CG    1 
ATOM   3455 C CD1   . LEU A 1 452 ? 81.798  -49.012 16.636  1.00 124.46 ? 462 LEU A CD1   1 
ATOM   3456 C CD2   . LEU A 1 452 ? 83.864  -49.988 17.648  1.00 126.74 ? 462 LEU A CD2   1 
ATOM   3457 N N     . LEU A 1 453 ? 83.893  -51.059 14.575  1.00 128.21 ? 463 LEU A N     1 
ATOM   3458 C CA    . LEU A 1 453 ? 82.996  -52.067 14.023  1.00 128.17 ? 463 LEU A CA    1 
ATOM   3459 C C     . LEU A 1 453 ? 81.908  -52.400 15.033  1.00 126.98 ? 463 LEU A C     1 
ATOM   3460 O O     . LEU A 1 453 ? 82.207  -52.787 16.155  1.00 127.16 ? 463 LEU A O     1 
ATOM   3461 C CB    . LEU A 1 453 ? 83.770  -53.335 13.650  1.00 130.01 ? 463 LEU A CB    1 
ATOM   3462 C CG    . LEU A 1 453 ? 83.365  -54.171 12.428  1.00 131.00 ? 463 LEU A CG    1 
ATOM   3463 C CD1   . LEU A 1 453 ? 84.072  -55.521 12.447  1.00 132.89 ? 463 LEU A CD1   1 
ATOM   3464 C CD2   . LEU A 1 453 ? 81.859  -54.360 12.315  1.00 129.90 ? 463 LEU A CD2   1 
ATOM   3465 N N     . ASP A 1 454 ? 80.650  -52.271 14.627  1.00 125.99 ? 464 ASP A N     1 
ATOM   3466 C CA    . ASP A 1 454 ? 79.517  -52.533 15.508  1.00 125.03 ? 464 ASP A CA    1 
ATOM   3467 C C     . ASP A 1 454 ? 78.953  -53.941 15.351  1.00 125.96 ? 464 ASP A C     1 
ATOM   3468 O O     . ASP A 1 454 ? 78.928  -54.479 14.253  1.00 126.89 ? 464 ASP A O     1 
ATOM   3469 C CB    . ASP A 1 454 ? 78.414  -51.518 15.242  1.00 123.56 ? 464 ASP A CB    1 
ATOM   3470 C CG    . ASP A 1 454 ? 77.170  -51.787 16.050  1.00 122.78 ? 464 ASP A CG    1 
ATOM   3471 O OD1   . ASP A 1 454 ? 77.292  -51.983 17.280  1.00 122.78 ? 464 ASP A OD1   1 
ATOM   3472 O OD2   . ASP A 1 454 ? 76.073  -51.806 15.453  1.00 122.36 ? 464 ASP A OD2   1 
ATOM   3473 N N     . PHE A 1 455 ? 78.498  -54.532 16.447  1.00 125.97 ? 465 PHE A N     1 
ATOM   3474 C CA    . PHE A 1 455 ? 77.894  -55.858 16.417  1.00 127.12 ? 465 PHE A CA    1 
ATOM   3475 C C     . PHE A 1 455 ? 76.454  -55.774 16.909  1.00 126.28 ? 465 PHE A C     1 
ATOM   3476 O O     . PHE A 1 455 ? 76.205  -55.278 18.006  1.00 125.46 ? 465 PHE A O     1 
ATOM   3477 C CB    . PHE A 1 455 ? 78.689  -56.834 17.284  1.00 128.51 ? 465 PHE A CB    1 
ATOM   3478 C CG    . PHE A 1 455 ? 80.047  -57.172 16.743  1.00 129.78 ? 465 PHE A CG    1 
ATOM   3479 C CD1   . PHE A 1 455 ? 80.997  -56.189 16.541  1.00 129.29 ? 465 PHE A CD1   1 
ATOM   3480 C CD2   . PHE A 1 455 ? 80.382  -58.487 16.469  1.00 131.74 ? 465 PHE A CD2   1 
ATOM   3481 C CE1   . PHE A 1 455 ? 82.236  -56.506 16.050  1.00 130.67 ? 465 PHE A CE1   1 
ATOM   3482 C CE2   . PHE A 1 455 ? 81.628  -58.812 15.981  1.00 133.07 ? 465 PHE A CE2   1 
ATOM   3483 C CZ    . PHE A 1 455 ? 82.557  -57.820 15.771  1.00 132.52 ? 465 PHE A CZ    1 
ATOM   3484 N N     . ARG A 1 456 ? 75.505  -56.262 16.121  1.00 126.72 ? 466 ARG A N     1 
ATOM   3485 C CA    . ARG A 1 456 ? 74.097  -56.135 16.481  1.00 126.08 ? 466 ARG A CA    1 
ATOM   3486 C C     . ARG A 1 456 ? 73.334  -57.448 16.339  1.00 127.79 ? 466 ARG A C     1 
ATOM   3487 O O     . ARG A 1 456 ? 73.480  -58.147 15.344  1.00 129.10 ? 466 ARG A O     1 
ATOM   3488 C CB    . ARG A 1 456 ? 73.441  -55.050 15.626  1.00 145.95 ? 466 ARG A CB    1 
ATOM   3489 C CG    . ARG A 1 456 ? 71.926  -55.035 15.686  1.00 145.64 ? 466 ARG A CG    1 
ATOM   3490 C CD    . ARG A 1 456 ? 71.344  -53.764 15.093  1.00 144.15 ? 466 ARG A CD    1 
ATOM   3491 N NE    . ARG A 1 456 ? 71.575  -53.656 13.656  1.00 144.54 ? 466 ARG A NE    1 
ATOM   3492 C CZ    . ARG A 1 456 ? 72.576  -52.977 13.102  1.00 144.22 ? 466 ARG A CZ    1 
ATOM   3493 N NH1   . ARG A 1 456 ? 73.453  -52.338 13.865  1.00 143.50 ? 466 ARG A NH1   1 
ATOM   3494 N NH2   . ARG A 1 456 ? 72.699  -52.936 11.781  1.00 144.88 ? 466 ARG A NH2   1 
ATOM   3495 N N     . SER A 1 457 ? 72.517  -57.781 17.332  1.00 143.23 ? 467 SER A N     1 
ATOM   3496 C CA    . SER A 1 457 ? 71.691  -58.984 17.266  1.00 145.12 ? 467 SER A CA    1 
ATOM   3497 C C     . SER A 1 457 ? 70.475  -58.778 16.359  1.00 144.97 ? 467 SER A C     1 
ATOM   3498 O O     . SER A 1 457 ? 70.234  -57.671 15.881  1.00 143.29 ? 467 SER A O     1 
ATOM   3499 C CB    . SER A 1 457 ? 71.241  -59.391 18.672  1.00 130.54 ? 467 SER A CB    1 
ATOM   3500 O OG    . SER A 1 457 ? 70.565  -58.331 19.337  1.00 128.87 ? 467 SER A OG    1 
ATOM   3501 N N     . ILE A 1 458 ? 69.694  -59.834 16.151  1.00 162.19 ? 468 ILE A N     1 
ATOM   3502 C CA    . ILE A 1 458 ? 68.489  -59.752 15.322  1.00 162.47 ? 468 ILE A CA    1 
ATOM   3503 C C     . ILE A 1 458 ? 67.365  -60.608 15.910  1.00 164.27 ? 468 ILE A C     1 
ATOM   3504 O O     . ILE A 1 458 ? 67.499  -61.134 17.014  1.00 165.08 ? 468 ILE A O     1 
ATOM   3505 C CB    . ILE A 1 458 ? 68.770  -60.181 13.866  1.00 133.22 ? 468 ILE A CB    1 
ATOM   3506 C CG1   . ILE A 1 458 ? 69.692  -61.399 13.823  1.00 135.37 ? 468 ILE A CG1   1 
ATOM   3507 C CG2   . ILE A 1 458 ? 69.436  -59.052 13.101  1.00 131.38 ? 468 ILE A CG2   1 
ATOM   3508 C CD1   . ILE A 1 458 ? 69.087  -62.703 14.334  1.00 137.95 ? 468 ILE A CD1   1 
ATOM   3509 N N     . ASP A 1 459 ? 66.269  -60.764 15.169  1.00 134.71 ? 469 ASP A N     1 
ATOM   3510 C CA    . ASP A 1 459 ? 65.121  -61.515 15.678  1.00 136.66 ? 469 ASP A CA    1 
ATOM   3511 C C     . ASP A 1 459 ? 64.476  -62.405 14.616  1.00 139.18 ? 469 ASP A C     1 
ATOM   3512 O O     . ASP A 1 459 ? 64.585  -62.141 13.421  1.00 138.94 ? 469 ASP A O     1 
ATOM   3513 C CB    . ASP A 1 459 ? 64.075  -60.550 16.251  1.00 283.93 ? 469 ASP A CB    1 
ATOM   3514 C CG    . ASP A 1 459 ? 63.137  -61.219 17.248  1.00 285.79 ? 469 ASP A CG    1 
ATOM   3515 O OD1   . ASP A 1 459 ? 62.505  -62.237 16.894  1.00 288.46 ? 469 ASP A OD1   1 
ATOM   3516 O OD2   . ASP A 1 459 ? 63.035  -60.727 18.393  1.00 284.83 ? 469 ASP A OD2   1 
ATOM   3517 N N     . ASP A 1 460 ? 63.807  -63.461 15.073  1.00 245.01 ? 470 ASP A N     1 
ATOM   3518 C CA    . ASP A 1 460 ? 63.041  -64.354 14.206  1.00 247.90 ? 470 ASP A CA    1 
ATOM   3519 C C     . ASP A 1 460 ? 61.759  -63.655 13.744  1.00 247.32 ? 470 ASP A C     1 
ATOM   3520 O O     . ASP A 1 460 ? 61.289  -62.724 14.397  1.00 245.29 ? 470 ASP A O     1 
ATOM   3521 C CB    . ASP A 1 460 ? 62.721  -65.660 14.947  1.00 210.52 ? 470 ASP A CB    1 
ATOM   3522 C CG    . ASP A 1 460 ? 62.129  -66.726 14.041  1.00 214.06 ? 470 ASP A CG    1 
ATOM   3523 O OD1   . ASP A 1 460 ? 62.238  -66.589 12.805  1.00 214.07 ? 470 ASP A OD1   1 
ATOM   3524 O OD2   . ASP A 1 460 ? 61.564  -67.709 14.569  1.00 217.08 ? 470 ASP A OD2   1 
ATOM   3525 N N     . GLY A 1 461 ? 61.200  -64.099 12.621  1.00 279.08 ? 471 GLY A N     1 
ATOM   3526 C CA    . GLY A 1 461 ? 60.026  -63.465 12.043  1.00 278.77 ? 471 GLY A CA    1 
ATOM   3527 C C     . GLY A 1 461 ? 58.773  -63.522 12.902  1.00 279.70 ? 471 GLY A C     1 
ATOM   3528 O O     . GLY A 1 461 ? 58.600  -64.439 13.705  1.00 281.92 ? 471 GLY A O     1 
ATOM   3529 N N     . ILE A 1 462 ? 57.899  -62.533 12.726  1.00 244.79 ? 472 ILE A N     1 
ATOM   3530 C CA    . ILE A 1 462 ? 56.640  -62.457 13.468  1.00 245.66 ? 472 ILE A CA    1 
ATOM   3531 C C     . ILE A 1 462 ? 55.739  -63.653 13.159  1.00 249.78 ? 472 ILE A C     1 
ATOM   3532 O O     . ILE A 1 462 ? 55.157  -64.260 14.062  1.00 251.81 ? 472 ILE A O     1 
ATOM   3533 C CB    . ILE A 1 462 ? 55.873  -61.146 13.152  1.00 166.63 ? 472 ILE A CB    1 
ATOM   3534 C CG1   . ILE A 1 462 ? 56.668  -59.924 13.627  1.00 162.87 ? 472 ILE A CG1   1 
ATOM   3535 C CG2   . ILE A 1 462 ? 54.481  -61.167 13.780  1.00 168.07 ? 472 ILE A CG2   1 
ATOM   3536 C CD1   . ILE A 1 462 ? 56.011  -58.596 13.306  1.00 160.76 ? 472 ILE A CD1   1 
ATOM   3537 N N     . THR A 1 517 ? 57.677  -77.525 21.220  1.00 284.28 ? 527 THR A N     1 
ATOM   3538 C CA    . THR A 1 517 ? 57.565  -76.079 21.394  1.00 279.12 ? 527 THR A CA    1 
ATOM   3539 C C     . THR A 1 517 ? 58.655  -75.406 22.260  1.00 275.37 ? 527 THR A C     1 
ATOM   3540 O O     . THR A 1 517 ? 58.844  -74.193 22.151  1.00 270.82 ? 527 THR A O     1 
ATOM   3541 C CB    . THR A 1 517 ? 56.183  -75.707 21.986  1.00 222.88 ? 527 THR A CB    1 
ATOM   3542 O OG1   . THR A 1 517 ? 56.074  -76.201 23.327  1.00 225.42 ? 527 THR A OG1   1 
ATOM   3543 C CG2   . THR A 1 517 ? 55.062  -76.294 21.135  1.00 226.62 ? 527 THR A CG2   1 
ATOM   3544 N N     . PRO A 1 518 ? 59.368  -76.161 23.128  1.00 323.01 ? 528 PRO A N     1 
ATOM   3545 C CA    . PRO A 1 518 ? 60.434  -75.422 23.819  1.00 319.24 ? 528 PRO A CA    1 
ATOM   3546 C C     . PRO A 1 518 ? 61.775  -75.452 23.080  1.00 317.32 ? 528 PRO A C     1 
ATOM   3547 O O     . PRO A 1 518 ? 61.913  -76.179 22.096  1.00 319.35 ? 528 PRO A O     1 
ATOM   3548 C CB    . PRO A 1 518 ? 60.541  -76.155 25.157  1.00 184.04 ? 528 PRO A CB    1 
ATOM   3549 C CG    . PRO A 1 518 ? 60.176  -77.563 24.825  1.00 189.47 ? 528 PRO A CG    1 
ATOM   3550 C CD    . PRO A 1 518 ? 59.146  -77.490 23.733  1.00 190.14 ? 528 PRO A CD    1 
ATOM   3551 N N     . ARG A 1 519 ? 62.759  -74.705 23.578  1.00 197.20 ? 529 ARG A N     1 
ATOM   3552 C CA    . ARG A 1 519 ? 64.066  -74.645 22.932  1.00 195.31 ? 529 ARG A CA    1 
ATOM   3553 C C     . ARG A 1 519 ? 65.177  -74.867 23.963  1.00 195.32 ? 529 ARG A C     1 
ATOM   3554 O O     . ARG A 1 519 ? 65.174  -74.236 25.020  1.00 193.76 ? 529 ARG A O     1 
ATOM   3555 C CB    . ARG A 1 519 ? 64.231  -73.279 22.247  1.00 169.05 ? 529 ARG A CB    1 
ATOM   3556 C CG    . ARG A 1 519 ? 65.186  -73.238 21.065  1.00 167.72 ? 529 ARG A CG    1 
ATOM   3557 C CD    . ARG A 1 519 ? 65.534  -71.800 20.658  1.00 162.89 ? 529 ARG A CD    1 
ATOM   3558 N NE    . ARG A 1 519 ? 64.389  -71.040 20.153  1.00 161.53 ? 529 ARG A NE    1 
ATOM   3559 C CZ    . ARG A 1 519 ? 64.456  -69.790 19.696  1.00 157.75 ? 529 ARG A CZ    1 
ATOM   3560 N NH1   . ARG A 1 519 ? 65.615  -69.143 19.675  1.00 155.00 ? 529 ARG A NH1   1 
ATOM   3561 N NH2   . ARG A 1 519 ? 63.359  -69.182 19.261  1.00 156.93 ? 529 ARG A NH2   1 
ATOM   3562 N N     . PRO A 1 520 ? 66.152  -75.740 23.649  1.00 184.42 ? 530 PRO A N     1 
ATOM   3563 C CA    . PRO A 1 520 ? 67.307  -75.926 24.531  1.00 184.35 ? 530 PRO A CA    1 
ATOM   3564 C C     . PRO A 1 520 ? 68.494  -75.076 24.100  1.00 180.38 ? 530 PRO A C     1 
ATOM   3565 O O     . PRO A 1 520 ? 69.593  -75.604 23.937  1.00 181.19 ? 530 PRO A O     1 
ATOM   3566 C CB    . PRO A 1 520 ? 67.615  -77.414 24.380  1.00 180.88 ? 530 PRO A CB    1 
ATOM   3567 C CG    . PRO A 1 520 ? 67.259  -77.696 22.946  1.00 181.65 ? 530 PRO A CG    1 
ATOM   3568 C CD    . PRO A 1 520 ? 66.118  -76.755 22.580  1.00 179.35 ? 530 PRO A CD    1 
ATOM   3569 N N     . GLY A 1 521 ? 68.278  -73.777 23.937  1.00 167.38 ? 531 GLY A N     1 
ATOM   3570 C CA    . GLY A 1 521 ? 69.354  -72.878 23.577  1.00 163.74 ? 531 GLY A CA    1 
ATOM   3571 C C     . GLY A 1 521 ? 68.917  -71.437 23.682  1.00 159.84 ? 531 GLY A C     1 
ATOM   3572 O O     . GLY A 1 521 ? 67.740  -71.117 23.507  1.00 159.65 ? 531 GLY A O     1 
ATOM   3573 N N     . SER A 1 522 ? 69.882  -70.560 23.929  1.00 156.90 ? 532 SER A N     1 
ATOM   3574 C CA    . SER A 1 522 ? 69.601  -69.157 24.191  1.00 153.38 ? 532 SER A CA    1 
ATOM   3575 C C     . SER A 1 522 ? 69.989  -68.287 23.013  1.00 150.48 ? 532 SER A C     1 
ATOM   3576 O O     . SER A 1 522 ? 71.139  -68.292 22.584  1.00 149.86 ? 532 SER A O     1 
ATOM   3577 C CB    . SER A 1 522 ? 70.344  -68.694 25.444  1.00 154.70 ? 532 SER A CB    1 
ATOM   3578 O OG    . SER A 1 522 ? 70.067  -67.335 25.738  1.00 151.59 ? 532 SER A OG    1 
ATOM   3579 N N     . HIS A 1 523 ? 69.026  -67.531 22.501  1.00 148.87 ? 533 HIS A N     1 
ATOM   3580 C CA    . HIS A 1 523 ? 69.270  -66.652 21.369  1.00 146.30 ? 533 HIS A CA    1 
ATOM   3581 C C     . HIS A 1 523 ? 70.252  -65.547 21.738  1.00 143.38 ? 533 HIS A C     1 
ATOM   3582 O O     . HIS A 1 523 ? 71.037  -65.103 20.902  1.00 141.96 ? 533 HIS A O     1 
ATOM   3583 C CB    . HIS A 1 523 ? 67.956  -66.050 20.871  1.00 232.69 ? 533 HIS A CB    1 
ATOM   3584 C CG    . HIS A 1 523 ? 68.121  -65.114 19.717  1.00 230.24 ? 533 HIS A CG    1 
ATOM   3585 N ND1   . HIS A 1 523 ? 68.632  -65.515 18.501  1.00 230.90 ? 533 HIS A ND1   1 
ATOM   3586 C CD2   . HIS A 1 523 ? 67.845  -63.795 19.593  1.00 227.37 ? 533 HIS A CD2   1 
ATOM   3587 C CE1   . HIS A 1 523 ? 68.662  -64.483 17.676  1.00 228.55 ? 533 HIS A CE1   1 
ATOM   3588 N NE2   . HIS A 1 523 ? 68.190  -63.427 18.315  1.00 226.37 ? 533 HIS A NE2   1 
ATOM   3589 N N     . THR A 1 524 ? 70.205  -65.116 22.995  1.00 142.79 ? 534 THR A N     1 
ATOM   3590 C CA    . THR A 1 524 ? 71.070  -64.051 23.494  1.00 140.38 ? 534 THR A CA    1 
ATOM   3591 C C     . THR A 1 524 ? 72.518  -64.518 23.607  1.00 141.07 ? 534 THR A C     1 
ATOM   3592 O O     . THR A 1 524 ? 73.437  -63.801 23.221  1.00 139.31 ? 534 THR A O     1 
ATOM   3593 C CB    . THR A 1 524 ? 70.590  -63.533 24.869  1.00 140.04 ? 534 THR A CB    1 
ATOM   3594 O OG1   . THR A 1 524 ? 69.303  -62.921 24.734  1.00 139.14 ? 534 THR A OG1   1 
ATOM   3595 C CG2   . THR A 1 524 ? 71.554  -62.509 25.427  1.00 138.03 ? 534 THR A CG2   1 
ATOM   3596 N N     . ILE A 1 525 ? 72.721  -65.722 24.132  1.00 143.84 ? 535 ILE A N     1 
ATOM   3597 C CA    . ILE A 1 525 ? 74.067  -66.270 24.291  1.00 144.87 ? 535 ILE A CA    1 
ATOM   3598 C C     . ILE A 1 525 ? 74.694  -66.613 22.936  1.00 145.08 ? 535 ILE A C     1 
ATOM   3599 O O     . ILE A 1 525 ? 75.869  -66.321 22.688  1.00 144.29 ? 535 ILE A O     1 
ATOM   3600 C CB    . ILE A 1 525 ? 74.057  -67.527 25.189  1.00 148.15 ? 535 ILE A CB    1 
ATOM   3601 C CG1   . ILE A 1 525 ? 73.615  -67.169 26.607  1.00 148.18 ? 535 ILE A CG1   1 
ATOM   3602 C CG2   . ILE A 1 525 ? 75.431  -68.157 25.247  1.00 149.43 ? 535 ILE A CG2   1 
ATOM   3603 C CD1   . ILE A 1 525 ? 74.607  -66.312 27.350  1.00 146.53 ? 535 ILE A CD1   1 
ATOM   3604 N N     . GLU A 1 526 ? 73.899  -67.225 22.062  1.00 146.37 ? 536 GLU A N     1 
ATOM   3605 C CA    . GLU A 1 526 ? 74.358  -67.596 20.727  1.00 146.95 ? 536 GLU A CA    1 
ATOM   3606 C C     . GLU A 1 526 ? 74.927  -66.393 19.979  1.00 144.07 ? 536 GLU A C     1 
ATOM   3607 O O     . GLU A 1 526 ? 75.890  -66.528 19.227  1.00 144.34 ? 536 GLU A O     1 
ATOM   3608 C CB    . GLU A 1 526 ? 73.219  -68.230 19.922  1.00 152.73 ? 536 GLU A CB    1 
ATOM   3609 C CG    . GLU A 1 526 ? 72.884  -69.657 20.336  1.00 156.45 ? 536 GLU A CG    1 
ATOM   3610 C CD    . GLU A 1 526 ? 71.546  -70.129 19.796  1.00 158.12 ? 536 GLU A CD    1 
ATOM   3611 O OE1   . GLU A 1 526 ? 70.964  -71.067 20.383  1.00 160.98 ? 536 GLU A OE1   1 
ATOM   3612 O OE2   . GLU A 1 526 ? 71.074  -69.565 18.785  1.00 156.80 ? 536 GLU A OE2   1 
ATOM   3613 N N     . PHE A 1 527 ? 74.338  -65.221 20.197  1.00 141.56 ? 537 PHE A N     1 
ATOM   3614 C CA    . PHE A 1 527 ? 74.835  -63.986 19.604  1.00 138.96 ? 537 PHE A CA    1 
ATOM   3615 C C     . PHE A 1 527 ? 76.229  -63.661 20.114  1.00 138.42 ? 537 PHE A C     1 
ATOM   3616 O O     . PHE A 1 527 ? 77.107  -63.299 19.338  1.00 137.84 ? 537 PHE A O     1 
ATOM   3617 C CB    . PHE A 1 527 ? 73.882  -62.831 19.898  1.00 136.70 ? 537 PHE A CB    1 
ATOM   3618 C CG    . PHE A 1 527 ? 74.449  -61.480 19.592  1.00 134.18 ? 537 PHE A CG    1 
ATOM   3619 C CD1   . PHE A 1 527 ? 74.605  -61.061 18.291  1.00 133.47 ? 537 PHE A CD1   1 
ATOM   3620 C CD2   . PHE A 1 527 ? 74.802  -60.615 20.609  1.00 132.79 ? 537 PHE A CD2   1 
ATOM   3621 C CE1   . PHE A 1 527 ? 75.115  -59.816 18.009  1.00 131.47 ? 537 PHE A CE1   1 
ATOM   3622 C CE2   . PHE A 1 527 ? 75.311  -59.369 20.328  1.00 130.80 ? 537 PHE A CE2   1 
ATOM   3623 C CZ    . PHE A 1 527 ? 75.467  -58.971 19.028  1.00 130.15 ? 537 PHE A CZ    1 
ATOM   3624 N N     . PHE A 1 528 ? 76.431  -63.803 21.421  1.00 138.86 ? 538 PHE A N     1 
ATOM   3625 C CA    . PHE A 1 528 ? 77.720  -63.504 22.037  1.00 138.59 ? 538 PHE A CA    1 
ATOM   3626 C C     . PHE A 1 528 ? 78.802  -64.473 21.569  1.00 140.58 ? 538 PHE A C     1 
ATOM   3627 O O     . PHE A 1 528 ? 79.912  -64.064 21.232  1.00 140.08 ? 538 PHE A O     1 
ATOM   3628 C CB    . PHE A 1 528 ? 77.615  -63.547 23.562  1.00 139.06 ? 538 PHE A CB    1 
ATOM   3629 C CG    . PHE A 1 528 ? 76.797  -62.433 24.160  1.00 137.11 ? 538 PHE A CG    1 
ATOM   3630 C CD1   . PHE A 1 528 ? 77.021  -61.113 23.809  1.00 134.74 ? 538 PHE A CD1   1 
ATOM   3631 C CD2   . PHE A 1 528 ? 75.807  -62.709 25.083  1.00 137.91 ? 538 PHE A CD2   1 
ATOM   3632 C CE1   . PHE A 1 528 ? 76.268  -60.092 24.366  1.00 133.16 ? 538 PHE A CE1   1 
ATOM   3633 C CE2   . PHE A 1 528 ? 75.053  -61.693 25.639  1.00 136.32 ? 538 PHE A CE2   1 
ATOM   3634 C CZ    . PHE A 1 528 ? 75.285  -60.384 25.280  1.00 133.92 ? 538 PHE A CZ    1 
ATOM   3635 N N     . GLU A 1 529 ? 78.476  -65.760 21.558  1.00 143.08 ? 539 GLU A N     1 
ATOM   3636 C CA    . GLU A 1 529 ? 79.423  -66.774 21.118  1.00 145.33 ? 539 GLU A CA    1 
ATOM   3637 C C     . GLU A 1 529 ? 79.835  -66.540 19.670  1.00 144.89 ? 539 GLU A C     1 
ATOM   3638 O O     . GLU A 1 529 ? 80.987  -66.764 19.299  1.00 145.72 ? 539 GLU A O     1 
ATOM   3639 C CB    . GLU A 1 529 ? 78.829  -68.175 21.278  1.00 148.32 ? 539 GLU A CB    1 
ATOM   3640 C CG    . GLU A 1 529 ? 78.790  -68.675 22.714  1.00 149.71 ? 539 GLU A CG    1 
ATOM   3641 C CD    . GLU A 1 529 ? 78.408  -70.144 22.818  1.00 153.22 ? 539 GLU A CD    1 
ATOM   3642 O OE1   . GLU A 1 529 ? 78.676  -70.759 23.875  1.00 155.04 ? 539 GLU A OE1   1 
ATOM   3643 O OE2   . GLU A 1 529 ? 77.838  -70.683 21.847  1.00 154.37 ? 539 GLU A OE2   1 
ATOM   3644 N N     . MET A 1 530 ? 78.884  -66.085 18.860  1.00 143.75 ? 540 MET A N     1 
ATOM   3645 C CA    . MET A 1 530 ? 79.124  -65.837 17.444  1.00 143.50 ? 540 MET A CA    1 
ATOM   3646 C C     . MET A 1 530 ? 80.098  -64.688 17.276  1.00 141.54 ? 540 MET A C     1 
ATOM   3647 O O     . MET A 1 530 ? 81.044  -64.777 16.499  1.00 142.28 ? 540 MET A O     1 
ATOM   3648 C CB    . MET A 1 530 ? 77.815  -65.533 16.720  1.00 157.46 ? 540 MET A CB    1 
ATOM   3649 C CG    . MET A 1 530 ? 77.903  -65.565 15.206  1.00 158.02 ? 540 MET A CG    1 
ATOM   3650 S SD    . MET A 1 530 ? 76.277  -65.365 14.452  1.00 157.64 ? 540 MET A SD    1 
ATOM   3651 C CE    . MET A 1 530 ? 75.335  -66.571 15.379  1.00 159.87 ? 540 MET A CE    1 
ATOM   3652 N N     . CYS A 1 531 ? 79.861  -63.610 18.013  1.00 139.29 ? 541 CYS A N     1 
ATOM   3653 C CA    . CYS A 1 531 ? 80.756  -62.463 17.990  1.00 137.64 ? 541 CYS A CA    1 
ATOM   3654 C C     . CYS A 1 531 ? 82.114  -62.845 18.556  1.00 138.89 ? 541 CYS A C     1 
ATOM   3655 O O     . CYS A 1 531 ? 83.150  -62.527 17.978  1.00 139.04 ? 541 CYS A O     1 
ATOM   3656 C CB    . CYS A 1 531 ? 80.172  -61.298 18.784  1.00 135.36 ? 541 CYS A CB    1 
ATOM   3657 S SG    . CYS A 1 531 ? 78.512  -60.813 18.298  1.00 133.95 ? 541 CYS A SG    1 
ATOM   3658 N N     . ALA A 1 532 ? 82.093  -63.535 19.692  1.00 139.97 ? 542 ALA A N     1 
ATOM   3659 C CA    . ALA A 1 532 ? 83.312  -63.930 20.388  1.00 141.30 ? 542 ALA A CA    1 
ATOM   3660 C C     . ALA A 1 532 ? 84.279  -64.677 19.472  1.00 143.22 ? 542 ALA A C     1 
ATOM   3661 O O     . ALA A 1 532 ? 85.474  -64.378 19.437  1.00 143.48 ? 542 ALA A O     1 
ATOM   3662 C CB    . ALA A 1 532 ? 82.968  -64.783 21.601  1.00 190.54 ? 542 ALA A CB    1 
ATOM   3663 N N     . ASN A 1 533 ? 83.755  -65.646 18.732  1.00 144.78 ? 543 ASN A N     1 
ATOM   3664 C CA    . ASN A 1 533 ? 84.569  -66.419 17.805  1.00 146.90 ? 543 ASN A CA    1 
ATOM   3665 C C     . ASN A 1 533 ? 85.201  -65.529 16.744  1.00 145.90 ? 543 ASN A C     1 
ATOM   3666 O O     . ASN A 1 533 ? 86.380  -65.667 16.426  1.00 147.10 ? 543 ASN A O     1 
ATOM   3667 C CB    . ASN A 1 533 ? 83.735  -67.513 17.139  1.00 148.82 ? 543 ASN A CB    1 
ATOM   3668 C CG    . ASN A 1 533 ? 83.283  -68.582 18.117  1.00 150.65 ? 543 ASN A CG    1 
ATOM   3669 O OD1   . ASN A 1 533 ? 83.807  -68.689 19.227  1.00 150.95 ? 543 ASN A OD1   1 
ATOM   3670 N ND2   . ASN A 1 533 ? 82.312  -69.392 17.701  1.00 152.17 ? 543 ASN A ND2   1 
ATOM   3671 N N     . LEU A 1 534 ? 84.405  -64.618 16.200  1.00 143.90 ? 544 LEU A N     1 
ATOM   3672 C CA    . LEU A 1 534 ? 84.891  -63.670 15.209  1.00 142.97 ? 544 LEU A CA    1 
ATOM   3673 C C     . LEU A 1 534 ? 85.972  -62.765 15.790  1.00 142.08 ? 544 LEU A C     1 
ATOM   3674 O O     . LEU A 1 534 ? 87.032  -62.593 15.187  1.00 142.97 ? 544 LEU A O     1 
ATOM   3675 C CB    . LEU A 1 534 ? 83.731  -62.830 14.671  1.00 140.99 ? 544 LEU A CB    1 
ATOM   3676 C CG    . LEU A 1 534 ? 84.062  -61.668 13.740  1.00 139.84 ? 544 LEU A CG    1 
ATOM   3677 C CD1   . LEU A 1 534 ? 84.776  -62.190 12.518  1.00 141.93 ? 544 LEU A CD1   1 
ATOM   3678 C CD2   . LEU A 1 534 ? 82.792  -60.935 13.344  1.00 138.03 ? 544 LEU A CD2   1 
ATOM   3679 N N     . ILE A 1 535 ? 85.699  -62.203 16.968  1.00 140.58 ? 545 ILE A N     1 
ATOM   3680 C CA    . ILE A 1 535 ? 86.598  -61.244 17.613  1.00 139.77 ? 545 ILE A CA    1 
ATOM   3681 C C     . ILE A 1 535 ? 87.959  -61.859 17.921  1.00 141.81 ? 545 ILE A C     1 
ATOM   3682 O O     . ILE A 1 535 ? 88.992  -61.205 17.770  1.00 141.98 ? 545 ILE A O     1 
ATOM   3683 C CB    . ILE A 1 535 ? 85.991  -60.687 18.915  1.00 138.23 ? 545 ILE A CB    1 
ATOM   3684 C CG1   . ILE A 1 535 ? 84.699  -59.934 18.616  1.00 136.19 ? 545 ILE A CG1   1 
ATOM   3685 C CG2   . ILE A 1 535 ? 86.961  -59.744 19.588  1.00 137.79 ? 545 ILE A CG2   1 
ATOM   3686 C CD1   . ILE A 1 535 ? 83.760  -59.862 19.782  1.00 135.29 ? 545 ILE A CD1   1 
ATOM   3687 N N     . LYS A 1 536 ? 87.953  -63.123 18.335  1.00 144.96 ? 546 LYS A N     1 
ATOM   3688 C CA    . LYS A 1 536 ? 89.183  -63.843 18.662  1.00 147.16 ? 546 LYS A CA    1 
ATOM   3689 C C     . LYS A 1 536 ? 90.166  -63.887 17.488  1.00 148.50 ? 546 LYS A C     1 
ATOM   3690 O O     . LYS A 1 536 ? 91.380  -63.818 17.682  1.00 149.65 ? 546 LYS A O     1 
ATOM   3691 C CB    . LYS A 1 536 ? 88.849  -65.266 19.127  1.00 147.73 ? 546 LYS A CB    1 
ATOM   3692 C CG    . LYS A 1 536 ? 90.055  -66.181 19.338  1.00 150.39 ? 546 LYS A CG    1 
ATOM   3693 C CD    . LYS A 1 536 ? 90.987  -65.674 20.432  1.00 150.32 ? 546 LYS A CD    1 
ATOM   3694 C CE    . LYS A 1 536 ? 92.119  -66.664 20.692  1.00 153.16 ? 546 LYS A CE    1 
ATOM   3695 N NZ    . LYS A 1 536 ? 93.064  -66.191 21.743  1.00 153.36 ? 546 LYS A NZ    1 
ATOM   3696 N N     . ILE A 1 537 ? 89.641  -63.991 16.272  1.00 147.18 ? 547 ILE A N     1 
ATOM   3697 C CA    . ILE A 1 537 ? 90.485  -64.061 15.088  1.00 148.70 ? 547 ILE A CA    1 
ATOM   3698 C C     . ILE A 1 537 ? 90.986  -62.677 14.688  1.00 147.40 ? 547 ILE A C     1 
ATOM   3699 O O     . ILE A 1 537 ? 92.121  -62.525 14.240  1.00 148.80 ? 547 ILE A O     1 
ATOM   3700 C CB    . ILE A 1 537 ? 89.739  -64.706 13.910  1.00 149.60 ? 547 ILE A CB    1 
ATOM   3701 C CG1   . ILE A 1 537 ? 89.020  -65.975 14.373  1.00 150.81 ? 547 ILE A CG1   1 
ATOM   3702 C CG2   . ILE A 1 537 ? 90.697  -65.016 12.770  1.00 151.86 ? 547 ILE A CG2   1 
ATOM   3703 C CD1   . ILE A 1 537 ? 89.934  -67.031 14.973  1.00 153.27 ? 547 ILE A CD1   1 
ATOM   3704 N N     . LEU A 1 538 ? 90.141  -61.667 14.855  1.00 144.95 ? 548 LEU A N     1 
ATOM   3705 C CA    . LEU A 1 538 ? 90.522  -60.295 14.536  1.00 143.80 ? 548 LEU A CA    1 
ATOM   3706 C C     . LEU A 1 538 ? 91.600  -59.773 15.486  1.00 144.06 ? 548 LEU A C     1 
ATOM   3707 O O     . LEU A 1 538 ? 92.433  -58.952 15.102  1.00 144.46 ? 548 LEU A O     1 
ATOM   3708 C CB    . LEU A 1 538 ? 89.303  -59.370 14.577  1.00 141.25 ? 548 LEU A CB    1 
ATOM   3709 C CG    . LEU A 1 538 ? 88.477  -59.235 13.297  1.00 140.88 ? 548 LEU A CG    1 
ATOM   3710 C CD1   . LEU A 1 538 ? 87.823  -60.541 12.963  1.00 142.02 ? 548 LEU A CD1   1 
ATOM   3711 C CD2   . LEU A 1 538 ? 87.431  -58.146 13.413  1.00 138.42 ? 548 LEU A CD2   1 
ATOM   3712 N N     . ALA A 1 539 ? 91.574  -60.249 16.726  1.00 160.48 ? 549 ALA A N     1 
ATOM   3713 C CA    . ALA A 1 539 ? 92.553  -59.843 17.732  1.00 160.95 ? 549 ALA A CA    1 
ATOM   3714 C C     . ALA A 1 539 ? 93.861  -60.610 17.564  1.00 163.62 ? 549 ALA A C     1 
ATOM   3715 O O     . ALA A 1 539 ? 94.901  -60.020 17.275  1.00 164.56 ? 549 ALA A O     1 
ATOM   3716 C CB    . ALA A 1 539 ? 91.994  -60.046 19.136  1.00 143.74 ? 549 ALA A CB    1 
ATOM   3717 N N     . GLN A 1 540 ? 93.801  -61.925 17.753  1.00 155.09 ? 550 GLN A N     1 
ATOM   3718 C CA    . GLN A 1 540 ? 94.977  -62.783 17.628  1.00 157.82 ? 550 GLN A CA    1 
ATOM   3719 C C     . GLN A 1 540 ? 94.998  -63.503 16.279  1.00 159.33 ? 550 GLN A C     1 
ATOM   3720 O O     . GLN A 1 540 ? 95.765  -63.147 15.383  1.00 160.37 ? 550 GLN A O     1 
ATOM   3721 C CB    . GLN A 1 540 ? 95.016  -63.804 18.771  1.00 204.43 ? 550 GLN A CB    1 
ATOM   3722 C CG    . GLN A 1 540 ? 96.361  -64.497 18.956  1.00 207.21 ? 550 GLN A CG    1 
ATOM   3723 C CD    . GLN A 1 540 ? 97.387  -63.610 19.638  1.00 207.37 ? 550 GLN A CD    1 
ATOM   3724 O OE1   . GLN A 1 540 ? 97.161  -63.121 20.745  1.00 206.26 ? 550 GLN A OE1   1 
ATOM   3725 N NE2   . GLN A 1 540 ? 98.519  -63.397 18.979  1.00 208.99 ? 550 GLN A NE2   1 
ATOM   3726 N N     . PRO B 2 3   ? 31.321  -47.515 -12.069 1.00 231.34 ? 78  PRO B N     1 
ATOM   3727 C CA    . PRO B 2 3   ? 31.916  -46.600 -13.047 1.00 231.87 ? 78  PRO B CA    1 
ATOM   3728 C C     . PRO B 2 3   ? 33.435  -46.594 -12.973 1.00 231.11 ? 78  PRO B C     1 
ATOM   3729 O O     . PRO B 2 3   ? 34.007  -47.228 -12.086 1.00 230.02 ? 78  PRO B O     1 
ATOM   3730 C CB    . PRO B 2 3   ? 31.352  -45.245 -12.633 1.00 202.69 ? 78  PRO B CB    1 
ATOM   3731 C CG    . PRO B 2 3   ? 31.229  -45.359 -11.150 1.00 200.71 ? 78  PRO B CG    1 
ATOM   3732 C CD    . PRO B 2 3   ? 30.874  -46.803 -10.859 1.00 201.42 ? 78  PRO B CD    1 
ATOM   3733 N N     . THR B 2 4   ? 34.071  -45.877 -13.896 1.00 220.70 ? 79  THR B N     1 
ATOM   3734 C CA    . THR B 2 4   ? 35.526  -45.759 -13.931 1.00 220.14 ? 79  THR B CA    1 
ATOM   3735 C C     . THR B 2 4   ? 35.948  -44.383 -14.456 1.00 219.90 ? 79  THR B C     1 
ATOM   3736 O O     . THR B 2 4   ? 35.151  -43.672 -15.074 1.00 220.64 ? 79  THR B O     1 
ATOM   3737 C CB    . THR B 2 4   ? 36.170  -46.864 -14.807 1.00 205.00 ? 79  THR B CB    1 
ATOM   3738 O OG1   . THR B 2 4   ? 35.366  -47.087 -15.971 1.00 207.17 ? 79  THR B OG1   1 
ATOM   3739 C CG2   . THR B 2 4   ? 36.299  -48.175 -14.036 1.00 204.67 ? 79  THR B CG2   1 
ATOM   3740 N N     . VAL B 2 5   ? 37.202  -44.012 -14.197 1.00 306.14 ? 80  VAL B N     1 
ATOM   3741 C CA    . VAL B 2 5   ? 37.741  -42.724 -14.638 1.00 305.85 ? 80  VAL B CA    1 
ATOM   3742 C C     . VAL B 2 5   ? 39.040  -42.887 -15.427 1.00 306.77 ? 80  VAL B C     1 
ATOM   3743 O O     . VAL B 2 5   ? 39.777  -43.854 -15.235 1.00 306.88 ? 80  VAL B O     1 
ATOM   3744 C CB    . VAL B 2 5   ? 38.004  -41.780 -13.446 1.00 199.33 ? 80  VAL B CB    1 
ATOM   3745 C CG1   . VAL B 2 5   ? 36.730  -41.578 -12.647 1.00 198.43 ? 80  VAL B CG1   1 
ATOM   3746 C CG2   . VAL B 2 5   ? 39.121  -42.322 -12.561 1.00 198.09 ? 80  VAL B CG2   1 
ATOM   3747 N N     . ILE B 2 6   ? 39.308  -41.938 -16.322 1.00 203.32 ? 81  ILE B N     1 
ATOM   3748 C CA    . ILE B 2 6   ? 40.507  -41.969 -17.159 1.00 204.33 ? 81  ILE B CA    1 
ATOM   3749 C C     . ILE B 2 6   ? 41.200  -40.608 -17.152 1.00 203.40 ? 81  ILE B C     1 
ATOM   3750 O O     . ILE B 2 6   ? 40.540  -39.573 -17.066 1.00 202.81 ? 81  ILE B O     1 
ATOM   3751 C CB    . ILE B 2 6   ? 40.175  -42.364 -18.621 1.00 206.86 ? 81  ILE B CB    1 
ATOM   3752 C CG1   . ILE B 2 6   ? 39.301  -43.618 -18.663 1.00 207.89 ? 81  ILE B CG1   1 
ATOM   3753 C CG2   . ILE B 2 6   ? 41.445  -42.592 -19.428 1.00 207.99 ? 81  ILE B CG2   1 
ATOM   3754 C CD1   . ILE B 2 6   ? 38.913  -44.044 -20.061 1.00 210.43 ? 81  ILE B CD1   1 
ATOM   3755 N N     . ARG B 2 7   ? 42.528  -40.616 -17.250 1.00 203.33 ? 82  ARG B N     1 
ATOM   3756 C CA    . ARG B 2 7   ? 43.318  -39.387 -17.285 1.00 202.60 ? 82  ARG B CA    1 
ATOM   3757 C C     . ARG B 2 7   ? 44.019  -39.232 -18.633 1.00 204.48 ? 82  ARG B C     1 
ATOM   3758 O O     . ARG B 2 7   ? 44.191  -40.201 -19.375 1.00 206.14 ? 82  ARG B O     1 
ATOM   3759 C CB    . ARG B 2 7   ? 44.354  -39.362 -16.153 1.00 240.85 ? 82  ARG B CB    1 
ATOM   3760 C CG    . ARG B 2 7   ? 43.767  -39.292 -14.748 1.00 238.80 ? 82  ARG B CG    1 
ATOM   3761 C CD    . ARG B 2 7   ? 44.862  -39.241 -13.683 1.00 237.12 ? 82  ARG B CD    1 
ATOM   3762 N NE    . ARG B 2 7   ? 45.214  -37.875 -13.293 1.00 235.84 ? 82  ARG B NE    1 
ATOM   3763 C CZ    . ARG B 2 7   ? 44.879  -37.315 -12.133 1.00 233.94 ? 82  ARG B CZ    1 
ATOM   3764 N NH1   . ARG B 2 7   ? 44.183  -38.003 -11.237 1.00 233.10 ? 82  ARG B NH1   1 
ATOM   3765 N NH2   . ARG B 2 7   ? 45.244  -36.067 -11.865 1.00 232.93 ? 82  ARG B NH2   1 
ATOM   3766 N N     . TRP B 2 8   ? 44.383  -37.995 -18.953 1.00 225.51 ? 83  TRP B N     1 
ATOM   3767 C CA    . TRP B 2 8   ? 45.048  -37.677 -20.210 1.00 227.23 ? 83  TRP B CA    1 
ATOM   3768 C C     . TRP B 2 8   ? 46.241  -36.747 -19.951 1.00 226.28 ? 83  TRP B C     1 
ATOM   3769 O O     . TRP B 2 8   ? 46.064  -35.585 -19.587 1.00 225.13 ? 83  TRP B O     1 
ATOM   3770 C CB    . TRP B 2 8   ? 44.016  -37.061 -21.164 1.00 215.56 ? 83  TRP B CB    1 
ATOM   3771 C CG    . TRP B 2 8   ? 44.527  -36.195 -22.269 1.00 216.81 ? 83  TRP B CG    1 
ATOM   3772 C CD1   . TRP B 2 8   ? 44.684  -34.841 -22.237 1.00 216.05 ? 83  TRP B CD1   1 
ATOM   3773 C CD2   . TRP B 2 8   ? 44.889  -36.610 -23.592 1.00 219.14 ? 83  TRP B CD2   1 
ATOM   3774 N NE1   . TRP B 2 8   ? 45.148  -34.389 -23.449 1.00 217.73 ? 83  TRP B NE1   1 
ATOM   3775 C CE2   . TRP B 2 8   ? 45.281  -35.457 -24.300 1.00 219.66 ? 83  TRP B CE2   1 
ATOM   3776 C CE3   . TRP B 2 8   ? 44.933  -37.848 -24.245 1.00 220.87 ? 83  TRP B CE3   1 
ATOM   3777 C CZ2   . TRP B 2 8   ? 45.715  -35.501 -25.624 1.00 221.84 ? 83  TRP B CZ2   1 
ATOM   3778 C CZ3   . TRP B 2 8   ? 45.363  -37.891 -25.562 1.00 223.03 ? 83  TRP B CZ3   1 
ATOM   3779 C CH2   . TRP B 2 8   ? 45.747  -36.725 -26.236 1.00 223.51 ? 83  TRP B CH2   1 
ATOM   3780 N N     . SER B 2 9   ? 47.452  -37.260 -20.164 1.00 271.37 ? 84  SER B N     1 
ATOM   3781 C CA    . SER B 2 9   ? 48.672  -36.571 -19.732 1.00 270.36 ? 84  SER B CA    1 
ATOM   3782 C C     . SER B 2 9   ? 49.282  -35.664 -20.800 1.00 271.60 ? 84  SER B C     1 
ATOM   3783 O O     . SER B 2 9   ? 50.238  -34.936 -20.530 1.00 270.88 ? 84  SER B O     1 
ATOM   3784 C CB    . SER B 2 9   ? 49.719  -37.591 -19.273 1.00 204.42 ? 84  SER B CB    1 
ATOM   3785 O OG    . SER B 2 9   ? 49.372  -38.159 -18.022 1.00 202.78 ? 84  SER B OG    1 
ATOM   3786 N N     . GLU B 2 10  ? 48.732  -35.714 -22.007 1.00 251.13 ? 85  GLU B N     1 
ATOM   3787 C CA    . GLU B 2 10  ? 49.223  -34.900 -23.116 1.00 252.52 ? 85  GLU B CA    1 
ATOM   3788 C C     . GLU B 2 10  ? 48.423  -33.600 -23.209 1.00 252.01 ? 85  GLU B C     1 
ATOM   3789 O O     . GLU B 2 10  ? 47.241  -33.571 -22.882 1.00 251.44 ? 85  GLU B O     1 
ATOM   3790 C CB    . GLU B 2 10  ? 49.146  -35.684 -24.430 1.00 211.65 ? 85  GLU B CB    1 
ATOM   3791 C CG    . GLU B 2 10  ? 50.427  -35.653 -25.250 1.00 213.05 ? 85  GLU B CG    1 
ATOM   3792 C CD    . GLU B 2 10  ? 50.537  -36.827 -26.205 1.00 215.24 ? 85  GLU B CD    1 
ATOM   3793 O OE1   . GLU B 2 10  ? 51.666  -37.128 -26.645 1.00 216.22 ? 85  GLU B OE1   1 
ATOM   3794 O OE2   . GLU B 2 10  ? 49.499  -37.450 -26.513 1.00 216.02 ? 85  GLU B OE2   1 
ATOM   3795 N N     . GLY B 2 11  ? 49.076  -32.516 -23.616 1.00 208.78 ? 86  GLY B N     1 
ATOM   3796 C CA    . GLY B 2 11  ? 48.411  -31.227 -23.712 1.00 208.29 ? 86  GLY B CA    1 
ATOM   3797 C C     . GLY B 2 11  ? 47.422  -31.122 -24.861 1.00 210.06 ? 86  GLY B C     1 
ATOM   3798 O O     . GLY B 2 11  ? 47.601  -31.746 -25.907 1.00 212.08 ? 86  GLY B O     1 
ATOM   3799 N N     . GLY B 2 12  ? 46.369  -30.332 -24.661 1.00 209.35 ? 87  GLY B N     1 
ATOM   3800 C CA    . GLY B 2 12  ? 45.391  -30.074 -25.705 1.00 210.93 ? 87  GLY B CA    1 
ATOM   3801 C C     . GLY B 2 12  ? 44.407  -28.972 -25.350 1.00 209.84 ? 87  GLY B C     1 
ATOM   3802 O O     . GLY B 2 12  ? 44.145  -28.713 -24.173 1.00 207.82 ? 87  GLY B O     1 
ATOM   3803 N N     . LYS B 2 13  ? 43.844  -28.334 -26.373 1.00 228.70 ? 88  LYS B N     1 
ATOM   3804 C CA    . LYS B 2 13  ? 42.902  -27.233 -26.173 1.00 227.89 ? 88  LYS B CA    1 
ATOM   3805 C C     . LYS B 2 13  ? 41.501  -27.751 -25.847 1.00 227.71 ? 88  LYS B C     1 
ATOM   3806 O O     . LYS B 2 13  ? 41.001  -27.566 -24.735 1.00 225.86 ? 88  LYS B O     1 
ATOM   3807 C CB    . LYS B 2 13  ? 42.854  -26.328 -27.411 1.00 212.03 ? 88  LYS B CB    1 
ATOM   3808 C CG    . LYS B 2 13  ? 44.128  -25.525 -27.674 1.00 212.05 ? 88  LYS B CG    1 
ATOM   3809 C CD    . LYS B 2 13  ? 45.026  -26.197 -28.703 1.00 214.08 ? 88  LYS B CD    1 
ATOM   3810 C CE    . LYS B 2 13  ? 46.072  -25.227 -29.230 1.00 214.55 ? 88  LYS B CE    1 
ATOM   3811 N NZ    . LYS B 2 13  ? 46.882  -25.818 -30.328 1.00 216.72 ? 88  LYS B NZ    1 
ATOM   3812 N N     . GLU B 2 14  ? 40.868  -28.388 -26.828 1.00 301.49 ? 89  GLU B N     1 
ATOM   3813 C CA    . GLU B 2 14  ? 39.588  -29.055 -26.616 1.00 301.64 ? 89  GLU B CA    1 
ATOM   3814 C C     . GLU B 2 14  ? 39.771  -30.565 -26.702 1.00 302.54 ? 89  GLU B C     1 
ATOM   3815 O O     . GLU B 2 14  ? 40.341  -31.074 -27.668 1.00 304.34 ? 89  GLU B O     1 
ATOM   3816 C CB    . GLU B 2 14  ? 38.547  -28.587 -27.635 1.00 213.98 ? 89  GLU B CB    1 
ATOM   3817 C CG    . GLU B 2 14  ? 37.519  -27.620 -27.070 1.00 212.72 ? 89  GLU B CG    1 
ATOM   3818 C CD    . GLU B 2 14  ? 36.309  -27.459 -27.972 1.00 214.38 ? 89  GLU B CD    1 
ATOM   3819 O OE1   . GLU B 2 14  ? 36.472  -27.520 -29.209 1.00 216.46 ? 89  GLU B OE1   1 
ATOM   3820 O OE2   . GLU B 2 14  ? 35.192  -27.279 -27.442 1.00 213.65 ? 89  GLU B OE2   1 
ATOM   3821 N N     . VAL B 2 15  ? 39.287  -31.279 -25.689 1.00 233.09 ? 90  VAL B N     1 
ATOM   3822 C CA    . VAL B 2 15  ? 39.494  -32.721 -25.606 1.00 233.69 ? 90  VAL B CA    1 
ATOM   3823 C C     . VAL B 2 15  ? 38.196  -33.473 -25.291 1.00 233.83 ? 90  VAL B C     1 
ATOM   3824 O O     . VAL B 2 15  ? 37.446  -33.094 -24.392 1.00 232.31 ? 90  VAL B O     1 
ATOM   3825 C CB    . VAL B 2 15  ? 40.568  -33.069 -24.541 1.00 210.93 ? 90  VAL B CB    1 
ATOM   3826 C CG1   . VAL B 2 15  ? 41.937  -32.589 -24.987 1.00 211.23 ? 90  VAL B CG1   1 
ATOM   3827 C CG2   . VAL B 2 15  ? 40.224  -32.449 -23.201 1.00 208.50 ? 90  VAL B CG2   1 
ATOM   3828 N N     . PHE B 2 16  ? 37.936  -34.535 -26.051 1.00 225.66 ? 91  PHE B N     1 
ATOM   3829 C CA    . PHE B 2 16  ? 36.775  -35.397 -25.831 1.00 226.07 ? 91  PHE B CA    1 
ATOM   3830 C C     . PHE B 2 16  ? 37.210  -36.859 -25.743 1.00 226.67 ? 91  PHE B C     1 
ATOM   3831 O O     . PHE B 2 16  ? 38.343  -37.198 -26.088 1.00 227.18 ? 91  PHE B O     1 
ATOM   3832 C CB    . PHE B 2 16  ? 35.740  -35.235 -26.950 1.00 217.15 ? 91  PHE B CB    1 
ATOM   3833 C CG    . PHE B 2 16  ? 35.110  -33.870 -27.021 1.00 216.64 ? 91  PHE B CG    1 
ATOM   3834 C CD1   . PHE B 2 16  ? 34.789  -33.172 -25.872 1.00 214.42 ? 91  PHE B CD1   1 
ATOM   3835 C CD2   . PHE B 2 16  ? 34.831  -33.290 -28.248 1.00 218.45 ? 91  PHE B CD2   1 
ATOM   3836 C CE1   . PHE B 2 16  ? 34.208  -31.917 -25.946 1.00 213.99 ? 91  PHE B CE1   1 
ATOM   3837 C CE2   . PHE B 2 16  ? 34.251  -32.037 -28.328 1.00 218.02 ? 91  PHE B CE2   1 
ATOM   3838 C CZ    . PHE B 2 16  ? 33.939  -31.350 -27.176 1.00 215.78 ? 91  PHE B CZ    1 
ATOM   3839 N N     . ILE B 2 17  ? 36.309  -37.721 -25.278 1.00 215.69 ? 92  ILE B N     1 
ATOM   3840 C CA    . ILE B 2 17  ? 36.586  -39.153 -25.204 1.00 216.36 ? 92  ILE B CA    1 
ATOM   3841 C C     . ILE B 2 17  ? 35.401  -39.961 -25.744 1.00 218.11 ? 92  ILE B C     1 
ATOM   3842 O O     . ILE B 2 17  ? 34.242  -39.645 -25.469 1.00 217.83 ? 92  ILE B O     1 
ATOM   3843 C CB    . ILE B 2 17  ? 36.925  -39.585 -23.751 1.00 214.14 ? 92  ILE B CB    1 
ATOM   3844 C CG1   . ILE B 2 17  ? 37.279  -41.078 -23.680 1.00 214.84 ? 92  ILE B CG1   1 
ATOM   3845 C CG2   . ILE B 2 17  ? 35.799  -39.213 -22.797 1.00 212.69 ? 92  ILE B CG2   1 
ATOM   3846 C CD1   . ILE B 2 17  ? 36.146  -41.984 -23.233 1.00 215.01 ? 92  ILE B CD1   1 
ATOM   3847 N N     . SER B 2 18  ? 35.705  -40.994 -26.526 1.00 226.61 ? 93  SER B N     1 
ATOM   3848 C CA    . SER B 2 18  ? 34.687  -41.846 -27.141 1.00 228.54 ? 93  SER B CA    1 
ATOM   3849 C C     . SER B 2 18  ? 34.950  -43.314 -26.813 1.00 228.86 ? 93  SER B C     1 
ATOM   3850 O O     . SER B 2 18  ? 35.858  -43.621 -26.043 1.00 227.45 ? 93  SER B O     1 
ATOM   3851 C CB    . SER B 2 18  ? 34.656  -41.641 -28.658 1.00 253.90 ? 93  SER B CB    1 
ATOM   3852 O OG    . SER B 2 18  ? 34.452  -40.279 -28.992 1.00 253.65 ? 93  SER B OG    1 
ATOM   3853 N N     . GLY B 2 19  ? 34.157  -44.217 -27.389 1.00 224.11 ? 94  GLY B N     1 
ATOM   3854 C CA    . GLY B 2 19  ? 34.353  -45.643 -27.175 1.00 224.64 ? 94  GLY B CA    1 
ATOM   3855 C C     . GLY B 2 19  ? 33.223  -46.546 -27.644 1.00 226.53 ? 94  GLY B C     1 
ATOM   3856 O O     . GLY B 2 19  ? 32.264  -46.092 -28.266 1.00 227.68 ? 94  GLY B O     1 
ATOM   3857 N N     . SER B 2 20  ? 33.347  -47.837 -27.348 1.00 332.70 ? 95  SER B N     1 
ATOM   3858 C CA    . SER B 2 20  ? 32.344  -48.828 -27.733 1.00 334.51 ? 95  SER B CA    1 
ATOM   3859 C C     . SER B 2 20  ? 31.140  -48.870 -26.783 1.00 333.45 ? 95  SER B C     1 
ATOM   3860 O O     . SER B 2 20  ? 30.057  -49.305 -27.177 1.00 334.98 ? 95  SER B O     1 
ATOM   3861 C CB    . SER B 2 20  ? 32.986  -50.217 -27.824 1.00 229.59 ? 95  SER B CB    1 
ATOM   3862 O OG    . SER B 2 20  ? 32.068  -51.185 -28.304 1.00 231.57 ? 95  SER B OG    1 
ATOM   3863 N N     . PHE B 2 21  ? 31.335  -48.442 -25.535 1.00 291.66 ? 96  PHE B N     1 
ATOM   3864 C CA    . PHE B 2 21  ? 30.251  -48.419 -24.549 1.00 290.50 ? 96  PHE B CA    1 
ATOM   3865 C C     . PHE B 2 21  ? 29.137  -47.483 -24.986 1.00 291.10 ? 96  PHE B C     1 
ATOM   3866 O O     . PHE B 2 21  ? 27.998  -47.902 -25.194 1.00 292.36 ? 96  PHE B O     1 
ATOM   3867 C CB    . PHE B 2 21  ? 30.769  -47.981 -23.178 1.00 276.91 ? 96  PHE B CB    1 
ATOM   3868 C CG    . PHE B 2 21  ? 31.594  -49.017 -22.477 1.00 276.11 ? 96  PHE B CG    1 
ATOM   3869 C CD1   . PHE B 2 21  ? 31.234  -50.355 -22.507 1.00 277.30 ? 96  PHE B CD1   1 
ATOM   3870 C CD2   . PHE B 2 21  ? 32.731  -48.651 -21.783 1.00 274.21 ? 96  PHE B CD2   1 
ATOM   3871 C CE1   . PHE B 2 21  ? 31.997  -51.306 -21.855 1.00 276.57 ? 96  PHE B CE1   1 
ATOM   3872 C CE2   . PHE B 2 21  ? 33.496  -49.595 -21.132 1.00 273.49 ? 96  PHE B CE2   1 
ATOM   3873 C CZ    . PHE B 2 21  ? 33.131  -50.925 -21.169 1.00 274.66 ? 96  PHE B CZ    1 
ATOM   3874 N N     . ASN B 2 22  ? 29.487  -46.210 -25.134 1.00 237.36 ? 97  ASN B N     1 
ATOM   3875 C CA    . ASN B 2 22  ? 28.607  -45.237 -25.758 1.00 238.15 ? 97  ASN B CA    1 
ATOM   3876 C C     . ASN B 2 22  ? 28.499  -45.571 -27.238 1.00 240.97 ? 97  ASN B C     1 
ATOM   3877 O O     . ASN B 2 22  ? 29.322  -46.332 -27.755 1.00 241.99 ? 97  ASN B O     1 
ATOM   3878 C CB    . ASN B 2 22  ? 29.123  -43.809 -25.549 1.00 264.69 ? 97  ASN B CB    1 
ATOM   3879 C CG    . ASN B 2 22  ? 30.594  -43.661 -25.894 1.00 264.47 ? 97  ASN B CG    1 
ATOM   3880 O OD1   . ASN B 2 22  ? 30.979  -43.736 -27.060 1.00 266.33 ? 97  ASN B OD1   1 
ATOM   3881 N ND2   . ASN B 2 22  ? 31.422  -43.440 -24.879 1.00 262.25 ? 97  ASN B ND2   1 
ATOM   3882 N N     . ASN B 2 23  ? 27.484  -45.029 -27.910 1.00 312.25 ? 98  ASN B N     1 
ATOM   3883 C CA    . ASN B 2 23  ? 27.334  -45.219 -29.350 1.00 314.98 ? 98  ASN B CA    1 
ATOM   3884 C C     . ASN B 2 23  ? 28.666  -44.929 -30.018 1.00 315.25 ? 98  ASN B C     1 
ATOM   3885 O O     . ASN B 2 23  ? 29.330  -43.958 -29.656 1.00 313.59 ? 98  ASN B O     1 
ATOM   3886 C CB    . ASN B 2 23  ? 26.253  -44.294 -29.918 1.00 339.39 ? 98  ASN B CB    1 
ATOM   3887 C CG    . ASN B 2 23  ? 24.973  -45.022 -30.267 1.00 341.28 ? 98  ASN B CG    1 
ATOM   3888 O OD1   . ASN B 2 23  ? 24.556  -45.947 -29.571 1.00 341.00 ? 98  ASN B OD1   1 
ATOM   3889 N ND2   . ASN B 2 23  ? 24.338  -44.602 -31.355 1.00 343.29 ? 98  ASN B ND2   1 
ATOM   3890 N N     . TRP B 2 24  ? 29.063  -45.768 -30.975 1.00 233.71 ? 99  TRP B N     1 
ATOM   3891 C CA    . TRP B 2 24  ? 30.405  -45.691 -31.559 1.00 234.06 ? 99  TRP B CA    1 
ATOM   3892 C C     . TRP B 2 24  ? 30.719  -44.287 -32.071 1.00 233.82 ? 99  TRP B C     1 
ATOM   3893 O O     . TRP B 2 24  ? 31.888  -43.917 -32.180 1.00 233.25 ? 99  TRP B O     1 
ATOM   3894 C CB    . TRP B 2 24  ? 30.574  -46.720 -32.683 1.00 236.78 ? 99  TRP B CB    1 
ATOM   3895 C CG    . TRP B 2 24  ? 31.345  -47.965 -32.277 1.00 236.61 ? 99  TRP B CG    1 
ATOM   3896 C CD1   . TRP B 2 24  ? 32.256  -48.078 -31.263 1.00 234.44 ? 99  TRP B CD1   1 
ATOM   3897 C CD2   . TRP B 2 24  ? 31.257  -49.265 -32.879 1.00 238.73 ? 99  TRP B CD2   1 
ATOM   3898 N NE1   . TRP B 2 24  ? 32.740  -49.365 -31.201 1.00 235.07 ? 99  TRP B NE1   1 
ATOM   3899 C CE2   . TRP B 2 24  ? 32.143  -50.112 -32.182 1.00 237.69 ? 99  TRP B CE2   1 
ATOM   3900 C CE3   . TRP B 2 24  ? 30.516  -49.793 -33.941 1.00 241.46 ? 99  TRP B CE3   1 
ATOM   3901 C CZ2   . TRP B 2 24  ? 32.306  -51.458 -32.513 1.00 239.25 ? 99  TRP B CZ2   1 
ATOM   3902 C CZ3   . TRP B 2 24  ? 30.681  -51.129 -34.268 1.00 243.03 ? 99  TRP B CZ3   1 
ATOM   3903 C CH2   . TRP B 2 24  ? 31.569  -51.945 -33.557 1.00 241.91 ? 99  TRP B CH2   1 
ATOM   3904 N N     . SER B 2 25  ? 29.686  -43.500 -32.372 1.00 234.28 ? 100 SER B N     1 
ATOM   3905 C CA    . SER B 2 25  ? 29.894  -42.064 -32.492 1.00 233.37 ? 100 SER B CA    1 
ATOM   3906 C C     . SER B 2 25  ? 29.174  -41.330 -31.362 1.00 231.16 ? 100 SER B C     1 
ATOM   3907 O O     . SER B 2 25  ? 27.988  -41.013 -31.458 1.00 231.68 ? 100 SER B O     1 
ATOM   3908 C CB    . SER B 2 25  ? 29.394  -41.557 -33.849 1.00 300.46 ? 100 SER B CB    1 
ATOM   3909 O OG    . SER B 2 25  ? 27.977  -41.506 -33.891 1.00 301.18 ? 100 SER B OG    1 
ATOM   3910 N N     . THR B 2 26  ? 29.943  -40.979 -30.335 1.00 297.57 ? 101 THR B N     1 
ATOM   3911 C CA    . THR B 2 26  ? 29.461  -40.220 -29.187 1.00 295.26 ? 101 THR B CA    1 
ATOM   3912 C C     . THR B 2 26  ? 30.643  -39.431 -28.658 1.00 293.29 ? 101 THR B C     1 
ATOM   3913 O O     . THR B 2 26  ? 31.780  -39.906 -28.692 1.00 293.20 ? 101 THR B O     1 
ATOM   3914 C CB    . THR B 2 26  ? 28.885  -41.106 -28.049 1.00 225.34 ? 101 THR B CB    1 
ATOM   3915 O OG1   . THR B 2 26  ? 28.045  -42.128 -28.593 1.00 227.40 ? 101 THR B OG1   1 
ATOM   3916 C CG2   . THR B 2 26  ? 28.073  -40.263 -27.063 1.00 223.47 ? 101 THR B CG2   1 
ATOM   3917 N N     . LYS B 2 27  ? 30.374  -38.230 -28.171 1.00 227.65 ? 102 LYS B N     1 
ATOM   3918 C CA    . LYS B 2 27  ? 31.424  -37.360 -27.669 1.00 225.80 ? 102 LYS B CA    1 
ATOM   3919 C C     . LYS B 2 27  ? 31.132  -36.927 -26.233 1.00 223.23 ? 102 LYS B C     1 
ATOM   3920 O O     . LYS B 2 27  ? 30.061  -36.400 -25.936 1.00 222.83 ? 102 LYS B O     1 
ATOM   3921 C CB    . LYS B 2 27  ? 31.578  -36.145 -28.586 1.00 221.84 ? 102 LYS B CB    1 
ATOM   3922 C CG    . LYS B 2 27  ? 30.308  -35.787 -29.346 1.00 223.42 ? 102 LYS B CG    1 
ATOM   3923 C CD    . LYS B 2 27  ? 30.486  -34.526 -30.172 1.00 223.97 ? 102 LYS B CD    1 
ATOM   3924 C CE    . LYS B 2 27  ? 30.197  -33.282 -29.354 1.00 221.90 ? 102 LYS B CE    1 
ATOM   3925 N NZ    . LYS B 2 27  ? 30.522  -32.044 -30.110 1.00 222.31 ? 102 LYS B NZ    1 
ATOM   3926 N N     . ILE B 2 28  ? 32.089  -37.163 -25.343 1.00 238.84 ? 103 ILE B N     1 
ATOM   3927 C CA    . ILE B 2 28  ? 31.916  -36.843 -23.933 1.00 236.39 ? 103 ILE B CA    1 
ATOM   3928 C C     . ILE B 2 28  ? 32.850  -35.710 -23.531 1.00 234.72 ? 103 ILE B C     1 
ATOM   3929 O O     . ILE B 2 28  ? 34.070  -35.874 -23.560 1.00 234.45 ? 103 ILE B O     1 
ATOM   3930 C CB    . ILE B 2 28  ? 32.186  -38.074 -23.045 1.00 213.61 ? 103 ILE B CB    1 
ATOM   3931 C CG1   . ILE B 2 28  ? 31.365  -39.272 -23.531 1.00 215.48 ? 103 ILE B CG1   1 
ATOM   3932 C CG2   . ILE B 2 28  ? 31.900  -37.763 -21.579 1.00 211.19 ? 103 ILE B CG2   1 
ATOM   3933 C CD1   . ILE B 2 28  ? 29.877  -39.128 -23.311 1.00 215.66 ? 103 ILE B CD1   1 
ATOM   3934 N N     . PRO B 2 29  ? 32.282  -34.547 -23.173 1.00 259.09 ? 104 PRO B N     1 
ATOM   3935 C CA    . PRO B 2 29  ? 33.133  -33.410 -22.799 1.00 257.54 ? 104 PRO B CA    1 
ATOM   3936 C C     . PRO B 2 29  ? 34.004  -33.692 -21.574 1.00 255.50 ? 104 PRO B C     1 
ATOM   3937 O O     . PRO B 2 29  ? 33.498  -34.020 -20.500 1.00 254.17 ? 104 PRO B O     1 
ATOM   3938 C CB    . PRO B 2 29  ? 32.116  -32.305 -22.493 1.00 209.30 ? 104 PRO B CB    1 
ATOM   3939 C CG    . PRO B 2 29  ? 30.910  -32.669 -23.302 1.00 211.23 ? 104 PRO B CG    1 
ATOM   3940 C CD    . PRO B 2 29  ? 30.865  -34.169 -23.303 1.00 212.14 ? 104 PRO B CD    1 
ATOM   3941 N N     . LEU B 2 30  ? 35.312  -33.542 -21.751 1.00 207.84 ? 105 LEU B N     1 
ATOM   3942 C CA    . LEU B 2 30  ? 36.277  -33.681 -20.666 1.00 205.97 ? 105 LEU B CA    1 
ATOM   3943 C C     . LEU B 2 30  ? 36.445  -32.379 -19.877 1.00 204.01 ? 105 LEU B C     1 
ATOM   3944 O O     . LEU B 2 30  ? 36.216  -31.288 -20.399 1.00 204.28 ? 105 LEU B O     1 
ATOM   3945 C CB    . LEU B 2 30  ? 37.630  -34.160 -21.204 1.00 206.75 ? 105 LEU B CB    1 
ATOM   3946 C CG    . LEU B 2 30  ? 37.735  -35.596 -21.736 1.00 208.36 ? 105 LEU B CG    1 
ATOM   3947 C CD1   . LEU B 2 30  ? 39.157  -35.900 -22.163 1.00 208.90 ? 105 LEU B CD1   1 
ATOM   3948 C CD2   . LEU B 2 30  ? 37.285  -36.605 -20.705 1.00 207.42 ? 105 LEU B CD2   1 
ATOM   3949 N N     . ILE B 2 31  ? 36.881  -32.513 -18.629 1.00 202.08 ? 106 ILE B N     1 
ATOM   3950 C CA    . ILE B 2 31  ? 37.116  -31.388 -17.728 1.00 200.09 ? 106 ILE B CA    1 
ATOM   3951 C C     . ILE B 2 31  ? 38.630  -31.236 -17.558 1.00 199.45 ? 106 ILE B C     1 
ATOM   3952 O O     . ILE B 2 31  ? 39.375  -32.182 -17.799 1.00 200.15 ? 106 ILE B O     1 
ATOM   3953 C CB    . ILE B 2 31  ? 36.434  -31.592 -16.357 1.00 198.33 ? 106 ILE B CB    1 
ATOM   3954 C CG1   . ILE B 2 31  ? 35.006  -32.116 -16.535 1.00 199.23 ? 106 ILE B CG1   1 
ATOM   3955 C CG2   . ILE B 2 31  ? 36.434  -30.300 -15.548 1.00 196.50 ? 106 ILE B CG2   1 
ATOM   3956 C CD1   . ILE B 2 31  ? 34.088  -31.167 -17.274 1.00 200.07 ? 106 ILE B CD1   1 
ATOM   3957 N N     . LYS B 2 32  ? 39.085  -30.045 -17.181 1.00 246.35 ? 107 LYS B N     1 
ATOM   3958 C CA    . LYS B 2 32  ? 40.506  -29.707 -17.224 1.00 246.03 ? 107 LYS B CA    1 
ATOM   3959 C C     . LYS B 2 32  ? 41.186  -29.650 -15.853 1.00 243.93 ? 107 LYS B C     1 
ATOM   3960 O O     . LYS B 2 32  ? 40.539  -29.448 -14.824 1.00 242.44 ? 107 LYS B O     1 
ATOM   3961 C CB    . LYS B 2 32  ? 40.695  -28.356 -17.916 1.00 232.43 ? 107 LYS B CB    1 
ATOM   3962 C CG    . LYS B 2 32  ? 40.022  -27.204 -17.177 1.00 230.89 ? 107 LYS B CG    1 
ATOM   3963 C CD    . LYS B 2 32  ? 40.760  -25.888 -17.379 1.00 230.50 ? 107 LYS B CD    1 
ATOM   3964 C CE    . LYS B 2 32  ? 40.225  -24.804 -16.451 1.00 228.74 ? 107 LYS B CE    1 
ATOM   3965 N NZ    . LYS B 2 32  ? 38.804  -24.462 -16.738 1.00 229.17 ? 107 LYS B NZ    1 
HETATM 3966 N N     . SEP B 2 33  ? 42.496  -29.884 -15.858 1.00 311.02 ? 108 SEP B N     1 
HETATM 3967 C CA    . SEP B 2 33  ? 43.360  -29.625 -14.708 1.00 309.19 ? 108 SEP B CA    1 
HETATM 3968 C CB    . SEP B 2 33  ? 43.456  -30.848 -13.793 1.00 226.53 ? 108 SEP B CB    1 
HETATM 3969 O OG    . SEP B 2 33  ? 42.214  -31.042 -13.134 1.00 225.80 ? 108 SEP B OG    1 
HETATM 3970 C C     . SEP B 2 33  ? 44.730  -29.188 -15.221 1.00 309.66 ? 108 SEP B C     1 
HETATM 3971 O O     . SEP B 2 33  ? 44.907  -29.016 -16.428 1.00 311.33 ? 108 SEP B O     1 
HETATM 3972 P P     . SEP B 2 33  ? 42.276  -32.096 -11.919 1.00 224.60 ? 108 SEP B P     1 
HETATM 3973 O O1P   . SEP B 2 33  ? 43.227  -31.534 -10.750 1.00 222.66 ? 108 SEP B O1P   1 
HETATM 3974 O O2P   . SEP B 2 33  ? 40.780  -32.286 -11.352 1.00 224.10 ? 108 SEP B O2P   1 
HETATM 3975 O O3P   . SEP B 2 33  ? 42.847  -33.503 -12.455 1.00 225.95 ? 108 SEP B O3P   1 
ATOM   3976 N N     . HIS B 2 34  ? 45.693  -28.999 -14.324 1.00 229.28 ? 109 HIS B N     1 
ATOM   3977 C CA    . HIS B 2 34  ? 46.971  -28.423 -14.737 1.00 229.64 ? 109 HIS B CA    1 
ATOM   3978 C C     . HIS B 2 34  ? 47.743  -29.346 -15.689 1.00 231.42 ? 109 HIS B C     1 
ATOM   3979 O O     . HIS B 2 34  ? 48.146  -28.917 -16.772 1.00 232.83 ? 109 HIS B O     1 
ATOM   3980 C CB    . HIS B 2 34  ? 47.830  -28.048 -13.511 1.00 287.17 ? 109 HIS B CB    1 
ATOM   3981 C CG    . HIS B 2 34  ? 48.201  -29.203 -12.631 1.00 286.44 ? 109 HIS B CG    1 
ATOM   3982 N ND1   . HIS B 2 34  ? 49.320  -29.978 -12.853 1.00 287.14 ? 109 HIS B ND1   1 
ATOM   3983 C CD2   . HIS B 2 34  ? 47.619  -29.697 -11.513 1.00 285.08 ? 109 HIS B CD2   1 
ATOM   3984 C CE1   . HIS B 2 34  ? 49.401  -30.910 -11.921 1.00 286.24 ? 109 HIS B CE1   1 
ATOM   3985 N NE2   . HIS B 2 34  ? 48.382  -30.761 -11.095 1.00 284.99 ? 109 HIS B NE2   1 
ATOM   3986 N N     . ASN B 2 35  ? 47.991  -30.586 -15.276 1.00 352.85 ? 110 ASN B N     1 
ATOM   3987 C CA    . ASN B 2 35  ? 48.643  -31.565 -16.145 1.00 354.57 ? 110 ASN B CA    1 
ATOM   3988 C C     . ASN B 2 35  ? 47.718  -32.616 -16.776 1.00 355.93 ? 110 ASN B C     1 
ATOM   3989 O O     . ASN B 2 35  ? 48.172  -33.441 -17.571 1.00 357.50 ? 110 ASN B O     1 
ATOM   3990 C CB    . ASN B 2 35  ? 49.754  -32.274 -15.370 1.00 290.52 ? 110 ASN B CB    1 
ATOM   3991 C CG    . ASN B 2 35  ? 50.975  -32.558 -16.228 1.00 292.00 ? 110 ASN B CG    1 
ATOM   3992 O OD1   . ASN B 2 35  ? 51.332  -31.770 -17.105 1.00 292.99 ? 110 ASN B OD1   1 
ATOM   3993 N ND2   . ASN B 2 35  ? 51.619  -33.691 -15.980 1.00 292.20 ? 110 ASN B ND2   1 
ATOM   3994 N N     . ASP B 2 36  ? 46.434  -32.594 -16.426 1.00 362.74 ? 111 ASP B N     1 
ATOM   3995 C CA    . ASP B 2 36  ? 45.524  -33.674 -16.817 1.00 363.84 ? 111 ASP B CA    1 
ATOM   3996 C C     . ASP B 2 36  ? 44.160  -33.171 -17.288 1.00 364.37 ? 111 ASP B C     1 
ATOM   3997 O O     . ASP B 2 36  ? 43.797  -32.017 -17.060 1.00 363.50 ? 111 ASP B O     1 
ATOM   3998 C CB    . ASP B 2 36  ? 45.318  -34.648 -15.650 1.00 220.19 ? 111 ASP B CB    1 
ATOM   3999 C CG    . ASP B 2 36  ? 46.623  -35.162 -15.073 1.00 219.56 ? 111 ASP B CG    1 
ATOM   4000 O OD1   . ASP B 2 36  ? 47.449  -35.698 -15.842 1.00 220.93 ? 111 ASP B OD1   1 
ATOM   4001 O OD2   . ASP B 2 36  ? 46.822  -35.025 -13.847 1.00 217.72 ? 111 ASP B OD2   1 
ATOM   4002 N N     . PHE B 2 37  ? 43.419  -34.051 -17.958 1.00 280.53 ? 112 PHE B N     1 
ATOM   4003 C CA    . PHE B 2 37  ? 42.048  -33.781 -18.386 1.00 281.18 ? 112 PHE B CA    1 
ATOM   4004 C C     . PHE B 2 37  ? 41.190  -35.026 -18.142 1.00 281.57 ? 112 PHE B C     1 
ATOM   4005 O O     . PHE B 2 37  ? 41.512  -36.102 -18.642 1.00 282.85 ? 112 PHE B O     1 
ATOM   4006 C CB    . PHE B 2 37  ? 42.005  -33.379 -19.865 1.00 258.49 ? 112 PHE B CB    1 
ATOM   4007 C CG    . PHE B 2 37  ? 42.706  -32.080 -20.171 1.00 258.24 ? 112 PHE B CG    1 
ATOM   4008 C CD1   . PHE B 2 37  ? 44.088  -32.025 -20.271 1.00 258.26 ? 112 PHE B CD1   1 
ATOM   4009 C CD2   . PHE B 2 37  ? 41.980  -30.918 -20.379 1.00 258.05 ? 112 PHE B CD2   1 
ATOM   4010 C CE1   . PHE B 2 37  ? 44.732  -30.835 -20.551 1.00 258.09 ? 112 PHE B CE1   1 
ATOM   4011 C CE2   . PHE B 2 37  ? 42.619  -29.725 -20.666 1.00 257.86 ? 112 PHE B CE2   1 
ATOM   4012 C CZ    . PHE B 2 37  ? 43.996  -29.685 -20.752 1.00 257.89 ? 112 PHE B CZ    1 
ATOM   4013 N N     . VAL B 2 38  ? 40.106  -34.893 -17.377 1.00 200.80 ? 113 VAL B N     1 
ATOM   4014 C CA    . VAL B 2 38  ? 39.335  -36.070 -16.958 1.00 200.95 ? 113 VAL B CA    1 
ATOM   4015 C C     . VAL B 2 38  ? 37.811  -35.925 -17.044 1.00 201.33 ? 113 VAL B C     1 
ATOM   4016 O O     . VAL B 2 38  ? 37.282  -34.822 -17.178 1.00 201.05 ? 113 VAL B O     1 
ATOM   4017 C CB    . VAL B 2 38  ? 39.673  -36.457 -15.504 1.00 198.95 ? 113 VAL B CB    1 
ATOM   4018 C CG1   . VAL B 2 38  ? 41.154  -36.771 -15.358 1.00 198.64 ? 113 VAL B CG1   1 
ATOM   4019 C CG2   . VAL B 2 38  ? 39.265  -35.343 -14.555 1.00 197.06 ? 113 VAL B CG2   1 
ATOM   4020 N N     . ALA B 2 39  ? 37.120  -37.063 -16.969 1.00 202.02 ? 114 ALA B N     1 
ATOM   4021 C CA    . ALA B 2 39  ? 35.667  -37.107 -16.804 1.00 202.20 ? 114 ALA B CA    1 
ATOM   4022 C C     . ALA B 2 39  ? 35.243  -38.477 -16.281 1.00 202.34 ? 114 ALA B C     1 
ATOM   4023 O O     . ALA B 2 39  ? 36.070  -39.379 -16.141 1.00 202.41 ? 114 ALA B O     1 
ATOM   4024 C CB    . ALA B 2 39  ? 34.958  -36.796 -18.112 1.00 204.19 ? 114 ALA B CB    1 
ATOM   4025 N N     . ILE B 2 40  ? 33.951  -38.634 -16.004 1.00 261.70 ? 115 ILE B N     1 
ATOM   4026 C CA    . ILE B 2 40  ? 33.435  -39.878 -15.435 1.00 261.79 ? 115 ILE B CA    1 
ATOM   4027 C C     . ILE B 2 40  ? 32.167  -40.340 -16.140 1.00 263.60 ? 115 ILE B C     1 
ATOM   4028 O O     . ILE B 2 40  ? 31.309  -39.528 -16.488 1.00 263.96 ? 115 ILE B O     1 
ATOM   4029 C CB    . ILE B 2 40  ? 33.124  -39.734 -13.934 1.00 200.38 ? 115 ILE B CB    1 
ATOM   4030 C CG1   . ILE B 2 40  ? 34.245  -38.986 -13.216 1.00 198.51 ? 115 ILE B CG1   1 
ATOM   4031 C CG2   . ILE B 2 40  ? 32.883  -41.102 -13.302 1.00 200.39 ? 115 ILE B CG2   1 
ATOM   4032 C CD1   . ILE B 2 40  ? 34.070  -38.953 -11.742 1.00 196.48 ? 115 ILE B CD1   1 
ATOM   4033 N N     . LEU B 2 41  ? 32.056  -41.648 -16.345 1.00 265.65 ? 116 LEU B N     1 
ATOM   4034 C CA    . LEU B 2 41  ? 30.869  -42.236 -16.955 1.00 267.45 ? 116 LEU B CA    1 
ATOM   4035 C C     . LEU B 2 41  ? 30.547  -43.590 -16.336 1.00 267.54 ? 116 LEU B C     1 
ATOM   4036 O O     . LEU B 2 41  ? 31.422  -44.251 -15.774 1.00 266.75 ? 116 LEU B O     1 
ATOM   4037 C CB    . LEU B 2 41  ? 31.058  -42.391 -18.463 1.00 209.62 ? 116 LEU B CB    1 
ATOM   4038 C CG    . LEU B 2 41  ? 31.188  -41.121 -19.305 1.00 210.04 ? 116 LEU B CG    1 
ATOM   4039 C CD1   . LEU B 2 41  ? 31.587  -41.485 -20.719 1.00 212.31 ? 116 LEU B CD1   1 
ATOM   4040 C CD2   . LEU B 2 41  ? 29.891  -40.327 -19.298 1.00 210.08 ? 116 LEU B CD2   1 
ATOM   4041 N N     . ASP B 2 42  ? 29.287  -43.999 -16.450 1.00 253.69 ? 117 ASP B N     1 
ATOM   4042 C CA    . ASP B 2 42  ? 28.862  -45.310 -15.979 1.00 254.08 ? 117 ASP B CA    1 
ATOM   4043 C C     . ASP B 2 42  ? 28.999  -46.318 -17.111 1.00 256.41 ? 117 ASP B C     1 
ATOM   4044 O O     . ASP B 2 42  ? 28.302  -46.221 -18.121 1.00 258.25 ? 117 ASP B O     1 
ATOM   4045 C CB    . ASP B 2 42  ? 27.416  -45.274 -15.477 1.00 261.89 ? 117 ASP B CB    1 
ATOM   4046 C CG    . ASP B 2 42  ? 27.191  -44.219 -14.412 1.00 259.72 ? 117 ASP B CG    1 
ATOM   4047 O OD1   . ASP B 2 42  ? 27.661  -43.076 -14.594 1.00 258.97 ? 117 ASP B OD1   1 
ATOM   4048 O OD2   . ASP B 2 42  ? 26.545  -44.536 -13.392 1.00 258.81 ? 117 ASP B OD2   1 
ATOM   4049 N N     . LEU B 2 43  ? 29.892  -47.288 -16.941 1.00 231.99 ? 118 LEU B N     1 
ATOM   4050 C CA    . LEU B 2 43  ? 30.178  -48.244 -18.005 1.00 234.15 ? 118 LEU B CA    1 
ATOM   4051 C C     . LEU B 2 43  ? 29.861  -49.672 -17.565 1.00 234.64 ? 118 LEU B C     1 
ATOM   4052 O O     . LEU B 2 43  ? 30.132  -50.047 -16.424 1.00 233.02 ? 118 LEU B O     1 
ATOM   4053 C CB    . LEU B 2 43  ? 31.645  -48.133 -18.430 1.00 213.17 ? 118 LEU B CB    1 
ATOM   4054 C CG    . LEU B 2 43  ? 32.178  -46.715 -18.669 1.00 212.33 ? 118 LEU B CG    1 
ATOM   4055 C CD1   . LEU B 2 43  ? 33.674  -46.728 -18.956 1.00 212.16 ? 118 LEU B CD1   1 
ATOM   4056 C CD2   . LEU B 2 43  ? 31.420  -46.033 -19.798 1.00 213.97 ? 118 LEU B CD2   1 
ATOM   4057 N N     . PRO B 2 44  ? 29.300  -50.479 -18.481 1.00 234.78 ? 119 PRO B N     1 
ATOM   4058 C CA    . PRO B 2 44  ? 28.891  -51.858 -18.182 1.00 235.55 ? 119 PRO B CA    1 
ATOM   4059 C C     . PRO B 2 44  ? 30.060  -52.835 -18.107 1.00 235.53 ? 119 PRO B C     1 
ATOM   4060 O O     . PRO B 2 44  ? 31.135  -52.543 -18.626 1.00 235.58 ? 119 PRO B O     1 
ATOM   4061 C CB    . PRO B 2 44  ? 27.971  -52.207 -19.353 1.00 219.48 ? 119 PRO B CB    1 
ATOM   4062 C CG    . PRO B 2 44  ? 28.467  -51.372 -20.465 1.00 220.34 ? 119 PRO B CG    1 
ATOM   4063 C CD    . PRO B 2 44  ? 28.915  -50.080 -19.845 1.00 218.15 ? 119 PRO B CD    1 
ATOM   4064 N N     . GLU B 2 45  ? 29.831  -53.985 -17.476 1.00 236.61 ? 120 GLU B N     1 
ATOM   4065 C CA    . GLU B 2 45  ? 30.866  -54.994 -17.257 1.00 236.48 ? 120 GLU B CA    1 
ATOM   4066 C C     . GLU B 2 45  ? 31.475  -55.512 -18.558 1.00 238.60 ? 120 GLU B C     1 
ATOM   4067 O O     . GLU B 2 45  ? 30.755  -55.957 -19.451 1.00 240.74 ? 120 GLU B O     1 
ATOM   4068 C CB    . GLU B 2 45  ? 30.288  -56.173 -16.464 1.00 266.56 ? 120 GLU B CB    1 
ATOM   4069 C CG    . GLU B 2 45  ? 29.779  -55.819 -15.071 1.00 264.43 ? 120 GLU B CG    1 
ATOM   4070 C CD    . GLU B 2 45  ? 30.881  -55.804 -14.024 1.00 262.25 ? 120 GLU B CD    1 
ATOM   4071 O OE1   . GLU B 2 45  ? 31.624  -56.803 -13.919 1.00 262.45 ? 120 GLU B OE1   1 
ATOM   4072 O OE2   . GLU B 2 45  ? 31.005  -54.792 -13.303 1.00 260.35 ? 120 GLU B OE2   1 
ATOM   4073 N N     . GLY B 2 46  ? 32.799  -55.444 -18.666 1.00 263.86 ? 121 GLY B N     1 
ATOM   4074 C CA    . GLY B 2 46  ? 33.490  -56.052 -19.788 1.00 265.79 ? 121 GLY B CA    1 
ATOM   4075 C C     . GLY B 2 46  ? 34.724  -55.309 -20.268 1.00 265.46 ? 121 GLY B C     1 
ATOM   4076 O O     . GLY B 2 46  ? 35.189  -54.362 -19.628 1.00 263.53 ? 121 GLY B O     1 
ATOM   4077 N N     . GLU B 2 47  ? 35.249  -55.751 -21.410 1.00 337.35 ? 122 GLU B N     1 
ATOM   4078 C CA    . GLU B 2 47  ? 36.364  -55.077 -22.068 1.00 337.48 ? 122 GLU B CA    1 
ATOM   4079 C C     . GLU B 2 47  ? 35.865  -53.861 -22.847 1.00 338.07 ? 122 GLU B C     1 
ATOM   4080 O O     . GLU B 2 47  ? 34.660  -53.608 -22.907 1.00 338.48 ? 122 GLU B O     1 
ATOM   4081 C CB    . GLU B 2 47  ? 37.103  -56.045 -23.000 1.00 223.99 ? 122 GLU B CB    1 
ATOM   4082 C CG    . GLU B 2 47  ? 36.242  -56.632 -24.107 1.00 226.63 ? 122 GLU B CG    1 
ATOM   4083 C CD    . GLU B 2 47  ? 36.933  -57.765 -24.840 1.00 228.48 ? 122 GLU B CD    1 
ATOM   4084 O OE1   . GLU B 2 47  ? 36.236  -58.550 -25.517 1.00 230.53 ? 122 GLU B OE1   1 
ATOM   4085 O OE2   . GLU B 2 47  ? 38.173  -57.873 -24.737 1.00 227.92 ? 122 GLU B OE2   1 
ATOM   4086 N N     . HIS B 2 48  ? 36.789  -53.111 -23.442 1.00 357.50 ? 123 HIS B N     1 
ATOM   4087 C CA    . HIS B 2 48  ? 36.423  -51.867 -24.112 1.00 357.86 ? 123 HIS B CA    1 
ATOM   4088 C C     . HIS B 2 48  ? 37.453  -51.407 -25.147 1.00 358.92 ? 123 HIS B C     1 
ATOM   4089 O O     . HIS B 2 48  ? 38.635  -51.737 -25.052 1.00 358.61 ? 123 HIS B O     1 
ATOM   4090 C CB    . HIS B 2 48  ? 36.219  -50.781 -23.054 1.00 331.02 ? 123 HIS B CB    1 
ATOM   4091 C CG    . HIS B 2 48  ? 35.614  -49.517 -23.576 1.00 331.22 ? 123 HIS B CG    1 
ATOM   4092 N ND1   . HIS B 2 48  ? 36.112  -48.272 -23.258 1.00 329.65 ? 123 HIS B ND1   1 
ATOM   4093 C CD2   . HIS B 2 48  ? 34.541  -49.300 -24.373 1.00 332.81 ? 123 HIS B CD2   1 
ATOM   4094 C CE1   . HIS B 2 48  ? 35.378  -47.342 -23.841 1.00 330.24 ? 123 HIS B CE1   1 
ATOM   4095 N NE2   . HIS B 2 48  ? 34.417  -47.939 -24.524 1.00 332.15 ? 123 HIS B NE2   1 
ATOM   4096 N N     . GLN B 2 49  ? 36.993  -50.619 -26.116 1.00 266.50 ? 124 GLN B N     1 
ATOM   4097 C CA    . GLN B 2 49  ? 37.857  -50.002 -27.120 1.00 267.51 ? 124 GLN B CA    1 
ATOM   4098 C C     . GLN B 2 49  ? 37.565  -48.507 -27.174 1.00 266.65 ? 124 GLN B C     1 
ATOM   4099 O O     . GLN B 2 49  ? 36.459  -48.107 -27.541 1.00 267.37 ? 124 GLN B O     1 
ATOM   4100 C CB    . GLN B 2 49  ? 37.638  -50.627 -28.503 1.00 229.31 ? 124 GLN B CB    1 
ATOM   4101 C CG    . GLN B 2 49  ? 37.990  -52.101 -28.617 1.00 230.46 ? 124 GLN B CG    1 
ATOM   4102 C CD    . GLN B 2 49  ? 37.440  -52.730 -29.888 1.00 233.37 ? 124 GLN B CD    1 
ATOM   4103 O OE1   . GLN B 2 49  ? 36.242  -52.992 -29.995 1.00 234.19 ? 124 GLN B OE1   1 
ATOM   4104 N NE2   . GLN B 2 49  ? 38.314  -52.971 -30.858 1.00 235.01 ? 124 GLN B NE2   1 
ATOM   4105 N N     . TYR B 2 50  ? 38.543  -47.681 -26.815 1.00 227.76 ? 125 TYR B N     1 
ATOM   4106 C CA    . TYR B 2 50  ? 38.323  -46.237 -26.797 1.00 226.82 ? 125 TYR B CA    1 
ATOM   4107 C C     . TYR B 2 50  ? 39.484  -45.436 -27.385 1.00 226.99 ? 125 TYR B C     1 
ATOM   4108 O O     . TYR B 2 50  ? 40.614  -45.918 -27.466 1.00 227.18 ? 125 TYR B O     1 
ATOM   4109 C CB    . TYR B 2 50  ? 38.035  -45.764 -25.367 1.00 220.43 ? 125 TYR B CB    1 
ATOM   4110 C CG    . TYR B 2 50  ? 39.205  -45.821 -24.411 1.00 218.54 ? 125 TYR B CG    1 
ATOM   4111 C CD1   . TYR B 2 50  ? 39.585  -47.015 -23.818 1.00 218.24 ? 125 TYR B CD1   1 
ATOM   4112 C CD2   . TYR B 2 50  ? 39.908  -44.671 -24.076 1.00 217.07 ? 125 TYR B CD2   1 
ATOM   4113 C CE1   . TYR B 2 50  ? 40.645  -47.065 -22.933 1.00 216.55 ? 125 TYR B CE1   1 
ATOM   4114 C CE2   . TYR B 2 50  ? 40.969  -44.711 -23.192 1.00 215.40 ? 125 TYR B CE2   1 
ATOM   4115 C CZ    . TYR B 2 50  ? 41.333  -45.910 -22.624 1.00 215.15 ? 125 TYR B CZ    1 
ATOM   4116 O OH    . TYR B 2 50  ? 42.390  -45.951 -21.742 1.00 213.53 ? 125 TYR B OH    1 
ATOM   4117 N N     . LYS B 2 51  ? 39.182  -44.209 -27.803 1.00 223.26 ? 126 LYS B N     1 
ATOM   4118 C CA    . LYS B 2 51  ? 40.177  -43.311 -28.378 1.00 223.45 ? 126 LYS B CA    1 
ATOM   4119 C C     . LYS B 2 51  ? 39.796  -41.857 -28.095 1.00 222.12 ? 126 LYS B C     1 
ATOM   4120 O O     . LYS B 2 51  ? 38.617  -41.535 -27.951 1.00 221.95 ? 126 LYS B O     1 
ATOM   4121 C CB    . LYS B 2 51  ? 40.314  -43.555 -29.884 1.00 226.21 ? 126 LYS B CB    1 
ATOM   4122 C CG    . LYS B 2 51  ? 41.571  -42.964 -30.503 1.00 226.68 ? 126 LYS B CG    1 
ATOM   4123 C CD    . LYS B 2 51  ? 41.773  -43.443 -31.930 1.00 229.51 ? 126 LYS B CD    1 
ATOM   4124 C CE    . LYS B 2 51  ? 43.166  -43.095 -32.431 1.00 229.96 ? 126 LYS B CE    1 
ATOM   4125 N NZ    . LYS B 2 51  ? 43.495  -43.781 -33.709 1.00 232.69 ? 126 LYS B NZ    1 
ATOM   4126 N N     . PHE B 2 52  ? 40.798  -40.987 -28.010 1.00 224.09 ? 127 PHE B N     1 
ATOM   4127 C CA    . PHE B 2 52  ? 40.581  -39.585 -27.659 1.00 222.68 ? 127 PHE B CA    1 
ATOM   4128 C C     . PHE B 2 52  ? 40.452  -38.678 -28.881 1.00 224.26 ? 127 PHE B C     1 
ATOM   4129 O O     . PHE B 2 52  ? 41.084  -38.912 -29.911 1.00 226.09 ? 127 PHE B O     1 
ATOM   4130 C CB    . PHE B 2 52  ? 41.715  -39.078 -26.765 1.00 217.81 ? 127 PHE B CB    1 
ATOM   4131 C CG    . PHE B 2 52  ? 41.783  -39.757 -25.430 1.00 215.95 ? 127 PHE B CG    1 
ATOM   4132 C CD1   . PHE B 2 52  ? 40.806  -39.537 -24.476 1.00 214.41 ? 127 PHE B CD1   1 
ATOM   4133 C CD2   . PHE B 2 52  ? 42.830  -40.609 -25.124 1.00 215.78 ? 127 PHE B CD2   1 
ATOM   4134 C CE1   . PHE B 2 52  ? 40.866  -40.159 -23.247 1.00 212.75 ? 127 PHE B CE1   1 
ATOM   4135 C CE2   . PHE B 2 52  ? 42.895  -41.234 -23.896 1.00 214.11 ? 127 PHE B CE2   1 
ATOM   4136 C CZ    . PHE B 2 52  ? 41.913  -41.008 -22.957 1.00 212.60 ? 127 PHE B CZ    1 
ATOM   4137 N N     . PHE B 2 53  ? 39.617  -37.651 -28.755 1.00 343.09 ? 128 PHE B N     1 
ATOM   4138 C CA    . PHE B 2 53  ? 39.439  -36.651 -29.804 1.00 344.35 ? 128 PHE B CA    1 
ATOM   4139 C C     . PHE B 2 53  ? 39.994  -35.311 -29.327 1.00 342.64 ? 128 PHE B C     1 
ATOM   4140 O O     . PHE B 2 53  ? 39.384  -34.643 -28.492 1.00 340.93 ? 128 PHE B O     1 
ATOM   4141 C CB    . PHE B 2 53  ? 37.952  -36.535 -30.165 1.00 222.87 ? 128 PHE B CB    1 
ATOM   4142 C CG    . PHE B 2 53  ? 37.646  -35.509 -31.226 1.00 224.19 ? 128 PHE B CG    1 
ATOM   4143 C CD1   . PHE B 2 53  ? 37.826  -35.802 -32.569 1.00 226.71 ? 128 PHE B CD1   1 
ATOM   4144 C CD2   . PHE B 2 53  ? 37.141  -34.266 -30.881 1.00 222.96 ? 128 PHE B CD2   1 
ATOM   4145 C CE1   . PHE B 2 53  ? 37.530  -34.865 -33.546 1.00 227.97 ? 128 PHE B CE1   1 
ATOM   4146 C CE2   . PHE B 2 53  ? 36.844  -33.327 -31.854 1.00 224.19 ? 128 PHE B CE2   1 
ATOM   4147 C CZ    . PHE B 2 53  ? 37.038  -33.629 -33.188 1.00 226.70 ? 128 PHE B CZ    1 
ATOM   4148 N N     . VAL B 2 54  ? 41.143  -34.912 -29.869 1.00 220.82 ? 129 VAL B N     1 
ATOM   4149 C CA    . VAL B 2 54  ? 41.817  -33.700 -29.408 1.00 219.25 ? 129 VAL B CA    1 
ATOM   4150 C C     . VAL B 2 54  ? 42.162  -32.761 -30.570 1.00 220.72 ? 129 VAL B C     1 
ATOM   4151 O O     . VAL B 2 54  ? 42.743  -33.170 -31.580 1.00 222.65 ? 129 VAL B O     1 
ATOM   4152 C CB    . VAL B 2 54  ? 43.102  -34.034 -28.591 1.00 217.90 ? 129 VAL B CB    1 
ATOM   4153 C CG1   . VAL B 2 54  ? 42.775  -34.990 -27.457 1.00 216.52 ? 129 VAL B CG1   1 
ATOM   4154 C CG2   . VAL B 2 54  ? 44.189  -34.629 -29.468 1.00 219.64 ? 129 VAL B CG2   1 
ATOM   4155 N N     . ASP B 2 55  ? 41.740  -31.507 -30.431 1.00 338.42 ? 130 ASP B N     1 
ATOM   4156 C CA    . ASP B 2 55  ? 42.016  -30.449 -31.401 1.00 339.52 ? 130 ASP B CA    1 
ATOM   4157 C C     . ASP B 2 55  ? 41.505  -30.777 -32.808 1.00 342.23 ? 130 ASP B C     1 
ATOM   4158 O O     . ASP B 2 55  ? 41.944  -30.172 -33.786 1.00 343.61 ? 130 ASP B O     1 
ATOM   4159 C CB    . ASP B 2 55  ? 43.522  -30.159 -31.462 1.00 239.53 ? 130 ASP B CB    1 
ATOM   4160 C CG    . ASP B 2 55  ? 44.119  -29.842 -30.097 1.00 236.97 ? 130 ASP B CG    1 
ATOM   4161 O OD1   . ASP B 2 55  ? 43.485  -29.099 -29.319 1.00 235.29 ? 130 ASP B OD1   1 
ATOM   4162 O OD2   . ASP B 2 55  ? 45.228  -30.338 -29.802 1.00 236.68 ? 130 ASP B OD2   1 
ATOM   4163 N N     . GLY B 2 56  ? 40.553  -31.703 -32.902 1.00 320.82 ? 131 GLY B N     1 
ATOM   4164 C CA    . GLY B 2 56  ? 40.016  -32.117 -34.188 1.00 323.44 ? 131 GLY B CA    1 
ATOM   4165 C C     . GLY B 2 56  ? 40.482  -33.471 -34.704 1.00 325.08 ? 131 GLY B C     1 
ATOM   4166 O O     . GLY B 2 56  ? 39.851  -34.045 -35.592 1.00 327.14 ? 131 GLY B O     1 
ATOM   4167 N N     . GLN B 2 57  ? 41.580  -33.987 -34.156 1.00 295.73 ? 132 GLN B N     1 
ATOM   4168 C CA    . GLN B 2 57  ? 42.137  -35.263 -34.611 1.00 297.23 ? 132 GLN B CA    1 
ATOM   4169 C C     . GLN B 2 57  ? 41.893  -36.385 -33.604 1.00 296.07 ? 132 GLN B C     1 
ATOM   4170 O O     . GLN B 2 57  ? 42.003  -36.177 -32.396 1.00 293.76 ? 132 GLN B O     1 
ATOM   4171 C CB    . GLN B 2 57  ? 43.641  -35.129 -34.875 1.00 231.87 ? 132 GLN B CB    1 
ATOM   4172 C CG    . GLN B 2 57  ? 44.286  -36.373 -35.486 1.00 233.66 ? 132 GLN B CG    1 
ATOM   4173 C CD    . GLN B 2 57  ? 45.805  -36.309 -35.500 1.00 233.56 ? 132 GLN B CD    1 
ATOM   4174 O OE1   . GLN B 2 57  ? 46.407  -35.433 -34.879 1.00 231.90 ? 132 GLN B OE1   1 
ATOM   4175 N NE2   . GLN B 2 57  ? 46.431  -37.243 -36.209 1.00 235.39 ? 132 GLN B NE2   1 
ATOM   4176 N N     . TRP B 2 58  ? 41.563  -37.572 -34.106 1.00 338.25 ? 133 TRP B N     1 
ATOM   4177 C CA    . TRP B 2 58  ? 41.437  -38.753 -33.257 1.00 337.43 ? 133 TRP B CA    1 
ATOM   4178 C C     . TRP B 2 58  ? 42.812  -39.346 -32.971 1.00 337.08 ? 133 TRP B C     1 
ATOM   4179 O O     . TRP B 2 58  ? 43.520  -39.758 -33.891 1.00 338.91 ? 133 TRP B O     1 
ATOM   4180 C CB    . TRP B 2 58  ? 40.539  -39.807 -33.914 1.00 231.12 ? 133 TRP B CB    1 
ATOM   4181 C CG    . TRP B 2 58  ? 39.079  -39.456 -33.932 1.00 231.22 ? 133 TRP B CG    1 
ATOM   4182 C CD1   . TRP B 2 58  ? 38.475  -38.500 -34.694 1.00 232.16 ? 133 TRP B CD1   1 
ATOM   4183 C CD2   . TRP B 2 58  ? 38.035  -40.076 -33.163 1.00 230.46 ? 133 TRP B CD2   1 
ATOM   4184 N NE1   . TRP B 2 58  ? 37.123  -38.477 -34.441 1.00 232.01 ? 133 TRP B NE1   1 
ATOM   4185 C CE2   . TRP B 2 58  ? 36.829  -39.432 -33.509 1.00 230.99 ? 133 TRP B CE2   1 
ATOM   4186 C CE3   . TRP B 2 58  ? 38.007  -41.105 -32.219 1.00 229.42 ? 133 TRP B CE3   1 
ATOM   4187 C CZ2   . TRP B 2 58  ? 35.606  -39.789 -32.937 1.00 230.54 ? 133 TRP B CZ2   1 
ATOM   4188 C CZ3   . TRP B 2 58  ? 36.791  -41.455 -31.654 1.00 228.96 ? 133 TRP B CZ3   1 
ATOM   4189 C CH2   . TRP B 2 58  ? 35.609  -40.798 -32.015 1.00 229.53 ? 133 TRP B CH2   1 
ATOM   4190 N N     . VAL B 2 59  ? 43.185  -39.393 -31.695 1.00 226.36 ? 134 VAL B N     1 
ATOM   4191 C CA    . VAL B 2 59  ? 44.476  -39.945 -31.290 1.00 225.83 ? 134 VAL B CA    1 
ATOM   4192 C C     . VAL B 2 59  ? 44.347  -40.808 -30.035 1.00 224.13 ? 134 VAL B C     1 
ATOM   4193 O O     . VAL B 2 59  ? 43.376  -40.698 -29.286 1.00 222.86 ? 134 VAL B O     1 
ATOM   4194 C CB    . VAL B 2 59  ? 45.523  -38.839 -31.016 1.00 232.79 ? 134 VAL B CB    1 
ATOM   4195 C CG1   . VAL B 2 59  ? 45.777  -37.997 -32.264 1.00 234.52 ? 134 VAL B CG1   1 
ATOM   4196 C CG2   . VAL B 2 59  ? 45.088  -37.974 -29.849 1.00 230.27 ? 134 VAL B CG2   1 
ATOM   4197 N N     . HIS B 2 60  ? 45.349  -41.649 -29.802 1.00 229.19 ? 135 HIS B N     1 
ATOM   4198 C CA    . HIS B 2 60  ? 45.348  -42.554 -28.660 1.00 227.73 ? 135 HIS B CA    1 
ATOM   4199 C C     . HIS B 2 60  ? 46.454  -42.192 -27.678 1.00 225.73 ? 135 HIS B C     1 
ATOM   4200 O O     . HIS B 2 60  ? 47.423  -41.524 -28.036 1.00 225.91 ? 135 HIS B O     1 
ATOM   4201 C CB    . HIS B 2 60  ? 45.510  -44.003 -29.117 1.00 224.32 ? 135 HIS B CB    1 
ATOM   4202 C CG    . HIS B 2 60  ? 46.792  -44.267 -29.840 1.00 225.65 ? 135 HIS B CG    1 
ATOM   4203 N ND1   . HIS B 2 60  ? 46.912  -44.145 -31.207 1.00 228.01 ? 135 HIS B ND1   1 
ATOM   4204 C CD2   . HIS B 2 60  ? 48.011  -44.645 -29.387 1.00 225.02 ? 135 HIS B CD2   1 
ATOM   4205 C CE1   . HIS B 2 60  ? 48.149  -44.438 -31.566 1.00 228.77 ? 135 HIS B CE1   1 
ATOM   4206 N NE2   . HIS B 2 60  ? 48.836  -44.745 -30.480 1.00 226.99 ? 135 HIS B NE2   1 
ATOM   4207 N N     . ASP B 2 61  ? 46.281  -42.615 -26.431 1.00 218.79 ? 136 ASP B N     1 
ATOM   4208 C CA    . ASP B 2 61  ? 47.247  -42.355 -25.370 1.00 216.79 ? 136 ASP B CA    1 
ATOM   4209 C C     . ASP B 2 61  ? 48.255  -43.498 -25.251 1.00 217.21 ? 136 ASP B C     1 
ATOM   4210 O O     . ASP B 2 61  ? 47.886  -44.613 -24.885 1.00 217.26 ? 136 ASP B O     1 
ATOM   4211 C CB    . ASP B 2 61  ? 46.511  -42.147 -24.043 1.00 248.38 ? 136 ASP B CB    1 
ATOM   4212 C CG    . ASP B 2 61  ? 47.452  -41.988 -22.865 1.00 246.31 ? 136 ASP B CG    1 
ATOM   4213 O OD1   . ASP B 2 61  ? 48.528  -41.379 -23.036 1.00 246.22 ? 136 ASP B OD1   1 
ATOM   4214 O OD2   . ASP B 2 61  ? 47.110  -42.471 -21.763 1.00 244.81 ? 136 ASP B OD2   1 
ATOM   4215 N N     . PRO B 2 62  ? 49.533  -43.226 -25.570 1.00 217.57 ? 137 PRO B N     1 
ATOM   4216 C CA    . PRO B 2 62  ? 50.582  -44.250 -25.485 1.00 218.02 ? 137 PRO B CA    1 
ATOM   4217 C C     . PRO B 2 62  ? 50.810  -44.780 -24.068 1.00 215.95 ? 137 PRO B C     1 
ATOM   4218 O O     . PRO B 2 62  ? 51.315  -45.892 -23.917 1.00 216.35 ? 137 PRO B O     1 
ATOM   4219 C CB    . PRO B 2 62  ? 51.829  -43.517 -25.993 1.00 218.52 ? 137 PRO B CB    1 
ATOM   4220 C CG    . PRO B 2 62  ? 51.300  -42.429 -26.855 1.00 219.35 ? 137 PRO B CG    1 
ATOM   4221 C CD    . PRO B 2 62  ? 50.031  -41.986 -26.189 1.00 217.93 ? 137 PRO B CD    1 
ATOM   4222 N N     . SER B 2 63  ? 50.448  -43.997 -23.054 1.00 242.61 ? 138 SER B N     1 
ATOM   4223 C CA    . SER B 2 63  ? 50.613  -44.415 -21.663 1.00 240.58 ? 138 SER B CA    1 
ATOM   4224 C C     . SER B 2 63  ? 49.776  -45.655 -21.357 1.00 240.78 ? 138 SER B C     1 
ATOM   4225 O O     . SER B 2 63  ? 50.236  -46.571 -20.678 1.00 240.21 ? 138 SER B O     1 
ATOM   4226 C CB    . SER B 2 63  ? 50.239  -43.278 -20.708 1.00 213.79 ? 138 SER B CB    1 
ATOM   4227 O OG    . SER B 2 63  ? 51.066  -42.145 -20.912 1.00 213.53 ? 138 SER B OG    1 
ATOM   4228 N N     . GLU B 2 64  ? 48.547  -45.672 -21.865 1.00 212.87 ? 139 GLU B N     1 
ATOM   4229 C CA    . GLU B 2 64  ? 47.652  -46.818 -21.715 1.00 213.35 ? 139 GLU B CA    1 
ATOM   4230 C C     . GLU B 2 64  ? 47.969  -47.889 -22.762 1.00 215.68 ? 139 GLU B C     1 
ATOM   4231 O O     . GLU B 2 64  ? 48.630  -47.598 -23.759 1.00 217.12 ? 139 GLU B O     1 
ATOM   4232 C CB    . GLU B 2 64  ? 46.190  -46.368 -21.831 1.00 250.58 ? 139 GLU B CB    1 
ATOM   4233 C CG    . GLU B 2 64  ? 45.674  -45.580 -20.633 1.00 248.24 ? 139 GLU B CG    1 
ATOM   4234 C CD    . GLU B 2 64  ? 45.401  -46.455 -19.421 1.00 246.87 ? 139 GLU B CD    1 
ATOM   4235 O OE1   . GLU B 2 64  ? 44.792  -47.534 -19.586 1.00 247.86 ? 139 GLU B OE1   1 
ATOM   4236 O OE2   . GLU B 2 64  ? 45.797  -46.062 -18.302 1.00 244.84 ? 139 GLU B OE2   1 
ATOM   4237 N N     . PRO B 2 65  ? 47.511  -49.136 -22.534 1.00 216.10 ? 140 PRO B N     1 
ATOM   4238 C CA    . PRO B 2 65  ? 47.687  -50.203 -23.527 1.00 218.40 ? 140 PRO B CA    1 
ATOM   4239 C C     . PRO B 2 65  ? 46.993  -49.881 -24.847 1.00 220.48 ? 140 PRO B C     1 
ATOM   4240 O O     . PRO B 2 65  ? 46.099  -49.039 -24.864 1.00 220.07 ? 140 PRO B O     1 
ATOM   4241 C CB    . PRO B 2 65  ? 47.037  -51.418 -22.858 1.00 218.12 ? 140 PRO B CB    1 
ATOM   4242 C CG    . PRO B 2 65  ? 47.114  -51.135 -21.409 1.00 215.55 ? 140 PRO B CG    1 
ATOM   4243 C CD    . PRO B 2 65  ? 46.935  -49.654 -21.280 1.00 214.43 ? 140 PRO B CD    1 
ATOM   4244 N N     . VAL B 2 66  ? 47.397  -50.540 -25.932 1.00 222.71 ? 141 VAL B N     1 
ATOM   4245 C CA    . VAL B 2 66  ? 46.819  -50.277 -27.248 1.00 224.88 ? 141 VAL B CA    1 
ATOM   4246 C C     . VAL B 2 66  ? 46.612  -51.557 -28.055 1.00 227.16 ? 141 VAL B C     1 
ATOM   4247 O O     . VAL B 2 66  ? 47.353  -52.525 -27.894 1.00 227.43 ? 141 VAL B O     1 
ATOM   4248 C CB    . VAL B 2 66  ? 47.704  -49.313 -28.069 1.00 225.61 ? 141 VAL B CB    1 
ATOM   4249 C CG1   . VAL B 2 66  ? 47.591  -47.893 -27.535 1.00 223.79 ? 141 VAL B CG1   1 
ATOM   4250 C CG2   . VAL B 2 66  ? 49.152  -49.780 -28.062 1.00 225.80 ? 141 VAL B CG2   1 
ATOM   4251 N N     . VAL B 2 67  ? 45.593  -51.551 -28.916 1.00 311.94 ? 142 VAL B N     1 
ATOM   4252 C CA    . VAL B 2 67  ? 45.328  -52.655 -29.843 1.00 314.39 ? 142 VAL B CA    1 
ATOM   4253 C C     . VAL B 2 67  ? 44.783  -52.148 -31.176 1.00 316.54 ? 142 VAL B C     1 
ATOM   4254 O O     . VAL B 2 67  ? 44.558  -50.950 -31.350 1.00 316.07 ? 142 VAL B O     1 
ATOM   4255 C CB    . VAL B 2 67  ? 44.316  -53.664 -29.272 1.00 231.11 ? 142 VAL B CB    1 
ATOM   4256 C CG1   . VAL B 2 67  ? 44.945  -54.501 -28.174 1.00 229.63 ? 142 VAL B CG1   1 
ATOM   4257 C CG2   . VAL B 2 67  ? 43.070  -52.942 -28.783 1.00 229.98 ? 142 VAL B CG2   1 
ATOM   4258 N N     . THR B 2 68  ? 44.552  -53.071 -32.106 1.00 235.81 ? 143 THR B N     1 
ATOM   4259 C CA    . THR B 2 68  ? 43.978  -52.732 -33.406 1.00 238.09 ? 143 THR B CA    1 
ATOM   4260 C C     . THR B 2 68  ? 42.544  -53.242 -33.513 1.00 238.95 ? 143 THR B C     1 
ATOM   4261 O O     . THR B 2 68  ? 42.282  -54.422 -33.285 1.00 239.44 ? 143 THR B O     1 
ATOM   4262 C CB    . THR B 2 68  ? 44.805  -53.319 -34.567 1.00 270.99 ? 143 THR B CB    1 
ATOM   4263 O OG1   . THR B 2 68  ? 46.192  -53.017 -34.375 1.00 270.20 ? 143 THR B OG1   1 
ATOM   4264 C CG2   . THR B 2 68  ? 44.338  -52.742 -35.898 1.00 273.20 ? 143 THR B CG2   1 
ATOM   4265 N N     . SER B 2 69  ? 41.620  -52.351 -33.861 1.00 274.91 ? 144 SER B N     1 
ATOM   4266 C CA    . SER B 2 69  ? 40.210  -52.709 -33.986 1.00 275.77 ? 144 SER B CA    1 
ATOM   4267 C C     . SER B 2 69  ? 39.927  -53.386 -35.323 1.00 278.88 ? 144 SER B C     1 
ATOM   4268 O O     . SER B 2 69  ? 40.833  -53.569 -36.135 1.00 280.32 ? 144 SER B O     1 
ATOM   4269 C CB    . SER B 2 69  ? 39.327  -51.469 -33.831 1.00 239.08 ? 144 SER B CB    1 
ATOM   4270 O OG    . SER B 2 69  ? 39.578  -50.534 -34.866 1.00 240.28 ? 144 SER B OG    1 
ATOM   4271 N N     . GLN B 2 70  ? 38.668  -53.750 -35.549 1.00 262.37 ? 145 GLN B N     1 
ATOM   4272 C CA    . GLN B 2 70  ? 38.273  -54.413 -36.789 1.00 265.39 ? 145 GLN B CA    1 
ATOM   4273 C C     . GLN B 2 70  ? 38.379  -53.468 -37.982 1.00 266.96 ? 145 GLN B C     1 
ATOM   4274 O O     . GLN B 2 70  ? 38.639  -53.902 -39.105 1.00 269.42 ? 145 GLN B O     1 
ATOM   4275 C CB    . GLN B 2 70  ? 36.846  -54.958 -36.682 1.00 247.98 ? 145 GLN B CB    1 
ATOM   4276 C CG    . GLN B 2 70  ? 36.621  -55.918 -35.524 1.00 246.59 ? 145 GLN B CG    1 
ATOM   4277 C CD    . GLN B 2 70  ? 37.479  -57.166 -35.616 1.00 247.44 ? 145 GLN B CD    1 
ATOM   4278 O OE1   . GLN B 2 70  ? 37.848  -57.603 -36.706 1.00 249.76 ? 145 GLN B OE1   1 
ATOM   4279 N NE2   . GLN B 2 70  ? 37.802  -57.746 -34.466 1.00 245.58 ? 145 GLN B NE2   1 
ATOM   4280 N N     . LEU B 2 71  ? 38.173  -52.176 -37.731 1.00 247.41 ? 146 LEU B N     1 
ATOM   4281 C CA    . LEU B 2 71  ? 38.253  -51.155 -38.775 1.00 248.66 ? 146 LEU B CA    1 
ATOM   4282 C C     . LEU B 2 71  ? 39.703  -50.899 -39.180 1.00 248.84 ? 146 LEU B C     1 
ATOM   4283 O O     . LEU B 2 71  ? 39.976  -50.399 -40.272 1.00 250.56 ? 146 LEU B O     1 
ATOM   4284 C CB    . LEU B 2 71  ? 37.594  -49.852 -38.303 1.00 250.82 ? 146 LEU B CB    1 
ATOM   4285 C CG    . LEU B 2 71  ? 37.536  -48.652 -39.257 1.00 251.82 ? 146 LEU B CG    1 
ATOM   4286 C CD1   . LEU B 2 71  ? 36.798  -48.995 -40.541 1.00 254.85 ? 146 LEU B CD1   1 
ATOM   4287 C CD2   . LEU B 2 71  ? 36.884  -47.462 -38.574 1.00 249.81 ? 146 LEU B CD2   1 
ATOM   4288 N N     . GLY B 2 72  ? 40.629  -51.255 -38.296 1.00 247.12 ? 147 GLY B N     1 
ATOM   4289 C CA    . GLY B 2 72  ? 42.044  -51.075 -38.559 1.00 247.17 ? 147 GLY B CA    1 
ATOM   4290 C C     . GLY B 2 72  ? 42.629  -49.876 -37.841 1.00 244.78 ? 147 GLY B C     1 
ATOM   4291 O O     . GLY B 2 72  ? 43.773  -49.493 -38.083 1.00 244.77 ? 147 GLY B O     1 
ATOM   4292 N N     . THR B 2 73  ? 41.840  -49.281 -36.953 1.00 242.80 ? 148 THR B N     1 
ATOM   4293 C CA    . THR B 2 73  ? 42.285  -48.111 -36.208 1.00 240.46 ? 148 THR B CA    1 
ATOM   4294 C C     . THR B 2 73  ? 43.035  -48.533 -34.952 1.00 238.23 ? 148 THR B C     1 
ATOM   4295 O O     . THR B 2 73  ? 43.103  -49.720 -34.637 1.00 238.45 ? 148 THR B O     1 
ATOM   4296 C CB    . THR B 2 73  ? 41.099  -47.220 -35.812 1.00 274.28 ? 148 THR B CB    1 
ATOM   4297 O OG1   . THR B 2 73  ? 40.288  -47.904 -34.850 1.00 273.12 ? 148 THR B OG1   1 
ATOM   4298 C CG2   . THR B 2 73  ? 40.255  -46.896 -37.030 1.00 276.57 ? 148 THR B CG2   1 
ATOM   4299 N N     . ILE B 2 74  ? 43.573  -47.559 -34.223 1.00 306.34 ? 149 ILE B N     1 
ATOM   4300 C CA    . ILE B 2 74  ? 44.317  -47.840 -32.998 1.00 304.14 ? 149 ILE B CA    1 
ATOM   4301 C C     . ILE B 2 74  ? 43.526  -47.394 -31.770 1.00 301.72 ? 149 ILE B C     1 
ATOM   4302 O O     . ILE B 2 74  ? 43.349  -46.199 -31.537 1.00 300.54 ? 149 ILE B O     1 
ATOM   4303 C CB    . ILE B 2 74  ? 45.696  -47.141 -32.992 1.00 233.26 ? 149 ILE B CB    1 
ATOM   4304 C CG1   . ILE B 2 74  ? 46.453  -47.409 -34.294 1.00 235.77 ? 149 ILE B CG1   1 
ATOM   4305 C CG2   . ILE B 2 74  ? 46.522  -47.601 -31.805 1.00 231.29 ? 149 ILE B CG2   1 
ATOM   4306 C CD1   . ILE B 2 74  ? 47.748  -46.631 -34.411 1.00 235.39 ? 149 ILE B CD1   1 
ATOM   4307 N N     . ASN B 2 75  ? 43.060  -48.361 -30.984 1.00 230.79 ? 150 ASN B N     1 
ATOM   4308 C CA    . ASN B 2 75  ? 42.298  -48.081 -29.770 1.00 228.57 ? 150 ASN B CA    1 
ATOM   4309 C C     . ASN B 2 75  ? 42.957  -48.708 -28.550 1.00 226.70 ? 150 ASN B C     1 
ATOM   4310 O O     . ASN B 2 75  ? 43.830  -49.568 -28.679 1.00 227.34 ? 150 ASN B O     1 
ATOM   4311 C CB    . ASN B 2 75  ? 40.861  -48.589 -29.897 1.00 229.45 ? 150 ASN B CB    1 
ATOM   4312 C CG    . ASN B 2 75  ? 40.083  -47.875 -30.979 1.00 231.09 ? 150 ASN B CG    1 
ATOM   4313 O OD1   . ASN B 2 75  ? 40.399  -46.743 -31.345 1.00 230.91 ? 150 ASN B OD1   1 
ATOM   4314 N ND2   . ASN B 2 75  ? 39.053  -48.533 -31.496 1.00 232.76 ? 150 ASN B ND2   1 
ATOM   4315 N N     . ASN B 2 76  ? 42.541  -48.270 -27.365 1.00 224.42 ? 151 ASN B N     1 
ATOM   4316 C CA    . ASN B 2 76  ? 43.126  -48.760 -26.123 1.00 222.48 ? 151 ASN B CA    1 
ATOM   4317 C C     . ASN B 2 76  ? 42.288  -49.859 -25.461 1.00 222.25 ? 151 ASN B C     1 
ATOM   4318 O O     . ASN B 2 76  ? 41.188  -50.175 -25.916 1.00 223.49 ? 151 ASN B O     1 
ATOM   4319 C CB    . ASN B 2 76  ? 43.322  -47.593 -25.152 1.00 220.04 ? 151 ASN B CB    1 
ATOM   4320 C CG    . ASN B 2 76  ? 44.176  -46.482 -25.738 1.00 220.19 ? 151 ASN B CG    1 
ATOM   4321 O OD1   . ASN B 2 76  ? 43.737  -45.747 -26.620 1.00 221.30 ? 151 ASN B OD1   1 
ATOM   4322 N ND2   . ASN B 2 76  ? 45.399  -46.350 -25.240 1.00 219.10 ? 151 ASN B ND2   1 
ATOM   4323 N N     . LEU B 2 77  ? 42.808  -50.420 -24.371 1.00 220.67 ? 152 LEU B N     1 
ATOM   4324 C CA    . LEU B 2 77  ? 42.135  -51.507 -23.663 1.00 220.35 ? 152 LEU B CA    1 
ATOM   4325 C C     . LEU B 2 77  ? 42.008  -51.223 -22.173 1.00 217.72 ? 152 LEU B C     1 
ATOM   4326 O O     . LEU B 2 77  ? 42.989  -50.866 -21.516 1.00 216.19 ? 152 LEU B O     1 
ATOM   4327 C CB    . LEU B 2 77  ? 42.879  -52.833 -23.856 1.00 221.41 ? 152 LEU B CB    1 
ATOM   4328 C CG    . LEU B 2 77  ? 42.790  -53.579 -25.188 1.00 224.21 ? 152 LEU B CG    1 
ATOM   4329 C CD1   . LEU B 2 77  ? 43.445  -54.945 -25.046 1.00 224.78 ? 152 LEU B CD1   1 
ATOM   4330 C CD2   . LEU B 2 77  ? 41.350  -53.720 -25.661 1.00 225.47 ? 152 LEU B CD2   1 
ATOM   4331 N N     . ILE B 2 78  ? 40.795  -51.388 -21.650 1.00 217.27 ? 153 ILE B N     1 
ATOM   4332 C CA    . ILE B 2 78  ? 40.538  -51.315 -20.214 1.00 214.96 ? 153 ILE B CA    1 
ATOM   4333 C C     . ILE B 2 78  ? 39.474  -52.338 -19.803 1.00 215.29 ? 153 ILE B C     1 
ATOM   4334 O O     . ILE B 2 78  ? 38.482  -52.543 -20.505 1.00 216.87 ? 153 ILE B O     1 
ATOM   4335 C CB    . ILE B 2 78  ? 40.084  -49.897 -19.775 1.00 227.17 ? 153 ILE B CB    1 
ATOM   4336 C CG1   . ILE B 2 78  ? 38.961  -49.382 -20.677 1.00 228.58 ? 153 ILE B CG1   1 
ATOM   4337 C CG2   . ILE B 2 78  ? 41.260  -48.919 -19.759 1.00 226.21 ? 153 ILE B CG2   1 
ATOM   4338 C CD1   . ILE B 2 78  ? 37.587  -49.467 -20.049 1.00 228.06 ? 153 ILE B CD1   1 
ATOM   4339 N N     . HIS B 2 79  ? 39.695  -52.986 -18.665 1.00 352.31 ? 154 HIS B N     1 
ATOM   4340 C CA    . HIS B 2 79  ? 38.725  -53.931 -18.126 1.00 352.42 ? 154 HIS B CA    1 
ATOM   4341 C C     . HIS B 2 79  ? 38.029  -53.340 -16.907 1.00 350.33 ? 154 HIS B C     1 
ATOM   4342 O O     . HIS B 2 79  ? 38.635  -53.201 -15.844 1.00 348.40 ? 154 HIS B O     1 
ATOM   4343 C CB    . HIS B 2 79  ? 39.406  -55.251 -17.760 1.00 218.00 ? 154 HIS B CB    1 
ATOM   4344 C CG    . HIS B 2 79  ? 39.131  -56.362 -18.724 1.00 220.41 ? 154 HIS B CG    1 
ATOM   4345 N ND1   . HIS B 2 79  ? 38.006  -57.154 -18.643 1.00 221.25 ? 154 HIS B ND1   1 
ATOM   4346 C CD2   . HIS B 2 79  ? 39.836  -56.818 -19.786 1.00 222.22 ? 154 HIS B CD2   1 
ATOM   4347 C CE1   . HIS B 2 79  ? 38.028  -58.048 -19.615 1.00 223.46 ? 154 HIS B CE1   1 
ATOM   4348 N NE2   . HIS B 2 79  ? 39.128  -57.866 -20.323 1.00 224.09 ? 154 HIS B NE2   1 
ATOM   4349 N N     . VAL B 2 80  ? 36.752  -53.003 -17.057 1.00 305.88 ? 155 VAL B N     1 
ATOM   4350 C CA    . VAL B 2 80  ? 36.012  -52.379 -15.967 1.00 304.05 ? 155 VAL B CA    1 
ATOM   4351 C C     . VAL B 2 80  ? 35.419  -53.429 -15.025 1.00 303.58 ? 155 VAL B C     1 
ATOM   4352 O O     . VAL B 2 80  ? 34.719  -54.352 -15.447 1.00 305.17 ? 155 VAL B O     1 
ATOM   4353 C CB    . VAL B 2 80  ? 34.893  -51.447 -16.497 1.00 235.54 ? 155 VAL B CB    1 
ATOM   4354 C CG1   . VAL B 2 80  ? 35.498  -50.230 -17.181 1.00 235.51 ? 155 VAL B CG1   1 
ATOM   4355 C CG2   . VAL B 2 80  ? 33.978  -52.183 -17.454 1.00 237.91 ? 155 VAL B CG2   1 
ATOM   4356 N N     . LYS B 2 81  ? 35.737  -53.289 -13.743 1.00 273.79 ? 156 LYS B N     1 
ATOM   4357 C CA    . LYS B 2 81  ? 35.201  -54.161 -12.705 1.00 273.09 ? 156 LYS B CA    1 
ATOM   4358 C C     . LYS B 2 81  ? 34.798  -53.327 -11.492 1.00 270.90 ? 156 LYS B C     1 
ATOM   4359 O O     . LYS B 2 81  ? 35.159  -52.155 -11.388 1.00 269.80 ? 156 LYS B O     1 
ATOM   4360 C CB    . LYS B 2 81  ? 36.223  -55.228 -12.299 1.00 206.93 ? 156 LYS B CB    1 
ATOM   4361 C CG    . LYS B 2 81  ? 36.560  -56.246 -13.377 1.00 209.11 ? 156 LYS B CG    1 
ATOM   4362 C CD    . LYS B 2 81  ? 36.105  -57.644 -12.985 1.00 209.73 ? 156 LYS B CD    1 
ATOM   4363 C CE    . LYS B 2 81  ? 34.737  -57.968 -13.566 1.00 211.42 ? 156 LYS B CE    1 
ATOM   4364 N NZ    . LYS B 2 81  ? 34.407  -59.420 -13.454 1.00 212.49 ? 156 LYS B NZ    1 
ATOM   4365 N N     . LYS B 2 82  ? 33.978  -53.910 -10.625 1.00 217.88 ? 157 LYS B N     1 
ATOM   4366 C CA    . LYS B 2 82  ? 33.614  -53.309 -9.341  1.00 215.81 ? 157 LYS B CA    1 
ATOM   4367 C C     . LYS B 2 82  ? 34.342  -53.903 -8.124  1.00 214.21 ? 157 LYS B C     1 
ATOM   4368 O O     . LYS B 2 82  ? 33.965  -53.629 -6.984  1.00 212.63 ? 157 LYS B O     1 
ATOM   4369 C CB    . LYS B 2 82  ? 32.102  -53.392 -9.145  1.00 204.63 ? 157 LYS B CB    1 
ATOM   4370 C CG    . LYS B 2 82  ? 31.432  -54.409 -10.044 1.00 206.95 ? 157 LYS B CG    1 
ATOM   4371 C CD    . LYS B 2 82  ? 31.403  -55.772 -9.385  1.00 207.03 ? 157 LYS B CD    1 
ATOM   4372 C CE    . LYS B 2 82  ? 31.500  -56.888 -10.406 1.00 209.25 ? 157 LYS B CE    1 
ATOM   4373 N NZ    . LYS B 2 82  ? 32.919  -57.208 -10.725 1.00 209.23 ? 157 LYS B NZ    1 
ATOM   4374 N N     . SER B 2 83  ? 35.317  -54.775 -8.363  1.00 442.52 ? 158 SER B N     1 
ATOM   4375 C CA    . SER B 2 83  ? 35.991  -55.487 -7.276  1.00 441.24 ? 158 SER B CA    1 
ATOM   4376 C C     . SER B 2 83  ? 37.306  -54.863 -6.799  1.00 439.65 ? 158 SER B C     1 
ATOM   4377 O O     . SER B 2 83  ? 37.961  -55.419 -5.914  1.00 438.60 ? 158 SER B O     1 
ATOM   4378 C CB    . SER B 2 83  ? 36.256  -56.933 -7.697  1.00 201.57 ? 158 SER B CB    1 
ATOM   4379 O OG    . SER B 2 83  ? 37.058  -56.976 -8.862  1.00 202.91 ? 158 SER B OG    1 
ATOM   4380 N N     . ASP B 2 84  ? 37.705  -53.722 -7.360  1.00 246.45 ? 159 ASP B N     1 
ATOM   4381 C CA    . ASP B 2 84  ? 38.988  -53.156 -6.955  1.00 245.10 ? 159 ASP B CA    1 
ATOM   4382 C C     . ASP B 2 84  ? 38.798  -52.002 -5.969  1.00 243.09 ? 159 ASP B C     1 
ATOM   4383 O O     . ASP B 2 84  ? 38.633  -50.846 -6.361  1.00 242.93 ? 159 ASP B O     1 
ATOM   4384 C CB    . ASP B 2 84  ? 39.735  -52.669 -8.205  1.00 231.91 ? 159 ASP B CB    1 
ATOM   4385 C CG    . ASP B 2 84  ? 41.246  -52.703 -8.053  1.00 231.29 ? 159 ASP B CG    1 
ATOM   4386 O OD1   . ASP B 2 84  ? 41.770  -52.178 -7.049  1.00 229.46 ? 159 ASP B OD1   1 
ATOM   4387 O OD2   . ASP B 2 84  ? 41.913  -53.242 -8.960  1.00 232.72 ? 159 ASP B OD2   1 
ATOM   4388 N N     . PHE B 2 85  ? 38.851  -52.343 -4.683  1.00 366.50 ? 160 PHE B N     1 
ATOM   4389 C CA    . PHE B 2 85  ? 38.936  -51.400 -3.567  1.00 364.44 ? 160 PHE B CA    1 
ATOM   4390 C C     . PHE B 2 85  ? 40.336  -51.451 -2.940  1.00 363.26 ? 160 PHE B C     1 
ATOM   4391 O O     . PHE B 2 85  ? 40.582  -50.869 -1.882  1.00 361.50 ? 160 PHE B O     1 
ATOM   4392 C CB    . PHE B 2 85  ? 37.812  -51.661 -2.548  1.00 219.89 ? 160 PHE B CB    1 
ATOM   4393 C CG    . PHE B 2 85  ? 38.244  -52.391 -1.313  1.00 218.66 ? 160 PHE B CG    1 
ATOM   4394 C CD1   . PHE B 2 85  ? 38.577  -53.733 -1.366  1.00 219.47 ? 160 PHE B CD1   1 
ATOM   4395 C CD2   . PHE B 2 85  ? 38.298  -51.735 -0.092  1.00 216.73 ? 160 PHE B CD2   1 
ATOM   4396 C CE1   . PHE B 2 85  ? 38.969  -54.403 -0.227  1.00 218.36 ? 160 PHE B CE1   1 
ATOM   4397 C CE2   . PHE B 2 85  ? 38.688  -52.399 1.049   1.00 215.64 ? 160 PHE B CE2   1 
ATOM   4398 C CZ    . PHE B 2 85  ? 39.024  -53.735 0.983   1.00 216.44 ? 160 PHE B CZ    1 
ATOM   4399 N N     . GLU B 2 86  ? 41.246  -52.150 -3.616  1.00 276.25 ? 161 GLU B N     1 
ATOM   4400 C CA    . GLU B 2 86  ? 42.447  -52.726 -3.007  1.00 275.53 ? 161 GLU B CA    1 
ATOM   4401 C C     . GLU B 2 86  ? 43.345  -51.723 -2.302  1.00 273.83 ? 161 GLU B C     1 
ATOM   4402 O O     . GLU B 2 86  ? 43.273  -50.529 -2.552  1.00 273.46 ? 161 GLU B O     1 
ATOM   4403 C CB    . GLU B 2 86  ? 43.282  -53.438 -4.077  1.00 358.29 ? 161 GLU B CB    1 
ATOM   4404 C CG    . GLU B 2 86  ? 42.634  -54.667 -4.678  1.00 360.00 ? 161 GLU B CG    1 
ATOM   4405 C CD    . GLU B 2 86  ? 42.513  -55.802 -3.684  1.00 359.45 ? 161 GLU B CD    1 
ATOM   4406 O OE1   . GLU B 2 86  ? 41.684  -56.705 -3.917  1.00 360.56 ? 161 GLU B OE1   1 
ATOM   4407 O OE2   . GLU B 2 86  ? 43.247  -55.795 -2.672  1.00 357.96 ? 161 GLU B OE2   1 
ATOM   4408 N N     . VAL B 2 87  ? 44.161  -52.227 -1.381  1.00 371.33 ? 162 VAL B N     1 
ATOM   4409 C CA    . VAL B 2 87  ? 45.087  -51.400 -0.616  1.00 369.73 ? 162 VAL B CA    1 
ATOM   4410 C C     . VAL B 2 87  ? 46.533  -51.887 -0.797  1.00 370.02 ? 162 VAL B C     1 
ATOM   4411 O O     . VAL B 2 87  ? 47.405  -51.107 -1.178  1.00 369.94 ? 162 VAL B O     1 
ATOM   4412 C CB    . VAL B 2 87  ? 44.696  -51.337 0.890   1.00 238.62 ? 162 VAL B CB    1 
ATOM   4413 C CG1   . VAL B 2 87  ? 43.462  -50.470 1.069   1.00 238.14 ? 162 VAL B CG1   1 
ATOM   4414 C CG2   . VAL B 2 87  ? 44.452  -52.719 1.475   1.00 238.76 ? 162 VAL B CG2   1 
ATOM   4415 N N     . PHE B 2 88  ? 46.798  -53.149 -0.469  1.00 364.76 ? 163 PHE B N     1 
ATOM   4416 C CA    . PHE B 2 88  ? 48.138  -53.716 -0.610  1.00 365.10 ? 163 PHE B CA    1 
ATOM   4417 C C     . PHE B 2 88  ? 48.443  -54.274 -2.007  1.00 367.13 ? 163 PHE B C     1 
ATOM   4418 O O     . PHE B 2 88  ? 49.607  -54.485 -2.352  1.00 367.59 ? 163 PHE B O     1 
ATOM   4419 C CB    . PHE B 2 88  ? 48.343  -54.813 0.437   1.00 273.33 ? 163 PHE B CB    1 
ATOM   4420 C CG    . PHE B 2 88  ? 48.026  -54.376 1.839   1.00 271.43 ? 163 PHE B CG    1 
ATOM   4421 C CD1   . PHE B 2 88  ? 48.681  -53.292 2.401   1.00 270.08 ? 163 PHE B CD1   1 
ATOM   4422 C CD2   . PHE B 2 88  ? 47.079  -55.049 2.597   1.00 271.04 ? 163 PHE B CD2   1 
ATOM   4423 C CE1   . PHE B 2 88  ? 48.395  -52.884 3.689   1.00 268.39 ? 163 PHE B CE1   1 
ATOM   4424 C CE2   . PHE B 2 88  ? 46.788  -54.646 3.887   1.00 269.35 ? 163 PHE B CE2   1 
ATOM   4425 C CZ    . PHE B 2 88  ? 47.448  -53.562 4.433   1.00 268.02 ? 163 PHE B CZ    1 
ATOM   4426 N N     . ASP B 2 89  ? 47.406  -54.505 -2.808  1.00 328.81 ? 164 ASP B N     1 
ATOM   4427 C CA    . ASP B 2 89  ? 47.591  -55.000 -4.171  1.00 330.85 ? 164 ASP B CA    1 
ATOM   4428 C C     . ASP B 2 89  ? 48.041  -53.871 -5.093  1.00 331.33 ? 164 ASP B C     1 
ATOM   4429 O O     . ASP B 2 89  ? 48.678  -54.106 -6.121  1.00 332.78 ? 164 ASP B O     1 
ATOM   4430 C CB    . ASP B 2 89  ? 46.302  -55.631 -4.703  1.00 316.42 ? 164 ASP B CB    1 
ATOM   4431 C CG    . ASP B 2 89  ? 45.906  -56.879 -3.942  1.00 316.26 ? 164 ASP B CG    1 
ATOM   4432 O OD1   . ASP B 2 89  ? 46.431  -57.090 -2.829  1.00 314.85 ? 164 ASP B OD1   1 
ATOM   4433 O OD2   . ASP B 2 89  ? 45.070  -57.651 -4.458  1.00 317.59 ? 164 ASP B OD2   1 
ATOM   4434 N N     . ALA B 2 90  ? 47.698  -52.644 -4.714  1.00 354.79 ? 165 ALA B N     1 
ATOM   4435 C CA    . ALA B 2 90  ? 48.101  -51.458 -5.461  1.00 355.05 ? 165 ALA B CA    1 
ATOM   4436 C C     . ALA B 2 90  ? 49.611  -51.262 -5.391  1.00 354.73 ? 165 ALA B C     1 
ATOM   4437 O O     . ALA B 2 90  ? 50.229  -50.753 -6.328  1.00 355.66 ? 165 ALA B O     1 
ATOM   4438 C CB    . ALA B 2 90  ? 47.384  -50.231 -4.927  1.00 225.44 ? 165 ALA B CB    1 
ATOM   4439 N N     . LEU B 2 91  ? 50.194  -51.671 -4.269  1.00 233.85 ? 166 LEU B N     1 
ATOM   4440 C CA    . LEU B 2 91  ? 51.635  -51.582 -4.059  1.00 233.49 ? 166 LEU B CA    1 
ATOM   4441 C C     . LEU B 2 91  ? 52.350  -52.553 -4.994  1.00 235.24 ? 166 LEU B C     1 
ATOM   4442 O O     . LEU B 2 91  ? 53.444  -52.273 -5.489  1.00 235.76 ? 166 LEU B O     1 
ATOM   4443 C CB    . LEU B 2 91  ? 51.986  -51.879 -2.597  1.00 217.20 ? 166 LEU B CB    1 
ATOM   4444 C CG    . LEU B 2 91  ? 51.828  -50.782 -1.536  1.00 215.28 ? 166 LEU B CG    1 
ATOM   4445 C CD1   . LEU B 2 91  ? 50.505  -50.029 -1.641  1.00 215.03 ? 166 LEU B CD1   1 
ATOM   4446 C CD2   . LEU B 2 91  ? 51.968  -51.402 -0.159  1.00 213.91 ? 166 LEU B CD2   1 
ATOM   4447 N N     . LYS B 2 92  ? 51.711  -53.696 -5.228  1.00 253.80 ? 167 LYS B N     1 
ATOM   4448 C CA    . LYS B 2 92  ? 52.192  -54.684 -6.186  1.00 255.64 ? 167 LYS B CA    1 
ATOM   4449 C C     . LYS B 2 92  ? 52.049  -54.173 -7.617  1.00 257.30 ? 167 LYS B C     1 
ATOM   4450 O O     . LYS B 2 92  ? 51.340  -53.198 -7.870  1.00 257.10 ? 167 LYS B O     1 
ATOM   4451 C CB    . LYS B 2 92  ? 51.434  -56.008 -6.013  1.00 195.26 ? 167 LYS B CB    1 
ATOM   4452 C CG    . LYS B 2 92  ? 51.428  -56.915 -7.241  1.00 197.48 ? 167 LYS B CG    1 
ATOM   4453 C CD    . LYS B 2 92  ? 51.069  -58.353 -6.874  1.00 197.87 ? 167 LYS B CD    1 
ATOM   4454 C CE    . LYS B 2 92  ? 49.689  -58.463 -6.238  1.00 197.18 ? 167 LYS B CE    1 
ATOM   4455 N NZ    . LYS B 2 92  ? 48.588  -58.367 -7.236  1.00 198.62 ? 167 LYS B NZ    1 
ATOM   4456 N N     . SER B 2 107 ? 65.219  -60.946 5.448   1.00 187.80 ? 182 SER B N     1 
ATOM   4457 C CA    . SER B 2 107 ? 64.452  -60.200 6.440   1.00 185.20 ? 182 SER B CA    1 
ATOM   4458 C C     . SER B 2 107 ? 63.353  -59.360 5.790   1.00 186.73 ? 182 SER B C     1 
ATOM   4459 O O     . SER B 2 107 ? 63.063  -59.516 4.600   1.00 189.93 ? 182 SER B O     1 
ATOM   4460 C CB    . SER B 2 107 ? 65.383  -59.301 7.254   1.00 148.66 ? 182 SER B CB    1 
ATOM   4461 O OG    . SER B 2 107 ? 64.691  -58.692 8.326   1.00 146.17 ? 182 SER B OG    1 
ATOM   4462 N N     . SER B 2 108 ? 62.724  -58.490 6.578   1.00 287.13 ? 183 SER B N     1 
ATOM   4463 C CA    . SER B 2 108 ? 61.982  -57.385 5.995   1.00 288.40 ? 183 SER B CA    1 
ATOM   4464 C C     . SER B 2 108 ? 62.763  -56.134 6.346   1.00 286.68 ? 183 SER B C     1 
ATOM   4465 O O     . SER B 2 108 ? 62.462  -55.443 7.319   1.00 284.34 ? 183 SER B O     1 
ATOM   4466 C CB    . SER B 2 108 ? 60.567  -57.324 6.568   1.00 160.17 ? 183 SER B CB    1 
ATOM   4467 O OG    . SER B 2 108 ? 60.618  -57.307 7.986   1.00 156.83 ? 183 SER B OG    1 
ATOM   4468 N N     . SER B 2 109 ? 63.663  -55.769 5.444   1.00 228.36 ? 184 SER B N     1 
ATOM   4469 C CA    . SER B 2 109 ? 64.760  -54.869 5.769   1.00 226.84 ? 184 SER B CA    1 
ATOM   4470 C C     . SER B 2 109 ? 64.446  -53.520 5.120   1.00 228.13 ? 184 SER B C     1 
ATOM   4471 O O     . SER B 2 109 ? 63.356  -53.379 4.564   1.00 229.94 ? 184 SER B O     1 
ATOM   4472 C CB    . SER B 2 109 ? 66.090  -55.489 5.309   1.00 188.00 ? 184 SER B CB    1 
ATOM   4473 O OG    . SER B 2 109 ? 66.291  -55.337 3.916   1.00 191.31 ? 184 SER B OG    1 
ATOM   4474 N N     . PRO B 2 110 ? 65.350  -52.514 5.214   1.00 249.81 ? 185 PRO B N     1 
ATOM   4475 C CA    . PRO B 2 110 ? 64.897  -51.275 4.573   1.00 251.30 ? 185 PRO B CA    1 
ATOM   4476 C C     . PRO B 2 110 ? 64.725  -51.467 3.069   1.00 255.15 ? 185 PRO B C     1 
ATOM   4477 O O     . PRO B 2 110 ? 65.670  -51.878 2.395   1.00 256.60 ? 185 PRO B O     1 
ATOM   4478 C CB    . PRO B 2 110 ? 66.024  -50.289 4.885   1.00 202.03 ? 185 PRO B CB    1 
ATOM   4479 C CG    . PRO B 2 110 ? 67.232  -51.144 5.012   1.00 201.49 ? 185 PRO B CG    1 
ATOM   4480 C CD    . PRO B 2 110 ? 66.748  -52.399 5.677   1.00 200.27 ? 185 PRO B CD    1 
ATOM   4481 N N     . PRO B 2 111 ? 63.535  -51.171 2.572   1.00 327.87 ? 186 PRO B N     1 
ATOM   4482 C CA    . PRO B 2 111 ? 63.149  -51.549 1.215   1.00 331.76 ? 186 PRO B CA    1 
ATOM   4483 C C     . PRO B 2 111 ? 63.927  -50.914 0.069   1.00 334.47 ? 186 PRO B C     1 
ATOM   4484 O O     . PRO B 2 111 ? 63.483  -49.900 -0.469  1.00 336.00 ? 186 PRO B O     1 
ATOM   4485 C CB    . PRO B 2 111 ? 61.682  -51.113 1.142   1.00 226.33 ? 186 PRO B CB    1 
ATOM   4486 C CG    . PRO B 2 111 ? 61.201  -51.206 2.549   1.00 222.82 ? 186 PRO B CG    1 
ATOM   4487 C CD    . PRO B 2 111 ? 62.372  -50.816 3.405   1.00 219.98 ? 186 PRO B CD    1 
ATOM   4488 N N     . GLY B 2 112 ? 65.058  -51.530 -0.263  1.00 248.53 ? 187 GLY B N     1 
ATOM   4489 C CA    . GLY B 2 112 ? 65.869  -51.212 -1.423  1.00 252.42 ? 187 GLY B CA    1 
ATOM   4490 C C     . GLY B 2 112 ? 66.439  -52.538 -1.892  1.00 253.48 ? 187 GLY B C     1 
ATOM   4491 O O     . GLY B 2 112 ? 67.370  -53.068 -1.278  1.00 251.07 ? 187 GLY B O     1 
ATOM   4492 N N     . PRO B 2 113 ? 65.825  -53.103 -3.023  1.00 358.67 ? 188 PRO B N     1 
ATOM   4493 C CA    . PRO B 2 113 ? 66.247  -54.496 -3.275  1.00 360.13 ? 188 PRO B CA    1 
ATOM   4494 C C     . PRO B 2 113 ? 67.676  -54.684 -3.786  1.00 361.09 ? 188 PRO B C     1 
ATOM   4495 O O     . PRO B 2 113 ? 68.209  -53.842 -4.509  1.00 363.61 ? 188 PRO B O     1 
ATOM   4496 C CB    . PRO B 2 113 ? 65.246  -55.008 -4.333  1.00 237.62 ? 188 PRO B CB    1 
ATOM   4497 C CG    . PRO B 2 113 ? 64.114  -54.046 -4.342  1.00 237.23 ? 188 PRO B CG    1 
ATOM   4498 C CD    . PRO B 2 113 ? 64.812  -52.750 -4.133  1.00 234.88 ? 188 PRO B CD    1 
ATOM   4499 N N     . TYR B 2 114 ? 68.273  -55.810 -3.403  1.00 327.22 ? 189 TYR B N     1 
ATOM   4500 C CA    . TYR B 2 114 ? 69.563  -56.250 -3.923  1.00 328.80 ? 189 TYR B CA    1 
ATOM   4501 C C     . TYR B 2 114 ? 69.788  -57.704 -3.502  1.00 328.25 ? 189 TYR B C     1 
ATOM   4502 O O     . TYR B 2 114 ? 68.885  -58.342 -2.960  1.00 327.11 ? 189 TYR B O     1 
ATOM   4503 C CB    . TYR B 2 114 ? 70.710  -55.341 -3.455  1.00 241.81 ? 189 TYR B CB    1 
ATOM   4504 C CG    . TYR B 2 114 ? 71.684  -55.002 -4.570  1.00 245.07 ? 189 TYR B CG    1 
ATOM   4505 C CD1   . TYR B 2 114 ? 71.220  -54.676 -5.838  1.00 249.10 ? 189 TYR B CD1   1 
ATOM   4506 C CD2   . TYR B 2 114 ? 73.060  -55.028 -4.363  1.00 244.36 ? 189 TYR B CD2   1 
ATOM   4507 C CE1   . TYR B 2 114 ? 72.092  -54.374 -6.863  1.00 252.29 ? 189 TYR B CE1   1 
ATOM   4508 C CE2   . TYR B 2 114 ? 73.941  -54.725 -5.387  1.00 247.51 ? 189 TYR B CE2   1 
ATOM   4509 C CZ    . TYR B 2 114 ? 73.449  -54.400 -6.634  1.00 251.46 ? 189 TYR B CZ    1 
ATOM   4510 O OH    . TYR B 2 114 ? 74.314  -54.098 -7.659  1.00 254.80 ? 189 TYR B OH    1 
ATOM   4511 N N     . GLY B 2 115 ? 70.998  -58.210 -3.722  1.00 194.28 ? 190 GLY B N     1 
ATOM   4512 C CA    . GLY B 2 115 ? 71.268  -59.641 -3.724  1.00 195.24 ? 190 GLY B CA    1 
ATOM   4513 C C     . GLY B 2 115 ? 71.137  -60.425 -2.427  1.00 191.73 ? 190 GLY B C     1 
ATOM   4514 O O     . GLY B 2 115 ? 70.689  -59.903 -1.405  1.00 188.27 ? 190 GLY B O     1 
ATOM   4515 N N     . GLN B 2 116 ? 71.558  -61.689 -2.488  1.00 238.46 ? 191 GLN B N     1 
ATOM   4516 C CA    . GLN B 2 116 ? 71.080  -62.739 -1.583  1.00 236.56 ? 191 GLN B CA    1 
ATOM   4517 C C     . GLN B 2 116 ? 72.140  -63.416 -0.702  1.00 234.48 ? 191 GLN B C     1 
ATOM   4518 O O     . GLN B 2 116 ? 73.298  -63.007 -0.667  1.00 234.10 ? 191 GLN B O     1 
ATOM   4519 C CB    . GLN B 2 116 ? 70.353  -63.811 -2.408  1.00 217.27 ? 191 GLN B CB    1 
ATOM   4520 C CG    . GLN B 2 116 ? 71.247  -64.873 -3.072  1.00 220.32 ? 191 GLN B CG    1 
ATOM   4521 C CD    . GLN B 2 116 ? 72.366  -64.295 -3.928  1.00 222.52 ? 191 GLN B CD    1 
ATOM   4522 O OE1   . GLN B 2 116 ? 72.156  -63.921 -5.084  1.00 226.00 ? 191 GLN B OE1   1 
ATOM   4523 N NE2   . GLN B 2 116 ? 73.567  -64.236 -3.364  1.00 220.69 ? 191 GLN B NE2   1 
ATOM   4524 N N     . GLU B 2 117 ? 71.709  -64.455 0.014   1.00 210.65 ? 192 GLU B N     1 
ATOM   4525 C CA    . GLU B 2 117 ? 72.518  -65.145 1.021   1.00 208.43 ? 192 GLU B CA    1 
ATOM   4526 C C     . GLU B 2 117 ? 73.716  -65.946 0.493   1.00 210.86 ? 192 GLU B C     1 
ATOM   4527 O O     . GLU B 2 117 ? 73.766  -66.318 -0.681  1.00 214.69 ? 192 GLU B O     1 
ATOM   4528 C CB    . GLU B 2 117 ? 71.623  -66.097 1.828   1.00 215.65 ? 192 GLU B CB    1 
ATOM   4529 C CG    . GLU B 2 117 ? 70.522  -65.416 2.638   1.00 212.76 ? 192 GLU B CG    1 
ATOM   4530 C CD    . GLU B 2 117 ? 70.854  -65.312 4.124   1.00 208.72 ? 192 GLU B CD    1 
ATOM   4531 O OE1   . GLU B 2 117 ? 70.199  -64.519 4.840   1.00 206.20 ? 192 GLU B OE1   1 
ATOM   4532 O OE2   . GLU B 2 117 ? 71.767  -66.029 4.581   1.00 208.27 ? 192 GLU B OE2   1 
ATOM   4533 N N     . MET B 2 118 ? 74.678  -66.171 1.394   1.00 172.24 ? 193 MET B N     1 
ATOM   4534 C CA    . MET B 2 118 ? 75.689  -67.241 1.321   1.00 173.80 ? 193 MET B CA    1 
ATOM   4535 C C     . MET B 2 118 ? 76.939  -67.005 0.449   1.00 176.42 ? 193 MET B C     1 
ATOM   4536 O O     . MET B 2 118 ? 77.828  -67.857 0.425   1.00 177.75 ? 193 MET B O     1 
ATOM   4537 C CB    . MET B 2 118 ? 75.025  -68.559 0.875   1.00 284.99 ? 193 MET B CB    1 
ATOM   4538 C CG    . MET B 2 118 ? 73.856  -69.016 1.757   1.00 282.75 ? 193 MET B CG    1 
ATOM   4539 S SD    . MET B 2 118 ? 73.473  -70.778 1.642   1.00 285.07 ? 193 MET B SD    1 
ATOM   4540 C CE    . MET B 2 118 ? 71.994  -70.869 2.650   1.00 282.14 ? 193 MET B CE    1 
ATOM   4541 N N     . TYR B 2 119 ? 77.030  -65.884 -0.263  1.00 279.46 ? 194 TYR B N     1 
ATOM   4542 C CA    . TYR B 2 119 ? 78.215  -65.645 -1.101  1.00 282.11 ? 194 TYR B CA    1 
ATOM   4543 C C     . TYR B 2 119 ? 78.584  -64.171 -1.298  1.00 281.40 ? 194 TYR B C     1 
ATOM   4544 O O     . TYR B 2 119 ? 77.704  -63.318 -1.421  1.00 280.63 ? 194 TYR B O     1 
ATOM   4545 C CB    . TYR B 2 119 ? 78.022  -66.296 -2.473  1.00 279.98 ? 194 TYR B CB    1 
ATOM   4546 C CG    . TYR B 2 119 ? 78.802  -67.580 -2.677  1.00 282.34 ? 194 TYR B CG    1 
ATOM   4547 C CD1   . TYR B 2 119 ? 80.087  -67.728 -2.166  1.00 281.54 ? 194 TYR B CD1   1 
ATOM   4548 C CD2   . TYR B 2 119 ? 78.251  -68.644 -3.383  1.00 285.59 ? 194 TYR B CD2   1 
ATOM   4549 C CE1   . TYR B 2 119 ? 80.801  -68.902 -2.354  1.00 283.89 ? 194 TYR B CE1   1 
ATOM   4550 C CE2   . TYR B 2 119 ? 78.957  -69.821 -3.575  1.00 287.96 ? 194 TYR B CE2   1 
ATOM   4551 C CZ    . TYR B 2 119 ? 80.230  -69.945 -3.059  1.00 287.08 ? 194 TYR B CZ    1 
ATOM   4552 O OH    . TYR B 2 119 ? 80.934  -71.114 -3.250  1.00 289.60 ? 194 TYR B OH    1 
ATOM   4553 N N     . ALA B 2 120 ? 79.893  -63.904 -1.349  1.00 204.83 ? 195 ALA B N     1 
ATOM   4554 C CA    . ALA B 2 120 ? 80.461  -62.581 -1.654  1.00 204.80 ? 195 ALA B CA    1 
ATOM   4555 C C     . ALA B 2 120 ? 81.992  -62.622 -1.621  1.00 205.61 ? 195 ALA B C     1 
ATOM   4556 O O     . ALA B 2 120 ? 82.581  -63.596 -1.147  1.00 205.50 ? 195 ALA B O     1 
ATOM   4557 C CB    . ALA B 2 120 ? 79.951  -61.523 -0.682  1.00 172.02 ? 195 ALA B CB    1 
ATOM   4558 N N     . PHE B 2 121 ? 82.631  -61.584 -2.163  1.00 184.72 ? 196 PHE B N     1 
ATOM   4559 C CA    . PHE B 2 121 ? 84.090  -61.464 -2.090  1.00 185.40 ? 196 PHE B CA    1 
ATOM   4560 C C     . PHE B 2 121 ? 84.636  -60.077 -1.708  1.00 183.58 ? 196 PHE B C     1 
ATOM   4561 O O     . PHE B 2 121 ? 85.166  -59.892 -0.613  1.00 180.79 ? 196 PHE B O     1 
ATOM   4562 C CB    . PHE B 2 121 ? 84.706  -61.888 -3.425  1.00 268.02 ? 196 PHE B CB    1 
ATOM   4563 C CG    . PHE B 2 121 ? 85.610  -63.085 -3.321  1.00 269.52 ? 196 PHE B CG    1 
ATOM   4564 C CD1   . PHE B 2 121 ? 85.095  -64.368 -3.401  1.00 270.62 ? 196 PHE B CD1   1 
ATOM   4565 C CD2   . PHE B 2 121 ? 86.974  -62.927 -3.139  1.00 269.98 ? 196 PHE B CD2   1 
ATOM   4566 C CE1   . PHE B 2 121 ? 85.924  -65.471 -3.303  1.00 272.15 ? 196 PHE B CE1   1 
ATOM   4567 C CE2   . PHE B 2 121 ? 87.807  -64.026 -3.041  1.00 271.53 ? 196 PHE B CE2   1 
ATOM   4568 C CZ    . PHE B 2 121 ? 87.281  -65.299 -3.123  1.00 272.61 ? 196 PHE B CZ    1 
ATOM   4569 N N     . ARG B 2 122 ? 84.494  -59.110 -2.616  1.00 243.49 ? 197 ARG B N     1 
ATOM   4570 C CA    . ARG B 2 122 ? 85.259  -57.859 -2.551  1.00 242.99 ? 197 ARG B CA    1 
ATOM   4571 C C     . ARG B 2 122 ? 84.415  -56.592 -2.736  1.00 242.08 ? 197 ARG B C     1 
ATOM   4572 O O     . ARG B 2 122 ? 83.186  -56.640 -2.724  1.00 241.24 ? 197 ARG B O     1 
ATOM   4573 C CB    . ARG B 2 122 ? 86.385  -57.867 -3.593  1.00 243.47 ? 197 ARG B CB    1 
ATOM   4574 C CG    . ARG B 2 122 ? 87.778  -57.651 -3.003  1.00 242.81 ? 197 ARG B CG    1 
ATOM   4575 C CD    . ARG B 2 122 ? 88.745  -57.038 -4.017  1.00 246.27 ? 197 ARG B CD    1 
ATOM   4576 N NE    . ARG B 2 122 ? 88.816  -55.580 -3.909  1.00 245.09 ? 197 ARG B NE    1 
ATOM   4577 C CZ    . ARG B 2 122 ? 89.788  -54.920 -3.284  1.00 243.87 ? 197 ARG B CZ    1 
ATOM   4578 N NH1   . ARG B 2 122 ? 90.782  -55.584 -2.711  1.00 243.68 ? 197 ARG B NH1   1 
ATOM   4579 N NH2   . ARG B 2 122 ? 89.770  -53.593 -3.234  1.00 243.01 ? 197 ARG B NH2   1 
ATOM   4580 N N     . SER B 2 123 ? 85.107  -55.463 -2.889  1.00 333.73 ? 198 SER B N     1 
ATOM   4581 C CA    . SER B 2 123 ? 84.510  -54.123 -2.874  1.00 332.55 ? 198 SER B CA    1 
ATOM   4582 C C     . SER B 2 123 ? 83.393  -53.869 -3.889  1.00 334.65 ? 198 SER B C     1 
ATOM   4583 O O     . SER B 2 123 ? 83.395  -54.413 -4.994  1.00 338.27 ? 198 SER B O     1 
ATOM   4584 C CB    . SER B 2 123 ? 85.607  -53.071 -3.091  1.00 199.87 ? 198 SER B CB    1 
ATOM   4585 O OG    . SER B 2 123 ? 86.201  -53.199 -4.373  1.00 204.13 ? 198 SER B OG    1 
ATOM   4586 N N     . GLU B 2 124 ? 82.443  -53.028 -3.487  1.00 400.71 ? 199 GLU B N     1 
ATOM   4587 C CA    . GLU B 2 124 ? 81.397  -52.541 -4.379  1.00 402.61 ? 199 GLU B CA    1 
ATOM   4588 C C     . GLU B 2 124 ? 81.917  -51.384 -5.227  1.00 405.01 ? 199 GLU B C     1 
ATOM   4589 O O     . GLU B 2 124 ? 83.035  -50.909 -5.027  1.00 404.83 ? 199 GLU B O     1 
ATOM   4590 C CB    . GLU B 2 124 ? 80.173  -52.088 -3.574  1.00 253.21 ? 199 GLU B CB    1 
ATOM   4591 C CG    . GLU B 2 124 ? 79.149  -53.177 -3.284  1.00 252.37 ? 199 GLU B CG    1 
ATOM   4592 C CD    . GLU B 2 124 ? 78.013  -53.190 -4.291  1.00 255.04 ? 199 GLU B CD    1 
ATOM   4593 O OE1   . GLU B 2 124 ? 78.288  -53.052 -5.503  1.00 258.85 ? 199 GLU B OE1   1 
ATOM   4594 O OE2   . GLU B 2 124 ? 76.844  -53.328 -3.870  1.00 253.50 ? 199 GLU B OE2   1 
ATOM   4595 N N     . GLU B 2 125 ? 81.084  -50.911 -6.149  1.00 257.55 ? 200 GLU B N     1 
ATOM   4596 C CA    . GLU B 2 125 ? 81.450  -49.805 -7.025  1.00 260.14 ? 200 GLU B CA    1 
ATOM   4597 C C     . GLU B 2 125 ? 81.544  -48.486 -6.265  1.00 257.41 ? 200 GLU B C     1 
ATOM   4598 O O     . GLU B 2 125 ? 82.435  -47.673 -6.519  1.00 258.45 ? 200 GLU B O     1 
ATOM   4599 C CB    . GLU B 2 125 ? 80.437  -49.666 -8.162  1.00 221.40 ? 200 GLU B CB    1 
ATOM   4600 C CG    . GLU B 2 125 ? 80.753  -48.533 -9.124  1.00 224.43 ? 200 GLU B CG    1 
ATOM   4601 C CD    . GLU B 2 125 ? 79.509  -47.879 -9.685  1.00 225.78 ? 200 GLU B CD    1 
ATOM   4602 O OE1   . GLU B 2 125 ? 78.457  -48.550 -9.746  1.00 225.90 ? 200 GLU B OE1   1 
ATOM   4603 O OE2   . GLU B 2 125 ? 79.582  -46.689 -10.056 1.00 226.84 ? 200 GLU B OE2   1 
ATOM   4604 N N     . ARG B 2 126 ? 80.620  -48.284 -5.329  1.00 252.01 ? 201 ARG B N     1 
ATOM   4605 C CA    . ARG B 2 126 ? 80.469  -46.999 -4.650  1.00 249.68 ? 201 ARG B CA    1 
ATOM   4606 C C     . ARG B 2 126 ? 81.654  -46.633 -3.755  1.00 247.54 ? 201 ARG B C     1 
ATOM   4607 O O     . ARG B 2 126 ? 82.215  -47.478 -3.057  1.00 245.94 ? 201 ARG B O     1 
ATOM   4608 C CB    . ARG B 2 126 ? 79.181  -46.986 -3.826  1.00 245.83 ? 201 ARG B CB    1 
ATOM   4609 C CG    . ARG B 2 126 ? 78.268  -45.813 -4.154  1.00 246.42 ? 201 ARG B CG    1 
ATOM   4610 C CD    . ARG B 2 126 ? 77.454  -46.071 -5.415  1.00 250.05 ? 201 ARG B CD    1 
ATOM   4611 N NE    . ARG B 2 126 ? 77.001  -44.835 -6.048  1.00 251.86 ? 201 ARG B NE    1 
ATOM   4612 C CZ    . ARG B 2 126 ? 76.002  -44.077 -5.603  1.00 250.34 ? 201 ARG B CZ    1 
ATOM   4613 N NH1   . ARG B 2 126 ? 75.670  -42.973 -6.257  1.00 252.40 ? 201 ARG B NH1   1 
ATOM   4614 N NH2   . ARG B 2 126 ? 75.339  -44.416 -4.505  1.00 246.92 ? 201 ARG B NH2   1 
ATOM   4615 N N     . PHE B 2 127 ? 82.042  -45.364 -3.827  1.00 300.71 ? 202 PHE B N     1 
ATOM   4616 C CA    . PHE B 2 127 ? 83.156  -44.807 -3.060  1.00 299.14 ? 202 PHE B CA    1 
ATOM   4617 C C     . PHE B 2 127 ? 82.764  -44.027 -1.796  1.00 295.49 ? 202 PHE B C     1 
ATOM   4618 O O     . PHE B 2 127 ? 83.588  -43.292 -1.251  1.00 294.60 ? 202 PHE B O     1 
ATOM   4619 C CB    . PHE B 2 127 ? 84.025  -43.945 -3.975  1.00 231.31 ? 202 PHE B CB    1 
ATOM   4620 C CG    . PHE B 2 127 ? 84.884  -44.756 -4.907  1.00 234.55 ? 202 PHE B CG    1 
ATOM   4621 C CD1   . PHE B 2 127 ? 86.012  -45.409 -4.432  1.00 234.00 ? 202 PHE B CD1   1 
ATOM   4622 C CD2   . PHE B 2 127 ? 84.549  -44.895 -6.244  1.00 238.33 ? 202 PHE B CD2   1 
ATOM   4623 C CE1   . PHE B 2 127 ? 86.800  -46.173 -5.277  1.00 237.13 ? 202 PHE B CE1   1 
ATOM   4624 C CE2   . PHE B 2 127 ? 85.334  -45.656 -7.096  1.00 241.53 ? 202 PHE B CE2   1 
ATOM   4625 C CZ    . PHE B 2 127 ? 86.462  -46.295 -6.612  1.00 240.91 ? 202 PHE B CZ    1 
ATOM   4626 N N     . LYS B 2 128 ? 81.499  -44.103 -1.389  1.00 168.15 ? 203 LYS B N     1 
ATOM   4627 C CA    . LYS B 2 128 ? 81.046  -43.429 -0.169  1.00 164.83 ? 203 LYS B CA    1 
ATOM   4628 C C     . LYS B 2 128 ? 81.852  -43.845 1.067   1.00 162.15 ? 203 LYS B C     1 
ATOM   4629 O O     . LYS B 2 128 ? 82.039  -45.032 1.323   1.00 161.55 ? 203 LYS B O     1 
ATOM   4630 C CB    . LYS B 2 128 ? 79.561  -43.708 0.079   1.00 184.34 ? 203 LYS B CB    1 
ATOM   4631 C CG    . LYS B 2 128 ? 78.713  -43.730 -1.180  1.00 187.29 ? 203 LYS B CG    1 
ATOM   4632 C CD    . LYS B 2 128 ? 77.405  -42.981 -0.986  1.00 186.48 ? 203 LYS B CD    1 
ATOM   4633 C CE    . LYS B 2 128 ? 77.387  -41.689 -1.790  1.00 188.84 ? 203 LYS B CE    1 
ATOM   4634 N NZ    . LYS B 2 128 ? 77.175  -41.944 -3.242  1.00 192.76 ? 203 LYS B NZ    1 
ATOM   4635 N N     . SER B 2 129 ? 82.322  -42.857 1.826   1.00 172.35 ? 204 SER B N     1 
ATOM   4636 C CA    . SER B 2 129 ? 83.054  -43.095 3.071   1.00 169.94 ? 204 SER B CA    1 
ATOM   4637 C C     . SER B 2 129 ? 82.105  -43.589 4.167   1.00 166.90 ? 204 SER B C     1 
ATOM   4638 O O     . SER B 2 129 ? 80.905  -43.323 4.106   1.00 166.39 ? 204 SER B O     1 
ATOM   4639 C CB    . SER B 2 129 ? 83.776  -41.815 3.514   1.00 168.23 ? 204 SER B CB    1 
ATOM   4640 O OG    . SER B 2 129 ? 82.883  -40.718 3.604   1.00 167.73 ? 204 SER B OG    1 
ATOM   4641 N N     . PRO B 2 130 ? 82.635  -44.315 5.173   1.00 153.43 ? 205 PRO B N     1 
ATOM   4642 C CA    . PRO B 2 130 ? 81.751  -44.886 6.196   1.00 150.74 ? 205 PRO B CA    1 
ATOM   4643 C C     . PRO B 2 130 ? 81.087  -43.819 7.044   1.00 148.88 ? 205 PRO B C     1 
ATOM   4644 O O     . PRO B 2 130 ? 81.662  -42.749 7.221   1.00 149.12 ? 205 PRO B O     1 
ATOM   4645 C CB    . PRO B 2 130 ? 82.698  -45.744 7.039   1.00 149.65 ? 205 PRO B CB    1 
ATOM   4646 C CG    . PRO B 2 130 ? 84.026  -45.132 6.842   1.00 151.04 ? 205 PRO B CG    1 
ATOM   4647 C CD    . PRO B 2 130 ? 84.047  -44.647 5.429   1.00 153.86 ? 205 PRO B CD    1 
ATOM   4648 N N     . PRO B 2 131 ? 79.883  -44.105 7.557   1.00 147.20 ? 206 PRO B N     1 
ATOM   4649 C CA    . PRO B 2 131 ? 79.138  -43.126 8.350   1.00 145.60 ? 206 PRO B CA    1 
ATOM   4650 C C     . PRO B 2 131 ? 79.805  -42.869 9.688   1.00 143.70 ? 206 PRO B C     1 
ATOM   4651 O O     . PRO B 2 131 ? 80.492  -43.749 10.205  1.00 143.02 ? 206 PRO B O     1 
ATOM   4652 C CB    . PRO B 2 131 ? 77.777  -43.791 8.536   1.00 144.50 ? 206 PRO B CB    1 
ATOM   4653 C CG    . PRO B 2 131 ? 78.068  -45.242 8.460   1.00 144.49 ? 206 PRO B CG    1 
ATOM   4654 C CD    . PRO B 2 131 ? 79.171  -45.389 7.458   1.00 146.83 ? 206 PRO B CD    1 
ATOM   4655 N N     . ILE B 2 132 ? 79.609  -41.676 10.239  1.00 143.08 ? 207 ILE B N     1 
ATOM   4656 C CA    . ILE B 2 132 ? 80.213  -41.321 11.515  1.00 141.60 ? 207 ILE B CA    1 
ATOM   4657 C C     . ILE B 2 132 ? 79.423  -41.977 12.638  1.00 139.31 ? 207 ILE B C     1 
ATOM   4658 O O     . ILE B 2 132 ? 78.199  -42.047 12.570  1.00 138.75 ? 207 ILE B O     1 
ATOM   4659 C CB    . ILE B 2 132 ? 80.254  -39.794 11.724  1.00 141.97 ? 207 ILE B CB    1 
ATOM   4660 C CG1   . ILE B 2 132 ? 80.833  -39.096 10.498  1.00 144.43 ? 207 ILE B CG1   1 
ATOM   4661 C CG2   . ILE B 2 132 ? 81.085  -39.437 12.934  1.00 141.00 ? 207 ILE B CG2   1 
ATOM   4662 C CD1   . ILE B 2 132 ? 79.787  -38.578 9.549   1.00 145.59 ? 207 ILE B CD1   1 
ATOM   4663 N N     . LEU B 2 133 ? 80.125  -42.470 13.657  1.00 138.18 ? 208 LEU B N     1 
ATOM   4664 C CA    . LEU B 2 133 ? 79.493  -43.102 14.812  1.00 136.14 ? 208 LEU B CA    1 
ATOM   4665 C C     . LEU B 2 133 ? 78.546  -42.159 15.537  1.00 135.11 ? 208 LEU B C     1 
ATOM   4666 O O     . LEU B 2 133 ? 78.936  -41.058 15.919  1.00 135.38 ? 208 LEU B O     1 
ATOM   4667 C CB    . LEU B 2 133 ? 80.554  -43.596 15.787  1.00 135.52 ? 208 LEU B CB    1 
ATOM   4668 C CG    . LEU B 2 133 ? 80.016  -44.333 17.007  1.00 133.64 ? 208 LEU B CG    1 
ATOM   4669 C CD1   . LEU B 2 133 ? 79.573  -45.732 16.633  1.00 133.37 ? 208 LEU B CD1   1 
ATOM   4670 C CD2   . LEU B 2 133 ? 81.081  -44.370 18.069  1.00 133.34 ? 208 LEU B CD2   1 
ATOM   4671 N N     . PRO B 2 134 ? 77.293  -42.587 15.733  1.00 134.10 ? 209 PRO B N     1 
ATOM   4672 C CA    . PRO B 2 134 ? 76.339  -41.735 16.443  1.00 133.25 ? 209 PRO B CA    1 
ATOM   4673 C C     . PRO B 2 134 ? 76.695  -41.642 17.921  1.00 131.95 ? 209 PRO B C     1 
ATOM   4674 O O     . PRO B 2 134 ? 77.147  -42.637 18.482  1.00 131.20 ? 209 PRO B O     1 
ATOM   4675 C CB    . PRO B 2 134 ? 75.006  -42.454 16.234  1.00 132.67 ? 209 PRO B CB    1 
ATOM   4676 C CG    . PRO B 2 134 ? 75.376  -43.871 16.040  1.00 132.49 ? 209 PRO B CG    1 
ATOM   4677 C CD    . PRO B 2 134 ? 76.690  -43.863 15.316  1.00 133.86 ? 209 PRO B CD    1 
ATOM   4678 N N     . PRO B 2 135 ? 76.510  -40.463 18.541  1.00 131.91 ? 210 PRO B N     1 
ATOM   4679 C CA    . PRO B 2 135 ? 76.792  -40.249 19.968  1.00 131.01 ? 210 PRO B CA    1 
ATOM   4680 C C     . PRO B 2 135 ? 75.960  -41.134 20.896  1.00 129.48 ? 210 PRO B C     1 
ATOM   4681 O O     . PRO B 2 135 ? 76.272  -41.224 22.080  1.00 128.84 ? 210 PRO B O     1 
ATOM   4682 C CB    . PRO B 2 135 ? 76.447  -38.771 20.176  1.00 188.22 ? 210 PRO B CB    1 
ATOM   4683 C CG    . PRO B 2 135 ? 76.607  -38.154 18.822  1.00 189.72 ? 210 PRO B CG    1 
ATOM   4684 C CD    . PRO B 2 135 ? 76.150  -39.208 17.858  1.00 189.69 ? 210 PRO B CD    1 
ATOM   4685 N N     . HIS B 2 136 ? 74.912  -41.757 20.371  1.00 129.09 ? 211 HIS B N     1 
ATOM   4686 C CA    . HIS B 2 136 ? 74.030  -42.595 21.173  1.00 127.78 ? 211 HIS B CA    1 
ATOM   4687 C C     . HIS B 2 136 ? 74.690  -43.875 21.679  1.00 127.10 ? 211 HIS B C     1 
ATOM   4688 O O     . HIS B 2 136 ? 74.574  -44.211 22.852  1.00 126.20 ? 211 HIS B O     1 
ATOM   4689 C CB    . HIS B 2 136 ? 72.789  -42.957 20.372  1.00 127.84 ? 211 HIS B CB    1 
ATOM   4690 C CG    . HIS B 2 136 ? 71.964  -41.779 19.966  1.00 128.55 ? 211 HIS B CG    1 
ATOM   4691 N ND1   . HIS B 2 136 ? 72.458  -40.751 19.191  1.00 129.86 ? 211 HIS B ND1   1 
ATOM   4692 C CD2   . HIS B 2 136 ? 70.671  -41.472 20.219  1.00 128.30 ? 211 HIS B CD2   1 
ATOM   4693 C CE1   . HIS B 2 136 ? 71.505  -39.860 18.987  1.00 130.38 ? 211 HIS B CE1   1 
ATOM   4694 N NE2   . HIS B 2 136 ? 70.411  -40.273 19.601  1.00 129.47 ? 211 HIS B NE2   1 
ATOM   4695 N N     . LEU B 2 137 ? 75.367  -44.593 20.792  1.00 127.72 ? 212 LEU B N     1 
ATOM   4696 C CA    . LEU B 2 137 ? 75.996  -45.855 21.154  1.00 127.31 ? 212 LEU B CA    1 
ATOM   4697 C C     . LEU B 2 137 ? 77.192  -45.648 22.060  1.00 127.39 ? 212 LEU B C     1 
ATOM   4698 O O     . LEU B 2 137 ? 77.593  -46.556 22.780  1.00 126.92 ? 212 LEU B O     1 
ATOM   4699 C CB    . LEU B 2 137 ? 76.443  -46.617 19.911  1.00 128.28 ? 212 LEU B CB    1 
ATOM   4700 C CG    . LEU B 2 137 ? 75.376  -47.007 18.896  1.00 128.61 ? 212 LEU B CG    1 
ATOM   4701 C CD1   . LEU B 2 137 ? 76.000  -47.818 17.785  1.00 129.83 ? 212 LEU B CD1   1 
ATOM   4702 C CD2   . LEU B 2 137 ? 74.281  -47.793 19.571  1.00 127.40 ? 212 LEU B CD2   1 
ATOM   4703 N N     . LEU B 2 138 ? 77.779  -44.460 22.004  1.00 128.17 ? 213 LEU B N     1 
ATOM   4704 C CA    . LEU B 2 138 ? 78.935  -44.155 22.833  1.00 128.56 ? 213 LEU B CA    1 
ATOM   4705 C C     . LEU B 2 138 ? 78.544  -44.044 24.311  1.00 127.70 ? 213 LEU B C     1 
ATOM   4706 O O     . LEU B 2 138 ? 79.380  -44.219 25.203  1.00 127.90 ? 213 LEU B O     1 
ATOM   4707 C CB    . LEU B 2 138 ? 79.604  -42.870 22.352  1.00 147.39 ? 213 LEU B CB    1 
ATOM   4708 C CG    . LEU B 2 138 ? 81.116  -42.942 22.133  1.00 148.58 ? 213 LEU B CG    1 
ATOM   4709 C CD1   . LEU B 2 138 ? 81.632  -41.636 21.547  1.00 149.92 ? 213 LEU B CD1   1 
ATOM   4710 C CD2   . LEU B 2 138 ? 81.845  -43.272 23.425  1.00 148.43 ? 213 LEU B CD2   1 
ATOM   4711 N N     . GLN B 2 139 ? 77.271  -43.753 24.573  1.00 126.93 ? 214 GLN B N     1 
ATOM   4712 C CA    . GLN B 2 139 ? 76.775  -43.734 25.946  1.00 126.23 ? 214 GLN B CA    1 
ATOM   4713 C C     . GLN B 2 139 ? 76.471  -45.163 26.392  1.00 125.32 ? 214 GLN B C     1 
ATOM   4714 O O     . GLN B 2 139 ? 75.542  -45.797 25.891  1.00 124.70 ? 214 GLN B O     1 
ATOM   4715 C CB    . GLN B 2 139 ? 75.522  -42.860 26.046  1.00 175.70 ? 214 GLN B CB    1 
ATOM   4716 C CG    . GLN B 2 139 ? 75.250  -42.273 27.416  1.00 175.64 ? 214 GLN B CG    1 
ATOM   4717 C CD    . GLN B 2 139 ? 73.964  -41.465 27.449  1.00 175.54 ? 214 GLN B CD    1 
ATOM   4718 O OE1   . GLN B 2 139 ? 72.941  -41.878 26.900  1.00 174.98 ? 214 GLN B OE1   1 
ATOM   4719 N NE2   . GLN B 2 139 ? 74.013  -40.300 28.086  1.00 176.27 ? 214 GLN B NE2   1 
ATOM   4720 N N     . VAL B 2 140 ? 77.225  -45.647 27.373  1.00 137.47 ? 215 VAL B N     1 
ATOM   4721 C CA    . VAL B 2 140 ? 77.139  -47.047 27.786  1.00 136.85 ? 215 VAL B CA    1 
ATOM   4722 C C     . VAL B 2 140 ? 76.328  -47.174 29.061  1.00 136.21 ? 215 VAL B C     1 
ATOM   4723 O O     . VAL B 2 140 ? 76.396  -46.295 29.916  1.00 136.60 ? 215 VAL B O     1 
ATOM   4724 C CB    . VAL B 2 140 ? 78.532  -47.661 28.011  1.00 125.50 ? 215 VAL B CB    1 
ATOM   4725 C CG1   . VAL B 2 140 ? 79.131  -48.096 26.703  1.00 126.02 ? 215 VAL B CG1   1 
ATOM   4726 C CG2   . VAL B 2 140 ? 79.444  -46.669 28.697  1.00 126.48 ? 215 VAL B CG2   1 
ATOM   4727 N N     . ILE B 2 141 ? 75.535  -48.239 29.182  1.00 123.32 ? 216 ILE B N     1 
ATOM   4728 C CA    . ILE B 2 141 ? 74.676  -48.398 30.358  1.00 122.81 ? 216 ILE B CA    1 
ATOM   4729 C C     . ILE B 2 141 ? 75.305  -49.121 31.541  1.00 123.07 ? 216 ILE B C     1 
ATOM   4730 O O     . ILE B 2 141 ? 74.834  -48.978 32.664  1.00 123.08 ? 216 ILE B O     1 
ATOM   4731 C CB    . ILE B 2 141 ? 73.371  -49.140 30.000  1.00 172.62 ? 216 ILE B CB    1 
ATOM   4732 C CG1   . ILE B 2 141 ? 73.593  -50.103 28.832  1.00 172.56 ? 216 ILE B CG1   1 
ATOM   4733 C CG2   . ILE B 2 141 ? 72.286  -48.143 29.637  1.00 172.48 ? 216 ILE B CG2   1 
ATOM   4734 C CD1   . ILE B 2 141 ? 74.351  -51.363 29.183  1.00 172.66 ? 216 ILE B CD1   1 
ATOM   4735 N N     . LEU B 2 142 ? 76.359  -49.891 31.306  1.00 123.49 ? 217 LEU B N     1 
ATOM   4736 C CA    . LEU B 2 142 ? 77.003  -50.612 32.396  1.00 123.96 ? 217 LEU B CA    1 
ATOM   4737 C C     . LEU B 2 142 ? 78.011  -49.744 33.134  1.00 125.13 ? 217 LEU B C     1 
ATOM   4738 O O     . LEU B 2 142 ? 78.263  -49.956 34.318  1.00 125.72 ? 217 LEU B O     1 
ATOM   4739 C CB    . LEU B 2 142 ? 77.673  -51.885 31.884  1.00 126.53 ? 217 LEU B CB    1 
ATOM   4740 C CG    . LEU B 2 142 ? 76.732  -53.012 31.452  1.00 125.66 ? 217 LEU B CG    1 
ATOM   4741 C CD1   . LEU B 2 142 ? 77.526  -54.216 30.960  1.00 126.13 ? 217 LEU B CD1   1 
ATOM   4742 C CD2   . LEU B 2 142 ? 75.792  -53.400 32.587  1.00 125.18 ? 217 LEU B CD2   1 
ATOM   4743 N N     . ASN B 2 143 ? 78.601  -48.782 32.430  1.00 130.81 ? 218 ASN B N     1 
ATOM   4744 C CA    . ASN B 2 143 ? 79.568  -47.877 33.046  1.00 132.11 ? 218 ASN B CA    1 
ATOM   4745 C C     . ASN B 2 143 ? 78.872  -46.843 33.940  1.00 132.29 ? 218 ASN B C     1 
ATOM   4746 O O     . ASN B 2 143 ? 79.477  -46.296 34.867  1.00 133.50 ? 218 ASN B O     1 
ATOM   4747 C CB    . ASN B 2 143 ? 80.407  -47.183 31.970  1.00 215.55 ? 218 ASN B CB    1 
ATOM   4748 C CG    . ASN B 2 143 ? 81.599  -46.439 32.542  1.00 217.14 ? 218 ASN B CG    1 
ATOM   4749 O OD1   . ASN B 2 143 ? 82.167  -46.841 33.557  1.00 217.96 ? 218 ASN B OD1   1 
ATOM   4750 N ND2   . ASN B 2 143 ? 81.983  -45.346 31.891  1.00 217.75 ? 218 ASN B ND2   1 
ATOM   4751 N N     . LYS B 2 144 ? 77.597  -46.585 33.658  1.00 126.11 ? 219 LYS B N     1 
ATOM   4752 C CA    . LYS B 2 144 ? 76.790  -45.690 34.483  1.00 126.32 ? 219 LYS B CA    1 
ATOM   4753 C C     . LYS B 2 144 ? 76.636  -46.244 35.889  1.00 126.71 ? 219 LYS B C     1 
ATOM   4754 O O     . LYS B 2 144 ? 76.298  -47.414 36.063  1.00 126.04 ? 219 LYS B O     1 
ATOM   4755 C CB    . LYS B 2 144 ? 75.405  -45.476 33.868  1.00 168.86 ? 219 LYS B CB    1 
ATOM   4756 C CG    . LYS B 2 144 ? 75.384  -44.612 32.623  1.00 168.83 ? 219 LYS B CG    1 
ATOM   4757 C CD    . LYS B 2 144 ? 73.970  -44.508 32.076  1.00 167.97 ? 219 LYS B CD    1 
ATOM   4758 C CE    . LYS B 2 144 ? 73.931  -43.805 30.729  1.00 168.07 ? 219 LYS B CE    1 
ATOM   4759 N NZ    . LYS B 2 144 ? 72.566  -43.869 30.128  1.00 167.40 ? 219 LYS B NZ    1 
ATOM   4760 N N     . ASP B 2 145 ? 76.882  -45.404 36.889  1.00 127.98 ? 220 ASP B N     1 
ATOM   4761 C CA    . ASP B 2 145 ? 76.694  -45.792 38.285  1.00 128.70 ? 220 ASP B CA    1 
ATOM   4762 C C     . ASP B 2 145 ? 75.256  -45.558 38.742  1.00 128.21 ? 220 ASP B C     1 
ATOM   4763 O O     . ASP B 2 145 ? 74.724  -44.452 38.620  1.00 128.42 ? 220 ASP B O     1 
ATOM   4764 C CB    . ASP B 2 145 ? 77.663  -45.026 39.191  1.00 194.00 ? 220 ASP B CB    1 
ATOM   4765 C CG    . ASP B 2 145 ? 78.941  -45.798 39.467  1.00 194.91 ? 220 ASP B CG    1 
ATOM   4766 O OD1   . ASP B 2 145 ? 78.850  -46.979 39.867  1.00 194.60 ? 220 ASP B OD1   1 
ATOM   4767 O OD2   . ASP B 2 145 ? 80.035  -45.221 39.283  1.00 196.07 ? 220 ASP B OD2   1 
ATOM   4768 N N     . THR B 2 146 ? 74.630  -46.609 39.265  1.00 164.03 ? 221 THR B N     1 
ATOM   4769 C CA    . THR B 2 146 ? 73.270  -46.514 39.781  1.00 163.73 ? 221 THR B CA    1 
ATOM   4770 C C     . THR B 2 146 ? 73.269  -45.856 41.153  1.00 165.43 ? 221 THR B C     1 
ATOM   4771 O O     . THR B 2 146 ? 74.327  -45.534 41.697  1.00 166.86 ? 221 THR B O     1 
ATOM   4772 C CB    . THR B 2 146 ? 72.599  -47.900 39.892  1.00 126.40 ? 221 THR B CB    1 
ATOM   4773 O OG1   . THR B 2 146 ? 73.401  -48.757 40.712  1.00 127.22 ? 221 THR B OG1   1 
ATOM   4774 C CG2   . THR B 2 146 ? 72.442  -48.536 38.525  1.00 124.91 ? 221 THR B CG2   1 
ATOM   4775 N N     . ASN B 2 147 ? 72.077  -45.668 41.712  1.00 155.34 ? 222 ASN B N     1 
ATOM   4776 C CA    . ASN B 2 147 ? 71.936  -45.153 43.069  1.00 157.14 ? 222 ASN B CA    1 
ATOM   4777 C C     . ASN B 2 147 ? 72.405  -46.198 44.079  1.00 157.97 ? 222 ASN B C     1 
ATOM   4778 O O     . ASN B 2 147 ? 72.508  -47.381 43.756  1.00 156.93 ? 222 ASN B O     1 
ATOM   4779 C CB    . ASN B 2 147 ? 70.485  -44.749 43.344  1.00 156.86 ? 222 ASN B CB    1 
ATOM   4780 C CG    . ASN B 2 147 ? 70.372  -43.661 44.393  1.00 158.94 ? 222 ASN B CG    1 
ATOM   4781 O OD1   . ASN B 2 147 ? 71.205  -43.561 45.295  1.00 160.63 ? 222 ASN B OD1   1 
ATOM   4782 N ND2   . ASN B 2 147 ? 69.339  -42.834 44.279  1.00 159.03 ? 222 ASN B ND2   1 
ATOM   4783 N N     . ILE B 2 148 ? 72.725  -45.758 45.290  1.00 133.88 ? 223 ILE B N     1 
ATOM   4784 C CA    . ILE B 2 148 ? 73.197  -46.672 46.324  1.00 135.08 ? 223 ILE B CA    1 
ATOM   4785 C C     . ILE B 2 148 ? 72.034  -47.382 47.029  1.00 134.99 ? 223 ILE B C     1 
ATOM   4786 O O     . ILE B 2 148 ? 72.186  -48.505 47.502  1.00 135.15 ? 223 ILE B O     1 
ATOM   4787 C CB    . ILE B 2 148 ? 74.076  -45.937 47.370  1.00 137.76 ? 223 ILE B CB    1 
ATOM   4788 C CG1   . ILE B 2 148 ? 75.020  -44.943 46.688  1.00 138.06 ? 223 ILE B CG1   1 
ATOM   4789 C CG2   . ILE B 2 148 ? 74.896  -46.926 48.175  1.00 139.05 ? 223 ILE B CG2   1 
ATOM   4790 C CD1   . ILE B 2 148 ? 74.540  -43.503 46.713  1.00 138.82 ? 223 ILE B CD1   1 
ATOM   4791 N N     . SER B 2 149 ? 70.877  -46.729 47.090  1.00 134.85 ? 224 SER B N     1 
ATOM   4792 C CA    . SER B 2 149 ? 69.734  -47.257 47.837  1.00 135.12 ? 224 SER B CA    1 
ATOM   4793 C C     . SER B 2 149 ? 68.976  -48.354 47.091  1.00 132.99 ? 224 SER B C     1 
ATOM   4794 O O     . SER B 2 149 ? 68.452  -49.277 47.713  1.00 133.20 ? 224 SER B O     1 
ATOM   4795 C CB    . SER B 2 149 ? 68.769  -46.124 48.193  1.00 204.97 ? 224 SER B CB    1 
ATOM   4796 O OG    . SER B 2 149 ? 68.316  -45.458 47.028  1.00 203.46 ? 224 SER B OG    1 
ATOM   4797 N N     . CYS B 2 150 ? 68.910  -48.244 45.765  1.00 136.87 ? 225 CYS B N     1 
ATOM   4798 C CA    . CYS B 2 150 ? 68.165  -49.195 44.936  1.00 135.01 ? 225 CYS B CA    1 
ATOM   4799 C C     . CYS B 2 150 ? 68.884  -50.542 44.825  1.00 134.50 ? 225 CYS B C     1 
ATOM   4800 O O     . CYS B 2 150 ? 70.064  -50.652 45.154  1.00 135.37 ? 225 CYS B O     1 
ATOM   4801 C CB    . CYS B 2 150 ? 67.915  -48.611 43.543  1.00 211.42 ? 225 CYS B CB    1 
ATOM   4802 S SG    . CYS B 2 150 ? 69.412  -48.186 42.648  1.00 211.14 ? 225 CYS B SG    1 
ATOM   4803 N N     . ASP B 2 151 ? 68.150  -51.570 44.405  1.00 127.59 ? 226 ASP B N     1 
ATOM   4804 C CA    . ASP B 2 151 ? 68.710  -52.902 44.182  1.00 127.08 ? 226 ASP B CA    1 
ATOM   4805 C C     . ASP B 2 151 ? 69.872  -52.869 43.189  1.00 126.45 ? 226 ASP B C     1 
ATOM   4806 O O     . ASP B 2 151 ? 69.787  -52.208 42.153  1.00 125.53 ? 226 ASP B O     1 
ATOM   4807 C CB    . ASP B 2 151 ? 67.619  -53.850 43.675  1.00 149.22 ? 226 ASP B CB    1 
ATOM   4808 C CG    . ASP B 2 151 ? 68.021  -55.310 43.760  1.00 149.13 ? 226 ASP B CG    1 
ATOM   4809 O OD1   . ASP B 2 151 ? 68.902  -55.746 42.985  1.00 148.57 ? 226 ASP B OD1   1 
ATOM   4810 O OD2   . ASP B 2 151 ? 67.435  -56.025 44.599  1.00 149.74 ? 226 ASP B OD2   1 
ATOM   4811 N N     . PRO B 2 152 ? 70.965  -53.584 43.500  1.00 127.11 ? 227 PRO B N     1 
ATOM   4812 C CA    . PRO B 2 152 ? 72.146  -53.669 42.628  1.00 126.78 ? 227 PRO B CA    1 
ATOM   4813 C C     . PRO B 2 152 ? 71.857  -54.201 41.214  1.00 125.13 ? 227 PRO B C     1 
ATOM   4814 O O     . PRO B 2 152 ? 72.509  -53.792 40.249  1.00 124.71 ? 227 PRO B O     1 
ATOM   4815 C CB    . PRO B 2 152 ? 73.064  -54.630 43.390  1.00 127.95 ? 227 PRO B CB    1 
ATOM   4816 C CG    . PRO B 2 152 ? 72.685  -54.453 44.806  1.00 129.42 ? 227 PRO B CG    1 
ATOM   4817 C CD    . PRO B 2 152 ? 71.199  -54.234 44.798  1.00 128.59 ? 227 PRO B CD    1 
ATOM   4818 N N     . ALA B 2 153 ? 70.881  -55.096 41.099  1.00 124.40 ? 228 ALA B N     1 
ATOM   4819 C CA    . ALA B 2 153 ? 70.569  -55.735 39.830  1.00 123.15 ? 228 ALA B CA    1 
ATOM   4820 C C     . ALA B 2 153 ? 69.816  -54.811 38.883  1.00 122.27 ? 228 ALA B C     1 
ATOM   4821 O O     . ALA B 2 153 ? 69.704  -55.097 37.697  1.00 121.48 ? 228 ALA B O     1 
ATOM   4822 C CB    . ALA B 2 153 ? 69.770  -57.002 40.066  1.00 267.19 ? 228 ALA B CB    1 
ATOM   4823 N N     . LEU B 2 154 ? 69.297  -53.705 39.397  1.00 122.62 ? 229 LEU B N     1 
ATOM   4824 C CA    . LEU B 2 154 ? 68.553  -52.766 38.566  1.00 122.01 ? 229 LEU B CA    1 
ATOM   4825 C C     . LEU B 2 154 ? 69.446  -51.883 37.704  1.00 121.97 ? 229 LEU B C     1 
ATOM   4826 O O     . LEU B 2 154 ? 70.604  -51.638 38.039  1.00 122.66 ? 229 LEU B O     1 
ATOM   4827 C CB    . LEU B 2 154 ? 67.670  -51.882 39.431  1.00 122.60 ? 229 LEU B CB    1 
ATOM   4828 C CG    . LEU B 2 154 ? 66.462  -52.570 40.049  1.00 122.61 ? 229 LEU B CG    1 
ATOM   4829 C CD1   . LEU B 2 154 ? 65.896  -51.687 41.128  1.00 123.65 ? 229 LEU B CD1   1 
ATOM   4830 C CD2   . LEU B 2 154 ? 65.423  -52.854 38.986  1.00 121.64 ? 229 LEU B CD2   1 
ATOM   4831 N N     . LEU B 2 155 ? 68.882  -51.405 36.597  1.00 121.32 ? 230 LEU B N     1 
ATOM   4832 C CA    . LEU B 2 155 ? 69.557  -50.500 35.669  1.00 121.34 ? 230 LEU B CA    1 
ATOM   4833 C C     . LEU B 2 155 ? 68.536  -49.503 35.106  1.00 121.17 ? 230 LEU B C     1 
ATOM   4834 O O     . LEU B 2 155 ? 67.339  -49.779 35.118  1.00 120.85 ? 230 LEU B O     1 
ATOM   4835 C CB    . LEU B 2 155 ? 70.229  -51.287 34.542  1.00 120.91 ? 230 LEU B CB    1 
ATOM   4836 C CG    . LEU B 2 155 ? 71.465  -52.112 34.902  1.00 121.31 ? 230 LEU B CG    1 
ATOM   4837 C CD1   . LEU B 2 155 ? 71.929  -52.904 33.694  1.00 121.00 ? 230 LEU B CD1   1 
ATOM   4838 C CD2   . LEU B 2 155 ? 72.580  -51.218 35.425  1.00 122.22 ? 230 LEU B CD2   1 
ATOM   4839 N N     . PRO B 2 156 ? 68.997  -48.331 34.631  1.00 121.54 ? 231 PRO B N     1 
ATOM   4840 C CA    . PRO B 2 156 ? 68.057  -47.361 34.050  1.00 121.56 ? 231 PRO B CA    1 
ATOM   4841 C C     . PRO B 2 156 ? 67.433  -47.856 32.750  1.00 120.94 ? 231 PRO B C     1 
ATOM   4842 O O     . PRO B 2 156 ? 68.008  -48.724 32.097  1.00 120.59 ? 231 PRO B O     1 
ATOM   4843 C CB    . PRO B 2 156 ? 68.933  -46.133 33.792  1.00 122.23 ? 231 PRO B CB    1 
ATOM   4844 C CG    . PRO B 2 156 ? 70.315  -46.674 33.680  1.00 122.29 ? 231 PRO B CG    1 
ATOM   4845 C CD    . PRO B 2 156 ? 70.376  -47.816 34.645  1.00 122.14 ? 231 PRO B CD    1 
ATOM   4846 N N     . GLU B 2 157 ? 66.275  -47.310 32.386  1.00 121.01 ? 232 GLU B N     1 
ATOM   4847 C CA    . GLU B 2 157 ? 65.599  -47.696 31.151  1.00 120.74 ? 232 GLU B CA    1 
ATOM   4848 C C     . GLU B 2 157 ? 66.431  -47.296 29.934  1.00 120.95 ? 232 GLU B C     1 
ATOM   4849 O O     . GLU B 2 157 ? 66.653  -46.111 29.691  1.00 121.48 ? 232 GLU B O     1 
ATOM   4850 C CB    . GLU B 2 157 ? 64.206  -47.062 31.078  1.00 149.30 ? 232 GLU B CB    1 
ATOM   4851 C CG    . GLU B 2 157 ? 63.395  -47.476 29.855  1.00 149.31 ? 232 GLU B CG    1 
ATOM   4852 C CD    . GLU B 2 157 ? 61.957  -46.989 29.906  1.00 149.81 ? 232 GLU B CD    1 
ATOM   4853 O OE1   . GLU B 2 157 ? 61.178  -47.326 28.986  1.00 150.05 ? 232 GLU B OE1   1 
ATOM   4854 O OE2   . GLU B 2 157 ? 61.604  -46.270 30.865  1.00 150.15 ? 232 GLU B OE2   1 
ATOM   4855 N N     . PRO B 2 158 ? 66.892  -48.290 29.159  1.00 120.68 ? 233 PRO B N     1 
ATOM   4856 C CA    . PRO B 2 158 ? 67.803  -48.036 28.042  1.00 121.05 ? 233 PRO B CA    1 
ATOM   4857 C C     . PRO B 2 158 ? 67.086  -47.411 26.870  1.00 121.56 ? 233 PRO B C     1 
ATOM   4858 O O     . PRO B 2 158 ? 65.877  -47.596 26.734  1.00 121.57 ? 233 PRO B O     1 
ATOM   4859 C CB    . PRO B 2 158 ? 68.308  -49.431 27.677  1.00 120.79 ? 233 PRO B CB    1 
ATOM   4860 C CG    . PRO B 2 158 ? 67.177  -50.320 28.040  1.00 120.38 ? 233 PRO B CG    1 
ATOM   4861 C CD    . PRO B 2 158 ? 66.552  -49.719 29.273  1.00 120.22 ? 233 PRO B CD    1 
ATOM   4862 N N     . ASN B 2 159 ? 67.824  -46.683 26.040  1.00 122.16 ? 234 ASN B N     1 
ATOM   4863 C CA    . ASN B 2 159 ? 67.274  -46.134 24.807  1.00 122.92 ? 234 ASN B CA    1 
ATOM   4864 C C     . ASN B 2 159 ? 67.103  -47.232 23.760  1.00 123.13 ? 234 ASN B C     1 
ATOM   4865 O O     . ASN B 2 159 ? 67.951  -48.114 23.635  1.00 122.96 ? 234 ASN B O     1 
ATOM   4866 C CB    . ASN B 2 159 ? 68.170  -45.020 24.269  1.00 155.80 ? 234 ASN B CB    1 
ATOM   4867 C CG    . ASN B 2 159 ? 67.418  -44.042 23.383  1.00 156.73 ? 234 ASN B CG    1 
ATOM   4868 O OD1   . ASN B 2 159 ? 66.629  -44.438 22.521  1.00 157.16 ? 234 ASN B OD1   1 
ATOM   4869 N ND2   . ASN B 2 159 ? 67.649  -42.754 23.601  1.00 157.25 ? 234 ASN B ND2   1 
ATOM   4870 N N     . HIS B 2 160 ? 66.009  -47.174 23.006  1.00 123.71 ? 235 HIS B N     1 
ATOM   4871 C CA    . HIS B 2 160 ? 65.670  -48.249 22.081  1.00 124.14 ? 235 HIS B CA    1 
ATOM   4872 C C     . HIS B 2 160 ? 66.743  -48.426 21.013  1.00 124.90 ? 235 HIS B C     1 
ATOM   4873 O O     . HIS B 2 160 ? 66.902  -49.513 20.457  1.00 125.20 ? 235 HIS B O     1 
ATOM   4874 C CB    . HIS B 2 160 ? 64.314  -47.986 21.427  1.00 165.89 ? 235 HIS B CB    1 
ATOM   4875 C CG    . HIS B 2 160 ? 64.348  -46.899 20.405  1.00 167.12 ? 235 HIS B CG    1 
ATOM   4876 N ND1   . HIS B 2 160 ? 64.389  -47.153 19.050  1.00 168.42 ? 235 HIS B ND1   1 
ATOM   4877 C CD2   . HIS B 2 160 ? 64.370  -45.552 20.537  1.00 167.44 ? 235 HIS B CD2   1 
ATOM   4878 C CE1   . HIS B 2 160 ? 64.421  -46.010 18.390  1.00 169.47 ? 235 HIS B CE1   1 
ATOM   4879 N NE2   . HIS B 2 160 ? 64.415  -45.024 19.269  1.00 168.86 ? 235 HIS B NE2   1 
ATOM   4880 N N     . VAL B 2 161 ? 67.496  -47.362 20.752  1.00 125.35 ? 236 VAL B N     1 
ATOM   4881 C CA    . VAL B 2 161 ? 68.491  -47.375 19.687  1.00 126.32 ? 236 VAL B CA    1 
ATOM   4882 C C     . VAL B 2 161 ? 69.742  -48.158 20.047  1.00 125.87 ? 236 VAL B C     1 
ATOM   4883 O O     . VAL B 2 161 ? 70.419  -48.680 19.171  1.00 126.69 ? 236 VAL B O     1 
ATOM   4884 C CB    . VAL B 2 161 ? 68.909  -45.947 19.294  1.00 130.68 ? 236 VAL B CB    1 
ATOM   4885 C CG1   . VAL B 2 161 ? 67.728  -45.209 18.722  1.00 131.52 ? 236 VAL B CG1   1 
ATOM   4886 C CG2   . VAL B 2 161 ? 69.478  -45.200 20.486  1.00 129.86 ? 236 VAL B CG2   1 
ATOM   4887 N N     . MET B 2 162 ? 70.071  -48.192 21.329  1.00 124.78 ? 237 MET B N     1 
ATOM   4888 C CA    . MET B 2 162 ? 71.273  -48.864 21.806  1.00 124.47 ? 237 MET B CA    1 
ATOM   4889 C C     . MET B 2 162 ? 71.000  -50.254 22.362  1.00 123.78 ? 237 MET B C     1 
ATOM   4890 O O     . MET B 2 162 ? 71.805  -50.769 23.130  1.00 123.38 ? 237 MET B O     1 
ATOM   4891 C CB    . MET B 2 162 ? 72.016  -48.002 22.829  1.00 197.09 ? 237 MET B CB    1 
ATOM   4892 C CG    . MET B 2 162 ? 71.153  -47.310 23.856  1.00 196.44 ? 237 MET B CG    1 
ATOM   4893 S SD    . MET B 2 162 ? 71.255  -48.114 25.464  1.00 195.45 ? 237 MET B SD    1 
ATOM   4894 C CE    . MET B 2 162 ? 72.950  -47.761 25.923  1.00 195.89 ? 237 MET B CE    1 
ATOM   4895 N N     . LEU B 2 163 ? 69.828  -50.810 22.074  1.00 130.46 ? 238 LEU B N     1 
ATOM   4896 C CA    . LEU B 2 163 ? 69.445  -52.107 22.629  1.00 129.90 ? 238 LEU B CA    1 
ATOM   4897 C C     . LEU B 2 163 ? 70.223  -53.291 22.048  1.00 130.47 ? 238 LEU B C     1 
ATOM   4898 O O     . LEU B 2 163 ? 71.001  -53.936 22.748  1.00 130.11 ? 238 LEU B O     1 
ATOM   4899 C CB    . LEU B 2 163 ? 67.949  -52.347 22.418  1.00 136.02 ? 238 LEU B CB    1 
ATOM   4900 C CG    . LEU B 2 163 ? 66.989  -51.496 23.250  1.00 135.42 ? 238 LEU B CG    1 
ATOM   4901 C CD1   . LEU B 2 163 ? 65.547  -51.742 22.815  1.00 135.82 ? 238 LEU B CD1   1 
ATOM   4902 C CD2   . LEU B 2 163 ? 67.173  -51.761 24.750  1.00 134.41 ? 238 LEU B CD2   1 
ATOM   4903 N N     . ASN B 2 164 ? 70.012  -53.590 20.780  1.00 124.84 ? 239 ASN B N     1 
ATOM   4904 C CA    . ASN B 2 164 ? 70.632  -54.768 20.193  1.00 125.62 ? 239 ASN B CA    1 
ATOM   4905 C C     . ASN B 2 164 ? 72.154  -54.697 20.100  1.00 126.05 ? 239 ASN B C     1 
ATOM   4906 O O     . ASN B 2 164 ? 72.815  -55.722 19.948  1.00 126.56 ? 239 ASN B O     1 
ATOM   4907 C CB    . ASN B 2 164 ? 70.059  -55.013 18.804  1.00 184.51 ? 239 ASN B CB    1 
ATOM   4908 C CG    . ASN B 2 164 ? 68.582  -55.324 18.835  1.00 184.40 ? 239 ASN B CG    1 
ATOM   4909 O OD1   . ASN B 2 164 ? 68.061  -55.815 19.838  1.00 183.35 ? 239 ASN B OD1   1 
ATOM   4910 N ND2   . ASN B 2 164 ? 67.897  -55.054 17.727  1.00 185.68 ? 239 ASN B ND2   1 
ATOM   4911 N N     . HIS B 2 165 ? 72.708  -53.491 20.178  1.00 126.00 ? 240 HIS B N     1 
ATOM   4912 C CA    . HIS B 2 165 ? 74.139  -53.300 19.972  1.00 126.66 ? 240 HIS B CA    1 
ATOM   4913 C C     . HIS B 2 165 ? 74.962  -53.960 21.066  1.00 126.08 ? 240 HIS B C     1 
ATOM   4914 O O     . HIS B 2 165 ? 74.625  -53.869 22.241  1.00 124.98 ? 240 HIS B O     1 
ATOM   4915 C CB    . HIS B 2 165 ? 74.467  -51.812 19.893  1.00 126.80 ? 240 HIS B CB    1 
ATOM   4916 C CG    . HIS B 2 165 ? 73.795  -51.117 18.757  1.00 127.68 ? 240 HIS B CG    1 
ATOM   4917 N ND1   . HIS B 2 165 ? 74.442  -50.818 17.579  1.00 129.18 ? 240 HIS B ND1   1 
ATOM   4918 C CD2   . HIS B 2 165 ? 72.523  -50.680 18.607  1.00 127.47 ? 240 HIS B CD2   1 
ATOM   4919 C CE1   . HIS B 2 165 ? 73.601  -50.217 16.755  1.00 129.88 ? 240 HIS B CE1   1 
ATOM   4920 N NE2   . HIS B 2 165 ? 72.429  -50.120 17.355  1.00 128.87 ? 240 HIS B NE2   1 
ATOM   4921 N N     . LEU B 2 166 ? 76.039  -54.629 20.672  1.00 149.36 ? 241 LEU B N     1 
ATOM   4922 C CA    . LEU B 2 166 ? 76.925  -55.310 21.609  1.00 149.17 ? 241 LEU B CA    1 
ATOM   4923 C C     . LEU B 2 166 ? 77.804  -54.319 22.360  1.00 149.00 ? 241 LEU B C     1 
ATOM   4924 O O     . LEU B 2 166 ? 78.208  -53.307 21.796  1.00 149.57 ? 241 LEU B O     1 
ATOM   4925 C CB    . LEU B 2 166 ? 77.796  -56.318 20.861  1.00 128.18 ? 241 LEU B CB    1 
ATOM   4926 C CG    . LEU B 2 166 ? 78.754  -57.229 21.626  1.00 128.42 ? 241 LEU B CG    1 
ATOM   4927 C CD1   . LEU B 2 166 ? 78.909  -58.518 20.865  1.00 129.57 ? 241 LEU B CD1   1 
ATOM   4928 C CD2   . LEU B 2 166 ? 80.109  -56.585 21.800  1.00 129.12 ? 241 LEU B CD2   1 
ATOM   4929 N N     . TYR B 2 167 ? 78.100  -54.609 23.627  1.00 126.07 ? 242 TYR B N     1 
ATOM   4930 C CA    . TYR B 2 167 ? 79.083  -53.831 24.379  1.00 126.28 ? 242 TYR B CA    1 
ATOM   4931 C C     . TYR B 2 167 ? 80.115  -54.769 24.981  1.00 126.89 ? 242 TYR B C     1 
ATOM   4932 O O     . TYR B 2 167 ? 79.826  -55.505 25.923  1.00 126.36 ? 242 TYR B O     1 
ATOM   4933 C CB    . TYR B 2 167 ? 78.411  -53.002 25.479  1.00 125.27 ? 242 TYR B CB    1 
ATOM   4934 C CG    . TYR B 2 167 ? 77.586  -51.860 24.956  1.00 124.95 ? 242 TYR B CG    1 
ATOM   4935 C CD1   . TYR B 2 167 ? 78.187  -50.822 24.267  1.00 125.73 ? 242 TYR B CD1   1 
ATOM   4936 C CD2   . TYR B 2 167 ? 76.211  -51.816 25.150  1.00 124.03 ? 242 TYR B CD2   1 
ATOM   4937 C CE1   . TYR B 2 167 ? 77.453  -49.775 23.776  1.00 125.62 ? 242 TYR B CE1   1 
ATOM   4938 C CE2   . TYR B 2 167 ? 75.461  -50.767 24.662  1.00 123.93 ? 242 TYR B CE2   1 
ATOM   4939 C CZ    . TYR B 2 167 ? 76.090  -49.746 23.973  1.00 124.74 ? 242 TYR B CZ    1 
ATOM   4940 O OH    . TYR B 2 167 ? 75.360  -48.688 23.478  1.00 124.81 ? 242 TYR B OH    1 
ATOM   4941 N N     . ALA B 2 168 ? 81.330  -54.719 24.458  1.00 128.15 ? 243 ALA B N     1 
ATOM   4942 C CA    . ALA B 2 168 ? 82.387  -55.595 24.928  1.00 129.04 ? 243 ALA B CA    1 
ATOM   4943 C C     . ALA B 2 168 ? 83.271  -54.836 25.896  1.00 129.44 ? 243 ALA B C     1 
ATOM   4944 O O     . ALA B 2 168 ? 83.512  -53.643 25.719  1.00 129.63 ? 243 ALA B O     1 
ATOM   4945 C CB    . ALA B 2 168 ? 83.198  -56.131 23.765  1.00 286.44 ? 243 ALA B CB    1 
ATOM   4946 N N     . LEU B 2 169 ? 83.734  -55.529 26.930  1.00 129.72 ? 244 LEU B N     1 
ATOM   4947 C CA    . LEU B 2 169 ? 84.640  -54.950 27.911  1.00 130.47 ? 244 LEU B CA    1 
ATOM   4948 C C     . LEU B 2 169 ? 86.058  -55.382 27.578  1.00 132.22 ? 244 LEU B C     1 
ATOM   4949 O O     . LEU B 2 169 ? 86.291  -56.549 27.259  1.00 132.76 ? 244 LEU B O     1 
ATOM   4950 C CB    . LEU B 2 169 ? 84.244  -55.375 29.330  1.00 153.32 ? 244 LEU B CB    1 
ATOM   4951 C CG    . LEU B 2 169 ? 85.259  -55.469 30.477  1.00 154.56 ? 244 LEU B CG    1 
ATOM   4952 C CD1   . LEU B 2 169 ? 85.991  -54.178 30.765  1.00 155.41 ? 244 LEU B CD1   1 
ATOM   4953 C CD2   . LEU B 2 169 ? 84.538  -55.939 31.723  1.00 153.95 ? 244 LEU B CD2   1 
ATOM   4954 N N     . SER B 2 170 ? 86.993  -54.436 27.660  1.00 150.10 ? 245 SER B N     1 
ATOM   4955 C CA    . SER B 2 170 ? 88.384  -54.655 27.265  1.00 151.98 ? 245 SER B CA    1 
ATOM   4956 C C     . SER B 2 170 ? 88.936  -55.920 27.901  1.00 152.85 ? 245 SER B C     1 
ATOM   4957 O O     . SER B 2 170 ? 88.783  -56.129 29.106  1.00 152.64 ? 245 SER B O     1 
ATOM   4958 C CB    . SER B 2 170 ? 89.244  -53.451 27.664  1.00 215.17 ? 245 SER B CB    1 
ATOM   4959 O OG    . SER B 2 170 ? 89.124  -53.183 29.051  1.00 215.00 ? 245 SER B OG    1 
ATOM   4960 N N     . ILE B 2 171 ? 89.599  -56.760 27.108  1.00 153.62 ? 246 ILE B N     1 
ATOM   4961 C CA    . ILE B 2 171 ? 89.977  -58.051 27.650  1.00 154.43 ? 246 ILE B CA    1 
ATOM   4962 C C     . ILE B 2 171 ? 91.320  -57.872 28.325  1.00 156.34 ? 246 ILE B C     1 
ATOM   4963 O O     . ILE B 2 171 ? 92.381  -57.954 27.706  1.00 158.08 ? 246 ILE B O     1 
ATOM   4964 C CB    . ILE B 2 171 ? 90.066  -59.142 26.546  1.00 178.53 ? 246 ILE B CB    1 
ATOM   4965 C CG1   . ILE B 2 171 ? 90.541  -58.535 25.218  1.00 179.39 ? 246 ILE B CG1   1 
ATOM   4966 C CG2   . ILE B 2 171 ? 88.719  -59.821 26.353  1.00 176.93 ? 246 ILE B CG2   1 
ATOM   4967 C CD1   . ILE B 2 171 ? 90.780  -59.552 24.108  1.00 180.57 ? 246 ILE B CD1   1 
ATOM   4968 N N     . LYS B 2 172 ? 91.233  -57.688 29.637  1.00 190.71 ? 247 LYS B N     1 
ATOM   4969 C CA    . LYS B 2 172 ? 92.377  -57.473 30.508  1.00 192.60 ? 247 LYS B CA    1 
ATOM   4970 C C     . LYS B 2 172 ? 92.712  -58.776 31.218  1.00 193.64 ? 247 LYS B C     1 
ATOM   4971 O O     . LYS B 2 172 ? 93.508  -58.802 32.153  1.00 195.26 ? 247 LYS B O     1 
ATOM   4972 C CB    . LYS B 2 172 ? 92.101  -56.347 31.509  1.00 181.50 ? 247 LYS B CB    1 
ATOM   4973 C CG    . LYS B 2 172 ? 93.344  -55.557 31.930  1.00 183.60 ? 247 LYS B CG    1 
ATOM   4974 C CD    . LYS B 2 172 ? 93.815  -54.597 30.837  1.00 183.97 ? 247 LYS B CD    1 
ATOM   4975 C CE    . LYS B 2 172 ? 95.092  -53.864 31.246  1.00 186.29 ? 247 LYS B CE    1 
ATOM   4976 N NZ    . LYS B 2 172 ? 94.921  -53.058 32.490  1.00 186.45 ? 247 LYS B NZ    1 
ATOM   4977 N N     . ASP B 2 173 ? 92.024  -59.840 30.819  1.00 228.01 ? 248 ASP B N     1 
ATOM   4978 C CA    . ASP B 2 173 ? 92.211  -61.154 31.416  1.00 228.92 ? 248 ASP B CA    1 
ATOM   4979 C C     . ASP B 2 173 ? 92.262  -62.216 30.319  1.00 229.31 ? 248 ASP B C     1 
ATOM   4980 O O     . ASP B 2 173 ? 92.197  -61.896 29.130  1.00 229.00 ? 248 ASP B O     1 
ATOM   4981 C CB    . ASP B 2 173 ? 91.082  -61.447 32.411  1.00 218.64 ? 248 ASP B CB    1 
ATOM   4982 C CG    . ASP B 2 173 ? 91.510  -62.375 33.534  1.00 220.09 ? 248 ASP B CG    1 
ATOM   4983 O OD1   . ASP B 2 173 ? 92.293  -63.311 33.274  1.00 221.74 ? 248 ASP B OD1   1 
ATOM   4984 O OD2   . ASP B 2 173 ? 91.059  -62.168 34.682  1.00 219.74 ? 248 ASP B OD2   1 
ATOM   4985 N N     . SER B 2 174 ? 92.372  -63.479 30.720  1.00 153.67 ? 249 SER B N     1 
ATOM   4986 C CA    . SER B 2 174 ? 92.392  -64.587 29.771  1.00 154.28 ? 249 SER B CA    1 
ATOM   4987 C C     . SER B 2 174 ? 90.972  -65.006 29.414  1.00 152.24 ? 249 SER B C     1 
ATOM   4988 O O     . SER B 2 174 ? 90.769  -66.005 28.723  1.00 152.63 ? 249 SER B O     1 
ATOM   4989 C CB    . SER B 2 174 ? 93.164  -65.780 30.337  1.00 195.32 ? 249 SER B CB    1 
ATOM   4990 O OG    . SER B 2 174 ? 92.477  -66.353 31.435  1.00 194.64 ? 249 SER B OG    1 
ATOM   4991 N N     . VAL B 2 175 ? 89.992  -64.260 29.924  1.00 145.63 ? 250 VAL B N     1 
ATOM   4992 C CA    . VAL B 2 175 ? 88.585  -64.518 29.623  1.00 143.71 ? 250 VAL B CA    1 
ATOM   4993 C C     . VAL B 2 175 ? 87.912  -63.318 28.951  1.00 142.15 ? 250 VAL B C     1 
ATOM   4994 O O     . VAL B 2 175 ? 88.132  -62.165 29.323  1.00 141.85 ? 250 VAL B O     1 
ATOM   4995 C CB    . VAL B 2 175 ? 87.808  -64.908 30.894  1.00 165.85 ? 250 VAL B CB    1 
ATOM   4996 C CG1   . VAL B 2 175 ? 88.415  -66.159 31.491  1.00 167.53 ? 250 VAL B CG1   1 
ATOM   4997 C CG2   . VAL B 2 175 ? 87.826  -63.780 31.908  1.00 165.36 ? 250 VAL B CG2   1 
ATOM   4998 N N     . MET B 2 176 ? 87.108  -63.603 27.934  1.00 136.33 ? 251 MET B N     1 
ATOM   4999 C CA    . MET B 2 176 ? 86.447  -62.551 27.182  1.00 135.10 ? 251 MET B CA    1 
ATOM   5000 C C     . MET B 2 176 ? 85.173  -62.143 27.900  1.00 133.16 ? 251 MET B C     1 
ATOM   5001 O O     . MET B 2 176 ? 84.481  -62.979 28.482  1.00 132.64 ? 251 MET B O     1 
ATOM   5002 C CB    . MET B 2 176 ? 86.140  -63.008 25.755  1.00 143.60 ? 251 MET B CB    1 
ATOM   5003 C CG    . MET B 2 176 ? 85.829  -61.871 24.794  1.00 143.05 ? 251 MET B CG    1 
ATOM   5004 S SD    . MET B 2 176 ? 85.141  -62.452 23.235  1.00 143.44 ? 251 MET B SD    1 
ATOM   5005 C CE    . MET B 2 176 ? 86.335  -63.710 22.786  1.00 145.87 ? 251 MET B CE    1 
ATOM   5006 N N     . VAL B 2 177 ? 84.875  -60.851 27.866  1.00 132.25 ? 252 VAL B N     1 
ATOM   5007 C CA    . VAL B 2 177 ? 83.706  -60.318 28.547  1.00 130.59 ? 252 VAL B CA    1 
ATOM   5008 C C     . VAL B 2 177 ? 82.941  -59.366 27.643  1.00 129.62 ? 252 VAL B C     1 
ATOM   5009 O O     . VAL B 2 177 ? 83.477  -58.356 27.190  1.00 129.99 ? 252 VAL B O     1 
ATOM   5010 C CB    . VAL B 2 177 ? 84.105  -59.599 29.833  1.00 130.91 ? 252 VAL B CB    1 
ATOM   5011 C CG1   . VAL B 2 177 ? 84.344  -60.602 30.913  1.00 131.54 ? 252 VAL B CG1   1 
ATOM   5012 C CG2   . VAL B 2 177 ? 85.366  -58.797 29.603  1.00 132.16 ? 252 VAL B CG2   1 
ATOM   5013 N N     . LEU B 2 178 ? 81.689  -59.703 27.368  1.00 151.22 ? 253 LEU B N     1 
ATOM   5014 C CA    . LEU B 2 178 ? 80.880  -58.914 26.450  1.00 150.51 ? 253 LEU B CA    1 
ATOM   5015 C C     . LEU B 2 178 ? 79.395  -59.025 26.792  1.00 149.14 ? 253 LEU B C     1 
ATOM   5016 O O     . LEU B 2 178 ? 78.921  -60.089 27.191  1.00 148.97 ? 253 LEU B O     1 
ATOM   5017 C CB    . LEU B 2 178 ? 81.144  -59.348 25.002  1.00 128.82 ? 253 LEU B CB    1 
ATOM   5018 C CG    . LEU B 2 178 ? 80.824  -60.781 24.553  1.00 129.33 ? 253 LEU B CG    1 
ATOM   5019 C CD1   . LEU B 2 178 ? 80.888  -60.878 23.037  1.00 130.38 ? 253 LEU B CD1   1 
ATOM   5020 C CD2   . LEU B 2 178 ? 81.752  -61.819 25.174  1.00 130.32 ? 253 LEU B CD2   1 
ATOM   5021 N N     . SER B 2 179 ? 78.666  -57.923 26.625  1.00 125.65 ? 254 SER B N     1 
ATOM   5022 C CA    . SER B 2 179 ? 77.259  -57.851 27.013  1.00 124.47 ? 254 SER B CA    1 
ATOM   5023 C C     . SER B 2 179 ? 76.428  -57.136 25.966  1.00 124.19 ? 254 SER B C     1 
ATOM   5024 O O     . SER B 2 179 ? 76.972  -56.557 25.033  1.00 124.85 ? 254 SER B O     1 
ATOM   5025 C CB    . SER B 2 179 ? 77.106  -57.132 28.351  1.00 123.85 ? 254 SER B CB    1 
ATOM   5026 O OG    . SER B 2 179 ? 77.341  -55.742 28.210  1.00 123.85 ? 254 SER B OG    1 
ATOM   5027 N N     . ALA B 2 180 ? 75.108  -57.206 26.101  1.00 123.38 ? 255 ALA B N     1 
ATOM   5028 C CA    . ALA B 2 180 ? 74.207  -56.444 25.241  1.00 123.20 ? 255 ALA B CA    1 
ATOM   5029 C C     . ALA B 2 180 ? 72.874  -56.233 25.935  1.00 122.24 ? 255 ALA B C     1 
ATOM   5030 O O     . ALA B 2 180 ? 72.464  -57.069 26.735  1.00 121.85 ? 255 ALA B O     1 
ATOM   5031 C CB    . ALA B 2 180 ? 74.006  -57.154 23.924  1.00 187.00 ? 255 ALA B CB    1 
ATOM   5032 N N     . THR B 2 181 ? 72.164  -55.162 25.604  1.00 122.02 ? 256 THR B N     1 
ATOM   5033 C CA    . THR B 2 181 ? 70.903  -54.917 26.285  1.00 121.28 ? 256 THR B CA    1 
ATOM   5034 C C     . THR B 2 181 ? 69.726  -55.346 25.419  1.00 121.47 ? 256 THR B C     1 
ATOM   5035 O O     . THR B 2 181 ? 69.195  -54.550 24.655  1.00 121.76 ? 256 THR B O     1 
ATOM   5036 C CB    . THR B 2 181 ? 70.766  -53.416 26.615  1.00 121.08 ? 256 THR B CB    1 
ATOM   5037 O OG1   . THR B 2 181 ? 71.978  -52.946 27.215  1.00 121.25 ? 256 THR B OG1   1 
ATOM   5038 C CG2   . THR B 2 181 ? 69.595  -53.155 27.540  1.00 120.47 ? 256 THR B CG2   1 
ATOM   5039 N N     . HIS B 2 182 ? 69.215  -56.548 25.655  1.00 121.38 ? 257 HIS B N     1 
ATOM   5040 C CA    . HIS B 2 182 ? 68.136  -57.082 24.834  1.00 121.81 ? 257 HIS B CA    1 
ATOM   5041 C C     . HIS B 2 182 ? 66.804  -56.749 25.469  1.00 121.27 ? 257 HIS B C     1 
ATOM   5042 O O     . HIS B 2 182 ? 66.689  -56.737 26.689  1.00 120.60 ? 257 HIS B O     1 
ATOM   5043 C CB    . HIS B 2 182 ? 68.267  -58.590 24.664  1.00 149.52 ? 257 HIS B CB    1 
ATOM   5044 C CG    . HIS B 2 182 ? 69.531  -59.013 23.994  1.00 150.30 ? 257 HIS B CG    1 
ATOM   5045 N ND1   . HIS B 2 182 ? 69.627  -59.188 22.630  1.00 151.45 ? 257 HIS B ND1   1 
ATOM   5046 C CD2   . HIS B 2 182 ? 70.755  -59.296 24.498  1.00 150.30 ? 257 HIS B CD2   1 
ATOM   5047 C CE1   . HIS B 2 182 ? 70.856  -59.563 22.322  1.00 152.10 ? 257 HIS B CE1   1 
ATOM   5048 N NE2   . HIS B 2 182 ? 71.560  -59.637 23.438  1.00 151.40 ? 257 HIS B NE2   1 
ATOM   5049 N N     . ARG B 2 183 ? 65.793  -56.475 24.656  1.00 121.77 ? 258 ARG B N     1 
ATOM   5050 C CA    . ARG B 2 183 ? 64.496  -56.108 25.202  1.00 121.46 ? 258 ARG B CA    1 
ATOM   5051 C C     . ARG B 2 183 ? 63.537  -57.284 25.159  1.00 121.78 ? 258 ARG B C     1 
ATOM   5052 O O     . ARG B 2 183 ? 63.653  -58.174 24.315  1.00 122.55 ? 258 ARG B O     1 
ATOM   5053 C CB    . ARG B 2 183 ? 63.892  -54.905 24.464  1.00 130.09 ? 258 ARG B CB    1 
ATOM   5054 C CG    . ARG B 2 183 ? 63.246  -55.216 23.117  1.00 131.28 ? 258 ARG B CG    1 
ATOM   5055 C CD    . ARG B 2 183 ? 61.915  -54.484 22.957  1.00 131.72 ? 258 ARG B CD    1 
ATOM   5056 N NE    . ARG B 2 183 ? 62.039  -53.044 23.174  1.00 131.50 ? 258 ARG B NE    1 
ATOM   5057 C CZ    . ARG B 2 183 ? 61.022  -52.190 23.113  1.00 131.94 ? 258 ARG B CZ    1 
ATOM   5058 N NH1   . ARG B 2 183 ? 59.803  -52.633 22.836  1.00 132.65 ? 258 ARG B NH1   1 
ATOM   5059 N NH2   . ARG B 2 183 ? 61.219  -50.894 23.327  1.00 131.85 ? 258 ARG B NH2   1 
ATOM   5060 N N     . TYR B 2 184 ? 62.629  -57.297 26.127  1.00 139.25 ? 259 TYR B N     1 
ATOM   5061 C CA    . TYR B 2 184 ? 61.536  -58.253 26.188  1.00 139.63 ? 259 TYR B CA    1 
ATOM   5062 C C     . TYR B 2 184 ? 60.242  -57.480 25.977  1.00 140.05 ? 259 TYR B C     1 
ATOM   5063 O O     . TYR B 2 184 ? 60.290  -56.271 25.750  1.00 140.04 ? 259 TYR B O     1 
ATOM   5064 C CB    . TYR B 2 184 ? 61.540  -58.982 27.526  1.00 138.50 ? 259 TYR B CB    1 
ATOM   5065 C CG    . TYR B 2 184 ? 60.824  -60.307 27.519  1.00 139.02 ? 259 TYR B CG    1 
ATOM   5066 C CD1   . TYR B 2 184 ? 61.305  -61.374 26.774  1.00 139.64 ? 259 TYR B CD1   1 
ATOM   5067 C CD2   . TYR B 2 184 ? 59.677  -60.499 28.274  1.00 139.03 ? 259 TYR B CD2   1 
ATOM   5068 C CE1   . TYR B 2 184 ? 60.654  -62.594 26.774  1.00 140.27 ? 259 TYR B CE1   1 
ATOM   5069 C CE2   . TYR B 2 184 ? 59.021  -61.713 28.281  1.00 139.62 ? 259 TYR B CE2   1 
ATOM   5070 C CZ    . TYR B 2 184 ? 59.512  -62.756 27.530  1.00 140.23 ? 259 TYR B CZ    1 
ATOM   5071 O OH    . TYR B 2 184 ? 58.855  -63.964 27.538  1.00 140.98 ? 259 TYR B OH    1 
ATOM   5072 N N     . LYS B 2 185 ? 59.101  -58.158 26.065  1.00 122.63 ? 260 LYS B N     1 
ATOM   5073 C CA    . LYS B 2 185 ? 57.829  -57.567 25.652  1.00 123.41 ? 260 LYS B CA    1 
ATOM   5074 C C     . LYS B 2 185 ? 57.644  -56.140 26.177  1.00 123.00 ? 260 LYS B C     1 
ATOM   5075 O O     . LYS B 2 185 ? 57.545  -55.201 25.385  1.00 123.56 ? 260 LYS B O     1 
ATOM   5076 C CB    . LYS B 2 185 ? 56.662  -58.453 26.096  1.00 161.23 ? 260 LYS B CB    1 
ATOM   5077 C CG    . LYS B 2 185 ? 56.850  -59.935 25.776  1.00 161.67 ? 260 LYS B CG    1 
ATOM   5078 C CD    . LYS B 2 185 ? 55.515  -60.671 25.593  1.00 162.81 ? 260 LYS B CD    1 
ATOM   5079 C CE    . LYS B 2 185 ? 54.601  -60.548 26.812  1.00 162.46 ? 260 LYS B CE    1 
ATOM   5080 N NZ    . LYS B 2 185 ? 53.321  -61.305 26.650  1.00 163.69 ? 260 LYS B NZ    1 
ATOM   5081 N N     . LYS B 2 186 ? 57.518  -55.977 27.490  1.00 161.69 ? 261 LYS B N     1 
ATOM   5082 C CA    . LYS B 2 186 ? 57.629  -54.650 28.111  1.00 161.33 ? 261 LYS B CA    1 
ATOM   5083 C C     . LYS B 2 186 ? 58.913  -54.374 28.921  1.00 160.43 ? 261 LYS B C     1 
ATOM   5084 O O     . LYS B 2 186 ? 59.063  -53.289 29.481  1.00 160.28 ? 261 LYS B O     1 
ATOM   5085 C CB    . LYS B 2 186 ? 56.400  -54.396 28.981  1.00 170.36 ? 261 LYS B CB    1 
ATOM   5086 C CG    . LYS B 2 186 ? 55.121  -54.237 28.166  1.00 171.50 ? 261 LYS B CG    1 
ATOM   5087 C CD    . LYS B 2 186 ? 55.004  -52.831 27.603  1.00 172.01 ? 261 LYS B CD    1 
ATOM   5088 C CE    . LYS B 2 186 ? 54.515  -51.869 28.674  1.00 172.02 ? 261 LYS B CE    1 
ATOM   5089 N NZ    . LYS B 2 186 ? 54.537  -50.448 28.229  1.00 172.53 ? 261 LYS B NZ    1 
ATOM   5090 N N     . LYS B 2 187 ? 59.827  -55.339 28.994  1.00 120.60 ? 262 LYS B N     1 
ATOM   5091 C CA    . LYS B 2 187 ? 60.983  -55.227 29.890  1.00 119.96 ? 262 LYS B CA    1 
ATOM   5092 C C     . LYS B 2 187 ? 62.318  -55.226 29.143  1.00 119.87 ? 262 LYS B C     1 
ATOM   5093 O O     . LYS B 2 187 ? 62.395  -55.666 28.003  1.00 120.27 ? 262 LYS B O     1 
ATOM   5094 C CB    . LYS B 2 187 ? 60.974  -56.372 30.906  1.00 141.19 ? 262 LYS B CB    1 
ATOM   5095 C CG    . LYS B 2 187 ? 59.620  -56.638 31.558  1.00 141.47 ? 262 LYS B CG    1 
ATOM   5096 C CD    . LYS B 2 187 ? 59.162  -55.463 32.407  1.00 141.55 ? 262 LYS B CD    1 
ATOM   5097 C CE    . LYS B 2 187 ? 57.771  -55.694 32.974  1.00 142.05 ? 262 LYS B CE    1 
ATOM   5098 N NZ    . LYS B 2 187 ? 57.726  -56.867 33.887  1.00 142.02 ? 262 LYS B NZ    1 
ATOM   5099 N N     . TYR B 2 188 ? 63.370  -54.730 29.785  1.00 119.53 ? 263 TYR B N     1 
ATOM   5100 C CA    . TYR B 2 188 ? 64.704  -54.736 29.190  1.00 119.55 ? 263 TYR B CA    1 
ATOM   5101 C C     . TYR B 2 188 ? 65.693  -55.471 30.097  1.00 119.32 ? 263 TYR B C     1 
ATOM   5102 O O     . TYR B 2 188 ? 65.579  -55.400 31.322  1.00 119.16 ? 263 TYR B O     1 
ATOM   5103 C CB    . TYR B 2 188 ? 65.191  -53.308 28.939  1.00 119.67 ? 263 TYR B CB    1 
ATOM   5104 C CG    . TYR B 2 188 ? 64.231  -52.442 28.163  1.00 120.07 ? 263 TYR B CG    1 
ATOM   5105 C CD1   . TYR B 2 188 ? 63.246  -51.704 28.809  1.00 120.11 ? 263 TYR B CD1   1 
ATOM   5106 C CD2   . TYR B 2 188 ? 64.317  -52.348 26.787  1.00 120.61 ? 263 TYR B CD2   1 
ATOM   5107 C CE1   . TYR B 2 188 ? 62.363  -50.901 28.096  1.00 120.67 ? 263 TYR B CE1   1 
ATOM   5108 C CE2   . TYR B 2 188 ? 63.442  -51.551 26.065  1.00 121.21 ? 263 TYR B CE2   1 
ATOM   5109 C CZ    . TYR B 2 188 ? 62.466  -50.828 26.723  1.00 121.22 ? 263 TYR B CZ    1 
ATOM   5110 O OH    . TYR B 2 188 ? 61.592  -50.032 26.006  1.00 121.98 ? 263 TYR B OH    1 
ATOM   5111 N N     . VAL B 2 189 ? 66.658  -56.173 29.503  1.00 119.51 ? 264 VAL B N     1 
ATOM   5112 C CA    . VAL B 2 189 ? 67.687  -56.880 30.275  1.00 119.52 ? 264 VAL B CA    1 
ATOM   5113 C C     . VAL B 2 189 ? 69.077  -56.763 29.644  1.00 119.88 ? 264 VAL B C     1 
ATOM   5114 O O     . VAL B 2 189 ? 69.247  -56.954 28.444  1.00 120.24 ? 264 VAL B O     1 
ATOM   5115 C CB    . VAL B 2 189 ? 67.340  -58.383 30.449  1.00 119.63 ? 264 VAL B CB    1 
ATOM   5116 C CG1   . VAL B 2 189 ? 66.076  -58.541 31.270  1.00 119.41 ? 264 VAL B CG1   1 
ATOM   5117 C CG2   . VAL B 2 189 ? 67.181  -59.076 29.107  1.00 120.06 ? 264 VAL B CG2   1 
ATOM   5118 N N     . THR B 2 190 ? 70.073  -56.438 30.454  1.00 119.98 ? 265 THR B N     1 
ATOM   5119 C CA    . THR B 2 190 ? 71.443  -56.384 29.969  1.00 120.49 ? 265 THR B CA    1 
ATOM   5120 C C     . THR B 2 190 ? 72.198  -57.625 30.405  1.00 120.88 ? 265 THR B C     1 
ATOM   5121 O O     . THR B 2 190 ? 72.526  -57.764 31.577  1.00 120.98 ? 265 THR B O     1 
ATOM   5122 C CB    . THR B 2 190 ? 72.164  -55.150 30.494  1.00 120.65 ? 265 THR B CB    1 
ATOM   5123 O OG1   . THR B 2 190 ? 71.342  -54.002 30.278  1.00 120.36 ? 265 THR B OG1   1 
ATOM   5124 C CG2   . THR B 2 190 ? 73.500  -54.968 29.798  1.00 121.30 ? 265 THR B CG2   1 
ATOM   5125 N N     . THR B 2 191 ? 72.495  -58.513 29.464  1.00 127.32 ? 266 THR B N     1 
ATOM   5126 C CA    . THR B 2 191 ? 73.080  -59.805 29.802  1.00 127.84 ? 266 THR B CA    1 
ATOM   5127 C C     . THR B 2 191 ? 74.589  -59.829 29.572  1.00 128.67 ? 266 THR B C     1 
ATOM   5128 O O     . THR B 2 191 ? 75.052  -59.717 28.439  1.00 129.16 ? 266 THR B O     1 
ATOM   5129 C CB    . THR B 2 191 ? 72.433  -60.939 28.985  1.00 126.07 ? 266 THR B CB    1 
ATOM   5130 O OG1   . THR B 2 191 ? 71.029  -60.680 28.813  1.00 125.48 ? 266 THR B OG1   1 
ATOM   5131 C CG2   . THR B 2 191 ? 72.641  -62.281 29.679  1.00 126.48 ? 266 THR B CG2   1 
ATOM   5132 N N     . LEU B 2 192 ? 75.349  -59.988 30.652  1.00 123.01 ? 267 LEU B N     1 
ATOM   5133 C CA    . LEU B 2 192 ? 76.807  -60.057 30.593  1.00 124.01 ? 267 LEU B CA    1 
ATOM   5134 C C     . LEU B 2 192 ? 77.261  -61.508 30.496  1.00 124.83 ? 267 LEU B C     1 
ATOM   5135 O O     . LEU B 2 192 ? 76.622  -62.388 31.065  1.00 124.66 ? 267 LEU B O     1 
ATOM   5136 C CB    . LEU B 2 192 ? 77.436  -59.398 31.820  1.00 124.31 ? 267 LEU B CB    1 
ATOM   5137 C CG    . LEU B 2 192 ? 77.367  -57.879 31.975  1.00 123.97 ? 267 LEU B CG    1 
ATOM   5138 C CD1   . LEU B 2 192 ? 75.960  -57.399 32.263  1.00 122.92 ? 267 LEU B CD1   1 
ATOM   5139 C CD2   . LEU B 2 192 ? 78.305  -57.442 33.078  1.00 124.82 ? 267 LEU B CD2   1 
ATOM   5140 N N     . LEU B 2 193 ? 78.345  -61.763 29.765  1.00 125.85 ? 268 LEU B N     1 
ATOM   5141 C CA    . LEU B 2 193 ? 78.855  -63.126 29.602  1.00 126.88 ? 268 LEU B CA    1 
ATOM   5142 C C     . LEU B 2 193 ? 80.377  -63.207 29.706  1.00 128.25 ? 268 LEU B C     1 
ATOM   5143 O O     . LEU B 2 193 ? 81.096  -62.515 28.981  1.00 128.72 ? 268 LEU B O     1 
ATOM   5144 C CB    . LEU B 2 193 ? 78.396  -63.708 28.259  1.00 127.10 ? 268 LEU B CB    1 
ATOM   5145 C CG    . LEU B 2 193 ? 79.018  -65.018 27.757  1.00 128.49 ? 268 LEU B CG    1 
ATOM   5146 C CD1   . LEU B 2 193 ? 78.944  -66.135 28.784  1.00 128.79 ? 268 LEU B CD1   1 
ATOM   5147 C CD2   . LEU B 2 193 ? 78.329  -65.458 26.489  1.00 128.73 ? 268 LEU B CD2   1 
ATOM   5148 N N     . TYR B 2 194 ? 80.855  -64.069 30.604  1.00 129.05 ? 269 TYR B N     1 
ATOM   5149 C CA    . TYR B 2 194 ? 82.283  -64.345 30.743  1.00 130.65 ? 269 TYR B CA    1 
ATOM   5150 C C     . TYR B 2 194 ? 82.631  -65.667 30.060  1.00 131.82 ? 269 TYR B C     1 
ATOM   5151 O O     . TYR B 2 194 ? 82.293  -66.739 30.562  1.00 132.09 ? 269 TYR B O     1 
ATOM   5152 C CB    . TYR B 2 194 ? 82.679  -64.413 32.221  1.00 131.17 ? 269 TYR B CB    1 
ATOM   5153 C CG    . TYR B 2 194 ? 82.656  -63.096 32.967  1.00 130.62 ? 269 TYR B CG    1 
ATOM   5154 C CD1   . TYR B 2 194 ? 81.472  -62.406 33.174  1.00 129.10 ? 269 TYR B CD1   1 
ATOM   5155 C CD2   . TYR B 2 194 ? 83.820  -62.564 33.504  1.00 131.86 ? 269 TYR B CD2   1 
ATOM   5156 C CE1   . TYR B 2 194 ? 81.456  -61.209 33.867  1.00 128.82 ? 269 TYR B CE1   1 
ATOM   5157 C CE2   . TYR B 2 194 ? 83.813  -61.367 34.194  1.00 131.61 ? 269 TYR B CE2   1 
ATOM   5158 C CZ    . TYR B 2 194 ? 82.631  -60.697 34.372  1.00 130.09 ? 269 TYR B CZ    1 
ATOM   5159 O OH    . TYR B 2 194 ? 82.632  -59.511 35.064  1.00 130.05 ? 269 TYR B OH    1 
ATOM   5160 N N     . LYS B 2 195 ? 83.283  -65.583 28.904  1.00 132.66 ? 270 LYS B N     1 
ATOM   5161 C CA    . LYS B 2 195 ? 83.693  -66.764 28.142  1.00 134.08 ? 270 LYS B CA    1 
ATOM   5162 C C     . LYS B 2 195 ? 85.204  -66.796 27.935  1.00 135.94 ? 270 LYS B C     1 
ATOM   5163 O O     . LYS B 2 195 ? 85.758  -65.872 27.351  1.00 136.15 ? 270 LYS B O     1 
ATOM   5164 C CB    . LYS B 2 195 ? 82.969  -66.821 26.790  1.00 133.79 ? 270 LYS B CB    1 
ATOM   5165 C CG    . LYS B 2 195 ? 82.774  -68.240 26.250  1.00 134.90 ? 270 LYS B CG    1 
ATOM   5166 C CD    . LYS B 2 195 ? 81.798  -68.271 25.086  1.00 134.56 ? 270 LYS B CD    1 
ATOM   5167 C CE    . LYS B 2 195 ? 82.460  -67.827 23.795  1.00 135.69 ? 270 LYS B CE    1 
ATOM   5168 N NZ    . LYS B 2 195 ? 83.355  -68.882 23.242  1.00 137.90 ? 270 LYS B NZ    1 
ATOM   5169 N N     . PRO B 2 196 ? 85.880  -67.841 28.432  1.00 137.41 ? 271 PRO B N     1 
ATOM   5170 C CA    . PRO B 2 196 ? 87.327  -68.013 28.239  1.00 139.49 ? 271 PRO B CA    1 
ATOM   5171 C C     . PRO B 2 196 ? 87.754  -67.966 26.779  1.00 140.48 ? 271 PRO B C     1 
ATOM   5172 O O     . PRO B 2 196 ? 87.015  -68.454 25.928  1.00 140.23 ? 271 PRO B O     1 
ATOM   5173 C CB    . PRO B 2 196 ? 87.592  -69.401 28.812  1.00 140.85 ? 271 PRO B CB    1 
ATOM   5174 C CG    . PRO B 2 196 ? 86.531  -69.583 29.813  1.00 139.39 ? 271 PRO B CG    1 
ATOM   5175 C CD    . PRO B 2 196 ? 85.311  -68.923 29.246  1.00 137.36 ? 271 PRO B CD    1 
ATOM   5176 N N     . ILE B 2 197 ? 88.932  -67.402 26.515  1.00 197.51 ? 272 ILE B N     1 
ATOM   5177 C CA    . ILE B 2 197 ? 89.475  -67.256 25.164  1.00 198.74 ? 272 ILE B CA    1 
ATOM   5178 C C     . ILE B 2 197 ? 89.308  -68.505 24.295  1.00 199.99 ? 272 ILE B C     1 
ATOM   5179 O O     . ILE B 2 197 ? 89.481  -68.461 23.075  1.00 200.97 ? 272 ILE B O     1 
ATOM   5180 C CB    . ILE B 2 197 ? 90.975  -66.882 25.215  1.00 161.12 ? 272 ILE B CB    1 
ATOM   5181 C CG1   . ILE B 2 197 ? 91.718  -67.717 26.273  1.00 162.52 ? 272 ILE B CG1   1 
ATOM   5182 C CG2   . ILE B 2 197 ? 91.137  -65.400 25.517  1.00 160.14 ? 272 ILE B CG2   1 
ATOM   5183 C CD1   . ILE B 2 197 ? 92.102  -69.139 25.847  1.00 164.50 ? 272 ILE B CD1   1 
ATOM   5184 N N     . ASN C 3 2   ? 41.113  -68.014 54.759  1.00 318.46 ? 25  ASN G N     1 
ATOM   5185 C CA    . ASN C 3 2   ? 42.525  -67.671 54.888  1.00 313.21 ? 25  ASN G CA    1 
ATOM   5186 C C     . ASN C 3 2   ? 43.226  -67.655 53.531  1.00 309.94 ? 25  ASN G C     1 
ATOM   5187 O O     . ASN C 3 2   ? 43.924  -66.700 53.189  1.00 306.74 ? 25  ASN G O     1 
ATOM   5188 C CB    . ASN C 3 2   ? 43.231  -68.651 55.833  1.00 185.72 ? 25  ASN G CB    1 
ATOM   5189 C CG    . ASN C 3 2   ? 42.529  -68.781 57.177  1.00 189.32 ? 25  ASN G CG    1 
ATOM   5190 O OD1   . ASN C 3 2   ? 41.838  -67.865 57.622  1.00 191.45 ? 25  ASN G OD1   1 
ATOM   5191 N ND2   . ASN C 3 2   ? 42.707  -69.926 57.830  1.00 190.30 ? 25  ASN G ND2   1 
ATOM   5192 N N     . ASN C 3 3   ? 43.019  -68.717 52.758  1.00 190.66 ? 26  ASN G N     1 
ATOM   5193 C CA    . ASN C 3 3   ? 43.610  -68.853 51.431  1.00 188.20 ? 26  ASN G CA    1 
ATOM   5194 C C     . ASN C 3 3   ? 42.748  -68.161 50.379  1.00 190.17 ? 26  ASN G C     1 
ATOM   5195 O O     . ASN C 3 3   ? 43.002  -68.271 49.181  1.00 189.08 ? 26  ASN G O     1 
ATOM   5196 C CB    . ASN C 3 3   ? 43.795  -70.331 51.067  1.00 185.17 ? 26  ASN G CB    1 
ATOM   5197 C CG    . ASN C 3 3   ? 44.592  -71.102 52.108  1.00 183.79 ? 26  ASN G CG    1 
ATOM   5198 O OD1   . ASN C 3 3   ? 44.176  -72.173 52.553  1.00 186.68 ? 26  ASN G OD1   1 
ATOM   5199 N ND2   . ASN C 3 3   ? 45.744  -70.562 52.497  1.00 179.62 ? 26  ASN G ND2   1 
ATOM   5200 N N     . SER C 3 4   ? 41.705  -67.483 50.842  1.00 370.82 ? 27  SER G N     1 
ATOM   5201 C CA    . SER C 3 4   ? 40.731  -66.845 49.964  1.00 373.59 ? 27  SER G CA    1 
ATOM   5202 C C     . SER C 3 4   ? 41.343  -65.814 49.015  1.00 370.47 ? 27  SER G C     1 
ATOM   5203 O O     . SER C 3 4   ? 40.920  -65.700 47.863  1.00 371.71 ? 27  SER G O     1 
ATOM   5204 C CB    . SER C 3 4   ? 39.636  -66.181 50.805  1.00 250.69 ? 27  SER G CB    1 
ATOM   5205 O OG    . SER C 3 4   ? 38.574  -65.716 49.992  1.00 254.21 ? 27  SER G OG    1 
ATOM   5206 N N     . VAL C 3 5   ? 42.339  -65.072 49.490  1.00 238.74 ? 28  VAL G N     1 
ATOM   5207 C CA    . VAL C 3 5   ? 42.830  -63.914 48.746  1.00 236.40 ? 28  VAL G CA    1 
ATOM   5208 C C     . VAL C 3 5   ? 44.320  -63.973 48.385  1.00 231.37 ? 28  VAL G C     1 
ATOM   5209 O O     . VAL C 3 5   ? 44.671  -63.864 47.210  1.00 230.04 ? 28  VAL G O     1 
ATOM   5210 C CB    . VAL C 3 5   ? 42.526  -62.605 49.503  1.00 155.16 ? 28  VAL G CB    1 
ATOM   5211 C CG1   . VAL C 3 5   ? 41.024  -62.305 49.445  1.00 160.41 ? 28  VAL G CG1   1 
ATOM   5212 C CG2   . VAL C 3 5   ? 43.002  -62.664 50.943  1.00 154.03 ? 28  VAL G CG2   1 
ATOM   5213 N N     . TYR C 3 6   ? 45.192  -64.079 49.384  1.00 147.57 ? 29  TYR G N     1 
ATOM   5214 C CA    . TYR C 3 6   ? 46.630  -64.152 49.138  1.00 143.08 ? 29  TYR G CA    1 
ATOM   5215 C C     . TYR C 3 6   ? 47.021  -65.301 48.206  1.00 142.22 ? 29  TYR G C     1 
ATOM   5216 O O     . TYR C 3 6   ? 47.924  -65.151 47.383  1.00 139.43 ? 29  TYR G O     1 
ATOM   5217 C CB    . TYR C 3 6   ? 47.395  -64.286 50.457  1.00 176.17 ? 29  TYR G CB    1 
ATOM   5218 C CG    . TYR C 3 6   ? 47.677  -62.968 51.144  1.00 175.24 ? 29  TYR G CG    1 
ATOM   5219 C CD1   . TYR C 3 6   ? 48.385  -61.965 50.496  1.00 172.86 ? 29  TYR G CD1   1 
ATOM   5220 C CD2   . TYR C 3 6   ? 47.252  -62.734 52.447  1.00 177.02 ? 29  TYR G CD2   1 
ATOM   5221 C CE1   . TYR C 3 6   ? 48.652  -60.756 51.122  1.00 172.37 ? 29  TYR G CE1   1 
ATOM   5222 C CE2   . TYR C 3 6   ? 47.513  -61.528 53.085  1.00 176.52 ? 29  TYR G CE2   1 
ATOM   5223 C CZ    . TYR C 3 6   ? 48.214  -60.541 52.417  1.00 174.21 ? 29  TYR G CZ    1 
ATOM   5224 O OH    . TYR C 3 6   ? 48.476  -59.340 53.046  1.00 174.07 ? 29  TYR G OH    1 
ATOM   5225 N N     . THR C 3 7   ? 46.347  -66.442 48.336  1.00 145.17 ? 30  THR G N     1 
ATOM   5226 C CA    . THR C 3 7   ? 46.625  -67.604 47.489  1.00 145.07 ? 30  THR G CA    1 
ATOM   5227 C C     . THR C 3 7   ? 46.113  -67.388 46.063  1.00 146.45 ? 30  THR G C     1 
ATOM   5228 O O     . THR C 3 7   ? 46.757  -67.786 45.090  1.00 144.92 ? 30  THR G O     1 
ATOM   5229 C CB    . THR C 3 7   ? 45.993  -68.890 48.067  1.00 249.48 ? 30  THR G CB    1 
ATOM   5230 O OG1   . THR C 3 7   ? 46.367  -69.037 49.442  1.00 248.67 ? 30  THR G OG1   1 
ATOM   5231 C CG2   . THR C 3 7   ? 46.457  -70.114 47.289  1.00 249.27 ? 30  THR G CG2   1 
ATOM   5232 N N     . SER C 3 8   ? 44.953  -66.748 45.948  1.00 147.22 ? 31  SER G N     1 
ATOM   5233 C CA    . SER C 3 8   ? 44.356  -66.453 44.649  1.00 149.04 ? 31  SER G CA    1 
ATOM   5234 C C     . SER C 3 8   ? 45.160  -65.405 43.880  1.00 145.96 ? 31  SER G C     1 
ATOM   5235 O O     . SER C 3 8   ? 45.324  -65.499 42.661  1.00 145.80 ? 31  SER G O     1 
ATOM   5236 C CB    . SER C 3 8   ? 42.912  -65.976 44.821  1.00 20.00  ? 31  SER G CB    1 
ATOM   5237 O OG    . SER C 3 8   ? 42.861  -64.750 45.529  1.00 20.00  ? 31  SER G OG    1 
ATOM   5238 N N     . PHE C 3 9   ? 45.660  -64.411 44.605  1.00 182.97 ? 32  PHE G N     1 
ATOM   5239 C CA    . PHE C 3 9   ? 46.429  -63.325 44.014  1.00 180.34 ? 32  PHE G CA    1 
ATOM   5240 C C     . PHE C 3 9   ? 47.636  -63.829 43.233  1.00 177.12 ? 32  PHE G C     1 
ATOM   5241 O O     . PHE C 3 9   ? 47.908  -63.354 42.133  1.00 176.51 ? 32  PHE G O     1 
ATOM   5242 C CB    . PHE C 3 9   ? 46.881  -62.353 45.103  1.00 139.48 ? 32  PHE G CB    1 
ATOM   5243 C CG    . PHE C 3 9   ? 47.817  -61.283 44.619  1.00 136.71 ? 32  PHE G CG    1 
ATOM   5244 C CD1   . PHE C 3 9   ? 47.384  -60.311 43.730  1.00 138.11 ? 32  PHE G CD1   1 
ATOM   5245 C CD2   . PHE C 3 9   ? 49.125  -61.236 45.069  1.00 133.02 ? 32  PHE G CD2   1 
ATOM   5246 C CE1   . PHE C 3 9   ? 48.244  -59.319 43.287  1.00 135.90 ? 32  PHE G CE1   1 
ATOM   5247 C CE2   . PHE C 3 9   ? 49.989  -60.246 44.631  1.00 130.82 ? 32  PHE G CE2   1 
ATOM   5248 C CZ    . PHE C 3 9   ? 49.547  -59.286 43.738  1.00 132.27 ? 32  PHE G CZ    1 
ATOM   5249 N N     . MET C 3 10  ? 48.351  -64.796 43.798  1.00 154.13 ? 33  MET G N     1 
ATOM   5250 C CA    . MET C 3 10  ? 49.528  -65.355 43.141  1.00 151.36 ? 33  MET G CA    1 
ATOM   5251 C C     . MET C 3 10  ? 49.171  -66.130 41.872  1.00 153.21 ? 33  MET G C     1 
ATOM   5252 O O     . MET C 3 10  ? 49.924  -66.119 40.896  1.00 151.62 ? 33  MET G O     1 
ATOM   5253 C CB    . MET C 3 10  ? 50.295  -66.254 44.109  1.00 165.23 ? 33  MET G CB    1 
ATOM   5254 C CG    . MET C 3 10  ? 50.886  -65.495 45.277  1.00 163.06 ? 33  MET G CG    1 
ATOM   5255 S SD    . MET C 3 10  ? 51.785  -66.550 46.428  1.00 161.34 ? 33  MET G SD    1 
ATOM   5256 C CE    . MET C 3 10  ? 50.464  -67.520 47.159  1.00 165.35 ? 33  MET G CE    1 
ATOM   5257 N N     . LYS C 3 11  ? 48.019  -66.793 41.885  1.00 173.79 ? 34  LYS G N     1 
ATOM   5258 C CA    . LYS C 3 11  ? 47.568  -67.559 40.727  1.00 176.17 ? 34  LYS G CA    1 
ATOM   5259 C C     . LYS C 3 11  ? 47.041  -66.654 39.618  1.00 177.54 ? 34  LYS G C     1 
ATOM   5260 O O     . LYS C 3 11  ? 46.977  -67.061 38.458  1.00 178.74 ? 34  LYS G O     1 
ATOM   5261 C CB    . LYS C 3 11  ? 46.489  -68.565 41.134  1.00 145.18 ? 34  LYS G CB    1 
ATOM   5262 C CG    . LYS C 3 11  ? 46.995  -69.692 42.020  1.00 144.48 ? 34  LYS G CG    1 
ATOM   5263 C CD    . LYS C 3 11  ? 45.885  -70.660 42.405  1.00 148.78 ? 34  LYS G CD    1 
ATOM   5264 C CE    . LYS C 3 11  ? 46.429  -71.836 43.210  1.00 148.37 ? 34  LYS G CE    1 
ATOM   5265 N NZ    . LYS C 3 11  ? 45.362  -72.796 43.617  1.00 152.89 ? 34  LYS G NZ    1 
ATOM   5266 N N     . SER C 3 12  ? 46.671  -65.428 39.977  1.00 172.49 ? 35  SER G N     1 
ATOM   5267 C CA    . SER C 3 12  ? 46.071  -64.496 39.024  1.00 174.29 ? 35  SER G CA    1 
ATOM   5268 C C     . SER C 3 12  ? 47.097  -63.581 38.354  1.00 171.28 ? 35  SER G C     1 
ATOM   5269 O O     . SER C 3 12  ? 46.736  -62.736 37.534  1.00 172.58 ? 35  SER G O     1 
ATOM   5270 C CB    . SER C 3 12  ? 45.002  -63.646 39.716  1.00 247.28 ? 35  SER G CB    1 
ATOM   5271 O OG    . SER C 3 12  ? 45.563  -62.870 40.760  1.00 244.83 ? 35  SER G OG    1 
ATOM   5272 N N     . HIS C 3 13  ? 48.370  -63.750 38.696  1.00 156.67 ? 36  HIS G N     1 
ATOM   5273 C CA    . HIS C 3 13  ? 49.430  -62.931 38.113  1.00 153.91 ? 36  HIS G CA    1 
ATOM   5274 C C     . HIS C 3 13  ? 50.613  -63.776 37.671  1.00 151.46 ? 36  HIS G C     1 
ATOM   5275 O O     . HIS C 3 13  ? 50.944  -64.763 38.325  1.00 150.64 ? 36  HIS G O     1 
ATOM   5276 C CB    . HIS C 3 13  ? 49.895  -61.872 39.110  1.00 168.60 ? 36  HIS G CB    1 
ATOM   5277 C CG    . HIS C 3 13  ? 48.975  -60.699 39.208  1.00 170.88 ? 36  HIS G CG    1 
ATOM   5278 N ND1   . HIS C 3 13  ? 49.022  -59.643 38.325  1.00 171.33 ? 36  HIS G ND1   1 
ATOM   5279 C CD2   . HIS C 3 13  ? 47.975  -60.418 40.077  1.00 173.19 ? 36  HIS G CD2   1 
ATOM   5280 C CE1   . HIS C 3 13  ? 48.096  -58.758 38.648  1.00 173.81 ? 36  HIS G CE1   1 
ATOM   5281 N NE2   . HIS C 3 13  ? 47.447  -59.205 39.708  1.00 174.99 ? 36  HIS G NE2   1 
ATOM   5282 N N     . ARG C 3 14  ? 51.258  -63.385 36.570  1.00 157.55 ? 37  ARG G N     1 
ATOM   5283 C CA    . ARG C 3 14  ? 52.399  -64.144 36.062  1.00 155.58 ? 37  ARG G CA    1 
ATOM   5284 C C     . ARG C 3 14  ? 53.704  -63.703 36.715  1.00 151.94 ? 37  ARG G C     1 
ATOM   5285 O O     . ARG C 3 14  ? 53.739  -62.701 37.429  1.00 150.99 ? 37  ARG G O     1 
ATOM   5286 C CB    . ARG C 3 14  ? 52.526  -63.993 34.544  1.00 175.88 ? 37  ARG G CB    1 
ATOM   5287 C CG    . ARG C 3 14  ? 51.227  -63.723 33.807  1.00 179.52 ? 37  ARG G CG    1 
ATOM   5288 C CD    . ARG C 3 14  ? 51.142  -62.259 33.398  1.00 179.65 ? 37  ARG G CD    1 
ATOM   5289 N NE    . ARG C 3 14  ? 50.592  -62.072 32.054  1.00 182.39 ? 37  ARG G NE    1 
ATOM   5290 C CZ    . ARG C 3 14  ? 51.260  -62.303 30.924  1.00 182.16 ? 37  ARG G CZ    1 
ATOM   5291 N NH1   . ARG C 3 14  ? 52.507  -62.750 30.959  1.00 179.38 ? 37  ARG G NH1   1 
ATOM   5292 N NH2   . ARG C 3 14  ? 50.676  -62.095 29.752  1.00 184.99 ? 37  ARG G NH2   1 
ATOM   5293 N N     . CYS C 3 15  ? 54.784  -64.425 36.419  1.00 124.36 ? 38  CYS G N     1 
ATOM   5294 C CA    . CYS C 3 15  ? 56.109  -64.096 36.945  1.00 121.16 ? 38  CYS G CA    1 
ATOM   5295 C C     . CYS C 3 15  ? 56.661  -62.932 36.146  1.00 120.37 ? 38  CYS G C     1 
ATOM   5296 O O     . CYS C 3 15  ? 57.596  -62.252 36.562  1.00 118.17 ? 38  CYS G O     1 
ATOM   5297 C CB    . CYS C 3 15  ? 57.059  -65.296 36.867  1.00 120.06 ? 38  CYS G CB    1 
ATOM   5298 S SG    . CYS C 3 15  ? 56.460  -66.802 37.674  1.00 121.52 ? 38  CYS G SG    1 
ATOM   5299 N N     . TYR C 3 16  ? 56.059  -62.725 34.983  1.00 122.49 ? 39  TYR G N     1 
ATOM   5300 C CA    . TYR C 3 16  ? 56.405  -61.631 34.095  1.00 122.47 ? 39  TYR G CA    1 
ATOM   5301 C C     . TYR C 3 16  ? 56.343  -60.289 34.809  1.00 121.81 ? 39  TYR G C     1 
ATOM   5302 O O     . TYR C 3 16  ? 57.207  -59.439 34.613  1.00 120.50 ? 39  TYR G O     1 
ATOM   5303 C CB    . TYR C 3 16  ? 55.460  -61.638 32.889  1.00 156.26 ? 39  TYR G CB    1 
ATOM   5304 C CG    . TYR C 3 16  ? 55.667  -60.518 31.893  1.00 156.87 ? 39  TYR G CG    1 
ATOM   5305 C CD1   . TYR C 3 16  ? 55.065  -59.280 32.075  1.00 157.89 ? 39  TYR G CD1   1 
ATOM   5306 C CD2   . TYR C 3 16  ? 56.437  -60.711 30.758  1.00 156.83 ? 39  TYR G CD2   1 
ATOM   5307 C CE1   . TYR C 3 16  ? 55.244  -58.265 31.173  1.00 158.77 ? 39  TYR G CE1   1 
ATOM   5308 C CE2   . TYR C 3 16  ? 56.619  -59.699 29.850  1.00 157.66 ? 39  TYR G CE2   1 
ATOM   5309 C CZ    . TYR C 3 16  ? 56.020  -58.480 30.064  1.00 158.63 ? 39  TYR G CZ    1 
ATOM   5310 O OH    . TYR C 3 16  ? 56.197  -57.469 29.161  1.00 159.76 ? 39  TYR G OH    1 
ATOM   5311 N N     . ASP C 3 17  ? 55.311  -60.106 35.629  1.00 132.08 ? 40  ASP G N     1 
ATOM   5312 C CA    . ASP C 3 17  ? 55.088  -58.843 36.329  1.00 132.11 ? 40  ASP G CA    1 
ATOM   5313 C C     . ASP C 3 17  ? 56.157  -58.567 37.392  1.00 129.29 ? 40  ASP G C     1 
ATOM   5314 O O     . ASP C 3 17  ? 56.419  -57.416 37.753  1.00 128.93 ? 40  ASP G O     1 
ATOM   5315 C CB    . ASP C 3 17  ? 53.702  -58.836 36.980  1.00 132.21 ? 40  ASP G CB    1 
ATOM   5316 C CG    . ASP C 3 17  ? 52.585  -59.123 35.993  1.00 135.38 ? 40  ASP G CG    1 
ATOM   5317 O OD1   . ASP C 3 17  ? 52.648  -60.158 35.294  1.00 135.72 ? 40  ASP G OD1   1 
ATOM   5318 O OD2   . ASP C 3 17  ? 51.638  -58.309 35.927  1.00 137.81 ? 40  ASP G OD2   1 
ATOM   5319 N N     . LEU C 3 18  ? 56.767  -59.633 37.892  1.00 118.56 ? 41  LEU G N     1 
ATOM   5320 C CA    . LEU C 3 18  ? 57.819  -59.529 38.895  1.00 116.03 ? 41  LEU G CA    1 
ATOM   5321 C C     . LEU C 3 18  ? 59.115  -58.978 38.305  1.00 114.37 ? 41  LEU G C     1 
ATOM   5322 O O     . LEU C 3 18  ? 59.890  -58.328 39.003  1.00 112.90 ? 41  LEU G O     1 
ATOM   5323 C CB    . LEU C 3 18  ? 58.083  -60.898 39.528  1.00 127.68 ? 41  LEU G CB    1 
ATOM   5324 C CG    . LEU C 3 18  ? 57.138  -61.447 40.598  1.00 128.78 ? 41  LEU G CG    1 
ATOM   5325 C CD1   . LEU C 3 18  ? 57.374  -60.719 41.897  1.00 127.76 ? 41  LEU G CD1   1 
ATOM   5326 C CD2   . LEU C 3 18  ? 55.670  -61.363 40.193  1.00 131.78 ? 41  LEU G CD2   1 
ATOM   5327 N N     . ILE C 3 19  ? 59.344  -59.259 37.019  1.00 114.89 ? 42  ILE G N     1 
ATOM   5328 C CA    . ILE C 3 19  ? 60.563  -58.852 36.315  1.00 113.74 ? 42  ILE G CA    1 
ATOM   5329 C C     . ILE C 3 19  ? 60.661  -57.336 36.209  1.00 114.18 ? 42  ILE G C     1 
ATOM   5330 O O     . ILE C 3 19  ? 59.719  -56.681 35.771  1.00 116.21 ? 42  ILE G O     1 
ATOM   5331 C CB    . ILE C 3 19  ? 60.630  -59.462 34.896  1.00 114.81 ? 42  ILE G CB    1 
ATOM   5332 C CG1   . ILE C 3 19  ? 60.502  -60.981 34.965  1.00 114.86 ? 42  ILE G CG1   1 
ATOM   5333 C CG2   . ILE C 3 19  ? 61.929  -59.077 34.210  1.00 113.83 ? 42  ILE G CG2   1 
ATOM   5334 C CD1   . ILE C 3 19  ? 60.297  -61.632 33.632  1.00 116.58 ? 42  ILE G CD1   1 
ATOM   5335 N N     . PRO C 3 20  ? 61.801  -56.770 36.626  1.00 112.57 ? 43  PRO G N     1 
ATOM   5336 C CA    . PRO C 3 20  ? 61.989  -55.319 36.569  1.00 113.22 ? 43  PRO G CA    1 
ATOM   5337 C C     . PRO C 3 20  ? 61.952  -54.801 35.144  1.00 114.85 ? 43  PRO G C     1 
ATOM   5338 O O     . PRO C 3 20  ? 62.259  -55.556 34.223  1.00 114.83 ? 43  PRO G O     1 
ATOM   5339 C CB    . PRO C 3 20  ? 63.379  -55.116 37.170  1.00 111.24 ? 43  PRO G CB    1 
ATOM   5340 C CG    . PRO C 3 20  ? 63.640  -56.335 37.966  1.00 109.59 ? 43  PRO G CG    1 
ATOM   5341 C CD    . PRO C 3 20  ? 62.945  -57.448 37.254  1.00 110.36 ? 43  PRO G CD    1 
ATOM   5342 N N     . THR C 3 21  ? 61.591  -53.532 34.979  1.00 116.47 ? 44  THR G N     1 
ATOM   5343 C CA    . THR C 3 21  ? 61.532  -52.905 33.665  1.00 118.37 ? 44  THR G CA    1 
ATOM   5344 C C     . THR C 3 21  ? 62.903  -52.938 32.995  1.00 117.39 ? 44  THR G C     1 
ATOM   5345 O O     . THR C 3 21  ? 63.011  -53.233 31.806  1.00 118.32 ? 44  THR G O     1 
ATOM   5346 C CB    . THR C 3 21  ? 61.027  -51.446 33.755  1.00 131.46 ? 44  THR G CB    1 
ATOM   5347 O OG1   . THR C 3 21  ? 59.705  -51.423 34.311  1.00 132.81 ? 44  THR G OG1   1 
ATOM   5348 C CG2   . THR C 3 21  ? 60.995  -50.799 32.381  1.00 133.66 ? 44  THR G CG2   1 
ATOM   5349 N N     . SER C 3 22  ? 63.947  -52.638 33.760  1.00 115.76 ? 45  SER G N     1 
ATOM   5350 C CA    . SER C 3 22  ? 65.320  -52.768 33.275  1.00 114.84 ? 45  SER G CA    1 
ATOM   5351 C C     . SER C 3 22  ? 66.221  -53.343 34.360  1.00 112.44 ? 45  SER G C     1 
ATOM   5352 O O     . SER C 3 22  ? 66.229  -52.845 35.484  1.00 111.85 ? 45  SER G O     1 
ATOM   5353 C CB    . SER C 3 22  ? 65.864  -51.421 32.807  1.00 116.31 ? 45  SER G CB    1 
ATOM   5354 O OG    . SER C 3 22  ? 67.236  -51.533 32.477  1.00 115.54 ? 45  SER G OG    1 
ATOM   5355 N N     . SER C 3 23  ? 66.970  -54.392 34.032  1.00 121.90 ? 46  SER G N     1 
ATOM   5356 C CA    . SER C 3 23  ? 67.797  -55.085 35.024  1.00 119.85 ? 46  SER G CA    1 
ATOM   5357 C C     . SER C 3 23  ? 69.098  -55.621 34.431  1.00 119.36 ? 46  SER G C     1 
ATOM   5358 O O     . SER C 3 23  ? 69.288  -55.608 33.215  1.00 120.59 ? 46  SER G O     1 
ATOM   5359 C CB    . SER C 3 23  ? 67.011  -56.226 35.680  1.00 108.46 ? 46  SER G CB    1 
ATOM   5360 O OG    . SER C 3 23  ? 66.470  -57.111 34.717  1.00 109.34 ? 46  SER G OG    1 
ATOM   5361 N N     . LYS C 3 24  ? 69.999  -56.062 35.305  1.00 107.25 ? 47  LYS G N     1 
ATOM   5362 C CA    . LYS C 3 24  ? 71.290  -56.612 34.909  1.00 106.92 ? 47  LYS G CA    1 
ATOM   5363 C C     . LYS C 3 24  ? 71.352  -58.110 35.185  1.00 105.99 ? 47  LYS G C     1 
ATOM   5364 O O     . LYS C 3 24  ? 70.728  -58.596 36.123  1.00 105.10 ? 47  LYS G O     1 
ATOM   5365 C CB    . LYS C 3 24  ? 72.417  -55.887 35.646  1.00 106.38 ? 47  LYS G CB    1 
ATOM   5366 C CG    . LYS C 3 24  ? 73.816  -56.344 35.289  1.00 106.38 ? 47  LYS G CG    1 
ATOM   5367 C CD    . LYS C 3 24  ? 74.864  -55.343 35.749  1.00 106.62 ? 47  LYS G CD    1 
ATOM   5368 C CE    . LYS C 3 24  ? 74.908  -55.221 37.259  1.00 105.34 ? 47  LYS G CE    1 
ATOM   5369 N NZ    . LYS C 3 24  ? 75.811  -54.113 37.676  1.00 106.02 ? 47  LYS G NZ    1 
ATOM   5370 N N     . LEU C 3 25  ? 72.081  -58.840 34.349  1.00 147.36 ? 48  LEU G N     1 
ATOM   5371 C CA    . LEU C 3 25  ? 72.288  -60.267 34.547  1.00 146.89 ? 48  LEU G CA    1 
ATOM   5372 C C     . LEU C 3 25  ? 73.668  -60.676 34.058  1.00 147.32 ? 48  LEU G C     1 
ATOM   5373 O O     . LEU C 3 25  ? 74.094  -60.249 32.984  1.00 148.61 ? 48  LEU G O     1 
ATOM   5374 C CB    . LEU C 3 25  ? 71.218  -61.069 33.807  1.00 107.08 ? 48  LEU G CB    1 
ATOM   5375 C CG    . LEU C 3 25  ? 71.354  -62.589 33.811  1.00 107.26 ? 48  LEU G CG    1 
ATOM   5376 C CD1   . LEU C 3 25  ? 71.195  -63.121 35.216  1.00 105.88 ? 48  LEU G CD1   1 
ATOM   5377 C CD2   . LEU C 3 25  ? 70.318  -63.198 32.903  1.00 108.83 ? 48  LEU G CD2   1 
ATOM   5378 N N     . VAL C 3 26  ? 74.361  -61.515 34.825  1.00 105.65 ? 49  VAL G N     1 
ATOM   5379 C CA    . VAL C 3 26  ? 75.637  -62.054 34.362  1.00 106.41 ? 49  VAL G CA    1 
ATOM   5380 C C     . VAL C 3 26  ? 75.567  -63.573 34.276  1.00 106.87 ? 49  VAL G C     1 
ATOM   5381 O O     . VAL C 3 26  ? 74.870  -64.213 35.059  1.00 106.12 ? 49  VAL G O     1 
ATOM   5382 C CB    . VAL C 3 26  ? 76.821  -61.642 35.270  1.00 105.65 ? 49  VAL G CB    1 
ATOM   5383 C CG1   . VAL C 3 26  ? 76.756  -60.165 35.596  1.00 105.29 ? 49  VAL G CG1   1 
ATOM   5384 C CG2   . VAL C 3 26  ? 76.836  -62.448 36.532  1.00 104.46 ? 49  VAL G CG2   1 
ATOM   5385 N N     . VAL C 3 27  ? 76.262  -64.140 33.292  1.00 143.84 ? 50  VAL G N     1 
ATOM   5386 C CA    . VAL C 3 27  ? 76.310  -65.589 33.114  1.00 144.83 ? 50  VAL G CA    1 
ATOM   5387 C C     . VAL C 3 27  ? 77.751  -66.059 32.962  1.00 145.83 ? 50  VAL G C     1 
ATOM   5388 O O     . VAL C 3 27  ? 78.605  -65.324 32.464  1.00 146.45 ? 50  VAL G O     1 
ATOM   5389 C CB    . VAL C 3 27  ? 75.489  -66.055 31.887  1.00 111.18 ? 50  VAL G CB    1 
ATOM   5390 C CG1   . VAL C 3 27  ? 74.030  -65.711 32.063  1.00 110.54 ? 50  VAL G CG1   1 
ATOM   5391 C CG2   . VAL C 3 27  ? 76.008  -65.425 30.627  1.00 112.69 ? 50  VAL G CG2   1 
ATOM   5392 N N     . PHE C 3 28  ? 78.019  -67.281 33.411  1.00 140.49 ? 51  PHE G N     1 
ATOM   5393 C CA    . PHE C 3 28  ? 79.361  -67.846 33.348  1.00 141.75 ? 51  PHE G CA    1 
ATOM   5394 C C     . PHE C 3 28  ? 79.375  -69.114 32.503  1.00 144.13 ? 51  PHE G C     1 
ATOM   5395 O O     . PHE C 3 28  ? 78.488  -69.958 32.621  1.00 144.40 ? 51  PHE G O     1 
ATOM   5396 C CB    . PHE C 3 28  ? 79.894  -68.152 34.756  1.00 113.12 ? 51  PHE G CB    1 
ATOM   5397 C CG    . PHE C 3 28  ? 80.021  -66.942 35.639  1.00 111.17 ? 51  PHE G CG    1 
ATOM   5398 C CD1   . PHE C 3 28  ? 80.443  -65.724 35.126  1.00 111.23 ? 51  PHE G CD1   1 
ATOM   5399 C CD2   . PHE C 3 28  ? 79.711  -67.021 36.982  1.00 109.58 ? 51  PHE G CD2   1 
ATOM   5400 C CE1   . PHE C 3 28  ? 80.552  -64.611 35.939  1.00 109.81 ? 51  PHE G CE1   1 
ATOM   5401 C CE2   . PHE C 3 28  ? 79.818  -65.915 37.796  1.00 108.11 ? 51  PHE G CE2   1 
ATOM   5402 C CZ    . PHE C 3 28  ? 80.239  -64.708 37.274  1.00 108.25 ? 51  PHE G CZ    1 
ATOM   5403 N N     . ASP C 3 29  ? 80.385  -69.237 31.646  1.00 116.53 ? 52  ASP G N     1 
ATOM   5404 C CA    . ASP C 3 29  ? 80.622  -70.468 30.900  1.00 119.24 ? 52  ASP G CA    1 
ATOM   5405 C C     . ASP C 3 29  ? 81.204  -71.538 31.830  1.00 119.66 ? 52  ASP G C     1 
ATOM   5406 O O     . ASP C 3 29  ? 81.984  -71.232 32.729  1.00 118.60 ? 52  ASP G O     1 
ATOM   5407 C CB    . ASP C 3 29  ? 81.562  -70.202 29.718  1.00 156.13 ? 52  ASP G CB    1 
ATOM   5408 C CG    . ASP C 3 29  ? 81.619  -71.362 28.731  1.00 159.33 ? 52  ASP G CG    1 
ATOM   5409 O OD1   . ASP C 3 29  ? 80.876  -72.347 28.918  1.00 159.79 ? 52  ASP G OD1   1 
ATOM   5410 O OD2   . ASP C 3 29  ? 82.399  -71.281 27.756  1.00 161.65 ? 52  ASP G OD2   1 
ATOM   5411 N N     . THR C 3 30  ? 80.824  -72.792 31.617  1.00 121.48 ? 53  THR G N     1 
ATOM   5412 C CA    . THR C 3 30  ? 81.299  -73.874 32.467  1.00 122.29 ? 53  THR G CA    1 
ATOM   5413 C C     . THR C 3 30  ? 82.812  -74.060 32.344  1.00 124.10 ? 53  THR G C     1 
ATOM   5414 O O     . THR C 3 30  ? 83.440  -74.663 33.211  1.00 124.48 ? 53  THR G O     1 
ATOM   5415 C CB    . THR C 3 30  ? 80.595  -75.206 32.136  1.00 147.78 ? 53  THR G CB    1 
ATOM   5416 O OG1   . THR C 3 30  ? 80.814  -75.536 30.760  1.00 150.68 ? 53  THR G OG1   1 
ATOM   5417 C CG2   . THR C 3 30  ? 79.103  -75.096 32.387  1.00 146.26 ? 53  THR G CG2   1 
ATOM   5418 N N     . SER C 3 31  ? 83.391  -73.538 31.266  1.00 137.51 ? 54  SER G N     1 
ATOM   5419 C CA    . SER C 3 31  ? 84.829  -73.653 31.033  1.00 139.65 ? 54  SER G CA    1 
ATOM   5420 C C     . SER C 3 31  ? 85.611  -72.618 31.850  1.00 137.73 ? 54  SER G C     1 
ATOM   5421 O O     . SER C 3 31  ? 86.831  -72.706 31.993  1.00 139.26 ? 54  SER G O     1 
ATOM   5422 C CB    . SER C 3 31  ? 85.145  -73.510 29.534  1.00 163.59 ? 54  SER G CB    1 
ATOM   5423 O OG    . SER C 3 31  ? 84.648  -72.295 28.995  1.00 162.05 ? 54  SER G OG    1 
ATOM   5424 N N     . LEU C 3 32  ? 84.899  -71.640 32.393  1.00 123.04 ? 55  LEU G N     1 
ATOM   5425 C CA    . LEU C 3 32  ? 85.529  -70.580 33.171  1.00 121.33 ? 55  LEU G CA    1 
ATOM   5426 C C     . LEU C 3 32  ? 86.005  -71.113 34.518  1.00 120.76 ? 55  LEU G C     1 
ATOM   5427 O O     . LEU C 3 32  ? 85.386  -72.017 35.077  1.00 120.46 ? 55  LEU G O     1 
ATOM   5428 C CB    . LEU C 3 32  ? 84.548  -69.421 33.360  1.00 118.16 ? 55  LEU G CB    1 
ATOM   5429 C CG    . LEU C 3 32  ? 84.944  -68.229 34.229  1.00 116.28 ? 55  LEU G CG    1 
ATOM   5430 C CD1   . LEU C 3 32  ? 86.203  -67.596 33.702  1.00 118.01 ? 55  LEU G CD1   1 
ATOM   5431 C CD2   . LEU C 3 32  ? 83.815  -67.209 34.290  1.00 114.08 ? 55  LEU G CD2   1 
ATOM   5432 N N     . GLN C 3 33  ? 87.102  -70.565 35.039  1.00 138.88 ? 56  GLN G N     1 
ATOM   5433 C CA    . GLN C 3 33  ? 87.611  -70.968 36.352  1.00 138.48 ? 56  GLN G CA    1 
ATOM   5434 C C     . GLN C 3 33  ? 86.721  -70.468 37.487  1.00 135.37 ? 56  GLN G C     1 
ATOM   5435 O O     . GLN C 3 33  ? 86.056  -69.444 37.352  1.00 133.53 ? 56  GLN G O     1 
ATOM   5436 C CB    . GLN C 3 33  ? 89.036  -70.460 36.559  1.00 180.14 ? 56  GLN G CB    1 
ATOM   5437 C CG    . GLN C 3 33  ? 90.063  -71.125 35.665  1.00 183.72 ? 56  GLN G CG    1 
ATOM   5438 C CD    . GLN C 3 33  ? 91.483  -70.901 36.147  1.00 185.38 ? 56  GLN G CD    1 
ATOM   5439 O OE1   . GLN C 3 33  ? 91.711  -70.613 37.323  1.00 184.08 ? 56  GLN G OE1   1 
ATOM   5440 N NE2   . GLN C 3 33  ? 92.445  -71.028 35.239  1.00 188.52 ? 56  GLN G NE2   1 
ATOM   5441 N N     . VAL C 3 34  ? 86.717  -71.183 38.609  1.00 116.64 ? 57  VAL G N     1 
ATOM   5442 C CA    . VAL C 3 34  ? 85.853  -70.815 39.729  1.00 114.03 ? 57  VAL G CA    1 
ATOM   5443 C C     . VAL C 3 34  ? 86.324  -69.526 40.407  1.00 112.62 ? 57  VAL G C     1 
ATOM   5444 O O     . VAL C 3 34  ? 85.509  -68.686 40.791  1.00 110.50 ? 57  VAL G O     1 
ATOM   5445 C CB    . VAL C 3 34  ? 85.766  -71.950 40.778  1.00 118.82 ? 57  VAL G CB    1 
ATOM   5446 C CG1   . VAL C 3 34  ? 85.046  -73.152 40.201  1.00 120.13 ? 57  VAL G CG1   1 
ATOM   5447 C CG2   . VAL C 3 34  ? 87.147  -72.355 41.259  1.00 120.73 ? 57  VAL G CG2   1 
ATOM   5448 N N     . LYS C 3 35  ? 87.641  -69.372 40.531  1.00 120.06 ? 58  LYS G N     1 
ATOM   5449 C CA    . LYS C 3 35  ? 88.232  -68.207 41.176  1.00 119.34 ? 58  LYS G CA    1 
ATOM   5450 C C     . LYS C 3 35  ? 87.801  -66.930 40.475  1.00 118.31 ? 58  LYS G C     1 
ATOM   5451 O O     . LYS C 3 35  ? 87.378  -65.977 41.127  1.00 116.62 ? 58  LYS G O     1 
ATOM   5452 C CB    . LYS C 3 35  ? 89.759  -68.313 41.181  1.00 168.17 ? 58  LYS G CB    1 
ATOM   5453 C CG    . LYS C 3 35  ? 90.470  -67.130 41.822  1.00 167.97 ? 58  LYS G CG    1 
ATOM   5454 C CD    . LYS C 3 35  ? 91.934  -67.082 41.404  1.00 170.88 ? 58  LYS G CD    1 
ATOM   5455 C CE    . LYS C 3 35  ? 92.670  -65.914 42.049  1.00 171.10 ? 58  LYS G CE    1 
ATOM   5456 N NZ    . LYS C 3 35  ? 94.107  -65.855 41.640  1.00 174.28 ? 58  LYS G NZ    1 
ATOM   5457 N N     . LYS C 3 36  ? 87.899  -66.934 39.144  1.00 127.44 ? 59  LYS G N     1 
ATOM   5458 C CA    . LYS C 3 36  ? 87.543  -65.784 38.309  1.00 127.00 ? 59  LYS G CA    1 
ATOM   5459 C C     . LYS C 3 36  ? 86.046  -65.491 38.357  1.00 124.77 ? 59  LYS G C     1 
ATOM   5460 O O     . LYS C 3 36  ? 85.625  -64.335 38.302  1.00 123.78 ? 59  LYS G O     1 
ATOM   5461 C CB    . LYS C 3 36  ? 87.973  -66.019 36.857  1.00 172.70 ? 59  LYS G CB    1 
ATOM   5462 C CG    . LYS C 3 36  ? 89.440  -66.348 36.687  1.00 175.39 ? 59  LYS G CG    1 
ATOM   5463 C CD    . LYS C 3 36  ? 89.714  -66.890 35.300  1.00 177.85 ? 59  LYS G CD    1 
ATOM   5464 C CE    . LYS C 3 36  ? 91.082  -67.549 35.234  1.00 180.84 ? 59  LYS G CE    1 
ATOM   5465 N NZ    . LYS C 3 36  ? 91.356  -68.169 33.905  1.00 183.62 ? 59  LYS G NZ    1 
ATOM   5466 N N     . ALA C 3 37  ? 85.246  -66.546 38.461  1.00 110.57 ? 60  ALA G N     1 
ATOM   5467 C CA    . ALA C 3 37  ? 83.800  -66.402 38.492  1.00 108.85 ? 60  ALA G CA    1 
ATOM   5468 C C     . ALA C 3 37  ? 83.350  -65.678 39.759  1.00 106.85 ? 60  ALA G C     1 
ATOM   5469 O O     . ALA C 3 37  ? 82.468  -64.822 39.714  1.00 105.66 ? 60  ALA G O     1 
ATOM   5470 C CB    . ALA C 3 37  ? 83.132  -67.763 38.386  1.00 122.80 ? 60  ALA G CB    1 
ATOM   5471 N N     . PHE C 3 38  ? 83.971  -66.013 40.885  1.00 107.46 ? 61  PHE G N     1 
ATOM   5472 C CA    . PHE C 3 38  ? 83.597  -65.413 42.162  1.00 105.89 ? 61  PHE G CA    1 
ATOM   5473 C C     . PHE C 3 38  ? 84.010  -63.945 42.246  1.00 105.68 ? 61  PHE G C     1 
ATOM   5474 O O     . PHE C 3 38  ? 83.309  -63.135 42.847  1.00 104.44 ? 61  PHE G O     1 
ATOM   5475 C CB    . PHE C 3 38  ? 84.208  -66.200 43.319  1.00 113.01 ? 61  PHE G CB    1 
ATOM   5476 C CG    . PHE C 3 38  ? 83.614  -67.572 43.499  1.00 113.21 ? 61  PHE G CG    1 
ATOM   5477 C CD1   . PHE C 3 38  ? 82.242  -67.759 43.529  1.00 112.11 ? 61  PHE G CD1   1 
ATOM   5478 C CD2   . PHE C 3 38  ? 84.434  -68.680 43.628  1.00 114.86 ? 61  PHE G CD2   1 
ATOM   5479 C CE1   . PHE C 3 38  ? 81.703  -69.029 43.694  1.00 112.67 ? 61  PHE G CE1   1 
ATOM   5480 C CE2   . PHE C 3 38  ? 83.900  -69.948 43.792  1.00 115.43 ? 61  PHE G CE2   1 
ATOM   5481 C CZ    . PHE C 3 38  ? 82.535  -70.122 43.824  1.00 114.34 ? 61  PHE G CZ    1 
ATOM   5482 N N     . PHE C 3 39  ? 85.140  -63.600 41.642  1.00 127.14 ? 62  PHE G N     1 
ATOM   5483 C CA    . PHE C 3 39  ? 85.568  -62.207 41.599  1.00 127.44 ? 62  PHE G CA    1 
ATOM   5484 C C     . PHE C 3 39  ? 84.666  -61.374 40.687  1.00 127.00 ? 62  PHE G C     1 
ATOM   5485 O O     . PHE C 3 39  ? 84.495  -60.173 40.893  1.00 126.77 ? 62  PHE G O     1 
ATOM   5486 C CB    . PHE C 3 39  ? 87.019  -62.108 41.131  1.00 135.63 ? 62  PHE G CB    1 
ATOM   5487 C CG    . PHE C 3 39  ? 88.019  -62.515 42.169  1.00 136.36 ? 62  PHE G CG    1 
ATOM   5488 C CD1   . PHE C 3 39  ? 87.991  -61.950 43.426  1.00 135.54 ? 62  PHE G CD1   1 
ATOM   5489 C CD2   . PHE C 3 39  ? 88.988  -63.464 41.886  1.00 138.17 ? 62  PHE G CD2   1 
ATOM   5490 C CE1   . PHE C 3 39  ? 88.907  -62.324 44.383  1.00 136.43 ? 62  PHE G CE1   1 
ATOM   5491 C CE2   . PHE C 3 39  ? 89.912  -63.839 42.843  1.00 139.12 ? 62  PHE G CE2   1 
ATOM   5492 C CZ    . PHE C 3 39  ? 89.874  -63.265 44.091  1.00 138.22 ? 62  PHE G CZ    1 
ATOM   5493 N N     . ALA C 3 40  ? 84.096  -62.019 39.674  1.00 154.32 ? 63  ALA G N     1 
ATOM   5494 C CA    . ALA C 3 40  ? 83.215  -61.334 38.737  1.00 154.18 ? 63  ALA G CA    1 
ATOM   5495 C C     . ALA C 3 40  ? 81.900  -60.990 39.415  1.00 152.43 ? 63  ALA G C     1 
ATOM   5496 O O     . ALA C 3 40  ? 81.225  -60.028 39.048  1.00 152.29 ? 63  ALA G O     1 
ATOM   5497 C CB    . ALA C 3 40  ? 82.971  -62.190 37.505  1.00 330.90 ? 63  ALA G CB    1 
ATOM   5498 N N     . LEU C 3 41  ? 81.541  -61.784 40.412  1.00 103.62 ? 64  LEU G N     1 
ATOM   5499 C CA    . LEU C 3 41  ? 80.307  -61.557 41.139  1.00 102.23 ? 64  LEU G CA    1 
ATOM   5500 C C     . LEU C 3 41  ? 80.362  -60.249 41.927  1.00 101.87 ? 64  LEU G C     1 
ATOM   5501 O O     . LEU C 3 41  ? 79.409  -59.467 41.913  1.00 101.46 ? 64  LEU G O     1 
ATOM   5502 C CB    . LEU C 3 41  ? 80.019  -62.731 42.076  1.00 101.56 ? 64  LEU G CB    1 
ATOM   5503 C CG    . LEU C 3 41  ? 79.504  -64.037 41.468  1.00 101.96 ? 64  LEU G CG    1 
ATOM   5504 C CD1   . LEU C 3 41  ? 79.700  -65.197 42.427  1.00 101.93 ? 64  LEU G CD1   1 
ATOM   5505 C CD2   . LEU C 3 41  ? 78.039  -63.899 41.113  1.00 101.45 ? 64  LEU G CD2   1 
ATOM   5506 N N     . VAL C 3 42  ? 81.477  -60.006 42.608  1.00 131.76 ? 65  VAL G N     1 
ATOM   5507 C CA    . VAL C 3 42  ? 81.576  -58.838 43.477  1.00 131.72 ? 65  VAL G CA    1 
ATOM   5508 C C     . VAL C 3 42  ? 81.720  -57.551 42.673  1.00 132.77 ? 65  VAL G C     1 
ATOM   5509 O O     . VAL C 3 42  ? 81.264  -56.491 43.103  1.00 132.81 ? 65  VAL G O     1 
ATOM   5510 C CB    . VAL C 3 42  ? 82.752  -58.955 44.469  1.00 102.79 ? 65  VAL G CB    1 
ATOM   5511 C CG1   . VAL C 3 42  ? 82.551  -60.149 45.385  1.00 101.96 ? 65  VAL G CG1   1 
ATOM   5512 C CG2   . VAL C 3 42  ? 84.079  -59.052 43.736  1.00 104.34 ? 65  VAL G CG2   1 
ATOM   5513 N N     . THR C 3 43  ? 82.342  -57.639 41.502  1.00 104.45 ? 66  THR G N     1 
ATOM   5514 C CA    . THR C 3 43  ? 82.523  -56.458 40.669  1.00 105.79 ? 66  THR G CA    1 
ATOM   5515 C C     . THR C 3 43  ? 81.194  -56.031 40.050  1.00 105.38 ? 66  THR G C     1 
ATOM   5516 O O     . THR C 3 43  ? 80.988  -54.851 39.769  1.00 106.29 ? 66  THR G O     1 
ATOM   5517 C CB    . THR C 3 43  ? 83.561  -56.692 39.550  1.00 123.84 ? 66  THR G CB    1 
ATOM   5518 O OG1   . THR C 3 43  ? 83.227  -57.876 38.821  1.00 123.49 ? 66  THR G OG1   1 
ATOM   5519 C CG2   . THR C 3 43  ? 84.959  -56.844 40.132  1.00 124.85 ? 66  THR G CG2   1 
ATOM   5520 N N     . ASN C 3 44  ? 80.307  -56.995 39.815  1.00 104.33 ? 67  ASN G N     1 
ATOM   5521 C CA    . ASN C 3 44  ? 78.973  -56.699 39.295  1.00 104.07 ? 67  ASN G CA    1 
ATOM   5522 C C     . ASN C 3 44  ? 77.902  -56.518 40.376  1.00 102.93 ? 67  ASN G C     1 
ATOM   5523 O O     . ASN C 3 44  ? 76.811  -56.013 40.106  1.00 103.04 ? 67  ASN G O     1 
ATOM   5524 C CB    . ASN C 3 44  ? 78.536  -57.799 38.327  1.00 107.22 ? 67  ASN G CB    1 
ATOM   5525 C CG    . ASN C 3 44  ? 79.340  -57.796 37.041  1.00 108.78 ? 67  ASN G CG    1 
ATOM   5526 O OD1   . ASN C 3 44  ? 79.421  -56.782 36.341  1.00 109.97 ? 67  ASN G OD1   1 
ATOM   5527 N ND2   . ASN C 3 44  ? 79.947  -58.932 36.727  1.00 109.07 ? 67  ASN G ND2   1 
ATOM   5528 N N     . GLY C 3 45  ? 78.212  -56.914 41.602  1.00 141.30 ? 68  GLY G N     1 
ATOM   5529 C CA    . GLY C 3 45  ? 77.244  -56.803 42.675  1.00 140.45 ? 68  GLY G CA    1 
ATOM   5530 C C     . GLY C 3 45  ? 76.246  -57.949 42.748  1.00 139.57 ? 68  GLY G C     1 
ATOM   5531 O O     . GLY C 3 45  ? 75.570  -58.116 43.766  1.00 138.96 ? 68  GLY G O     1 
ATOM   5532 N N     . VAL C 3 46  ? 76.151  -58.740 41.680  1.00 100.58 ? 69  VAL G N     1 
ATOM   5533 C CA    . VAL C 3 46  ? 75.223  -59.875 41.643  1.00 100.16 ? 69  VAL G CA    1 
ATOM   5534 C C     . VAL C 3 46  ? 75.678  -61.054 42.506  1.00 99.62  ? 69  VAL G C     1 
ATOM   5535 O O     . VAL C 3 46  ? 76.865  -61.374 42.570  1.00 99.82  ? 69  VAL G O     1 
ATOM   5536 C CB    . VAL C 3 46  ? 75.017  -60.384 40.213  1.00 160.50 ? 69  VAL G CB    1 
ATOM   5537 C CG1   . VAL C 3 46  ? 74.327  -59.325 39.373  1.00 161.22 ? 69  VAL G CG1   1 
ATOM   5538 C CG2   . VAL C 3 46  ? 76.344  -60.775 39.602  1.00 161.11 ? 69  VAL G CG2   1 
ATOM   5539 N N     . ARG C 3 47  ? 74.725  -61.665 43.206  1.00 99.20  ? 70  ARG G N     1 
ATOM   5540 C CA    . ARG C 3 47  ? 74.996  -62.837 44.041  1.00 98.96  ? 70  ARG G CA    1 
ATOM   5541 C C     . ARG C 3 47  ? 74.605  -64.168 43.381  1.00 99.56  ? 70  ARG G C     1 
ATOM   5542 O O     . ARG C 3 47  ? 74.659  -65.212 44.025  1.00 99.69  ? 70  ARG G O     1 
ATOM   5543 C CB    . ARG C 3 47  ? 74.301  -62.696 45.405  1.00 140.06 ? 70  ARG G CB    1 
ATOM   5544 C CG    . ARG C 3 47  ? 72.809  -62.437 45.338  1.00 140.22 ? 70  ARG G CG    1 
ATOM   5545 C CD    . ARG C 3 47  ? 72.263  -61.988 46.678  1.00 140.02 ? 70  ARG G CD    1 
ATOM   5546 N NE    . ARG C 3 47  ? 72.474  -62.987 47.713  1.00 139.93 ? 70  ARG G NE    1 
ATOM   5547 C CZ    . ARG C 3 47  ? 71.734  -63.080 48.809  1.00 140.10 ? 70  ARG G CZ    1 
ATOM   5548 N NH1   . ARG C 3 47  ? 70.733  -62.232 49.007  1.00 140.41 ? 70  ARG G NH1   1 
ATOM   5549 N NH2   . ARG C 3 47  ? 71.992  -64.025 49.704  1.00 140.24 ? 70  ARG G NH2   1 
ATOM   5550 N N     . ALA C 3 48  ? 74.158  -64.132 42.129  1.00 116.99 ? 71  ALA G N     1 
ATOM   5551 C CA    . ALA C 3 48  ? 73.828  -65.366 41.413  1.00 117.95 ? 71  ALA G CA    1 
ATOM   5552 C C     . ALA C 3 48  ? 74.037  -65.206 39.913  1.00 118.88 ? 71  ALA G C     1 
ATOM   5553 O O     . ALA C 3 48  ? 73.731  -64.153 39.355  1.00 118.85 ? 71  ALA G O     1 
ATOM   5554 C CB    . ALA C 3 48  ? 72.393  -65.779 41.703  1.00 101.38 ? 71  ALA G CB    1 
ATOM   5555 N N     . ALA C 3 49  ? 74.557  -66.245 39.262  1.00 124.90 ? 72  ALA G N     1 
ATOM   5556 C CA    . ALA C 3 49  ? 74.692  -66.231 37.807  1.00 126.15 ? 72  ALA G CA    1 
ATOM   5557 C C     . ALA C 3 49  ? 74.347  -67.579 37.180  1.00 127.71 ? 72  ALA G C     1 
ATOM   5558 O O     . ALA C 3 49  ? 74.798  -68.621 37.654  1.00 128.20 ? 72  ALA G O     1 
ATOM   5559 C CB    . ALA C 3 49  ? 76.108  -65.829 37.425  1.00 191.11 ? 72  ALA G CB    1 
ATOM   5560 N N     . PRO C 3 50  ? 73.587  -67.560 36.074  1.00 107.08 ? 73  PRO G N     1 
ATOM   5561 C CA    . PRO C 3 50  ? 73.271  -68.802 35.368  1.00 108.99 ? 73  PRO G CA    1 
ATOM   5562 C C     . PRO C 3 50  ? 74.495  -69.415 34.699  1.00 110.39 ? 73  PRO G C     1 
ATOM   5563 O O     . PRO C 3 50  ? 75.281  -68.706 34.073  1.00 110.50 ? 73  PRO G O     1 
ATOM   5564 C CB    . PRO C 3 50  ? 72.239  -68.355 34.330  1.00 109.89 ? 73  PRO G CB    1 
ATOM   5565 C CG    . PRO C 3 50  ? 71.590  -67.173 34.948  1.00 108.28 ? 73  PRO G CG    1 
ATOM   5566 C CD    . PRO C 3 50  ? 72.695  -66.461 35.668  1.00 106.74 ? 73  PRO G CD    1 
ATOM   5567 N N     . LEU C 3 51  ? 74.647  -70.726 34.837  1.00 111.75 ? 74  LEU G N     1 
ATOM   5568 C CA    . LEU C 3 51  ? 75.746  -71.448 34.208  1.00 113.59 ? 74  LEU G CA    1 
ATOM   5569 C C     . LEU C 3 51  ? 75.416  -71.923 32.791  1.00 116.04 ? 74  LEU G C     1 
ATOM   5570 O O     . LEU C 3 51  ? 74.492  -72.708 32.589  1.00 117.35 ? 74  LEU G O     1 
ATOM   5571 C CB    . LEU C 3 51  ? 76.126  -72.646 35.066  1.00 114.29 ? 74  LEU G CB    1 
ATOM   5572 C CG    . LEU C 3 51  ? 76.591  -72.331 36.481  1.00 112.33 ? 74  LEU G CG    1 
ATOM   5573 C CD1   . LEU C 3 51  ? 76.585  -73.601 37.332  1.00 113.31 ? 74  LEU G CD1   1 
ATOM   5574 C CD2   . LEU C 3 51  ? 77.978  -71.707 36.417  1.00 112.01 ? 74  LEU G CD2   1 
ATOM   5575 N N     . TRP C 3 52  ? 76.186  -71.461 31.815  1.00 116.94 ? 75  TRP G N     1 
ATOM   5576 C CA    . TRP C 3 52  ? 75.977  -71.872 30.432  1.00 119.53 ? 75  TRP G CA    1 
ATOM   5577 C C     . TRP C 3 52  ? 77.061  -72.840 29.988  1.00 122.00 ? 75  TRP G C     1 
ATOM   5578 O O     . TRP C 3 52  ? 78.238  -72.622 30.264  1.00 121.72 ? 75  TRP G O     1 
ATOM   5579 C CB    . TRP C 3 52  ? 75.953  -70.654 29.509  1.00 119.35 ? 75  TRP G CB    1 
ATOM   5580 C CG    . TRP C 3 52  ? 75.959  -70.988 28.040  1.00 122.24 ? 75  TRP G CG    1 
ATOM   5581 C CD1   . TRP C 3 52  ? 77.053  -71.144 27.236  1.00 124.23 ? 75  TRP G CD1   1 
ATOM   5582 C CD2   . TRP C 3 52  ? 74.815  -71.187 27.200  1.00 123.75 ? 75  TRP G CD2   1 
ATOM   5583 N NE1   . TRP C 3 52  ? 76.659  -71.436 25.953  1.00 126.87 ? 75  TRP G NE1   1 
ATOM   5584 C CE2   . TRP C 3 52  ? 75.290  -71.469 25.906  1.00 126.62 ? 75  TRP G CE2   1 
ATOM   5585 C CE3   . TRP C 3 52  ? 73.435  -71.160 27.420  1.00 123.22 ? 75  TRP G CE3   1 
ATOM   5586 C CZ2   . TRP C 3 52  ? 74.432  -71.717 24.835  1.00 128.90 ? 75  TRP G CZ2   1 
ATOM   5587 C CZ3   . TRP C 3 52  ? 72.587  -71.408 26.354  1.00 125.52 ? 75  TRP G CZ3   1 
ATOM   5588 C CH2   . TRP C 3 52  ? 73.087  -71.682 25.081  1.00 128.29 ? 75  TRP G CH2   1 
ATOM   5589 N N     . ASP C 3 53  ? 76.661  -73.906 29.300  1.00 124.70 ? 76  ASP G N     1 
ATOM   5590 C CA    . ASP C 3 53  ? 77.609  -74.864 28.738  1.00 127.69 ? 76  ASP G CA    1 
ATOM   5591 C C     . ASP C 3 53  ? 77.738  -74.650 27.235  1.00 130.05 ? 76  ASP G C     1 
ATOM   5592 O O     . ASP C 3 53  ? 76.740  -74.647 26.520  1.00 130.97 ? 76  ASP G O     1 
ATOM   5593 C CB    . ASP C 3 53  ? 77.167  -76.299 29.029  1.00 144.34 ? 76  ASP G CB    1 
ATOM   5594 C CG    . ASP C 3 53  ? 78.258  -77.316 28.753  1.00 147.38 ? 76  ASP G CG    1 
ATOM   5595 O OD1   . ASP C 3 53  ? 78.657  -77.460 27.577  1.00 150.02 ? 76  ASP G OD1   1 
ATOM   5596 O OD2   . ASP C 3 53  ? 78.702  -77.983 29.714  1.00 147.38 ? 76  ASP G OD2   1 
ATOM   5597 N N     . SER C 3 54  ? 78.964  -74.477 26.755  1.00 137.94 ? 77  SER G N     1 
ATOM   5598 C CA    . SER C 3 54  ? 79.184  -74.200 25.340  1.00 140.34 ? 77  SER G CA    1 
ATOM   5599 C C     . SER C 3 54  ? 78.971  -75.448 24.480  1.00 144.25 ? 77  SER G C     1 
ATOM   5600 O O     . SER C 3 54  ? 78.468  -75.358 23.358  1.00 146.17 ? 77  SER G O     1 
ATOM   5601 C CB    . SER C 3 54  ? 80.590  -73.636 25.121  1.00 153.05 ? 77  SER G CB    1 
ATOM   5602 O OG    . SER C 3 54  ? 80.769  -73.211 23.781  1.00 155.26 ? 77  SER G OG    1 
ATOM   5603 N N     . LYS C 3 55  ? 79.357  -76.607 25.010  1.00 144.23 ? 78  LYS G N     1 
ATOM   5604 C CA    . LYS C 3 55  ? 79.218  -77.868 24.287  1.00 148.35 ? 78  LYS G CA    1 
ATOM   5605 C C     . LYS C 3 55  ? 77.759  -78.286 24.178  1.00 148.71 ? 78  LYS G C     1 
ATOM   5606 O O     . LYS C 3 55  ? 77.266  -78.558 23.086  1.00 151.48 ? 78  LYS G O     1 
ATOM   5607 C CB    . LYS C 3 55  ? 80.020  -78.978 24.967  1.00 160.67 ? 78  LYS G CB    1 
ATOM   5608 C CG    . LYS C 3 55  ? 81.508  -78.703 25.070  1.00 160.99 ? 78  LYS G CG    1 
ATOM   5609 C CD    . LYS C 3 55  ? 82.249  -79.941 25.557  1.00 163.60 ? 78  LYS G CD    1 
ATOM   5610 C CE    . LYS C 3 55  ? 83.750  -79.700 25.667  1.00 164.31 ? 78  LYS G CE    1 
ATOM   5611 N NZ    . LYS C 3 55  ? 84.505  -80.949 25.998  1.00 167.61 ? 78  LYS G NZ    1 
ATOM   5612 N N     . LYS C 3 56  ? 77.074  -78.331 25.316  1.00 140.97 ? 79  LYS G N     1 
ATOM   5613 C CA    . LYS C 3 56  ? 75.669  -78.715 25.355  1.00 141.33 ? 79  LYS G CA    1 
ATOM   5614 C C     . LYS C 3 56  ? 74.774  -77.622 24.778  1.00 139.85 ? 79  LYS G C     1 
ATOM   5615 O O     . LYS C 3 56  ? 73.632  -77.879 24.392  1.00 141.11 ? 79  LYS G O     1 
ATOM   5616 C CB    . LYS C 3 56  ? 75.240  -79.030 26.788  1.00 152.63 ? 79  LYS G CB    1 
ATOM   5617 C CG    . LYS C 3 56  ? 76.099  -80.067 27.504  1.00 153.98 ? 79  LYS G CG    1 
ATOM   5618 C CD    . LYS C 3 56  ? 75.455  -80.492 28.822  1.00 152.50 ? 79  LYS G CD    1 
ATOM   5619 C CE    . LYS C 3 56  ? 76.419  -81.277 29.693  1.00 153.22 ? 79  LYS G CE    1 
ATOM   5620 N NZ    . LYS C 3 56  ? 77.493  -80.404 30.236  1.00 150.44 ? 79  LYS G NZ    1 
ATOM   5621 N N     . GLN C 3 57  ? 75.304  -76.404 24.745  1.00 137.43 ? 80  GLN G N     1 
ATOM   5622 C CA    . GLN C 3 57  ? 74.600  -75.241 24.210  1.00 136.11 ? 80  GLN G CA    1 
ATOM   5623 C C     . GLN C 3 57  ? 73.300  -74.976 24.983  1.00 133.95 ? 80  GLN G C     1 
ATOM   5624 O O     . GLN C 3 57  ? 72.253  -74.694 24.397  1.00 134.66 ? 80  GLN G O     1 
ATOM   5625 C CB    . GLN C 3 57  ? 74.325  -75.427 22.711  1.00 151.13 ? 80  GLN G CB    1 
ATOM   5626 C CG    . GLN C 3 57  ? 74.163  -74.130 21.920  1.00 150.44 ? 80  GLN G CG    1 
ATOM   5627 C CD    . GLN C 3 57  ? 75.483  -73.428 21.640  1.00 150.09 ? 80  GLN G CD    1 
ATOM   5628 O OE1   . GLN C 3 57  ? 76.548  -74.044 21.675  1.00 151.42 ? 80  GLN G OE1   1 
ATOM   5629 N NE2   . GLN C 3 57  ? 75.415  -72.131 21.358  1.00 148.60 ? 80  GLN G NE2   1 
ATOM   5630 N N     . SER C 3 58  ? 73.384  -75.067 26.308  1.00 131.56 ? 81  SER G N     1 
ATOM   5631 C CA    . SER C 3 58  ? 72.236  -74.815 27.173  1.00 129.57 ? 81  SER G CA    1 
ATOM   5632 C C     . SER C 3 58  ? 72.663  -74.467 28.605  1.00 126.39 ? 81  SER G C     1 
ATOM   5633 O O     . SER C 3 58  ? 73.809  -74.702 28.992  1.00 126.11 ? 81  SER G O     1 
ATOM   5634 C CB    . SER C 3 58  ? 71.307  -76.027 27.175  1.00 198.95 ? 81  SER G CB    1 
ATOM   5635 O OG    . SER C 3 58  ? 70.126  -75.755 27.903  1.00 197.48 ? 81  SER G OG    1 
ATOM   5636 N N     . PHE C 3 59  ? 71.742  -73.911 29.392  1.00 143.72 ? 82  PHE G N     1 
ATOM   5637 C CA    . PHE C 3 59  ? 72.047  -73.575 30.781  1.00 140.93 ? 82  PHE G CA    1 
ATOM   5638 C C     . PHE C 3 59  ? 72.016  -74.832 31.644  1.00 141.80 ? 82  PHE G C     1 
ATOM   5639 O O     . PHE C 3 59  ? 70.974  -75.471 31.783  1.00 143.03 ? 82  PHE G O     1 
ATOM   5640 C CB    . PHE C 3 59  ? 71.048  -72.553 31.329  1.00 119.28 ? 82  PHE G CB    1 
ATOM   5641 C CG    . PHE C 3 59  ? 71.122  -71.208 30.675  1.00 118.30 ? 82  PHE G CG    1 
ATOM   5642 C CD1   . PHE C 3 59  ? 72.190  -70.365 30.918  1.00 116.63 ? 82  PHE G CD1   1 
ATOM   5643 C CD2   . PHE C 3 59  ? 70.107  -70.774 29.843  1.00 119.31 ? 82  PHE G CD2   1 
ATOM   5644 C CE1   . PHE C 3 59  ? 72.253  -69.123 30.330  1.00 116.05 ? 82  PHE G CE1   1 
ATOM   5645 C CE2   . PHE C 3 59  ? 70.168  -69.532 29.252  1.00 118.69 ? 82  PHE G CE2   1 
ATOM   5646 C CZ    . PHE C 3 59  ? 71.242  -68.706 29.496  1.00 117.08 ? 82  PHE G CZ    1 
ATOM   5647 N N     . VAL C 3 60  ? 73.162  -75.187 32.221  1.00 134.64 ? 83  VAL G N     1 
ATOM   5648 C CA    . VAL C 3 60  ? 73.273  -76.420 33.000  1.00 135.88 ? 83  VAL G CA    1 
ATOM   5649 C C     . VAL C 3 60  ? 72.828  -76.283 34.457  1.00 133.73 ? 83  VAL G C     1 
ATOM   5650 O O     . VAL C 3 60  ? 72.352  -77.248 35.054  1.00 135.00 ? 83  VAL G O     1 
ATOM   5651 C CB    . VAL C 3 60  ? 74.717  -76.978 32.970  1.00 152.67 ? 83  VAL G CB    1 
ATOM   5652 C CG1   . VAL C 3 60  ? 75.057  -77.502 31.583  1.00 155.80 ? 83  VAL G CG1   1 
ATOM   5653 C CG2   . VAL C 3 60  ? 75.713  -75.924 33.400  1.00 150.13 ? 83  VAL G CG2   1 
ATOM   5654 N N     . GLY C 3 61  ? 72.998  -75.097 35.035  1.00 118.15 ? 84  GLY G N     1 
ATOM   5655 C CA    . GLY C 3 61  ? 72.735  -74.911 36.452  1.00 116.23 ? 84  GLY G CA    1 
ATOM   5656 C C     . GLY C 3 61  ? 72.877  -73.479 36.933  1.00 113.33 ? 84  GLY G C     1 
ATOM   5657 O O     . GLY C 3 61  ? 72.856  -72.534 36.145  1.00 112.75 ? 84  GLY G O     1 
ATOM   5658 N N     . MET C 3 62  ? 73.015  -73.321 38.243  1.00 130.50 ? 85  MET G N     1 
ATOM   5659 C CA    . MET C 3 62  ? 73.109  -71.999 38.844  1.00 128.04 ? 85  MET G CA    1 
ATOM   5660 C C     . MET C 3 62  ? 74.333  -71.908 39.754  1.00 127.06 ? 85  MET G C     1 
ATOM   5661 O O     . MET C 3 62  ? 74.792  -72.916 40.295  1.00 128.04 ? 85  MET G O     1 
ATOM   5662 C CB    . MET C 3 62  ? 71.826  -71.685 39.622  1.00 130.88 ? 85  MET G CB    1 
ATOM   5663 C CG    . MET C 3 62  ? 71.640  -70.224 39.994  1.00 128.85 ? 85  MET G CG    1 
ATOM   5664 S SD    . MET C 3 62  ? 71.613  -69.145 38.552  1.00 128.87 ? 85  MET G SD    1 
ATOM   5665 C CE    . MET C 3 62  ? 70.442  -69.984 37.494  1.00 131.12 ? 85  MET G CE    1 
ATOM   5666 N N     . LEU C 3 63  ? 74.865  -70.698 39.905  1.00 122.81 ? 86  LEU G N     1 
ATOM   5667 C CA    . LEU C 3 63  ? 76.019  -70.457 40.765  1.00 122.00 ? 86  LEU G CA    1 
ATOM   5668 C C     . LEU C 3 63  ? 75.722  -69.317 41.726  1.00 120.07 ? 86  LEU G C     1 
ATOM   5669 O O     . LEU C 3 63  ? 75.537  -68.176 41.300  1.00 119.28 ? 86  LEU G O     1 
ATOM   5670 C CB    . LEU C 3 63  ? 77.257  -70.129 39.931  1.00 106.46 ? 86  LEU G CB    1 
ATOM   5671 C CG    . LEU C 3 63  ? 78.637  -70.562 40.436  1.00 107.07 ? 86  LEU G CG    1 
ATOM   5672 C CD1   . LEU C 3 63  ? 79.714  -70.107 39.466  1.00 107.92 ? 86  LEU G CD1   1 
ATOM   5673 C CD2   . LEU C 3 63  ? 78.925  -70.027 41.817  1.00 105.61 ? 86  LEU G CD2   1 
ATOM   5674 N N     . THR C 3 64  ? 75.691  -69.636 43.019  1.00 110.50 ? 87  THR G N     1 
ATOM   5675 C CA    . THR C 3 64  ? 75.424  -68.661 44.076  1.00 109.01 ? 87  THR G CA    1 
ATOM   5676 C C     . THR C 3 64  ? 76.609  -68.574 45.036  1.00 108.70 ? 87  THR G C     1 
ATOM   5677 O O     . THR C 3 64  ? 77.669  -69.144 44.774  1.00 109.59 ? 87  THR G O     1 
ATOM   5678 C CB    . THR C 3 64  ? 74.148  -69.004 44.883  1.00 104.89 ? 87  THR G CB    1 
ATOM   5679 O OG1   . THR C 3 64  ? 74.457  -69.966 45.896  1.00 105.46 ? 87  THR G OG1   1 
ATOM   5680 C CG2   . THR C 3 64  ? 73.049  -69.545 43.974  1.00 105.92 ? 87  THR G CG2   1 
ATOM   5681 N N     . ILE C 3 65  ? 76.438  -67.834 46.132  1.00 100.70 ? 88  ILE G N     1 
ATOM   5682 C CA    . ILE C 3 65  ? 77.508  -67.683 47.110  1.00 100.58 ? 88  ILE G CA    1 
ATOM   5683 C C     . ILE C 3 65  ? 77.726  -68.989 47.858  1.00 101.55 ? 88  ILE G C     1 
ATOM   5684 O O     . ILE C 3 65  ? 78.821  -69.245 48.350  1.00 102.08 ? 88  ILE G O     1 
ATOM   5685 C CB    . ILE C 3 65  ? 77.233  -66.564 48.132  1.00 99.59  ? 88  ILE G CB    1 
ATOM   5686 C CG1   . ILE C 3 65  ? 76.334  -65.472 47.545  1.00 98.93  ? 88  ILE G CG1   1 
ATOM   5687 C CG2   . ILE C 3 65  ? 78.545  -65.981 48.604  1.00 99.64  ? 88  ILE G CG2   1 
ATOM   5688 C CD1   . ILE C 3 65  ? 74.867  -65.608 47.919  1.00 98.82  ? 88  ILE G CD1   1 
ATOM   5689 N N     . THR C 3 66  ? 76.684  -69.812 47.929  1.00 102.05 ? 89  THR G N     1 
ATOM   5690 C CA    . THR C 3 66  ? 76.762  -71.117 48.583  1.00 103.36 ? 89  THR G CA    1 
ATOM   5691 C C     . THR C 3 66  ? 77.863  -71.981 47.986  1.00 104.77 ? 89  THR G C     1 
ATOM   5692 O O     . THR C 3 66  ? 78.509  -72.758 48.689  1.00 105.87 ? 89  THR G O     1 
ATOM   5693 C CB    . THR C 3 66  ? 75.433  -71.879 48.473  1.00 107.28 ? 89  THR G CB    1 
ATOM   5694 O OG1   . THR C 3 66  ? 74.352  -70.993 48.779  1.00 106.21 ? 89  THR G OG1   1 
ATOM   5695 C CG2   . THR C 3 66  ? 75.405  -73.073 49.426  1.00 108.74 ? 89  THR G CG2   1 
ATOM   5696 N N     . ASP C 3 67  ? 78.066  -71.845 46.681  1.00 104.99 ? 90  ASP G N     1 
ATOM   5697 C CA    . ASP C 3 67  ? 79.114  -72.586 45.997  1.00 106.60 ? 90  ASP G CA    1 
ATOM   5698 C C     . ASP C 3 67  ? 80.486  -72.116 46.468  1.00 106.53 ? 90  ASP G C     1 
ATOM   5699 O O     . ASP C 3 67  ? 81.406  -72.916 46.615  1.00 108.14 ? 90  ASP G O     1 
ATOM   5700 C CB    . ASP C 3 67  ? 78.983  -72.433 44.480  1.00 142.57 ? 90  ASP G CB    1 
ATOM   5701 C CG    . ASP C 3 67  ? 77.630  -72.893 43.959  1.00 142.95 ? 90  ASP G CG    1 
ATOM   5702 O OD1   . ASP C 3 67  ? 77.404  -74.120 43.884  1.00 144.75 ? 90  ASP G OD1   1 
ATOM   5703 O OD2   . ASP C 3 67  ? 76.794  -72.027 43.618  1.00 141.73 ? 90  ASP G OD2   1 
ATOM   5704 N N     . PHE C 3 68  ? 80.617  -70.817 46.711  1.00 104.97 ? 91  PHE G N     1 
ATOM   5705 C CA    . PHE C 3 68  ? 81.851  -70.265 47.258  1.00 105.05 ? 91  PHE G CA    1 
ATOM   5706 C C     . PHE C 3 68  ? 82.058  -70.727 48.709  1.00 105.37 ? 91  PHE G C     1 
ATOM   5707 O O     . PHE C 3 68  ? 83.190  -70.868 49.170  1.00 106.37 ? 91  PHE G O     1 
ATOM   5708 C CB    . PHE C 3 68  ? 81.833  -68.733 47.159  1.00 103.62 ? 91  PHE G CB    1 
ATOM   5709 C CG    . PHE C 3 68  ? 83.105  -68.073 47.616  1.00 104.00 ? 91  PHE G CG    1 
ATOM   5710 C CD1   . PHE C 3 68  ? 84.322  -68.431 47.066  1.00 105.57 ? 91  PHE G CD1   1 
ATOM   5711 C CD2   . PHE C 3 68  ? 83.081  -67.084 48.589  1.00 103.10 ? 91  PHE G CD2   1 
ATOM   5712 C CE1   . PHE C 3 68  ? 85.495  -67.827 47.486  1.00 106.25 ? 91  PHE G CE1   1 
ATOM   5713 C CE2   . PHE C 3 68  ? 84.254  -66.474 49.013  1.00 103.78 ? 91  PHE G CE2   1 
ATOM   5714 C CZ    . PHE C 3 68  ? 85.461  -66.847 48.460  1.00 105.35 ? 91  PHE G CZ    1 
ATOM   5715 N N     . ILE C 3 69  ? 80.961  -70.966 49.421  1.00 104.78 ? 92  ILE G N     1 
ATOM   5716 C CA    . ILE C 3 69  ? 81.024  -71.469 50.787  1.00 105.32 ? 92  ILE G CA    1 
ATOM   5717 C C     . ILE C 3 69  ? 81.425  -72.929 50.795  1.00 107.40 ? 92  ILE G C     1 
ATOM   5718 O O     . ILE C 3 69  ? 82.351  -73.321 51.502  1.00 108.58 ? 92  ILE G O     1 
ATOM   5719 C CB    . ILE C 3 69  ? 79.685  -71.323 51.510  1.00 104.44 ? 92  ILE G CB    1 
ATOM   5720 C CG1   . ILE C 3 69  ? 79.276  -69.857 51.564  1.00 102.73 ? 92  ILE G CG1   1 
ATOM   5721 C CG2   . ILE C 3 69  ? 79.776  -71.883 52.908  1.00 105.30 ? 92  ILE G CG2   1 
ATOM   5722 C CD1   . ILE C 3 69  ? 77.853  -69.641 52.005  1.00 102.07 ? 92  ILE G CD1   1 
ATOM   5723 N N     . ASN C 3 70  ? 80.721  -73.728 49.999  1.00 108.12 ? 93  ASN G N     1 
ATOM   5724 C CA    . ASN C 3 70  ? 80.994  -75.155 49.905  1.00 110.49 ? 93  ASN G CA    1 
ATOM   5725 C C     . ASN C 3 70  ? 82.451  -75.418 49.568  1.00 111.97 ? 93  ASN G C     1 
ATOM   5726 O O     . ASN C 3 70  ? 83.127  -76.163 50.269  1.00 113.69 ? 93  ASN G O     1 
ATOM   5727 C CB    . ASN C 3 70  ? 80.095  -75.821 48.861  1.00 152.19 ? 93  ASN G CB    1 
ATOM   5728 C CG    . ASN C 3 70  ? 78.673  -76.028 49.352  1.00 151.83 ? 93  ASN G CG    1 
ATOM   5729 O OD1   . ASN C 3 70  ? 77.720  -75.546 48.742  1.00 150.79 ? 93  ASN G OD1   1 
ATOM   5730 N ND2   . ASN C 3 70  ? 78.524  -76.758 50.453  1.00 152.97 ? 93  ASN G ND2   1 
ATOM   5731 N N     . ILE C 3 71  ? 82.934  -74.785 48.506  1.00 111.54 ? 94  ILE G N     1 
ATOM   5732 C CA    . ILE C 3 71  ? 84.300  -75.002 48.048  1.00 113.24 ? 94  ILE G CA    1 
ATOM   5733 C C     . ILE C 3 71  ? 85.319  -74.481 49.061  1.00 113.23 ? 94  ILE G C     1 
ATOM   5734 O O     . ILE C 3 71  ? 86.433  -74.990 49.135  1.00 115.29 ? 94  ILE G O     1 
ATOM   5735 C CB    . ILE C 3 71  ? 84.542  -74.335 46.674  1.00 112.89 ? 94  ILE G CB    1 
ATOM   5736 C CG1   . ILE C 3 71  ? 85.827  -74.858 46.031  1.00 115.38 ? 94  ILE G CG1   1 
ATOM   5737 C CG2   . ILE C 3 71  ? 84.590  -72.819 46.799  1.00 110.68 ? 94  ILE G CG2   1 
ATOM   5738 C CD1   . ILE C 3 71  ? 86.121  -74.225 44.685  1.00 115.40 ? 94  ILE G CD1   1 
ATOM   5739 N N     . LEU C 3 72  ? 84.933  -73.484 49.852  1.00 111.21 ? 95  LEU G N     1 
ATOM   5740 C CA    . LEU C 3 72  ? 85.835  -72.908 50.844  1.00 111.31 ? 95  LEU G CA    1 
ATOM   5741 C C     . LEU C 3 72  ? 85.989  -73.833 52.048  1.00 112.75 ? 95  LEU G C     1 
ATOM   5742 O O     . LEU C 3 72  ? 87.077  -73.979 52.604  1.00 114.28 ? 95  LEU G O     1 
ATOM   5743 C CB    . LEU C 3 72  ? 85.330  -71.540 51.294  1.00 109.05 ? 95  LEU G CB    1 
ATOM   5744 C CG    . LEU C 3 72  ? 86.330  -70.386 51.252  1.00 108.93 ? 95  LEU G CG    1 
ATOM   5745 C CD1   . LEU C 3 72  ? 86.771  -70.128 49.836  1.00 109.29 ? 95  LEU G CD1   1 
ATOM   5746 C CD2   . LEU C 3 72  ? 85.722  -69.131 51.840  1.00 107.09 ? 95  LEU G CD2   1 
ATOM   5747 N N     . HIS C 3 73  ? 84.887  -74.455 52.448  1.00 112.50 ? 96  HIS G N     1 
ATOM   5748 C CA    . HIS C 3 73  ? 84.913  -75.413 53.544  1.00 114.13 ? 96  HIS G CA    1 
ATOM   5749 C C     . HIS C 3 73  ? 85.452  -76.764 53.075  1.00 116.93 ? 96  HIS G C     1 
ATOM   5750 O O     . HIS C 3 73  ? 86.175  -77.441 53.807  1.00 119.04 ? 96  HIS G O     1 
ATOM   5751 C CB    . HIS C 3 73  ? 83.515  -75.579 54.146  1.00 132.23 ? 96  HIS G CB    1 
ATOM   5752 C CG    . HIS C 3 73  ? 83.487  -76.428 55.377  1.00 133.93 ? 96  HIS G CG    1 
ATOM   5753 N ND1   . HIS C 3 73  ? 83.877  -75.958 56.614  1.00 133.88 ? 96  HIS G ND1   1 
ATOM   5754 C CD2   . HIS C 3 73  ? 83.128  -77.721 55.562  1.00 136.03 ? 96  HIS G CD2   1 
ATOM   5755 C CE1   . HIS C 3 73  ? 83.757  -76.923 57.509  1.00 135.80 ? 96  HIS G CE1   1 
ATOM   5756 N NE2   . HIS C 3 73  ? 83.302  -78.002 56.897  1.00 137.15 ? 96  HIS G NE2   1 
ATOM   5757 N N     . ARG C 3 74  ? 85.091  -77.150 51.853  1.00 138.47 ? 97  ARG G N     1 
ATOM   5758 C CA    . ARG C 3 74  ? 85.503  -78.435 51.290  1.00 141.41 ? 97  ARG G CA    1 
ATOM   5759 C C     . ARG C 3 74  ? 87.008  -78.502 51.052  1.00 143.31 ? 97  ARG G C     1 
ATOM   5760 O O     . ARG C 3 74  ? 87.687  -79.365 51.609  1.00 145.91 ? 97  ARG G O     1 
ATOM   5761 C CB    . ARG C 3 74  ? 84.761  -78.704 49.976  1.00 159.42 ? 97  ARG G CB    1 
ATOM   5762 C CG    . ARG C 3 74  ? 85.068  -80.044 49.325  1.00 162.75 ? 97  ARG G CG    1 
ATOM   5763 C CD    . ARG C 3 74  ? 84.561  -81.183 50.182  1.00 164.68 ? 97  ARG G CD    1 
ATOM   5764 N NE    . ARG C 3 74  ? 83.740  -82.121 49.423  1.00 166.35 ? 97  ARG G NE    1 
ATOM   5765 C CZ    . ARG C 3 74  ? 82.446  -81.948 49.172  1.00 164.91 ? 97  ARG G CZ    1 
ATOM   5766 N NH1   . ARG C 3 74  ? 81.820  -80.862 49.609  1.00 161.74 ? 97  ARG G NH1   1 
ATOM   5767 N NH2   . ARG C 3 74  ? 81.779  -82.860 48.477  1.00 166.93 ? 97  ARG G NH2   1 
ATOM   5768 N N     . TYR C 3 75  ? 87.535  -77.581 50.248  1.00 121.02 ? 98  TYR G N     1 
ATOM   5769 C CA    . TYR C 3 75  ? 88.968  -77.572 50.004  1.00 123.02 ? 98  TYR G CA    1 
ATOM   5770 C C     . TYR C 3 75  ? 89.581  -76.501 50.880  1.00 121.83 ? 98  TYR G C     1 
ATOM   5771 O O     . TYR C 3 75  ? 89.620  -75.329 50.505  1.00 119.95 ? 98  TYR G O     1 
ATOM   5772 C CB    . TYR C 3 75  ? 89.277  -77.263 48.530  1.00 161.50 ? 98  TYR G CB    1 
ATOM   5773 C CG    . TYR C 3 75  ? 88.710  -78.227 47.509  1.00 162.90 ? 98  TYR G CG    1 
ATOM   5774 C CD1   . TYR C 3 75  ? 88.878  -79.595 47.649  1.00 165.96 ? 98  TYR G CD1   1 
ATOM   5775 C CD2   . TYR C 3 75  ? 88.017  -77.762 46.395  1.00 161.46 ? 98  TYR G CD2   1 
ATOM   5776 C CE1   . TYR C 3 75  ? 88.368  -80.477 46.715  1.00 167.61 ? 98  TYR G CE1   1 
ATOM   5777 C CE2   . TYR C 3 75  ? 87.502  -78.635 45.456  1.00 163.01 ? 98  TYR G CE2   1 
ATOM   5778 C CZ    . TYR C 3 75  ? 87.680  -79.991 45.621  1.00 166.11 ? 98  TYR G CZ    1 
ATOM   5779 O OH    . TYR C 3 75  ? 87.168  -80.863 44.686  1.00 167.99 ? 98  TYR G OH    1 
ATOM   5780 N N     . TYR C 3 76  ? 90.107  -76.909 52.026  1.00 123.28 ? 99  TYR G N     1 
ATOM   5781 C CA    . TYR C 3 76  ? 90.836  -75.987 52.877  1.00 122.85 ? 99  TYR G CA    1 
ATOM   5782 C C     . TYR C 3 76  ? 91.761  -76.733 53.813  1.00 125.75 ? 99  TYR G C     1 
ATOM   5783 O O     . TYR C 3 76  ? 91.398  -77.785 54.335  1.00 127.10 ? 99  TYR G O     1 
ATOM   5784 C CB    . TYR C 3 76  ? 89.865  -75.126 53.666  1.00 119.97 ? 99  TYR G CB    1 
ATOM   5785 C CG    . TYR C 3 76  ? 90.519  -74.083 54.536  1.00 119.56 ? 99  TYR G CG    1 
ATOM   5786 C CD1   . TYR C 3 76  ? 91.517  -73.253 54.046  1.00 119.98 ? 99  TYR G CD1   1 
ATOM   5787 C CD2   . TYR C 3 76  ? 90.109  -73.902 55.847  1.00 118.97 ? 99  TYR G CD2   1 
ATOM   5788 C CE1   . TYR C 3 76  ? 92.100  -72.282 54.854  1.00 119.92 ? 99  TYR G CE1   1 
ATOM   5789 C CE2   . TYR C 3 76  ? 90.684  -72.941 56.662  1.00 118.86 ? 99  TYR G CE2   1 
ATOM   5790 C CZ    . TYR C 3 76  ? 91.676  -72.132 56.163  1.00 119.36 ? 99  TYR G CZ    1 
ATOM   5791 O OH    . TYR C 3 76  ? 92.240  -71.174 56.974  1.00 119.57 ? 99  TYR G OH    1 
ATOM   5792 N N     . LYS C 3 77  ? 92.926  -76.156 54.077  1.00 126.87 ? 100 LYS G N     1 
ATOM   5793 C CA    . LYS C 3 77  ? 93.912  -76.780 54.950  1.00 129.93 ? 100 LYS G CA    1 
ATOM   5794 C C     . LYS C 3 77  ? 94.225  -75.830 56.089  1.00 129.18 ? 100 LYS G C     1 
ATOM   5795 O O     . LYS C 3 77  ? 94.012  -76.156 57.252  1.00 129.65 ? 100 LYS G O     1 
ATOM   5796 C CB    . LYS C 3 77  ? 95.192  -77.155 54.188  1.00 151.19 ? 100 LYS G CB    1 
ATOM   5797 C CG    . LYS C 3 77  ? 95.178  -78.531 53.503  1.00 153.73 ? 100 LYS G CG    1 
ATOM   5798 C CD    . LYS C 3 77  ? 94.160  -78.609 52.372  1.00 151.83 ? 100 LYS G CD    1 
ATOM   5799 C CE    . LYS C 3 77  ? 94.362  -77.493 51.350  1.00 150.17 ? 100 LYS G CE    1 
ATOM   5800 N NZ    . LYS C 3 77  ? 93.300  -77.479 50.296  1.00 148.22 ? 100 LYS G NZ    1 
ATOM   5801 N N     . SER C 3 78  ? 94.764  -74.663 55.754  1.00 135.08 ? 101 SER G N     1 
ATOM   5802 C CA    . SER C 3 78  ? 95.032  -73.640 56.755  1.00 134.47 ? 101 SER G CA    1 
ATOM   5803 C C     . SER C 3 78  ? 95.146  -72.255 56.148  1.00 132.79 ? 101 SER G C     1 
ATOM   5804 O O     . SER C 3 78  ? 95.309  -72.115 54.939  1.00 132.67 ? 101 SER G O     1 
ATOM   5805 C CB    . SER C 3 78  ? 96.305  -73.956 57.520  1.00 152.11 ? 101 SER G CB    1 
ATOM   5806 O OG    . SER C 3 78  ? 96.659  -72.877 58.362  1.00 151.84 ? 101 SER G OG    1 
ATOM   5807 N N     . ALA C 3 79  ? 95.077  -71.241 57.005  1.00 142.04 ? 102 ALA G N     1 
ATOM   5808 C CA    . ALA C 3 79  ? 95.108  -69.837 56.599  1.00 140.63 ? 102 ALA G CA    1 
ATOM   5809 C C     . ALA C 3 79  ? 96.414  -69.402 55.917  1.00 142.86 ? 102 ALA G C     1 
ATOM   5810 O O     . ALA C 3 79  ? 96.458  -68.376 55.237  1.00 142.00 ? 102 ALA G O     1 
ATOM   5811 C CB    . ALA C 3 79  ? 94.845  -68.955 57.813  1.00 289.86 ? 102 ALA G CB    1 
ATOM   5812 N N     . LEU C 3 80  ? 97.471  -70.182 56.101  1.00 134.54 ? 103 LEU G N     1 
ATOM   5813 C CA    . LEU C 3 80  ? 98.802  -69.814 55.615  1.00 137.29 ? 103 LEU G CA    1 
ATOM   5814 C C     . LEU C 3 80  ? 99.324  -70.804 54.571  1.00 139.32 ? 103 LEU G C     1 
ATOM   5815 O O     . LEU C 3 80  ? 99.818  -70.408 53.514  1.00 140.09 ? 103 LEU G O     1 
ATOM   5816 C CB    . LEU C 3 80  ? 99.800  -69.673 56.773  1.00 167.82 ? 103 LEU G CB    1 
ATOM   5817 C CG    . LEU C 3 80  ? 100.056 -70.805 57.767  1.00 169.85 ? 103 LEU G CG    1 
ATOM   5818 C CD1   . LEU C 3 80  ? 101.480 -70.708 58.267  1.00 173.77 ? 103 LEU G CD1   1 
ATOM   5819 C CD2   . LEU C 3 80  ? 99.080  -70.740 58.933  1.00 167.83 ? 103 LEU G CD2   1 
ATOM   5820 N N     . VAL C 3 81  ? 99.306  -72.082 54.926  1.00 187.66 ? 104 VAL G N     1 
ATOM   5821 C CA    . VAL C 3 81  ? 100.015 -73.115 54.181  1.00 190.65 ? 104 VAL G CA    1 
ATOM   5822 C C     . VAL C 3 81  ? 99.696  -73.281 52.679  1.00 189.99 ? 104 VAL G C     1 
ATOM   5823 O O     . VAL C 3 81  ? 100.630 -73.287 51.880  1.00 192.52 ? 104 VAL G O     1 
ATOM   5824 C CB    . VAL C 3 81  ? 99.830  -74.493 54.877  1.00 431.04 ? 104 VAL G CB    1 
ATOM   5825 C CG1   . VAL C 3 81  ? 100.363 -74.428 56.301  1.00 432.60 ? 104 VAL G CG1   1 
ATOM   5826 C CG2   . VAL C 3 81  ? 98.376  -74.939 54.884  1.00 428.05 ? 104 VAL G CG2   1 
ATOM   5827 N N     . GLN C 3 82  ? 98.432  -73.414 52.269  1.00 136.26 ? 105 GLN G N     1 
ATOM   5828 C CA    . GLN C 3 82  ? 98.188  -73.877 50.896  1.00 136.45 ? 105 GLN G CA    1 
ATOM   5829 C C     . GLN C 3 82  ? 97.454  -72.925 49.943  1.00 133.56 ? 105 GLN G C     1 
ATOM   5830 O O     . GLN C 3 82  ? 98.117  -72.287 49.128  1.00 134.55 ? 105 GLN G O     1 
ATOM   5831 C CB    . GLN C 3 82  ? 97.432  -75.213 50.930  1.00 360.86 ? 105 GLN G CB    1 
ATOM   5832 C CG    . GLN C 3 82  ? 98.288  -76.425 51.327  1.00 364.87 ? 105 GLN G CG    1 
ATOM   5833 C CD    . GLN C 3 82  ? 98.833  -77.203 50.133  1.00 367.85 ? 105 GLN G CD    1 
ATOM   5834 O OE1   . GLN C 3 82  ? 99.097  -76.645 49.080  1.00 367.82 ? 105 GLN G OE1   1 
ATOM   5835 N NE2   . GLN C 3 82  ? 98.991  -78.502 50.303  1.00 370.70 ? 105 GLN G NE2   1 
ATOM   5836 N N     . ILE C 3 83  ? 96.123  -72.823 50.069  1.00 161.38 ? 106 ILE G N     1 
ATOM   5837 C CA    . ILE C 3 83  ? 95.204  -72.157 49.104  1.00 158.74 ? 106 ILE G CA    1 
ATOM   5838 C C     . ILE C 3 83  ? 95.058  -72.916 47.769  1.00 159.82 ? 106 ILE G C     1 
ATOM   5839 O O     . ILE C 3 83  ? 94.336  -72.476 46.873  1.00 158.08 ? 106 ILE G O     1 
ATOM   5840 C CB    . ILE C 3 83  ? 95.601  -70.653 48.800  1.00 186.12 ? 106 ILE G CB    1 
ATOM   5841 C CG1   . ILE C 3 83  ? 96.542  -70.505 47.587  1.00 188.47 ? 106 ILE G CG1   1 
ATOM   5842 C CG2   . ILE C 3 83  ? 96.123  -69.955 50.050  1.00 186.31 ? 106 ILE G CG2   1 
ATOM   5843 C CD1   . ILE C 3 83  ? 97.415  -69.259 47.620  1.00 189.32 ? 106 ILE G CD1   1 
ATOM   5844 N N     . TYR C 3 84  ? 95.739  -74.055 47.655  1.00 200.86 ? 107 TYR G N     1 
ATOM   5845 C CA    . TYR C 3 84  ? 96.017  -74.723 46.376  1.00 203.08 ? 107 TYR G CA    1 
ATOM   5846 C C     . TYR C 3 84  ? 94.831  -75.251 45.543  1.00 201.78 ? 107 TYR G C     1 
ATOM   5847 O O     . TYR C 3 84  ? 94.790  -75.034 44.331  1.00 202.07 ? 107 TYR G O     1 
ATOM   5848 C CB    . TYR C 3 84  ? 96.975  -75.890 46.639  1.00 227.43 ? 107 TYR G CB    1 
ATOM   5849 C CG    . TYR C 3 84  ? 98.012  -76.098 45.560  1.00 230.88 ? 107 TYR G CG    1 
ATOM   5850 C CD1   . TYR C 3 84  ? 98.511  -75.027 44.827  1.00 230.77 ? 107 TYR G CD1   1 
ATOM   5851 C CD2   . TYR C 3 84  ? 98.489  -77.370 45.266  1.00 234.57 ? 107 TYR G CD2   1 
ATOM   5852 C CE1   . TYR C 3 84  ? 99.462  -75.218 43.834  1.00 234.23 ? 107 TYR G CE1   1 
ATOM   5853 C CE2   . TYR C 3 84  ? 99.437  -77.571 44.275  1.00 238.07 ? 107 TYR G CE2   1 
ATOM   5854 C CZ    . TYR C 3 84  ? 99.921  -76.493 43.561  1.00 237.86 ? 107 TYR G CZ    1 
ATOM   5855 O OH    . TYR C 3 84  ? 100.865 -76.694 42.577  1.00 241.62 ? 107 TYR G OH    1 
ATOM   5856 N N     . GLU C 3 85  ? 93.890  -75.951 46.172  1.00 129.99 ? 108 GLU G N     1 
ATOM   5857 C CA    . GLU C 3 85  ? 92.882  -76.715 45.428  1.00 129.77 ? 108 GLU G CA    1 
ATOM   5858 C C     . GLU C 3 85  ? 91.949  -75.877 44.542  1.00 127.05 ? 108 GLU G C     1 
ATOM   5859 O O     . GLU C 3 85  ? 91.717  -76.236 43.391  1.00 128.04 ? 108 GLU G O     1 
ATOM   5860 C CB    . GLU C 3 85  ? 92.032  -77.556 46.387  1.00 185.46 ? 108 GLU G CB    1 
ATOM   5861 C CG    . GLU C 3 85  ? 92.380  -79.041 46.408  1.00 189.10 ? 108 GLU G CG    1 
ATOM   5862 C CD    . GLU C 3 85  ? 93.599  -79.344 47.254  1.00 191.66 ? 108 GLU G CD    1 
ATOM   5863 O OE1   . GLU C 3 85  ? 93.489  -79.264 48.495  1.00 190.76 ? 108 GLU G OE1   1 
ATOM   5864 O OE2   . GLU C 3 85  ? 94.665  -79.658 46.684  1.00 194.79 ? 108 GLU G OE2   1 
ATOM   5865 N N     . LEU C 3 86  ? 91.406  -74.780 45.061  1.00 123.93 ? 109 LEU G N     1 
ATOM   5866 C CA    . LEU C 3 86  ? 90.380  -74.040 44.321  1.00 121.45 ? 109 LEU G CA    1 
ATOM   5867 C C     . LEU C 3 86  ? 90.942  -73.136 43.242  1.00 121.78 ? 109 LEU G C     1 
ATOM   5868 O O     . LEU C 3 86  ? 90.235  -72.805 42.300  1.00 120.79 ? 109 LEU G O     1 
ATOM   5869 C CB    . LEU C 3 86  ? 89.513  -73.189 45.257  1.00 128.39 ? 109 LEU G CB    1 
ATOM   5870 C CG    . LEU C 3 86  ? 89.923  -71.736 45.530  1.00 126.99 ? 109 LEU G CG    1 
ATOM   5871 C CD1   . LEU C 3 86  ? 88.783  -70.987 46.197  1.00 124.04 ? 109 LEU G CD1   1 
ATOM   5872 C CD2   . LEU C 3 86  ? 91.195  -71.665 46.390  1.00 128.64 ? 109 LEU G CD2   1 
ATOM   5873 N N     . GLU C 3 87  ? 92.195  -72.717 43.380  1.00 123.36 ? 110 GLU G N     1 
ATOM   5874 C CA    . GLU C 3 87  ? 92.763  -71.743 42.450  1.00 123.85 ? 110 GLU G CA    1 
ATOM   5875 C C     . GLU C 3 87  ? 92.915  -72.300 41.031  1.00 126.01 ? 110 GLU G C     1 
ATOM   5876 O O     . GLU C 3 87  ? 92.648  -71.604 40.047  1.00 125.48 ? 110 GLU G O     1 
ATOM   5877 C CB    . GLU C 3 87  ? 94.112  -71.249 42.968  1.00 164.65 ? 110 GLU G CB    1 
ATOM   5878 C CG    . GLU C 3 87  ? 94.009  -70.369 44.203  1.00 162.63 ? 110 GLU G CG    1 
ATOM   5879 C CD    . GLU C 3 87  ? 93.880  -68.894 43.867  1.00 161.15 ? 110 GLU G CD    1 
ATOM   5880 O OE1   . GLU C 3 87  ? 94.532  -68.443 42.900  1.00 162.77 ? 110 GLU G OE1   1 
ATOM   5881 O OE2   . GLU C 3 87  ? 93.130  -68.188 44.575  1.00 158.64 ? 110 GLU G OE2   1 
ATOM   5882 N N     . GLU C 3 88  ? 93.336  -73.558 40.935  1.00 128.71 ? 111 GLU G N     1 
ATOM   5883 C CA    . GLU C 3 88  ? 93.504  -74.227 39.647  1.00 131.29 ? 111 GLU G CA    1 
ATOM   5884 C C     . GLU C 3 88  ? 92.216  -74.937 39.217  1.00 130.36 ? 111 GLU G C     1 
ATOM   5885 O O     . GLU C 3 88  ? 92.169  -75.584 38.172  1.00 132.51 ? 111 GLU G O     1 
ATOM   5886 C CB    . GLU C 3 88  ? 94.664  -75.228 39.717  1.00 135.30 ? 111 GLU G CB    1 
ATOM   5887 C CG    . GLU C 3 88  ? 94.352  -76.501 40.509  1.00 136.12 ? 111 GLU G CG    1 
ATOM   5888 C CD    . GLU C 3 88  ? 95.593  -77.323 40.848  1.00 140.06 ? 111 GLU G CD    1 
ATOM   5889 O OE1   . GLU C 3 88  ? 95.539  -78.569 40.740  1.00 142.58 ? 111 GLU G OE1   1 
ATOM   5890 O OE2   . GLU C 3 88  ? 96.619  -76.724 41.236  1.00 140.91 ? 111 GLU G OE2   1 
ATOM   5891 N N     . HIS C 3 89  ? 91.180  -74.820 40.038  1.00 127.43 ? 112 HIS G N     1 
ATOM   5892 C CA    . HIS C 3 89  ? 89.900  -75.468 39.774  1.00 126.59 ? 112 HIS G CA    1 
ATOM   5893 C C     . HIS C 3 89  ? 89.052  -74.682 38.791  1.00 124.88 ? 112 HIS G C     1 
ATOM   5894 O O     . HIS C 3 89  ? 89.187  -73.463 38.677  1.00 123.28 ? 112 HIS G O     1 
ATOM   5895 C CB    . HIS C 3 89  ? 89.121  -75.655 41.072  1.00 130.39 ? 112 HIS G CB    1 
ATOM   5896 C CG    . HIS C 3 89  ? 88.586  -77.037 41.268  1.00 131.95 ? 112 HIS G CG    1 
ATOM   5897 N ND1   . HIS C 3 89  ? 87.348  -77.282 41.820  1.00 130.20 ? 112 HIS G ND1   1 
ATOM   5898 C CD2   . HIS C 3 89  ? 89.127  -78.252 41.008  1.00 135.44 ? 112 HIS G CD2   1 
ATOM   5899 C CE1   . HIS C 3 89  ? 87.145  -78.586 41.884  1.00 132.54 ? 112 HIS G CE1   1 
ATOM   5900 N NE2   . HIS C 3 89  ? 88.210  -79.198 41.398  1.00 135.75 ? 112 HIS G NE2   1 
ATOM   5901 N N     . LYS C 3 90  ? 88.163  -75.389 38.102  1.00 134.46 ? 113 LYS G N     1 
ATOM   5902 C CA    . LYS C 3 90  ? 87.267  -74.779 37.125  1.00 133.22 ? 113 LYS G CA    1 
ATOM   5903 C C     . LYS C 3 90  ? 85.829  -75.152 37.446  1.00 131.61 ? 113 LYS G C     1 
ATOM   5904 O O     . LYS C 3 90  ? 85.594  -76.121 38.168  1.00 132.27 ? 113 LYS G O     1 
ATOM   5905 C CB    . LYS C 3 90  ? 87.633  -75.225 35.708  1.00 127.24 ? 113 LYS G CB    1 
ATOM   5906 C CG    . LYS C 3 90  ? 89.108  -75.035 35.378  1.00 129.57 ? 113 LYS G CG    1 
ATOM   5907 C CD    . LYS C 3 90  ? 89.500  -75.668 34.053  1.00 133.14 ? 113 LYS G CD    1 
ATOM   5908 C CE    . LYS C 3 90  ? 89.007  -74.852 32.878  1.00 132.60 ? 113 LYS G CE    1 
ATOM   5909 N NZ    . LYS C 3 90  ? 89.535  -75.389 31.594  1.00 136.42 ? 113 LYS G NZ    1 
ATOM   5910 N N     . ILE C 3 91  ? 84.875  -74.387 36.913  1.00 120.79 ? 114 ILE G N     1 
ATOM   5911 C CA    . ILE C 3 91  ? 83.459  -74.582 37.231  1.00 119.26 ? 114 ILE G CA    1 
ATOM   5912 C C     . ILE C 3 91  ? 82.996  -75.998 36.911  1.00 121.67 ? 114 ILE G C     1 
ATOM   5913 O O     . ILE C 3 91  ? 82.468  -76.684 37.781  1.00 121.53 ? 114 ILE G O     1 
ATOM   5914 C CB    . ILE C 3 91  ? 82.553  -73.575 36.488  1.00 117.62 ? 114 ILE G CB    1 
ATOM   5915 C CG1   . ILE C 3 91  ? 82.738  -72.172 37.066  1.00 115.08 ? 114 ILE G CG1   1 
ATOM   5916 C CG2   . ILE C 3 91  ? 81.091  -73.985 36.603  1.00 116.94 ? 114 ILE G CG2   1 
ATOM   5917 C CD1   . ILE C 3 91  ? 82.051  -71.084 36.273  1.00 113.93 ? 114 ILE G CD1   1 
ATOM   5918 N N     . GLU C 3 92  ? 83.219  -76.443 35.679  1.00 124.20 ? 115 GLU G N     1 
ATOM   5919 C CA    . GLU C 3 92  ? 82.817  -77.787 35.272  1.00 127.04 ? 115 GLU G CA    1 
ATOM   5920 C C     . GLU C 3 92  ? 83.532  -78.867 36.086  1.00 129.02 ? 115 GLU G C     1 
ATOM   5921 O O     . GLU C 3 92  ? 82.973  -79.937 36.329  1.00 130.63 ? 115 GLU G O     1 
ATOM   5922 C CB    . GLU C 3 92  ? 83.080  -77.998 33.777  1.00 143.68 ? 115 GLU G CB    1 
ATOM   5923 C CG    . GLU C 3 92  ? 84.554  -78.002 33.386  1.00 145.79 ? 115 GLU G CG    1 
ATOM   5924 C CD    . GLU C 3 92  ? 84.778  -78.288 31.907  1.00 148.90 ? 115 GLU G CD    1 
ATOM   5925 O OE1   . GLU C 3 92  ? 83.882  -77.979 31.091  1.00 148.54 ? 115 GLU G OE1   1 
ATOM   5926 O OE2   . GLU C 3 92  ? 85.853  -78.824 31.561  1.00 151.95 ? 115 GLU G OE2   1 
ATOM   5927 N N     . THR C 3 93  ? 84.763  -78.580 36.508  1.00 132.75 ? 116 THR G N     1 
ATOM   5928 C CA    . THR C 3 93  ? 85.545  -79.516 37.311  1.00 134.79 ? 116 THR G CA    1 
ATOM   5929 C C     . THR C 3 93  ? 84.981  -79.619 38.720  1.00 132.80 ? 116 THR G C     1 
ATOM   5930 O O     . THR C 3 93  ? 84.910  -80.707 39.293  1.00 134.68 ? 116 THR G O     1 
ATOM   5931 C CB    . THR C 3 93  ? 87.022  -79.099 37.392  1.00 171.60 ? 116 THR G CB    1 
ATOM   5932 O OG1   . THR C 3 93  ? 87.525  -78.877 36.072  1.00 173.43 ? 116 THR G OG1   1 
ATOM   5933 C CG2   . THR C 3 93  ? 87.847  -80.185 38.060  1.00 174.47 ? 116 THR G CG2   1 
ATOM   5934 N N     . TRP C 3 94  ? 84.578  -78.480 39.273  1.00 125.68 ? 117 TRP G N     1 
ATOM   5935 C CA    . TRP C 3 94  ? 83.963  -78.451 40.596  1.00 123.73 ? 117 TRP G CA    1 
ATOM   5936 C C     . TRP C 3 94  ? 82.548  -79.018 40.564  1.00 123.68 ? 117 TRP G C     1 
ATOM   5937 O O     . TRP C 3 94  ? 82.103  -79.657 41.517  1.00 123.92 ? 117 TRP G O     1 
ATOM   5938 C CB    . TRP C 3 94  ? 83.939  -77.029 41.154  1.00 139.25 ? 117 TRP G CB    1 
ATOM   5939 C CG    . TRP C 3 94  ? 83.482  -76.972 42.584  1.00 137.58 ? 117 TRP G CG    1 
ATOM   5940 C CD1   . TRP C 3 94  ? 84.198  -77.336 43.692  1.00 138.23 ? 117 TRP G CD1   1 
ATOM   5941 C CD2   . TRP C 3 94  ? 82.208  -76.528 43.059  1.00 135.31 ? 117 TRP G CD2   1 
ATOM   5942 N NE1   . TRP C 3 94  ? 83.445  -77.144 44.826  1.00 136.46 ? 117 TRP G NE1   1 
ATOM   5943 C CE2   . TRP C 3 94  ? 82.221  -76.649 44.464  1.00 134.68 ? 117 TRP G CE2   1 
ATOM   5944 C CE3   . TRP C 3 94  ? 81.059  -76.039 42.434  1.00 133.99 ? 117 TRP G CE3   1 
ATOM   5945 C CZ2   . TRP C 3 94  ? 81.127  -76.296 45.251  1.00 132.83 ? 117 TRP G CZ2   1 
ATOM   5946 C CZ3   . TRP C 3 94  ? 79.975  -75.692 43.217  1.00 132.17 ? 117 TRP G CZ3   1 
ATOM   5947 C CH2   . TRP C 3 94  ? 80.015  -75.823 44.611  1.00 131.63 ? 117 TRP G CH2   1 
ATOM   5948 N N     . ARG C 3 95  ? 81.844  -78.772 39.467  1.00 123.58 ? 118 ARG G N     1 
ATOM   5949 C CA    . ARG C 3 95  ? 80.532  -79.364 39.254  1.00 124.16 ? 118 ARG G CA    1 
ATOM   5950 C C     . ARG C 3 95  ? 80.625  -80.886 39.268  1.00 127.79 ? 118 ARG G C     1 
ATOM   5951 O O     . ARG C 3 95  ? 79.701  -81.564 39.710  1.00 128.50 ? 118 ARG G O     1 
ATOM   5952 C CB    . ARG C 3 95  ? 79.936  -78.885 37.927  1.00 146.15 ? 118 ARG G CB    1 
ATOM   5953 C CG    . ARG C 3 95  ? 79.530  -77.414 37.902  1.00 142.83 ? 118 ARG G CG    1 
ATOM   5954 C CD    . ARG C 3 95  ? 78.072  -77.214 38.292  1.00 141.33 ? 118 ARG G CD    1 
ATOM   5955 N NE    . ARG C 3 95  ? 77.167  -77.872 37.353  1.00 143.35 ? 118 ARG G NE    1 
ATOM   5956 C CZ    . ARG C 3 95  ? 75.846  -77.727 37.356  1.00 142.73 ? 118 ARG G CZ    1 
ATOM   5957 N NH1   . ARG C 3 95  ? 75.265  -76.935 38.251  1.00 140.13 ? 118 ARG G NH1   1 
ATOM   5958 N NH2   . ARG C 3 95  ? 75.108  -78.372 36.460  1.00 145.00 ? 118 ARG G NH2   1 
ATOM   5959 N N     . GLU C 3 96  ? 81.750  -81.409 38.783  1.00 163.37 ? 119 GLU G N     1 
ATOM   5960 C CA    . GLU C 3 96  ? 81.978  -82.847 38.714  1.00 167.36 ? 119 GLU G CA    1 
ATOM   5961 C C     . GLU C 3 96  ? 82.093  -83.451 40.109  1.00 167.69 ? 119 GLU G C     1 
ATOM   5962 O O     . GLU C 3 96  ? 81.497  -84.489 40.390  1.00 169.89 ? 119 GLU G O     1 
ATOM   5963 C CB    . GLU C 3 96  ? 83.238  -83.149 37.902  1.00 159.62 ? 119 GLU G CB    1 
ATOM   5964 C CG    . GLU C 3 96  ? 83.258  -84.529 37.276  1.00 164.27 ? 119 GLU G CG    1 
ATOM   5965 C CD    . GLU C 3 96  ? 84.437  -84.720 36.342  1.00 167.18 ? 119 GLU G CD    1 
ATOM   5966 O OE1   . GLU C 3 96  ? 84.392  -85.644 35.499  1.00 171.03 ? 119 GLU G OE1   1 
ATOM   5967 O OE2   . GLU C 3 96  ? 85.409  -83.943 36.455  1.00 165.88 ? 119 GLU G OE2   1 
ATOM   5968 N N     . VAL C 3 97  ? 82.851  -82.794 40.984  1.00 132.74 ? 120 VAL G N     1 
ATOM   5969 C CA    . VAL C 3 97  ? 83.019  -83.278 42.352  1.00 133.03 ? 120 VAL G CA    1 
ATOM   5970 C C     . VAL C 3 97  ? 81.819  -82.917 43.228  1.00 130.43 ? 120 VAL G C     1 
ATOM   5971 O O     . VAL C 3 97  ? 81.602  -83.527 44.274  1.00 131.22 ? 120 VAL G O     1 
ATOM   5972 C CB    . VAL C 3 97  ? 84.307  -82.725 43.003  1.00 132.26 ? 120 VAL G CB    1 
ATOM   5973 C CG1   . VAL C 3 97  ? 85.524  -83.106 42.176  1.00 135.24 ? 120 VAL G CG1   1 
ATOM   5974 C CG2   . VAL C 3 97  ? 84.228  -81.219 43.174  1.00 128.24 ? 120 VAL G CG2   1 
ATOM   5975 N N     . TYR C 3 98  ? 81.044  -81.926 42.796  1.00 150.10 ? 121 TYR G N     1 
ATOM   5976 C CA    . TYR C 3 98  ? 79.823  -81.540 43.497  1.00 147.91 ? 121 TYR G CA    1 
ATOM   5977 C C     . TYR C 3 98  ? 78.685  -82.502 43.165  1.00 150.06 ? 121 TYR G C     1 
ATOM   5978 O O     . TYR C 3 98  ? 77.855  -82.819 44.017  1.00 150.04 ? 121 TYR G O     1 
ATOM   5979 C CB    . TYR C 3 98  ? 79.428  -80.109 43.133  1.00 192.16 ? 121 TYR G CB    1 
ATOM   5980 C CG    . TYR C 3 98  ? 78.648  -79.379 44.204  1.00 189.49 ? 121 TYR G CG    1 
ATOM   5981 C CD1   . TYR C 3 98  ? 79.233  -79.073 45.424  1.00 188.42 ? 121 TYR G CD1   1 
ATOM   5982 C CD2   . TYR C 3 98  ? 77.335  -78.976 43.987  1.00 188.29 ? 121 TYR G CD2   1 
ATOM   5983 C CE1   . TYR C 3 98  ? 78.530  -78.396 46.402  1.00 186.27 ? 121 TYR G CE1   1 
ATOM   5984 C CE2   . TYR C 3 98  ? 76.625  -78.298 44.962  1.00 186.17 ? 121 TYR G CE2   1 
ATOM   5985 C CZ    . TYR C 3 98  ? 77.228  -78.011 46.165  1.00 185.17 ? 121 TYR G CZ    1 
ATOM   5986 O OH    . TYR C 3 98  ? 76.527  -77.339 47.137  1.00 183.36 ? 121 TYR G OH    1 
ATOM   5987 N N     . LEU C 3 99  ? 78.655  -82.961 41.918  1.00 241.03 ? 122 LEU G N     1 
ATOM   5988 C CA    . LEU C 3 99  ? 77.647  -83.920 41.474  1.00 243.66 ? 122 LEU G CA    1 
ATOM   5989 C C     . LEU C 3 99  ? 78.095  -85.360 41.733  1.00 247.77 ? 122 LEU G C     1 
ATOM   5990 O O     . LEU C 3 99  ? 77.334  -86.305 41.512  1.00 250.60 ? 122 LEU G O     1 
ATOM   5991 C CB    . LEU C 3 99  ? 77.329  -83.719 39.988  1.00 216.61 ? 122 LEU G CB    1 
ATOM   5992 C CG    . LEU C 3 99  ? 76.194  -82.749 39.634  1.00 214.03 ? 122 LEU G CG    1 
ATOM   5993 C CD1   . LEU C 3 99  ? 76.377  -81.392 40.304  1.00 209.92 ? 122 LEU G CD1   1 
ATOM   5994 C CD2   . LEU C 3 99  ? 76.069  -82.592 38.121  1.00 215.10 ? 122 LEU G CD2   1 
ATOM   5995 N N     . GLN C 3 100 ? 79.333  -85.512 42.200  1.00 260.84 ? 123 GLN G N     1 
ATOM   5996 C CA    . GLN C 3 100 ? 79.864  -86.809 42.612  1.00 264.78 ? 123 GLN G CA    1 
ATOM   5997 C C     . GLN C 3 100 ? 78.956  -87.464 43.648  1.00 265.67 ? 123 GLN G C     1 
ATOM   5998 O O     . GLN C 3 100 ? 78.718  -88.671 43.607  1.00 269.60 ? 123 GLN G O     1 
ATOM   5999 C CB    . GLN C 3 100 ? 81.280  -86.655 43.180  1.00 195.15 ? 123 GLN G CB    1 
ATOM   6000 C CG    . GLN C 3 100 ? 82.395  -87.145 42.260  1.00 198.26 ? 123 GLN G CG    1 
ATOM   6001 C CD    . GLN C 3 100 ? 82.601  -88.651 42.330  1.00 203.32 ? 123 GLN G CD    1 
ATOM   6002 O OE1   . GLN C 3 100 ? 82.297  -89.285 43.342  1.00 204.42 ? 123 GLN G OE1   1 
ATOM   6003 N NE2   . GLN C 3 100 ? 83.121  -89.231 41.251  1.00 206.71 ? 123 GLN G NE2   1 
ATOM   6004 N N     . ASP C 3 101 ? 78.454  -86.656 44.576  1.00 315.38 ? 124 ASP G N     1 
ATOM   6005 C CA    . ASP C 3 101 ? 77.571  -87.143 45.630  1.00 316.03 ? 124 ASP G CA    1 
ATOM   6006 C C     . ASP C 3 101 ? 76.137  -87.355 45.139  1.00 316.72 ? 124 ASP G C     1 
ATOM   6007 O O     . ASP C 3 101 ? 75.525  -88.388 45.416  1.00 319.90 ? 124 ASP G O     1 
ATOM   6008 C CB    . ASP C 3 101 ? 77.579  -86.173 46.818  1.00 209.49 ? 124 ASP G CB    1 
ATOM   6009 C CG    . ASP C 3 101 ? 78.947  -86.059 47.476  1.00 209.31 ? 124 ASP G CG    1 
ATOM   6010 O OD1   . ASP C 3 101 ? 79.964  -86.255 46.776  1.00 210.66 ? 124 ASP G OD1   1 
ATOM   6011 O OD2   . ASP C 3 101 ? 79.005  -85.770 48.692  1.00 208.05 ? 124 ASP G OD2   1 
ATOM   6012 N N     . SER C 3 102 ? 75.605  -86.377 44.410  1.00 290.49 ? 125 SER G N     1 
ATOM   6013 C CA    . SER C 3 102 ? 74.217  -86.429 43.954  1.00 290.95 ? 125 SER G CA    1 
ATOM   6014 C C     . SER C 3 102 ? 74.008  -85.646 42.658  1.00 289.44 ? 125 SER G C     1 
ATOM   6015 O O     . SER C 3 102 ? 74.753  -84.714 42.364  1.00 286.85 ? 125 SER G O     1 
ATOM   6016 C CB    . SER C 3 102 ? 73.285  -85.893 45.045  1.00 181.95 ? 125 SER G CB    1 
ATOM   6017 O OG    . SER C 3 102 ? 73.633  -84.567 45.413  1.00 177.79 ? 125 SER G OG    1 
ATOM   6018 N N     . PHE C 3 103 ? 72.984  -86.023 41.893  1.00 171.48 ? 126 PHE G N     1 
ATOM   6019 C CA    . PHE C 3 103 ? 72.683  -85.366 40.620  1.00 170.59 ? 126 PHE G CA    1 
ATOM   6020 C C     . PHE C 3 103 ? 71.384  -84.560 40.686  1.00 168.52 ? 126 PHE G C     1 
ATOM   6021 O O     . PHE C 3 103 ? 70.297  -85.131 40.776  1.00 170.58 ? 126 PHE G O     1 
ATOM   6022 C CB    . PHE C 3 103 ? 72.586  -86.407 39.502  1.00 223.63 ? 126 PHE G CB    1 
ATOM   6023 C CG    . PHE C 3 103 ? 73.422  -86.088 38.295  1.00 223.70 ? 126 PHE G CG    1 
ATOM   6024 C CD1   . PHE C 3 103 ? 73.051  -85.074 37.426  1.00 221.59 ? 126 PHE G CD1   1 
ATOM   6025 C CD2   . PHE C 3 103 ? 74.571  -86.812 38.022  1.00 226.22 ? 126 PHE G CD2   1 
ATOM   6026 C CE1   . PHE C 3 103 ? 73.818  -84.781 36.311  1.00 221.93 ? 126 PHE G CE1   1 
ATOM   6027 C CE2   . PHE C 3 103 ? 75.341  -86.526 36.909  1.00 226.61 ? 126 PHE G CE2   1 
ATOM   6028 C CZ    . PHE C 3 103 ? 74.964  -85.509 36.052  1.00 224.44 ? 126 PHE G CZ    1 
ATOM   6029 N N     . LYS C 3 104 ? 71.507  -83.234 40.690  1.00 183.48 ? 127 LYS G N     1 
ATOM   6030 C CA    . LYS C 3 104 ? 70.355  -82.328 40.640  1.00 181.55 ? 127 LYS G CA    1 
ATOM   6031 C C     . LYS C 3 104 ? 70.417  -81.370 39.436  1.00 180.07 ? 127 LYS G C     1 
ATOM   6032 O O     . LYS C 3 104 ? 71.338  -80.558 39.345  1.00 177.78 ? 127 LYS G O     1 
ATOM   6033 C CB    . LYS C 3 104 ? 70.255  -81.542 41.952  1.00 204.95 ? 127 LYS G CB    1 
ATOM   6034 C CG    . LYS C 3 104 ? 68.830  -81.264 42.418  1.00 204.73 ? 127 LYS G CG    1 
ATOM   6035 C CD    . LYS C 3 104 ? 68.213  -80.101 41.658  1.00 202.84 ? 127 LYS G CD    1 
ATOM   6036 C CE    . LYS C 3 104 ? 66.761  -79.882 42.050  1.00 203.18 ? 127 LYS G CE    1 
ATOM   6037 N NZ    . LYS C 3 104 ? 66.617  -79.515 43.486  1.00 201.61 ? 127 LYS G NZ    1 
ATOM   6038 N N     . PRO C 3 105 ? 69.441  -81.453 38.512  1.00 191.81 ? 128 PRO G N     1 
ATOM   6039 C CA    . PRO C 3 105 ? 69.473  -80.568 37.338  1.00 190.76 ? 128 PRO G CA    1 
ATOM   6040 C C     . PRO C 3 105 ? 68.995  -79.142 37.619  1.00 187.36 ? 128 PRO G C     1 
ATOM   6041 O O     . PRO C 3 105 ? 68.533  -78.841 38.720  1.00 185.90 ? 128 PRO G O     1 
ATOM   6042 C CB    . PRO C 3 105 ? 68.520  -81.257 36.362  1.00 141.66 ? 128 PRO G CB    1 
ATOM   6043 C CG    . PRO C 3 105 ? 67.520  -81.914 37.250  1.00 143.07 ? 128 PRO G CG    1 
ATOM   6044 C CD    . PRO C 3 105 ? 68.286  -82.369 38.476  1.00 142.50 ? 128 PRO G CD    1 
ATOM   6045 N N     . LEU C 3 106 ? 69.085  -78.286 36.604  1.00 137.31 ? 129 LEU G N     1 
ATOM   6046 C CA    . LEU C 3 106 ? 68.697  -76.883 36.726  1.00 134.47 ? 129 LEU G CA    1 
ATOM   6047 C C     . LEU C 3 106 ? 67.180  -76.762 36.768  1.00 135.21 ? 129 LEU G C     1 
ATOM   6048 O O     . LEU C 3 106 ? 66.480  -77.413 35.988  1.00 137.92 ? 129 LEU G O     1 
ATOM   6049 C CB    . LEU C 3 106 ? 69.279  -76.059 35.561  1.00 120.50 ? 129 LEU G CB    1 
ATOM   6050 C CG    . LEU C 3 106 ? 69.040  -74.547 35.398  1.00 118.06 ? 129 LEU G CG    1 
ATOM   6051 C CD1   . LEU C 3 106 ? 67.707  -74.224 34.728  1.00 119.10 ? 129 LEU G CD1   1 
ATOM   6052 C CD2   . LEU C 3 106 ? 69.146  -73.822 36.724  1.00 115.36 ? 129 LEU G CD2   1 
ATOM   6053 N N     . VAL C 3 107 ? 66.674  -75.939 37.685  1.00 119.78 ? 130 VAL G N     1 
ATOM   6054 C CA    . VAL C 3 107 ? 65.249  -75.623 37.712  1.00 120.44 ? 130 VAL G CA    1 
ATOM   6055 C C     . VAL C 3 107 ? 65.016  -74.160 37.313  1.00 118.48 ? 130 VAL G C     1 
ATOM   6056 O O     . VAL C 3 107 ? 65.717  -73.252 37.758  1.00 115.94 ? 130 VAL G O     1 
ATOM   6057 C CB    . VAL C 3 107 ? 64.617  -75.907 39.096  1.00 120.38 ? 130 VAL G CB    1 
ATOM   6058 C CG1   . VAL C 3 107 ? 64.837  -77.361 39.492  1.00 122.67 ? 130 VAL G CG1   1 
ATOM   6059 C CG2   . VAL C 3 107 ? 65.184  -74.996 40.141  1.00 117.34 ? 130 VAL G CG2   1 
ATOM   6060 N N     . CYS C 3 108 ? 64.043  -73.950 36.434  1.00 120.00 ? 131 CYS G N     1 
ATOM   6061 C CA    . CYS C 3 108 ? 63.719  -72.619 35.939  1.00 118.77 ? 131 CYS G CA    1 
ATOM   6062 C C     . CYS C 3 108 ? 62.238  -72.541 35.600  1.00 120.76 ? 131 CYS G C     1 
ATOM   6063 O O     . CYS C 3 108 ? 61.609  -73.554 35.279  1.00 123.49 ? 131 CYS G O     1 
ATOM   6064 C CB    . CYS C 3 108 ? 64.561  -72.274 34.711  1.00 206.32 ? 131 CYS G CB    1 
ATOM   6065 S SG    . CYS C 3 108 ? 64.277  -73.368 33.300  1.00 209.96 ? 131 CYS G SG    1 
ATOM   6066 N N     . ILE C 3 109 ? 61.683  -71.338 35.665  1.00 139.74 ? 132 ILE G N     1 
ATOM   6067 C CA    . ILE C 3 109 ? 60.268  -71.150 35.387  1.00 141.75 ? 132 ILE G CA    1 
ATOM   6068 C C     . ILE C 3 109 ? 60.063  -70.102 34.286  1.00 141.91 ? 132 ILE G C     1 
ATOM   6069 O O     . ILE C 3 109 ? 60.809  -69.132 34.193  1.00 139.84 ? 132 ILE G O     1 
ATOM   6070 C CB    . ILE C 3 109 ? 59.504  -70.748 36.669  1.00 121.11 ? 132 ILE G CB    1 
ATOM   6071 C CG1   . ILE C 3 109 ? 57.995  -70.866 36.458  1.00 123.93 ? 132 ILE G CG1   1 
ATOM   6072 C CG2   . ILE C 3 109 ? 59.890  -69.353 37.110  1.00 118.50 ? 132 ILE G CG2   1 
ATOM   6073 C CD1   . ILE C 3 109 ? 57.181  -70.579 37.689  1.00 123.93 ? 132 ILE G CD1   1 
ATOM   6074 N N     . SER C 3 110 ? 59.069  -70.330 33.430  1.00 124.66 ? 133 SER G N     1 
ATOM   6075 C CA    . SER C 3 110 ? 58.723  -69.391 32.369  1.00 125.38 ? 133 SER G CA    1 
ATOM   6076 C C     . SER C 3 110 ? 58.035  -68.161 32.937  1.00 124.53 ? 133 SER G C     1 
ATOM   6077 O O     . SER C 3 110 ? 57.282  -68.266 33.898  1.00 124.84 ? 133 SER G O     1 
ATOM   6078 C CB    . SER C 3 110 ? 57.814  -70.060 31.342  1.00 142.24 ? 133 SER G CB    1 
ATOM   6079 O OG    . SER C 3 110 ? 57.319  -69.108 30.420  1.00 143.21 ? 133 SER G OG    1 
ATOM   6080 N N     . PRO C 3 111 ? 58.285  -66.986 32.343  1.00 124.27 ? 134 PRO G N     1 
ATOM   6081 C CA    . PRO C 3 111 ? 57.630  -65.760 32.811  1.00 123.89 ? 134 PRO G CA    1 
ATOM   6082 C C     . PRO C 3 111 ? 56.118  -65.787 32.613  1.00 126.86 ? 134 PRO G C     1 
ATOM   6083 O O     . PRO C 3 111 ? 55.410  -65.039 33.283  1.00 126.98 ? 134 PRO G O     1 
ATOM   6084 C CB    . PRO C 3 111 ? 58.272  -64.668 31.952  1.00 122.66 ? 134 PRO G CB    1 
ATOM   6085 C CG    . PRO C 3 111 ? 58.793  -65.377 30.765  1.00 123.76 ? 134 PRO G CG    1 
ATOM   6086 C CD    . PRO C 3 111 ? 59.232  -66.717 31.253  1.00 123.41 ? 134 PRO G CD    1 
ATOM   6087 N N     . ASN C 3 112 ? 55.636  -66.638 31.714  1.00 155.69 ? 135 ASN G N     1 
ATOM   6088 C CA    . ASN C 3 112 ? 54.201  -66.774 31.484  1.00 158.96 ? 135 ASN G CA    1 
ATOM   6089 C C     . ASN C 3 112 ? 53.486  -67.528 32.598  1.00 159.79 ? 135 ASN G C     1 
ATOM   6090 O O     . ASN C 3 112 ? 52.280  -67.362 32.786  1.00 162.11 ? 135 ASN G O     1 
ATOM   6091 C CB    . ASN C 3 112 ? 53.940  -67.472 30.155  1.00 164.45 ? 135 ASN G CB    1 
ATOM   6092 C CG    . ASN C 3 112 ? 54.359  -66.636 28.978  1.00 164.49 ? 135 ASN G CG    1 
ATOM   6093 O OD1   . ASN C 3 112 ? 54.535  -65.423 29.098  1.00 163.05 ? 135 ASN G OD1   1 
ATOM   6094 N ND2   . ASN C 3 112 ? 54.517  -67.274 27.826  1.00 166.45 ? 135 ASN G ND2   1 
ATOM   6095 N N     . ALA C 3 113 ? 54.228  -68.361 33.323  1.00 146.82 ? 136 ALA G N     1 
ATOM   6096 C CA    . ALA C 3 113 ? 53.672  -69.103 34.452  1.00 147.56 ? 136 ALA G CA    1 
ATOM   6097 C C     . ALA C 3 113 ? 53.286  -68.160 35.590  1.00 146.33 ? 136 ALA G C     1 
ATOM   6098 O O     . ALA C 3 113 ? 53.849  -67.075 35.725  1.00 144.01 ? 136 ALA G O     1 
ATOM   6099 C CB    . ALA C 3 113 ? 54.661  -70.149 34.940  1.00 130.82 ? 136 ALA G CB    1 
ATOM   6100 N N     . SER C 3 114 ? 52.322  -68.578 36.404  1.00 136.67 ? 137 SER G N     1 
ATOM   6101 C CA    . SER C 3 114 ? 51.808  -67.744 37.489  1.00 136.20 ? 137 SER G CA    1 
ATOM   6102 C C     . SER C 3 114 ? 52.814  -67.591 38.631  1.00 132.90 ? 137 SER G C     1 
ATOM   6103 O O     . SER C 3 114 ? 53.763  -68.365 38.742  1.00 131.40 ? 137 SER G O     1 
ATOM   6104 C CB    . SER C 3 114 ? 50.493  -68.317 38.025  1.00 173.66 ? 137 SER G CB    1 
ATOM   6105 O OG    . SER C 3 114 ? 50.688  -69.591 38.614  1.00 174.07 ? 137 SER G OG    1 
ATOM   6106 N N     . LEU C 3 115 ? 52.606  -66.573 39.463  1.00 128.19 ? 138 LEU G N     1 
ATOM   6107 C CA    . LEU C 3 115 ? 53.429  -66.348 40.647  1.00 125.50 ? 138 LEU G CA    1 
ATOM   6108 C C     . LEU C 3 115 ? 53.295  -67.505 41.640  1.00 126.18 ? 138 LEU G C     1 
ATOM   6109 O O     . LEU C 3 115 ? 54.210  -67.784 42.414  1.00 124.06 ? 138 LEU G O     1 
ATOM   6110 C CB    . LEU C 3 115 ? 53.045  -65.024 41.311  1.00 127.64 ? 138 LEU G CB    1 
ATOM   6111 C CG    . LEU C 3 115 ? 53.816  -64.616 42.566  1.00 125.21 ? 138 LEU G CG    1 
ATOM   6112 C CD1   . LEU C 3 115 ? 55.298  -64.473 42.266  1.00 122.12 ? 138 LEU G CD1   1 
ATOM   6113 C CD2   . LEU C 3 115 ? 53.255  -63.326 43.147  1.00 125.81 ? 138 LEU G CD2   1 
ATOM   6114 N N     . PHE C 3 116 ? 52.151  -68.181 41.603  1.00 129.43 ? 139 PHE G N     1 
ATOM   6115 C CA    . PHE C 3 116 ? 51.914  -69.350 42.443  1.00 130.78 ? 139 PHE G CA    1 
ATOM   6116 C C     . PHE C 3 116 ? 52.820  -70.520 42.057  1.00 130.10 ? 139 PHE G C     1 
ATOM   6117 O O     . PHE C 3 116 ? 53.213  -71.318 42.910  1.00 129.83 ? 139 PHE G O     1 
ATOM   6118 C CB    . PHE C 3 116 ? 50.449  -69.774 42.353  1.00 162.16 ? 139 PHE G CB    1 
ATOM   6119 C CG    . PHE C 3 116 ? 50.075  -70.873 43.302  1.00 164.07 ? 139 PHE G CG    1 
ATOM   6120 C CD1   . PHE C 3 116 ? 49.693  -70.580 44.599  1.00 164.37 ? 139 PHE G CD1   1 
ATOM   6121 C CD2   . PHE C 3 116 ? 50.103  -72.200 42.897  1.00 165.88 ? 139 PHE G CD2   1 
ATOM   6122 C CE1   . PHE C 3 116 ? 49.347  -71.585 45.479  1.00 166.37 ? 139 PHE G CE1   1 
ATOM   6123 C CE2   . PHE C 3 116 ? 49.760  -73.212 43.772  1.00 167.96 ? 139 PHE G CE2   1 
ATOM   6124 C CZ    . PHE C 3 116 ? 49.380  -72.904 45.066  1.00 168.18 ? 139 PHE G CZ    1 
ATOM   6125 N N     . ASP C 3 117 ? 53.138  -70.623 40.768  1.00 138.12 ? 140 ASP G N     1 
ATOM   6126 C CA    . ASP C 3 117 ? 54.009  -71.688 40.273  1.00 137.84 ? 140 ASP G CA    1 
ATOM   6127 C C     . ASP C 3 117 ? 55.455  -71.441 40.687  1.00 134.22 ? 140 ASP G C     1 
ATOM   6128 O O     . ASP C 3 117 ? 56.228  -72.383 40.860  1.00 133.87 ? 140 ASP G O     1 
ATOM   6129 C CB    . ASP C 3 117 ? 53.912  -71.809 38.747  1.00 156.29 ? 140 ASP G CB    1 
ATOM   6130 C CG    . ASP C 3 117 ? 52.521  -72.197 38.277  1.00 160.31 ? 140 ASP G CG    1 
ATOM   6131 O OD1   . ASP C 3 117 ? 51.768  -72.806 39.068  1.00 162.42 ? 140 ASP G OD1   1 
ATOM   6132 O OD2   . ASP C 3 117 ? 52.185  -71.892 37.111  1.00 161.59 ? 140 ASP G OD2   1 
ATOM   6133 N N     . ALA C 3 118 ? 55.808  -70.168 40.843  1.00 131.67 ? 141 ALA G N     1 
ATOM   6134 C CA    . ALA C 3 118 ? 57.152  -69.780 41.260  1.00 128.43 ? 141 ALA G CA    1 
ATOM   6135 C C     . ALA C 3 118 ? 57.402  -70.116 42.723  1.00 127.63 ? 141 ALA G C     1 
ATOM   6136 O O     . ALA C 3 118 ? 58.387  -70.775 43.058  1.00 126.50 ? 141 ALA G O     1 
ATOM   6137 C CB    . ALA C 3 118 ? 57.373  -68.298 41.018  1.00 118.87 ? 141 ALA G CB    1 
ATOM   6138 N N     . VAL C 3 119 ? 56.506  -69.661 43.591  1.00 158.75 ? 142 VAL G N     1 
ATOM   6139 C CA    . VAL C 3 119 ? 56.650  -69.892 45.023  1.00 158.29 ? 142 VAL G CA    1 
ATOM   6140 C C     . VAL C 3 119 ? 56.630  -71.384 45.343  1.00 160.00 ? 142 VAL G C     1 
ATOM   6141 O O     . VAL C 3 119 ? 57.235  -71.827 46.319  1.00 159.21 ? 142 VAL G O     1 
ATOM   6142 C CB    . VAL C 3 119 ? 55.548  -69.182 45.827  1.00 121.55 ? 142 VAL G CB    1 
ATOM   6143 C CG1   . VAL C 3 119 ? 55.669  -67.677 45.671  1.00 119.99 ? 142 VAL G CG1   1 
ATOM   6144 C CG2   . VAL C 3 119 ? 54.174  -69.656 45.384  1.00 125.03 ? 142 VAL G CG2   1 
ATOM   6145 N N     . SER C 3 120 ? 55.934  -72.154 44.514  1.00 171.73 ? 143 SER G N     1 
ATOM   6146 C CA    . SER C 3 120 ? 55.914  -73.602 44.657  1.00 173.83 ? 143 SER G CA    1 
ATOM   6147 C C     . SER C 3 120 ? 57.296  -74.170 44.352  1.00 172.14 ? 143 SER G C     1 
ATOM   6148 O O     . SER C 3 120 ? 57.815  -75.000 45.095  1.00 172.33 ? 143 SER G O     1 
ATOM   6149 C CB    . SER C 3 120 ? 54.860  -74.219 43.733  1.00 130.12 ? 143 SER G CB    1 
ATOM   6150 O OG    . SER C 3 120 ? 54.818  -75.630 43.865  1.00 132.58 ? 143 SER G OG    1 
ATOM   6151 N N     . SER C 3 121 ? 57.894  -73.700 43.263  1.00 161.07 ? 144 SER G N     1 
ATOM   6152 C CA    . SER C 3 121 ? 59.199  -74.184 42.827  1.00 159.79 ? 144 SER G CA    1 
ATOM   6153 C C     . SER C 3 121 ? 60.300  -73.819 43.821  1.00 157.01 ? 144 SER G C     1 
ATOM   6154 O O     . SER C 3 121 ? 61.322  -74.498 43.905  1.00 156.55 ? 144 SER G O     1 
ATOM   6155 C CB    . SER C 3 121 ? 59.536  -73.628 41.441  1.00 142.08 ? 144 SER G CB    1 
ATOM   6156 O OG    . SER C 3 121 ? 58.586  -74.049 40.475  1.00 144.92 ? 144 SER G OG    1 
ATOM   6157 N N     . LEU C 3 122 ? 60.089  -72.748 44.574  1.00 151.32 ? 145 LEU G N     1 
ATOM   6158 C CA    . LEU C 3 122 ? 61.063  -72.332 45.573  1.00 148.96 ? 145 LEU G CA    1 
ATOM   6159 C C     . LEU C 3 122 ? 61.035  -73.250 46.794  1.00 150.04 ? 145 LEU G C     1 
ATOM   6160 O O     . LEU C 3 122 ? 62.077  -73.600 47.350  1.00 148.98 ? 145 LEU G O     1 
ATOM   6161 C CB    . LEU C 3 122 ? 60.803  -70.889 46.003  1.00 114.02 ? 145 LEU G CB    1 
ATOM   6162 C CG    . LEU C 3 122 ? 60.936  -69.792 44.949  1.00 112.86 ? 145 LEU G CG    1 
ATOM   6163 C CD1   . LEU C 3 122 ? 60.639  -68.437 45.581  1.00 111.84 ? 145 LEU G CD1   1 
ATOM   6164 C CD2   . LEU C 3 122 ? 62.323  -69.815 44.320  1.00 111.14 ? 145 LEU G CD2   1 
ATOM   6165 N N     . ILE C 3 123 ? 59.835  -73.623 47.216  1.00 163.75 ? 146 ILE G N     1 
ATOM   6166 C CA    . ILE C 3 123 ? 59.673  -74.491 48.374  1.00 165.26 ? 146 ILE G CA    1 
ATOM   6167 C C     . ILE C 3 123 ? 59.900  -75.960 48.011  1.00 167.42 ? 146 ILE G C     1 
ATOM   6168 O O     . ILE C 3 123 ? 60.569  -76.691 48.743  1.00 167.65 ? 146 ILE G O     1 
ATOM   6169 C CB    . ILE C 3 123 ? 58.274  -74.324 48.996  1.00 141.43 ? 146 ILE G CB    1 
ATOM   6170 C CG1   . ILE C 3 123 ? 58.026  -72.858 49.360  1.00 139.70 ? 146 ILE G CG1   1 
ATOM   6171 C CG2   . ILE C 3 123 ? 58.116  -75.216 50.218  1.00 143.24 ? 146 ILE G CG2   1 
ATOM   6172 C CD1   . ILE C 3 123 ? 56.568  -72.532 49.581  1.00 142.05 ? 146 ILE G CD1   1 
ATOM   6173 N N     . ARG C 3 124 ? 59.347  -76.377 46.872  1.00 129.59 ? 147 ARG G N     1 
ATOM   6174 C CA    . ARG C 3 124 ? 59.425  -77.768 46.427  1.00 132.27 ? 147 ARG G CA    1 
ATOM   6175 C C     . ARG C 3 124 ? 60.870  -78.197 46.194  1.00 130.92 ? 147 ARG G C     1 
ATOM   6176 O O     . ARG C 3 124 ? 61.275  -79.285 46.604  1.00 132.55 ? 147 ARG G O     1 
ATOM   6177 C CB    . ARG C 3 124 ? 58.592  -77.969 45.155  1.00 172.42 ? 147 ARG G CB    1 
ATOM   6178 C CG    . ARG C 3 124 ? 58.757  -79.319 44.480  1.00 175.30 ? 147 ARG G CG    1 
ATOM   6179 C CD    . ARG C 3 124 ? 57.574  -79.625 43.567  1.00 178.49 ? 147 ARG G CD    1 
ATOM   6180 N NE    . ARG C 3 124 ? 57.188  -78.483 42.739  1.00 177.05 ? 147 ARG G NE    1 
ATOM   6181 C CZ    . ARG C 3 124 ? 57.666  -78.236 41.523  1.00 176.31 ? 147 ARG G CZ    1 
ATOM   6182 N NH1   . ARG C 3 124 ? 58.562  -79.048 40.977  1.00 176.87 ? 147 ARG G NH1   1 
ATOM   6183 N NH2   . ARG C 3 124 ? 57.248  -77.171 40.851  1.00 175.28 ? 147 ARG G NH2   1 
ATOM   6184 N N     . ASN C 3 125 ? 61.648  -77.331 45.553  1.00 154.46 ? 148 ASN G N     1 
ATOM   6185 C CA    . ASN C 3 125 ? 63.047  -77.634 45.265  1.00 153.28 ? 148 ASN G CA    1 
ATOM   6186 C C     . ASN C 3 125 ? 64.013  -77.099 46.324  1.00 150.71 ? 148 ASN G C     1 
ATOM   6187 O O     . ASN C 3 125 ? 65.219  -77.346 46.245  1.00 149.88 ? 148 ASN G O     1 
ATOM   6188 C CB    . ASN C 3 125 ? 63.435  -77.076 43.890  1.00 129.78 ? 148 ASN G CB    1 
ATOM   6189 C CG    . ASN C 3 125 ? 62.633  -77.701 42.751  1.00 132.61 ? 148 ASN G CG    1 
ATOM   6190 O OD1   . ASN C 3 125 ? 62.733  -78.901 42.487  1.00 135.19 ? 148 ASN G OD1   1 
ATOM   6191 N ND2   . ASN C 3 125 ? 61.844  -76.881 42.062  1.00 132.40 ? 148 ASN G ND2   1 
ATOM   6192 N N     . LYS C 3 126 ? 63.474  -76.387 47.314  1.00 135.31 ? 149 LYS G N     1 
ATOM   6193 C CA    . LYS C 3 126 ? 64.278  -75.722 48.340  1.00 133.00 ? 149 LYS G CA    1 
ATOM   6194 C C     . LYS C 3 126 ? 65.395  -74.876 47.726  1.00 130.42 ? 149 LYS G C     1 
ATOM   6195 O O     . LYS C 3 126 ? 66.582  -75.161 47.901  1.00 129.72 ? 149 LYS G O     1 
ATOM   6196 C CB    . LYS C 3 126 ? 64.861  -76.744 49.316  1.00 170.23 ? 149 LYS G CB    1 
ATOM   6197 C CG    . LYS C 3 126 ? 63.959  -77.043 50.499  1.00 171.85 ? 149 LYS G CG    1 
ATOM   6198 C CD    . LYS C 3 126 ? 64.629  -77.991 51.484  1.00 173.00 ? 149 LYS G CD    1 
ATOM   6199 C CE    . LYS C 3 126 ? 63.883  -78.037 52.814  1.00 174.21 ? 149 LYS G CE    1 
ATOM   6200 N NZ    . LYS C 3 126 ? 63.995  -76.752 53.566  1.00 171.81 ? 149 LYS G NZ    1 
ATOM   6201 N N     . ILE C 3 127 ? 64.996  -73.829 47.009  1.00 121.44 ? 150 ILE G N     1 
ATOM   6202 C CA    . ILE C 3 127 ? 65.926  -72.984 46.274  1.00 119.42 ? 150 ILE G CA    1 
ATOM   6203 C C     . ILE C 3 127 ? 65.566  -71.507 46.425  1.00 117.76 ? 150 ILE G C     1 
ATOM   6204 O O     . ILE C 3 127 ? 64.392  -71.146 46.414  1.00 118.56 ? 150 ILE G O     1 
ATOM   6205 C CB    . ILE C 3 127 ? 65.946  -73.381 44.794  1.00 173.53 ? 150 ILE G CB    1 
ATOM   6206 C CG1   . ILE C 3 127 ? 66.768  -74.657 44.630  1.00 174.86 ? 150 ILE G CG1   1 
ATOM   6207 C CG2   . ILE C 3 127 ? 66.523  -72.278 43.943  1.00 171.77 ? 150 ILE G CG2   1 
ATOM   6208 C CD1   . ILE C 3 127 ? 66.629  -75.301 43.292  1.00 176.68 ? 150 ILE G CD1   1 
ATOM   6209 N N     . HIS C 3 128 ? 66.580  -70.669 46.626  1.00 134.62 ? 151 HIS G N     1 
ATOM   6210 C CA    . HIS C 3 128 ? 66.387  -69.227 46.742  1.00 133.27 ? 151 HIS G CA    1 
ATOM   6211 C C     . HIS C 3 128 ? 66.313  -68.501 45.394  1.00 132.98 ? 151 HIS G C     1 
ATOM   6212 O O     . HIS C 3 128 ? 65.462  -67.631 45.204  1.00 133.12 ? 151 HIS G O     1 
ATOM   6213 C CB    . HIS C 3 128 ? 67.506  -68.620 47.581  1.00 149.72 ? 151 HIS G CB    1 
ATOM   6214 C CG    . HIS C 3 128 ? 67.593  -69.170 48.969  1.00 150.05 ? 151 HIS G CG    1 
ATOM   6215 N ND1   . HIS C 3 128 ? 67.513  -70.520 49.251  1.00 151.47 ? 151 HIS G ND1   1 
ATOM   6216 C CD2   . HIS C 3 128 ? 67.773  -68.552 50.160  1.00 149.41 ? 151 HIS G CD2   1 
ATOM   6217 C CE1   . HIS C 3 128 ? 67.633  -70.706 50.551  1.00 151.63 ? 151 HIS G CE1   1 
ATOM   6218 N NE2   . HIS C 3 128 ? 67.793  -69.526 51.127  1.00 150.37 ? 151 HIS G NE2   1 
ATOM   6219 N N     . ARG C 3 129 ? 67.206  -68.856 44.468  1.00 117.20 ? 152 ARG G N     1 
ATOM   6220 C CA    . ARG C 3 129 ? 67.242  -68.223 43.145  1.00 117.15 ? 152 ARG G CA    1 
ATOM   6221 C C     . ARG C 3 129 ? 66.495  -69.035 42.090  1.00 119.03 ? 152 ARG G C     1 
ATOM   6222 O O     . ARG C 3 129 ? 66.914  -70.133 41.723  1.00 120.03 ? 152 ARG G O     1 
ATOM   6223 C CB    . ARG C 3 129 ? 68.681  -68.017 42.664  1.00 133.34 ? 152 ARG G CB    1 
ATOM   6224 C CG    . ARG C 3 129 ? 69.667  -67.553 43.710  1.00 131.92 ? 152 ARG G CG    1 
ATOM   6225 C CD    . ARG C 3 129 ? 69.185  -66.332 44.471  1.00 131.05 ? 152 ARG G CD    1 
ATOM   6226 N NE    . ARG C 3 129 ? 70.256  -65.745 45.274  1.00 129.90 ? 152 ARG G NE    1 
ATOM   6227 C CZ    . ARG C 3 129 ? 70.842  -66.340 46.316  1.00 129.70 ? 152 ARG G CZ    1 
ATOM   6228 N NH1   . ARG C 3 129 ? 70.474  -67.555 46.699  1.00 130.59 ? 152 ARG G NH1   1 
ATOM   6229 N NH2   . ARG C 3 129 ? 71.807  -65.719 46.979  1.00 128.88 ? 152 ARG G NH2   1 
ATOM   6230 N N     . LEU C 3 130 ? 65.400  -68.485 41.584  1.00 108.68 ? 153 LEU G N     1 
ATOM   6231 C CA    . LEU C 3 130 ? 64.688  -69.133 40.499  1.00 110.67 ? 153 LEU G CA    1 
ATOM   6232 C C     . LEU C 3 130 ? 64.800  -68.286 39.240  1.00 110.62 ? 153 LEU G C     1 
ATOM   6233 O O     . LEU C 3 130 ? 64.113  -67.270 39.116  1.00 110.57 ? 153 LEU G O     1 
ATOM   6234 C CB    . LEU C 3 130 ? 63.224  -69.344 40.885  1.00 111.15 ? 153 LEU G CB    1 
ATOM   6235 C CG    . LEU C 3 130 ? 62.280  -69.956 39.853  1.00 113.65 ? 153 LEU G CG    1 
ATOM   6236 C CD1   . LEU C 3 130 ? 62.843  -71.255 39.280  1.00 114.92 ? 153 LEU G CD1   1 
ATOM   6237 C CD2   . LEU C 3 130 ? 60.913  -70.186 40.483  1.00 115.36 ? 153 LEU G CD2   1 
ATOM   6238 N N     . PRO C 3 131 ? 65.670  -68.699 38.298  1.00 110.61 ? 154 PRO G N     1 
ATOM   6239 C CA    . PRO C 3 131 ? 65.824  -67.926 37.061  1.00 110.83 ? 154 PRO G CA    1 
ATOM   6240 C C     . PRO C 3 131 ? 64.599  -68.045 36.157  1.00 112.95 ? 154 PRO G C     1 
ATOM   6241 O O     . PRO C 3 131 ? 64.184  -69.161 35.830  1.00 114.80 ? 154 PRO G O     1 
ATOM   6242 C CB    . PRO C 3 131 ? 67.058  -68.559 36.412  1.00 122.67 ? 154 PRO G CB    1 
ATOM   6243 C CG    . PRO C 3 131 ? 67.027  -69.978 36.888  1.00 123.73 ? 154 PRO G CG    1 
ATOM   6244 C CD    . PRO C 3 131 ? 66.507  -69.914 38.300  1.00 122.79 ? 154 PRO G CD    1 
ATOM   6245 N N     . VAL C 3 132 ? 64.051  -66.919 35.718  1.00 112.18 ? 155 VAL G N     1 
ATOM   6246 C CA    . VAL C 3 132 ? 62.945  -66.982 34.776  1.00 114.43 ? 155 VAL G CA    1 
ATOM   6247 C C     . VAL C 3 132 ? 63.514  -66.952 33.362  1.00 115.35 ? 155 VAL G C     1 
ATOM   6248 O O     . VAL C 3 132 ? 64.321  -66.089 33.005  1.00 114.27 ? 155 VAL G O     1 
ATOM   6249 C CB    . VAL C 3 132 ? 61.898  -65.848 34.983  1.00 147.36 ? 155 VAL G CB    1 
ATOM   6250 C CG1   . VAL C 3 132 ? 61.210  -66.004 36.328  1.00 147.07 ? 155 VAL G CG1   1 
ATOM   6251 C CG2   . VAL C 3 132 ? 62.518  -64.465 34.849  1.00 145.94 ? 155 VAL G CG2   1 
ATOM   6252 N N     . ILE C 3 133 ? 63.118  -67.939 32.569  1.00 125.89 ? 156 ILE G N     1 
ATOM   6253 C CA    . ILE C 3 133 ? 63.642  -68.085 31.223  1.00 127.21 ? 156 ILE G CA    1 
ATOM   6254 C C     . ILE C 3 133 ? 62.498  -68.224 30.232  1.00 130.01 ? 156 ILE G C     1 
ATOM   6255 O O     . ILE C 3 133 ? 61.624  -69.074 30.401  1.00 131.73 ? 156 ILE G O     1 
ATOM   6256 C CB    . ILE C 3 133 ? 64.581  -69.305 31.108  1.00 119.39 ? 156 ILE G CB    1 
ATOM   6257 C CG1   . ILE C 3 133 ? 65.716  -69.209 32.131  1.00 116.87 ? 156 ILE G CG1   1 
ATOM   6258 C CG2   . ILE C 3 133 ? 65.146  -69.413 29.702  1.00 121.02 ? 156 ILE G CG2   1 
ATOM   6259 C CD1   . ILE C 3 133 ? 66.722  -70.337 32.047  1.00 117.49 ? 156 ILE G CD1   1 
ATOM   6260 N N     . ASP C 3 134 ? 62.501  -67.369 29.212  1.00 144.55 ? 157 ASP G N     1 
ATOM   6261 C CA    . ASP C 3 134 ? 61.523  -67.435 28.131  1.00 147.46 ? 157 ASP G CA    1 
ATOM   6262 C C     . ASP C 3 134 ? 61.734  -68.702 27.312  1.00 149.78 ? 157 ASP G C     1 
ATOM   6263 O O     . ASP C 3 134 ? 62.774  -68.862 26.681  1.00 149.79 ? 157 ASP G O     1 
ATOM   6264 C CB    . ASP C 3 134 ? 61.638  -66.196 27.238  1.00 145.59 ? 157 ASP G CB    1 
ATOM   6265 C CG    . ASP C 3 134 ? 60.680  -66.227 26.063  1.00 148.81 ? 157 ASP G CG    1 
ATOM   6266 O OD1   . ASP C 3 134 ? 59.558  -66.754 26.220  1.00 150.55 ? 157 ASP G OD1   1 
ATOM   6267 O OD2   . ASP C 3 134 ? 61.049  -65.719 24.982  1.00 149.84 ? 157 ASP G OD2   1 
ATOM   6268 N N     . PRO C 3 135 ? 60.745  -69.610 27.316  1.00 151.93 ? 158 PRO G N     1 
ATOM   6269 C CA    . PRO C 3 135 ? 60.907  -70.896 26.632  1.00 154.53 ? 158 PRO G CA    1 
ATOM   6270 C C     . PRO C 3 135 ? 60.985  -70.748 25.120  1.00 156.91 ? 158 PRO G C     1 
ATOM   6271 O O     . PRO C 3 135 ? 61.649  -71.550 24.462  1.00 158.43 ? 158 PRO G O     1 
ATOM   6272 C CB    . PRO C 3 135 ? 59.653  -71.671 27.040  1.00 134.70 ? 158 PRO G CB    1 
ATOM   6273 C CG    . PRO C 3 135 ? 58.643  -70.617 27.318  1.00 134.29 ? 158 PRO G CG    1 
ATOM   6274 C CD    . PRO C 3 135 ? 59.412  -69.475 27.926  1.00 130.69 ? 158 PRO G CD    1 
ATOM   6275 N N     . GLU C 3 136 ? 60.314  -69.736 24.579  1.00 154.47 ? 159 GLU G N     1 
ATOM   6276 C CA    . GLU C 3 136 ? 60.308  -69.516 23.139  1.00 156.96 ? 159 GLU G CA    1 
ATOM   6277 C C     . GLU C 3 136 ? 61.688  -69.100 22.638  1.00 155.69 ? 159 GLU G C     1 
ATOM   6278 O O     . GLU C 3 136 ? 62.194  -69.664 21.669  1.00 157.78 ? 159 GLU G O     1 
ATOM   6279 C CB    . GLU C 3 136 ? 59.272  -68.457 22.757  1.00 206.31 ? 159 GLU G CB    1 
ATOM   6280 C CG    . GLU C 3 136 ? 59.039  -68.343 21.256  1.00 209.59 ? 159 GLU G CG    1 
ATOM   6281 C CD    . GLU C 3 136 ? 58.205  -67.133 20.881  1.00 210.39 ? 159 GLU G CD    1 
ATOM   6282 O OE1   . GLU C 3 136 ? 58.177  -66.774 19.685  1.00 212.67 ? 159 GLU G OE1   1 
ATOM   6283 O OE2   . GLU C 3 136 ? 57.578  -66.539 21.783  1.00 208.98 ? 159 GLU G OE2   1 
ATOM   6284 N N     . SER C 3 137 ? 62.270  -68.086 23.274  1.00 144.27 ? 160 SER G N     1 
ATOM   6285 C CA    . SER C 3 137 ? 63.617  -67.625 22.932  1.00 143.03 ? 160 SER G CA    1 
ATOM   6286 C C     . SER C 3 137 ? 64.760  -68.381 23.628  1.00 141.36 ? 160 SER G C     1 
ATOM   6287 O O     . SER C 3 137 ? 65.885  -68.423 23.122  1.00 141.48 ? 160 SER G O     1 
ATOM   6288 C CB    . SER C 3 137 ? 63.739  -66.133 23.248  1.00 130.31 ? 160 SER G CB    1 
ATOM   6289 O OG    . SER C 3 137 ? 63.645  -65.892 24.642  1.00 127.56 ? 160 SER G OG    1 
ATOM   6290 N N     . GLY C 3 138 ? 64.472  -68.985 24.775  1.00 168.89 ? 161 GLY G N     1 
ATOM   6291 C CA    . GLY C 3 138 ? 65.503  -69.649 25.555  1.00 167.33 ? 161 GLY G CA    1 
ATOM   6292 C C     . GLY C 3 138 ? 66.420  -68.704 26.317  1.00 164.15 ? 161 GLY G C     1 
ATOM   6293 O O     . GLY C 3 138 ? 67.463  -69.125 26.813  1.00 163.04 ? 161 GLY G O     1 
ATOM   6294 N N     . ASN C 3 139 ? 66.038  -67.433 26.421  1.00 123.54 ? 162 ASN G N     1 
ATOM   6295 C CA    . ASN C 3 139 ? 66.879  -66.432 27.077  1.00 120.94 ? 162 ASN G CA    1 
ATOM   6296 C C     . ASN C 3 139 ? 66.548  -66.251 28.550  1.00 118.64 ? 162 ASN G C     1 
ATOM   6297 O O     . ASN C 3 139 ? 65.377  -66.165 28.914  1.00 118.94 ? 162 ASN G O     1 
ATOM   6298 C CB    . ASN C 3 139 ? 66.748  -65.087 26.370  1.00 128.81 ? 162 ASN G CB    1 
ATOM   6299 C CG    . ASN C 3 139 ? 67.021  -65.180 24.891  1.00 131.33 ? 162 ASN G CG    1 
ATOM   6300 O OD1   . ASN C 3 139 ? 67.545  -66.184 24.404  1.00 132.65 ? 162 ASN G OD1   1 
ATOM   6301 N ND2   . ASN C 3 139 ? 66.677  -64.126 24.161  1.00 132.30 ? 162 ASN G ND2   1 
ATOM   6302 N N     . THR C 3 140 ? 67.570  -66.171 29.396  1.00 116.58 ? 163 THR G N     1 
ATOM   6303 C CA    . THR C 3 140 ? 67.325  -65.946 30.817  1.00 114.51 ? 163 THR G CA    1 
ATOM   6304 C C     . THR C 3 140 ? 67.055  -64.469 31.044  1.00 113.49 ? 163 THR G C     1 
ATOM   6305 O O     . THR C 3 140 ? 67.925  -63.630 30.830  1.00 112.84 ? 163 THR G O     1 
ATOM   6306 C CB    . THR C 3 140 ? 68.521  -66.385 31.679  1.00 112.92 ? 163 THR G CB    1 
ATOM   6307 O OG1   . THR C 3 140 ? 68.820  -67.764 31.427  1.00 114.24 ? 163 THR G OG1   1 
ATOM   6308 C CG2   . THR C 3 140 ? 68.220  -66.185 33.159  1.00 111.05 ? 163 THR G CG2   1 
ATOM   6309 N N     . LEU C 3 141 ? 65.840  -64.153 31.464  1.00 113.70 ? 164 LEU G N     1 
ATOM   6310 C CA    . LEU C 3 141 ? 65.443  -62.765 31.646  1.00 113.26 ? 164 LEU G CA    1 
ATOM   6311 C C     . LEU C 3 141 ? 65.859  -62.168 32.984  1.00 111.11 ? 164 LEU G C     1 
ATOM   6312 O O     . LEU C 3 141 ? 66.470  -61.104 33.044  1.00 110.41 ? 164 LEU G O     1 
ATOM   6313 C CB    . LEU C 3 141 ? 63.931  -62.648 31.485  1.00 114.87 ? 164 LEU G CB    1 
ATOM   6314 C CG    . LEU C 3 141 ? 63.369  -63.206 30.176  1.00 117.39 ? 164 LEU G CG    1 
ATOM   6315 C CD1   . LEU C 3 141 ? 61.853  -63.307 30.240  1.00 119.10 ? 164 LEU G CD1   1 
ATOM   6316 C CD2   . LEU C 3 141 ? 63.805  -62.345 28.997  1.00 118.34 ? 164 LEU G CD2   1 
ATOM   6317 N N     . TYR C 3 142 ? 65.537  -62.879 34.056  1.00 115.60 ? 165 TYR G N     1 
ATOM   6318 C CA    . TYR C 3 142 ? 65.686  -62.352 35.406  1.00 113.92 ? 165 TYR G CA    1 
ATOM   6319 C C     . TYR C 3 142 ? 65.770  -63.489 36.429  1.00 113.18 ? 165 TYR G C     1 
ATOM   6320 O O     . TYR C 3 142 ? 65.383  -64.625 36.152  1.00 114.25 ? 165 TYR G O     1 
ATOM   6321 C CB    . TYR C 3 142 ? 64.521  -61.407 35.731  1.00 137.59 ? 165 TYR G CB    1 
ATOM   6322 C CG    . TYR C 3 142 ? 64.536  -60.844 37.137  1.00 136.30 ? 165 TYR G CG    1 
ATOM   6323 C CD1   . TYR C 3 142 ? 65.569  -60.021 37.566  1.00 135.01 ? 165 TYR G CD1   1 
ATOM   6324 C CD2   . TYR C 3 142 ? 63.513  -61.132 38.035  1.00 136.68 ? 165 TYR G CD2   1 
ATOM   6325 C CE1   . TYR C 3 142 ? 65.587  -59.504 38.853  1.00 134.11 ? 165 TYR G CE1   1 
ATOM   6326 C CE2   . TYR C 3 142 ? 63.521  -60.618 39.323  1.00 135.76 ? 165 TYR G CE2   1 
ATOM   6327 C CZ    . TYR C 3 142 ? 64.561  -59.805 39.726  1.00 134.47 ? 165 TYR G CZ    1 
ATOM   6328 O OH    . TYR C 3 142 ? 64.578  -59.292 41.002  1.00 133.83 ? 165 TYR G OH    1 
ATOM   6329 N N     . ILE C 3 143 ? 66.287  -63.186 37.611  1.00 106.36 ? 166 ILE G N     1 
ATOM   6330 C CA    . ILE C 3 143 ? 66.370  -64.180 38.668  1.00 105.79 ? 166 ILE G CA    1 
ATOM   6331 C C     . ILE C 3 143 ? 65.408  -63.833 39.801  1.00 105.71 ? 166 ILE G C     1 
ATOM   6332 O O     . ILE C 3 143 ? 65.575  -62.816 40.475  1.00 104.84 ? 166 ILE G O     1 
ATOM   6333 C CB    . ILE C 3 143 ? 67.802  -64.290 39.218  1.00 104.35 ? 166 ILE G CB    1 
ATOM   6334 C CG1   . ILE C 3 143 ? 68.792  -64.538 38.078  1.00 104.73 ? 166 ILE G CG1   1 
ATOM   6335 C CG2   . ILE C 3 143 ? 67.892  -65.391 40.261  1.00 104.08 ? 166 ILE G CG2   1 
ATOM   6336 C CD1   . ILE C 3 143 ? 70.237  -64.550 38.521  1.00 103.66 ? 166 ILE G CD1   1 
ATOM   6337 N N     . LEU C 3 144 ? 64.399  -64.677 40.001  1.00 118.62 ? 167 LEU G N     1 
ATOM   6338 C CA    . LEU C 3 144 ? 63.431  -64.483 41.079  1.00 118.96 ? 167 LEU G CA    1 
ATOM   6339 C C     . LEU C 3 144 ? 64.066  -64.695 42.452  1.00 117.64 ? 167 LEU G C     1 
ATOM   6340 O O     . LEU C 3 144 ? 64.953  -65.533 42.610  1.00 117.04 ? 167 LEU G O     1 
ATOM   6341 C CB    . LEU C 3 144 ? 62.238  -65.425 40.905  1.00 109.28 ? 167 LEU G CB    1 
ATOM   6342 C CG    . LEU C 3 144 ? 60.930  -64.781 40.445  1.00 110.99 ? 167 LEU G CG    1 
ATOM   6343 C CD1   . LEU C 3 144 ? 60.301  -63.978 41.562  1.00 110.98 ? 167 LEU G CD1   1 
ATOM   6344 C CD2   . LEU C 3 144 ? 61.165  -63.891 39.244  1.00 111.04 ? 167 LEU G CD2   1 
ATOM   6345 N N     . THR C 3 145 ? 63.605  -63.932 43.440  1.00 105.78 ? 168 THR G N     1 
ATOM   6346 C CA    . THR C 3 145 ? 64.124  -64.024 44.801  1.00 104.79 ? 168 THR G CA    1 
ATOM   6347 C C     . THR C 3 145 ? 62.971  -63.905 45.783  1.00 105.91 ? 168 THR G C     1 
ATOM   6348 O O     . THR C 3 145 ? 61.953  -63.288 45.470  1.00 107.12 ? 168 THR G O     1 
ATOM   6349 C CB    . THR C 3 145 ? 65.173  -62.926 45.094  1.00 172.67 ? 168 THR G CB    1 
ATOM   6350 O OG1   . THR C 3 145 ? 66.052  -62.791 43.972  1.00 172.12 ? 168 THR G OG1   1 
ATOM   6351 C CG2   . THR C 3 145 ? 65.996  -63.265 46.334  1.00 171.70 ? 168 THR G CG2   1 
ATOM   6352 N N     . HIS C 3 146 ? 63.126  -64.506 46.960  1.00 105.76 ? 169 HIS G N     1 
ATOM   6353 C CA    . HIS C 3 146 ? 62.122  -64.411 48.012  1.00 106.99 ? 169 HIS G CA    1 
ATOM   6354 C C     . HIS C 3 146 ? 61.811  -62.956 48.339  1.00 107.05 ? 169 HIS G C     1 
ATOM   6355 O O     . HIS C 3 146 ? 60.661  -62.598 48.597  1.00 108.69 ? 169 HIS G O     1 
ATOM   6356 C CB    . HIS C 3 146 ? 62.594  -65.135 49.270  1.00 132.09 ? 169 HIS G CB    1 
ATOM   6357 C CG    . HIS C 3 146 ? 62.629  -66.623 49.138  1.00 132.81 ? 169 HIS G CG    1 
ATOM   6358 N ND1   . HIS C 3 146 ? 61.611  -67.434 49.594  1.00 134.78 ? 169 HIS G ND1   1 
ATOM   6359 C CD2   . HIS C 3 146 ? 63.565  -67.450 48.613  1.00 132.15 ? 169 HIS G CD2   1 
ATOM   6360 C CE1   . HIS C 3 146 ? 61.916  -68.697 49.353  1.00 135.33 ? 169 HIS G CE1   1 
ATOM   6361 N NE2   . HIS C 3 146 ? 63.096  -68.735 48.758  1.00 133.76 ? 169 HIS G NE2   1 
ATOM   6362 N N     . LYS C 3 147 ? 62.851  -62.126 48.320  1.00 107.47 ? 170 LYS G N     1 
ATOM   6363 C CA    . LYS C 3 147 ? 62.719  -60.697 48.588  1.00 107.70 ? 170 LYS G CA    1 
ATOM   6364 C C     . LYS C 3 147 ? 61.828  -60.022 47.552  1.00 108.95 ? 170 LYS G C     1 
ATOM   6365 O O     . LYS C 3 147 ? 60.929  -59.247 47.891  1.00 110.43 ? 170 LYS G O     1 
ATOM   6366 C CB    . LYS C 3 147 ? 64.097  -60.028 48.602  1.00 120.59 ? 170 LYS G CB    1 
ATOM   6367 C CG    . LYS C 3 147 ? 65.116  -60.682 49.527  1.00 119.46 ? 170 LYS G CG    1 
ATOM   6368 C CD    . LYS C 3 147 ? 66.533  -60.413 49.040  1.00 118.08 ? 170 LYS G CD    1 
ATOM   6369 C CE    . LYS C 3 147 ? 66.966  -58.976 49.295  1.00 118.11 ? 170 LYS G CE    1 
ATOM   6370 N NZ    . LYS C 3 147 ? 67.576  -58.853 50.642  1.00 117.89 ? 170 LYS G NZ    1 
ATOM   6371 N N     . ARG C 3 148 ? 62.094  -60.330 46.287  1.00 106.69 ? 171 ARG G N     1 
ATOM   6372 C CA    . ARG C 3 148 ? 61.377  -59.742 45.164  1.00 107.92 ? 171 ARG G CA    1 
ATOM   6373 C C     . ARG C 3 148 ? 59.870  -60.025 45.228  1.00 110.10 ? 171 ARG G C     1 
ATOM   6374 O O     . ARG C 3 148 ? 59.049  -59.156 44.923  1.00 111.66 ? 171 ARG G O     1 
ATOM   6375 C CB    . ARG C 3 148 ? 61.964  -60.262 43.847  1.00 128.67 ? 171 ARG G CB    1 
ATOM   6376 C CG    . ARG C 3 148 ? 61.449  -59.558 42.607  1.00 129.89 ? 171 ARG G CG    1 
ATOM   6377 C CD    . ARG C 3 148 ? 62.003  -58.150 42.501  1.00 129.60 ? 171 ARG G CD    1 
ATOM   6378 N NE    . ARG C 3 148 ? 61.381  -57.403 41.411  1.00 131.18 ? 171 ARG G NE    1 
ATOM   6379 C CZ    . ARG C 3 148 ? 61.707  -56.158 41.074  1.00 131.56 ? 171 ARG G CZ    1 
ATOM   6380 N NH1   . ARG C 3 148 ? 62.657  -55.517 41.742  1.00 130.48 ? 171 ARG G NH1   1 
ATOM   6381 N NH2   . ARG C 3 148 ? 61.084  -55.555 40.070  1.00 133.29 ? 171 ARG G NH2   1 
ATOM   6382 N N     . ILE C 3 149 ? 59.512  -61.236 45.643  1.00 110.49 ? 172 ILE G N     1 
ATOM   6383 C CA    . ILE C 3 149 ? 58.113  -61.645 45.672  1.00 112.85 ? 172 ILE G CA    1 
ATOM   6384 C C     . ILE C 3 149 ? 57.354  -60.957 46.797  1.00 114.15 ? 172 ILE G C     1 
ATOM   6385 O O     . ILE C 3 149 ? 56.255  -60.448 46.588  1.00 116.30 ? 172 ILE G O     1 
ATOM   6386 C CB    . ILE C 3 149 ? 57.977  -63.163 45.826  1.00 113.27 ? 172 ILE G CB    1 
ATOM   6387 C CG1   . ILE C 3 149 ? 58.727  -63.868 44.703  1.00 112.35 ? 172 ILE G CG1   1 
ATOM   6388 C CG2   . ILE C 3 149 ? 56.518  -63.564 45.800  1.00 116.08 ? 172 ILE G CG2   1 
ATOM   6389 C CD1   . ILE C 3 149 ? 58.828  -65.347 44.883  1.00 112.75 ? 172 ILE G CD1   1 
ATOM   6390 N N     . LEU C 3 150 ? 57.947  -60.936 47.986  1.00 113.10 ? 173 LEU G N     1 
ATOM   6391 C CA    . LEU C 3 150 ? 57.295  -60.339 49.149  1.00 114.51 ? 173 LEU G CA    1 
ATOM   6392 C C     . LEU C 3 150 ? 57.048  -58.845 48.924  1.00 115.31 ? 173 LEU G C     1 
ATOM   6393 O O     . LEU C 3 150 ? 55.965  -58.331 49.216  1.00 117.68 ? 173 LEU G O     1 
ATOM   6394 C CB    . LEU C 3 150 ? 58.139  -60.558 50.411  1.00 120.90 ? 173 LEU G CB    1 
ATOM   6395 C CG    . LEU C 3 150 ? 57.436  -60.862 51.744  1.00 122.57 ? 173 LEU G CG    1 
ATOM   6396 C CD1   . LEU C 3 150 ? 58.397  -60.690 52.910  1.00 121.31 ? 173 LEU G CD1   1 
ATOM   6397 C CD2   . LEU C 3 150 ? 56.187  -60.016 51.961  1.00 125.23 ? 173 LEU G CD2   1 
ATOM   6398 N N     . LYS C 3 151 ? 58.059  -58.156 48.402  1.00 119.66 ? 174 LYS G N     1 
ATOM   6399 C CA    . LYS C 3 151 ? 57.941  -56.732 48.117  1.00 120.57 ? 174 LYS G CA    1 
ATOM   6400 C C     . LYS C 3 151 ? 56.811  -56.505 47.125  1.00 122.71 ? 174 LYS G C     1 
ATOM   6401 O O     . LYS C 3 151 ? 55.938  -55.661 47.332  1.00 124.99 ? 174 LYS G O     1 
ATOM   6402 C CB    . LYS C 3 151 ? 59.256  -56.176 47.570  1.00 125.39 ? 174 LYS G CB    1 
ATOM   6403 C CG    . LYS C 3 151 ? 59.235  -54.681 47.304  1.00 126.55 ? 174 LYS G CG    1 
ATOM   6404 C CD    . LYS C 3 151 ? 60.251  -53.961 48.168  1.00 125.67 ? 174 LYS G CD    1 
ATOM   6405 C CE    . LYS C 3 151 ? 60.429  -52.522 47.721  1.00 126.85 ? 174 LYS G CE    1 
ATOM   6406 N NZ    . LYS C 3 151 ? 61.515  -51.843 48.481  1.00 126.17 ? 174 LYS G NZ    1 
ATOM   6407 N N     . PHE C 3 152 ? 56.828  -57.287 46.053  1.00 138.06 ? 175 PHE G N     1 
ATOM   6408 C CA    . PHE C 3 152 ? 55.779  -57.243 45.045  1.00 140.20 ? 175 PHE G CA    1 
ATOM   6409 C C     . PHE C 3 152 ? 54.418  -57.561 45.651  1.00 142.81 ? 175 PHE G C     1 
ATOM   6410 O O     . PHE C 3 152 ? 53.400  -56.996 45.247  1.00 145.36 ? 175 PHE G O     1 
ATOM   6411 C CB    . PHE C 3 152 ? 56.096  -58.224 43.917  1.00 134.78 ? 175 PHE G CB    1 
ATOM   6412 C CG    . PHE C 3 152 ? 55.043  -58.290 42.840  1.00 137.13 ? 175 PHE G CG    1 
ATOM   6413 C CD1   . PHE C 3 152 ? 55.071  -57.410 41.767  1.00 137.77 ? 175 PHE G CD1   1 
ATOM   6414 C CD2   . PHE C 3 152 ? 54.041  -59.250 42.886  1.00 138.96 ? 175 PHE G CD2   1 
ATOM   6415 C CE1   . PHE C 3 152 ? 54.107  -57.470 40.770  1.00 140.15 ? 175 PHE G CE1   1 
ATOM   6416 C CE2   . PHE C 3 152 ? 53.076  -59.318 41.892  1.00 141.39 ? 175 PHE G CE2   1 
ATOM   6417 C CZ    . PHE C 3 152 ? 53.109  -58.427 40.832  1.00 141.96 ? 175 PHE G CZ    1 
ATOM   6418 N N     . LEU C 3 153 ? 54.404  -58.476 46.614  1.00 134.30 ? 176 LEU G N     1 
ATOM   6419 C CA    . LEU C 3 153 ? 53.153  -58.901 47.221  1.00 136.97 ? 176 LEU G CA    1 
ATOM   6420 C C     . LEU C 3 153 ? 52.472  -57.738 47.933  1.00 139.08 ? 176 LEU G C     1 
ATOM   6421 O O     . LEU C 3 153 ? 51.362  -57.354 47.577  1.00 141.92 ? 176 LEU G O     1 
ATOM   6422 C CB    . LEU C 3 153 ? 53.393  -60.055 48.199  1.00 122.52 ? 176 LEU G CB    1 
ATOM   6423 C CG    . LEU C 3 153 ? 52.439  -61.251 48.103  1.00 124.61 ? 176 LEU G CG    1 
ATOM   6424 C CD1   . LEU C 3 153 ? 50.976  -60.817 48.224  1.00 128.26 ? 176 LEU G CD1   1 
ATOM   6425 C CD2   . LEU C 3 153 ? 52.679  -62.037 46.813  1.00 123.99 ? 176 LEU G CD2   1 
ATOM   6426 N N     . LYS C 3 154 ? 53.159  -57.155 48.909  1.00 141.96 ? 177 LYS G N     1 
ATOM   6427 C CA    . LYS C 3 154 ? 52.556  -56.127 49.751  1.00 144.22 ? 177 LYS G CA    1 
ATOM   6428 C C     . LYS C 3 154 ? 52.320  -54.836 48.971  1.00 145.55 ? 177 LYS G C     1 
ATOM   6429 O O     . LYS C 3 154 ? 51.346  -54.118 49.215  1.00 148.62 ? 177 LYS G O     1 
ATOM   6430 C CB    . LYS C 3 154 ? 53.438  -55.865 50.982  1.00 149.78 ? 177 LYS G CB    1 
ATOM   6431 C CG    . LYS C 3 154 ? 52.927  -54.777 51.939  1.00 152.25 ? 177 LYS G CG    1 
ATOM   6432 C CD    . LYS C 3 154 ? 51.480  -55.008 52.394  1.00 155.80 ? 177 LYS G CD    1 
ATOM   6433 C CE    . LYS C 3 154 ? 51.339  -56.240 53.279  1.00 155.69 ? 177 LYS G CE    1 
ATOM   6434 N NZ    . LYS C 3 154 ? 49.911  -56.537 53.591  1.00 159.40 ? 177 LYS G NZ    1 
ATOM   6435 N N     . LEU C 3 155 ? 53.203  -54.553 48.020  1.00 126.17 ? 178 LEU G N     1 
ATOM   6436 C CA    . LEU C 3 155 ? 53.122  -53.310 47.264  1.00 127.41 ? 178 LEU G CA    1 
ATOM   6437 C C     . LEU C 3 155 ? 51.920  -53.305 46.320  1.00 130.15 ? 178 LEU G C     1 
ATOM   6438 O O     . LEU C 3 155 ? 51.246  -52.284 46.164  1.00 132.87 ? 178 LEU G O     1 
ATOM   6439 C CB    . LEU C 3 155 ? 54.418  -53.079 46.478  1.00 124.32 ? 178 LEU G CB    1 
ATOM   6440 C CG    . LEU C 3 155 ? 54.579  -51.764 45.712  1.00 125.42 ? 178 LEU G CG    1 
ATOM   6441 C CD1   . LEU C 3 155 ? 54.460  -50.565 46.641  1.00 127.25 ? 178 LEU G CD1   1 
ATOM   6442 C CD2   . LEU C 3 155 ? 55.910  -51.741 44.984  1.00 122.75 ? 178 LEU G CD2   1 
ATOM   6443 N N     . PHE C 3 156 ? 51.675  -54.436 45.664  1.00 140.61 ? 179 PHE G N     1 
ATOM   6444 C CA    . PHE C 3 156 ? 50.579  -54.533 44.704  1.00 143.29 ? 179 PHE G CA    1 
ATOM   6445 C C     . PHE C 3 156 ? 49.266  -55.129 45.228  1.00 146.22 ? 179 PHE G C     1 
ATOM   6446 O O     . PHE C 3 156 ? 48.247  -55.053 44.545  1.00 149.10 ? 179 PHE G O     1 
ATOM   6447 C CB    . PHE C 3 156 ? 51.047  -55.328 43.488  1.00 190.31 ? 179 PHE G CB    1 
ATOM   6448 C CG    . PHE C 3 156 ? 52.080  -54.613 42.672  1.00 188.52 ? 179 PHE G CG    1 
ATOM   6449 C CD1   . PHE C 3 156 ? 51.704  -53.757 41.653  1.00 190.42 ? 179 PHE G CD1   1 
ATOM   6450 C CD2   . PHE C 3 156 ? 53.427  -54.780 42.937  1.00 185.24 ? 179 PHE G CD2   1 
ATOM   6451 C CE1   . PHE C 3 156 ? 52.654  -53.090 40.902  1.00 189.07 ? 179 PHE G CE1   1 
ATOM   6452 C CE2   . PHE C 3 156 ? 54.383  -54.118 42.188  1.00 183.90 ? 179 PHE G CE2   1 
ATOM   6453 C CZ    . PHE C 3 156 ? 53.996  -53.272 41.168  1.00 185.82 ? 179 PHE G CZ    1 
ATOM   6454 N N     . ILE C 3 157 ? 49.266  -55.705 46.426  1.00 163.46 ? 180 ILE G N     1 
ATOM   6455 C CA    . ILE C 3 157 ? 48.028  -56.277 46.955  1.00 166.56 ? 180 ILE G CA    1 
ATOM   6456 C C     . ILE C 3 157 ? 47.136  -55.157 47.488  1.00 169.99 ? 180 ILE G C     1 
ATOM   6457 O O     . ILE C 3 157 ? 47.623  -54.193 48.080  1.00 169.49 ? 180 ILE G O     1 
ATOM   6458 C CB    . ILE C 3 157 ? 48.291  -57.332 48.069  1.00 163.61 ? 180 ILE G CB    1 
ATOM   6459 C CG1   . ILE C 3 157 ? 47.018  -58.122 48.390  1.00 166.99 ? 180 ILE G CG1   1 
ATOM   6460 C CG2   . ILE C 3 157 ? 48.856  -56.687 49.334  1.00 162.69 ? 180 ILE G CG2   1 
ATOM   6461 C CD1   . ILE C 3 157 ? 46.529  -58.983 47.252  1.00 167.96 ? 180 ILE G CD1   1 
ATOM   6462 N N     . THR C 3 158 ? 45.834  -55.270 47.245  1.00 186.07 ? 181 THR G N     1 
ATOM   6463 C CA    . THR C 3 158 ? 44.871  -54.286 47.737  1.00 189.97 ? 181 THR G CA    1 
ATOM   6464 C C     . THR C 3 158 ? 44.635  -54.445 49.242  1.00 191.00 ? 181 THR G C     1 
ATOM   6465 O O     . THR C 3 158 ? 45.013  -55.457 49.832  1.00 189.19 ? 181 THR G O     1 
ATOM   6466 C CB    . THR C 3 158 ? 43.529  -54.368 46.974  1.00 161.12 ? 181 THR G CB    1 
ATOM   6467 O OG1   . THR C 3 158 ? 42.465  -53.915 47.821  1.00 165.29 ? 181 THR G OG1   1 
ATOM   6468 C CG2   . THR C 3 158 ? 43.246  -55.788 46.502  1.00 160.91 ? 181 THR G CG2   1 
ATOM   6469 N N     . GLU C 3 159 ? 44.056  -53.422 49.865  1.00 228.04 ? 182 GLU G N     1 
ATOM   6470 C CA    . GLU C 3 159 ? 43.880  -53.398 51.320  1.00 229.31 ? 182 GLU G CA    1 
ATOM   6471 C C     . GLU C 3 159 ? 42.650  -54.144 51.859  1.00 233.04 ? 182 GLU G C     1 
ATOM   6472 O O     . GLU C 3 159 ? 42.577  -54.437 53.054  1.00 233.74 ? 182 GLU G O     1 
ATOM   6473 C CB    . GLU C 3 159 ? 43.831  -51.949 51.805  1.00 261.30 ? 182 GLU G CB    1 
ATOM   6474 C CG    . GLU C 3 159 ? 45.176  -51.245 51.789  1.00 257.81 ? 182 GLU G CG    1 
ATOM   6475 C CD    . GLU C 3 159 ? 45.196  -50.011 52.672  1.00 259.98 ? 182 GLU G CD    1 
ATOM   6476 O OE1   . GLU C 3 159 ? 44.163  -49.312 52.744  1.00 264.41 ? 182 GLU G OE1   1 
ATOM   6477 O OE2   . GLU C 3 159 ? 46.241  -49.746 53.303  1.00 257.54 ? 182 GLU G OE2   1 
ATOM   6478 N N     . PHE C 3 160 ? 41.679  -54.430 50.997  1.00 160.49 ? 183 PHE G N     1 
ATOM   6479 C CA    . PHE C 3 160 ? 40.509  -55.216 51.398  1.00 164.27 ? 183 PHE G CA    1 
ATOM   6480 C C     . PHE C 3 160 ? 40.805  -56.695 51.721  1.00 162.33 ? 183 PHE G C     1 
ATOM   6481 O O     . PHE C 3 160 ? 40.262  -57.227 52.692  1.00 164.58 ? 183 PHE G O     1 
ATOM   6482 C CB    . PHE C 3 160 ? 39.421  -55.136 50.321  1.00 233.22 ? 183 PHE G CB    1 
ATOM   6483 C CG    . PHE C 3 160 ? 38.240  -56.027 50.586  1.00 237.24 ? 183 PHE G CG    1 
ATOM   6484 C CD1   . PHE C 3 160 ? 37.476  -55.866 51.733  1.00 240.98 ? 183 PHE G CD1   1 
ATOM   6485 C CD2   . PHE C 3 160 ? 37.887  -57.019 49.687  1.00 237.63 ? 183 PHE G CD2   1 
ATOM   6486 C CE1   . PHE C 3 160 ? 36.384  -56.682 51.981  1.00 245.03 ? 183 PHE G CE1   1 
ATOM   6487 C CE2   . PHE C 3 160 ? 36.795  -57.838 49.928  1.00 241.71 ? 183 PHE G CE2   1 
ATOM   6488 C CZ    . PHE C 3 160 ? 36.042  -57.668 51.077  1.00 245.42 ? 183 PHE G CZ    1 
ATOM   6489 N N     . PRO C 3 161 ? 41.627  -57.378 50.893  1.00 400.55 ? 184 PRO G N     1 
ATOM   6490 C CA    . PRO C 3 161 ? 41.945  -58.784 51.179  1.00 398.97 ? 184 PRO G CA    1 
ATOM   6491 C C     . PRO C 3 161 ? 42.832  -59.049 52.400  1.00 396.41 ? 184 PRO G C     1 
ATOM   6492 O O     . PRO C 3 161 ? 42.588  -60.022 53.116  1.00 397.41 ? 184 PRO G O     1 
ATOM   6493 C CB    . PRO C 3 161 ? 42.677  -59.228 49.909  1.00 211.52 ? 184 PRO G CB    1 
ATOM   6494 C CG    . PRO C 3 161 ? 43.224  -58.007 49.331  1.00 209.89 ? 184 PRO G CG    1 
ATOM   6495 C CD    . PRO C 3 161 ? 42.177  -56.978 49.586  1.00 214.06 ? 184 PRO G CD    1 
ATOM   6496 N N     . LYS C 3 162 ? 43.828  -58.197 52.637  1.00 291.13 ? 185 LYS G N     1 
ATOM   6497 C CA    . LYS C 3 162 ? 44.850  -58.459 53.659  1.00 288.29 ? 185 LYS G CA    1 
ATOM   6498 C C     . LYS C 3 162 ? 44.334  -58.743 55.090  1.00 290.86 ? 185 LYS G C     1 
ATOM   6499 O O     . LYS C 3 162 ? 44.906  -59.591 55.779  1.00 289.23 ? 185 LYS G O     1 
ATOM   6500 C CB    . LYS C 3 162 ? 45.867  -57.300 53.701  1.00 193.36 ? 185 LYS G CB    1 
ATOM   6501 C CG    . LYS C 3 162 ? 45.305  -55.934 54.066  1.00 196.26 ? 185 LYS G CG    1 
ATOM   6502 C CD    . LYS C 3 162 ? 46.387  -54.890 54.266  1.00 193.85 ? 185 LYS G CD    1 
ATOM   6503 C CE    . LYS C 3 162 ? 45.779  -53.585 54.763  1.00 197.34 ? 185 LYS G CE    1 
ATOM   6504 N NZ    . LYS C 3 162 ? 46.806  -52.635 55.273  1.00 195.62 ? 185 LYS G NZ    1 
ATOM   6505 N N     . PRO C 3 163 ? 43.260  -58.063 55.547  1.00 240.46 ? 186 PRO G N     1 
ATOM   6506 C CA    . PRO C 3 163 ? 42.907  -58.280 56.951  1.00 242.79 ? 186 PRO G CA    1 
ATOM   6507 C C     . PRO C 3 163 ? 42.153  -59.583 57.188  1.00 245.16 ? 186 PRO G C     1 
ATOM   6508 O O     . PRO C 3 163 ? 40.923  -59.578 57.140  1.00 249.57 ? 186 PRO G O     1 
ATOM   6509 C CB    . PRO C 3 163 ? 42.008  -57.075 57.280  1.00 189.92 ? 186 PRO G CB    1 
ATOM   6510 C CG    . PRO C 3 163 ? 42.047  -56.183 56.059  1.00 189.26 ? 186 PRO G CG    1 
ATOM   6511 C CD    . PRO C 3 163 ? 42.327  -57.102 54.937  1.00 186.75 ? 186 PRO G CD    1 
ATOM   6512 N N     . GLU C 3 164 ? 42.868  -60.688 57.374  1.00 157.59 ? 187 GLU G N     1 
ATOM   6513 C CA    . GLU C 3 164 ? 42.221  -61.912 57.841  1.00 160.20 ? 187 GLU G CA    1 
ATOM   6514 C C     . GLU C 3 164 ? 42.924  -62.562 59.045  1.00 158.93 ? 187 GLU G C     1 
ATOM   6515 O O     . GLU C 3 164 ? 42.423  -62.515 60.170  1.00 161.91 ? 187 GLU G O     1 
ATOM   6516 C CB    . GLU C 3 164 ? 42.130  -62.914 56.685  1.00 248.86 ? 187 GLU G CB    1 
ATOM   6517 C CG    . GLU C 3 164 ? 40.803  -62.875 55.937  1.00 253.05 ? 187 GLU G CG    1 
ATOM   6518 C CD    . GLU C 3 164 ? 40.887  -63.467 54.542  1.00 251.79 ? 187 GLU G CD    1 
ATOM   6519 O OE1   . GLU C 3 164 ? 40.144  -62.993 53.658  1.00 253.87 ? 187 GLU G OE1   1 
ATOM   6520 O OE2   . GLU C 3 164 ? 41.689  -64.401 54.327  1.00 248.99 ? 187 GLU G OE2   1 
ATOM   6521 N N     . PHE C 3 165 ? 44.059  -63.207 58.789  1.00 154.83 ? 188 PHE G N     1 
ATOM   6522 C CA    . PHE C 3 165 ? 44.881  -63.803 59.842  1.00 153.28 ? 188 PHE G CA    1 
ATOM   6523 C C     . PHE C 3 165 ? 46.148  -63.004 60.180  1.00 149.45 ? 188 PHE G C     1 
ATOM   6524 O O     . PHE C 3 165 ? 46.963  -63.445 60.990  1.00 147.86 ? 188 PHE G O     1 
ATOM   6525 C CB    . PHE C 3 165 ? 45.244  -65.247 59.470  1.00 206.77 ? 188 PHE G CB    1 
ATOM   6526 C CG    . PHE C 3 165 ? 46.058  -65.378 58.209  1.00 202.98 ? 188 PHE G CG    1 
ATOM   6527 C CD1   . PHE C 3 165 ? 45.447  -65.387 56.959  1.00 203.84 ? 188 PHE G CD1   1 
ATOM   6528 C CD2   . PHE C 3 165 ? 47.431  -65.528 58.278  1.00 198.87 ? 188 PHE G CD2   1 
ATOM   6529 C CE1   . PHE C 3 165 ? 46.198  -65.520 55.805  1.00 200.62 ? 188 PHE G CE1   1 
ATOM   6530 C CE2   . PHE C 3 165 ? 48.185  -65.662 57.132  1.00 195.70 ? 188 PHE G CE2   1 
ATOM   6531 C CZ    . PHE C 3 165 ? 47.568  -65.658 55.892  1.00 196.57 ? 188 PHE G CZ    1 
ATOM   6532 N N     . MET C 3 166 ? 46.333  -61.859 59.530  1.00 203.20 ? 189 MET G N     1 
ATOM   6533 C CA    . MET C 3 166 ? 47.538  -61.055 59.723  1.00 199.78 ? 189 MET G CA    1 
ATOM   6534 C C     . MET C 3 166 ? 47.550  -60.370 61.085  1.00 201.41 ? 189 MET G C     1 
ATOM   6535 O O     . MET C 3 166 ? 48.611  -60.054 61.625  1.00 199.01 ? 189 MET G O     1 
ATOM   6536 C CB    . MET C 3 166 ? 47.665  -60.006 58.613  1.00 219.58 ? 189 MET G CB    1 
ATOM   6537 C CG    . MET C 3 166 ? 48.327  -60.509 57.337  1.00 216.32 ? 189 MET G CG    1 
ATOM   6538 S SD    . MET C 3 166 ? 50.123  -60.364 57.400  1.00 211.38 ? 189 MET G SD    1 
ATOM   6539 C CE    . MET C 3 166 ? 50.605  -61.401 56.022  1.00 208.81 ? 189 MET G CE    1 
ATOM   6540 N N     . SER C 3 167 ? 46.366  -60.147 61.640  1.00 166.65 ? 190 SER G N     1 
ATOM   6541 C CA    . SER C 3 167 ? 46.243  -59.398 62.885  1.00 168.89 ? 190 SER G CA    1 
ATOM   6542 C C     . SER C 3 167 ? 46.702  -60.207 64.096  1.00 168.84 ? 190 SER G C     1 
ATOM   6543 O O     . SER C 3 167 ? 46.851  -59.662 65.190  1.00 170.17 ? 190 SER G O     1 
ATOM   6544 C CB    . SER C 3 167 ? 44.797  -58.935 63.082  1.00 233.27 ? 190 SER G CB    1 
ATOM   6545 O OG    . SER C 3 167 ? 44.675  -58.079 64.206  1.00 235.70 ? 190 SER G OG    1 
ATOM   6546 N N     . LYS C 3 168 ? 46.910  -61.507 63.904  1.00 171.07 ? 191 LYS G N     1 
ATOM   6547 C CA    . LYS C 3 168 ? 47.343  -62.384 64.991  1.00 171.22 ? 191 LYS G CA    1 
ATOM   6548 C C     . LYS C 3 168 ? 48.849  -62.310 65.246  1.00 167.09 ? 191 LYS G C     1 
ATOM   6549 O O     . LYS C 3 168 ? 49.634  -62.044 64.335  1.00 163.55 ? 191 LYS G O     1 
ATOM   6550 C CB    . LYS C 3 168 ? 46.930  -63.829 64.706  1.00 152.81 ? 191 LYS G CB    1 
ATOM   6551 C CG    . LYS C 3 168 ? 45.449  -64.104 64.931  1.00 157.92 ? 191 LYS G CG    1 
ATOM   6552 C CD    . LYS C 3 168 ? 45.107  -65.561 64.668  1.00 159.06 ? 191 LYS G CD    1 
ATOM   6553 C CE    . LYS C 3 168 ? 43.729  -65.904 65.203  1.00 164.65 ? 191 LYS G CE    1 
ATOM   6554 N NZ    . LYS C 3 168 ? 43.412  -67.345 65.024  1.00 166.21 ? 191 LYS G NZ    1 
ATOM   6555 N N     . SER C 3 169 ? 49.238  -62.558 66.495  1.00 185.66 ? 192 SER G N     1 
ATOM   6556 C CA    . SER C 3 169 ? 50.635  -62.477 66.912  1.00 182.40 ? 192 SER G CA    1 
ATOM   6557 C C     . SER C 3 169 ? 51.453  -63.650 66.382  1.00 179.40 ? 192 SER G C     1 
ATOM   6558 O O     . SER C 3 169 ? 50.940  -64.757 66.230  1.00 180.73 ? 192 SER G O     1 
ATOM   6559 C CB    . SER C 3 169 ? 50.730  -62.423 68.439  1.00 147.50 ? 192 SER G CB    1 
ATOM   6560 O OG    . SER C 3 169 ? 50.108  -63.553 69.024  1.00 150.23 ? 192 SER G OG    1 
ATOM   6561 N N     . LEU C 3 170 ? 52.729  -63.393 66.108  1.00 138.52 ? 193 LEU G N     1 
ATOM   6562 C CA    . LEU C 3 170 ? 53.636  -64.400 65.562  1.00 135.62 ? 193 LEU G CA    1 
ATOM   6563 C C     . LEU C 3 170 ? 53.753  -65.629 66.463  1.00 136.99 ? 193 LEU G C     1 
ATOM   6564 O O     . LEU C 3 170 ? 53.765  -66.765 65.984  1.00 136.72 ? 193 LEU G O     1 
ATOM   6565 C CB    . LEU C 3 170 ? 55.019  -63.790 65.340  1.00 139.61 ? 193 LEU G CB    1 
ATOM   6566 C CG    . LEU C 3 170 ? 56.056  -64.689 64.667  1.00 136.55 ? 193 LEU G CG    1 
ATOM   6567 C CD1   . LEU C 3 170 ? 55.726  -64.882 63.190  1.00 135.41 ? 193 LEU G CD1   1 
ATOM   6568 C CD2   . LEU C 3 170 ? 57.462  -64.130 64.854  1.00 133.79 ? 193 LEU G CD2   1 
ATOM   6569 N N     . GLU C 3 171 ? 53.851  -65.385 67.766  1.00 138.69 ? 194 GLU G N     1 
ATOM   6570 C CA    . GLU C 3 171 ? 53.916  -66.448 68.760  1.00 140.54 ? 194 GLU G CA    1 
ATOM   6571 C C     . GLU C 3 171 ? 52.740  -67.399 68.607  1.00 143.65 ? 194 GLU G C     1 
ATOM   6572 O O     . GLU C 3 171 ? 52.908  -68.617 68.618  1.00 143.99 ? 194 GLU G O     1 
ATOM   6573 C CB    . GLU C 3 171 ? 53.934  -65.851 70.172  1.00 187.93 ? 194 GLU G CB    1 
ATOM   6574 C CG    . GLU C 3 171 ? 53.909  -66.864 71.312  1.00 190.46 ? 194 GLU G CG    1 
ATOM   6575 C CD    . GLU C 3 171 ? 53.833  -66.204 72.684  1.00 193.01 ? 194 GLU G CD    1 
ATOM   6576 O OE1   . GLU C 3 171 ? 53.823  -66.935 73.698  1.00 195.36 ? 194 GLU G OE1   1 
ATOM   6577 O OE2   . GLU C 3 171 ? 53.780  -64.957 72.750  1.00 192.93 ? 194 GLU G OE2   1 
ATOM   6578 N N     . GLU C 3 172 ? 51.552  -66.824 68.446  1.00 182.22 ? 195 GLU G N     1 
ATOM   6579 C CA    . GLU C 3 172 ? 50.317  -67.594 68.383  1.00 185.89 ? 195 GLU G CA    1 
ATOM   6580 C C     . GLU C 3 172 ? 50.120  -68.233 67.007  1.00 184.64 ? 195 GLU G C     1 
ATOM   6581 O O     . GLU C 3 172 ? 49.388  -69.212 66.868  1.00 187.22 ? 195 GLU G O     1 
ATOM   6582 C CB    . GLU C 3 172 ? 49.127  -66.695 68.738  1.00 235.90 ? 195 GLU G CB    1 
ATOM   6583 C CG    . GLU C 3 172 ? 47.832  -67.437 69.025  1.00 240.64 ? 195 GLU G CG    1 
ATOM   6584 C CD    . GLU C 3 172 ? 46.834  -67.316 67.894  1.00 241.77 ? 195 GLU G CD    1 
ATOM   6585 O OE1   . GLU C 3 172 ? 46.526  -66.173 67.496  1.00 241.54 ? 195 GLU G OE1   1 
ATOM   6586 O OE2   . GLU C 3 172 ? 46.364  -68.362 67.398  1.00 243.11 ? 195 GLU G OE2   1 
ATOM   6587 N N     . LEU C 3 173 ? 50.776  -67.677 65.994  1.00 158.17 ? 196 LEU G N     1 
ATOM   6588 C CA    . LEU C 3 173 ? 50.680  -68.206 64.634  1.00 156.86 ? 196 LEU G CA    1 
ATOM   6589 C C     . LEU C 3 173 ? 51.594  -69.409 64.378  1.00 154.99 ? 196 LEU G C     1 
ATOM   6590 O O     . LEU C 3 173 ? 51.341  -70.197 63.464  1.00 155.19 ? 196 LEU G O     1 
ATOM   6591 C CB    . LEU C 3 173 ? 50.986  -67.104 63.621  1.00 140.73 ? 196 LEU G CB    1 
ATOM   6592 C CG    . LEU C 3 173 ? 49.921  -66.014 63.491  1.00 142.95 ? 196 LEU G CG    1 
ATOM   6593 C CD1   . LEU C 3 173 ? 50.386  -64.912 62.558  1.00 140.09 ? 196 LEU G CD1   1 
ATOM   6594 C CD2   . LEU C 3 173 ? 48.613  -66.609 63.003  1.00 146.34 ? 196 LEU G CD2   1 
ATOM   6595 N N     . GLN C 3 174 ? 52.654  -69.531 65.177  1.00 177.76 ? 197 GLN G N     1 
ATOM   6596 C CA    . GLN C 3 174 ? 53.620  -70.633 65.081  1.00 176.25 ? 197 GLN G CA    1 
ATOM   6597 C C     . GLN C 3 174 ? 54.305  -70.708 63.714  1.00 172.94 ? 197 GLN G C     1 
ATOM   6598 O O     . GLN C 3 174 ? 54.433  -71.788 63.130  1.00 173.09 ? 197 GLN G O     1 
ATOM   6599 C CB    . GLN C 3 174 ? 52.944  -71.975 65.390  1.00 208.37 ? 197 GLN G CB    1 
ATOM   6600 C CG    . GLN C 3 174 ? 52.091  -71.985 66.652  1.00 212.34 ? 197 GLN G CG    1 
ATOM   6601 C CD    . GLN C 3 174 ? 52.899  -71.791 67.923  1.00 211.97 ? 197 GLN G CD    1 
ATOM   6602 O OE1   . GLN C 3 174 ? 54.125  -71.927 67.928  1.00 209.12 ? 197 GLN G OE1   1 
ATOM   6603 N NE2   . GLN C 3 174 ? 52.210  -71.472 69.014  1.00 215.15 ? 197 GLN G NE2   1 
ATOM   6604 N N     . ILE C 3 175 ? 54.748  -69.557 63.215  1.00 160.16 ? 198 ILE G N     1 
ATOM   6605 C CA    . ILE C 3 175 ? 55.429  -69.479 61.925  1.00 157.09 ? 198 ILE G CA    1 
ATOM   6606 C C     . ILE C 3 175 ? 56.930  -69.289 62.112  1.00 153.95 ? 198 ILE G C     1 
ATOM   6607 O O     . ILE C 3 175 ? 57.360  -68.320 62.732  1.00 153.04 ? 198 ILE G O     1 
ATOM   6608 C CB    . ILE C 3 175 ? 54.877  -68.323 61.063  1.00 172.49 ? 198 ILE G CB    1 
ATOM   6609 C CG1   . ILE C 3 175 ? 53.375  -68.504 60.831  1.00 175.88 ? 198 ILE G CG1   1 
ATOM   6610 C CG2   . ILE C 3 175 ? 55.617  -68.241 59.737  1.00 169.49 ? 198 ILE G CG2   1 
ATOM   6611 C CD1   . ILE C 3 175 ? 52.720  -67.357 60.091  1.00 175.94 ? 198 ILE G CD1   1 
ATOM   6612 N N     . GLY C 3 176 ? 57.722  -70.201 61.553  1.00 125.06 ? 199 GLY G N     1 
ATOM   6613 C CA    . GLY C 3 176 ? 59.170  -70.162 61.696  1.00 122.46 ? 199 GLY G CA    1 
ATOM   6614 C C     . GLY C 3 176 ? 59.748  -71.277 62.550  1.00 123.46 ? 199 GLY G C     1 
ATOM   6615 O O     . GLY C 3 176 ? 59.004  -72.002 63.211  1.00 126.33 ? 199 GLY G O     1 
ATOM   6616 N N     . THR C 3 177 ? 61.073  -71.430 62.514  1.00 139.55 ? 200 THR G N     1 
ATOM   6617 C CA    . THR C 3 177 ? 61.759  -72.463 63.295  1.00 140.51 ? 200 THR G CA    1 
ATOM   6618 C C     . THR C 3 177 ? 62.262  -71.911 64.625  1.00 140.66 ? 200 THR G C     1 
ATOM   6619 O O     . THR C 3 177 ? 63.138  -71.048 64.663  1.00 138.52 ? 200 THR G O     1 
ATOM   6620 C CB    . THR C 3 177 ? 62.954  -73.075 62.524  1.00 158.46 ? 200 THR G CB    1 
ATOM   6621 O OG1   . THR C 3 177 ? 62.494  -73.622 61.282  1.00 158.61 ? 200 THR G OG1   1 
ATOM   6622 C CG2   . THR C 3 177 ? 63.623  -74.179 63.342  1.00 159.90 ? 200 THR G CG2   1 
ATOM   6623 N N     . TYR C 3 178 ? 61.639  -72.365 65.708  1.00 129.39 ? 201 TYR G N     1 
ATOM   6624 C CA    . TYR C 3 178 ? 62.039  -72.020 67.066  1.00 130.22 ? 201 TYR G CA    1 
ATOM   6625 C C     . TYR C 3 178 ? 62.775  -73.145 67.798  1.00 131.48 ? 201 TYR G C     1 
ATOM   6626 O O     . TYR C 3 178 ? 63.070  -73.019 68.984  1.00 132.68 ? 201 TYR G O     1 
ATOM   6627 C CB    . TYR C 3 178 ? 60.811  -71.566 67.853  1.00 154.22 ? 201 TYR G CB    1 
ATOM   6628 C CG    . TYR C 3 178 ? 60.086  -70.423 67.167  1.00 153.33 ? 201 TYR G CG    1 
ATOM   6629 C CD1   . TYR C 3 178 ? 59.221  -70.660 66.104  1.00 153.60 ? 201 TYR G CD1   1 
ATOM   6630 C CD2   . TYR C 3 178 ? 60.280  -69.107 67.566  1.00 152.49 ? 201 TYR G CD2   1 
ATOM   6631 C CE1   . TYR C 3 178 ? 58.569  -69.626 65.467  1.00 153.02 ? 201 TYR G CE1   1 
ATOM   6632 C CE2   . TYR C 3 178 ? 59.628  -68.065 66.933  1.00 151.98 ? 201 TYR G CE2   1 
ATOM   6633 C CZ    . TYR C 3 178 ? 58.774  -68.332 65.888  1.00 152.23 ? 201 TYR G CZ    1 
ATOM   6634 O OH    . TYR C 3 178 ? 58.123  -67.297 65.262  1.00 151.98 ? 201 TYR G OH    1 
ATOM   6635 N N     . ALA C 3 179 ? 63.034  -74.252 67.110  1.00 178.49 ? 202 ALA G N     1 
ATOM   6636 C CA    . ALA C 3 179 ? 63.587  -75.439 67.760  1.00 180.36 ? 202 ALA G CA    1 
ATOM   6637 C C     . ALA C 3 179 ? 65.106  -75.373 67.938  1.00 178.52 ? 202 ALA G C     1 
ATOM   6638 O O     . ALA C 3 179 ? 65.604  -75.210 69.055  1.00 179.31 ? 202 ALA G O     1 
ATOM   6639 C CB    . ALA C 3 179 ? 63.205  -76.688 66.973  1.00 252.78 ? 202 ALA G CB    1 
ATOM   6640 N N     . ASN C 3 180 ? 65.838  -75.514 66.839  1.00 148.57 ? 203 ASN G N     1 
ATOM   6641 C CA    . ASN C 3 180 ? 67.294  -75.459 66.885  1.00 146.99 ? 203 ASN G CA    1 
ATOM   6642 C C     . ASN C 3 180 ? 67.794  -74.242 66.143  1.00 143.78 ? 203 ASN G C     1 
ATOM   6643 O O     . ASN C 3 180 ? 67.727  -74.193 64.919  1.00 142.27 ? 203 ASN G O     1 
ATOM   6644 C CB    . ASN C 3 180 ? 67.911  -76.717 66.276  1.00 153.06 ? 203 ASN G CB    1 
ATOM   6645 C CG    . ASN C 3 180 ? 67.369  -77.991 66.888  1.00 156.61 ? 203 ASN G CG    1 
ATOM   6646 O OD1   . ASN C 3 180 ? 67.203  -78.091 68.105  1.00 158.60 ? 203 ASN G OD1   1 
ATOM   6647 N ND2   . ASN C 3 180 ? 67.083  -78.974 66.043  1.00 157.71 ? 203 ASN G ND2   1 
ATOM   6648 N N     . ILE C 3 181 ? 68.308  -73.264 66.876  1.00 158.95 ? 204 ILE G N     1 
ATOM   6649 C CA    . ILE C 3 181 ? 68.761  -72.035 66.247  1.00 156.28 ? 204 ILE G CA    1 
ATOM   6650 C C     . ILE C 3 181 ? 70.243  -72.153 65.939  1.00 154.93 ? 204 ILE G C     1 
ATOM   6651 O O     . ILE C 3 181 ? 71.072  -72.206 66.847  1.00 155.65 ? 204 ILE G O     1 
ATOM   6652 C CB    . ILE C 3 181 ? 68.506  -70.803 67.140  1.00 138.99 ? 204 ILE G CB    1 
ATOM   6653 C CG1   . ILE C 3 181 ? 67.100  -70.856 67.746  1.00 141.20 ? 204 ILE G CG1   1 
ATOM   6654 C CG2   . ILE C 3 181 ? 68.727  -69.516 66.357  1.00 136.63 ? 204 ILE G CG2   1 
ATOM   6655 C CD1   . ILE C 3 181 ? 65.992  -70.973 66.723  1.00 141.05 ? 204 ILE G CD1   1 
ATOM   6656 N N     . ALA C 3 182 ? 70.576  -72.199 64.655  1.00 126.37 ? 205 ALA G N     1 
ATOM   6657 C CA    . ALA C 3 182 ? 71.969  -72.333 64.261  1.00 125.34 ? 205 ALA G CA    1 
ATOM   6658 C C     . ALA C 3 182 ? 72.651  -70.977 64.362  1.00 123.71 ? 205 ALA G C     1 
ATOM   6659 O O     . ALA C 3 182 ? 72.307  -70.040 63.642  1.00 122.18 ? 205 ALA G O     1 
ATOM   6660 C CB    . ALA C 3 182 ? 72.077  -72.890 62.846  1.00 112.16 ? 205 ALA G CB    1 
ATOM   6661 N N     . MET C 3 183 ? 73.637  -70.888 65.248  1.00 116.49 ? 206 MET G N     1 
ATOM   6662 C CA    . MET C 3 183 ? 74.308  -69.623 65.518  1.00 115.53 ? 206 MET G CA    1 
ATOM   6663 C C     . MET C 3 183 ? 75.809  -69.805 65.597  1.00 115.58 ? 206 MET G C     1 
ATOM   6664 O O     . MET C 3 183 ? 76.306  -70.926 65.531  1.00 116.48 ? 206 MET G O     1 
ATOM   6665 C CB    . MET C 3 183 ? 73.823  -69.021 66.834  1.00 134.02 ? 206 MET G CB    1 
ATOM   6666 C CG    . MET C 3 183 ? 72.324  -69.021 67.030  1.00 134.82 ? 206 MET G CG    1 
ATOM   6667 S SD    . MET C 3 183 ? 71.875  -68.442 68.676  1.00 136.98 ? 206 MET G SD    1 
ATOM   6668 C CE    . MET C 3 183 ? 72.580  -69.722 69.717  1.00 139.14 ? 206 MET G CE    1 
ATOM   6669 N N     . VAL C 3 184 ? 76.524  -68.698 65.774  1.00 110.48 ? 207 VAL G N     1 
ATOM   6670 C CA    . VAL C 3 184 ? 77.957  -68.740 66.037  1.00 110.98 ? 207 VAL G CA    1 
ATOM   6671 C C     . VAL C 3 184 ? 78.281  -67.715 67.104  1.00 111.78 ? 207 VAL G C     1 
ATOM   6672 O O     . VAL C 3 184 ? 77.498  -66.798 67.331  1.00 111.52 ? 207 VAL G O     1 
ATOM   6673 C CB    . VAL C 3 184 ? 78.802  -68.444 64.785  1.00 133.39 ? 207 VAL G CB    1 
ATOM   6674 C CG1   . VAL C 3 184 ? 78.635  -69.534 63.738  1.00 133.00 ? 207 VAL G CG1   1 
ATOM   6675 C CG2   . VAL C 3 184 ? 78.434  -67.096 64.218  1.00 131.90 ? 207 VAL G CG2   1 
ATOM   6676 N N     . ARG C 3 185 ? 79.428  -67.875 67.761  1.00 113.05 ? 208 ARG G N     1 
ATOM   6677 C CA    . ARG C 3 185 ? 79.868  -66.930 68.784  1.00 114.19 ? 208 ARG G CA    1 
ATOM   6678 C C     . ARG C 3 185 ? 80.492  -65.720 68.117  1.00 113.07 ? 208 ARG G C     1 
ATOM   6679 O O     . ARG C 3 185 ? 80.625  -65.687 66.901  1.00 111.46 ? 208 ARG G O     1 
ATOM   6680 C CB    . ARG C 3 185 ? 80.880  -67.577 69.730  1.00 126.98 ? 208 ARG G CB    1 
ATOM   6681 C CG    . ARG C 3 185 ? 80.660  -67.260 71.202  1.00 129.05 ? 208 ARG G CG    1 
ATOM   6682 C CD    . ARG C 3 185 ? 79.506  -68.067 71.772  1.00 129.97 ? 208 ARG G CD    1 
ATOM   6683 N NE    . ARG C 3 185 ? 79.512  -68.066 73.231  1.00 132.50 ? 208 ARG G NE    1 
ATOM   6684 C CZ    . ARG C 3 185 ? 80.289  -68.846 73.979  1.00 134.54 ? 208 ARG G CZ    1 
ATOM   6685 N NH1   . ARG C 3 185 ? 81.135  -69.693 73.408  1.00 134.41 ? 208 ARG G NH1   1 
ATOM   6686 N NH2   . ARG C 3 185 ? 80.225  -68.778 75.303  1.00 136.97 ? 208 ARG G NH2   1 
ATOM   6687 N N     . THR C 3 186 ? 80.891  -64.733 68.905  1.00 114.18 ? 209 THR G N     1 
ATOM   6688 C CA    . THR C 3 186 ? 81.574  -63.581 68.348  1.00 113.64 ? 209 THR G CA    1 
ATOM   6689 C C     . THR C 3 186 ? 83.027  -63.925 68.064  1.00 114.16 ? 209 THR G C     1 
ATOM   6690 O O     . THR C 3 186 ? 83.651  -63.319 67.197  1.00 113.44 ? 209 THR G O     1 
ATOM   6691 C CB    . THR C 3 186 ? 81.515  -62.368 69.282  1.00 115.08 ? 209 THR G CB    1 
ATOM   6692 O OG1   . THR C 3 186 ? 82.127  -62.699 70.533  1.00 117.34 ? 209 THR G OG1   1 
ATOM   6693 C CG2   . THR C 3 186 ? 80.080  -61.964 69.521  1.00 114.86 ? 209 THR G CG2   1 
ATOM   6694 N N     . THR C 3 187 ? 83.570  -64.879 68.815  1.00 115.72 ? 210 THR G N     1 
ATOM   6695 C CA    . THR C 3 187 ? 84.956  -65.306 68.629  1.00 116.69 ? 210 THR G CA    1 
ATOM   6696 C C     . THR C 3 187 ? 85.120  -66.581 67.804  1.00 116.07 ? 210 THR G C     1 
ATOM   6697 O O     . THR C 3 187 ? 86.247  -67.010 67.552  1.00 117.03 ? 210 THR G O     1 
ATOM   6698 C CB    . THR C 3 187 ? 85.652  -65.529 69.970  1.00 119.35 ? 210 THR G CB    1 
ATOM   6699 O OG1   . THR C 3 187 ? 84.906  -66.486 70.730  1.00 120.09 ? 210 THR G OG1   1 
ATOM   6700 C CG2   . THR C 3 187 ? 85.747  -64.221 70.738  1.00 120.46 ? 210 THR G CG2   1 
ATOM   6701 N N     . THR C 3 188 ? 84.015  -67.193 67.387  1.00 114.81 ? 211 THR G N     1 
ATOM   6702 C CA    . THR C 3 188 ? 84.096  -68.398 66.561  1.00 114.47 ? 211 THR G CA    1 
ATOM   6703 C C     . THR C 3 188 ? 84.644  -68.083 65.175  1.00 113.13 ? 211 THR G C     1 
ATOM   6704 O O     . THR C 3 188 ? 84.188  -67.145 64.530  1.00 111.52 ? 211 THR G O     1 
ATOM   6705 C CB    . THR C 3 188 ? 82.729  -69.081 66.406  1.00 113.70 ? 211 THR G CB    1 
ATOM   6706 O OG1   . THR C 3 188 ? 81.704  -68.086 66.330  1.00 112.33 ? 211 THR G OG1   1 
ATOM   6707 C CG2   . THR C 3 188 ? 82.460  -70.005 67.592  1.00 115.72 ? 211 THR G CG2   1 
ATOM   6708 N N     . PRO C 3 189 ? 85.632  -68.869 64.717  1.00 114.07 ? 212 PRO G N     1 
ATOM   6709 C CA    . PRO C 3 189 ? 86.266  -68.684 63.408  1.00 113.27 ? 212 PRO G CA    1 
ATOM   6710 C C     . PRO C 3 189 ? 85.270  -68.674 62.262  1.00 111.18 ? 212 PRO G C     1 
ATOM   6711 O O     . PRO C 3 189 ? 84.200  -69.257 62.394  1.00 110.73 ? 212 PRO G O     1 
ATOM   6712 C CB    . PRO C 3 189 ? 87.189  -69.894 63.294  1.00 120.97 ? 212 PRO G CB    1 
ATOM   6713 C CG    . PRO C 3 189 ? 87.535  -70.219 64.693  1.00 123.03 ? 212 PRO G CG    1 
ATOM   6714 C CD    . PRO C 3 189 ? 86.299  -69.925 65.499  1.00 122.25 ? 212 PRO G CD    1 
ATOM   6715 N N     . VAL C 3 190 ? 85.615  -68.016 61.159  1.00 110.17 ? 213 VAL G N     1 
ATOM   6716 C CA    . VAL C 3 190 ? 84.710  -67.938 60.021  1.00 108.36 ? 213 VAL G CA    1 
ATOM   6717 C C     . VAL C 3 190 ? 84.583  -69.299 59.349  1.00 108.74 ? 213 VAL G C     1 
ATOM   6718 O O     . VAL C 3 190 ? 83.578  -69.584 58.708  1.00 107.68 ? 213 VAL G O     1 
ATOM   6719 C CB    . VAL C 3 190 ? 85.164  -66.888 58.973  1.00 107.51 ? 213 VAL G CB    1 
ATOM   6720 C CG1   . VAL C 3 190 ? 85.125  -65.480 59.559  1.00 107.29 ? 213 VAL G CG1   1 
ATOM   6721 C CG2   . VAL C 3 190 ? 86.542  -67.212 58.446  1.00 108.84 ? 213 VAL G CG2   1 
ATOM   6722 N N     . TYR C 3 191 ? 85.595  -70.143 59.505  1.00 110.56 ? 214 TYR G N     1 
ATOM   6723 C CA    . TYR C 3 191 ? 85.556  -71.464 58.896  1.00 111.44 ? 214 TYR G CA    1 
ATOM   6724 C C     . TYR C 3 191 ? 84.449  -72.330 59.502  1.00 111.70 ? 214 TYR G C     1 
ATOM   6725 O O     . TYR C 3 191 ? 83.730  -73.013 58.773  1.00 111.46 ? 214 TYR G O     1 
ATOM   6726 C CB    . TYR C 3 191 ? 86.909  -72.163 59.032  1.00 113.79 ? 214 TYR G CB    1 
ATOM   6727 C CG    . TYR C 3 191 ? 86.928  -73.580 58.502  1.00 115.28 ? 214 TYR G CG    1 
ATOM   6728 C CD1   . TYR C 3 191 ? 87.018  -73.826 57.149  1.00 115.08 ? 214 TYR G CD1   1 
ATOM   6729 C CD2   . TYR C 3 191 ? 86.864  -74.671 59.359  1.00 117.21 ? 214 TYR G CD2   1 
ATOM   6730 C CE1   . TYR C 3 191 ? 87.039  -75.109 56.659  1.00 116.79 ? 214 TYR G CE1   1 
ATOM   6731 C CE2   . TYR C 3 191 ? 86.884  -75.963 58.873  1.00 118.95 ? 214 TYR G CE2   1 
ATOM   6732 C CZ    . TYR C 3 191 ? 86.973  -76.171 57.523  1.00 118.75 ? 214 TYR G CZ    1 
ATOM   6733 O OH    . TYR C 3 191 ? 86.994  -77.448 57.022  1.00 120.81 ? 214 TYR G OH    1 
ATOM   6734 N N     . VAL C 3 192 ? 84.309  -72.303 60.828  1.00 115.18 ? 215 VAL G N     1 
ATOM   6735 C CA    . VAL C 3 192 ? 83.300  -73.132 61.491  1.00 115.85 ? 215 VAL G CA    1 
ATOM   6736 C C     . VAL C 3 192 ? 81.914  -72.590 61.168  1.00 113.96 ? 215 VAL G C     1 
ATOM   6737 O O     . VAL C 3 192 ? 80.928  -73.326 61.179  1.00 114.32 ? 215 VAL G O     1 
ATOM   6738 C CB    . VAL C 3 192 ? 83.500  -73.207 63.035  1.00 114.70 ? 215 VAL G CB    1 
ATOM   6739 C CG1   . VAL C 3 192 ? 84.891  -73.730 63.376  1.00 116.87 ? 215 VAL G CG1   1 
ATOM   6740 C CG2   . VAL C 3 192 ? 83.262  -71.861 63.691  1.00 113.57 ? 215 VAL G CG2   1 
ATOM   6741 N N     . ALA C 3 193 ? 81.849  -71.299 60.861  1.00 114.30 ? 216 ALA G N     1 
ATOM   6742 C CA    . ALA C 3 193 ? 80.604  -70.694 60.431  1.00 112.66 ? 216 ALA G CA    1 
ATOM   6743 C C     . ALA C 3 193 ? 80.231  -71.268 59.074  1.00 112.11 ? 216 ALA G C     1 
ATOM   6744 O O     . ALA C 3 193 ? 79.067  -71.570 58.818  1.00 111.80 ? 216 ALA G O     1 
ATOM   6745 C CB    . ALA C 3 193 ? 80.726  -69.181 60.371  1.00 106.58 ? 216 ALA G CB    1 
ATOM   6746 N N     . LEU C 3 194 ? 81.226  -71.433 58.206  1.00 107.50 ? 217 LEU G N     1 
ATOM   6747 C CA    . LEU C 3 194 ? 80.991  -72.039 56.900  1.00 107.37 ? 217 LEU G CA    1 
ATOM   6748 C C     . LEU C 3 194 ? 80.620  -73.501 57.098  1.00 109.10 ? 217 LEU G C     1 
ATOM   6749 O O     . LEU C 3 194 ? 79.836  -74.065 56.334  1.00 109.18 ? 217 LEU G O     1 
ATOM   6750 C CB    . LEU C 3 194 ? 82.221  -71.914 55.997  1.00 107.62 ? 217 LEU G CB    1 
ATOM   6751 C CG    . LEU C 3 194 ? 82.764  -70.506 55.742  1.00 106.41 ? 217 LEU G CG    1 
ATOM   6752 C CD1   . LEU C 3 194 ? 83.967  -70.571 54.830  1.00 107.18 ? 217 LEU G CD1   1 
ATOM   6753 C CD2   . LEU C 3 194 ? 81.699  -69.584 55.159  1.00 104.58 ? 217 LEU G CD2   1 
ATOM   6754 N N     . GLY C 3 195 ? 81.181  -74.100 58.144  1.00 110.77 ? 218 GLY G N     1 
ATOM   6755 C CA    . GLY C 3 195 ? 80.912  -75.485 58.479  1.00 112.88 ? 218 GLY G CA    1 
ATOM   6756 C C     . GLY C 3 195 ? 79.465  -75.714 58.857  1.00 112.80 ? 218 GLY G C     1 
ATOM   6757 O O     . GLY C 3 195 ? 78.915  -76.795 58.641  1.00 114.30 ? 218 GLY G O     1 
ATOM   6758 N N     . ILE C 3 196 ? 78.845  -74.694 59.438  1.00 119.62 ? 219 ILE G N     1 
ATOM   6759 C CA    . ILE C 3 196 ? 77.433  -74.769 59.789  1.00 119.64 ? 219 ILE G CA    1 
ATOM   6760 C C     . ILE C 3 196 ? 76.589  -74.506 58.544  1.00 118.35 ? 219 ILE G C     1 
ATOM   6761 O O     . ILE C 3 196 ? 75.506  -75.064 58.378  1.00 119.07 ? 219 ILE G O     1 
ATOM   6762 C CB    . ILE C 3 196 ? 77.076  -73.772 60.916  1.00 110.77 ? 219 ILE G CB    1 
ATOM   6763 C CG1   . ILE C 3 196 ? 77.960  -74.024 62.137  1.00 112.27 ? 219 ILE G CG1   1 
ATOM   6764 C CG2   . ILE C 3 196 ? 75.614  -73.902 61.316  1.00 111.23 ? 219 ILE G CG2   1 
ATOM   6765 C CD1   . ILE C 3 196 ? 77.755  -73.036 63.241  1.00 111.96 ? 219 ILE G CD1   1 
ATOM   6766 N N     . PHE C 3 197 ? 77.106  -73.666 57.658  1.00 108.45 ? 220 PHE G N     1 
ATOM   6767 C CA    . PHE C 3 197 ? 76.400  -73.343 56.432  1.00 107.32 ? 220 PHE G CA    1 
ATOM   6768 C C     . PHE C 3 197 ? 76.264  -74.559 55.520  1.00 108.67 ? 220 PHE G C     1 
ATOM   6769 O O     . PHE C 3 197 ? 75.297  -74.670 54.770  1.00 108.57 ? 220 PHE G O     1 
ATOM   6770 C CB    . PHE C 3 197 ? 77.118  -72.216 55.696  1.00 105.65 ? 220 PHE G CB    1 
ATOM   6771 C CG    . PHE C 3 197 ? 76.770  -70.850 56.193  1.00 104.28 ? 220 PHE G CG    1 
ATOM   6772 C CD1   . PHE C 3 197 ? 75.471  -70.541 56.561  1.00 104.07 ? 220 PHE G CD1   1 
ATOM   6773 C CD2   . PHE C 3 197 ? 77.741  -69.870 56.285  1.00 103.54 ? 220 PHE G CD2   1 
ATOM   6774 C CE1   . PHE C 3 197 ? 75.147  -69.273 57.012  1.00 103.16 ? 220 PHE G CE1   1 
ATOM   6775 C CE2   . PHE C 3 197 ? 77.429  -68.604 56.739  1.00 102.64 ? 220 PHE G CE2   1 
ATOM   6776 C CZ    . PHE C 3 197 ? 76.129  -68.303 57.104  1.00 102.45 ? 220 PHE G CZ    1 
ATOM   6777 N N     . VAL C 3 198 ? 77.254  -75.446 55.548  1.00 110.19 ? 221 VAL G N     1 
ATOM   6778 C CA    . VAL C 3 198 ? 77.191  -76.666 54.744  1.00 111.99 ? 221 VAL G CA    1 
ATOM   6779 C C     . VAL C 3 198 ? 76.394  -77.775 55.439  1.00 114.16 ? 221 VAL G C     1 
ATOM   6780 O O     . VAL C 3 198 ? 75.762  -78.599 54.775  1.00 115.55 ? 221 VAL G O     1 
ATOM   6781 C CB    . VAL C 3 198 ? 78.606  -77.193 54.379  1.00 120.61 ? 221 VAL G CB    1 
ATOM   6782 C CG1   . VAL C 3 198 ? 79.381  -76.141 53.612  1.00 118.86 ? 221 VAL G CG1   1 
ATOM   6783 C CG2   . VAL C 3 198 ? 79.380  -77.613 55.612  1.00 122.02 ? 221 VAL G CG2   1 
ATOM   6784 N N     . GLN C 3 199 ? 76.428  -77.791 56.773  1.00 114.70 ? 222 GLN G N     1 
ATOM   6785 C CA    . GLN C 3 199 ? 75.744  -78.817 57.560  1.00 117.07 ? 222 GLN G CA    1 
ATOM   6786 C C     . GLN C 3 199 ? 74.235  -78.604 57.542  1.00 116.77 ? 222 GLN G C     1 
ATOM   6787 O O     . GLN C 3 199 ? 73.458  -79.562 57.503  1.00 118.90 ? 222 GLN G O     1 
ATOM   6788 C CB    . GLN C 3 199 ? 76.258  -78.822 59.001  1.00 143.64 ? 222 GLN G CB    1 
ATOM   6789 C CG    . GLN C 3 199 ? 75.668  -79.927 59.857  1.00 146.47 ? 222 GLN G CG    1 
ATOM   6790 C CD    . GLN C 3 199 ? 76.356  -80.047 61.200  1.00 147.68 ? 222 GLN G CD    1 
ATOM   6791 O OE1   . GLN C 3 199 ? 76.756  -79.045 61.796  1.00 146.09 ? 222 GLN G OE1   1 
ATOM   6792 N NE2   . GLN C 3 199 ? 76.508  -81.281 61.683  1.00 150.79 ? 222 GLN G NE2   1 
ATOM   6793 N N     . HIS C 3 200 ? 73.830  -77.337 57.558  1.00 125.71 ? 223 HIS G N     1 
ATOM   6794 C CA    . HIS C 3 200 ? 72.420  -76.982 57.482  1.00 125.43 ? 223 HIS G CA    1 
ATOM   6795 C C     . HIS C 3 200 ? 72.123  -76.258 56.165  1.00 123.63 ? 223 HIS G C     1 
ATOM   6796 O O     . HIS C 3 200 ? 73.032  -75.940 55.401  1.00 122.47 ? 223 HIS G O     1 
ATOM   6797 C CB    . HIS C 3 200 ? 72.019  -76.090 58.665  1.00 113.45 ? 223 HIS G CB    1 
ATOM   6798 C CG    . HIS C 3 200 ? 72.402  -76.631 60.013  1.00 115.14 ? 223 HIS G CG    1 
ATOM   6799 N ND1   . HIS C 3 200 ? 73.713  -76.796 60.410  1.00 115.30 ? 223 HIS G ND1   1 
ATOM   6800 C CD2   . HIS C 3 200 ? 71.641  -77.012 61.065  1.00 116.96 ? 223 HIS G CD2   1 
ATOM   6801 C CE1   . HIS C 3 200 ? 73.743  -77.270 61.642  1.00 117.12 ? 223 HIS G CE1   1 
ATOM   6802 N NE2   . HIS C 3 200 ? 72.499  -77.409 62.062  1.00 118.14 ? 223 HIS G NE2   1 
ATOM   6803 N N     . ARG C 3 201 ? 70.848  -75.990 55.910  1.00 113.87 ? 224 ARG G N     1 
ATOM   6804 C CA    . ARG C 3 201 ? 70.439  -75.269 54.712  1.00 112.42 ? 224 ARG G CA    1 
ATOM   6805 C C     . ARG C 3 201 ? 70.206  -73.792 55.015  1.00 110.41 ? 224 ARG G C     1 
ATOM   6806 O O     . ARG C 3 201 ? 69.704  -73.049 54.170  1.00 109.37 ? 224 ARG G O     1 
ATOM   6807 C CB    . ARG C 3 201 ? 69.184  -75.896 54.099  1.00 195.76 ? 224 ARG G CB    1 
ATOM   6808 C CG    . ARG C 3 201 ? 69.311  -77.387 53.831  1.00 198.28 ? 224 ARG G CG    1 
ATOM   6809 C CD    . ARG C 3 201 ? 68.255  -77.877 52.851  1.00 199.76 ? 224 ARG G CD    1 
ATOM   6810 N NE    . ARG C 3 201 ? 67.542  -79.054 53.343  1.00 202.85 ? 224 ARG G NE    1 
ATOM   6811 C CZ    . ARG C 3 201 ? 68.053  -80.281 53.388  1.00 205.12 ? 224 ARG G CZ    1 
ATOM   6812 N NH1   . ARG C 3 201 ? 67.324  -81.288 53.849  1.00 208.19 ? 224 ARG G NH1   1 
ATOM   6813 N NH2   . ARG C 3 201 ? 69.295  -80.505 52.978  1.00 204.63 ? 224 ARG G NH2   1 
ATOM   6814 N N     . VAL C 3 202 ? 70.527  -73.385 56.238  1.00 109.94 ? 225 VAL G N     1 
ATOM   6815 C CA    . VAL C 3 202 ? 70.271  -72.020 56.694  1.00 108.57 ? 225 VAL G CA    1 
ATOM   6816 C C     . VAL C 3 202 ? 70.960  -70.961 55.829  1.00 106.56 ? 225 VAL G C     1 
ATOM   6817 O O     . VAL C 3 202 ? 72.042  -71.200 55.292  1.00 106.11 ? 225 VAL G O     1 
ATOM   6818 C CB    . VAL C 3 202 ? 70.717  -71.835 58.153  1.00 137.48 ? 225 VAL G CB    1 
ATOM   6819 C CG1   . VAL C 3 202 ? 70.027  -72.848 59.034  1.00 139.72 ? 225 VAL G CG1   1 
ATOM   6820 C CG2   . VAL C 3 202 ? 72.225  -71.983 58.271  1.00 137.03 ? 225 VAL G CG2   1 
ATOM   6821 N N     . SER C 3 203 ? 70.314  -69.802 55.678  1.00 104.41 ? 226 SER G N     1 
ATOM   6822 C CA    . SER C 3 203 ? 70.877  -68.699 54.897  1.00 102.82 ? 226 SER G CA    1 
ATOM   6823 C C     . SER C 3 203 ? 71.719  -67.724 55.726  1.00 102.11 ? 226 SER G C     1 
ATOM   6824 O O     . SER C 3 203 ? 72.455  -66.918 55.161  1.00 101.08 ? 226 SER G O     1 
ATOM   6825 C CB    . SER C 3 203 ? 69.763  -67.920 54.185  1.00 183.68 ? 226 SER G CB    1 
ATOM   6826 O OG    . SER C 3 203 ? 68.869  -67.327 55.113  1.00 184.27 ? 226 SER G OG    1 
ATOM   6827 N N     . ALA C 3 204 ? 71.623  -67.802 57.054  1.00 102.92 ? 227 ALA G N     1 
ATOM   6828 C CA    . ALA C 3 204 ? 72.417  -66.939 57.934  1.00 102.65 ? 227 ALA G CA    1 
ATOM   6829 C C     . ALA C 3 204 ? 72.639  -67.532 59.310  1.00 103.90 ? 227 ALA G C     1 
ATOM   6830 O O     . ALA C 3 204 ? 71.920  -68.430 59.744  1.00 105.10 ? 227 ALA G O     1 
ATOM   6831 C CB    . ALA C 3 204 ? 71.772  -65.592 58.084  1.00 102.38 ? 227 ALA G CB    1 
ATOM   6832 N N     . LEU C 3 205 ? 73.641  -66.997 59.993  1.00 158.83 ? 228 LEU G N     1 
ATOM   6833 C CA    . LEU C 3 205 ? 73.999  -67.417 61.336  1.00 160.15 ? 228 LEU G CA    1 
ATOM   6834 C C     . LEU C 3 205 ? 74.096  -66.203 62.251  1.00 160.41 ? 228 LEU G C     1 
ATOM   6835 O O     . LEU C 3 205 ? 75.125  -65.531 62.266  1.00 160.04 ? 228 LEU G O     1 
ATOM   6836 C CB    . LEU C 3 205 ? 75.326  -68.174 61.322  1.00 105.44 ? 228 LEU G CB    1 
ATOM   6837 C CG    . LEU C 3 205 ? 75.387  -69.429 60.463  1.00 105.63 ? 228 LEU G CG    1 
ATOM   6838 C CD1   . LEU C 3 205 ? 76.826  -69.839 60.299  1.00 105.87 ? 228 LEU G CD1   1 
ATOM   6839 C CD2   . LEU C 3 205 ? 74.580  -70.540 61.097  1.00 107.23 ? 228 LEU G CD2   1 
ATOM   6840 N N     . PRO C 3 206 ? 73.014  -65.880 62.980  1.00 109.93 ? 229 PRO G N     1 
ATOM   6841 C CA    . PRO C 3 206 ? 73.120  -64.732 63.885  1.00 110.57 ? 229 PRO G CA    1 
ATOM   6842 C C     . PRO C 3 206 ? 74.174  -64.977 64.965  1.00 111.62 ? 229 PRO G C     1 
ATOM   6843 O O     . PRO C 3 206 ? 74.117  -65.994 65.654  1.00 112.78 ? 229 PRO G O     1 
ATOM   6844 C CB    . PRO C 3 206 ? 71.714  -64.627 64.487  1.00 108.23 ? 229 PRO G CB    1 
ATOM   6845 C CG    . PRO C 3 206 ? 71.139  -65.990 64.359  1.00 108.74 ? 229 PRO G CG    1 
ATOM   6846 C CD    . PRO C 3 206 ? 71.726  -66.582 63.113  1.00 107.28 ? 229 PRO G CD    1 
ATOM   6847 N N     . VAL C 3 207 ? 75.121  -64.057 65.113  1.00 107.91 ? 230 VAL G N     1 
ATOM   6848 C CA    . VAL C 3 207 ? 76.186  -64.250 66.085  1.00 109.11 ? 230 VAL G CA    1 
ATOM   6849 C C     . VAL C 3 207 ? 75.686  -63.884 67.476  1.00 110.98 ? 230 VAL G C     1 
ATOM   6850 O O     . VAL C 3 207 ? 74.780  -63.062 67.627  1.00 111.29 ? 230 VAL G O     1 
ATOM   6851 C CB    . VAL C 3 207 ? 77.443  -63.422 65.749  1.00 108.70 ? 230 VAL G CB    1 
ATOM   6852 C CG1   . VAL C 3 207 ? 77.767  -63.526 64.275  1.00 106.97 ? 230 VAL G CG1   1 
ATOM   6853 C CG2   . VAL C 3 207 ? 77.246  -61.981 66.134  1.00 109.28 ? 230 VAL G CG2   1 
ATOM   6854 N N     . VAL C 3 208 ? 76.271  -64.506 68.493  1.00 112.48 ? 231 VAL G N     1 
ATOM   6855 C CA    . VAL C 3 208 ? 75.863  -64.256 69.868  1.00 114.59 ? 231 VAL G CA    1 
ATOM   6856 C C     . VAL C 3 208 ? 77.061  -64.098 70.802  1.00 116.09 ? 231 VAL G C     1 
ATOM   6857 O O     . VAL C 3 208 ? 78.143  -64.628 70.548  1.00 115.83 ? 231 VAL G O     1 
ATOM   6858 C CB    . VAL C 3 208 ? 74.959  -65.389 70.399  1.00 118.73 ? 231 VAL G CB    1 
ATOM   6859 C CG1   . VAL C 3 208 ? 73.624  -65.394 69.672  1.00 117.89 ? 231 VAL G CG1   1 
ATOM   6860 C CG2   . VAL C 3 208 ? 75.655  -66.737 70.263  1.00 118.83 ? 231 VAL G CG2   1 
ATOM   6861 N N     . ASP C 3 209 ? 76.849  -63.358 71.884  1.00 117.93 ? 232 ASP G N     1 
ATOM   6862 C CA    . ASP C 3 209 ? 77.862  -63.158 72.915  1.00 119.86 ? 232 ASP G CA    1 
ATOM   6863 C C     . ASP C 3 209 ? 77.790  -64.257 73.982  1.00 121.81 ? 232 ASP G C     1 
ATOM   6864 O O     . ASP C 3 209 ? 77.175  -65.304 73.766  1.00 121.47 ? 232 ASP G O     1 
ATOM   6865 C CB    . ASP C 3 209 ? 77.709  -61.775 73.555  1.00 133.68 ? 232 ASP G CB    1 
ATOM   6866 C CG    . ASP C 3 209 ? 76.386  -61.605 74.281  1.00 135.09 ? 232 ASP G CG    1 
ATOM   6867 O OD1   . ASP C 3 209 ? 75.431  -62.355 73.983  1.00 134.41 ? 232 ASP G OD1   1 
ATOM   6868 O OD2   . ASP C 3 209 ? 76.299  -60.713 75.150  1.00 137.14 ? 232 ASP G OD2   1 
ATOM   6869 N N     . GLU C 3 210 ? 78.459  -64.031 75.112  1.00 130.28 ? 233 GLU G N     1 
ATOM   6870 C CA    . GLU C 3 210 ? 78.447  -64.989 76.217  1.00 132.56 ? 233 GLU G CA    1 
ATOM   6871 C C     . GLU C 3 210 ? 77.021  -65.281 76.667  1.00 133.43 ? 233 GLU G C     1 
ATOM   6872 O O     . GLU C 3 210 ? 76.673  -66.422 76.970  1.00 134.32 ? 233 GLU G O     1 
ATOM   6873 C CB    . GLU C 3 210 ? 79.273  -64.471 77.400  1.00 196.45 ? 233 GLU G CB    1 
ATOM   6874 C CG    . GLU C 3 210 ? 80.591  -63.788 77.025  1.00 196.06 ? 233 GLU G CG    1 
ATOM   6875 C CD    . GLU C 3 210 ? 81.604  -64.724 76.374  1.00 195.15 ? 233 GLU G CD    1 
ATOM   6876 O OE1   . GLU C 3 210 ? 82.643  -65.003 77.007  1.00 197.04 ? 233 GLU G OE1   1 
ATOM   6877 O OE2   . GLU C 3 210 ? 81.378  -65.165 75.225  1.00 192.78 ? 233 GLU G OE2   1 
ATOM   6878 N N     . LYS C 3 211 ? 76.199  -64.239 76.689  1.00 127.25 ? 234 LYS G N     1 
ATOM   6879 C CA    . LYS C 3 211 ? 74.825  -64.340 77.165  1.00 128.50 ? 234 LYS G CA    1 
ATOM   6880 C C     . LYS C 3 211 ? 73.910  -65.080 76.193  1.00 126.74 ? 234 LYS G C     1 
ATOM   6881 O O     . LYS C 3 211 ? 72.870  -65.604 76.591  1.00 128.07 ? 234 LYS G O     1 
ATOM   6882 C CB    . LYS C 3 211 ? 74.260  -62.943 77.430  1.00 138.63 ? 234 LYS G CB    1 
ATOM   6883 C CG    . LYS C 3 211 ? 74.995  -62.145 78.495  1.00 141.00 ? 234 LYS G CG    1 
ATOM   6884 C CD    . LYS C 3 211 ? 74.607  -62.588 79.893  1.00 144.27 ? 234 LYS G CD    1 
ATOM   6885 C CE    . LYS C 3 211 ? 75.229  -61.684 80.946  1.00 146.95 ? 234 LYS G CE    1 
ATOM   6886 N NZ    . LYS C 3 211 ? 74.761  -60.272 80.833  1.00 147.39 ? 234 LYS G NZ    1 
ATOM   6887 N N     . GLY C 3 212 ? 74.293  -65.121 74.921  1.00 124.03 ? 235 GLY G N     1 
ATOM   6888 C CA    . GLY C 3 212 ? 73.430  -65.673 73.888  1.00 122.39 ? 235 GLY G CA    1 
ATOM   6889 C C     . GLY C 3 212 ? 72.551  -64.624 73.224  1.00 121.32 ? 235 GLY G C     1 
ATOM   6890 O O     . GLY C 3 212 ? 71.494  -64.936 72.672  1.00 120.87 ? 235 GLY G O     1 
ATOM   6891 N N     . ARG C 3 213 ? 72.997  -63.371 73.282  1.00 126.48 ? 236 ARG G N     1 
ATOM   6892 C CA    . ARG C 3 213 ? 72.272  -62.246 72.697  1.00 125.84 ? 236 ARG G CA    1 
ATOM   6893 C C     . ARG C 3 213 ? 72.811  -61.886 71.315  1.00 123.17 ? 236 ARG G C     1 
ATOM   6894 O O     . ARG C 3 213 ? 74.024  -61.910 71.092  1.00 122.37 ? 236 ARG G O     1 
ATOM   6895 C CB    . ARG C 3 213 ? 72.364  -61.029 73.620  1.00 122.60 ? 236 ARG G CB    1 
ATOM   6896 C CG    . ARG C 3 213 ? 72.040  -61.337 75.070  1.00 125.57 ? 236 ARG G CG    1 
ATOM   6897 C CD    . ARG C 3 213 ? 72.035  -60.086 75.938  1.00 127.90 ? 236 ARG G CD    1 
ATOM   6898 N NE    . ARG C 3 213 ? 73.370  -59.597 76.258  1.00 128.24 ? 236 ARG G NE    1 
ATOM   6899 C CZ    . ARG C 3 213 ? 73.612  -58.608 77.112  1.00 130.65 ? 236 ARG G CZ    1 
ATOM   6900 N NH1   . ARG C 3 213 ? 72.608  -58.003 77.735  1.00 132.91 ? 236 ARG G NH1   1 
ATOM   6901 N NH2   . ARG C 3 213 ? 74.858  -58.226 77.346  1.00 131.08 ? 236 ARG G NH2   1 
ATOM   6902 N N     . VAL C 3 214 ? 71.926  -61.517 70.392  1.00 117.16 ? 237 VAL G N     1 
ATOM   6903 C CA    . VAL C 3 214 ? 72.383  -61.235 69.037  1.00 114.80 ? 237 VAL G CA    1 
ATOM   6904 C C     . VAL C 3 214 ? 73.019  -59.846 68.954  1.00 114.92 ? 237 VAL G C     1 
ATOM   6905 O O     . VAL C 3 214 ? 72.351  -58.821 69.103  1.00 115.95 ? 237 VAL G O     1 
ATOM   6906 C CB    . VAL C 3 214 ? 71.214  -61.342 68.017  1.00 117.20 ? 237 VAL G CB    1 
ATOM   6907 C CG1   . VAL C 3 214 ? 70.823  -62.791 67.817  1.00 116.89 ? 237 VAL G CG1   1 
ATOM   6908 C CG2   . VAL C 3 214 ? 69.995  -60.533 68.467  1.00 118.89 ? 237 VAL G CG2   1 
ATOM   6909 N N     . VAL C 3 215 ? 74.329  -59.820 68.724  1.00 131.21 ? 238 VAL G N     1 
ATOM   6910 C CA    . VAL C 3 215 ? 75.041  -58.556 68.556  1.00 131.50 ? 238 VAL G CA    1 
ATOM   6911 C C     . VAL C 3 215 ? 75.383  -58.255 67.094  1.00 129.46 ? 238 VAL G C     1 
ATOM   6912 O O     . VAL C 3 215 ? 75.860  -57.164 66.773  1.00 129.74 ? 238 VAL G O     1 
ATOM   6913 C CB    . VAL C 3 215 ? 76.336  -58.536 69.402  1.00 127.05 ? 238 VAL G CB    1 
ATOM   6914 C CG1   . VAL C 3 215 ? 76.007  -58.652 70.885  1.00 129.46 ? 238 VAL G CG1   1 
ATOM   6915 C CG2   . VAL C 3 215 ? 77.264  -59.657 68.987  1.00 125.81 ? 238 VAL G CG2   1 
ATOM   6916 N N     . ASP C 3 216 ? 75.129  -59.228 66.220  1.00 110.32 ? 239 ASP G N     1 
ATOM   6917 C CA    . ASP C 3 216 ? 75.392  -59.100 64.788  1.00 108.49 ? 239 ASP G CA    1 
ATOM   6918 C C     . ASP C 3 216 ? 74.770  -60.297 64.081  1.00 107.17 ? 239 ASP G C     1 
ATOM   6919 O O     . ASP C 3 216 ? 74.219  -61.182 64.735  1.00 107.79 ? 239 ASP G O     1 
ATOM   6920 C CB    . ASP C 3 216 ? 76.895  -59.017 64.497  1.00 135.26 ? 239 ASP G CB    1 
ATOM   6921 C CG    . ASP C 3 216 ? 77.217  -58.176 63.273  1.00 134.34 ? 239 ASP G CG    1 
ATOM   6922 O OD1   . ASP C 3 216 ? 76.423  -58.177 62.306  1.00 133.20 ? 239 ASP G OD1   1 
ATOM   6923 O OD2   . ASP C 3 216 ? 78.272  -57.505 63.284  1.00 135.00 ? 239 ASP G OD2   1 
ATOM   6924 N N     . ILE C 3 217 ? 74.861  -60.325 62.752  1.00 114.90 ? 240 ILE G N     1 
ATOM   6925 C CA    . ILE C 3 217 ? 74.372  -61.459 61.973  1.00 113.84 ? 240 ILE G CA    1 
ATOM   6926 C C     . ILE C 3 217 ? 75.310  -61.754 60.808  1.00 112.57 ? 240 ILE G C     1 
ATOM   6927 O O     . ILE C 3 217 ? 75.786  -60.839 60.130  1.00 112.13 ? 240 ILE G O     1 
ATOM   6928 C CB    . ILE C 3 217 ? 72.935  -61.226 61.445  1.00 104.43 ? 240 ILE G CB    1 
ATOM   6929 C CG1   . ILE C 3 217 ? 72.436  -62.474 60.721  1.00 103.75 ? 240 ILE G CG1   1 
ATOM   6930 C CG2   . ILE C 3 217 ? 72.850  -59.990 60.549  1.00 103.94 ? 240 ILE G CG2   1 
ATOM   6931 C CD1   . ILE C 3 217 ? 70.982  -62.424 60.406  1.00 104.09 ? 240 ILE G CD1   1 
ATOM   6932 N N     . TYR C 3 218 ? 75.590  -63.039 60.597  1.00 108.89 ? 241 TYR G N     1 
ATOM   6933 C CA    . TYR C 3 218 ? 76.457  -63.457 59.502  1.00 108.02 ? 241 TYR G CA    1 
ATOM   6934 C C     . TYR C 3 218 ? 75.640  -64.223 58.465  1.00 107.31 ? 241 TYR G C     1 
ATOM   6935 O O     . TYR C 3 218 ? 75.331  -65.402 58.648  1.00 107.76 ? 241 TYR G O     1 
ATOM   6936 C CB    . TYR C 3 218 ? 77.592  -64.328 60.048  1.00 102.88 ? 241 TYR G CB    1 
ATOM   6937 C CG    . TYR C 3 218 ? 78.793  -64.474 59.143  1.00 102.52 ? 241 TYR G CG    1 
ATOM   6938 C CD1   . TYR C 3 218 ? 79.595  -63.381 58.844  1.00 102.45 ? 241 TYR G CD1   1 
ATOM   6939 C CD2   . TYR C 3 218 ? 79.149  -65.710 58.618  1.00 102.63 ? 241 TYR G CD2   1 
ATOM   6940 C CE1   . TYR C 3 218 ? 80.707  -63.505 58.024  1.00 102.44 ? 241 TYR G CE1   1 
ATOM   6941 C CE2   . TYR C 3 218 ? 80.264  -65.847 57.797  1.00 102.64 ? 241 TYR G CE2   1 
ATOM   6942 C CZ    . TYR C 3 218 ? 81.041  -64.736 57.503  1.00 102.53 ? 241 TYR G CZ    1 
ATOM   6943 O OH    . TYR C 3 218 ? 82.153  -64.836 56.693  1.00 102.83 ? 241 TYR G OH    1 
ATOM   6944 N N     . SER C 3 219 ? 75.315  -63.537 57.369  1.00 133.82 ? 242 SER G N     1 
ATOM   6945 C CA    . SER C 3 219 ? 74.525  -64.090 56.270  1.00 133.30 ? 242 SER G CA    1 
ATOM   6946 C C     . SER C 3 219 ? 75.414  -64.859 55.315  1.00 132.97 ? 242 SER G C     1 
ATOM   6947 O O     . SER C 3 219 ? 76.627  -64.656 55.290  1.00 132.98 ? 242 SER G O     1 
ATOM   6948 C CB    . SER C 3 219 ? 73.760  -62.989 55.522  1.00 99.68  ? 242 SER G CB    1 
ATOM   6949 O OG    . SER C 3 219 ? 72.880  -63.537 54.550  1.00 99.47  ? 242 SER G OG    1 
ATOM   6950 N N     . LYS C 3 220 ? 74.816  -65.764 54.548  1.00 99.80  ? 243 LYS G N     1 
ATOM   6951 C CA    . LYS C 3 220 ? 75.553  -66.455 53.509  1.00 99.75  ? 243 LYS G CA    1 
ATOM   6952 C C     . LYS C 3 220 ? 75.980  -65.453 52.460  1.00 99.04  ? 243 LYS G C     1 
ATOM   6953 O O     . LYS C 3 220 ? 76.898  -65.718 51.708  1.00 99.13  ? 243 LYS G O     1 
ATOM   6954 C CB    . LYS C 3 220 ? 74.726  -67.579 52.892  1.00 100.26 ? 243 LYS G CB    1 
ATOM   6955 C CG    . LYS C 3 220 ? 74.846  -68.882 53.655  1.00 101.43 ? 243 LYS G CG    1 
ATOM   6956 C CD    . LYS C 3 220 ? 73.847  -69.931 53.202  1.00 102.35 ? 243 LYS G CD    1 
ATOM   6957 C CE    . LYS C 3 220 ? 74.195  -70.538 51.860  1.00 102.64 ? 243 LYS G CE    1 
ATOM   6958 N NZ    . LYS C 3 220 ? 73.140  -71.498 51.421  1.00 103.83 ? 243 LYS G NZ    1 
ATOM   6959 N N     . PHE C 3 221 ? 75.325  -64.297 52.419  1.00 98.61  ? 244 PHE G N     1 
ATOM   6960 C CA    . PHE C 3 221 ? 75.754  -63.224 51.529  1.00 98.24  ? 244 PHE G CA    1 
ATOM   6961 C C     . PHE C 3 221 ? 77.036  -62.579 52.046  1.00 98.46  ? 244 PHE G C     1 
ATOM   6962 O O     . PHE C 3 221 ? 77.887  -62.147 51.272  1.00 98.52  ? 244 PHE G O     1 
ATOM   6963 C CB    . PHE C 3 221 ? 74.656  -62.169 51.380  1.00 98.12  ? 244 PHE G CB    1 
ATOM   6964 C CG    . PHE C 3 221 ? 75.066  -60.977 50.563  1.00 98.06  ? 244 PHE G CG    1 
ATOM   6965 C CD1   . PHE C 3 221 ? 74.976  -61.003 49.179  1.00 97.96  ? 244 PHE G CD1   1 
ATOM   6966 C CD2   . PHE C 3 221 ? 75.543  -59.830 51.179  1.00 98.42  ? 244 PHE G CD2   1 
ATOM   6967 C CE1   . PHE C 3 221 ? 75.358  -59.901 48.429  1.00 98.18  ? 244 PHE G CE1   1 
ATOM   6968 C CE2   . PHE C 3 221 ? 75.926  -58.729 50.442  1.00 98.72  ? 244 PHE G CE2   1 
ATOM   6969 C CZ    . PHE C 3 221 ? 75.835  -58.760 49.066  1.00 98.59  ? 244 PHE G CZ    1 
ATOM   6970 N N     . ASP C 3 222 ? 77.170  -62.520 53.363  1.00 98.83  ? 245 ASP G N     1 
ATOM   6971 C CA    . ASP C 3 222 ? 78.295  -61.826 53.982  1.00 99.35  ? 245 ASP G CA    1 
ATOM   6972 C C     . ASP C 3 222 ? 79.637  -62.493 53.688  1.00 99.77  ? 245 ASP G C     1 
ATOM   6973 O O     . ASP C 3 222 ? 80.693  -61.870 53.832  1.00 100.39 ? 245 ASP G O     1 
ATOM   6974 C CB    . ASP C 3 222 ? 78.087  -61.733 55.496  1.00 129.82 ? 245 ASP G CB    1 
ATOM   6975 C CG    . ASP C 3 222 ? 77.062  -60.680 55.888  1.00 129.95 ? 245 ASP G CG    1 
ATOM   6976 O OD1   . ASP C 3 222 ? 77.231  -59.503 55.497  1.00 130.13 ? 245 ASP G OD1   1 
ATOM   6977 O OD2   . ASP C 3 222 ? 76.089  -61.032 56.589  1.00 130.14 ? 245 ASP G OD2   1 
ATOM   6978 N N     . VAL C 3 223 ? 79.603  -63.758 53.282  1.00 99.75  ? 246 VAL G N     1 
ATOM   6979 C CA    . VAL C 3 223 ? 80.845  -64.486 53.062  1.00 100.51 ? 246 VAL G CA    1 
ATOM   6980 C C     . VAL C 3 223 ? 81.508  -64.097 51.744  1.00 100.59 ? 246 VAL G C     1 
ATOM   6981 O O     . VAL C 3 223 ? 82.691  -64.370 51.541  1.00 101.51 ? 246 VAL G O     1 
ATOM   6982 C CB    . VAL C 3 223 ? 80.631  -66.014 53.076  1.00 100.94 ? 246 VAL G CB    1 
ATOM   6983 C CG1   . VAL C 3 223 ? 79.875  -66.436 54.315  1.00 101.09 ? 246 VAL G CG1   1 
ATOM   6984 C CG2   . VAL C 3 223 ? 79.892  -66.447 51.853  1.00 100.53 ? 246 VAL G CG2   1 
ATOM   6985 N N     . ILE C 3 224 ? 80.757  -63.453 50.854  1.00 99.88  ? 247 ILE G N     1 
ATOM   6986 C CA    . ILE C 3 224 ? 81.295  -63.081 49.549  1.00 100.14 ? 247 ILE G CA    1 
ATOM   6987 C C     . ILE C 3 224 ? 82.272  -61.922 49.717  1.00 100.80 ? 247 ILE G C     1 
ATOM   6988 O O     . ILE C 3 224 ? 83.147  -61.704 48.879  1.00 101.57 ? 247 ILE G O     1 
ATOM   6989 C CB    . ILE C 3 224 ? 80.174  -62.707 48.544  1.00 99.46  ? 247 ILE G CB    1 
ATOM   6990 C CG1   . ILE C 3 224 ? 80.689  -62.775 47.105  1.00 99.99  ? 247 ILE G CG1   1 
ATOM   6991 C CG2   . ILE C 3 224 ? 79.609  -61.329 48.838  1.00 99.13  ? 247 ILE G CG2   1 
ATOM   6992 C CD1   . ILE C 3 224 ? 81.304  -64.101 46.737  1.00 100.74 ? 247 ILE G CD1   1 
ATOM   6993 N N     . ASN C 3 225 ? 82.130  -61.196 50.821  1.00 100.79 ? 248 ASN G N     1 
ATOM   6994 C CA    . ASN C 3 225 ? 83.046  -60.114 51.151  1.00 101.78 ? 248 ASN G CA    1 
ATOM   6995 C C     . ASN C 3 225 ? 84.485  -60.607 51.224  1.00 103.02 ? 248 ASN G C     1 
ATOM   6996 O O     . ASN C 3 225 ? 85.421  -59.861 50.936  1.00 104.18 ? 248 ASN G O     1 
ATOM   6997 C CB    . ASN C 3 225 ? 82.643  -59.462 52.477  1.00 113.28 ? 248 ASN G CB    1 
ATOM   6998 C CG    . ASN C 3 225 ? 83.608  -58.366 52.914  1.00 114.69 ? 248 ASN G CG    1 
ATOM   6999 O OD1   . ASN C 3 225 ? 83.688  -57.308 52.285  1.00 115.21 ? 248 ASN G OD1   1 
ATOM   7000 N ND2   . ASN C 3 225 ? 84.333  -58.611 54.006  1.00 115.59 ? 248 ASN G ND2   1 
ATOM   7001 N N     . LEU C 3 226 ? 84.651  -61.869 51.612  1.00 129.27 ? 249 LEU G N     1 
ATOM   7002 C CA    . LEU C 3 226 ? 85.969  -62.494 51.674  1.00 130.71 ? 249 LEU G CA    1 
ATOM   7003 C C     . LEU C 3 226 ? 86.611  -62.457 50.300  1.00 131.40 ? 249 LEU G C     1 
ATOM   7004 O O     . LEU C 3 226 ? 87.800  -62.176 50.158  1.00 132.95 ? 249 LEU G O     1 
ATOM   7005 C CB    . LEU C 3 226 ? 85.872  -63.938 52.175  1.00 106.23 ? 249 LEU G CB    1 
ATOM   7006 C CG    . LEU C 3 226 ? 85.754  -64.206 53.679  1.00 106.44 ? 249 LEU G CG    1 
ATOM   7007 C CD1   . LEU C 3 226 ? 84.561  -63.480 54.330  1.00 105.25 ? 249 LEU G CD1   1 
ATOM   7008 C CD2   . LEU C 3 226 ? 85.670  -65.707 53.908  1.00 106.87 ? 249 LEU G CD2   1 
ATOM   7009 N N     . ALA C 3 227 ? 85.808  -62.732 49.283  1.00 104.28 ? 250 ALA G N     1 
ATOM   7010 C CA    . ALA C 3 227 ? 86.281  -62.668 47.916  1.00 105.02 ? 250 ALA G CA    1 
ATOM   7011 C C     . ALA C 3 227 ? 86.476  -61.211 47.495  1.00 105.36 ? 250 ALA G C     1 
ATOM   7012 O O     . ALA C 3 227 ? 87.434  -60.874 46.797  1.00 106.82 ? 250 ALA G O     1 
ATOM   7013 C CB    . ALA C 3 227 ? 85.308  -63.374 46.994  1.00 104.17 ? 250 ALA G CB    1 
ATOM   7014 N N     . ALA C 3 228 ? 85.567  -60.349 47.936  1.00 104.33 ? 251 ALA G N     1 
ATOM   7015 C CA    . ALA C 3 228 ? 85.621  -58.936 47.582  1.00 104.87 ? 251 ALA G CA    1 
ATOM   7016 C C     . ALA C 3 228 ? 86.891  -58.288 48.115  1.00 106.63 ? 251 ALA G C     1 
ATOM   7017 O O     . ALA C 3 228 ? 87.497  -57.460 47.443  1.00 107.98 ? 251 ALA G O     1 
ATOM   7018 C CB    . ALA C 3 228 ? 84.390  -58.205 48.109  1.00 220.16 ? 251 ALA G CB    1 
ATOM   7019 N N     . GLU C 3 229 ? 87.289  -58.665 49.325  1.00 124.59 ? 252 GLU G N     1 
ATOM   7020 C CA    . GLU C 3 229 ? 88.467  -58.076 49.954  1.00 126.50 ? 252 GLU G CA    1 
ATOM   7021 C C     . GLU C 3 229 ? 89.736  -58.911 49.786  1.00 128.04 ? 252 GLU G C     1 
ATOM   7022 O O     . GLU C 3 229 ? 90.787  -58.544 50.314  1.00 129.92 ? 252 GLU G O     1 
ATOM   7023 C CB    . GLU C 3 229 ? 88.214  -57.843 51.443  1.00 173.32 ? 252 GLU G CB    1 
ATOM   7024 C CG    . GLU C 3 229 ? 87.322  -56.657 51.748  1.00 172.91 ? 252 GLU G CG    1 
ATOM   7025 C CD    . GLU C 3 229 ? 87.233  -56.377 53.231  1.00 173.33 ? 252 GLU G CD    1 
ATOM   7026 O OE1   . GLU C 3 229 ? 88.273  -56.048 53.843  1.00 175.18 ? 252 GLU G OE1   1 
ATOM   7027 O OE2   . GLU C 3 229 ? 86.123  -56.502 53.784  1.00 172.03 ? 252 GLU G OE2   1 
ATOM   7028 N N     . LYS C 3 230 ? 89.628  -60.029 49.069  1.00 109.81 ? 253 LYS G N     1 
ATOM   7029 C CA    . LYS C 3 230 ? 90.751  -60.951 48.851  1.00 111.48 ? 253 LYS G CA    1 
ATOM   7030 C C     . LYS C 3 230 ? 91.306  -61.515 50.166  1.00 112.24 ? 253 LYS G C     1 
ATOM   7031 O O     . LYS C 3 230 ? 92.500  -61.795 50.282  1.00 114.37 ? 253 LYS G O     1 
ATOM   7032 C CB    . LYS C 3 230 ? 91.877  -60.265 48.058  1.00 128.72 ? 253 LYS G CB    1 
ATOM   7033 C CG    . LYS C 3 230 ? 91.724  -60.302 46.531  1.00 128.83 ? 253 LYS G CG    1 
ATOM   7034 C CD    . LYS C 3 230 ? 90.464  -59.586 46.054  1.00 126.95 ? 253 LYS G CD    1 
ATOM   7035 C CE    . LYS C 3 230 ? 90.447  -59.414 44.542  1.00 127.57 ? 253 LYS G CE    1 
ATOM   7036 N NZ    . LYS C 3 230 ? 91.285  -58.278 44.089  1.00 129.68 ? 253 LYS G NZ    1 
ATOM   7037 N N     . THR C 3 231 ? 90.432  -61.648 51.161  1.00 110.75 ? 254 THR G N     1 
ATOM   7038 C CA    . THR C 3 231 ? 90.805  -62.205 52.459  1.00 111.45 ? 254 THR G CA    1 
ATOM   7039 C C     . THR C 3 231 ? 90.415  -63.669 52.657  1.00 110.91 ? 254 THR G C     1 
ATOM   7040 O O     . THR C 3 231 ? 90.627  -64.210 53.736  1.00 111.54 ? 254 THR G O     1 
ATOM   7041 C CB    . THR C 3 231 ? 90.185  -61.388 53.601  1.00 138.32 ? 254 THR G CB    1 
ATOM   7042 O OG1   . THR C 3 231 ? 88.763  -61.577 53.612  1.00 136.14 ? 254 THR G OG1   1 
ATOM   7043 C CG2   . THR C 3 231 ? 90.506  -59.911 53.419  1.00 139.16 ? 254 THR G CG2   1 
ATOM   7044 N N     . TYR C 3 232 ? 89.830  -64.298 51.638  1.00 116.11 ? 255 TYR G N     1 
ATOM   7045 C CA    . TYR C 3 232 ? 89.344  -65.679 51.753  1.00 115.81 ? 255 TYR G CA    1 
ATOM   7046 C C     . TYR C 3 232 ? 90.457  -66.674 52.071  1.00 118.04 ? 255 TYR G C     1 
ATOM   7047 O O     . TYR C 3 232 ? 90.187  -67.794 52.506  1.00 118.30 ? 255 TYR G O     1 
ATOM   7048 C CB    . TYR C 3 232 ? 88.625  -66.110 50.466  1.00 123.52 ? 255 TYR G CB    1 
ATOM   7049 C CG    . TYR C 3 232 ? 89.487  -66.051 49.222  1.00 124.90 ? 255 TYR G CG    1 
ATOM   7050 C CD1   . TYR C 3 232 ? 90.271  -67.135 48.837  1.00 126.80 ? 255 TYR G CD1   1 
ATOM   7051 C CD2   . TYR C 3 232 ? 89.516  -64.909 48.431  1.00 124.61 ? 255 TYR G CD2   1 
ATOM   7052 C CE1   . TYR C 3 232 ? 91.066  -67.081 47.701  1.00 128.38 ? 255 TYR G CE1   1 
ATOM   7053 C CE2   . TYR C 3 232 ? 90.305  -64.844 47.296  1.00 126.13 ? 255 TYR G CE2   1 
ATOM   7054 C CZ    . TYR C 3 232 ? 91.078  -65.931 46.933  1.00 128.00 ? 255 TYR G CZ    1 
ATOM   7055 O OH    . TYR C 3 232 ? 91.861  -65.863 45.798  1.00 129.80 ? 255 TYR G OH    1 
ATOM   7056 N N     . ASN C 3 233 ? 91.702  -66.266 51.834  1.00 116.79 ? 256 ASN G N     1 
ATOM   7057 C CA    . ASN C 3 233 ? 92.861  -67.079 52.181  1.00 119.34 ? 256 ASN G CA    1 
ATOM   7058 C C     . ASN C 3 233 ? 92.826  -67.492 53.651  1.00 119.67 ? 256 ASN G C     1 
ATOM   7059 O O     . ASN C 3 233 ? 92.897  -68.681 53.961  1.00 120.66 ? 256 ASN G O     1 
ATOM   7060 C CB    . ASN C 3 233 ? 94.155  -66.322 51.873  1.00 147.14 ? 256 ASN G CB    1 
ATOM   7061 C CG    . ASN C 3 233 ? 95.395  -67.188 52.026  1.00 150.19 ? 256 ASN G CG    1 
ATOM   7062 O OD1   . ASN C 3 233 ? 95.326  -68.324 52.496  1.00 150.79 ? 256 ASN G OD1   1 
ATOM   7063 N ND2   . ASN C 3 233 ? 96.544  -66.646 51.636  1.00 152.44 ? 256 ASN G ND2   1 
ATOM   7064 N N     . ASN C 3 234 ? 92.684  -66.510 54.545  1.00 126.30 ? 257 ASN G N     1 
ATOM   7065 C CA    . ASN C 3 234 ? 92.664  -66.764 55.987  1.00 126.81 ? 257 ASN G CA    1 
ATOM   7066 C C     . ASN C 3 234 ? 91.243  -66.970 56.497  1.00 124.61 ? 257 ASN G C     1 
ATOM   7067 O O     . ASN C 3 234 ? 90.452  -66.030 56.590  1.00 122.93 ? 257 ASN G O     1 
ATOM   7068 C CB    . ASN C 3 234 ? 93.327  -65.598 56.732  1.00 125.54 ? 257 ASN G CB    1 
ATOM   7069 C CG    . ASN C 3 234 ? 93.478  -65.858 58.218  1.00 126.62 ? 257 ASN G CG    1 
ATOM   7070 O OD1   . ASN C 3 234 ? 92.602  -66.438 58.853  1.00 125.57 ? 257 ASN G OD1   1 
ATOM   7071 N ND2   . ASN C 3 234 ? 94.600  -65.425 58.781  1.00 128.98 ? 257 ASN G ND2   1 
ATOM   7072 N N     . LEU C 3 235 ? 90.931  -68.215 56.827  1.00 115.59 ? 258 LEU G N     1 
ATOM   7073 C CA    . LEU C 3 235 ? 89.630  -68.567 57.380  1.00 114.05 ? 258 LEU G CA    1 
ATOM   7074 C C     . LEU C 3 235 ? 89.652  -68.775 58.901  1.00 115.03 ? 258 LEU G C     1 
ATOM   7075 O O     . LEU C 3 235 ? 88.672  -69.246 59.482  1.00 114.33 ? 258 LEU G O     1 
ATOM   7076 C CB    . LEU C 3 235 ? 89.077  -69.796 56.662  1.00 113.07 ? 258 LEU G CB    1 
ATOM   7077 C CG    . LEU C 3 235 ? 88.870  -69.545 55.162  1.00 112.03 ? 258 LEU G CG    1 
ATOM   7078 C CD1   . LEU C 3 235 ? 88.278  -70.761 54.475  1.00 112.17 ? 258 LEU G CD1   1 
ATOM   7079 C CD2   . LEU C 3 235 ? 88.002  -68.313 54.918  1.00 109.80 ? 258 LEU G CD2   1 
ATOM   7080 N N     . ASP C 3 236 ? 90.787  -68.486 59.531  1.00 134.40 ? 259 ASP G N     1 
ATOM   7081 C CA    . ASP C 3 236 ? 90.930  -68.670 60.976  1.00 135.73 ? 259 ASP G CA    1 
ATOM   7082 C C     . ASP C 3 236 ? 90.351  -67.503 61.783  1.00 134.74 ? 259 ASP G C     1 
ATOM   7083 O O     . ASP C 3 236 ? 90.144  -67.626 62.991  1.00 135.53 ? 259 ASP G O     1 
ATOM   7084 C CB    . ASP C 3 236 ? 92.406  -68.869 61.348  1.00 132.94 ? 259 ASP G CB    1 
ATOM   7085 C CG    . ASP C 3 236 ? 93.012  -70.110 60.710  1.00 134.54 ? 259 ASP G CG    1 
ATOM   7086 O OD1   . ASP C 3 236 ? 92.427  -70.617 59.729  1.00 133.31 ? 259 ASP G OD1   1 
ATOM   7087 O OD2   . ASP C 3 236 ? 94.076  -70.572 61.184  1.00 137.28 ? 259 ASP G OD2   1 
ATOM   7088 N N     . VAL C 3 237 ? 90.095  -66.378 61.114  1.00 120.27 ? 260 VAL G N     1 
ATOM   7089 C CA    . VAL C 3 237 ? 89.598  -65.172 61.781  1.00 119.69 ? 260 VAL G CA    1 
ATOM   7090 C C     . VAL C 3 237 ? 88.177  -65.372 62.281  1.00 118.21 ? 260 VAL G C     1 
ATOM   7091 O O     . VAL C 3 237 ? 87.448  -66.211 61.761  1.00 117.10 ? 260 VAL G O     1 
ATOM   7092 C CB    . VAL C 3 237 ? 89.623  -63.945 60.848  1.00 113.49 ? 260 VAL G CB    1 
ATOM   7093 C CG1   . VAL C 3 237 ? 91.047  -63.610 60.435  1.00 115.36 ? 260 VAL G CG1   1 
ATOM   7094 C CG2   . VAL C 3 237 ? 88.753  -64.190 59.628  1.00 111.38 ? 260 VAL G CG2   1 
ATOM   7095 N N     . SER C 3 238 ? 87.790  -64.605 63.296  1.00 113.24 ? 261 SER G N     1 
ATOM   7096 C CA    . SER C 3 238 ? 86.433  -64.663 63.841  1.00 112.19 ? 261 SER G CA    1 
ATOM   7097 C C     . SER C 3 238 ? 85.423  -63.970 62.944  1.00 110.13 ? 261 SER G C     1 
ATOM   7098 O O     . SER C 3 238 ? 85.794  -63.142 62.111  1.00 109.69 ? 261 SER G O     1 
ATOM   7099 C CB    . SER C 3 238 ? 86.389  -64.028 65.221  1.00 113.57 ? 261 SER G CB    1 
ATOM   7100 O OG    . SER C 3 238 ? 86.745  -62.662 65.134  1.00 113.88 ? 261 SER G OG    1 
ATOM   7101 N N     . VAL C 3 239 ? 84.145  -64.301 63.121  1.00 109.15 ? 262 VAL G N     1 
ATOM   7102 C CA    . VAL C 3 239 ? 83.097  -63.707 62.295  1.00 107.42 ? 262 VAL G CA    1 
ATOM   7103 C C     . VAL C 3 239 ? 82.984  -62.223 62.590  1.00 107.66 ? 262 VAL G C     1 
ATOM   7104 O O     . VAL C 3 239 ? 82.585  -61.446 61.722  1.00 106.65 ? 262 VAL G O     1 
ATOM   7105 C CB    . VAL C 3 239 ? 81.716  -64.366 62.506  1.00 106.75 ? 262 VAL G CB    1 
ATOM   7106 C CG1   . VAL C 3 239 ? 81.729  -65.806 62.043  1.00 106.67 ? 262 VAL G CG1   1 
ATOM   7107 C CG2   . VAL C 3 239 ? 81.310  -64.281 63.947  1.00 107.98 ? 262 VAL G CG2   1 
ATOM   7108 N N     . THR C 3 240 ? 83.351  -61.830 63.807  1.00 120.70 ? 263 THR G N     1 
ATOM   7109 C CA    . THR C 3 240 ? 83.323  -60.423 64.188  1.00 121.48 ? 263 THR G CA    1 
ATOM   7110 C C     . THR C 3 240 ? 84.394  -59.662 63.428  1.00 121.85 ? 263 THR G C     1 
ATOM   7111 O O     . THR C 3 240 ? 84.179  -58.529 62.997  1.00 121.79 ? 263 THR G O     1 
ATOM   7112 C CB    . THR C 3 240 ? 83.534  -60.225 65.697  1.00 137.84 ? 263 THR G CB    1 
ATOM   7113 O OG1   . THR C 3 240 ? 82.556  -60.984 66.418  1.00 137.77 ? 263 THR G OG1   1 
ATOM   7114 C CG2   . THR C 3 240 ? 83.393  -58.750 66.068  1.00 138.92 ? 263 THR G CG2   1 
ATOM   7115 N N     . LYS C 3 241 ? 85.546  -60.296 63.254  1.00 111.08 ? 264 LYS G N     1 
ATOM   7116 C CA    . LYS C 3 241 ? 86.643  -59.678 62.525  1.00 111.79 ? 264 LYS G CA    1 
ATOM   7117 C C     . LYS C 3 241 ? 86.306  -59.588 61.045  1.00 110.08 ? 264 LYS G C     1 
ATOM   7118 O O     . LYS C 3 241 ? 86.726  -58.657 60.363  1.00 110.45 ? 264 LYS G O     1 
ATOM   7119 C CB    . LYS C 3 241 ? 87.934  -60.465 62.726  1.00 135.65 ? 264 LYS G CB    1 
ATOM   7120 C CG    . LYS C 3 241 ? 89.195  -59.657 62.495  1.00 137.46 ? 264 LYS G CG    1 
ATOM   7121 C CD    . LYS C 3 241 ? 89.418  -58.666 63.625  1.00 139.43 ? 264 LYS G CD    1 
ATOM   7122 C CE    . LYS C 3 241 ? 90.702  -57.877 63.419  1.00 141.66 ? 264 LYS G CE    1 
ATOM   7123 N NZ    . LYS C 3 241 ? 90.898  -56.840 64.472  1.00 143.89 ? 264 LYS G NZ    1 
ATOM   7124 N N     . ALA C 3 242 ? 85.538  -60.559 60.561  1.00 117.45 ? 265 ALA G N     1 
ATOM   7125 C CA    . ALA C 3 242 ? 85.116  -60.585 59.168  1.00 115.93 ? 265 ALA G CA    1 
ATOM   7126 C C     . ALA C 3 242 ? 84.038  -59.542 58.924  1.00 115.10 ? 265 ALA G C     1 
ATOM   7127 O O     . ALA C 3 242 ? 84.007  -58.891 57.881  1.00 114.65 ? 265 ALA G O     1 
ATOM   7128 C CB    . ALA C 3 242 ? 84.613  -61.971 58.786  1.00 105.90 ? 265 ALA G CB    1 
ATOM   7129 N N     . LEU C 3 243 ? 83.161  -59.377 59.900  1.00 106.18 ? 266 LEU G N     1 
ATOM   7130 C CA    . LEU C 3 243 ? 82.085  -58.417 59.778  1.00 105.76 ? 266 LEU G CA    1 
ATOM   7131 C C     . LEU C 3 243 ? 82.564  -57.042 60.189  1.00 107.34 ? 266 LEU G C     1 
ATOM   7132 O O     . LEU C 3 243 ? 81.776  -56.103 60.225  1.00 107.57 ? 266 LEU G O     1 
ATOM   7133 C CB    . LEU C 3 243 ? 80.887  -58.834 60.623  1.00 105.51 ? 266 LEU G CB    1 
ATOM   7134 C CG    . LEU C 3 243 ? 80.094  -60.039 60.127  1.00 104.15 ? 266 LEU G CG    1 
ATOM   7135 C CD1   . LEU C 3 243 ? 79.131  -60.520 61.192  1.00 104.53 ? 266 LEU G CD1   1 
ATOM   7136 C CD2   . LEU C 3 243 ? 79.337  -59.676 58.875  1.00 102.96 ? 266 LEU G CD2   1 
ATOM   7137 N N     . GLN C 3 244 ? 83.849  -56.928 60.519  1.00 126.43 ? 267 GLN G N     1 
ATOM   7138 C CA    . GLN C 3 244 ? 84.429  -55.652 60.939  1.00 128.41 ? 267 GLN G CA    1 
ATOM   7139 C C     . GLN C 3 244 ? 84.516  -54.662 59.777  1.00 128.45 ? 267 GLN G C     1 
ATOM   7140 O O     . GLN C 3 244 ? 84.670  -53.456 59.983  1.00 130.11 ? 267 GLN G O     1 
ATOM   7141 C CB    . GLN C 3 244 ? 85.818  -55.865 61.550  1.00 145.46 ? 267 GLN G CB    1 
ATOM   7142 C CG    . GLN C 3 244 ? 86.345  -54.678 62.354  1.00 148.00 ? 267 GLN G CG    1 
ATOM   7143 C CD    . GLN C 3 244 ? 87.718  -54.940 62.950  1.00 150.00 ? 267 GLN G CD    1 
ATOM   7144 O OE1   . GLN C 3 244 ? 88.473  -55.772 62.447  1.00 149.65 ? 267 GLN G OE1   1 
ATOM   7145 N NE2   . GLN C 3 244 ? 88.045  -54.232 64.029  1.00 152.37 ? 267 GLN G NE2   1 
ATOM   7146 N N     . HIS C 3 245 ? 84.408  -55.174 58.556  1.00 109.20 ? 268 HIS G N     1 
ATOM   7147 C CA    . HIS C 3 245 ? 84.497  -54.334 57.369  1.00 109.32 ? 268 HIS G CA    1 
ATOM   7148 C C     . HIS C 3 245 ? 83.335  -53.346 57.285  1.00 109.30 ? 268 HIS G C     1 
ATOM   7149 O O     . HIS C 3 245 ? 83.515  -52.192 56.903  1.00 110.64 ? 268 HIS G O     1 
ATOM   7150 C CB    . HIS C 3 245 ? 84.548  -55.201 56.110  1.00 116.27 ? 268 HIS G CB    1 
ATOM   7151 C CG    . HIS C 3 245 ? 83.230  -55.794 55.723  1.00 114.32 ? 268 HIS G CG    1 
ATOM   7152 N ND1   . HIS C 3 245 ? 82.669  -56.865 56.384  1.00 113.37 ? 268 HIS G ND1   1 
ATOM   7153 C CD2   . HIS C 3 245 ? 82.362  -55.466 54.737  1.00 113.42 ? 268 HIS G CD2   1 
ATOM   7154 C CE1   . HIS C 3 245 ? 81.512  -57.170 55.822  1.00 112.01 ? 268 HIS G CE1   1 
ATOM   7155 N NE2   . HIS C 3 245 ? 81.301  -56.336 54.820  1.00 111.99 ? 268 HIS G NE2   1 
ATOM   7156 N N     . ARG C 3 246 ? 82.142  -53.815 57.629  1.00 108.05 ? 269 ARG G N     1 
ATOM   7157 C CA    . ARG C 3 246 ? 80.943  -52.990 57.593  1.00 108.19 ? 269 ARG G CA    1 
ATOM   7158 C C     . ARG C 3 246 ? 80.550  -52.429 58.962  1.00 109.72 ? 269 ARG G C     1 
ATOM   7159 O O     . ARG C 3 246 ? 79.493  -51.816 59.096  1.00 110.13 ? 269 ARG G O     1 
ATOM   7160 C CB    . ARG C 3 246 ? 79.783  -53.789 56.997  1.00 133.69 ? 269 ARG G CB    1 
ATOM   7161 C CG    . ARG C 3 246 ? 79.333  -54.976 57.836  1.00 132.84 ? 269 ARG G CG    1 
ATOM   7162 C CD    . ARG C 3 246 ? 78.011  -54.678 58.525  1.00 133.19 ? 269 ARG G CD    1 
ATOM   7163 N NE    . ARG C 3 246 ? 77.518  -55.802 59.314  1.00 132.66 ? 269 ARG G NE    1 
ATOM   7164 C CZ    . ARG C 3 246 ? 76.886  -56.852 58.803  1.00 131.28 ? 269 ARG G CZ    1 
ATOM   7165 N NH1   . ARG C 3 246 ? 76.681  -56.932 57.493  1.00 130.22 ? 269 ARG G NH1   1 
ATOM   7166 N NH2   . ARG C 3 246 ? 76.467  -57.826 59.600  1.00 131.23 ? 269 ARG G NH2   1 
ATOM   7167 N N     . SER C 3 247 ? 81.383  -52.663 59.974  1.00 165.75 ? 270 SER G N     1 
ATOM   7168 C CA    . SER C 3 247 ? 81.032  -52.359 61.368  1.00 167.26 ? 270 SER G CA    1 
ATOM   7169 C C     . SER C 3 247 ? 80.637  -50.901 61.631  1.00 169.38 ? 270 SER G C     1 
ATOM   7170 O O     . SER C 3 247 ? 79.923  -50.613 62.593  1.00 170.52 ? 270 SER G O     1 
ATOM   7171 C CB    . SER C 3 247 ? 82.194  -52.740 62.293  1.00 183.66 ? 270 SER G CB    1 
ATOM   7172 O OG    . SER C 3 247 ? 83.394  -52.088 61.914  1.00 185.05 ? 270 SER G OG    1 
ATOM   7173 N N     . HIS C 3 248 ? 81.121  -49.988 60.793  1.00 124.60 ? 271 HIS G N     1 
ATOM   7174 C CA    . HIS C 3 248 ? 80.836  -48.556 60.947  1.00 127.04 ? 271 HIS G CA    1 
ATOM   7175 C C     . HIS C 3 248 ? 79.667  -48.070 60.078  1.00 126.47 ? 271 HIS G C     1 
ATOM   7176 O O     . HIS C 3 248 ? 79.474  -46.866 59.898  1.00 128.54 ? 271 HIS G O     1 
ATOM   7177 C CB    . HIS C 3 248 ? 82.088  -47.722 60.662  1.00 256.78 ? 271 HIS G CB    1 
ATOM   7178 C CG    . HIS C 3 248 ? 82.098  -46.397 61.361  1.00 260.15 ? 271 HIS G CG    1 
ATOM   7179 N ND1   . HIS C 3 248 ? 80.955  -45.647 61.549  1.00 261.20 ? 271 HIS G ND1   1 
ATOM   7180 C CD2   . HIS C 3 248 ? 83.104  -45.692 61.932  1.00 263.02 ? 271 HIS G CD2   1 
ATOM   7181 C CE1   . HIS C 3 248 ? 81.258  -44.537 62.196  1.00 264.60 ? 271 HIS G CE1   1 
ATOM   7182 N NE2   . HIS C 3 248 ? 82.557  -44.539 62.440  1.00 265.76 ? 271 HIS G NE2   1 
ATOM   7183 N N     . TYR C 3 249 ? 78.939  -49.008 59.484  1.00 141.23 ? 272 TYR G N     1 
ATOM   7184 C CA    . TYR C 3 249 ? 78.014  -48.696 58.398  1.00 140.51 ? 272 TYR G CA    1 
ATOM   7185 C C     . TYR C 3 249 ? 76.604  -49.226 58.663  1.00 139.53 ? 272 TYR G C     1 
ATOM   7186 O O     . TYR C 3 249 ? 75.639  -48.471 58.545  1.00 140.65 ? 272 TYR G O     1 
ATOM   7187 C CB    . TYR C 3 249 ? 78.604  -49.191 57.079  1.00 209.78 ? 272 TYR G CB    1 
ATOM   7188 C CG    . TYR C 3 249 ? 79.939  -48.512 56.848  1.00 211.37 ? 272 TYR G CG    1 
ATOM   7189 C CD1   . TYR C 3 249 ? 81.100  -49.004 57.437  1.00 211.60 ? 272 TYR G CD1   1 
ATOM   7190 C CD2   . TYR C 3 249 ? 80.029  -47.341 56.105  1.00 213.07 ? 272 TYR G CD2   1 
ATOM   7191 C CE1   . TYR C 3 249 ? 82.308  -48.360 57.287  1.00 213.45 ? 272 TYR G CE1   1 
ATOM   7192 C CE2   . TYR C 3 249 ? 81.245  -46.702 55.925  1.00 214.91 ? 272 TYR G CE2   1 
ATOM   7193 C CZ    . TYR C 3 249 ? 82.380  -47.217 56.517  1.00 215.10 ? 272 TYR G CZ    1 
ATOM   7194 O OH    . TYR C 3 249 ? 83.591  -46.591 56.337  1.00 217.24 ? 272 TYR G OH    1 
ATOM   7195 N N     . PHE C 3 250 ? 76.469  -50.522 58.931  1.00 184.52 ? 273 PHE G N     1 
ATOM   7196 C CA    . PHE C 3 250 ? 75.178  -51.067 59.363  1.00 184.03 ? 273 PHE G CA    1 
ATOM   7197 C C     . PHE C 3 250 ? 74.663  -50.384 60.634  1.00 186.32 ? 273 PHE G C     1 
ATOM   7198 O O     . PHE C 3 250 ? 75.439  -49.981 61.503  1.00 187.83 ? 273 PHE G O     1 
ATOM   7199 C CB    . PHE C 3 250 ? 75.262  -52.587 59.578  1.00 186.90 ? 273 PHE G CB    1 
ATOM   7200 C CG    . PHE C 3 250 ? 75.867  -53.005 60.895  1.00 187.64 ? 273 PHE G CG    1 
ATOM   7201 C CD1   . PHE C 3 250 ? 77.068  -52.470 61.340  1.00 188.88 ? 273 PHE G CD1   1 
ATOM   7202 C CD2   . PHE C 3 250 ? 75.234  -53.960 61.675  1.00 187.33 ? 273 PHE G CD2   1 
ATOM   7203 C CE1   . PHE C 3 250 ? 77.614  -52.866 62.544  1.00 189.77 ? 273 PHE G CE1   1 
ATOM   7204 C CE2   . PHE C 3 250 ? 75.773  -54.361 62.875  1.00 188.20 ? 273 PHE G CE2   1 
ATOM   7205 C CZ    . PHE C 3 250 ? 76.966  -53.815 63.312  1.00 189.39 ? 273 PHE G CZ    1 
ATOM   7206 N N     . GLU C 3 251 ? 73.344  -50.245 60.722  1.00 168.35 ? 274 GLU G N     1 
ATOM   7207 C CA    . GLU C 3 251 ? 72.703  -49.600 61.863  1.00 170.81 ? 274 GLU G CA    1 
ATOM   7208 C C     . GLU C 3 251 ? 72.648  -50.526 63.079  1.00 170.78 ? 274 GLU G C     1 
ATOM   7209 O O     . GLU C 3 251 ? 73.009  -50.140 64.194  1.00 172.69 ? 274 GLU G O     1 
ATOM   7210 C CB    . GLU C 3 251 ? 71.294  -49.144 61.479  1.00 250.00 ? 274 GLU G CB    1 
ATOM   7211 C CG    . GLU C 3 251 ? 71.260  -48.129 60.344  1.00 250.58 ? 274 GLU G CG    1 
ATOM   7212 C CD    . GLU C 3 251 ? 70.091  -48.341 59.402  1.00 249.83 ? 274 GLU G CD    1 
ATOM   7213 O OE1   . GLU C 3 251 ? 69.591  -47.344 58.835  1.00 251.42 ? 274 GLU G OE1   1 
ATOM   7214 O OE2   . GLU C 3 251 ? 69.680  -49.508 59.222  1.00 247.90 ? 274 GLU G OE2   1 
ATOM   7215 N N     . GLY C 3 252 ? 72.204  -51.757 62.846  1.00 152.54 ? 275 GLY G N     1 
ATOM   7216 C CA    . GLY C 3 252 ? 72.079  -52.751 63.897  1.00 152.55 ? 275 GLY G CA    1 
ATOM   7217 C C     . GLY C 3 252 ? 71.565  -54.054 63.318  1.00 150.48 ? 275 GLY G C     1 
ATOM   7218 O O     . GLY C 3 252 ? 71.661  -54.271 62.109  1.00 148.79 ? 275 GLY G O     1 
ATOM   7219 N N     . VAL C 3 253 ? 71.027  -54.925 64.170  1.00 112.17 ? 276 VAL G N     1 
ATOM   7220 C CA    . VAL C 3 253 ? 70.411  -56.164 63.694  1.00 110.75 ? 276 VAL G CA    1 
ATOM   7221 C C     . VAL C 3 253 ? 68.890  -56.077 63.698  1.00 111.84 ? 276 VAL G C     1 
ATOM   7222 O O     . VAL C 3 253 ? 68.261  -55.900 64.742  1.00 113.84 ? 276 VAL G O     1 
ATOM   7223 C CB    . VAL C 3 253 ? 70.848  -57.387 64.524  1.00 110.59 ? 276 VAL G CB    1 
ATOM   7224 C CG1   . VAL C 3 253 ? 72.244  -57.774 64.154  1.00 109.20 ? 276 VAL G CG1   1 
ATOM   7225 C CG2   . VAL C 3 253 ? 70.774  -57.095 66.005  1.00 112.84 ? 276 VAL G CG2   1 
ATOM   7226 N N     . LEU C 3 254 ? 68.306  -56.197 62.512  1.00 115.81 ? 277 LEU G N     1 
ATOM   7227 C CA    . LEU C 3 254 ? 66.862  -56.111 62.370  1.00 116.98 ? 277 LEU G CA    1 
ATOM   7228 C C     . LEU C 3 254 ? 66.225  -57.361 62.975  1.00 117.37 ? 277 LEU G C     1 
ATOM   7229 O O     . LEU C 3 254 ? 66.533  -58.485 62.585  1.00 115.90 ? 277 LEU G O     1 
ATOM   7230 C CB    . LEU C 3 254 ? 66.468  -55.941 60.894  1.00 131.54 ? 277 LEU G CB    1 
ATOM   7231 C CG    . LEU C 3 254 ? 66.696  -54.570 60.233  1.00 131.91 ? 277 LEU G CG    1 
ATOM   7232 C CD1   . LEU C 3 254 ? 66.048  -53.437 61.031  1.00 134.62 ? 277 LEU G CD1   1 
ATOM   7233 C CD2   . LEU C 3 254 ? 68.173  -54.275 60.001  1.00 130.70 ? 277 LEU G CD2   1 
ATOM   7234 N N     . LYS C 3 255 ? 65.344  -57.154 63.945  1.00 140.24 ? 278 LYS G N     1 
ATOM   7235 C CA    . LYS C 3 255 ? 64.754  -58.261 64.679  1.00 141.17 ? 278 LYS G CA    1 
ATOM   7236 C C     . LYS C 3 255 ? 63.320  -57.943 65.089  1.00 143.75 ? 278 LYS G C     1 
ATOM   7237 O O     . LYS C 3 255 ? 62.880  -56.799 64.975  1.00 145.00 ? 278 LYS G O     1 
ATOM   7238 C CB    . LYS C 3 255 ? 65.608  -58.593 65.901  1.00 157.36 ? 278 LYS G CB    1 
ATOM   7239 C CG    . LYS C 3 255 ? 65.880  -57.413 66.819  1.00 159.16 ? 278 LYS G CG    1 
ATOM   7240 C CD    . LYS C 3 255 ? 66.925  -57.777 67.866  1.00 159.43 ? 278 LYS G CD    1 
ATOM   7241 C CE    . LYS C 3 255 ? 67.207  -56.620 68.815  1.00 161.57 ? 278 LYS G CE    1 
ATOM   7242 N NZ    . LYS C 3 255 ? 68.326  -56.923 69.757  1.00 161.89 ? 278 LYS G NZ    1 
ATOM   7243 N N     . CYS C 3 256 ? 62.588  -58.960 65.539  1.00 146.22 ? 279 CYS G N     1 
ATOM   7244 C CA    . CYS C 3 256 ? 61.210  -58.781 65.997  1.00 149.06 ? 279 CYS G CA    1 
ATOM   7245 C C     . CYS C 3 256 ? 60.935  -59.538 67.288  1.00 151.08 ? 279 CYS G C     1 
ATOM   7246 O O     . CYS C 3 256 ? 61.824  -60.186 67.835  1.00 150.27 ? 279 CYS G O     1 
ATOM   7247 C CB    . CYS C 3 256 ? 60.225  -59.231 64.921  1.00 129.10 ? 279 CYS G CB    1 
ATOM   7248 S SG    . CYS C 3 256 ? 60.683  -60.766 64.099  1.00 126.68 ? 279 CYS G SG    1 
ATOM   7249 N N     . TYR C 3 257 ? 59.697  -59.450 67.766  1.00 155.33 ? 280 TYR G N     1 
ATOM   7250 C CA    . TYR C 3 257 ? 59.300  -60.118 69.005  1.00 157.81 ? 280 TYR G CA    1 
ATOM   7251 C C     . TYR C 3 257 ? 58.198  -61.129 68.735  1.00 159.10 ? 280 TYR G C     1 
ATOM   7252 O O     . TYR C 3 257 ? 57.503  -61.053 67.721  1.00 158.82 ? 280 TYR G O     1 
ATOM   7253 C CB    . TYR C 3 257 ? 58.835  -59.103 70.063  1.00 142.68 ? 280 TYR G CB    1 
ATOM   7254 C CG    . TYR C 3 257 ? 59.904  -58.112 70.472  1.00 142.06 ? 280 TYR G CG    1 
ATOM   7255 C CD1   . TYR C 3 257 ? 60.860  -58.441 71.429  1.00 141.99 ? 280 TYR G CD1   1 
ATOM   7256 C CD2   . TYR C 3 257 ? 59.964  -56.849 69.893  1.00 141.82 ? 280 TYR G CD2   1 
ATOM   7257 C CE1   . TYR C 3 257 ? 61.846  -57.541 71.796  1.00 141.71 ? 280 TYR G CE1   1 
ATOM   7258 C CE2   . TYR C 3 257 ? 60.947  -55.942 70.254  1.00 141.60 ? 280 TYR G CE2   1 
ATOM   7259 C CZ    . TYR C 3 257 ? 61.885  -56.295 71.206  1.00 141.54 ? 280 TYR G CZ    1 
ATOM   7260 O OH    . TYR C 3 257 ? 62.866  -55.402 71.571  1.00 141.62 ? 280 TYR G OH    1 
ATOM   7261 N N     . LEU C 3 258 ? 58.050  -62.081 69.649  1.00 141.93 ? 281 LEU G N     1 
ATOM   7262 C CA    . LEU C 3 258 ? 57.066  -63.142 69.493  1.00 143.57 ? 281 LEU G CA    1 
ATOM   7263 C C     . LEU C 3 258 ? 55.641  -62.611 69.584  1.00 146.80 ? 281 LEU G C     1 
ATOM   7264 O O     . LEU C 3 258 ? 54.761  -63.065 68.855  1.00 147.52 ? 281 LEU G O     1 
ATOM   7265 C CB    . LEU C 3 258 ? 57.292  -64.232 70.541  1.00 135.49 ? 281 LEU G CB    1 
ATOM   7266 C CG    . LEU C 3 258 ? 58.281  -65.328 70.139  1.00 133.00 ? 281 LEU G CG    1 
ATOM   7267 C CD1   . LEU C 3 258 ? 58.717  -66.141 71.347  1.00 134.56 ? 281 LEU G CD1   1 
ATOM   7268 C CD2   . LEU C 3 258 ? 57.657  -66.229 69.085  1.00 132.72 ? 281 LEU G CD2   1 
ATOM   7269 N N     . HIS C 3 259 ? 55.420  -61.639 70.463  1.00 148.85 ? 282 HIS G N     1 
ATOM   7270 C CA    . HIS C 3 259 ? 54.076  -61.110 70.691  1.00 152.52 ? 282 HIS G CA    1 
ATOM   7271 C C     . HIS C 3 259 ? 53.599  -60.179 69.570  1.00 151.92 ? 282 HIS G C     1 
ATOM   7272 O O     . HIS C 3 259 ? 52.419  -59.826 69.514  1.00 154.90 ? 282 HIS G O     1 
ATOM   7273 C CB    . HIS C 3 259 ? 54.014  -60.378 72.037  1.00 151.44 ? 282 HIS G CB    1 
ATOM   7274 C CG    . HIS C 3 259 ? 54.827  -59.121 72.083  1.00 150.18 ? 282 HIS G CG    1 
ATOM   7275 N ND1   . HIS C 3 259 ? 54.370  -57.919 71.584  1.00 150.99 ? 282 HIS G ND1   1 
ATOM   7276 C CD2   . HIS C 3 259 ? 56.067  -58.878 72.571  1.00 148.49 ? 282 HIS G CD2   1 
ATOM   7277 C CE1   . HIS C 3 259 ? 55.294  -56.991 71.761  1.00 149.88 ? 282 HIS G CE1   1 
ATOM   7278 N NE2   . HIS C 3 259 ? 56.334  -57.547 72.357  1.00 148.35 ? 282 HIS G NE2   1 
ATOM   7279 N N     . GLU C 3 260 ? 54.509  -59.789 68.679  1.00 138.98 ? 283 GLU G N     1 
ATOM   7280 C CA    . GLU C 3 260 ? 54.173  -58.878 67.581  1.00 138.34 ? 283 GLU G CA    1 
ATOM   7281 C C     . GLU C 3 260 ? 53.319  -59.531 66.494  1.00 138.34 ? 283 GLU G C     1 
ATOM   7282 O O     . GLU C 3 260 ? 53.383  -60.741 66.269  1.00 137.42 ? 283 GLU G O     1 
ATOM   7283 C CB    . GLU C 3 260 ? 55.446  -58.305 66.948  1.00 164.89 ? 283 GLU G CB    1 
ATOM   7284 C CG    . GLU C 3 260 ? 56.120  -57.217 67.769  1.00 165.47 ? 283 GLU G CG    1 
ATOM   7285 C CD    . GLU C 3 260 ? 57.307  -56.594 67.054  1.00 162.31 ? 283 GLU G CD    1 
ATOM   7286 O OE1   . GLU C 3 260 ? 58.112  -57.342 66.460  1.00 159.23 ? 283 GLU G OE1   1 
ATOM   7287 O OE2   . GLU C 3 260 ? 57.431  -55.352 67.084  1.00 163.21 ? 283 GLU G OE2   1 
ATOM   7288 N N     . THR C 3 261 ? 52.525  -58.707 65.818  1.00 147.70 ? 284 THR G N     1 
ATOM   7289 C CA    . THR C 3 261 ? 51.616  -59.183 64.785  1.00 148.27 ? 284 THR G CA    1 
ATOM   7290 C C     . THR C 3 261 ? 52.363  -59.511 63.501  1.00 144.43 ? 284 THR G C     1 
ATOM   7291 O O     . THR C 3 261 ? 53.452  -58.988 63.258  1.00 141.66 ? 284 THR G O     1 
ATOM   7292 C CB    . THR C 3 261 ? 50.519  -58.145 64.471  1.00 174.47 ? 284 THR G CB    1 
ATOM   7293 O OG1   . THR C 3 261 ? 51.123  -56.931 64.007  1.00 172.97 ? 284 THR G OG1   1 
ATOM   7294 C CG2   . THR C 3 261 ? 49.688  -57.853 65.709  1.00 178.79 ? 284 THR G CG2   1 
ATOM   7295 N N     . LEU C 3 262 ? 51.765  -60.375 62.684  1.00 147.52 ? 285 LEU G N     1 
ATOM   7296 C CA    . LEU C 3 262 ? 52.336  -60.752 61.393  1.00 144.41 ? 285 LEU G CA    1 
ATOM   7297 C C     . LEU C 3 262 ? 52.352  -59.562 60.447  1.00 143.64 ? 285 LEU G C     1 
ATOM   7298 O O     . LEU C 3 262 ? 53.275  -59.409 59.649  1.00 140.60 ? 285 LEU G O     1 
ATOM   7299 C CB    . LEU C 3 262 ? 51.546  -61.907 60.770  1.00 134.57 ? 285 LEU G CB    1 
ATOM   7300 C CG    . LEU C 3 262 ? 52.098  -62.582 59.512  1.00 131.83 ? 285 LEU G CG    1 
ATOM   7301 C CD1   . LEU C 3 262 ? 53.386  -63.318 59.825  1.00 129.04 ? 285 LEU G CD1   1 
ATOM   7302 C CD2   . LEU C 3 262 ? 51.061  -63.531 58.923  1.00 134.01 ? 285 LEU G CD2   1 
ATOM   7303 N N     . GLU C 3 263 ? 51.321  -58.726 60.550  1.00 153.04 ? 286 GLU G N     1 
ATOM   7304 C CA    . GLU C 3 263 ? 51.205  -57.527 59.734  1.00 153.08 ? 286 GLU G CA    1 
ATOM   7305 C C     . GLU C 3 263 ? 52.421  -56.628 59.918  1.00 150.79 ? 286 GLU G C     1 
ATOM   7306 O O     . GLU C 3 263 ? 52.985  -56.131 58.944  1.00 148.76 ? 286 GLU G O     1 
ATOM   7307 C CB    . GLU C 3 263 ? 49.920  -56.765 60.080  1.00 227.72 ? 286 GLU G CB    1 
ATOM   7308 C CG    . GLU C 3 263 ? 49.745  -55.438 59.348  1.00 228.43 ? 286 GLU G CG    1 
ATOM   7309 C CD    . GLU C 3 263 ? 49.505  -55.598 57.854  1.00 227.44 ? 286 GLU G CD    1 
ATOM   7310 O OE1   . GLU C 3 263 ? 48.346  -55.440 57.417  1.00 230.43 ? 286 GLU G OE1   1 
ATOM   7311 O OE2   . GLU C 3 263 ? 50.476  -55.868 57.114  1.00 223.91 ? 286 GLU G OE2   1 
ATOM   7312 N N     . THR C 3 264 ? 52.831  -56.438 61.170  1.00 147.67 ? 287 THR G N     1 
ATOM   7313 C CA    . THR C 3 264 ? 53.962  -55.570 61.485  1.00 146.06 ? 287 THR G CA    1 
ATOM   7314 C C     . THR C 3 264 ? 55.281  -56.183 61.025  1.00 142.04 ? 287 THR G C     1 
ATOM   7315 O O     . THR C 3 264 ? 56.212  -55.464 60.665  1.00 140.26 ? 287 THR G O     1 
ATOM   7316 C CB    . THR C 3 264 ? 54.006  -55.273 62.979  1.00 134.49 ? 287 THR G CB    1 
ATOM   7317 N N     . ILE C 3 265 ? 55.356  -57.510 61.028  1.00 133.76 ? 288 ILE G N     1 
ATOM   7318 C CA    . ILE C 3 265 ? 56.578  -58.208 60.633  1.00 130.35 ? 288 ILE G CA    1 
ATOM   7319 C C     . ILE C 3 265 ? 56.854  -58.086 59.135  1.00 128.31 ? 288 ILE G C     1 
ATOM   7320 O O     . ILE C 3 265 ? 57.947  -57.689 58.723  1.00 126.02 ? 288 ILE G O     1 
ATOM   7321 C CB    . ILE C 3 265 ? 56.515  -59.699 61.021  1.00 142.44 ? 288 ILE G CB    1 
ATOM   7322 C CG1   . ILE C 3 265 ? 56.562  -59.842 62.542  1.00 144.06 ? 288 ILE G CG1   1 
ATOM   7323 C CG2   . ILE C 3 265 ? 57.666  -60.470 60.395  1.00 139.24 ? 288 ILE G CG2   1 
ATOM   7324 C CD1   . ILE C 3 265 ? 56.305  -61.243 63.034  1.00 144.83 ? 288 ILE G CD1   1 
ATOM   7325 N N     . ILE C 3 266 ? 55.855  -58.422 58.327  1.00 146.23 ? 289 ILE G N     1 
ATOM   7326 C CA    . ILE C 3 266 ? 55.997  -58.393 56.876  1.00 144.70 ? 289 ILE G CA    1 
ATOM   7327 C C     . ILE C 3 266 ? 56.396  -56.999 56.397  1.00 144.29 ? 289 ILE G C     1 
ATOM   7328 O O     . ILE C 3 266 ? 57.284  -56.860 55.554  1.00 142.01 ? 289 ILE G O     1 
ATOM   7329 C CB    . ILE C 3 266 ? 54.691  -58.848 56.172  1.00 123.49 ? 289 ILE G CB    1 
ATOM   7330 C CG1   . ILE C 3 266 ? 54.709  -60.358 55.929  1.00 122.79 ? 289 ILE G CG1   1 
ATOM   7331 C CG2   . ILE C 3 266 ? 54.509  -58.154 54.838  1.00 123.26 ? 289 ILE G CG2   1 
ATOM   7332 C CD1   . ILE C 3 266 ? 54.742  -61.188 57.193  1.00 123.54 ? 289 ILE G CD1   1 
ATOM   7333 N N     . ASN C 3 267 ? 55.760  -55.972 56.959  1.00 127.78 ? 290 ASN G N     1 
ATOM   7334 C CA    . ASN C 3 267 ? 56.024  -54.592 56.559  1.00 128.10 ? 290 ASN G CA    1 
ATOM   7335 C C     . ASN C 3 267 ? 57.446  -54.158 56.884  1.00 125.97 ? 290 ASN G C     1 
ATOM   7336 O O     . ASN C 3 267 ? 58.103  -53.511 56.070  1.00 124.77 ? 290 ASN G O     1 
ATOM   7337 C CB    . ASN C 3 267 ? 55.032  -53.637 57.224  1.00 172.81 ? 290 ASN G CB    1 
ATOM   7338 C CG    . ASN C 3 267 ? 53.610  -53.831 56.731  1.00 175.36 ? 290 ASN G CG    1 
ATOM   7339 O OD1   . ASN C 3 267 ? 53.376  -54.115 55.553  1.00 174.66 ? 290 ASN G OD1   1 
ATOM   7340 N ND2   . ASN C 3 267 ? 52.650  -53.677 57.635  1.00 178.61 ? 290 ASN G ND2   1 
ATOM   7341 N N     . ARG C 3 268 ? 57.915  -54.516 58.075  1.00 152.59 ? 291 ARG G N     1 
ATOM   7342 C CA    . ARG C 3 268 ? 59.277  -54.199 58.496  1.00 150.85 ? 291 ARG G CA    1 
ATOM   7343 C C     . ARG C 3 268 ? 60.300  -55.005 57.705  1.00 147.65 ? 291 ARG G C     1 
ATOM   7344 O O     . ARG C 3 268 ? 61.413  -54.544 57.449  1.00 146.14 ? 291 ARG G O     1 
ATOM   7345 C CB    . ARG C 3 268 ? 59.451  -54.468 59.992  1.00 140.99 ? 291 ARG G CB    1 
ATOM   7346 C CG    . ARG C 3 268 ? 60.821  -54.104 60.548  1.00 139.71 ? 291 ARG G CG    1 
ATOM   7347 C CD    . ARG C 3 268 ? 61.026  -54.715 61.927  1.00 140.33 ? 291 ARG G CD    1 
ATOM   7348 N NE    . ARG C 3 268 ? 60.030  -54.243 62.885  1.00 143.62 ? 291 ARG G NE    1 
ATOM   7349 C CZ    . ARG C 3 268 ? 59.751  -54.847 64.038  1.00 144.99 ? 291 ARG G CZ    1 
ATOM   7350 N NH1   . ARG C 3 268 ? 60.390  -55.956 64.376  1.00 143.34 ? 291 ARG G NH1   1 
ATOM   7351 N NH2   . ARG C 3 268 ? 58.828  -54.347 64.851  1.00 148.28 ? 291 ARG G NH2   1 
ATOM   7352 N N     . LEU C 3 269 ? 59.911  -56.213 57.319  1.00 115.87 ? 292 LEU G N     1 
ATOM   7353 C CA    . LEU C 3 269 ? 60.810  -57.122 56.626  1.00 113.24 ? 292 LEU G CA    1 
ATOM   7354 C C     . LEU C 3 269 ? 61.072  -56.681 55.179  1.00 112.12 ? 292 LEU G C     1 
ATOM   7355 O O     . LEU C 3 269 ? 62.203  -56.762 54.695  1.00 110.12 ? 292 LEU G O     1 
ATOM   7356 C CB    . LEU C 3 269 ? 60.237  -58.540 56.674  1.00 113.40 ? 292 LEU G CB    1 
ATOM   7357 C CG    . LEU C 3 269 ? 61.136  -59.714 56.301  1.00 111.25 ? 292 LEU G CG    1 
ATOM   7358 C CD1   . LEU C 3 269 ? 62.547  -59.502 56.787  1.00 109.63 ? 292 LEU G CD1   1 
ATOM   7359 C CD2   . LEU C 3 269 ? 60.567  -60.967 56.914  1.00 112.28 ? 292 LEU G CD2   1 
ATOM   7360 N N     . VAL C 3 270 ? 60.036  -56.202 54.492  1.00 113.65 ? 293 VAL G N     1 
ATOM   7361 C CA    . VAL C 3 270 ? 60.204  -55.729 53.121  1.00 112.98 ? 293 VAL G CA    1 
ATOM   7362 C C     . VAL C 3 270 ? 60.852  -54.351 53.095  1.00 113.16 ? 293 VAL G C     1 
ATOM   7363 O O     . VAL C 3 270 ? 61.569  -54.019 52.156  1.00 111.99 ? 293 VAL G O     1 
ATOM   7364 C CB    . VAL C 3 270 ? 58.863  -55.673 52.352  1.00 114.88 ? 293 VAL G CB    1 
ATOM   7365 C CG1   . VAL C 3 270 ? 58.250  -57.051 52.263  1.00 114.96 ? 293 VAL G CG1   1 
ATOM   7366 C CG2   . VAL C 3 270 ? 57.896  -54.702 53.007  1.00 117.73 ? 293 VAL G CG2   1 
ATOM   7367 N N     . GLU C 3 271 ? 60.610  -53.557 54.133  1.00 114.91 ? 294 GLU G N     1 
ATOM   7368 C CA    . GLU C 3 271 ? 61.148  -52.203 54.197  1.00 115.69 ? 294 GLU G CA    1 
ATOM   7369 C C     . GLU C 3 271 ? 62.640  -52.227 54.512  1.00 113.76 ? 294 GLU G C     1 
ATOM   7370 O O     . GLU C 3 271 ? 63.386  -51.359 54.060  1.00 113.64 ? 294 GLU G O     1 
ATOM   7371 C CB    . GLU C 3 271 ? 60.390  -51.377 55.240  1.00 188.05 ? 294 GLU G CB    1 
ATOM   7372 C CG    . GLU C 3 271 ? 60.692  -49.886 55.222  1.00 189.71 ? 294 GLU G CG    1 
ATOM   7373 C CD    . GLU C 3 271 ? 59.778  -49.092 56.152  1.00 193.13 ? 294 GLU G CD    1 
ATOM   7374 O OE1   . GLU C 3 271 ? 58.591  -49.458 56.294  1.00 194.68 ? 294 GLU G OE1   1 
ATOM   7375 O OE2   . GLU C 3 271 ? 60.249  -48.100 56.747  1.00 194.56 ? 294 GLU G OE2   1 
ATOM   7376 N N     . ALA C 3 272 ? 63.063  -53.226 55.289  1.00 112.52 ? 295 ALA G N     1 
ATOM   7377 C CA    . ALA C 3 272 ? 64.474  -53.417 55.634  1.00 110.83 ? 295 ALA G CA    1 
ATOM   7378 C C     . ALA C 3 272 ? 65.229  -54.067 54.480  1.00 108.58 ? 295 ALA G C     1 
ATOM   7379 O O     . ALA C 3 272 ? 66.451  -53.926 54.353  1.00 107.44 ? 295 ALA G O     1 
ATOM   7380 C CB    . ALA C 3 272 ? 64.608  -54.262 56.897  1.00 192.68 ? 295 ALA G CB    1 
ATOM   7381 N N     . GLU C 3 273 ? 64.473  -54.779 53.648  1.00 152.15 ? 296 GLU G N     1 
ATOM   7382 C CA    . GLU C 3 273 ? 64.986  -55.459 52.464  1.00 150.44 ? 296 GLU G CA    1 
ATOM   7383 C C     . GLU C 3 273 ? 65.979  -56.567 52.813  1.00 148.74 ? 296 GLU G C     1 
ATOM   7384 O O     . GLU C 3 273 ? 66.846  -56.900 52.010  1.00 147.42 ? 296 GLU G O     1 
ATOM   7385 C CB    . GLU C 3 273 ? 65.628  -54.452 51.497  1.00 161.61 ? 296 GLU G CB    1 
ATOM   7386 C CG    . GLU C 3 273 ? 64.743  -53.247 51.176  1.00 163.64 ? 296 GLU G CG    1 
ATOM   7387 C CD    . GLU C 3 273 ? 65.229  -52.452 49.975  1.00 163.68 ? 296 GLU G CD    1 
ATOM   7388 O OE1   . GLU C 3 273 ? 65.635  -51.282 50.155  1.00 164.78 ? 296 GLU G OE1   1 
ATOM   7389 O OE2   . GLU C 3 273 ? 65.191  -52.996 48.850  1.00 162.87 ? 296 GLU G OE2   1 
ATOM   7390 N N     . VAL C 3 274 ? 65.846  -57.146 54.004  1.00 106.50 ? 297 VAL G N     1 
ATOM   7391 C CA    . VAL C 3 274 ? 66.657  -58.304 54.373  1.00 105.27 ? 297 VAL G CA    1 
ATOM   7392 C C     . VAL C 3 274 ? 65.870  -59.608 54.192  1.00 105.40 ? 297 VAL G C     1 
ATOM   7393 O O     . VAL C 3 274 ? 64.682  -59.584 53.863  1.00 106.51 ? 297 VAL G O     1 
ATOM   7394 C CB    . VAL C 3 274 ? 67.148  -58.203 55.824  1.00 183.05 ? 297 VAL G CB    1 
ATOM   7395 C CG1   . VAL C 3 274 ? 67.904  -56.904 56.030  1.00 183.33 ? 297 VAL G CG1   1 
ATOM   7396 C CG2   . VAL C 3 274 ? 65.972  -58.296 56.786  1.00 184.75 ? 297 VAL G CG2   1 
ATOM   7397 N N     . HIS C 3 275 ? 66.537  -60.742 54.391  1.00 103.23 ? 298 HIS G N     1 
ATOM   7398 C CA    . HIS C 3 275 ? 65.908  -62.041 54.148  1.00 103.59 ? 298 HIS G CA    1 
ATOM   7399 C C     . HIS C 3 275 ? 65.276  -62.688 55.384  1.00 104.90 ? 298 HIS G C     1 
ATOM   7400 O O     . HIS C 3 275 ? 64.472  -63.608 55.254  1.00 105.83 ? 298 HIS G O     1 
ATOM   7401 C CB    . HIS C 3 275 ? 66.942  -62.994 53.538  1.00 102.39 ? 298 HIS G CB    1 
ATOM   7402 C CG    . HIS C 3 275 ? 66.373  -64.284 53.029  1.00 102.96 ? 298 HIS G CG    1 
ATOM   7403 N ND1   . HIS C 3 275 ? 65.723  -64.385 51.816  1.00 103.24 ? 298 HIS G ND1   1 
ATOM   7404 C CD2   . HIS C 3 275 ? 66.385  -65.532 53.556  1.00 103.58 ? 298 HIS G CD2   1 
ATOM   7405 C CE1   . HIS C 3 275 ? 65.345  -65.637 51.628  1.00 104.05 ? 298 HIS G CE1   1 
ATOM   7406 N NE2   . HIS C 3 275 ? 65.732  -66.353 52.669  1.00 104.30 ? 298 HIS G NE2   1 
ATOM   7407 N N     . ARG C 3 276 ? 65.619  -62.213 56.577  1.00 132.33 ? 299 ARG G N     1 
ATOM   7408 C CA    . ARG C 3 276 ? 65.066  -62.821 57.786  1.00 133.79 ? 299 ARG G CA    1 
ATOM   7409 C C     . ARG C 3 276 ? 65.166  -61.924 59.019  1.00 134.69 ? 299 ARG G C     1 
ATOM   7410 O O     . ARG C 3 276 ? 65.882  -60.925 59.015  1.00 134.06 ? 299 ARG G O     1 
ATOM   7411 C CB    . ARG C 3 276 ? 65.739  -64.174 58.050  1.00 106.37 ? 299 ARG G CB    1 
ATOM   7412 C CG    . ARG C 3 276 ? 66.797  -64.203 59.135  1.00 106.18 ? 299 ARG G CG    1 
ATOM   7413 C CD    . ARG C 3 276 ? 68.067  -63.448 58.764  1.00 104.64 ? 299 ARG G CD    1 
ATOM   7414 N NE    . ARG C 3 276 ? 68.454  -63.533 57.355  1.00 103.30 ? 299 ARG G NE    1 
ATOM   7415 C CZ    . ARG C 3 276 ? 68.804  -64.649 56.722  1.00 102.85 ? 299 ARG G CZ    1 
ATOM   7416 N NH1   . ARG C 3 276 ? 68.786  -65.819 57.351  1.00 103.68 ? 299 ARG G NH1   1 
ATOM   7417 N NH2   . ARG C 3 276 ? 69.154  -64.593 55.442  1.00 101.86 ? 299 ARG G NH2   1 
ATOM   7418 N N     . LEU C 3 277 ? 64.422  -62.279 60.063  1.00 127.99 ? 300 LEU G N     1 
ATOM   7419 C CA    . LEU C 3 277 ? 64.488  -61.577 61.339  1.00 129.25 ? 300 LEU G CA    1 
ATOM   7420 C C     . LEU C 3 277 ? 64.641  -62.573 62.486  1.00 130.22 ? 300 LEU G C     1 
ATOM   7421 O O     . LEU C 3 277 ? 63.972  -63.606 62.500  1.00 131.11 ? 300 LEU G O     1 
ATOM   7422 C CB    . LEU C 3 277 ? 63.239  -60.726 61.542  1.00 112.64 ? 300 LEU G CB    1 
ATOM   7423 C CG    . LEU C 3 277 ? 62.965  -59.702 60.443  1.00 112.17 ? 300 LEU G CG    1 
ATOM   7424 C CD1   . LEU C 3 277 ? 61.552  -59.171 60.560  1.00 114.53 ? 300 LEU G CD1   1 
ATOM   7425 C CD2   . LEU C 3 277 ? 63.975  -58.567 60.503  1.00 111.41 ? 300 LEU G CD2   1 
ATOM   7426 N N     . VAL C 3 278 ? 65.517  -62.264 63.441  1.00 111.75 ? 301 VAL G N     1 
ATOM   7427 C CA    . VAL C 3 278 ? 65.725  -63.136 64.600  1.00 112.93 ? 301 VAL G CA    1 
ATOM   7428 C C     . VAL C 3 278 ? 64.859  -62.691 65.791  1.00 115.52 ? 301 VAL G C     1 
ATOM   7429 O O     . VAL C 3 278 ? 65.075  -61.631 66.373  1.00 116.21 ? 301 VAL G O     1 
ATOM   7430 C CB    . VAL C 3 278 ? 67.228  -63.180 65.009  1.00 111.91 ? 301 VAL G CB    1 
ATOM   7431 C CG1   . VAL C 3 278 ? 68.037  -63.950 63.978  1.00 109.95 ? 301 VAL G CG1   1 
ATOM   7432 C CG2   . VAL C 3 278 ? 67.806  -61.778 65.173  1.00 111.70 ? 301 VAL G CG2   1 
ATOM   7433 N N     . VAL C 3 279 ? 63.863  -63.491 66.157  1.00 117.30 ? 302 VAL G N     1 
ATOM   7434 C CA    . VAL C 3 279 ? 62.957  -63.037 67.202  1.00 120.05 ? 302 VAL G CA    1 
ATOM   7435 C C     . VAL C 3 279 ? 63.659  -63.173 68.543  1.00 121.16 ? 302 VAL G C     1 
ATOM   7436 O O     . VAL C 3 279 ? 64.416  -64.121 68.764  1.00 120.56 ? 302 VAL G O     1 
ATOM   7437 C CB    . VAL C 3 279 ? 61.609  -63.801 67.206  1.00 147.20 ? 302 VAL G CB    1 
ATOM   7438 C CG1   . VAL C 3 279 ? 60.912  -63.657 65.871  1.00 146.36 ? 302 VAL G CG1   1 
ATOM   7439 C CG2   . VAL C 3 279 ? 61.804  -65.257 67.527  1.00 147.64 ? 302 VAL G CG2   1 
ATOM   7440 N N     . VAL C 3 280 ? 63.433  -62.196 69.420  1.00 156.61 ? 303 VAL G N     1 
ATOM   7441 C CA    . VAL C 3 280 ? 64.090  -62.143 70.723  1.00 157.98 ? 303 VAL G CA    1 
ATOM   7442 C C     . VAL C 3 280 ? 63.127  -61.683 71.827  1.00 161.43 ? 303 VAL G C     1 
ATOM   7443 O O     . VAL C 3 280 ? 61.928  -61.513 71.594  1.00 162.83 ? 303 VAL G O     1 
ATOM   7444 C CB    . VAL C 3 280 ? 65.321  -61.198 70.693  1.00 139.94 ? 303 VAL G CB    1 
ATOM   7445 C CG1   . VAL C 3 280 ? 66.403  -61.738 69.758  1.00 136.97 ? 303 VAL G CG1   1 
ATOM   7446 C CG2   . VAL C 3 280 ? 64.912  -59.793 70.278  1.00 140.22 ? 303 VAL G CG2   1 
ATOM   7447 N N     . ASP C 3 281 ? 63.670  -61.478 73.025  1.00 146.95 ? 304 ASP G N     1 
ATOM   7448 C CA    . ASP C 3 281 ? 62.899  -61.045 74.193  1.00 150.55 ? 304 ASP G CA    1 
ATOM   7449 C C     . ASP C 3 281 ? 63.519  -59.774 74.784  1.00 151.41 ? 304 ASP G C     1 
ATOM   7450 O O     . ASP C 3 281 ? 64.325  -59.119 74.125  1.00 149.28 ? 304 ASP G O     1 
ATOM   7451 C CB    . ASP C 3 281 ? 62.812  -62.161 75.244  1.00 194.98 ? 304 ASP G CB    1 
ATOM   7452 C CG    . ASP C 3 281 ? 64.163  -62.533 75.833  1.00 194.25 ? 304 ASP G CG    1 
ATOM   7453 O OD1   . ASP C 3 281 ? 65.199  -62.024 75.355  1.00 191.97 ? 304 ASP G OD1   1 
ATOM   7454 O OD2   . ASP C 3 281 ? 64.185  -63.355 76.776  1.00 196.20 ? 304 ASP G OD2   1 
ATOM   7455 N N     . GLU C 3 282 ? 63.088  -59.385 75.981  1.00 171.72 ? 305 GLU G N     1 
ATOM   7456 C CA    . GLU C 3 282 ? 63.697  -58.249 76.678  1.00 173.13 ? 305 GLU G CA    1 
ATOM   7457 C C     . GLU C 3 282 ? 65.222  -58.378 76.783  1.00 171.25 ? 305 GLU G C     1 
ATOM   7458 O O     . GLU C 3 282 ? 65.955  -57.412 76.562  1.00 170.59 ? 305 GLU G O     1 
ATOM   7459 C CB    . GLU C 3 282 ? 63.100  -58.093 78.082  1.00 230.10 ? 305 GLU G CB    1 
ATOM   7460 C CG    . GLU C 3 282 ? 61.626  -57.711 78.114  1.00 232.77 ? 305 GLU G CG    1 
ATOM   7461 C CD    . GLU C 3 282 ? 60.715  -58.910 78.280  1.00 233.87 ? 305 GLU G CD    1 
ATOM   7462 O OE1   . GLU C 3 282 ? 59.641  -58.756 78.898  1.00 237.43 ? 305 GLU G OE1   1 
ATOM   7463 O OE2   . GLU C 3 282 ? 61.073  -60.004 77.794  1.00 231.47 ? 305 GLU G OE2   1 
ATOM   7464 N N     . ASN C 3 283 ? 65.691  -59.577 77.117  1.00 207.15 ? 306 ASN G N     1 
ATOM   7465 C CA    . ASN C 3 283 ? 67.121  -59.843 77.238  1.00 205.67 ? 306 ASN G CA    1 
ATOM   7466 C C     . ASN C 3 283 ? 67.810  -59.898 75.876  1.00 201.91 ? 306 ASN G C     1 
ATOM   7467 O O     . ASN C 3 283 ? 69.029  -59.980 75.811  1.00 200.63 ? 306 ASN G O     1 
ATOM   7468 C CB    . ASN C 3 283 ? 67.362  -61.144 78.005  1.00 20.00  ? 306 ASN G CB    1 
ATOM   7469 C CG    . ASN C 3 283 ? 67.035  -61.022 79.480  1.00 20.00  ? 306 ASN G CG    1 
ATOM   7470 O OD1   . ASN C 3 283 ? 67.033  -59.924 80.038  1.00 20.00  ? 306 ASN G OD1   1 
ATOM   7471 N ND2   . ASN C 3 283 ? 66.755  -62.151 80.121  1.00 20.00  ? 306 ASN G ND2   1 
ATOM   7472 N N     . ASP C 3 284 ? 67.023  -59.861 74.801  1.00 129.52 ? 307 ASP G N     1 
ATOM   7473 C CA    . ASP C 3 284 ? 67.520  -59.959 73.419  1.00 126.15 ? 307 ASP G CA    1 
ATOM   7474 C C     . ASP C 3 284 ? 68.230  -61.284 73.124  1.00 124.39 ? 307 ASP G C     1 
ATOM   7475 O O     . ASP C 3 284 ? 69.063  -61.362 72.218  1.00 121.93 ? 307 ASP G O     1 
ATOM   7476 C CB    . ASP C 3 284 ? 68.460  -58.793 73.087  1.00 219.73 ? 307 ASP G CB    1 
ATOM   7477 C CG    . ASP C 3 284 ? 67.743  -57.463 73.035  1.00 221.21 ? 307 ASP G CG    1 
ATOM   7478 O OD1   . ASP C 3 284 ? 66.876  -57.291 72.153  1.00 220.49 ? 307 ASP G OD1   1 
ATOM   7479 O OD2   . ASP C 3 284 ? 68.052  -56.586 73.869  1.00 223.33 ? 307 ASP G OD2   1 
ATOM   7480 N N     . VAL C 3 285 ? 67.895  -62.323 73.887  1.00 151.88 ? 308 VAL G N     1 
ATOM   7481 C CA    . VAL C 3 285 ? 68.408  -63.664 73.617  1.00 150.75 ? 308 VAL G CA    1 
ATOM   7482 C C     . VAL C 3 285 ? 67.602  -64.283 72.490  1.00 149.37 ? 308 VAL G C     1 
ATOM   7483 O O     . VAL C 3 285 ? 66.448  -63.914 72.268  1.00 150.13 ? 308 VAL G O     1 
ATOM   7484 C CB    . VAL C 3 285 ? 68.347  -64.590 74.855  1.00 161.73 ? 308 VAL G CB    1 
ATOM   7485 C CG1   . VAL C 3 285 ? 69.144  -64.001 76.009  1.00 163.41 ? 308 VAL G CG1   1 
ATOM   7486 C CG2   . VAL C 3 285 ? 66.904  -64.856 75.266  1.00 164.04 ? 308 VAL G CG2   1 
ATOM   7487 N N     . VAL C 3 286 ? 68.209  -65.224 71.779  1.00 144.15 ? 309 VAL G N     1 
ATOM   7488 C CA    . VAL C 3 286 ? 67.541  -65.860 70.653  1.00 142.96 ? 309 VAL G CA    1 
ATOM   7489 C C     . VAL C 3 286 ? 66.346  -66.712 71.093  1.00 145.25 ? 309 VAL G C     1 
ATOM   7490 O O     . VAL C 3 286 ? 66.380  -67.404 72.112  1.00 147.33 ? 309 VAL G O     1 
ATOM   7491 C CB    . VAL C 3 286 ? 68.517  -66.728 69.842  1.00 118.57 ? 309 VAL G CB    1 
ATOM   7492 C CG1   . VAL C 3 286 ? 69.588  -65.858 69.228  1.00 116.42 ? 309 VAL G CG1   1 
ATOM   7493 C CG2   . VAL C 3 286 ? 69.139  -67.802 70.724  1.00 120.02 ? 309 VAL G CG2   1 
ATOM   7494 N N     . LYS C 3 287 ? 65.285  -66.626 70.305  1.00 135.52 ? 310 LYS G N     1 
ATOM   7495 C CA    . LYS C 3 287 ? 64.058  -67.380 70.518  1.00 137.78 ? 310 LYS G CA    1 
ATOM   7496 C C     . LYS C 3 287 ? 63.818  -68.227 69.275  1.00 136.51 ? 310 LYS G C     1 
ATOM   7497 O O     . LYS C 3 287 ? 63.608  -69.436 69.365  1.00 137.78 ? 310 LYS G O     1 
ATOM   7498 C CB    . LYS C 3 287 ? 62.878  -66.455 70.825  1.00 126.69 ? 310 LYS G CB    1 
ATOM   7499 C CG    . LYS C 3 287 ? 62.965  -65.791 72.200  1.00 128.84 ? 310 LYS G CG    1 
ATOM   7500 C CD    . LYS C 3 287 ? 62.870  -66.823 73.323  1.00 131.47 ? 310 LYS G CD    1 
ATOM   7501 C CE    . LYS C 3 287 ? 62.977  -66.182 74.706  1.00 133.85 ? 310 LYS G CE    1 
ATOM   7502 N NZ    . LYS C 3 287 ? 62.949  -67.189 75.812  1.00 136.58 ? 310 LYS G NZ    1 
ATOM   7503 N N     . GLY C 3 288 ? 63.772  -67.562 68.122  1.00 121.51 ? 311 GLY G N     1 
ATOM   7504 C CA    . GLY C 3 288 ? 63.656  -68.229 66.837  1.00 120.17 ? 311 GLY G CA    1 
ATOM   7505 C C     . GLY C 3 288 ? 64.060  -67.327 65.686  1.00 117.51 ? 311 GLY G C     1 
ATOM   7506 O O     . GLY C 3 288 ? 64.601  -66.240 65.896  1.00 116.60 ? 311 GLY G O     1 
ATOM   7507 N N     . ILE C 3 289 ? 63.804  -67.793 64.467  1.00 116.55 ? 312 ILE G N     1 
ATOM   7508 C CA    . ILE C 3 289 ? 64.116  -67.041 63.252  1.00 114.27 ? 312 ILE G CA    1 
ATOM   7509 C C     . ILE C 3 289 ? 62.981  -67.148 62.247  1.00 114.72 ? 312 ILE G C     1 
ATOM   7510 O O     . ILE C 3 289 ? 62.491  -68.246 61.970  1.00 115.80 ? 312 ILE G O     1 
ATOM   7511 C CB    . ILE C 3 289 ? 65.414  -67.543 62.595  1.00 122.50 ? 312 ILE G CB    1 
ATOM   7512 C CG1   . ILE C 3 289 ? 66.596  -67.312 63.538  1.00 122.15 ? 312 ILE G CG1   1 
ATOM   7513 C CG2   . ILE C 3 289 ? 65.633  -66.859 61.249  1.00 120.49 ? 312 ILE G CG2   1 
ATOM   7514 C CD1   . ILE C 3 289 ? 67.879  -67.961 63.102  1.00 120.83 ? 312 ILE G CD1   1 
ATOM   7515 N N     . VAL C 3 290 ? 62.542  -66.010 61.718  1.00 130.31 ? 313 VAL G N     1 
ATOM   7516 C CA    . VAL C 3 290 ? 61.509  -66.047 60.699  1.00 130.82 ? 313 VAL G CA    1 
ATOM   7517 C C     . VAL C 3 290 ? 62.030  -65.536 59.353  1.00 128.59 ? 313 VAL G C     1 
ATOM   7518 O O     . VAL C 3 290 ? 62.039  -64.336 59.082  1.00 127.97 ? 313 VAL G O     1 
ATOM   7519 C CB    . VAL C 3 290 ? 60.285  -65.218 61.157  1.00 134.68 ? 313 VAL G CB    1 
ATOM   7520 C CG1   . VAL C 3 290 ? 59.506  -65.987 62.199  1.00 137.42 ? 313 VAL G CG1   1 
ATOM   7521 C CG2   . VAL C 3 290 ? 60.721  -63.876 61.743  1.00 134.27 ? 313 VAL G CG2   1 
ATOM   7522 N N     . SER C 3 291 ? 62.398  -66.477 58.488  1.00 117.90 ? 314 SER G N     1 
ATOM   7523 C CA    . SER C 3 291 ? 62.903  -66.175 57.148  1.00 116.06 ? 314 SER G CA    1 
ATOM   7524 C C     . SER C 3 291 ? 61.763  -65.977 56.161  1.00 116.92 ? 314 SER G C     1 
ATOM   7525 O O     . SER C 3 291 ? 60.643  -66.422 56.409  1.00 119.01 ? 314 SER G O     1 
ATOM   7526 C CB    . SER C 3 291 ? 63.853  -67.274 56.663  1.00 154.39 ? 314 SER G CB    1 
ATOM   7527 O OG    . SER C 3 291 ? 64.344  -67.017 55.354  1.00 152.88 ? 314 SER G OG    1 
ATOM   7528 N N     . LEU C 3 292 ? 62.049  -65.289 55.057  1.00 112.78 ? 315 LEU G N     1 
ATOM   7529 C CA    . LEU C 3 292 ? 61.072  -65.104 53.989  1.00 113.61 ? 315 LEU G CA    1 
ATOM   7530 C C     . LEU C 3 292 ? 60.437  -66.427 53.586  1.00 115.03 ? 315 LEU G C     1 
ATOM   7531 O O     . LEU C 3 292 ? 59.246  -66.475 53.305  1.00 116.90 ? 315 LEU G O     1 
ATOM   7532 C CB    . LEU C 3 292 ? 61.714  -64.450 52.766  1.00 108.47 ? 315 LEU G CB    1 
ATOM   7533 C CG    . LEU C 3 292 ? 62.424  -63.115 52.985  1.00 107.26 ? 315 LEU G CG    1 
ATOM   7534 C CD1   . LEU C 3 292 ? 62.829  -62.489 51.668  1.00 106.20 ? 315 LEU G CD1   1 
ATOM   7535 C CD2   . LEU C 3 292 ? 61.556  -62.170 53.760  1.00 108.76 ? 315 LEU G CD2   1 
ATOM   7536 N N     . SER C 3 293 ? 61.230  -67.496 53.577  1.00 111.01 ? 316 SER G N     1 
ATOM   7537 C CA    . SER C 3 293 ? 60.721  -68.836 53.291  1.00 112.70 ? 316 SER G CA    1 
ATOM   7538 C C     . SER C 3 293 ? 59.522  -69.201 54.167  1.00 115.34 ? 316 SER G C     1 
ATOM   7539 O O     . SER C 3 293 ? 58.557  -69.794 53.690  1.00 117.37 ? 316 SER G O     1 
ATOM   7540 C CB    . SER C 3 293 ? 61.826  -69.873 53.477  1.00 142.16 ? 316 SER G CB    1 
ATOM   7541 O OG    . SER C 3 293 ? 62.988  -69.501 52.761  1.00 139.95 ? 316 SER G OG    1 
ATOM   7542 N N     . ASP C 3 294 ? 59.590  -68.842 55.446  1.00 115.56 ? 317 ASP G N     1 
ATOM   7543 C CA    . ASP C 3 294 ? 58.490  -69.087 56.373  1.00 118.26 ? 317 ASP G CA    1 
ATOM   7544 C C     . ASP C 3 294 ? 57.233  -68.332 55.966  1.00 119.77 ? 317 ASP G C     1 
ATOM   7545 O O     . ASP C 3 294 ? 56.150  -68.909 55.912  1.00 122.38 ? 317 ASP G O     1 
ATOM   7546 C CB    . ASP C 3 294 ? 58.886  -68.692 57.794  1.00 188.53 ? 317 ASP G CB    1 
ATOM   7547 C CG    . ASP C 3 294 ? 59.943  -69.599 58.373  1.00 187.89 ? 317 ASP G CG    1 
ATOM   7548 O OD1   . ASP C 3 294 ? 59.792  -70.835 58.263  1.00 189.27 ? 317 ASP G OD1   1 
ATOM   7549 O OD2   . ASP C 3 294 ? 60.927  -69.075 58.935  1.00 186.28 ? 317 ASP G OD2   1 
ATOM   7550 N N     . ILE C 3 295 ? 57.382  -67.041 55.682  1.00 127.96 ? 318 ILE G N     1 
ATOM   7551 C CA    . ILE C 3 295 ? 56.251  -66.218 55.267  1.00 129.49 ? 318 ILE G CA    1 
ATOM   7552 C C     . ILE C 3 295 ? 55.647  -66.726 53.954  1.00 130.31 ? 318 ILE G C     1 
ATOM   7553 O O     . ILE C 3 295 ? 54.430  -66.878 53.833  1.00 132.98 ? 318 ILE G O     1 
ATOM   7554 C CB    . ILE C 3 295 ? 56.657  -64.735 55.112  1.00 118.40 ? 318 ILE G CB    1 
ATOM   7555 C CG1   . ILE C 3 295 ? 57.111  -64.165 56.453  1.00 118.21 ? 318 ILE G CG1   1 
ATOM   7556 C CG2   . ILE C 3 295 ? 55.497  -63.909 54.575  1.00 120.24 ? 318 ILE G CG2   1 
ATOM   7557 C CD1   . ILE C 3 295 ? 58.588  -64.003 56.564  1.00 115.47 ? 318 ILE G CD1   1 
ATOM   7558 N N     . LEU C 3 296 ? 56.506  -67.006 52.981  1.00 172.60 ? 319 LEU G N     1 
ATOM   7559 C CA    . LEU C 3 296 ? 56.048  -67.489 51.685  1.00 173.39 ? 319 LEU G CA    1 
ATOM   7560 C C     . LEU C 3 296 ? 55.412  -68.874 51.782  1.00 175.85 ? 319 LEU G C     1 
ATOM   7561 O O     . LEU C 3 296 ? 54.421  -69.148 51.111  1.00 178.05 ? 319 LEU G O     1 
ATOM   7562 C CB    . LEU C 3 296 ? 57.203  -67.514 50.681  1.00 145.55 ? 319 LEU G CB    1 
ATOM   7563 C CG    . LEU C 3 296 ? 57.469  -66.233 49.882  1.00 144.06 ? 319 LEU G CG    1 
ATOM   7564 C CD1   . LEU C 3 296 ? 58.005  -65.110 50.762  1.00 142.70 ? 319 LEU G CD1   1 
ATOM   7565 C CD2   . LEU C 3 296 ? 58.417  -66.509 48.718  1.00 142.36 ? 319 LEU G CD2   1 
ATOM   7566 N N     . GLN C 3 297 ? 55.973  -69.742 52.619  1.00 121.89 ? 320 GLN G N     1 
ATOM   7567 C CA    . GLN C 3 297 ? 55.455  -71.101 52.757  1.00 124.48 ? 320 GLN G CA    1 
ATOM   7568 C C     . GLN C 3 297 ? 54.181  -71.125 53.601  1.00 127.64 ? 320 GLN G C     1 
ATOM   7569 O O     . GLN C 3 297 ? 53.389  -72.066 53.518  1.00 130.58 ? 320 GLN G O     1 
ATOM   7570 C CB    . GLN C 3 297 ? 56.518  -72.024 53.365  1.00 165.88 ? 320 GLN G CB    1 
ATOM   7571 C CG    . GLN C 3 297 ? 56.189  -73.510 53.315  1.00 168.54 ? 320 GLN G CG    1 
ATOM   7572 C CD    . GLN C 3 297 ? 57.379  -74.389 53.668  1.00 167.62 ? 320 GLN G CD    1 
ATOM   7573 O OE1   . GLN C 3 297 ? 58.524  -73.932 53.681  1.00 164.78 ? 320 GLN G OE1   1 
ATOM   7574 N NE2   . GLN C 3 297 ? 57.112  -75.660 53.956  1.00 170.32 ? 320 GLN G NE2   1 
ATOM   7575 N N     . ALA C 3 298 ? 53.981  -70.081 54.400  1.00 142.93 ? 321 ALA G N     1 
ATOM   7576 C CA    . ALA C 3 298 ? 52.798  -69.984 55.254  1.00 146.09 ? 321 ALA G CA    1 
ATOM   7577 C C     . ALA C 3 298 ? 51.610  -69.409 54.492  1.00 148.06 ? 321 ALA G C     1 
ATOM   7578 O O     . ALA C 3 298 ? 50.494  -69.351 55.007  1.00 151.21 ? 321 ALA G O     1 
ATOM   7579 C CB    . ALA C 3 298 ? 53.093  -69.139 56.480  1.00 142.97 ? 321 ALA G CB    1 
ATOM   7580 N N     . LEU C 3 299 ? 51.863  -68.995 53.258  1.00 145.10 ? 322 LEU G N     1 
ATOM   7581 C CA    . LEU C 3 299 ? 50.851  -68.385 52.401  1.00 146.80 ? 322 LEU G CA    1 
ATOM   7582 C C     . LEU C 3 299 ? 50.265  -69.410 51.426  1.00 148.92 ? 322 LEU G C     1 
ATOM   7583 O O     . LEU C 3 299 ? 49.045  -69.536 51.320  1.00 152.34 ? 322 LEU G O     1 
ATOM   7584 C CB    . LEU C 3 299 ? 51.425  -67.176 51.665  1.00 129.88 ? 322 LEU G CB    1 
ATOM   7585 C CG    . LEU C 3 299 ? 51.682  -65.973 52.584  1.00 128.87 ? 322 LEU G CG    1 
ATOM   7586 C CD1   . LEU C 3 299 ? 52.619  -64.976 51.928  1.00 125.84 ? 322 LEU G CD1   1 
ATOM   7587 C CD2   . LEU C 3 299 ? 50.382  -65.291 52.993  1.00 132.09 ? 322 LEU G CD2   1 
ATOM   7588 N N     . VAL C 3 300 ? 51.134  -70.075 50.666  1.00 173.31 ? 323 VAL G N     1 
ATOM   7589 C CA    . VAL C 3 300 ? 50.716  -71.073 49.679  1.00 175.31 ? 323 VAL G CA    1 
ATOM   7590 C C     . VAL C 3 300 ? 49.698  -72.096 50.208  1.00 179.40 ? 323 VAL G C     1 
ATOM   7591 O O     . VAL C 3 300 ? 48.805  -72.518 49.471  1.00 182.31 ? 323 VAL G O     1 
ATOM   7592 C CB    . VAL C 3 300 ? 51.939  -71.851 49.118  1.00 171.92 ? 323 VAL G CB    1 
ATOM   7593 C CG1   . VAL C 3 300 ? 52.902  -70.901 48.442  1.00 168.37 ? 323 VAL G CG1   1 
ATOM   7594 C CG2   . VAL C 3 300 ? 52.656  -72.637 50.217  1.00 171.37 ? 323 VAL G CG2   1 
ATOM   7595 N N     . LEU C 3 301 ? 49.817  -72.478 51.478  1.00 175.49 ? 324 LEU G N     1 
ATOM   7596 C CA    . LEU C 3 301 ? 48.882  -73.428 52.078  1.00 179.61 ? 324 LEU G CA    1 
ATOM   7597 C C     . LEU C 3 301 ? 48.294  -72.878 53.372  1.00 181.02 ? 324 LEU G C     1 
ATOM   7598 O O     . LEU C 3 301 ? 47.077  -72.765 53.510  1.00 184.54 ? 324 LEU G O     1 
ATOM   7599 C CB    . LEU C 3 301 ? 49.562  -74.783 52.332  1.00 151.76 ? 324 LEU G CB    1 
ATOM   7600 C CG    . LEU C 3 301 ? 50.976  -74.851 52.922  1.00 148.29 ? 324 LEU G CG    1 
ATOM   7601 C CD1   . LEU C 3 301 ? 51.005  -74.465 54.395  1.00 148.23 ? 324 LEU G CD1   1 
ATOM   7602 C CD2   . LEU C 3 301 ? 51.568  -76.244 52.721  1.00 149.08 ? 324 LEU G CD2   1 
HETATM 7603 C C1    . GLC D 4 .   ? 41.612  -44.258 -43.348 1.00 251.99 ? 1   GLC C C1    1 
HETATM 7604 C C2    . GLC D 4 .   ? 42.816  -44.313 -42.420 1.00 249.95 ? 1   GLC C C2    1 
HETATM 7605 C C3    . GLC D 4 .   ? 42.433  -44.108 -40.995 1.00 247.02 ? 1   GLC C C3    1 
HETATM 7606 C C4    . GLC D 4 .   ? 41.665  -42.935 -40.749 1.00 245.88 ? 1   GLC C C4    1 
HETATM 7607 C C5    . GLC D 4 .   ? 40.579  -42.683 -41.783 1.00 247.97 ? 1   GLC C C5    1 
HETATM 7608 C C6    . GLC D 4 .   ? 40.141  -41.282 -41.762 1.00 247.07 ? 1   GLC C C6    1 
HETATM 7609 O O2    . GLC D 4 .   ? 43.494  -45.534 -42.581 1.00 251.00 ? 1   GLC C O2    1 
HETATM 7610 O O3    . GLC D 4 .   ? 43.648  -44.096 -40.187 1.00 245.23 ? 1   GLC C O3    1 
HETATM 7611 O O4    . GLC D 4 .   ? 41.030  -43.077 -39.402 1.00 243.45 ? 1   GLC C O4    1 
HETATM 7612 O O5    . GLC D 4 .   ? 40.940  -43.044 -43.203 1.00 251.00 ? 1   GLC C O5    1 
HETATM 7613 O O6    . GLC D 4 .   ? 38.773  -41.034 -41.954 1.00 247.58 ? 1   GLC C O6    1 
HETATM 7614 C C1    . GLC D 4 .   ? 41.254  -41.951 -38.497 1.00 240.90 ? 2   GLC C C1    1 
HETATM 7615 C C2    . GLC D 4 .   ? 41.788  -42.449 -37.193 1.00 238.63 ? 2   GLC C C2    1 
HETATM 7616 C C3    . GLC D 4 .   ? 40.758  -43.332 -36.485 1.00 238.06 ? 2   GLC C C3    1 
HETATM 7617 C C4    . GLC D 4 .   ? 39.378  -42.734 -36.447 1.00 237.89 ? 2   GLC C C4    1 
HETATM 7618 C C5    . GLC D 4 .   ? 39.030  -42.008 -37.751 1.00 239.97 ? 2   GLC C C5    1 
HETATM 7619 C C6    . GLC D 4 .   ? 37.835  -41.089 -37.571 1.00 239.31 ? 2   GLC C C6    1 
HETATM 7620 O O2    . GLC D 4 .   ? 42.977  -43.152 -37.393 1.00 239.28 ? 2   GLC C O2    1 
HETATM 7621 O O3    . GLC D 4 .   ? 41.199  -43.622 -35.200 1.00 235.74 ? 2   GLC C O3    1 
HETATM 7622 O O4    . GLC D 4 .   ? 38.436  -43.782 -36.190 1.00 238.34 ? 2   GLC C O4    1 
HETATM 7623 O O5    . GLC D 4 .   ? 40.078  -41.256 -38.304 1.00 240.30 ? 2   GLC C O5    1 
HETATM 7624 O O6    . GLC D 4 .   ? 37.435  -40.332 -38.673 1.00 241.02 ? 2   GLC C O6    1 
HETATM 7625 C C1    . GLC D 4 .   ? 37.533  -43.524 -35.149 1.00 236.46 ? 3   GLC C C1    1 
HETATM 7626 C C2    . GLC D 4 .   ? 37.738  -44.550 -33.979 1.00 234.92 ? 3   GLC C C2    1 
HETATM 7627 C C3    . GLC D 4 .   ? 37.184  -45.916 -34.315 1.00 236.65 ? 3   GLC C C3    1 
HETATM 7628 C C4    . GLC D 4 .   ? 35.880  -45.884 -34.906 1.00 238.15 ? 3   GLC C C4    1 
HETATM 7629 C C5    . GLC D 4 .   ? 35.784  -44.894 -36.039 1.00 239.61 ? 3   GLC C C5    1 
HETATM 7630 C C6    . GLC D 4 .   ? 34.412  -44.802 -36.661 1.00 241.20 ? 3   GLC C C6    1 
HETATM 7631 O O2    . GLC D 4 .   ? 39.068  -44.624 -33.630 1.00 233.97 ? 3   GLC C O2    1 
HETATM 7632 O O3    . GLC D 4 .   ? 37.172  -46.737 -33.130 1.00 235.04 ? 3   GLC C O3    1 
HETATM 7633 O O4    . GLC D 4 .   ? 35.549  -47.235 -35.394 1.00 240.15 ? 3   GLC C O4    1 
HETATM 7634 O O5    . GLC D 4 .   ? 36.251  -43.570 -35.683 1.00 237.87 ? 3   GLC C O5    1 
HETATM 7635 O O6    . GLC D 4 .   ? 34.240  -43.842 -37.647 1.00 242.46 ? 3   GLC C O6    1 
HETATM 7636 C C1    . GLC D 4 .   ? 34.506  -47.868 -34.649 1.00 239.60 ? 4   GLC C C1    1 
HETATM 7637 C C2    . GLC D 4 .   ? 34.865  -49.312 -34.379 1.00 240.02 ? 4   GLC C C2    1 
HETATM 7638 C C3    . GLC D 4 .   ? 34.816  -50.167 -35.642 1.00 243.06 ? 4   GLC C C3    1 
HETATM 7639 C C4    . GLC D 4 .   ? 33.583  -49.938 -36.473 1.00 244.97 ? 4   GLC C C4    1 
HETATM 7640 C C5    . GLC D 4 .   ? 33.245  -48.476 -36.600 1.00 244.24 ? 4   GLC C C5    1 
HETATM 7641 C C6    . GLC D 4 .   ? 31.871  -48.249 -37.230 1.00 245.87 ? 4   GLC C C6    1 
HETATM 7642 O O2    . GLC D 4 .   ? 36.125  -49.380 -33.791 1.00 238.51 ? 4   GLC C O2    1 
HETATM 7643 O O3    . GLC D 4 .   ? 34.972  -51.509 -35.269 1.00 243.31 ? 4   GLC C O3    1 
HETATM 7644 O O4    . GLC D 4 .   ? 33.688  -50.616 -37.761 1.00 247.93 ? 4   GLC C O4    1 
HETATM 7645 O O5    . GLC D 4 .   ? 33.315  -47.752 -35.354 1.00 241.31 ? 4   GLC C O5    1 
HETATM 7646 O O6    . GLC D 4 .   ? 31.837  -47.584 -38.447 1.00 247.73 ? 4   GLC C O6    1 
HETATM 7647 C C1    . GLC D 4 .   ? 32.657  -51.430 -38.192 1.00 249.85 ? 5   GLC C C1    1 
HETATM 7648 C C2    . GLC D 4 .   ? 33.210  -52.838 -38.604 1.00 251.53 ? 5   GLC C C2    1 
HETATM 7649 C C3    . GLC D 4 .   ? 34.133  -52.725 -39.823 1.00 253.46 ? 5   GLC C C3    1 
HETATM 7650 C C4    . GLC D 4 .   ? 33.688  -51.821 -40.872 1.00 255.02 ? 5   GLC C C4    1 
HETATM 7651 C C5    . GLC D 4 .   ? 32.929  -50.632 -40.415 1.00 253.49 ? 5   GLC C C5    1 
HETATM 7652 C C6    . GLC D 4 .   ? 32.072  -50.071 -41.539 1.00 255.68 ? 5   GLC C C6    1 
HETATM 7653 O O2    . GLC D 4 .   ? 33.834  -53.424 -37.560 1.00 249.68 ? 5   GLC C O2    1 
HETATM 7654 O O3    . GLC D 4 .   ? 34.363  -54.036 -40.365 1.00 255.49 ? 5   GLC C O3    1 
HETATM 7655 O O4    . GLC D 4 .   ? 34.903  -51.336 -41.584 1.00 255.58 ? 5   GLC C O4    1 
HETATM 7656 O O5    . GLC D 4 .   ? 32.065  -50.819 -39.285 1.00 251.78 ? 5   GLC C O5    1 
HETATM 7657 O O6    . GLC D 4 .   ? 30.737  -50.397 -41.509 1.00 256.50 ? 5   GLC C O6    1 
HETATM 7658 C C1    . GLC D 4 .   ? 34.901  -51.551 -42.975 1.00 258.58 ? 6   GLC C C1    1 
HETATM 7659 C C2    . GLC D 4 .   ? 36.125  -52.449 -43.329 1.00 259.55 ? 6   GLC C C2    1 
HETATM 7660 C C3    . GLC D 4 .   ? 37.395  -51.603 -43.453 1.00 258.70 ? 6   GLC C C3    1 
HETATM 7661 C C4    . GLC D 4 .   ? 37.258  -50.430 -44.343 1.00 259.67 ? 6   GLC C C4    1 
HETATM 7662 C C5    . GLC D 4 .   ? 35.871  -49.999 -44.620 1.00 260.38 ? 6   GLC C C5    1 
HETATM 7663 C C6    . GLC D 4 .   ? 35.412  -50.458 -46.000 1.00 263.80 ? 6   GLC C C6    1 
HETATM 7664 O O2    . GLC D 4 .   ? 36.271  -53.427 -42.401 1.00 258.37 ? 6   GLC C O2    1 
HETATM 7665 O O3    . GLC D 4 .   ? 38.473  -52.421 -43.877 1.00 259.86 ? 6   GLC C O3    1 
HETATM 7666 O O4    . GLC D 4 .   ? 37.988  -49.286 -43.751 1.00 257.34 ? 6   GLC C O4    1 
HETATM 7667 O O5    . GLC D 4 .   ? 34.886  -50.308 -43.607 1.00 258.90 ? 6   GLC C O5    1 
HETATM 7668 O O6    . GLC D 4 .   ? 35.794  -49.705 -47.099 1.00 265.38 ? 6   GLC C O6    1 
HETATM 7669 C C1    . GLC D 4 .   ? 38.823  -48.580 -44.659 1.00 258.44 ? 7   GLC C C1    1 
HETATM 7670 C C2    . GLC D 4 .   ? 40.290  -48.877 -44.308 1.00 257.55 ? 7   GLC C C2    1 
HETATM 7671 C C3    . GLC D 4 .   ? 40.952  -47.739 -43.524 1.00 254.95 ? 7   GLC C C3    1 
HETATM 7672 C C4    . GLC D 4 .   ? 40.758  -46.381 -44.138 1.00 255.27 ? 7   GLC C C4    1 
HETATM 7673 C C5    . GLC D 4 .   ? 39.456  -46.285 -44.949 1.00 257.18 ? 7   GLC C C5    1 
HETATM 7674 C C6    . GLC D 4 .   ? 39.726  -46.294 -46.446 1.00 260.24 ? 7   GLC C C6    1 
HETATM 7675 O O2    . GLC D 4 .   ? 40.365  -50.042 -43.591 1.00 256.92 ? 7   GLC C O2    1 
HETATM 7676 O O3    . GLC D 4 .   ? 42.315  -48.006 -43.388 1.00 254.58 ? 7   GLC C O3    1 
HETATM 7677 O O4    . GLC D 4 .   ? 40.747  -45.378 -43.113 1.00 252.47 ? 7   GLC C O4    1 
HETATM 7678 O O5    . GLC D 4 .   ? 38.484  -47.241 -44.619 1.00 257.46 ? 7   GLC C O5    1 
HETATM 7679 O O6    . GLC D 4 .   ? 40.013  -45.086 -47.057 1.00 260.58 ? 7   GLC C O6    1 
HETATM 7680 O O4    . STU E 5 .   ? 46.792  -28.795 2.947   1.00 125.69 ? 601 STU A O4    1 
HETATM 7681 C C25   . STU E 5 .   ? 46.268  -27.863 3.823   1.00 125.59 ? 601 STU A C25   1 
HETATM 7682 C C24   . STU E 5 .   ? 47.332  -27.145 4.648   1.00 124.64 ? 601 STU A C24   1 
HETATM 7683 C C23   . STU E 5 .   ? 48.404  -28.099 5.214   1.00 123.16 ? 601 STU A C23   1 
HETATM 7684 C C22   . STU E 5 .   ? 48.932  -29.009 4.099   1.00 123.42 ? 601 STU A C22   1 
HETATM 7685 C C21   . STU E 5 .   ? 47.764  -29.679 3.398   1.00 124.42 ? 601 STU A C21   1 
HETATM 7686 C C26   . STU E 5 .   ? 48.345  -30.090 2.047   1.00 125.30 ? 601 STU A C26   1 
HETATM 7687 N N2    . STU E 5 .   ? 47.192  -30.860 4.068   1.00 123.88 ? 601 STU A N2    1 
HETATM 7688 C C18   . STU E 5 .   ? 45.980  -30.802 4.761   1.00 124.15 ? 601 STU A C18   1 
HETATM 7689 C C19   . STU E 5 .   ? 45.101  -29.729 4.994   1.00 124.83 ? 601 STU A C19   1 
HETATM 7690 C C6    . STU E 5 .   ? 43.929  -29.909 5.734   1.00 125.20 ? 601 STU A C6    1 
HETATM 7691 C C7    . STU E 5 .   ? 43.629  -31.194 6.253   1.00 124.97 ? 601 STU A C7    1 
HETATM 7692 C C10   . STU E 5 .   ? 44.510  -32.246 6.016   1.00 124.33 ? 601 STU A C10   1 
HETATM 7693 C C11   . STU E 5 .   ? 45.672  -32.065 5.282   1.00 123.88 ? 601 STU A C11   1 
HETATM 7694 C C12   . STU E 5 .   ? 46.762  -32.950 4.871   1.00 123.36 ? 601 STU A C12   1 
HETATM 7695 C C17   . STU E 5 .   ? 47.674  -32.168 4.125   1.00 123.36 ? 601 STU A C17   1 
HETATM 7696 C C16   . STU E 5 .   ? 48.827  -32.791 3.618   1.00 123.05 ? 601 STU A C16   1 
HETATM 7697 C C15   . STU E 5 .   ? 49.030  -34.141 3.850   1.00 122.74 ? 601 STU A C15   1 
HETATM 7698 C C14   . STU E 5 .   ? 48.127  -34.886 4.578   1.00 122.79 ? 601 STU A C14   1 
HETATM 7699 C C13   . STU E 5 .   ? 46.980  -34.310 5.102   1.00 123.13 ? 601 STU A C13   1 
HETATM 7700 C C9    . STU E 5 .   ? 43.925  -33.462 6.684   1.00 124.54 ? 601 STU A C9    1 
HETATM 7701 N N1    . STU E 5 .   ? 42.675  -33.020 7.307   1.00 125.36 ? 601 STU A N1    1 
HETATM 7702 C C8    . STU E 5 .   ? 42.504  -31.711 7.056   1.00 125.56 ? 601 STU A C8    1 
HETATM 7703 O O5    . STU E 5 .   ? 41.550  -31.062 7.448   1.00 126.32 ? 601 STU A O5    1 
HETATM 7704 C C5    . STU E 5 .   ? 43.274  -28.599 5.772   1.00 126.03 ? 601 STU A C5    1 
HETATM 7705 C C20   . STU E 5 .   ? 44.097  -27.710 5.050   1.00 126.16 ? 601 STU A C20   1 
HETATM 7706 C C1    . STU E 5 .   ? 43.743  -26.368 4.903   1.00 127.13 ? 601 STU A C1    1 
HETATM 7707 C C2    . STU E 5 .   ? 42.560  -25.947 5.492   1.00 127.84 ? 601 STU A C2    1 
HETATM 7708 C C3    . STU E 5 .   ? 41.748  -26.814 6.201   1.00 127.69 ? 601 STU A C3    1 
HETATM 7709 C C4    . STU E 5 .   ? 42.084  -28.152 6.357   1.00 126.83 ? 601 STU A C4    1 
HETATM 7710 N N3    . STU E 5 .   ? 45.192  -28.438 4.608   1.00 125.43 ? 601 STU A N3    1 
HETATM 7711 O O6    . STU E 5 .   ? 49.780  -30.013 4.663   1.00 122.17 ? 601 STU A O6    1 
HETATM 7712 C C27   . STU E 5 .   ? 51.129  -29.609 4.423   1.00 121.98 ? 601 STU A C27   1 
HETATM 7713 N N4    . STU E 5 .   ? 47.819  -28.946 6.256   1.00 122.36 ? 601 STU A N4    1 
HETATM 7714 C C28   . STU E 5 .   ? 48.733  -28.969 7.404   1.00 121.12 ? 601 STU A C28   1 
HETATM 7715 N N1    . EPE F 6 .   ? 34.278  -44.952 -6.677  1.00 163.40 ? 602 EPE A N1    1 
HETATM 7716 C C2    . EPE F 6 .   ? 35.623  -45.311 -6.189  1.00 160.75 ? 602 EPE A C2    1 
HETATM 7717 C C3    . EPE F 6 .   ? 36.161  -46.491 -6.988  1.00 163.08 ? 602 EPE A C3    1 
HETATM 7718 N N4    . EPE F 6 .   ? 36.103  -46.197 -8.406  1.00 165.25 ? 602 EPE A N4    1 
HETATM 7719 C C5    . EPE F 6 .   ? 34.786  -45.922 -8.943  1.00 168.12 ? 602 EPE A C5    1 
HETATM 7720 C C6    . EPE F 6 .   ? 34.142  -44.793 -8.145  1.00 165.97 ? 602 EPE A C6    1 
HETATM 7721 C C7    . EPE F 6 .   ? 37.282  -45.585 -8.997  1.00 163.42 ? 602 EPE A C7    1 
HETATM 7722 C C8    . EPE F 6 .   ? 37.028  -44.763 -10.257 1.00 165.05 ? 602 EPE A C8    1 
HETATM 7723 O O8    . EPE F 6 .   ? 36.561  -43.485 -9.884  1.00 163.21 ? 602 EPE A O8    1 
HETATM 7724 C C9    . EPE F 6 .   ? 33.290  -45.882 -6.122  1.00 165.84 ? 602 EPE A C9    1 
HETATM 7725 C C10   . EPE F 6 .   ? 31.929  -45.511 -6.684  1.00 168.81 ? 602 EPE A C10   1 
HETATM 7726 S S     . EPE F 6 .   ? 30.610  -45.940 -5.542  1.00 170.40 ? 602 EPE A S     1 
HETATM 7727 O O1S   . EPE F 6 .   ? 29.361  -45.430 -6.114  1.00 173.06 ? 602 EPE A O1S   1 
HETATM 7728 O O2S   . EPE F 6 .   ? 30.920  -45.293 -4.266  1.00 166.69 ? 602 EPE A O2S   1 
HETATM 7729 O O3S   . EPE F 6 .   ? 30.572  -47.398 -5.415  1.00 172.97 ? 602 EPE A O3S   1 
HETATM 7730 P P     . AMP G 7 .   ? 70.944  -71.162 47.354  1.00 148.81 ? 401 AMP G P     1 
HETATM 7731 O O1P   . AMP G 7 .   ? 72.114  -70.155 47.767  1.00 147.19 ? 401 AMP G O1P   1 
HETATM 7732 O O2P   . AMP G 7 .   ? 69.943  -70.753 46.206  1.00 149.07 ? 401 AMP G O2P   1 
HETATM 7733 O O3P   . AMP G 7 .   ? 70.195  -71.454 48.538  1.00 117.09 ? 401 AMP G O3P   1 
HETATM 7734 O "O5'" . AMP G 7 .   ? 71.614  -72.540 46.943  1.00 150.37 ? 401 AMP G "O5'" 1 
HETATM 7735 C "C5'" . AMP G 7 .   ? 72.710  -72.562 46.041  1.00 150.33 ? 401 AMP G "C5'" 1 
HETATM 7736 C "C4'" . AMP G 7 .   ? 73.143  -73.969 45.750  1.00 152.38 ? 401 AMP G "C4'" 1 
HETATM 7737 O "O4'" . AMP G 7 .   ? 72.003  -74.745 45.333  1.00 154.05 ? 401 AMP G "O4'" 1 
HETATM 7738 C "C3'" . AMP G 7 .   ? 74.212  -74.132 44.682  1.00 152.93 ? 401 AMP G "C3'" 1 
HETATM 7739 O "O3'" . AMP G 7 .   ? 75.200  -75.074 45.093  1.00 154.26 ? 401 AMP G "O3'" 1 
HETATM 7740 C "C2'" . AMP G 7 .   ? 73.468  -74.644 43.444  1.00 154.44 ? 401 AMP G "C2'" 1 
HETATM 7741 O "O2'" . AMP G 7 .   ? 74.096  -75.732 42.801  1.00 156.62 ? 401 AMP G "O2'" 1 
HETATM 7742 C "C1'" . AMP G 7 .   ? 72.070  -75.030 43.951  1.00 155.12 ? 401 AMP G "C1'" 1 
HETATM 7743 N N9    . AMP G 7 .   ? 70.989  -74.317 43.261  1.00 122.42 ? 401 AMP G N9    1 
HETATM 7744 C C8    . AMP G 7 .   ? 70.388  -73.181 43.655  1.00 120.72 ? 401 AMP G C8    1 
HETATM 7745 N N7    . AMP G 7 .   ? 69.456  -72.823 42.745  1.00 121.15 ? 401 AMP G N7    1 
HETATM 7746 C C5    . AMP G 7 .   ? 69.469  -73.744 41.750  1.00 123.11 ? 401 AMP G C5    1 
HETATM 7747 C C6    . AMP G 7 .   ? 68.725  -73.879 40.568  1.00 124.56 ? 401 AMP G C6    1 
HETATM 7748 N N6    . AMP G 7 .   ? 67.681  -72.883 40.207  1.00 124.00 ? 401 AMP G N6    1 
HETATM 7749 N N1    . AMP G 7 .   ? 68.986  -74.935 39.771  1.00 126.76 ? 401 AMP G N1    1 
HETATM 7750 C C2    . AMP G 7 .   ? 69.933  -75.826 40.105  1.00 127.58 ? 401 AMP G C2    1 
HETATM 7751 N N3    . AMP G 7 .   ? 70.658  -75.728 41.225  1.00 126.23 ? 401 AMP G N3    1 
HETATM 7752 C C4    . AMP G 7 .   ? 70.444  -74.688 42.071  1.00 123.95 ? 401 AMP G C4    1 
HETATM 7753 P P     . AMP H 7 .   ? 70.189  -61.472 52.677  1.00 99.76  ? 402 AMP G P     1 
HETATM 7754 O O1P   . AMP H 7 .   ? 71.059  -62.367 51.690  1.00 99.04  ? 402 AMP G O1P   1 
HETATM 7755 O O2P   . AMP H 7 .   ? 69.761  -62.055 54.081  1.00 100.50 ? 402 AMP G O2P   1 
HETATM 7756 O O3P   . AMP H 7 .   ? 69.062  -61.018 51.916  1.00 123.11 ? 402 AMP G O3P   1 
HETATM 7757 O "O5'" . AMP H 7 .   ? 71.061  -60.195 53.009  1.00 99.66  ? 402 AMP G "O5'" 1 
HETATM 7758 C "C5'" . AMP H 7 .   ? 72.376  -60.355 53.513  1.00 99.33  ? 402 AMP G "C5'" 1 
HETATM 7759 C "C4'" . AMP H 7 .   ? 72.961  -59.032 53.908  1.00 99.76  ? 402 AMP G "C4'" 1 
HETATM 7760 O "O4'" . AMP H 7 .   ? 71.969  -58.294 54.652  1.00 100.73 ? 402 AMP G "O4'" 1 
HETATM 7761 C "C3'" . AMP H 7 .   ? 74.194  -59.117 54.786  1.00 99.91  ? 402 AMP G "C3'" 1 
HETATM 7762 O "O3'" . AMP H 7 .   ? 75.088  -58.043 54.505  1.00 100.23 ? 402 AMP G "O3'" 1 
HETATM 7763 C "C2'" . AMP H 7 .   ? 73.652  -58.972 56.198  1.00 100.81 ? 402 AMP G "C2'" 1 
HETATM 7764 O "O2'" . AMP H 7 .   ? 74.536  -58.280 57.053  1.00 101.57 ? 402 AMP G "O2'" 1 
HETATM 7765 C "C1'" . AMP H 7 .   ? 72.336  -58.199 56.011  1.00 101.40 ? 402 AMP G "C1'" 1 
HETATM 7766 N N9    . AMP H 7 .   ? 71.237  -58.744 56.815  1.00 124.94 ? 402 AMP G N9    1 
HETATM 7767 C C8    . AMP H 7 .   ? 70.489  -59.818 56.505  1.00 124.67 ? 402 AMP G C8    1 
HETATM 7768 N N7    . AMP H 7 .   ? 69.595  -60.024 57.497  1.00 125.80 ? 402 AMP G N7    1 
HETATM 7769 C C5    . AMP H 7 .   ? 69.783  -59.072 58.452  1.00 126.77 ? 402 AMP G C5    1 
HETATM 7770 C C6    . AMP H 7 .   ? 69.159  -58.791 59.682  1.00 128.36 ? 402 AMP G C6    1 
HETATM 7771 N N6    . AMP H 7 .   ? 68.039  -59.619 60.195  1.00 129.32 ? 402 AMP G N6    1 
HETATM 7772 N N1    . AMP H 7 .   ? 69.593  -57.743 60.407  1.00 129.33 ? 402 AMP G N1    1 
HETATM 7773 C C2    . AMP H 7 .   ? 70.600  -56.985 59.960  1.00 128.82 ? 402 AMP G C2    1 
HETATM 7774 N N3    . AMP H 7 .   ? 71.217  -57.221 58.798  1.00 127.32 ? 402 AMP G N3    1 
HETATM 7775 C C4    . AMP H 7 .   ? 70.827  -58.262 58.020  1.00 126.24 ? 402 AMP G C4    1 
HETATM 7776 P P     . AMP I 7 .   ? 66.594  -69.752 54.531  1.00 112.57 ? 403 AMP G P     1 
HETATM 7777 O O1P   . AMP I 7 .   ? 65.648  -68.956 53.523  1.00 112.40 ? 403 AMP G O1P   1 
HETATM 7778 O O2P   . AMP I 7 .   ? 67.294  -68.981 55.713  1.00 111.80 ? 403 AMP G O2P   1 
HETATM 7779 O O3P   . AMP I 7 .   ? 67.573  -70.462 53.758  1.00 125.36 ? 403 AMP G O3P   1 
HETATM 7780 O "O5'" . AMP I 7 .   ? 65.706  -70.866 55.223  1.00 114.89 ? 403 AMP G "O5'" 1 
HETATM 7781 C "C5'" . AMP I 7 .   ? 64.539  -70.486 55.922  1.00 116.14 ? 403 AMP G "C5'" 1 
HETATM 7782 C "C4'" . AMP I 7 .   ? 63.998  -71.605 56.759  1.00 118.49 ? 403 AMP G "C4'" 1 
HETATM 7783 O "O4'" . AMP I 7 .   ? 65.047  -72.106 57.622  1.00 118.37 ? 403 AMP G "O4'" 1 
HETATM 7784 C "C3'" . AMP I 7 .   ? 62.850  -71.204 57.657  1.00 120.12 ? 403 AMP G "C3'" 1 
HETATM 7785 O "O3'" . AMP I 7 .   ? 61.913  -72.273 57.778  1.00 122.79 ? 403 AMP G "O3'" 1 
HETATM 7786 C "C2'" . AMP I 7 .   ? 63.526  -70.889 58.994  1.00 119.85 ? 403 AMP G "C2'" 1 
HETATM 7787 O "O2'" . AMP I 7 .   ? 62.729  -71.155 60.131  1.00 122.16 ? 403 AMP G "O2'" 1 
HETATM 7788 C "C1'" . AMP I 7 .   ? 64.797  -71.753 58.971  1.00 119.20 ? 403 AMP G "C1'" 1 
HETATM 7789 N N9    . AMP I 7 .   ? 65.995  -71.065 59.477  1.00 130.76 ? 403 AMP G N9    1 
HETATM 7790 C C8    . AMP I 7 .   ? 66.426  -69.842 59.113  1.00 128.83 ? 403 AMP G C8    1 
HETATM 7791 N N7    . AMP I 7 .   ? 67.568  -69.535 59.766  1.00 128.00 ? 403 AMP G N7    1 
HETATM 7792 C C5    . AMP I 7 .   ? 67.880  -70.584 60.562  1.00 129.37 ? 403 AMP G C5    1 
HETATM 7793 C C6    . AMP I 7 .   ? 68.938  -70.821 61.453  1.00 129.56 ? 403 AMP G C6    1 
HETATM 7794 N N6    . AMP I 7 .   ? 70.021  -69.832 61.683  1.00 128.09 ? 403 AMP G N6    1 
HETATM 7795 N N1    . AMP I 7 .   ? 68.956  -71.992 62.104  1.00 131.42 ? 403 AMP G N1    1 
HETATM 7796 C C2    . AMP I 7 .   ? 67.988  -72.896 61.902  1.00 133.09 ? 403 AMP G C2    1 
HETATM 7797 N N3    . AMP I 7 .   ? 66.964  -72.711 61.066  1.00 133.03 ? 403 AMP G N3    1 
HETATM 7798 C C4    . AMP I 7 .   ? 66.887  -71.552 60.377  1.00 131.13 ? 403 AMP G C4    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLY A 1   ? 1.8478 3.0662 1.7907 0.3857  -0.3115 -0.3812 11  GLY A N     
2    C CA    . GLY A 1   ? 1.8148 3.0250 1.8000 0.3532  -0.2983 -0.3623 11  GLY A CA    
3    C C     . GLY A 1   ? 1.7852 2.9295 1.7600 0.3314  -0.2612 -0.3187 11  GLY A C     
4    O O     . GLY A 1   ? 1.7891 2.9171 1.7174 0.3573  -0.2369 -0.2843 11  GLY A O     
5    N N     . SER A 2   ? 1.9900 3.0971 2.0098 0.2842  -0.2575 -0.3196 12  SER A N     
6    C CA    . SER A 2   ? 1.9624 3.0068 1.9766 0.2608  -0.2255 -0.2828 12  SER A CA    
7    C C     . SER A 2   ? 1.9475 2.9451 1.9951 0.2173  -0.2292 -0.2958 12  SER A C     
8    O O     . SER A 2   ? 1.9464 2.9593 2.0432 0.1910  -0.2507 -0.3239 12  SER A O     
9    C CB    . SER A 2   ? 2.3650 3.4156 2.3968 0.2527  -0.2078 -0.2565 12  SER A CB    
10   O OG    . SER A 2   ? 2.3546 3.4354 2.4442 0.2252  -0.2243 -0.2775 12  SER A OG    
11   N N     . VAL A 3   ? 1.6903 2.6312 1.7129 0.2098  -0.2083 -0.2740 13  VAL A N     
12   C CA    . VAL A 3   ? 1.6796 2.5727 1.7260 0.1735  -0.2104 -0.2839 13  VAL A CA    
13   C C     . VAL A 3   ? 1.6528 2.5288 1.7476 0.1327  -0.2027 -0.2749 13  VAL A C     
14   O O     . VAL A 3   ? 1.6359 2.5120 1.7296 0.1326  -0.1827 -0.2471 13  VAL A O     
15   C CB    . VAL A 3   ? 1.6754 2.5159 1.6822 0.1780  -0.1883 -0.2600 13  VAL A CB    
16   C CG1   . VAL A 3   ? 1.7047 2.5580 1.6741 0.2097  -0.2007 -0.2773 13  VAL A CG1   
17   C CG2   . VAL A 3   ? 1.6634 2.4914 1.6421 0.1922  -0.1590 -0.2182 13  VAL A CG2   
18   N N     . LYS A 4   ? 2.1714 3.0339 2.3089 0.0997  -0.2187 -0.2981 14  LYS A N     
19   C CA    . LYS A 4   ? 2.1484 2.9918 2.3321 0.0597  -0.2094 -0.2867 14  LYS A CA    
20   C C     . LYS A 4   ? 2.1506 2.9524 2.3631 0.0263  -0.2190 -0.3023 14  LYS A C     
21   O O     . LYS A 4   ? 2.1737 2.9771 2.3881 0.0304  -0.2430 -0.3339 14  LYS A O     
22   C CB    . LYS A 4   ? 1.6277 2.5275 1.8574 0.0525  -0.2220 -0.2968 14  LYS A CB    
23   C CG    . LYS A 4   ? 1.6508 2.5869 1.9184 0.0467  -0.2581 -0.3392 14  LYS A CG    
24   C CD    . LYS A 4   ? 1.6435 2.6252 1.9731 0.0248  -0.2669 -0.3441 14  LYS A CD    
25   C CE    . LYS A 4   ? 1.6685 2.6849 2.0446 0.0148  -0.3054 -0.3879 14  LYS A CE    
26   N NZ    . LYS A 4   ? 1.6606 2.7169 2.1086 -0.0151 -0.3129 -0.3904 14  LYS A NZ    
27   N N     . ILE A 5   ? 1.6102 2.3749 1.8439 -0.0047 -0.2005 -0.2804 15  ILE A N     
28   C CA    . ILE A 5   ? 1.6123 2.3350 1.8757 -0.0379 -0.2065 -0.2898 15  ILE A CA    
29   C C     . ILE A 5   ? 1.6019 2.3373 1.9262 -0.0728 -0.2061 -0.2844 15  ILE A C     
30   O O     . ILE A 5   ? 1.5810 2.3189 1.9080 -0.0786 -0.1833 -0.2554 15  ILE A O     
31   C CB    . ILE A 5   ? 1.5994 2.2607 1.8299 -0.0430 -0.1829 -0.2655 15  ILE A CB    
32   C CG1   . ILE A 5   ? 1.5984 2.2560 1.7687 -0.0073 -0.1688 -0.2503 15  ILE A CG1   
33   C CG2   . ILE A 5   ? 1.6141 2.2352 1.8553 -0.0601 -0.1965 -0.2851 15  ILE A CG2   
34   C CD1   . ILE A 5   ? 1.5840 2.1872 1.7261 -0.0122 -0.1448 -0.2240 15  ILE A CD1   
35   N N     . GLY A 6   ? 1.6192 2.3631 1.9933 -0.0954 -0.2313 -0.3119 16  GLY A N     
36   C CA    . GLY A 6   ? 1.6129 2.3747 2.0521 -0.1297 -0.2319 -0.3059 16  GLY A CA    
37   C C     . GLY A 6   ? 1.6029 2.4282 2.0562 -0.1179 -0.2290 -0.2986 16  GLY A C     
38   O O     . GLY A 6   ? 1.6167 2.4880 2.0680 -0.0963 -0.2496 -0.3221 16  GLY A O     
39   N N     . HIS A 7   ? 1.5811 2.4110 2.0480 -0.1303 -0.2040 -0.2665 17  HIS A N     
40   C CA    . HIS A 7   ? 1.5704 2.4571 2.0430 -0.1151 -0.1966 -0.2549 17  HIS A CA    
41   C C     . HIS A 7   ? 1.5568 2.4324 1.9652 -0.0821 -0.1724 -0.2304 17  HIS A C     
42   O O     . HIS A 7   ? 1.5485 2.4633 1.9548 -0.0667 -0.1627 -0.2168 17  HIS A O     
43   C CB    . HIS A 7   ? 1.5588 2.4668 2.0898 -0.1461 -0.1852 -0.2357 17  HIS A CB    
44   C CG    . HIS A 7   ? 1.5731 2.5276 2.1765 -0.1692 -0.2112 -0.2590 17  HIS A CG    
45   N ND1   . HIS A 7   ? 1.5782 2.6014 2.2020 -0.1542 -0.2273 -0.2747 17  HIS A ND1   
46   C CD2   . HIS A 7   ? 1.5856 2.5278 2.2489 -0.2068 -0.2248 -0.2691 17  HIS A CD2   
47   C CE1   . HIS A 7   ? 1.5922 2.6454 2.2875 -0.1825 -0.2505 -0.2946 17  HIS A CE1   
48   N NE2   . HIS A 7   ? 1.5977 2.6011 2.3192 -0.2154 -0.2494 -0.2911 17  HIS A NE2   
49   N N     . TYR A 8   ? 1.5565 2.3780 1.9152 -0.0717 -0.1630 -0.2241 18  TYR A N     
50   C CA    . TYR A 8   ? 1.5470 2.3508 1.8484 -0.0431 -0.1410 -0.2003 18  TYR A CA    
51   C C     . TYR A 8   ? 1.5620 2.3788 1.8183 -0.0062 -0.1511 -0.2127 18  TYR A C     
52   O O     . TYR A 8   ? 1.5759 2.3744 1.8175 -0.0023 -0.1647 -0.2315 18  TYR A O     
53   C CB    . TYR A 8   ? 1.6346 2.3722 1.9112 -0.0548 -0.1212 -0.1806 18  TYR A CB    
54   C CG    . TYR A 8   ? 1.6191 2.3437 1.9216 -0.0794 -0.1025 -0.1578 18  TYR A CG    
55   C CD1   . TYR A 8   ? 1.6079 2.3475 1.8994 -0.0671 -0.0834 -0.1346 18  TYR A CD1   
56   C CD2   . TYR A 8   ? 1.6191 2.3158 1.9547 -0.1124 -0.1037 -0.1588 18  TYR A CD2   
57   C CE1   . TYR A 8   ? 1.5968 2.3282 1.9082 -0.0855 -0.0660 -0.1141 18  TYR A CE1   
58   C CE2   . TYR A 8   ? 1.6078 2.2957 1.9644 -0.1321 -0.0852 -0.1355 18  TYR A CE2   
59   C CZ    . TYR A 8   ? 1.5965 2.3036 1.9399 -0.1177 -0.0663 -0.1136 18  TYR A CZ    
60   O OH    . TYR A 8   ? 1.5881 2.2901 1.9486 -0.1331 -0.0475 -0.0907 18  TYR A OH    
61   N N     . ILE A 9   ? 1.5616 2.4104 1.7947 0.0227  -0.1436 -0.2009 19  ILE A N     
62   C CA    . ILE A 9   ? 1.5777 2.4401 1.7649 0.0611  -0.1491 -0.2057 19  ILE A CA    
63   C C     . ILE A 9   ? 1.5728 2.3886 1.7086 0.0779  -0.1247 -0.1768 19  ILE A C     
64   O O     . ILE A 9   ? 1.5585 2.3527 1.6903 0.0727  -0.1038 -0.1516 19  ILE A O     
65   C CB    . ILE A 9   ? 1.5860 2.5137 1.7779 0.0865  -0.1577 -0.2105 19  ILE A CB    
66   C CG1   . ILE A 9   ? 1.5720 2.5041 1.7599 0.0928  -0.1350 -0.1811 19  ILE A CG1   
67   C CG2   . ILE A 9   ? 1.5922 2.5690 1.8400 0.0688  -0.1839 -0.2404 19  ILE A CG2   
68   C CD1   . ILE A 9   ? 1.5810 2.5066 1.7150 0.1316  -0.1212 -0.1603 19  ILE A CD1   
69   N N     . LEU A 10  ? 1.5870 2.3883 1.6847 0.0985  -0.1278 -0.1807 20  LEU A N     
70   C CA    . LEU A 10  ? 1.5842 2.3407 1.6392 0.1113  -0.1056 -0.1531 20  LEU A CA    
71   C C     . LEU A 10  ? 1.5917 2.3679 1.6181 0.1442  -0.0941 -0.1318 20  LEU A C     
72   O O     . LEU A 10  ? 1.6080 2.4323 1.6269 0.1705  -0.1061 -0.1417 20  LEU A O     
73   C CB    . LEU A 10  ? 1.5975 2.3332 1.6247 0.1209  -0.1109 -0.1617 20  LEU A CB    
74   C CG    . LEU A 10  ? 1.6005 2.3241 1.6513 0.0974  -0.1289 -0.1900 20  LEU A CG    
75   C CD1   . LEU A 10  ? 1.6095 2.3002 1.6265 0.1073  -0.1250 -0.1883 20  LEU A CD1   
76   C CD2   . LEU A 10  ? 1.5813 2.2774 1.6721 0.0575  -0.1249 -0.1885 20  LEU A CD2   
77   N N     . GLY A 11  ? 1.7208 2.4593 1.7342 0.1420  -0.0720 -0.1035 21  GLY A N     
78   C CA    . GLY A 11  ? 1.7291 2.4707 1.7166 0.1698  -0.0582 -0.0792 21  GLY A CA    
79   C C     . GLY A 11  ? 1.7399 2.4430 1.6875 0.1880  -0.0430 -0.0550 21  GLY A C     
80   O O     . GLY A 11  ? 1.7510 2.4511 1.6792 0.1978  -0.0466 -0.0584 21  GLY A O     
81   N N     . ASP A 12  ? 1.6000 2.2762 1.5368 0.1944  -0.0260 -0.0297 22  ASP A N     
82   C CA    . ASP A 12  ? 1.6099 2.2419 1.5176 0.2061  -0.0095 -0.0025 22  ASP A CA    
83   C C     . ASP A 12  ? 1.5979 2.1826 1.5064 0.1817  -0.0040 -0.0010 22  ASP A C     
84   O O     . ASP A 12  ? 1.5793 2.1513 1.5109 0.1528  -0.0079 -0.0150 22  ASP A O     
85   C CB    . ASP A 12  ? 2.3447 2.9537 2.2489 0.2127  0.0039  0.0186  22  ASP A CB    
86   C CG    . ASP A 12  ? 2.3629 2.9332 2.2401 0.2302  0.0186  0.0478  22  ASP A CG    
87   O OD1   . ASP A 12  ? 2.3810 2.9655 2.2376 0.2520  0.0187  0.0562  22  ASP A OD1   
88   O OD2   . ASP A 12  ? 2.3616 2.8879 2.2392 0.2228  0.0296  0.0626  22  ASP A OD2   
89   N N     . THR A 13  ? 1.6102 2.1708 1.4946 0.1941  0.0057  0.0178  23  THR A N     
90   C CA    . THR A 13  ? 1.6011 2.1194 1.4847 0.1746  0.0119  0.0219  23  THR A CA    
91   C C     . THR A 13  ? 1.5901 2.0563 1.4809 0.1561  0.0246  0.0373  23  THR A C     
92   O O     . THR A 13  ? 1.6007 2.0503 1.4834 0.1686  0.0344  0.0575  23  THR A O     
93   C CB    . THR A 13  ? 1.6199 2.1370 1.4778 0.1960  0.0188  0.0389  23  THR A CB    
94   O OG1   . THR A 13  ? 1.6321 2.1977 1.4804 0.2143  0.0052  0.0207  23  THR A OG1   
95   C CG2   . THR A 13  ? 1.6106 2.0869 1.4697 0.1766  0.0259  0.0445  23  THR A CG2   
96   N N     . LEU A 14  ? 1.5716 2.0122 1.4778 0.1276  0.0232  0.0265  24  LEU A N     
97   C CA    . LEU A 14  ? 1.5629 1.9546 1.4739 0.1109  0.0336  0.0386  24  LEU A CA    
98   C C     . LEU A 14  ? 1.5691 1.9236 1.4681 0.1111  0.0434  0.0572  24  LEU A C     
99   O O     . LEU A 14  ? 1.5760 1.8968 1.4718 0.1131  0.0530  0.0758  24  LEU A O     
100  C CB    . LEU A 14  ? 1.5427 1.9250 1.4751 0.0818  0.0285  0.0211  24  LEU A CB    
101  C CG    . LEU A 14  ? 1.5358 1.9471 1.4868 0.0768  0.0230  0.0093  24  LEU A CG    
102  C CD1   . LEU A 14  ? 1.5192 1.9203 1.4925 0.0477  0.0196  -0.0039 24  LEU A CD1   
103  C CD2   . LEU A 14  ? 1.5423 1.9436 1.4875 0.0889  0.0320  0.0242  24  LEU A CD2   
104  N N     . GLY A 15  ? 1.5688 1.9306 1.4630 0.1097  0.0404  0.0516  25  GLY A N     
105  C CA    . GLY A 15  ? 1.5727 1.9042 1.4601 0.1075  0.0500  0.0688  25  GLY A CA    
106  C C     . GLY A 15  ? 1.5742 1.9220 1.4546 0.1099  0.0459  0.0603  25  GLY A C     
107  O O     . GLY A 15  ? 1.5731 1.9525 1.4540 0.1121  0.0333  0.0374  25  GLY A O     
108  N N     . VAL A 16  ? 1.9783 2.3058 1.8537 0.1104  0.0558  0.0783  26  VAL A N     
109  C CA    . VAL A 16  ? 1.9839 2.3295 1.8492 0.1182  0.0543  0.0739  26  VAL A CA    
110  C C     . VAL A 16  ? 1.9677 2.2977 1.8434 0.0955  0.0464  0.0521  26  VAL A C     
111  O O     . VAL A 16  ? 1.9720 2.3249 1.8412 0.1016  0.0369  0.0335  26  VAL A O     
112  C CB    . VAL A 16  ? 2.5092 2.8458 2.3670 0.1300  0.0701  0.1059  26  VAL A CB    
113  C CG1   . VAL A 16  ? 2.5313 2.8863 2.3769 0.1562  0.0779  0.1294  26  VAL A CG1   
114  C CG2   . VAL A 16  ? 2.4987 2.7870 2.3735 0.1073  0.0784  0.1197  26  VAL A CG2   
115  N N     . GLY A 17  ? 2.2035 2.4941 2.0942 0.0715  0.0495  0.0538  27  GLY A N     
116  C CA    . GLY A 17  ? 2.1899 2.4626 2.0905 0.0503  0.0429  0.0356  27  GLY A CA    
117  C C     . GLY A 17  ? 2.1931 2.4601 2.0879 0.0522  0.0469  0.0405  27  GLY A C     
118  O O     . GLY A 17  ? 2.2040 2.4770 2.0906 0.0667  0.0576  0.0628  27  GLY A O     
119  N N     . THR A 18  ? 2.5808 2.8373 2.4813 0.0380  0.0387  0.0211  28  THR A N     
120  C CA    . THR A 18  ? 2.5834 2.8345 2.4793 0.0396  0.0415  0.0230  28  THR A CA    
121  C C     . THR A 18  ? 2.5998 2.8878 2.4793 0.0617  0.0339  0.0092  28  THR A C     
122  O O     . THR A 18  ? 2.6127 2.9212 2.4785 0.0822  0.0423  0.0246  28  THR A O     
123  C CB    . THR A 18  ? 1.6829 1.9015 1.5911 0.0156  0.0362  0.0092  28  THR A CB    
124  O OG1   . THR A 18  ? 1.6703 1.8603 1.5913 -0.0024 0.0399  0.0160  28  THR A OG1   
125  C CG2   . THR A 18  ? 1.6839 1.8926 1.5898 0.0164  0.0422  0.0174  28  THR A CG2   
126  N N     . PHE A 19  ? 2.4276 2.7243 2.3099 0.0578  0.0175  -0.0200 29  PHE A N     
127  C CA    . PHE A 19  ? 2.4461 2.7741 2.3144 0.0775  0.0049  -0.0415 29  PHE A CA    
128  C C     . PHE A 19  ? 2.4597 2.8281 2.3169 0.0999  0.0001  -0.0442 29  PHE A C     
129  O O     . PHE A 19  ? 2.4786 2.8798 2.3143 0.1285  0.0019  -0.0399 29  PHE A O     
130  C CB    . PHE A 19  ? 2.2786 2.5915 2.1598 0.0608  -0.0127 -0.0732 29  PHE A CB    
131  C CG    . PHE A 19  ? 2.2665 2.5390 2.1579 0.0395  -0.0082 -0.0699 29  PHE A CG    
132  C CD1   . PHE A 19  ? 2.2743 2.5433 2.1545 0.0487  -0.0059 -0.0699 29  PHE A CD1   
133  C CD2   . PHE A 19  ? 2.2492 2.4903 2.1601 0.0128  -0.0059 -0.0663 29  PHE A CD2   
134  C CE1   . PHE A 19  ? 2.2641 2.4981 2.1536 0.0307  -0.0024 -0.0671 29  PHE A CE1   
135  C CE2   . PHE A 19  ? 2.2404 2.4466 2.1585 -0.0041 -0.0022 -0.0632 29  PHE A CE2   
136  C CZ    . PHE A 19  ? 2.2475 2.4496 2.1554 0.0044  -0.0009 -0.0639 29  PHE A CZ    
137  N N     . GLY A 20  ? 2.3255 2.6949 2.1971 0.0886  -0.0062 -0.0516 30  GLY A N     
138  C CA    . GLY A 20  ? 2.3375 2.7462 2.2010 0.1090  -0.0118 -0.0549 30  GLY A CA    
139  C C     . GLY A 20  ? 2.3245 2.7259 2.2013 0.0983  -0.0054 -0.0415 30  GLY A C     
140  O O     . GLY A 20  ? 2.3069 2.6736 2.2002 0.0738  0.0003  -0.0351 30  GLY A O     
141  N N     . LYS A 21  ? 1.5903 2.0258 1.4577 0.1195  -0.0066 -0.0374 31  LYS A N     
142  C CA    . LYS A 21  ? 1.5828 2.0134 1.4572 0.1167  0.0019  -0.0201 31  LYS A CA    
143  C C     . LYS A 21  ? 1.5684 1.9965 1.4688 0.0940  -0.0083 -0.0387 31  LYS A C     
144  O O     . LYS A 21  ? 1.5662 1.9976 1.4811 0.0802  -0.0228 -0.0643 31  LYS A O     
145  C CB    . LYS A 21  ? 1.8583 2.3281 1.7136 0.1491  0.0036  -0.0093 31  LYS A CB    
146  C CG    . LYS A 21  ? 1.8703 2.3870 1.7246 0.1632  -0.0162 -0.0381 31  LYS A CG    
147  C CD    . LYS A 21  ? 1.8935 2.4507 1.7229 0.2004  -0.0137 -0.0255 31  LYS A CD    
148  C CE    . LYS A 21  ? 1.9126 2.4797 1.7148 0.2242  -0.0061 -0.0129 31  LYS A CE    
149  N NZ    . LYS A 21  ? 1.9387 2.5460 1.7144 0.2629  -0.0013 0.0038  31  LYS A NZ    
150  N N     . VAL A 22  ? 1.5614 1.9843 1.4686 0.0911  -0.0007 -0.0248 32  VAL A N     
151  C CA    . VAL A 22  ? 1.5485 1.9734 1.4808 0.0716  -0.0070 -0.0372 32  VAL A CA    
152  C C     . VAL A 22  ? 1.5534 2.0083 1.4859 0.0871  -0.0064 -0.0313 32  VAL A C     
153  O O     . VAL A 22  ? 1.5614 2.0110 1.4772 0.1047  0.0052  -0.0089 32  VAL A O     
154  C CB    . VAL A 22  ? 1.5322 1.9123 1.4757 0.0471  0.0032  -0.0269 32  VAL A CB    
155  C CG1   . VAL A 22  ? 1.5274 1.8813 1.4742 0.0306  0.0003  -0.0360 32  VAL A CG1   
156  C CG2   . VAL A 22  ? 1.5347 1.8898 1.4635 0.0569  0.0192  0.0005  32  VAL A CG2   
157  N N     . LYS A 23  ? 1.5508 2.0377 1.5042 0.0808  -0.0194 -0.0510 33  LYS A N     
158  C CA    . LYS A 23  ? 1.5551 2.0764 1.5118 0.0957  -0.0203 -0.0478 33  LYS A CA    
159  C C     . LYS A 23  ? 1.5405 2.0667 1.5285 0.0734  -0.0222 -0.0547 33  LYS A C     
160  O O     . LYS A 23  ? 1.5288 2.0327 1.5357 0.0468  -0.0233 -0.0618 33  LYS A O     
161  C CB    . LYS A 23  ? 2.0627 2.6359 2.0141 0.1182  -0.0361 -0.0651 33  LYS A CB    
162  C CG    . LYS A 23  ? 2.0812 2.6591 2.0000 0.1445  -0.0345 -0.0585 33  LYS A CG    
163  C CD    . LYS A 23  ? 2.1014 2.7337 2.0077 0.1760  -0.0453 -0.0665 33  LYS A CD    
164  C CE    . LYS A 23  ? 2.1224 2.7713 2.0012 0.2002  -0.0506 -0.0716 33  LYS A CE    
165  N NZ    . LYS A 23  ? 2.1291 2.7485 1.9807 0.2127  -0.0302 -0.0398 33  LYS A NZ    
166  N N     . VAL A 24  ? 1.5429 2.1009 1.5366 0.0857  -0.0219 -0.0512 34  VAL A N     
167  C CA    . VAL A 24  ? 1.5310 2.1040 1.5558 0.0678  -0.0226 -0.0559 34  VAL A CA    
168  C C     . VAL A 24  ? 1.5333 2.1572 1.5879 0.0623  -0.0416 -0.0805 34  VAL A C     
169  O O     . VAL A 24  ? 1.5466 2.2086 1.5932 0.0842  -0.0527 -0.0902 34  VAL A O     
170  C CB    . VAL A 24  ? 1.5329 2.1128 1.5503 0.0841  -0.0109 -0.0381 34  VAL A CB    
171  C CG1   . VAL A 24  ? 1.5340 2.0611 1.5271 0.0878  0.0052  -0.0165 34  VAL A CG1   
172  C CG2   . VAL A 24  ? 1.5487 2.1711 1.5532 0.1153  -0.0166 -0.0382 34  VAL A CG2   
173  N N     . GLY A 25  ? 1.5822 2.2071 1.6726 0.0332  -0.0463 -0.0905 35  GLY A N     
174  C CA    . GLY A 25  ? 1.5852 2.2585 1.7132 0.0239  -0.0645 -0.1124 35  GLY A CA    
175  C C     . GLY A 25  ? 1.5787 2.2887 1.7310 0.0233  -0.0591 -0.1045 35  GLY A C     
176  O O     . GLY A 25  ? 1.5703 2.2600 1.7154 0.0220  -0.0413 -0.0842 35  GLY A O     
177  N N     . LYS A 26  ? 1.5249 2.2911 1.7061 0.0257  -0.0751 -0.1213 36  LYS A N     
178  C CA    . LYS A 26  ? 1.5187 2.3271 1.7295 0.0235  -0.0707 -0.1145 36  LYS A CA    
179  C C     . LYS A 26  ? 1.5199 2.3737 1.7870 0.0007  -0.0897 -0.1358 36  LYS A C     
180  O O     . LYS A 26  ? 1.5323 2.4160 1.8073 0.0080  -0.1113 -0.1595 36  LYS A O     
181  C CB    . LYS A 26  ? 1.5846 2.4254 1.7694 0.0601  -0.0679 -0.1072 36  LYS A CB    
182  C CG    . LYS A 26  ? 1.5783 2.4507 1.7809 0.0636  -0.0567 -0.0934 36  LYS A CG    
183  C CD    . LYS A 26  ? 1.5889 2.4696 1.7534 0.1021  -0.0484 -0.0796 36  LYS A CD    
184  C CE    . LYS A 26  ? 1.5841 2.4817 1.7582 0.1072  -0.0335 -0.0634 36  LYS A CE    
185  N NZ    . LYS A 26  ? 1.5982 2.4932 1.7333 0.1451  -0.0250 -0.0492 36  LYS A NZ    
186  N N     . HIS A 27  ? 1.5095 2.3695 1.8170 -0.0261 -0.0819 -0.1270 37  HIS A N     
187  C CA    . HIS A 27  ? 1.5118 2.4118 1.8815 -0.0530 -0.0985 -0.1434 37  HIS A CA    
188  C C     . HIS A 27  ? 1.5182 2.4908 1.9095 -0.0361 -0.1126 -0.1558 37  HIS A C     
189  O O     . HIS A 27  ? 1.5138 2.5153 1.8951 -0.0161 -0.1002 -0.1405 37  HIS A O     
190  C CB    . HIS A 27  ? 1.5008 2.3953 1.9077 -0.0824 -0.0824 -0.1239 37  HIS A CB    
191  C CG    . HIS A 27  ? 1.5060 2.4147 1.9761 -0.1187 -0.0974 -0.1371 37  HIS A CG    
192  N ND1   . HIS A 27  ? 1.5088 2.4817 2.0372 -0.1304 -0.1085 -0.1443 37  HIS A ND1   
193  C CD2   . HIS A 27  ? 1.5112 2.3774 1.9983 -0.1462 -0.1035 -0.1437 37  HIS A CD2   
194  C CE1   . HIS A 27  ? 1.5165 2.4841 2.0973 -0.1651 -0.1212 -0.1545 37  HIS A CE1   
195  N NE2   . HIS A 27  ? 1.5189 2.4206 2.0744 -0.1745 -0.1184 -0.1544 37  HIS A NE2   
196  N N     . GLU A 28  ? 1.5310 2.5328 1.9514 -0.0424 -0.1398 -0.1852 38  GLU A N     
197  C CA    . GLU A 28  ? 1.5398 2.6127 1.9812 -0.0254 -0.1576 -0.2017 38  GLU A CA    
198  C C     . GLU A 28  ? 1.5296 2.6551 2.0166 -0.0348 -0.1481 -0.1870 38  GLU A C     
199  O O     . GLU A 28  ? 1.5315 2.7083 2.0141 -0.0090 -0.1491 -0.1858 38  GLU A O     
200  C CB    . GLU A 28  ? 2.5130 3.6067 2.9906 -0.0386 -0.1909 -0.2384 38  GLU A CB    
201  C CG    . GLU A 28  ? 2.5287 3.5889 2.9579 -0.0186 -0.2041 -0.2576 38  GLU A CG    
202  C CD    . GLU A 28  ? 2.5499 3.6273 3.0154 -0.0314 -0.2390 -0.2972 38  GLU A CD    
203  O OE1   . GLU A 28  ? 2.5505 3.6356 3.0797 -0.0681 -0.2490 -0.3056 38  GLU A OE1   
204  O OE2   . GLU A 28  ? 2.5689 3.6523 2.9999 -0.0041 -0.2567 -0.3197 38  GLU A OE2   
205  N N     . LEU A 29  ? 1.5204 2.6342 2.0501 -0.0700 -0.1379 -0.1741 39  LEU A N     
206  C CA    . LEU A 29  ? 1.5127 2.6816 2.0952 -0.0833 -0.1292 -0.1597 39  LEU A CA    
207  C C     . LEU A 29  ? 1.4998 2.6545 2.0515 -0.0702 -0.0970 -0.1259 39  LEU A C     
208  O O     . LEU A 29  ? 1.4983 2.6924 2.0359 -0.0426 -0.0892 -0.1171 39  LEU A O     
209  C CB    . LEU A 29  ? 1.5144 2.6858 2.1680 -0.1293 -0.1363 -0.1626 39  LEU A CB    
210  C CG    . LEU A 29  ? 1.5311 2.7259 2.2355 -0.1489 -0.1711 -0.1976 39  LEU A CG    
211  C CD1   . LEU A 29  ? 1.5433 2.6790 2.2092 -0.1452 -0.1869 -0.2204 39  LEU A CD1   
212  C CD2   . LEU A 29  ? 1.5335 2.7436 2.3193 -0.1940 -0.1732 -0.1917 39  LEU A CD2   
213  N N     . THR A 30  ? 1.4933 2.5911 2.0334 -0.0881 -0.0795 -0.1085 40  THR A N     
214  C CA    . THR A 30  ? 1.4843 2.5660 1.9980 -0.0779 -0.0504 -0.0785 40  THR A CA    
215  C C     . THR A 30  ? 1.4855 2.5345 1.9273 -0.0396 -0.0408 -0.0725 40  THR A C     
216  O O     . THR A 30  ? 1.4846 2.5532 1.9082 -0.0160 -0.0260 -0.0570 40  THR A O     
217  C CB    . THR A 30  ? 1.4801 2.5074 1.9969 -0.1052 -0.0364 -0.0633 40  THR A CB    
218  O OG1   . THR A 30  ? 1.4826 2.4429 1.9553 -0.1028 -0.0420 -0.0735 40  THR A OG1   
219  C CG2   . THR A 30  ? 1.4830 2.5344 2.0725 -0.1450 -0.0450 -0.0661 40  THR A CG2   
220  N N     . GLY A 31  ? 1.4900 2.4897 1.8924 -0.0327 -0.0495 -0.0844 41  GLY A N     
221  C CA    . GLY A 31  ? 1.4929 2.4535 1.8311 -0.0009 -0.0391 -0.0753 41  GLY A CA    
222  C C     . GLY A 31  ? 1.4880 2.3779 1.7936 -0.0083 -0.0223 -0.0600 41  GLY A C     
223  O O     . GLY A 31  ? 1.4904 2.3516 1.7524 0.0149  -0.0090 -0.0465 41  GLY A O     
224  N N     . HIS A 32  ? 1.4835 2.3454 1.8119 -0.0402 -0.0235 -0.0620 42  HIS A N     
225  C CA    . HIS A 32  ? 1.4799 2.2749 1.7775 -0.0472 -0.0101 -0.0499 42  HIS A CA    
226  C C     . HIS A 32  ? 1.4847 2.2344 1.7349 -0.0312 -0.0156 -0.0574 42  HIS A C     
227  O O     . HIS A 32  ? 1.4914 2.2570 1.7403 -0.0235 -0.0324 -0.0751 42  HIS A O     
228  C CB    . HIS A 32  ? 1.4769 2.2544 1.8114 -0.0840 -0.0113 -0.0503 42  HIS A CB    
229  C CG    . HIS A 32  ? 1.4740 2.1879 1.7793 -0.0910 0.0024  -0.0375 42  HIS A CG    
230  N ND1   . HIS A 32  ? 1.4758 2.1425 1.7711 -0.1043 -0.0053 -0.0470 42  HIS A ND1   
231  C CD2   . HIS A 32  ? 1.4713 2.1630 1.7545 -0.0843 0.0222  -0.0173 42  HIS A CD2   
232  C CE1   . HIS A 32  ? 1.4729 2.0921 1.7429 -0.1067 0.0094  -0.0324 42  HIS A CE1   
233  N NE2   . HIS A 32  ? 1.4707 2.1035 1.7326 -0.0947 0.0255  -0.0150 42  HIS A NE2   
234  N N     . LYS A 33  ? 1.4830 2.1789 1.6958 -0.0254 -0.0016 -0.0436 43  LYS A N     
235  C CA    . LYS A 33  ? 1.4878 2.1411 1.6582 -0.0107 -0.0036 -0.0458 43  LYS A CA    
236  C C     . LYS A 33  ? 1.4840 2.0858 1.6501 -0.0323 -0.0031 -0.0475 43  LYS A C     
237  O O     . LYS A 33  ? 1.4785 2.0546 1.6490 -0.0472 0.0083  -0.0362 43  LYS A O     
238  C CB    . LYS A 33  ? 2.0964 2.7274 2.2275 0.0157  0.0105  -0.0290 43  LYS A CB    
239  C CG    . LYS A 33  ? 2.1020 2.7793 2.2355 0.0387  0.0130  -0.0244 43  LYS A CG    
240  C CD    . LYS A 33  ? 2.1107 2.8255 2.2414 0.0576  -0.0011 -0.0362 43  LYS A CD    
241  C CE    . LYS A 33  ? 2.1207 2.7977 2.2099 0.0763  -0.0014 -0.0328 43  LYS A CE    
242  N NZ    . LYS A 33  ? 2.1283 2.7671 2.1847 0.0950  0.0134  -0.0137 43  LYS A NZ    
243  N N     . VAL A 34  ? 1.4889 2.0777 1.6451 -0.0317 -0.0155 -0.0615 44  VAL A N     
244  C CA    . VAL A 34  ? 1.4872 2.0276 1.6359 -0.0483 -0.0157 -0.0638 44  VAL A CA    
245  C C     . VAL A 34  ? 1.4935 2.0084 1.6040 -0.0298 -0.0177 -0.0654 44  VAL A C     
246  O O     . VAL A 34  ? 1.5023 2.0443 1.6017 -0.0096 -0.0263 -0.0732 44  VAL A O     
247  C CB    . VAL A 34  ? 1.4898 2.0396 1.6768 -0.0740 -0.0309 -0.0820 44  VAL A CB    
248  C CG1   . VAL A 34  ? 1.4849 2.0546 1.7135 -0.0963 -0.0259 -0.0750 44  VAL A CG1   
249  C CG2   . VAL A 34  ? 1.5003 2.0899 1.6971 -0.0640 -0.0512 -0.1045 44  VAL A CG2   
250  N N     . ALA A 35  ? 1.4904 1.9561 1.5813 -0.0356 -0.0093 -0.0569 45  ALA A N     
251  C CA    . ALA A 35  ? 1.4965 1.9390 1.5555 -0.0204 -0.0095 -0.0557 45  ALA A CA    
252  C C     . ALA A 35  ? 1.5013 1.9371 1.5667 -0.0308 -0.0229 -0.0742 45  ALA A C     
253  O O     . ALA A 35  ? 1.4971 1.9091 1.5785 -0.0535 -0.0239 -0.0781 45  ALA A O     
254  C CB    . ALA A 35  ? 2.4808 2.8766 2.5174 -0.0197 0.0056  -0.0372 45  ALA A CB    
255  N N     . VAL A 36  ? 1.5130 1.9698 1.5643 -0.0121 -0.0334 -0.0854 46  VAL A N     
256  C CA    . VAL A 36  ? 1.5224 1.9756 1.5760 -0.0165 -0.0481 -0.1061 46  VAL A CA    
257  C C     . VAL A 36  ? 1.5281 1.9568 1.5476 -0.0012 -0.0425 -0.0992 46  VAL A C     
258  O O     . VAL A 36  ? 1.5326 1.9682 1.5266 0.0218  -0.0340 -0.0846 46  VAL A O     
259  C CB    . VAL A 36  ? 1.5363 2.0379 1.6022 -0.0058 -0.0683 -0.1300 46  VAL A CB    
260  C CG1   . VAL A 36  ? 1.5321 2.0575 1.6414 -0.0271 -0.0767 -0.1399 46  VAL A CG1   
261  C CG2   . VAL A 36  ? 1.5438 2.0774 1.5846 0.0260  -0.0654 -0.1219 46  VAL A CG2   
262  N N     . LYS A 37  ? 1.5295 1.9296 1.5505 -0.0141 -0.0464 -0.1079 47  LYS A N     
263  C CA    . LYS A 37  ? 1.5357 1.9177 1.5282 -0.0001 -0.0418 -0.1025 47  LYS A CA    
264  C C     . LYS A 37  ? 1.5547 1.9604 1.5428 0.0126  -0.0604 -0.1283 47  LYS A C     
265  O O     . LYS A 37  ? 1.5606 1.9580 1.5676 -0.0027 -0.0746 -0.1499 47  LYS A O     
266  C CB    . LYS A 37  ? 1.6506 1.9853 1.6439 -0.0190 -0.0329 -0.0941 47  LYS A CB    
267  C CG    . LYS A 37  ? 1.6538 1.9706 1.6199 -0.0051 -0.0236 -0.0815 47  LYS A CG    
268  C CD    . LYS A 37  ? 1.6448 1.9180 1.6139 -0.0236 -0.0167 -0.0752 47  LYS A CD    
269  C CE    . LYS A 37  ? 1.6480 1.9093 1.5949 -0.0101 -0.0077 -0.0622 47  LYS A CE    
270  N NZ    . LYS A 37  ? 1.6406 1.8636 1.5910 -0.0264 -0.0031 -0.0586 47  LYS A NZ    
271  N N     . ILE A 38  ? 1.5676 2.0029 1.5307 0.0423  -0.0609 -0.1261 48  ILE A N     
272  C CA    . ILE A 38  ? 1.5899 2.0542 1.5436 0.0610  -0.0794 -0.1518 48  ILE A CA    
273  C C     . ILE A 38  ? 1.5993 2.0468 1.5271 0.0737  -0.0749 -0.1489 48  ILE A C     
274  O O     . ILE A 38  ? 1.6010 2.0517 1.5030 0.0932  -0.0593 -0.1254 48  ILE A O     
275  C CB    . ILE A 38  ? 1.6036 2.1169 1.5414 0.0913  -0.0836 -0.1520 48  ILE A CB    
276  C CG1   . ILE A 38  ? 1.5937 2.1275 1.5563 0.0815  -0.0859 -0.1516 48  ILE A CG1   
277  C CG2   . ILE A 38  ? 1.6298 2.1762 1.5586 0.1117  -0.1060 -0.1832 48  ILE A CG2   
278  C CD1   . ILE A 38  ? 1.5822 2.1100 1.5334 0.0884  -0.0647 -0.1189 48  ILE A CD1   
279  N N     . LEU A 39  ? 2.0494 2.4801 1.9860 0.0630  -0.0884 -0.1720 49  LEU A N     
280  C CA    . LEU A 39  ? 2.0611 2.4804 1.9738 0.0772  -0.0862 -0.1732 49  LEU A CA    
281  C C     . LEU A 39  ? 2.0911 2.5444 1.9905 0.1027  -0.1080 -0.2045 49  LEU A C     
282  O O     . LEU A 39  ? 2.1035 2.5535 2.0228 0.0919  -0.1301 -0.2364 49  LEU A O     
283  C CB    . LEU A 39  ? 2.2311 2.6034 2.1586 0.0509  -0.0851 -0.1760 49  LEU A CB    
284  C CG    . LEU A 39  ? 2.2045 2.5416 2.1451 0.0257  -0.0663 -0.1492 49  LEU A CG    
285  C CD1   . LEU A 39  ? 2.1953 2.5239 2.1699 -0.0017 -0.0734 -0.1575 49  LEU A CD1   
286  C CD2   . LEU A 39  ? 2.2000 2.4996 2.1345 0.0174  -0.0579 -0.1414 49  LEU A CD2   
287  N N     . ASN A 40  ? 2.1366 2.6224 2.0029 0.1374  -0.1020 -0.1951 50  ASN A N     
288  C CA    . ASN A 40  ? 2.1688 2.6943 2.0160 0.1687  -0.1222 -0.2239 50  ASN A CA    
289  C C     . ASN A 40  ? 2.1871 2.6960 2.0263 0.1732  -0.1339 -0.2473 50  ASN A C     
290  O O     . ASN A 40  ? 2.1811 2.6681 2.0071 0.1740  -0.1178 -0.2287 50  ASN A O     
291  C CB    . ASN A 40  ? 2.6966 3.2628 2.5079 0.2072  -0.1089 -0.2015 50  ASN A CB    
292  C CG    . ASN A 40  ? 2.7332 3.3461 2.5194 0.2451  -0.1292 -0.2305 50  ASN A CG    
293  O OD1   . ASN A 40  ? 2.7518 3.3897 2.5027 0.2793  -0.1197 -0.2178 50  ASN A OD1   
294  N ND2   . ASN A 40  ? 2.7461 3.3726 2.5515 0.2401  -0.1578 -0.2697 50  ASN A ND2   
295  N N     . ARG A 41  ? 2.0750 2.5941 1.9246 0.1761  -0.1632 -0.2890 51  ARG A N     
296  C CA    . ARG A 41  ? 2.0987 2.6007 1.9414 0.1825  -0.1788 -0.3169 51  ARG A CA    
297  C C     . ARG A 41  ? 2.1173 2.6429 1.9150 0.2225  -0.1683 -0.3074 51  ARG A C     
298  O O     . ARG A 41  ? 2.1173 2.6175 1.9064 0.2216  -0.1601 -0.3018 51  ARG A O     
299  C CB    . ARG A 41  ? 2.1600 2.6757 2.0200 0.1849  -0.2151 -0.3656 51  ARG A CB    
300  C CG    . ARG A 41  ? 2.1482 2.6314 2.0596 0.1412  -0.2279 -0.3789 51  ARG A CG    
301  C CD    . ARG A 41  ? 2.1537 2.5839 2.0798 0.1199  -0.2334 -0.3900 51  ARG A CD    
302  N NE    . ARG A 41  ? 2.1636 2.5730 2.1372 0.0891  -0.2575 -0.4176 51  ARG A NE    
303  C CZ    . ARG A 41  ? 2.2016 2.6186 2.1868 0.0975  -0.2914 -0.4623 51  ARG A CZ    
304  N NH1   . ARG A 41  ? 2.2338 2.6805 2.1816 0.1390  -0.3054 -0.4865 51  ARG A NH1   
305  N NH2   . ARG A 41  ? 2.2102 2.6058 2.2455 0.0653  -0.3116 -0.4829 51  ARG A NH2   
306  N N     . GLN A 42  ? 2.3632 2.9399 2.1328 0.2584  -0.1676 -0.3037 52  GLN A N     
307  C CA    . GLN A 42  ? 2.3841 2.9921 2.1104 0.3002  -0.1557 -0.2908 52  GLN A CA    
308  C C     . GLN A 42  ? 2.3600 2.9457 2.0802 0.2919  -0.1225 -0.2457 52  GLN A C     
309  O O     . GLN A 42  ? 2.3733 2.9631 2.0716 0.3114  -0.1151 -0.2411 52  GLN A O     
310  C CB    . GLN A 42  ? 2.4867 3.1526 2.1862 0.3373  -0.1549 -0.2839 52  GLN A CB    
311  C CG    . GLN A 42  ? 2.5248 3.2277 2.2149 0.3635  -0.1895 -0.3324 52  GLN A CG    
312  C CD    . GLN A 42  ? 2.5513 3.3171 2.2015 0.4124  -0.1863 -0.3237 52  GLN A CD    
313  O OE1   . GLN A 42  ? 2.5370 3.3170 2.1761 0.4195  -0.1595 -0.2803 52  GLN A OE1   
314  N NE2   . GLN A 42  ? 2.5934 3.3966 2.2214 0.4479  -0.2142 -0.3650 52  GLN A NE2   
315  N N     . LYS A 43  ? 1.7604 2.3239 1.5017 0.2637  -0.1037 -0.2137 53  LYS A N     
316  C CA    . LYS A 43  ? 1.7378 2.2791 1.4789 0.2532  -0.0741 -0.1714 53  LYS A CA    
317  C C     . LYS A 43  ? 1.7232 2.2156 1.4828 0.2244  -0.0740 -0.1772 53  LYS A C     
318  O O     . LYS A 43  ? 1.7227 2.2092 1.4715 0.2312  -0.0594 -0.1599 53  LYS A O     
319  C CB    . LYS A 43  ? 2.5395 3.0719 2.2960 0.2351  -0.0568 -0.1387 53  LYS A CB    
320  C CG    . LYS A 43  ? 2.5544 3.1328 2.2888 0.2668  -0.0493 -0.1206 53  LYS A CG    
321  C CD    . LYS A 43  ? 2.5317 3.0955 2.2800 0.2507  -0.0303 -0.0852 53  LYS A CD    
322  C CE    . LYS A 43  ? 2.5502 3.1555 2.2735 0.2853  -0.0175 -0.0583 53  LYS A CE    
323  N NZ    . LYS A 43  ? 2.5771 3.2307 2.2818 0.3156  -0.0380 -0.0864 53  LYS A NZ    
324  N N     . ILE A 44  ? 2.8814 3.3413 2.6700 0.1932  -0.0899 -0.2002 54  ILE A N     
325  C CA    . ILE A 44  ? 2.8687 3.2803 2.6758 0.1652  -0.0898 -0.2039 54  ILE A CA    
326  C C     . ILE A 44  ? 2.8971 3.3066 2.6908 0.1820  -0.1063 -0.2344 54  ILE A C     
327  O O     . ILE A 44  ? 2.8920 3.2687 2.6906 0.1700  -0.1021 -0.2323 54  ILE A O     
328  C CB    . ILE A 44  ? 2.8810 3.2593 2.7246 0.1269  -0.0998 -0.2150 54  ILE A CB    
329  C CG1   . ILE A 44  ? 2.9044 3.2957 2.7599 0.1288  -0.1297 -0.2563 54  ILE A CG1   
330  C CG2   . ILE A 44  ? 2.8544 3.2344 2.7095 0.1126  -0.0831 -0.1855 54  ILE A CG2   
331  C CD1   . ILE A 44  ? 2.9195 3.2749 2.7914 0.1138  -0.1487 -0.2861 54  ILE A CD1   
332  N N     . ARG A 45  ? 2.4180 2.8628 2.1936 0.2118  -0.1260 -0.2638 55  ARG A N     
333  C CA    . ARG A 45  ? 2.4515 2.8985 2.2095 0.2347  -0.1434 -0.2955 55  ARG A CA    
334  C C     . ARG A 45  ? 2.4568 2.9223 2.1842 0.2624  -0.1227 -0.2717 55  ARG A C     
335  O O     . ARG A 45  ? 2.4700 2.9190 2.1903 0.2686  -0.1268 -0.2839 55  ARG A O     
336  C CB    . ARG A 45  ? 1.9724 2.4571 1.7165 0.2637  -0.1712 -0.3344 55  ARG A CB    
337  C CG    . ARG A 45  ? 1.9819 2.4436 1.7598 0.2392  -0.2015 -0.3733 55  ARG A CG    
338  C CD    . ARG A 45  ? 2.0136 2.5220 1.7803 0.2675  -0.2265 -0.4057 55  ARG A CD    
339  N NE    . ARG A 45  ? 2.0301 2.5195 1.8321 0.2464  -0.2595 -0.4476 55  ARG A NE    
340  C CZ    . ARG A 45  ? 2.0573 2.5815 1.8616 0.2627  -0.2868 -0.4816 55  ARG A CZ    
341  N NH1   . ARG A 45  ? 2.0715 2.6521 1.8401 0.3029  -0.2845 -0.4785 55  ARG A NH1   
342  N NH2   . ARG A 45  ? 2.0723 2.5758 1.9163 0.2389  -0.3168 -0.5180 55  ARG A NH2   
343  N N     . SER A 46  ? 3.3323 3.8332 3.0434 0.2793  -0.1004 -0.2365 56  SER A N     
344  C CA    . SER A 46  ? 3.3390 3.8662 3.0244 0.3068  -0.0783 -0.2085 56  SER A CA    
345  C C     . SER A 46  ? 3.3175 3.8057 3.0184 0.2832  -0.0640 -0.1909 56  SER A C     
346  O O     . SER A 46  ? 3.3342 3.8256 3.0209 0.3004  -0.0649 -0.1993 56  SER A O     
347  C CB    . SER A 46  ? 2.8833 3.4446 2.5594 0.3189  -0.0543 -0.1667 56  SER A CB    
348  O OG    . SER A 46  ? 2.8911 3.4800 2.5475 0.3437  -0.0313 -0.1352 56  SER A OG    
349  N N     . LEU A 47  ? 2.6985 3.1519 2.4277 0.2457  -0.0514 -0.1673 57  LEU A N     
350  C CA    . LEU A 47  ? 2.6768 3.0897 2.4243 0.2196  -0.0408 -0.1534 57  LEU A CA    
351  C C     . LEU A 47  ? 2.6808 3.0504 2.4439 0.1986  -0.0628 -0.1885 57  LEU A C     
352  O O     . LEU A 47  ? 2.6940 3.0593 2.4629 0.1952  -0.0850 -0.2196 57  LEU A O     
353  C CB    . LEU A 47  ? 1.9948 2.3869 1.7650 0.1899  -0.0211 -0.1175 57  LEU A CB    
354  C CG    . LEU A 47  ? 1.9893 2.4114 1.7523 0.2038  0.0043  -0.0752 57  LEU A CG    
355  C CD1   . LEU A 47  ? 2.0045 2.4677 1.7504 0.2281  0.0035  -0.0718 57  LEU A CD1   
356  C CD2   . LEU A 47  ? 1.9577 2.3457 1.7473 0.1709  0.0204  -0.0452 57  LEU A CD2   
357  N N     . ASP A 48  ? 3.0739 3.4129 2.8452 0.1853  -0.0567 -0.1825 58  ASP A N     
358  C CA    . ASP A 48  ? 3.0772 3.3694 2.8651 0.1635  -0.0736 -0.2083 58  ASP A CA    
359  C C     . ASP A 48  ? 3.0459 3.2976 2.8641 0.1222  -0.0678 -0.1937 58  ASP A C     
360  O O     . ASP A 48  ? 3.0416 3.2527 2.8745 0.1016  -0.0719 -0.1995 58  ASP A O     
361  C CB    . ASP A 48  ? 3.3210 3.6038 3.0983 0.1760  -0.0720 -0.2121 58  ASP A CB    
362  C CG    . ASP A 48  ? 3.3628 3.6656 3.1156 0.2109  -0.0921 -0.2480 58  ASP A CG    
363  O OD1   . ASP A 48  ? 3.3831 3.6741 3.1409 0.2087  -0.1168 -0.2824 58  ASP A OD1   
364  O OD2   . ASP A 48  ? 3.3775 3.7099 3.1070 0.2416  -0.0838 -0.2421 58  ASP A OD2   
365  N N     . VAL A 49  ? 2.3744 2.6393 2.1997 0.1133  -0.0567 -0.1726 59  VAL A N     
366  C CA    . VAL A 49  ? 2.3467 2.5805 2.1973 0.0789  -0.0501 -0.1577 59  VAL A CA    
367  C C     . VAL A 49  ? 2.3519 2.5654 2.2225 0.0592  -0.0695 -0.1834 59  VAL A C     
368  O O     . VAL A 49  ? 2.3320 2.5275 2.2229 0.0337  -0.0649 -0.1725 59  VAL A O     
369  C CB    . VAL A 49  ? 1.9644 2.2191 1.8151 0.0789  -0.0331 -0.1281 59  VAL A CB    
370  C CG1   . VAL A 49  ? 1.9595 2.2309 1.7987 0.0933  -0.0127 -0.0982 59  VAL A CG1   
371  C CG2   . VAL A 49  ? 1.9783 2.2696 1.8199 0.0966  -0.0426 -0.1402 59  VAL A CG2   
372  N N     . VAL A 50  ? 2.4616 2.6807 2.3279 0.0719  -0.0915 -0.2172 60  VAL A N     
373  C CA    . VAL A 50  ? 2.4715 2.6686 2.3631 0.0513  -0.1119 -0.2428 60  VAL A CA    
374  C C     . VAL A 50  ? 2.4570 2.6056 2.3731 0.0180  -0.1076 -0.2337 60  VAL A C     
375  O O     . VAL A 50  ? 2.4516 2.5857 2.3946 -0.0065 -0.1135 -0.2369 60  VAL A O     
376  C CB    . VAL A 50  ? 2.3264 2.5262 2.2112 0.0699  -0.1385 -0.2833 60  VAL A CB    
377  C CG1   . VAL A 50  ? 2.3447 2.5958 2.2051 0.1043  -0.1457 -0.2957 60  VAL A CG1   
378  C CG2   . VAL A 50  ? 2.3412 2.5177 2.2123 0.0803  -0.1389 -0.2891 60  VAL A CG2   
379  N N     . GLY A 51  ? 2.0277 2.1547 1.9349 0.0185  -0.0969 -0.2212 61  GLY A N     
380  C CA    . GLY A 51  ? 2.0150 2.0993 1.9402 -0.0087 -0.0908 -0.2093 61  GLY A CA    
381  C C     . GLY A 51  ? 1.9821 2.0671 1.9141 -0.0245 -0.0706 -0.1777 61  GLY A C     
382  O O     . GLY A 51  ? 1.9714 2.0303 1.9226 -0.0490 -0.0677 -0.1695 61  GLY A O     
383  N N     . LYS A 52  ? 2.5076 2.6223 2.4238 -0.0092 -0.0568 -0.1595 62  LYS A N     
384  C CA    . LYS A 52  ? 2.4810 2.5967 2.4025 -0.0208 -0.0393 -0.1313 62  LYS A CA    
385  C C     . LYS A 52  ? 2.4737 2.5929 2.4125 -0.0363 -0.0429 -0.1329 62  LYS A C     
386  O O     . LYS A 52  ? 2.4563 2.5595 2.4069 -0.0544 -0.0336 -0.1169 62  LYS A O     
387  C CB    . LYS A 52  ? 2.3973 2.5459 2.3013 0.0003  -0.0262 -0.1129 62  LYS A CB    
388  C CG    . LYS A 52  ? 2.3792 2.5163 2.2841 -0.0055 -0.0084 -0.0850 62  LYS A CG    
389  C CD    . LYS A 52  ? 2.3878 2.5351 2.2797 0.0121  -0.0037 -0.0810 62  LYS A CD    
390  C CE    . LYS A 52  ? 2.3709 2.5061 2.2701 0.0033  0.0118  -0.0550 62  LYS A CE    
391  N NZ    . LYS A 52  ? 2.3631 2.4593 2.2738 -0.0176 0.0089  -0.0584 62  LYS A NZ    
392  N N     . ILE A 53  ? 1.8933 2.0368 1.8332 -0.0269 -0.0570 -0.1529 63  ILE A N     
393  C CA    . ILE A 53  ? 1.8887 2.0427 1.8478 -0.0398 -0.0623 -0.1570 63  ILE A CA    
394  C C     . ILE A 53  ? 1.8960 2.0218 1.8825 -0.0644 -0.0739 -0.1707 63  ILE A C     
395  O O     . ILE A 53  ? 1.8849 2.0078 1.8924 -0.0834 -0.0706 -0.1626 63  ILE A O     
396  C CB    . ILE A 53  ? 1.9201 2.1152 1.8716 -0.0191 -0.0743 -0.1739 63  ILE A CB    
397  C CG1   . ILE A 53  ? 1.9172 2.1406 1.8409 0.0073  -0.0612 -0.1566 63  ILE A CG1   
398  C CG2   . ILE A 53  ? 1.9137 2.1247 1.8871 -0.0317 -0.0791 -0.1763 63  ILE A CG2   
399  C CD1   . ILE A 53  ? 1.9392 2.2039 1.8462 0.0357  -0.0733 -0.1744 63  ILE A CD1   
400  N N     . ARG A 54  ? 1.7327 1.8384 1.7197 -0.0628 -0.0869 -0.1902 64  ARG A N     
401  C CA    . ARG A 54  ? 1.7452 1.8194 1.7598 -0.0859 -0.0980 -0.2014 64  ARG A CA    
402  C C     . ARG A 54  ? 1.7268 1.7719 1.7518 -0.1078 -0.0819 -0.1762 64  ARG A C     
403  O O     . ARG A 54  ? 1.7239 1.7628 1.7751 -0.1289 -0.0818 -0.1712 64  ARG A O     
404  C CB    . ARG A 54  ? 2.7799 2.8319 2.7888 -0.0770 -0.1136 -0.2248 64  ARG A CB    
405  C CG    . ARG A 54  ? 2.7961 2.8077 2.8339 -0.1011 -0.1233 -0.2320 64  ARG A CG    
406  C CD    . ARG A 54  ? 2.8275 2.8118 2.8577 -0.0904 -0.1385 -0.2544 64  ARG A CD    
407  N NE    . ARG A 54  ? 2.8309 2.7702 2.8706 -0.1070 -0.1327 -0.2421 64  ARG A NE    
408  C CZ    . ARG A 54  ? 2.8419 2.7531 2.9146 -0.1329 -0.1376 -0.2401 64  ARG A CZ    
409  N NH1   . ARG A 54  ? 2.8491 2.7735 2.9525 -0.1473 -0.1490 -0.2504 64  ARG A NH1   
410  N NH2   . ARG A 54  ? 2.8471 2.7190 2.9235 -0.1439 -0.1308 -0.2263 64  ARG A NH2   
411  N N     . ARG A 55  ? 2.4839 2.5146 2.4890 -0.1014 -0.0686 -0.1603 65  ARG A N     
412  C CA    . ARG A 55  ? 2.4696 2.4736 2.4797 -0.1177 -0.0547 -0.1384 65  ARG A CA    
413  C C     . ARG A 55  ? 2.4488 2.4682 2.4670 -0.1272 -0.0429 -0.1203 65  ARG A C     
414  O O     . ARG A 55  ? 2.4442 2.4475 2.4766 -0.1444 -0.0367 -0.1085 65  ARG A O     
415  C CB    . ARG A 55  ? 2.3429 2.3363 2.3305 -0.1063 -0.0441 -0.1264 65  ARG A CB    
416  C CG    . ARG A 55  ? 2.3264 2.3485 2.2968 -0.0907 -0.0330 -0.1134 65  ARG A CG    
417  C CD    . ARG A 55  ? 2.3158 2.3265 2.2737 -0.0862 -0.0209 -0.0968 65  ARG A CD    
418  N NE    . ARG A 55  ? 2.3282 2.3435 2.2720 -0.0687 -0.0248 -0.1055 65  ARG A NE    
419  C CZ    . ARG A 55  ? 2.3206 2.3407 2.2542 -0.0591 -0.0149 -0.0920 65  ARG A CZ    
420  N NH1   . ARG A 55  ? 2.3020 2.3194 2.2388 -0.0665 -0.0024 -0.0710 65  ARG A NH1   
421  N NH2   . ARG A 55  ? 2.3337 2.3627 2.2554 -0.0416 -0.0181 -0.1002 65  ARG A NH2   
422  N N     . GLU A 56  ? 1.5488 1.6004 1.5568 -0.1138 -0.0396 -0.1178 66  GLU A N     
423  C CA    . GLU A 56  ? 1.5313 1.5983 1.5435 -0.1181 -0.0287 -0.1013 66  GLU A CA    
424  C C     . GLU A 56  ? 1.5346 1.6093 1.5742 -0.1348 -0.0343 -0.1061 66  GLU A C     
425  O O     . GLU A 56  ? 1.5260 1.5924 1.5761 -0.1481 -0.0249 -0.0913 66  GLU A O     
426  C CB    . GLU A 56  ? 1.7856 1.8853 1.7819 -0.0983 -0.0257 -0.0986 66  GLU A CB    
427  C CG    . GLU A 56  ? 1.7716 1.8873 1.7714 -0.0998 -0.0161 -0.0835 66  GLU A CG    
428  C CD    . GLU A 56  ? 1.7710 1.9180 1.7559 -0.0789 -0.0139 -0.0800 66  GLU A CD    
429  O OE1   . GLU A 56  ? 1.7623 1.9215 1.7476 -0.0767 -0.0062 -0.0675 66  GLU A OE1   
430  O OE2   . GLU A 56  ? 1.7818 1.9418 1.7534 -0.0627 -0.0195 -0.0891 66  GLU A OE2   
431  N N     . ILE A 57  ? 1.6513 1.7442 1.7035 -0.1330 -0.0502 -0.1272 67  ILE A N     
432  C CA    . ILE A 57  ? 1.6567 1.7620 1.7414 -0.1496 -0.0578 -0.1334 67  ILE A CA    
433  C C     . ILE A 57  ? 1.6660 1.7384 1.7740 -0.1725 -0.0581 -0.1293 67  ILE A C     
434  O O     . ILE A 57  ? 1.6625 1.7397 1.7950 -0.1893 -0.0527 -0.1180 67  ILE A O     
435  C CB    . ILE A 57  ? 1.7168 1.8477 1.8114 -0.1418 -0.0787 -0.1611 67  ILE A CB    
436  C CG1   . ILE A 57  ? 1.7091 1.8774 1.7807 -0.1177 -0.0765 -0.1612 67  ILE A CG1   
437  C CG2   . ILE A 57  ? 1.7250 1.8679 1.8612 -0.1624 -0.0889 -0.1690 67  ILE A CG2   
438  C CD1   . ILE A 57  ? 1.7276 1.9273 1.8053 -0.1061 -0.0971 -0.1883 67  ILE A CD1   
439  N N     . GLN A 58  ? 2.4416 2.4820 2.5412 -0.1714 -0.0633 -0.1366 68  GLN A N     
440  C CA    . GLN A 58  ? 2.4547 2.4596 2.5732 -0.1903 -0.0633 -0.1312 68  GLN A CA    
441  C C     . GLN A 58  ? 2.4385 2.4345 2.5550 -0.1994 -0.0434 -0.1028 68  GLN A C     
442  O O     . GLN A 58  ? 2.4452 2.4332 2.5873 -0.2177 -0.0399 -0.0920 68  GLN A O     
443  C CB    . GLN A 58  ? 2.3292 2.3019 2.4310 -0.1817 -0.0703 -0.1420 68  GLN A CB    
444  C CG    . GLN A 58  ? 2.3482 2.2806 2.4678 -0.1986 -0.0717 -0.1370 68  GLN A CG    
445  C CD    . GLN A 58  ? 2.3630 2.2645 2.4618 -0.1867 -0.0768 -0.1458 68  GLN A CD    
446  O OE1   . GLN A 58  ? 2.3662 2.2783 2.4443 -0.1670 -0.0846 -0.1626 68  GLN A OE1   
447  N NE2   . GLN A 58  ? 2.3736 2.2395 2.4769 -0.1965 -0.0717 -0.1333 68  GLN A NE2   
448  N N     . ASN A 59  ? 1.7747 1.7733 1.8618 -0.1857 -0.0309 -0.0906 69  ASN A N     
449  C CA    . ASN A 59  ? 1.7618 1.7522 1.8420 -0.1897 -0.0140 -0.0671 69  ASN A CA    
450  C C     . ASN A 59  ? 1.7501 1.7697 1.8418 -0.1937 -0.0059 -0.0560 69  ASN A C     
451  O O     . ASN A 59  ? 1.7514 1.7684 1.8560 -0.2049 0.0030  -0.0409 69  ASN A O     
452  C CB    . ASN A 59  ? 1.6216 1.6039 1.6703 -0.1741 -0.0062 -0.0605 69  ASN A CB    
453  C CG    . ASN A 59  ? 1.6325 1.5899 1.6694 -0.1685 -0.0126 -0.0695 69  ASN A CG    
454  O OD1   . ASN A 59  ? 1.6509 1.5875 1.7003 -0.1771 -0.0206 -0.0771 69  ASN A OD1   
455  N ND2   . ASN A 59  ? 1.6231 1.5828 1.6378 -0.1536 -0.0089 -0.0678 69  ASN A ND2   
456  N N     . LEU A 60  ? 1.5219 1.5714 1.6079 -0.1823 -0.0085 -0.0627 70  LEU A N     
457  C CA    . LEU A 60  ? 1.5113 1.5911 1.6050 -0.1817 -0.0013 -0.0535 70  LEU A CA    
458  C C     . LEU A 60  ? 1.5196 1.6172 1.6503 -0.1991 -0.0053 -0.0545 70  LEU A C     
459  O O     . LEU A 60  ? 1.5126 1.6330 1.6535 -0.2015 0.0036  -0.0421 70  LEU A O     
460  C CB    . LEU A 60  ? 1.5442 1.6517 1.6241 -0.1640 -0.0049 -0.0612 70  LEU A CB    
461  C CG    . LEU A 60  ? 1.5313 1.6394 1.5846 -0.1483 0.0067  -0.0480 70  LEU A CG    
462  C CD1   . LEU A 60  ? 1.5301 1.6614 1.5700 -0.1301 0.0020  -0.0552 70  LEU A CD1   
463  C CD2   . LEU A 60  ? 1.5244 1.6441 1.5826 -0.1502 0.0177  -0.0333 70  LEU A CD2   
464  N N     . LYS A 61  ? 2.2212 2.3090 2.3740 -0.2107 -0.0193 -0.0692 71  LYS A N     
465  C CA    . LYS A 61  ? 2.2326 2.3373 2.4282 -0.2297 -0.0261 -0.0720 71  LYS A CA    
466  C C     . LYS A 61  ? 2.2341 2.3331 2.4476 -0.2451 -0.0110 -0.0471 71  LYS A C     
467  O O     . LYS A 61  ? 2.2305 2.3611 2.4681 -0.2525 -0.0052 -0.0371 71  LYS A O     
468  C CB    . LYS A 61  ? 1.6623 1.7480 1.8778 -0.2390 -0.0459 -0.0939 71  LYS A CB    
469  C CG    . LYS A 61  ? 1.6775 1.7823 1.9432 -0.2592 -0.0579 -0.1018 71  LYS A CG    
470  C CD    . LYS A 61  ? 1.6690 1.8224 1.9430 -0.2510 -0.0660 -0.1147 71  LYS A CD    
471  C CE    . LYS A 61  ? 1.6848 1.8604 2.0141 -0.2726 -0.0795 -0.1236 71  LYS A CE    
472  N NZ    . LYS A 61  ? 1.6765 1.9039 2.0147 -0.2635 -0.0874 -0.1355 71  LYS A NZ    
473  N N     . LEU A 62  ? 1.6335 1.6951 1.8339 -0.2477 -0.0041 -0.0364 72  LEU A N     
474  C CA    . LEU A 62  ? 1.6405 1.6938 1.8549 -0.2601 0.0101  -0.0119 72  LEU A CA    
475  C C     . LEU A 62  ? 1.6248 1.6846 1.8082 -0.2457 0.0283  0.0068  72  LEU A C     
476  O O     . LEU A 62  ? 1.6315 1.6791 1.8119 -0.2485 0.0410  0.0268  72  LEU A O     
477  C CB    . LEU A 62  ? 2.0986 2.1078 2.3168 -0.2696 0.0068  -0.0099 72  LEU A CB    
478  C CG    . LEU A 62  ? 2.1171 2.1204 2.3686 -0.2892 0.0159  0.0128  72  LEU A CG    
479  C CD1   . LEU A 62  ? 2.1238 2.1600 2.4253 -0.3076 0.0104  0.0119  72  LEU A CD1   
480  C CD2   . LEU A 62  ? 2.1421 2.0982 2.3973 -0.2970 0.0102  0.0129  72  LEU A CD2   
481  N N     . PHE A 63  ? 1.5300 1.6059 1.6884 -0.2283 0.0284  -0.0004 73  PHE A N     
482  C CA    . PHE A 63  ? 1.5183 1.5986 1.6484 -0.2131 0.0423  0.0131  73  PHE A CA    
483  C C     . PHE A 63  ? 1.5126 1.6322 1.6542 -0.2104 0.0517  0.0241  73  PHE A C     
484  O O     . PHE A 63  ? 1.5050 1.6541 1.6545 -0.2060 0.0464  0.0150  73  PHE A O     
485  C CB    . PHE A 63  ? 1.6171 1.6903 1.7158 -0.1954 0.0380  0.0019  73  PHE A CB    
486  C CG    . PHE A 63  ? 1.6180 1.6560 1.6905 -0.1891 0.0404  0.0045  73  PHE A CG    
487  C CD1   . PHE A 63  ? 1.6309 1.6409 1.7084 -0.1990 0.0387  0.0064  73  PHE A CD1   
488  C CD2   . PHE A 63  ? 1.6081 1.6408 1.6533 -0.1733 0.0435  0.0051  73  PHE A CD2   
489  C CE1   . PHE A 63  ? 1.6320 1.6130 1.6861 -0.1920 0.0402  0.0083  73  PHE A CE1   
490  C CE2   . PHE A 63  ? 1.6094 1.6128 1.6347 -0.1684 0.0444  0.0067  73  PHE A CE2   
491  C CZ    . PHE A 63  ? 1.6204 1.5998 1.6493 -0.1772 0.0428  0.0080  73  PHE A CZ    
492  N N     . ARG A 64  ? 1.5728 1.6948 1.7134 -0.2106 0.0659  0.0440  74  ARG A N     
493  C CA    . ARG A 64  ? 1.5693 1.7292 1.7149 -0.2033 0.0770  0.0561  74  ARG A CA    
494  C C     . ARG A 64  ? 1.5687 1.7199 1.6778 -0.1835 0.0881  0.0657  74  ARG A C     
495  O O     . ARG A 64  ? 1.5796 1.7149 1.6795 -0.1832 0.0967  0.0790  74  ARG A O     
496  C CB    . ARG A 64  ? 2.4932 2.6757 2.6778 -0.2208 0.0848  0.0730  74  ARG A CB    
497  C CG    . ARG A 64  ? 2.4916 2.7089 2.7183 -0.2349 0.0760  0.0650  74  ARG A CG    
498  C CD    . ARG A 64  ? 2.5060 2.7442 2.7774 -0.2551 0.0843  0.0848  74  ARG A CD    
499  N NE    . ARG A 64  ? 2.5234 2.7234 2.8076 -0.2721 0.0822  0.0905  74  ARG A NE    
500  C CZ    . ARG A 64  ? 2.5324 2.7138 2.8431 -0.2896 0.0655  0.0748  74  ARG A CZ    
501  N NH1   . ARG A 64  ? 2.5253 2.7253 2.8512 -0.2917 0.0490  0.0516  74  ARG A NH1   
502  N NH2   . ARG A 64  ? 2.5516 2.6953 2.8722 -0.3029 0.0642  0.0814  74  ARG A NH2   
503  N N     . HIS A 65  ? 1.7727 1.9335 1.8609 -0.1656 0.0870  0.0584  75  HIS A N     
504  C CA    . HIS A 65  ? 1.7757 1.9290 1.8318 -0.1455 0.0946  0.0640  75  HIS A CA    
505  C C     . HIS A 65  ? 1.7702 1.9514 1.8206 -0.1293 0.0954  0.0603  75  HIS A C     
506  O O     . HIS A 65  ? 1.7612 1.9516 1.8188 -0.1299 0.0869  0.0494  75  HIS A O     
507  C CB    . HIS A 65  ? 1.5064 1.6177 1.5353 -0.1397 0.0881  0.0553  75  HIS A CB    
508  C CG    . HIS A 65  ? 1.5149 1.6113 1.5140 -0.1223 0.0933  0.0596  75  HIS A CG    
509  N ND1   . HIS A 65  ? 1.5172 1.6259 1.5005 -0.1030 0.0958  0.0584  75  HIS A ND1   
510  C CD2   . HIS A 65  ? 1.5242 1.5935 1.5060 -0.1195 0.0945  0.0628  75  HIS A CD2   
511  C CE1   . HIS A 65  ? 1.5287 1.6180 1.4868 -0.0895 0.0974  0.0593  75  HIS A CE1   
512  N NE2   . HIS A 65  ? 1.5324 1.5992 1.4889 -0.0991 0.0967  0.0622  75  HIS A NE2   
513  N N     . PRO A 66  ? 1.5218 1.7166 1.5570 -0.1123 0.1050  0.0690  76  PRO A N     
514  C CA    . PRO A 66  ? 1.5204 1.7396 1.5480 -0.0939 0.1056  0.0655  76  PRO A CA    
515  C C     . PRO A 66  ? 1.5158 1.7098 1.5224 -0.0825 0.0958  0.0523  76  PRO A C     
516  O O     . PRO A 66  ? 1.5122 1.7258 1.5213 -0.0733 0.0930  0.0479  76  PRO A O     
517  C CB    . PRO A 66  ? 1.5240 1.7512 1.5322 -0.0753 0.1165  0.0754  76  PRO A CB    
518  C CG    . PRO A 66  ? 1.5306 1.7646 1.5542 -0.0895 0.1256  0.0904  76  PRO A CG    
519  C CD    . PRO A 66  ? 1.5242 1.7238 1.5557 -0.1100 0.1171  0.0848  76  PRO A CD    
520  N N     . HIS A 67  ? 1.5514 1.7046 1.5393 -0.0823 0.0912  0.0478  77  HIS A N     
521  C CA    . HIS A 67  ? 1.5486 1.6768 1.5213 -0.0741 0.0828  0.0385  77  HIS A CA    
522  C C     . HIS A 67  ? 1.5376 1.6522 1.5192 -0.0878 0.0748  0.0318  77  HIS A C     
523  O O     . HIS A 67  ? 1.5362 1.6325 1.5073 -0.0815 0.0695  0.0273  77  HIS A O     
524  C CB    . HIS A 67  ? 1.5146 1.6094 1.4627 -0.0626 0.0818  0.0369  77  HIS A CB    
525  C CG    . HIS A 67  ? 1.5298 1.6366 1.4645 -0.0454 0.0884  0.0410  77  HIS A CG    
526  N ND1   . HIS A 67  ? 1.5425 1.6348 1.4617 -0.0400 0.0909  0.0432  77  HIS A ND1   
527  C CD2   . HIS A 67  ? 1.5365 1.6714 1.4695 -0.0297 0.0929  0.0431  77  HIS A CD2   
528  C CE1   . HIS A 67  ? 1.5574 1.6686 1.4645 -0.0209 0.0969  0.0460  77  HIS A CE1   
529  N NE2   . HIS A 67  ? 1.5537 1.6906 1.4694 -0.0145 0.0983  0.0460  77  HIS A NE2   
530  N N     . ILE A 68  ? 1.5455 1.6687 1.5470 -0.1056 0.0738  0.0317  78  ILE A N     
531  C CA    . ILE A 68  ? 1.5384 1.6549 1.5486 -0.1158 0.0651  0.0229  78  ILE A CA    
532  C C     . ILE A 68  ? 1.5342 1.6870 1.5651 -0.1188 0.0611  0.0180  78  ILE A C     
533  O O     . ILE A 68  ? 1.5358 1.7145 1.5880 -0.1271 0.0642  0.0218  78  ILE A O     
534  C CB    . ILE A 68  ? 1.4827 1.5790 1.5009 -0.1322 0.0633  0.0226  78  ILE A CB    
535  C CG1   . ILE A 68  ? 1.4875 1.5502 1.4848 -0.1278 0.0658  0.0263  78  ILE A CG1   
536  C CG2   . ILE A 68  ? 1.4788 1.5710 1.5051 -0.1396 0.0533  0.0111  78  ILE A CG2   
537  C CD1   . ILE A 68  ? 1.4837 1.5248 1.4656 -0.1201 0.0603  0.0204  78  ILE A CD1   
538  N N     . ILE A 69  ? 1.4726 1.6300 1.4985 -0.1114 0.0544  0.0103  79  ILE A N     
539  C CA    . ILE A 69  ? 1.4707 1.6652 1.5139 -0.1109 0.0488  0.0037  79  ILE A CA    
540  C C     . ILE A 69  ? 1.4721 1.6737 1.5418 -0.1308 0.0421  -0.0037 79  ILE A C     
541  O O     . ILE A 69  ? 1.4738 1.6549 1.5423 -0.1376 0.0351  -0.0119 79  ILE A O     
542  C CB    . ILE A 69  ? 1.4700 1.6678 1.5000 -0.0972 0.0427  -0.0024 79  ILE A CB    
543  C CG1   . ILE A 69  ? 1.4729 1.6671 1.4832 -0.0777 0.0489  0.0065  79  ILE A CG1   
544  C CG2   . ILE A 69  ? 1.4704 1.7059 1.5182 -0.0975 0.0336  -0.0133 79  ILE A CG2   
545  C CD1   . ILE A 69  ? 1.4750 1.7027 1.4921 -0.0682 0.0523  0.0097  79  ILE A CD1   
546  N N     . LYS A 70  ? 1.7478 1.9802 1.8436 -0.1393 0.0437  -0.0011 80  LYS A N     
547  C CA    . LYS A 70  ? 1.7532 1.9895 1.8808 -0.1611 0.0387  -0.0044 80  LYS A CA    
548  C C     . LYS A 70  ? 1.7554 2.0109 1.8999 -0.1643 0.0227  -0.0232 80  LYS A C     
549  O O     . LYS A 70  ? 1.7528 2.0427 1.9010 -0.1537 0.0187  -0.0286 80  LYS A O     
550  C CB    . LYS A 70  ? 2.1098 2.3743 2.2629 -0.1696 0.0484  0.0093  80  LYS A CB    
551  C CG    . LYS A 70  ? 2.1194 2.3769 2.3043 -0.1938 0.0490  0.0154  80  LYS A CG    
552  C CD    . LYS A 70  ? 2.1247 2.4074 2.3515 -0.2104 0.0351  0.0026  80  LYS A CD    
553  C CE    . LYS A 70  ? 2.1372 2.4213 2.4048 -0.2352 0.0384  0.0143  80  LYS A CE    
554  N NZ    . LYS A 70  ? 2.1364 2.4569 2.4206 -0.2354 0.0545  0.0360  80  LYS A NZ    
555  N N     . LEU A 71  ? 1.4886 1.7222 1.6418 -0.1765 0.0125  -0.0343 81  LEU A N     
556  C CA    . LEU A 71  ? 1.4954 1.7446 1.6621 -0.1773 -0.0052 -0.0558 81  LEU A CA    
557  C C     . LEU A 71  ? 1.5042 1.7785 1.7178 -0.1974 -0.0134 -0.0612 81  LEU A C     
558  O O     . LEU A 71  ? 1.5138 1.7682 1.7501 -0.2172 -0.0136 -0.0574 81  LEU A O     
559  C CB    . LEU A 71  ? 1.5031 1.7165 1.6552 -0.1775 -0.0137 -0.0676 81  LEU A CB    
560  C CG    . LEU A 71  ? 1.5159 1.7400 1.6787 -0.1764 -0.0341 -0.0930 81  LEU A CG    
561  C CD1   . LEU A 71  ? 1.5120 1.7704 1.6589 -0.1546 -0.0384 -0.1007 81  LEU A CD1   
562  C CD2   . LEU A 71  ? 1.5248 1.7118 1.6699 -0.1743 -0.0398 -0.1022 81  LEU A CD2   
563  N N     . TYR A 72  ? 1.5027 1.8214 1.7326 -0.1921 -0.0201 -0.0689 82  TYR A N     
564  C CA    . TYR A 72  ? 1.5105 1.8607 1.7908 -0.2117 -0.0280 -0.0730 82  TYR A CA    
565  C C     . TYR A 72  ? 1.5284 1.8707 1.8350 -0.2251 -0.0506 -0.0978 82  TYR A C     
566  O O     . TYR A 72  ? 1.5410 1.8711 1.8850 -0.2494 -0.0545 -0.0962 82  TYR A O     
567  C CB    . TYR A 72  ? 1.5035 1.9075 1.7929 -0.1997 -0.0286 -0.0740 82  TYR A CB    
568  C CG    . TYR A 72  ? 1.4908 1.9056 1.7610 -0.1870 -0.0077 -0.0507 82  TYR A CG    
569  C CD1   . TYR A 72  ? 1.4898 1.8968 1.7712 -0.1991 0.0087  -0.0289 82  TYR A CD1   
570  C CD2   . TYR A 72  ? 1.4835 1.9156 1.7230 -0.1609 -0.0045 -0.0505 82  TYR A CD2   
571  C CE1   . TYR A 72  ? 1.4822 1.8996 1.7434 -0.1842 0.0262  -0.0105 82  TYR A CE1   
572  C CE2   . TYR A 72  ? 1.4763 1.9149 1.6980 -0.1475 0.0126  -0.0318 82  TYR A CE2   
573  C CZ    . TYR A 72  ? 1.4758 1.9075 1.7076 -0.1586 0.0272  -0.0133 82  TYR A CZ    
574  O OH    . TYR A 72  ? 1.4725 1.9111 1.6841 -0.1423 0.0427  0.0025  82  TYR A OH    
575  N N     . GLN A 73  ? 1.8290 2.1780 2.1159 -0.2079 -0.0659 -0.1202 83  GLN A N     
576  C CA    . GLN A 73  ? 1.8498 2.1903 2.1543 -0.2146 -0.0899 -0.1484 83  GLN A CA    
577  C C     . GLN A 73  ? 1.8533 2.1906 2.1154 -0.1875 -0.0991 -0.1662 83  GLN A C     
578  O O     . GLN A 73  ? 1.8399 2.1902 2.0671 -0.1651 -0.0884 -0.1566 83  GLN A O     
579  C CB    . GLN A 73  ? 1.5776 1.9602 1.9335 -0.2281 -0.1075 -0.1642 83  GLN A CB    
580  C CG    . GLN A 73  ? 1.5744 2.0073 1.9211 -0.2057 -0.1175 -0.1788 83  GLN A CG    
581  C CD    . GLN A 73  ? 1.5865 2.0633 1.9888 -0.2205 -0.1368 -0.1960 83  GLN A CD    
582  O OE1   . GLN A 73  ? 1.6050 2.0689 2.0498 -0.2446 -0.1517 -0.2084 83  GLN A OE1   
583  N NE2   . GLN A 73  ? 1.5781 2.1065 1.9822 -0.2062 -0.1373 -0.1964 83  GLN A NE2   
584  N N     . VAL A 74  ? 1.5777 1.8968 1.8430 -0.1884 -0.1185 -0.1909 84  VAL A N     
585  C CA    . VAL A 74  ? 1.5852 1.9073 1.8119 -0.1607 -0.1281 -0.2087 84  VAL A CA    
586  C C     . VAL A 74  ? 1.6113 1.9549 1.8587 -0.1575 -0.1579 -0.2448 84  VAL A C     
587  O O     . VAL A 74  ? 1.6328 1.9512 1.9038 -0.1723 -0.1741 -0.2629 84  VAL A O     
588  C CB    . VAL A 74  ? 1.5869 1.8618 1.7814 -0.1554 -0.1208 -0.2037 84  VAL A CB    
589  C CG1   . VAL A 74  ? 1.5627 1.8237 1.7294 -0.1506 -0.0943 -0.1723 84  VAL A CG1   
590  C CG2   . VAL A 74  ? 1.6030 1.8385 1.8260 -0.1801 -0.1283 -0.2095 84  VAL A CG2   
591  N N     . ILE A 75  ? 1.6123 2.0020 1.8500 -0.1363 -0.1662 -0.2561 85  ILE A N     
592  C CA    . ILE A 75  ? 1.6389 2.0559 1.8930 -0.1286 -0.1965 -0.2930 85  ILE A CA    
593  C C     . ILE A 75  ? 1.6521 2.0719 1.8568 -0.0937 -0.2033 -0.3083 85  ILE A C     
594  O O     . ILE A 75  ? 1.6368 2.0620 1.7999 -0.0720 -0.1844 -0.2879 85  ILE A O     
595  C CB    . ILE A 75  ? 1.6354 2.1095 1.9148 -0.1263 -0.2041 -0.2980 85  ILE A CB    
596  C CG1   . ILE A 75  ? 1.6169 2.0954 1.9376 -0.1556 -0.1891 -0.2734 85  ILE A CG1   
597  C CG2   . ILE A 75  ? 1.6661 2.1653 1.9747 -0.1253 -0.2391 -0.3391 85  ILE A CG2   
598  C CD1   . ILE A 75  ? 1.6077 2.1444 1.9476 -0.1505 -0.1898 -0.2705 85  ILE A CD1   
599  N N     . SER A 76  ? 1.7237 2.1401 1.9336 -0.0875 -0.2302 -0.3436 86  SER A N     
600  C CA    . SER A 76  ? 1.7403 2.1629 1.9020 -0.0515 -0.2368 -0.3587 86  SER A CA    
601  C C     . SER A 76  ? 1.7770 2.2276 1.9467 -0.0354 -0.2720 -0.4035 86  SER A C     
602  O O     . SER A 76  ? 1.7949 2.2438 2.0122 -0.0574 -0.2952 -0.4278 86  SER A O     
603  C CB    . SER A 76  ? 3.2274 3.5991 3.3660 -0.0524 -0.2271 -0.3514 86  SER A CB    
604  O OG    . SER A 76  ? 3.2607 3.6304 3.3805 -0.0302 -0.2491 -0.3845 86  SER A OG    
605  N N     . THR A 77  ? 2.2465 2.7249 2.3699 0.0043  -0.2755 -0.4132 87  THR A N     
606  C CA    . THR A 77  ? 2.2833 2.7966 2.4030 0.0292  -0.3082 -0.4557 87  THR A CA    
607  C C     . THR A 77  ? 2.3019 2.8204 2.3625 0.0712  -0.3066 -0.4620 87  THR A C     
608  O O     . THR A 77  ? 2.2811 2.7893 2.3061 0.0820  -0.2777 -0.4283 87  THR A O     
609  C CB    . THR A 77  ? 1.7821 2.3543 1.9136 0.0385  -0.3151 -0.4589 87  THR A CB    
610  O OG1   . THR A 77  ? 1.8131 2.4280 1.9122 0.0801  -0.3359 -0.4880 87  THR A OG1   
611  C CG2   . THR A 77  ? 1.7447 2.3284 1.8573 0.0410  -0.2808 -0.4136 87  THR A CG2   
612  N N     . PRO A 78  ? 2.7987 3.3343 2.8499 0.0956  -0.3379 -0.5052 88  PRO A N     
613  C CA    . PRO A 78  ? 2.8216 3.3718 2.8155 0.1407  -0.3379 -0.5133 88  PRO A CA    
614  C C     . PRO A 78  ? 2.8037 3.3918 2.7518 0.1717  -0.3104 -0.4782 88  PRO A C     
615  O O     . PRO A 78  ? 2.8108 3.4005 2.7139 0.2007  -0.2969 -0.4665 88  PRO A O     
616  C CB    . PRO A 78  ? 2.5287 3.1102 2.5270 0.1631  -0.3794 -0.5670 88  PRO A CB    
617  C CG    . PRO A 78  ? 2.5363 3.0864 2.5982 0.1208  -0.4026 -0.5909 88  PRO A CG    
618  C CD    . PRO A 78  ? 2.4905 3.0253 2.5881 0.0798  -0.3762 -0.5501 88  PRO A CD    
619  N N     . SER A 79  ? 2.1114 2.7301 2.0726 0.1661  -0.3022 -0.4608 89  SER A N     
620  C CA    . SER A 79  ? 2.0953 2.7441 2.0183 0.1920  -0.2753 -0.4240 89  SER A CA    
621  C C     . SER A 79  ? 2.0591 2.6675 1.9754 0.1731  -0.2388 -0.3774 89  SER A C     
622  O O     . SER A 79  ? 2.0596 2.6645 1.9376 0.1950  -0.2201 -0.3563 89  SER A O     
623  C CB    . SER A 79  ? 3.2916 3.9842 3.2318 0.1929  -0.2797 -0.4218 89  SER A CB    
624  O OG    . SER A 79  ? 3.2671 3.9389 3.2596 0.1491  -0.2793 -0.4170 89  SER A OG    
625  N N     . ASP A 80  ? 2.4308 3.0118 2.3853 0.1338  -0.2291 -0.3613 90  ASP A N     
626  C CA    . ASP A 80  ? 2.3983 2.9420 2.3483 0.1159  -0.1971 -0.3199 90  ASP A CA    
627  C C     . ASP A 80  ? 2.3761 2.8801 2.3708 0.0707  -0.1940 -0.3142 90  ASP A C     
628  O O     . ASP A 80  ? 2.3794 2.8933 2.4129 0.0514  -0.2112 -0.3329 90  ASP A O     
629  C CB    . ASP A 80  ? 2.9457 3.5157 2.8747 0.1326  -0.1746 -0.2855 90  ASP A CB    
630  C CG    . ASP A 80  ? 2.9585 3.5819 2.8912 0.1506  -0.1900 -0.3004 90  ASP A CG    
631  O OD1   . ASP A 80  ? 2.9560 3.5874 2.9287 0.1285  -0.2065 -0.3193 90  ASP A OD1   
632  O OD2   . ASP A 80  ? 2.9722 3.6318 2.8692 0.1874  -0.1853 -0.2918 90  ASP A OD2   
633  N N     . ILE A 81  ? 1.9118 2.3734 1.9013 0.0551  -0.1718 -0.2874 91  ILE A N     
634  C CA    . ILE A 81  ? 1.8910 2.3151 1.9156 0.0162  -0.1640 -0.2756 91  ILE A CA    
635  C C     . ILE A 81  ? 1.8646 2.3002 1.8985 0.0069  -0.1455 -0.2471 91  ILE A C     
636  O O     . ILE A 81  ? 1.8569 2.3093 1.8626 0.0279  -0.1300 -0.2257 91  ILE A O     
637  C CB    . ILE A 81  ? 1.6438 2.0194 1.6565 0.0064  -0.1490 -0.2600 91  ILE A CB    
638  C CG1   . ILE A 81  ? 1.6708 2.0387 1.6632 0.0248  -0.1632 -0.2839 91  ILE A CG1   
639  C CG2   . ILE A 81  ? 1.6317 1.9698 1.6805 -0.0309 -0.1464 -0.2545 91  ILE A CG2   
640  C CD1   . ILE A 81  ? 1.6977 2.0601 1.7178 0.0149  -0.1929 -0.3225 91  ILE A CD1   
641  N N     . PHE A 82  ? 1.7762 2.2030 1.8498 -0.0234 -0.1467 -0.2456 92  PHE A N     
642  C CA    . PHE A 82  ? 1.7527 2.1887 1.8359 -0.0324 -0.1288 -0.2192 92  PHE A CA    
643  C C     . PHE A 82  ? 1.7354 2.1309 1.8386 -0.0629 -0.1145 -0.2007 92  PHE A C     
644  O O     . PHE A 82  ? 1.7431 2.1144 1.8718 -0.0847 -0.1239 -0.2126 92  PHE A O     
645  C CB    . PHE A 82  ? 1.5958 2.0777 1.7087 -0.0343 -0.1431 -0.2331 92  PHE A CB    
646  C CG    . PHE A 82  ? 1.6137 2.1407 1.7055 -0.0017 -0.1571 -0.2502 92  PHE A CG    
647  C CD1   . PHE A 82  ? 1.6101 2.1524 1.6621 0.0276  -0.1421 -0.2302 92  PHE A CD1   
648  C CD2   . PHE A 82  ? 1.6373 2.1915 1.7500 0.0006  -0.1861 -0.2861 92  PHE A CD2   
649  C CE1   . PHE A 82  ? 1.6295 2.2153 1.6596 0.0604  -0.1538 -0.2434 92  PHE A CE1   
650  C CE2   . PHE A 82  ? 1.6566 2.2553 1.7469 0.0339  -0.2000 -0.3031 92  PHE A CE2   
651  C CZ    . PHE A 82  ? 1.6525 2.2681 1.7000 0.0647  -0.1829 -0.2805 92  PHE A CZ    
652  N N     . MET A 83  ? 1.6748 2.0615 1.7653 -0.0625 -0.0921 -0.1715 93  MET A N     
653  C CA    . MET A 83  ? 1.6601 2.0176 1.7691 -0.0880 -0.0787 -0.1539 93  MET A CA    
654  C C     . MET A 83  ? 1.6454 2.0245 1.7618 -0.0883 -0.0657 -0.1350 93  MET A C     
655  O O     . MET A 83  ? 1.6369 2.0133 1.7260 -0.0722 -0.0513 -0.1167 93  MET A O     
656  C CB    . MET A 83  ? 1.5321 1.8458 1.6150 -0.0876 -0.0641 -0.1379 93  MET A CB    
657  C CG    . MET A 83  ? 1.5469 1.8407 1.6177 -0.0828 -0.0748 -0.1545 93  MET A CG    
658  S SD    . MET A 83  ? 1.5379 1.7929 1.5755 -0.0757 -0.0570 -0.1341 93  MET A SD    
659  C CE    . MET A 83  ? 1.5214 1.7442 1.5756 -0.1016 -0.0420 -0.1134 93  MET A CE    
660  N N     . VAL A 84  ? 1.7680 2.1664 1.9226 -0.1069 -0.0699 -0.1377 94  VAL A N     
661  C CA    . VAL A 84  ? 1.7557 2.1784 1.9174 -0.1050 -0.0572 -0.1201 94  VAL A CA    
662  C C     . VAL A 84  ? 1.7435 2.1316 1.8986 -0.1159 -0.0372 -0.0963 94  VAL A C     
663  O O     . VAL A 84  ? 1.7449 2.1013 1.9105 -0.1348 -0.0360 -0.0949 94  VAL A O     
664  C CB    . VAL A 84  ? 1.5142 1.9786 1.7221 -0.1195 -0.0678 -0.1297 94  VAL A CB    
665  C CG1   . VAL A 84  ? 1.5284 2.0304 1.7430 -0.1068 -0.0901 -0.1560 94  VAL A CG1   
666  C CG2   . VAL A 84  ? 1.5182 1.9626 1.7639 -0.1508 -0.0706 -0.1310 94  VAL A CG2   
667  N N     . MET A 85  ? 1.7401 2.1335 1.8762 -0.1017 -0.0226 -0.0784 95  MET A N     
668  C CA    . MET A 85  ? 1.7318 2.0934 1.8559 -0.1065 -0.0052 -0.0581 95  MET A CA    
669  C C     . MET A 85  ? 1.7268 2.1139 1.8546 -0.0988 0.0056  -0.0444 95  MET A C     
670  O O     . MET A 85  ? 1.7285 2.1563 1.8645 -0.0877 0.0006  -0.0491 95  MET A O     
671  C CB    . MET A 85  ? 1.6777 2.0034 1.7640 -0.0925 0.0015  -0.0507 95  MET A CB    
672  C CG    . MET A 85  ? 1.6828 1.9823 1.7625 -0.0980 -0.0065 -0.0617 95  MET A CG    
673  S SD    . MET A 85  ? 1.6811 1.9469 1.7221 -0.0816 0.0030  -0.0497 95  MET A SD    
674  C CE    . MET A 85  ? 1.6870 1.9258 1.7273 -0.0917 -0.0058 -0.0628 95  MET A CE    
675  N N     . GLU A 86  ? 1.4723 1.8374 1.5929 -0.1025 0.0198  -0.0284 96  GLU A N     
676  C CA    . GLU A 86  ? 1.4708 1.8579 1.5896 -0.0909 0.0304  -0.0161 96  GLU A CA    
677  C C     . GLU A 86  ? 1.4734 1.8541 1.5589 -0.0643 0.0334  -0.0118 96  GLU A C     
678  O O     . GLU A 86  ? 1.4746 1.8161 1.5340 -0.0583 0.0373  -0.0069 96  GLU A O     
679  C CB    . GLU A 86  ? 1.9088 2.2760 2.0273 -0.0994 0.0439  -0.0015 96  GLU A CB    
680  C CG    . GLU A 86  ? 1.9091 2.2237 2.0023 -0.1016 0.0478  0.0023  96  GLU A CG    
681  C CD    . GLU A 86  ? 1.9117 2.2109 1.9957 -0.1006 0.0609  0.0164  96  GLU A CD    
682  O OE1   . GLU A 86  ? 1.9130 2.1843 1.9969 -0.1137 0.0635  0.0199  96  GLU A OE1   
683  O OE2   . GLU A 86  ? 1.9148 2.2305 1.9898 -0.0844 0.0681  0.0233  96  GLU A OE2   
684  N N     . TYR A 87  ? 1.7604 2.1805 1.8494 -0.0487 0.0313  -0.0130 97  TYR A N     
685  C CA    . TYR A 87  ? 1.7671 2.1829 1.8273 -0.0221 0.0342  -0.0070 97  TYR A CA    
686  C C     . TYR A 87  ? 1.7710 2.1742 1.8175 -0.0107 0.0465  0.0063  97  TYR A C     
687  O O     . TYR A 87  ? 1.7691 2.1931 1.8318 -0.0160 0.0522  0.0099  97  TYR A O     
688  C CB    . TYR A 87  ? 1.4875 1.9515 1.5550 -0.0070 0.0256  -0.0145 97  TYR A CB    
689  C CG    . TYR A 87  ? 1.4980 1.9627 1.5391 0.0222  0.0305  -0.0048 97  TYR A CG    
690  C CD1   . TYR A 87  ? 1.5058 1.9372 1.5186 0.0352  0.0321  0.0017  97  TYR A CD1   
691  C CD2   . TYR A 87  ? 1.5024 2.0014 1.5487 0.0372  0.0338  -0.0006 97  TYR A CD2   
692  C CE1   . TYR A 87  ? 1.5194 1.9477 1.5109 0.0613  0.0366  0.0128  97  TYR A CE1   
693  C CE2   . TYR A 87  ? 1.5159 2.0119 1.5378 0.0654  0.0376  0.0084  97  TYR A CE2   
694  C CZ    . TYR A 87  ? 1.5252 1.9838 1.5203 0.0767  0.0388  0.0155  97  TYR A CZ    
695  O OH    . TYR A 87  ? 1.5426 1.9944 1.5160 0.1040  0.0427  0.0267  97  TYR A OH    
696  N N     . VAL A 88  ? 1.4951 1.8642 1.5128 0.0055  0.0504  0.0136  98  VAL A N     
697  C CA    . VAL A 88  ? 1.5043 1.8556 1.5063 0.0196  0.0591  0.0230  98  VAL A CA    
698  C C     . VAL A 88  ? 1.5194 1.8640 1.5002 0.0462  0.0592  0.0290  98  VAL A C     
699  O O     . VAL A 88  ? 1.5228 1.8578 1.4945 0.0515  0.0553  0.0302  98  VAL A O     
700  C CB    . VAL A 88  ? 1.5043 1.8066 1.4947 0.0093  0.0634  0.0264  98  VAL A CB    
701  C CG1   . VAL A 88  ? 1.4944 1.8044 1.5039 -0.0126 0.0659  0.0244  98  VAL A CG1   
702  C CG2   . VAL A 88  ? 1.5033 1.7719 1.4831 0.0048  0.0593  0.0260  98  VAL A CG2   
703  N N     . SER A 89  ? 1.9263 2.2769 1.8993 0.0644  0.0641  0.0336  99  SER A N     
704  C CA    . SER A 89  ? 1.9448 2.2927 1.9005 0.0919  0.0638  0.0397  99  SER A CA    
705  C C     . SER A 89  ? 1.9613 2.2519 1.8955 0.1008  0.0652  0.0475  99  SER A C     
706  O O     . SER A 89  ? 1.9746 2.2553 1.8982 0.1157  0.0638  0.0550  99  SER A O     
707  C CB    . SER A 89  ? 1.5907 1.9706 1.5478 0.1102  0.0675  0.0403  99  SER A CB    
708  O OG    . SER A 89  ? 1.5912 1.9584 1.5474 0.1051  0.0733  0.0399  99  SER A OG    
709  N N     . GLY A 90  ? 2.0308 2.2852 1.9599 0.0925  0.0676  0.0464  100 GLY A N     
710  C CA    . GLY A 90  ? 2.0494 2.2498 1.9629 0.1003  0.0669  0.0516  100 GLY A CA    
711  C C     . GLY A 90  ? 2.0509 2.2236 1.9626 0.0946  0.0650  0.0593  100 GLY A C     
712  O O     . GLY A 90  ? 2.0719 2.2100 1.9749 0.1067  0.0644  0.0679  100 GLY A O     
713  N N     . GLY A 91  ? 1.5854 1.7735 1.5068 0.0769  0.0640  0.0570  101 GLY A N     
714  C CA    . GLY A 91  ? 1.5865 1.7555 1.5061 0.0727  0.0634  0.0651  101 GLY A CA    
715  C C     . GLY A 91  ? 1.5826 1.7099 1.5039 0.0556  0.0633  0.0648  101 GLY A C     
716  O O     . GLY A 91  ? 1.5769 1.6941 1.4999 0.0460  0.0629  0.0566  101 GLY A O     
717  N N     . GLU A 92  ? 1.6425 1.7481 1.5637 0.0530  0.0641  0.0748  102 GLU A N     
718  C CA    . GLU A 92  ? 1.6387 1.7082 1.5643 0.0367  0.0633  0.0746  102 GLU A CA    
719  C C     . GLU A 92  ? 1.6579 1.6857 1.5810 0.0417  0.0611  0.0755  102 GLU A C     
720  O O     . GLU A 92  ? 1.6789 1.6983 1.5966 0.0595  0.0608  0.0807  102 GLU A O     
721  C CB    . GLU A 92  ? 1.8697 1.9343 1.7990 0.0330  0.0655  0.0863  102 GLU A CB    
722  C CG    . GLU A 92  ? 1.8892 1.9577 1.8144 0.0517  0.0693  0.1039  102 GLU A CG    
723  C CD    . GLU A 92  ? 1.8901 1.9588 1.8191 0.0490  0.0737  0.1181  102 GLU A CD    
724  O OE1   . GLU A 92  ? 1.8724 1.9545 1.8038 0.0365  0.0728  0.1104  102 GLU A OE1   
725  O OE2   . GLU A 92  ? 1.9109 1.9669 1.8411 0.0604  0.0784  0.1381  102 GLU A OE2   
726  N N     . LEU A 93  ? 1.5808 1.5827 1.5074 0.0275  0.0582  0.0687  103 LEU A N     
727  C CA    . LEU A 93  ? 1.6004 1.5634 1.5247 0.0318  0.0530  0.0648  103 LEU A CA    
728  C C     . LEU A 93  ? 1.6239 1.5523 1.5556 0.0375  0.0510  0.0778  103 LEU A C     
729  O O     . LEU A 93  ? 1.6492 1.5482 1.5788 0.0488  0.0456  0.0754  103 LEU A O     
730  C CB    . LEU A 93  ? 1.5901 1.5373 1.5166 0.0156  0.0495  0.0545  103 LEU A CB    
731  C CG    . LEU A 93  ? 1.6104 1.5205 1.5332 0.0199  0.0417  0.0455  103 LEU A CG    
732  C CD1   . LEU A 93  ? 1.6224 1.5427 1.5303 0.0373  0.0411  0.0362  103 LEU A CD1   
733  C CD2   . LEU A 93  ? 1.5992 1.4976 1.5249 0.0038  0.0383  0.0375  103 LEU A CD2   
734  N N     . PHE A 94  ? 1.6182 1.5506 1.5597 0.0303  0.0553  0.0918  104 PHE A N     
735  C CA    . PHE A 94  ? 1.6412 1.5445 1.5948 0.0337  0.0557  0.1095  104 PHE A CA    
736  C C     . PHE A 94  ? 1.6660 1.5682 1.6132 0.0557  0.0573  0.1197  104 PHE A C     
737  O O     . PHE A 94  ? 1.6949 1.5615 1.6514 0.0619  0.0547  0.1305  104 PHE A O     
738  C CB    . PHE A 94  ? 2.6855 2.6037 2.6492 0.0242  0.0625  0.1250  104 PHE A CB    
739  C CG    . PHE A 94  ? 2.7058 2.5918 2.6897 0.0197  0.0632  0.1434  104 PHE A CG    
740  C CD1   . PHE A 94  ? 2.7120 2.5622 2.7112 0.0062  0.0552  0.1365  104 PHE A CD1   
741  C CD2   . PHE A 94  ? 2.7205 2.6142 2.7101 0.0291  0.0716  0.1685  104 PHE A CD2   
742  C CE1   . PHE A 94  ? 2.7319 2.5536 2.7563 -0.0004 0.0548  0.1538  104 PHE A CE1   
743  C CE2   . PHE A 94  ? 2.7411 2.6065 2.7545 0.0233  0.0735  0.1890  104 PHE A CE2   
744  C CZ    . PHE A 94  ? 2.7464 2.5755 2.7796 0.0072  0.0646  0.1814  104 PHE A CZ    
745  N N     . ASP A 95  ? 1.8026 1.7438 1.7360 0.0676  0.0609  0.1162  105 ASP A N     
746  C CA    . ASP A 95  ? 1.8254 1.7703 1.7498 0.0911  0.0617  0.1226  105 ASP A CA    
747  C C     . ASP A 95  ? 1.8443 1.7620 1.7626 0.1006  0.0542  0.1086  105 ASP A C     
748  O O     . ASP A 95  ? 1.8760 1.7676 1.7929 0.1176  0.0514  0.1151  105 ASP A O     
749  C CB    . ASP A 95  ? 2.3037 2.3026 2.2171 0.1010  0.0659  0.1197  105 ASP A CB    
750  C CG    . ASP A 95  ? 2.2972 2.3229 2.2118 0.1018  0.0720  0.1347  105 ASP A CG    
751  O OD1   . ASP A 95  ? 2.3144 2.3184 2.2357 0.1037  0.0759  0.1546  105 ASP A OD1   
752  O OD2   . ASP A 95  ? 2.2772 2.3472 2.1871 0.1013  0.0727  0.1267  105 ASP A OD2   
753  N N     . TYR A 96  ? 1.6818 1.6055 1.5958 0.0915  0.0508  0.0897  106 TYR A N     
754  C CA    . TYR A 96  ? 1.7004 1.6039 1.6051 0.1031  0.0437  0.0746  106 TYR A CA    
755  C C     . TYR A 96  ? 1.7268 1.5739 1.6400 0.1000  0.0340  0.0718  106 TYR A C     
756  O O     . TYR A 96  ? 1.7587 1.5775 1.6658 0.1173  0.0263  0.0647  106 TYR A O     
757  C CB    . TYR A 96  ? 1.9575 1.8879 1.8550 0.0950  0.0446  0.0585  106 TYR A CB    
758  C CG    . TYR A 96  ? 1.9775 1.8951 1.8615 0.1104  0.0388  0.0431  106 TYR A CG    
759  C CD1   . TYR A 96  ? 1.9982 1.9259 1.8705 0.1360  0.0388  0.0413  106 TYR A CD1   
760  C CD2   . TYR A 96  ? 1.9775 1.8761 1.8588 0.1020  0.0332  0.0301  106 TYR A CD2   
761  C CE1   . TYR A 96  ? 2.0192 1.9385 1.8768 0.1536  0.0337  0.0265  106 TYR A CE1   
762  C CE2   . TYR A 96  ? 1.9989 1.8894 1.8646 0.1197  0.0278  0.0154  106 TYR A CE2   
763  C CZ    . TYR A 96  ? 2.0199 1.9211 1.8735 0.1458  0.0282  0.0135  106 TYR A CZ    
764  O OH    . TYR A 96  ? 2.0439 1.9399 1.8797 0.1668  0.0230  -0.0018 106 TYR A OH    
765  N N     . ILE A 97  ? 1.7153 1.5472 1.6439 0.0785  0.0330  0.0758  107 ILE A N     
766  C CA    . ILE A 97  ? 1.7396 1.5209 1.6831 0.0723  0.0226  0.0739  107 ILE A CA    
767  C C     . ILE A 97  ? 1.7751 1.5246 1.7302 0.0837  0.0209  0.0904  107 ILE A C     
768  O O     . ILE A 97  ? 1.8104 1.5215 1.7656 0.0964  0.0100  0.0819  107 ILE A O     
769  C CB    . ILE A 97  ? 1.7834 1.5617 1.7449 0.0469  0.0236  0.0788  107 ILE A CB    
770  C CG1   . ILE A 97  ? 1.7549 1.5552 1.7059 0.0361  0.0235  0.0620  107 ILE A CG1   
771  C CG2   . ILE A 97  ? 1.8107 1.5394 1.7950 0.0394  0.0126  0.0798  107 ILE A CG2   
772  C CD1   . ILE A 97  ? 1.7711 1.5458 1.7147 0.0404  0.0113  0.0409  107 ILE A CD1   
773  N N     . CYS A 98  ? 1.7687 1.5347 1.7324 0.0810  0.0315  0.1142  108 CYS A N     
774  C CA    . CYS A 98  ? 1.8027 1.5406 1.7802 0.0901  0.0326  0.1364  108 CYS A CA    
775  C C     . CYS A 98  ? 1.8331 1.5612 1.7947 0.1177  0.0292  0.1330  108 CYS A C     
776  O O     . CYS A 98  ? 1.8738 1.5549 1.8457 0.1265  0.0207  0.1362  108 CYS A O     
777  C CB    . CYS A 98  ? 2.5634 2.3332 2.5464 0.0867  0.0470  0.1631  108 CYS A CB    
778  S SG    . CYS A 98  ? 2.6064 2.3474 2.6071 0.0983  0.0524  0.1981  108 CYS A SG    
779  N N     . LYS A 99  ? 1.8150 1.5875 1.7536 0.1313  0.0349  0.1260  109 LYS A N     
780  C CA    . LYS A 99  ? 1.8404 1.6140 1.7619 0.1598  0.0329  0.1224  109 LYS A CA    
781  C C     . LYS A 99  ? 1.8670 1.6042 1.7818 0.1703  0.0191  0.0991  109 LYS A C     
782  O O     . LYS A 99  ? 1.9070 1.6143 1.8175 0.1923  0.0127  0.0989  109 LYS A O     
783  C CB    . LYS A 99  ? 2.4049 2.2409 2.3078 0.1687  0.0412  0.1175  109 LYS A CB    
784  C CG    . LYS A 99  ? 2.4269 2.2753 2.3124 0.1991  0.0403  0.1138  109 LYS A CG    
785  C CD    . LYS A 99  ? 2.3947 2.3098 2.2688 0.2032  0.0479  0.1091  109 LYS A CD    
786  C CE    . LYS A 99  ? 2.4148 2.3485 2.2733 0.2338  0.0471  0.1043  109 LYS A CE    
787  N NZ    . LYS A 99  ? 2.3835 2.3853 2.2370 0.2356  0.0532  0.0989  109 LYS A NZ    
788  N N     . ASN A 100 ? 1.8475 1.5878 1.7599 0.1567  0.0142  0.0792  110 ASN A N     
789  C CA    . ASN A 100 ? 1.8726 1.5841 1.7749 0.1687  0.0007  0.0547  110 ASN A CA    
790  C C     . ASN A 100 ? 1.8979 1.5519 1.8207 0.1562  -0.0136 0.0488  110 ASN A C     
791  O O     . ASN A 100 ? 1.9215 1.5485 1.8368 0.1653  -0.0277 0.0256  110 ASN A O     
792  C CB    . ASN A 100 ? 2.3164 2.0676 2.2014 0.1658  0.0034  0.0365  110 ASN A CB    
793  C CG    . ASN A 100 ? 2.3435 2.0883 2.2069 0.1918  -0.0051 0.0147  110 ASN A CG    
794  O OD1   . ASN A 100 ? 2.3499 2.0798 2.2073 0.1905  -0.0141 -0.0042 110 ASN A OD1   
795  N ND2   . ASN A 100 ? 2.3621 2.1198 2.2124 0.2182  -0.0025 0.0170  110 ASN A ND2   
796  N N     . GLY A 101 ? 1.8957 1.5329 1.8452 0.1366  -0.0105 0.0695  111 GLY A N     
797  C CA    . GLY A 101 ? 1.9188 1.5053 1.8948 0.1217  -0.0242 0.0656  111 GLY A CA    
798  C C     . GLY A 101 ? 1.8945 1.4875 1.8711 0.1038  -0.0302 0.0463  111 GLY A C     
799  O O     . GLY A 101 ? 1.8557 1.4796 1.8376 0.0839  -0.0202 0.0547  111 GLY A O     
800  N N     . ARG A 102 ? 1.9222 1.4826 1.8946 0.1120  -0.0481 0.0203  112 ARG A N     
801  C CA    . ARG A 102 ? 1.9057 1.4713 1.8744 0.1004  -0.0558 -0.0003 112 ARG A CA    
802  C C     . ARG A 102 ? 1.8996 1.4942 1.8308 0.1209  -0.0553 -0.0218 112 ARG A C     
803  O O     . ARG A 102 ? 1.9270 1.5161 1.8395 0.1475  -0.0589 -0.0306 112 ARG A O     
804  C CB    . ARG A 102 ? 3.3012 2.8121 3.2936 0.0949  -0.0782 -0.0157 112 ARG A CB    
805  C CG    . ARG A 102 ? 3.3076 2.7917 3.3444 0.0707  -0.0790 0.0064  112 ARG A CG    
806  C CD    . ARG A 102 ? 3.3373 2.7974 3.3890 0.0789  -0.0746 0.0300  112 ARG A CD    
807  N NE    . ARG A 102 ? 3.3830 2.8109 3.4181 0.1077  -0.0878 0.0127  112 ARG A NE    
808  C CZ    . ARG A 102 ? 3.4141 2.8210 3.4531 0.1226  -0.0851 0.0290  112 ARG A CZ    
809  N NH1   . ARG A 102 ? 3.4044 2.8209 3.4626 0.1118  -0.0689 0.0645  112 ARG A NH1   
810  N NH2   . ARG A 102 ? 3.4576 2.8346 3.4794 0.1509  -0.0985 0.0102  112 ARG A NH2   
811  N N     . LEU A 103 ? 1.8660 1.4925 1.7869 0.1097  -0.0501 -0.0287 113 LEU A N     
812  C CA    . LEU A 103 ? 1.8603 1.5181 1.7485 0.1275  -0.0474 -0.0448 113 LEU A CA    
813  C C     . LEU A 103 ? 1.8855 1.5196 1.7635 0.1363  -0.0652 -0.0719 113 LEU A C     
814  O O     . LEU A 103 ? 1.8851 1.4972 1.7813 0.1186  -0.0751 -0.0769 113 LEU A O     
815  C CB    . LEU A 103 ? 1.8115 1.5213 1.6936 0.1123  -0.0297 -0.0339 113 LEU A CB    
816  C CG    . LEU A 103 ? 1.7884 1.5373 1.6684 0.1135  -0.0127 -0.0150 113 LEU A CG    
817  C CD1   . LEU A 103 ? 1.8119 1.5708 1.6716 0.1435  -0.0123 -0.0211 113 LEU A CD1   
818  C CD2   . LEU A 103 ? 1.7838 1.5207 1.6875 0.1001  -0.0085 0.0062  113 LEU A CD2   
819  N N     . ASP A 104 ? 1.9087 1.5508 1.7573 0.1653  -0.0693 -0.0894 114 ASP A N     
820  C CA    . ASP A 104 ? 1.9386 1.5623 1.7710 0.1807  -0.0870 -0.1176 114 ASP A CA    
821  C C     . ASP A 104 ? 1.9088 1.5672 1.7280 0.1713  -0.0797 -0.1201 114 ASP A C     
822  O O     . ASP A 104 ? 1.8660 1.5608 1.6896 0.1527  -0.0614 -0.1008 114 ASP A O     
823  C CB    . ASP A 104 ? 2.7192 2.3428 2.5214 0.2196  -0.0930 -0.1350 114 ASP A CB    
824  C CG    . ASP A 104 ? 2.6946 2.3765 2.4738 0.2322  -0.0714 -0.1232 114 ASP A CG    
825  O OD1   . ASP A 104 ? 2.6584 2.3676 2.4509 0.2148  -0.0541 -0.0993 114 ASP A OD1   
826  O OD2   . ASP A 104 ? 2.7133 2.4157 2.4625 0.2602  -0.0722 -0.1381 114 ASP A OD2   
827  N N     . GLU A 105 ? 1.9350 1.5815 1.7372 0.1861  -0.0950 -0.1445 115 GLU A N     
828  C CA    . GLU A 105 ? 1.9131 1.5877 1.7025 0.1791  -0.0899 -0.1467 115 GLU A CA    
829  C C     . GLU A 105 ? 1.8917 1.6214 1.6553 0.1904  -0.0683 -0.1355 115 GLU A C     
830  O O     . GLU A 105 ? 1.8556 1.6159 1.6215 0.1719  -0.0537 -0.1209 115 GLU A O     
831  C CB    . GLU A 105 ? 2.4028 2.0526 2.1778 0.1967  -0.1132 -0.1768 115 GLU A CB    
832  C CG    . GLU A 105 ? 2.4267 2.0227 2.2331 0.1836  -0.1371 -0.1899 115 GLU A CG    
833  C CD    . GLU A 105 ? 2.4556 2.0354 2.2522 0.1941  -0.1599 -0.2189 115 GLU A CD    
834  O OE1   . GLU A 105 ? 2.4685 2.0116 2.2960 0.1777  -0.1790 -0.2284 115 GLU A OE1   
835  O OE2   . GLU A 105 ? 2.4667 2.0729 2.2258 0.2192  -0.1587 -0.2313 115 GLU A OE2   
836  N N     . LYS A 106 ? 3.2144 2.9564 2.9555 0.2207  -0.0667 -0.1420 116 LYS A N     
837  C CA    . LYS A 106 ? 3.1986 2.9961 2.9188 0.2334  -0.0463 -0.1306 116 LYS A CA    
838  C C     . LYS A 106 ? 3.1511 2.9813 2.8920 0.2068  -0.0252 -0.1028 116 LYS A C     
839  O O     . LYS A 106 ? 3.1254 2.9992 2.8617 0.2002  -0.0084 -0.0897 116 LYS A O     
840  C CB    . LYS A 106 ? 2.1534 1.9579 1.8502 0.2714  -0.0487 -0.1415 116 LYS A CB    
841  C CG    . LYS A 106 ? 2.2058 1.9856 1.8753 0.3050  -0.0696 -0.1722 116 LYS A CG    
842  C CD    . LYS A 106 ? 2.2113 2.0365 1.8478 0.3269  -0.0601 -0.1750 116 LYS A CD    
843  C CE    . LYS A 106 ? 2.1972 2.0211 1.8342 0.3091  -0.0627 -0.1760 116 LYS A CE    
844  N NZ    . LYS A 106 ? 2.2309 2.0017 1.8698 0.3128  -0.0916 -0.2041 116 LYS A NZ    
845  N N     . GLU A 107 ? 1.8449 1.6534 1.6095 0.1923  -0.0269 -0.0940 117 GLU A N     
846  C CA    . GLU A 107 ? 1.8048 1.6414 1.5885 0.1697  -0.0102 -0.0707 117 GLU A CA    
847  C C     . GLU A 107 ? 1.7725 1.6044 1.5761 0.1365  -0.0077 -0.0614 117 GLU A C     
848  O O     . GLU A 107 ? 1.7411 1.6078 1.5477 0.1216  0.0060  -0.0494 117 GLU A O     
849  C CB    . GLU A 107 ? 2.1493 1.9686 1.9458 0.1736  -0.0121 -0.0638 117 GLU A CB    
850  C CG    . GLU A 107 ? 2.1128 1.9634 1.9263 0.1552  0.0033  -0.0417 117 GLU A CG    
851  C CD    . GLU A 107 ? 2.0983 2.0044 1.9019 0.1656  0.0183  -0.0347 117 GLU A CD    
852  O OE1   . GLU A 107 ? 2.0718 2.0064 1.8892 0.1532  0.0288  -0.0198 117 GLU A OE1   
853  O OE2   . GLU A 107 ? 2.1148 2.0387 1.8980 0.1870  0.0194  -0.0440 117 GLU A OE2   
854  N N     . SER A 108 ? 1.7822 1.5710 1.6021 0.1250  -0.0213 -0.0665 118 SER A N     
855  C CA    . SER A 108 ? 1.7551 1.5379 1.5953 0.0957  -0.0202 -0.0583 118 SER A CA    
856  C C     . SER A 108 ? 1.7386 1.5436 1.5674 0.0891  -0.0152 -0.0605 118 SER A C     
857  O O     . SER A 108 ? 1.7066 1.5297 1.5463 0.0675  -0.0052 -0.0478 118 SER A O     
858  C CB    . SER A 108 ? 2.1848 1.9191 2.0431 0.0891  -0.0381 -0.0672 118 SER A CB    
859  O OG    . SER A 108 ? 2.2163 1.9306 2.0593 0.1056  -0.0542 -0.0904 118 SER A OG    
860  N N     . ARG A 109 ? 1.7639 1.5671 1.5695 0.1096  -0.0226 -0.0767 119 ARG A N     
861  C CA    . ARG A 109 ? 1.7545 1.5791 1.5460 0.1078  -0.0173 -0.0772 119 ARG A CA    
862  C C     . ARG A 109 ? 1.7267 1.5976 1.5162 0.1015  0.0039  -0.0586 119 ARG A C     
863  O O     . ARG A 109 ? 1.7030 1.5888 1.4984 0.0835  0.0123  -0.0486 119 ARG A O     
864  C CB    . ARG A 109 ? 1.8842 1.7035 1.6468 0.1374  -0.0283 -0.0974 119 ARG A CB    
865  C CG    . ARG A 109 ? 1.8819 1.7189 1.6277 0.1389  -0.0250 -0.0981 119 ARG A CG    
866  C CD    . ARG A 109 ? 1.9228 1.7631 1.6348 0.1746  -0.0338 -0.1169 119 ARG A CD    
867  N NE    . ARG A 109 ? 1.9583 1.7550 1.6697 0.1870  -0.0596 -0.1432 119 ARG A NE    
868  C CZ    . ARG A 109 ? 2.0018 1.7911 1.6872 0.2213  -0.0726 -0.1651 119 ARG A CZ    
869  N NH1   . ARG A 109 ? 2.0138 1.8403 1.6699 0.2481  -0.0601 -0.1618 119 ARG A NH1   
870  N NH2   . ARG A 109 ? 2.0356 1.7811 1.7260 0.2294  -0.0986 -0.1905 119 ARG A NH2   
871  N N     . ARG A 110 ? 1.7315 1.6247 1.5154 0.1163  0.0116  -0.0543 120 ARG A N     
872  C CA    . ARG A 110 ? 1.7081 1.6482 1.4952 0.1108  0.0304  -0.0374 120 ARG A CA    
873  C C     . ARG A 110 ? 1.6720 1.6185 1.4850 0.0800  0.0373  -0.0232 120 ARG A C     
874  O O     . ARG A 110 ? 1.6519 1.6206 1.4708 0.0648  0.0472  -0.0131 120 ARG A O     
875  C CB    . ARG A 110 ? 1.8337 1.7953 1.6150 0.1318  0.0352  -0.0362 120 ARG A CB    
876  C CG    . ARG A 110 ? 1.8106 1.8245 1.6010 0.1255  0.0533  -0.0192 120 ARG A CG    
877  C CD    . ARG A 110 ? 1.8222 1.8592 1.6088 0.1471  0.0570  -0.0185 120 ARG A CD    
878  N NE    . ARG A 110 ? 1.8185 1.8346 1.6183 0.1422  0.0508  -0.0181 120 ARG A NE    
879  C CZ    . ARG A 110 ? 1.7905 1.8243 1.6117 0.1224  0.0571  -0.0060 120 ARG A CZ    
880  N NH1   . ARG A 110 ? 1.7642 1.8335 1.5987 0.1039  0.0682  0.0047  120 ARG A NH1   
881  N NH2   . ARG A 110 ? 1.7918 1.8073 1.6216 0.1220  0.0519  -0.0044 120 ARG A NH2   
882  N N     . LEU A 111 ? 1.6674 1.5933 1.4954 0.0723  0.0318  -0.0222 121 LEU A N     
883  C CA    . LEU A 111 ? 1.6374 1.5722 1.4867 0.0483  0.0378  -0.0099 121 LEU A CA    
884  C C     . LEU A 111 ? 1.6227 1.5434 1.4799 0.0276  0.0354  -0.0094 121 LEU A C     
885  O O     . LEU A 111 ? 1.5991 1.5392 1.4668 0.0103  0.0434  -0.0006 121 LEU A O     
886  C CB    . LEU A 111 ? 1.6412 1.5579 1.5020 0.0488  0.0330  -0.0071 121 LEU A CB    
887  C CG    . LEU A 111 ? 1.6497 1.5861 1.5069 0.0663  0.0373  -0.0036 121 LEU A CG    
888  C CD1   . LEU A 111 ? 1.6592 1.5712 1.5266 0.0684  0.0320  0.0011  121 LEU A CD1   
889  C CD2   . LEU A 111 ? 1.6249 1.6095 1.4893 0.0587  0.0501  0.0063  121 LEU A CD2   
890  N N     . PHE A 112 ? 1.6388 1.5258 1.4920 0.0300  0.0234  -0.0199 122 PHE A N     
891  C CA    . PHE A 112 ? 1.6269 1.5009 1.4878 0.0124  0.0200  -0.0201 122 PHE A CA    
892  C C     . PHE A 112 ? 1.6178 1.5140 1.4692 0.0085  0.0284  -0.0164 122 PHE A C     
893  O O     . PHE A 112 ? 1.5987 1.4982 1.4600 -0.0095 0.0321  -0.0100 122 PHE A O     
894  C CB    . PHE A 112 ? 1.6495 1.4872 1.5090 0.0179  0.0038  -0.0341 122 PHE A CB    
895  C CG    . PHE A 112 ? 1.6388 1.4662 1.5064 0.0021  -0.0004 -0.0351 122 PHE A CG    
896  C CD1   . PHE A 112 ? 1.6216 1.4408 1.5121 -0.0168 -0.0006 -0.0274 122 PHE A CD1   
897  C CD2   . PHE A 112 ? 1.6476 1.4764 1.4989 0.0082  -0.0034 -0.0426 122 PHE A CD2   
898  C CE1   . PHE A 112 ? 1.6125 1.4250 1.5106 -0.0297 -0.0044 -0.0284 122 PHE A CE1   
899  C CE2   . PHE A 112 ? 1.6391 1.4595 1.4972 -0.0046 -0.0077 -0.0435 122 PHE A CE2   
900  C CZ    . PHE A 112 ? 1.6210 1.4333 1.5032 -0.0238 -0.0083 -0.0369 122 PHE A CZ    
901  N N     . GLN A 113 ? 1.6345 1.5459 1.4664 0.0269  0.0318  -0.0193 123 GLN A N     
902  C CA    . GLN A 113 ? 1.6303 1.5659 1.4540 0.0253  0.0422  -0.0113 123 GLN A CA    
903  C C     . GLN A 113 ? 1.6044 1.5680 1.4465 0.0068  0.0552  0.0038  123 GLN A C     
904  O O     . GLN A 113 ? 1.5932 1.5628 1.4415 -0.0077 0.0607  0.0116  123 GLN A O     
905  C CB    . GLN A 113 ? 1.6552 1.6088 1.4554 0.0517  0.0457  -0.0144 123 GLN A CB    
906  C CG    . GLN A 113 ? 1.6855 1.6136 1.4642 0.0720  0.0311  -0.0322 123 GLN A CG    
907  C CD    . GLN A 113 ? 1.7142 1.6588 1.4686 0.1031  0.0323  -0.0386 123 GLN A CD    
908  O OE1   . GLN A 113 ? 1.7106 1.6829 1.4671 0.1095  0.0430  -0.0302 123 GLN A OE1   
909  N NE2   . GLN A 113 ? 1.7447 1.6748 1.4755 0.1247  0.0205  -0.0546 123 GLN A NE2   
910  N N     . GLN A 114 ? 1.5975 1.5770 1.4491 0.0082  0.0588  0.0070  124 GLN A N     
911  C CA    . GLN A 114 ? 1.5761 1.5847 1.4468 -0.0074 0.0684  0.0182  124 GLN A CA    
912  C C     . GLN A 114 ? 1.5565 1.5513 1.4435 -0.0292 0.0649  0.0192  124 GLN A C     
913  O O     . GLN A 114 ? 1.5434 1.5518 1.4431 -0.0450 0.0701  0.0256  124 GLN A O     
914  C CB    . GLN A 114 ? 1.5761 1.6062 1.4513 0.0027  0.0710  0.0194  124 GLN A CB    
915  C CG    . GLN A 114 ? 1.5959 1.6466 1.4555 0.0263  0.0759  0.0191  124 GLN A CG    
916  C CD    . GLN A 114 ? 1.5943 1.6734 1.4609 0.0357  0.0799  0.0219  124 GLN A CD    
917  O OE1   . GLN A 114 ? 1.5779 1.6638 1.4613 0.0239  0.0792  0.0246  124 GLN A OE1   
918  N NE2   . GLN A 114 ? 1.6133 1.7116 1.4657 0.0594  0.0838  0.0209  124 GLN A NE2   
919  N N     . ILE A 115 ? 1.5572 1.5254 1.4453 -0.0293 0.0559  0.0132  125 ILE A N     
920  C CA    . ILE A 115 ? 1.5410 1.4991 1.4430 -0.0463 0.0531  0.0147  125 ILE A CA    
921  C C     . ILE A 115 ? 1.5386 1.4824 1.4391 -0.0566 0.0513  0.0136  125 ILE A C     
922  O O     . ILE A 115 ? 1.5250 1.4732 1.4360 -0.0712 0.0532  0.0167  125 ILE A O     
923  C CB    . ILE A 115 ? 1.5453 1.4812 1.4511 -0.0429 0.0458  0.0123  125 ILE A CB    
924  C CG1   . ILE A 115 ? 1.5516 1.4990 1.4572 -0.0303 0.0475  0.0146  125 ILE A CG1   
925  C CG2   . ILE A 115 ? 1.5296 1.4627 1.4490 -0.0578 0.0451  0.0161  125 ILE A CG2   
926  C CD1   . ILE A 115 ? 1.5592 1.4844 1.4711 -0.0271 0.0418  0.0164  125 ILE A CD1   
927  N N     . LEU A 116 ? 1.5547 1.4814 1.4409 -0.0468 0.0464  0.0078  126 LEU A N     
928  C CA    . LEU A 116 ? 1.5556 1.4689 1.4381 -0.0533 0.0437  0.0064  126 LEU A CA    
929  C C     . LEU A 116 ? 1.5523 1.4844 1.4343 -0.0595 0.0535  0.0154  126 LEU A C     
930  O O     . LEU A 116 ? 1.5477 1.4721 1.4331 -0.0702 0.0535  0.0178  126 LEU A O     
931  C CB    . LEU A 116 ? 1.5770 1.4708 1.4434 -0.0386 0.0345  -0.0036 126 LEU A CB    
932  C CG    . LEU A 116 ? 1.5808 1.4610 1.4417 -0.0422 0.0298  -0.0064 126 LEU A CG    
933  C CD1   . LEU A 116 ? 1.5663 1.4325 1.4444 -0.0575 0.0244  -0.0071 126 LEU A CD1   
934  C CD2   . LEU A 116 ? 1.6058 1.4721 1.4491 -0.0240 0.0194  -0.0187 126 LEU A CD2   
935  N N     . SER A 117 ? 1.5566 1.5136 1.4363 -0.0529 0.0622  0.0215  127 SER A N     
936  C CA    . SER A 117 ? 1.5553 1.5326 1.4413 -0.0609 0.0727  0.0334  127 SER A CA    
937  C C     . SER A 117 ? 1.5369 1.5216 1.4463 -0.0809 0.0739  0.0365  127 SER A C     
938  O O     . SER A 117 ? 1.5356 1.5232 1.4555 -0.0936 0.0779  0.0436  127 SER A O     
939  C CB    . SER A 117 ? 1.5653 1.5727 1.4469 -0.0483 0.0824  0.0407  127 SER A CB    
940  O OG    . SER A 117 ? 1.5554 1.5808 1.4491 -0.0486 0.0831  0.0394  127 SER A OG    
941  N N     . GLY A 118 ? 1.5260 1.5129 1.4433 -0.0821 0.0694  0.0307  128 GLY A N     
942  C CA    . GLY A 118 ? 1.5113 1.5058 1.4473 -0.0969 0.0679  0.0300  128 GLY A CA    
943  C C     . GLY A 118 ? 1.5070 1.4782 1.4445 -0.1067 0.0622  0.0263  128 GLY A C     
944  O O     . GLY A 118 ? 1.5038 1.4769 1.4531 -0.1194 0.0625  0.0275  128 GLY A O     
945  N N     . VAL A 119 ? 1.5090 1.4583 1.4364 -0.1007 0.0563  0.0214  129 VAL A N     
946  C CA    . VAL A 119 ? 1.5047 1.4360 1.4346 -0.1084 0.0511  0.0181  129 VAL A CA    
947  C C     . VAL A 119 ? 1.5134 1.4336 1.4374 -0.1116 0.0524  0.0209  129 VAL A C     
948  O O     . VAL A 119 ? 1.5112 1.4210 1.4395 -0.1195 0.0497  0.0196  129 VAL A O     
949  C CB    . VAL A 119 ? 1.5055 1.4195 1.4317 -0.1024 0.0445  0.0138  129 VAL A CB    
950  C CG1   . VAL A 119 ? 1.5009 1.4240 1.4330 -0.0981 0.0444  0.0146  129 VAL A CG1   
951  C CG2   . VAL A 119 ? 1.5199 1.4203 1.4326 -0.0918 0.0414  0.0110  129 VAL A CG2   
952  N N     . ASP A 120 ? 1.5259 1.4492 1.4384 -0.1032 0.0567  0.0254  130 ASP A N     
953  C CA    . ASP A 120 ? 1.5380 1.4541 1.4431 -0.1036 0.0599  0.0315  130 ASP A CA    
954  C C     . ASP A 120 ? 1.5365 1.4622 1.4581 -0.1178 0.0659  0.0398  130 ASP A C     
955  O O     . ASP A 120 ? 1.5414 1.4531 1.4658 -0.1251 0.0649  0.0423  130 ASP A O     
956  C CB    . ASP A 120 ? 1.7940 1.7169 1.6811 -0.0878 0.0643  0.0356  130 ASP A CB    
957  C CG    . ASP A 120 ? 1.8100 1.7284 1.6869 -0.0852 0.0691  0.0451  130 ASP A CG    
958  O OD1   . ASP A 120 ? 1.8123 1.7110 1.6854 -0.0877 0.0633  0.0421  130 ASP A OD1   
959  O OD2   . ASP A 120 ? 1.8219 1.7583 1.6948 -0.0796 0.0794  0.0571  130 ASP A OD2   
960  N N     . TYR A 121 ? 1.5318 1.4813 1.4662 -0.1213 0.0711  0.0436  131 TYR A N     
961  C CA    . TYR A 121 ? 1.5310 1.4926 1.4882 -0.1366 0.0747  0.0495  131 TYR A CA    
962  C C     . TYR A 121 ? 1.5239 1.4710 1.4918 -0.1477 0.0659  0.0399  131 TYR A C     
963  O O     . TYR A 121 ? 1.5314 1.4698 1.5118 -0.1591 0.0652  0.0426  131 TYR A O     
964  C CB    . TYR A 121 ? 1.5248 1.5178 1.4955 -0.1370 0.0789  0.0513  131 TYR A CB    
965  C CG    . TYR A 121 ? 1.5261 1.5365 1.5258 -0.1535 0.0815  0.0571  131 TYR A CG    
966  C CD1   . TYR A 121 ? 1.5392 1.5622 1.5498 -0.1582 0.0919  0.0736  131 TYR A CD1   
967  C CD2   . TYR A 121 ? 1.5169 1.5331 1.5348 -0.1637 0.0733  0.0463  131 TYR A CD2   
968  C CE1   . TYR A 121 ? 1.5427 1.5811 1.5864 -0.1758 0.0934  0.0797  131 TYR A CE1   
969  C CE2   . TYR A 121 ? 1.5209 1.5522 1.5688 -0.1794 0.0728  0.0487  131 TYR A CE2   
970  C CZ    . TYR A 121 ? 1.5336 1.5749 1.5968 -0.1870 0.0826  0.0656  131 TYR A CZ    
971  O OH    . TYR A 121 ? 1.5396 1.5955 1.6393 -0.2052 0.0811  0.0685  131 TYR A OH    
972  N N     . CYS A 122 ? 1.5122 1.4569 1.4752 -0.1430 0.0593  0.0293  132 CYS A N     
973  C CA    . CYS A 122 ? 1.5066 1.4425 1.4762 -0.1489 0.0515  0.0198  132 CYS A CA    
974  C C     . CYS A 122 ? 1.5140 1.4240 1.4754 -0.1494 0.0484  0.0191  132 CYS A C     
975  O O     . CYS A 122 ? 1.5194 1.4199 1.4894 -0.1571 0.0444  0.0155  132 CYS A O     
976  C CB    . CYS A 122 ? 1.4950 1.4375 1.4601 -0.1411 0.0478  0.0130  132 CYS A CB    
977  S SG    . CYS A 122 ? 1.4882 1.4618 1.4618 -0.1380 0.0502  0.0131  132 CYS A SG    
978  N N     . HIS A 123 ? 1.5165 1.4151 1.4618 -0.1401 0.0489  0.0212  133 HIS A N     
979  C CA    . HIS A 123 ? 1.5235 1.4007 1.4604 -0.1383 0.0451  0.0200  133 HIS A CA    
980  C C     . HIS A 123 ? 1.5395 1.4063 1.4780 -0.1436 0.0487  0.0284  133 HIS A C     
981  O O     . HIS A 123 ? 1.5467 1.3964 1.4853 -0.1459 0.0446  0.0263  133 HIS A O     
982  C CB    . HIS A 123 ? 1.5256 1.3957 1.4470 -0.1268 0.0431  0.0192  133 HIS A CB    
983  C CG    . HIS A 123 ? 1.5139 1.3870 1.4379 -0.1232 0.0383  0.0125  133 HIS A CG    
984  N ND1   . HIS A 123 ? 1.5167 1.3813 1.4338 -0.1152 0.0334  0.0093  133 HIS A ND1   
985  C CD2   . HIS A 123 ? 1.5023 1.3863 1.4365 -0.1262 0.0375  0.0096  133 HIS A CD2   
986  C CE1   . HIS A 123 ? 1.5074 1.3759 1.4333 -0.1153 0.0307  0.0067  133 HIS A CE1   
987  N NE2   . HIS A 123 ? 1.4985 1.3798 1.4329 -0.1208 0.0340  0.0078  133 HIS A NE2   
988  N N     . ARG A 124 ? 1.7266 1.6045 1.6672 -0.1447 0.0569  0.0393  134 ARG A N     
989  C CA    . ARG A 124 ? 1.7450 1.6150 1.6903 -0.1502 0.0626  0.0522  134 ARG A CA    
990  C C     . ARG A 124 ? 1.7479 1.6150 1.7180 -0.1661 0.0598  0.0504  134 ARG A C     
991  O O     . ARG A 124 ? 1.7656 1.6168 1.7433 -0.1727 0.0611  0.0585  134 ARG A O     
992  C CB    . ARG A 124 ? 2.3136 2.2018 2.2555 -0.1453 0.0740  0.0671  134 ARG A CB    
993  C CG    . ARG A 124 ? 2.3283 2.2093 2.2443 -0.1291 0.0772  0.0739  134 ARG A CG    
994  C CD    . ARG A 124 ? 2.3310 2.2344 2.2343 -0.1156 0.0839  0.0783  134 ARG A CD    
995  N NE    . ARG A 124 ? 2.3322 2.2610 2.2538 -0.1230 0.0945  0.0909  134 ARG A NE    
996  C CZ    . ARG A 124 ? 2.3384 2.2918 2.2518 -0.1110 0.1032  0.0987  134 ARG A CZ    
997  N NH1   . ARG A 124 ? 2.3463 2.2991 2.2313 -0.0900 0.1012  0.0932  134 ARG A NH1   
998  N NH2   . ARG A 124 ? 2.3388 2.3188 2.2734 -0.1192 0.1130  0.1111  134 ARG A NH2   
999  N N     . HIS A 125 ? 1.5543 1.4362 1.5371 -0.1711 0.0549  0.0393  135 HIS A N     
1000 C CA    . HIS A 125 ? 1.5587 1.4396 1.5651 -0.1844 0.0486  0.0325  135 HIS A CA    
1001 C C     . HIS A 125 ? 1.5570 1.4217 1.5582 -0.1816 0.0376  0.0166  135 HIS A C     
1002 O O     . HIS A 125 ? 1.5610 1.4258 1.5776 -0.1884 0.0293  0.0052  135 HIS A O     
1003 C CB    . HIS A 125 ? 1.5479 1.4584 1.5711 -0.1896 0.0486  0.0285  135 HIS A CB    
1004 C CG    . HIS A 125 ? 1.5553 1.4838 1.5957 -0.1974 0.0582  0.0441  135 HIS A CG    
1005 N ND1   . HIS A 125 ? 1.5741 1.4946 1.6381 -0.2118 0.0600  0.0540  135 HIS A ND1   
1006 C CD2   . HIS A 125 ? 1.5485 1.5041 1.5878 -0.1923 0.0670  0.0526  135 HIS A CD2   
1007 C CE1   . HIS A 125 ? 1.5773 1.5223 1.6556 -0.2161 0.0707  0.0698  135 HIS A CE1   
1008 N NE2   . HIS A 125 ? 1.5616 1.5293 1.6238 -0.2033 0.0751  0.0684  135 HIS A NE2   
1009 N N     . MET A 126 ? 1.5713 1.4254 1.5517 -0.1702 0.0369  0.0149  136 MET A N     
1010 C CA    . MET A 126 ? 1.5702 1.4128 1.5446 -0.1650 0.0283  0.0025  136 MET A CA    
1011 C C     . MET A 126 ? 1.5569 1.4189 1.5357 -0.1625 0.0230  -0.0102 136 MET A C     
1012 O O     . MET A 126 ? 1.5623 1.4205 1.5442 -0.1610 0.0149  -0.0222 136 MET A O     
1013 C CB    . MET A 126 ? 2.0672 1.8859 2.0494 -0.1704 0.0227  -0.0003 136 MET A CB    
1014 C CG    . MET A 126 ? 2.0852 1.8837 2.0631 -0.1716 0.0285  0.0147  136 MET A CG    
1015 S SD    . MET A 126 ? 2.0810 1.8729 2.0321 -0.1562 0.0310  0.0193  136 MET A SD    
1016 C CE    . MET A 126 ? 2.1105 1.8765 2.0578 -0.1562 0.0353  0.0351  136 MET A CE    
1017 N N     . VAL A 127 ? 1.5233 1.4065 1.5010 -0.1598 0.0273  -0.0074 137 VAL A N     
1018 C CA    . VAL A 127 ? 1.5119 1.4151 1.4903 -0.1542 0.0240  -0.0159 137 VAL A CA    
1019 C C     . VAL A 127 ? 1.4989 1.4109 1.4671 -0.1456 0.0290  -0.0096 137 VAL A C     
1020 O O     . VAL A 127 ? 1.4966 1.4121 1.4627 -0.1455 0.0345  -0.0020 137 VAL A O     
1021 C CB    . VAL A 127 ? 1.9057 1.8293 1.8997 -0.1604 0.0217  -0.0207 137 VAL A CB    
1022 C CG1   . VAL A 127 ? 1.9220 1.8353 1.9307 -0.1693 0.0132  -0.0303 137 VAL A CG1   
1023 C CG2   . VAL A 127 ? 1.9029 1.8371 1.9024 -0.1650 0.0297  -0.0095 137 VAL A CG2   
1024 N N     . VAL A 128 ? 1.4931 1.4085 1.4561 -0.1378 0.0270  -0.0124 138 VAL A N     
1025 C CA    . VAL A 128 ? 1.4846 1.4040 1.4428 -0.1313 0.0307  -0.0055 138 VAL A CA    
1026 C C     . VAL A 128 ? 1.4782 1.4195 1.4389 -0.1256 0.0321  -0.0049 138 VAL A C     
1027 O O     . VAL A 128 ? 1.4792 1.4345 1.4419 -0.1226 0.0291  -0.0112 138 VAL A O     
1028 C CB    . VAL A 128 ? 1.4840 1.3935 1.4389 -0.1269 0.0290  -0.0045 138 VAL A CB    
1029 C CG1   . VAL A 128 ? 1.4913 1.3801 1.4410 -0.1296 0.0278  -0.0036 138 VAL A CG1   
1030 C CG2   . VAL A 128 ? 1.4859 1.4031 1.4419 -0.1229 0.0257  -0.0110 138 VAL A CG2   
1031 N N     . HIS A 129 ? 1.6897 1.6340 1.6492 -0.1221 0.0359  0.0023  139 HIS A N     
1032 C CA    . HIS A 129 ? 1.6863 1.6496 1.6473 -0.1148 0.0380  0.0057  139 HIS A CA    
1033 C C     . HIS A 129 ? 1.6854 1.6439 1.6475 -0.1094 0.0399  0.0140  139 HIS A C     
1034 O O     . HIS A 129 ? 1.6875 1.6327 1.6503 -0.1090 0.0406  0.0192  139 HIS A O     
1035 C CB    . HIS A 129 ? 1.7364 1.7063 1.6972 -0.1137 0.0409  0.0085  139 HIS A CB    
1036 C CG    . HIS A 129 ? 1.7353 1.7261 1.6969 -0.1050 0.0427  0.0119  139 HIS A CG    
1037 N ND1   . HIS A 129 ? 1.7352 1.7367 1.6964 -0.0975 0.0432  0.0154  139 HIS A ND1   
1038 C CD2   . HIS A 129 ? 1.7360 1.7412 1.6980 -0.1006 0.0448  0.0135  139 HIS A CD2   
1039 C CE1   . HIS A 129 ? 1.7369 1.7568 1.6971 -0.0887 0.0453  0.0195  139 HIS A CE1   
1040 N NE2   . HIS A 129 ? 1.7369 1.7590 1.6979 -0.0905 0.0457  0.0176  139 HIS A NE2   
1041 N N     . ARG A 130 ? 1.4698 1.4406 1.4335 -0.1043 0.0403  0.0156  140 ARG A N     
1042 C CA    . ARG A 130 ? 1.4701 1.4376 1.4401 -0.1015 0.0428  0.0258  140 ARG A CA    
1043 C C     . ARG A 130 ? 1.4728 1.4453 1.4479 -0.0960 0.0474  0.0384  140 ARG A C     
1044 O O     . ARG A 130 ? 1.4760 1.4351 1.4608 -0.0980 0.0478  0.0468  140 ARG A O     
1045 C CB    . ARG A 130 ? 1.4761 1.4595 1.4462 -0.0957 0.0436  0.0257  140 ARG A CB    
1046 C CG    . ARG A 130 ? 1.4766 1.4479 1.4459 -0.0998 0.0393  0.0179  140 ARG A CG    
1047 C CD    . ARG A 130 ? 1.4803 1.4492 1.4415 -0.1018 0.0339  0.0031  140 ARG A CD    
1048 N NE    . ARG A 130 ? 1.4851 1.4766 1.4415 -0.0920 0.0325  -0.0031 140 ARG A NE    
1049 C CZ    . ARG A 130 ? 1.4904 1.4931 1.4435 -0.0826 0.0317  -0.0058 140 ARG A CZ    
1050 N NH1   . ARG A 130 ? 1.4896 1.4841 1.4462 -0.0831 0.0328  -0.0017 140 ARG A NH1   
1051 N NH2   . ARG A 130 ? 1.4981 1.5229 1.4440 -0.0708 0.0292  -0.0136 140 ARG A NH2   
1052 N N     . ASP A 131 ? 1.4739 1.4650 1.4440 -0.0889 0.0496  0.0393  141 ASP A N     
1053 C CA    . ASP A 131 ? 1.4798 1.4757 1.4533 -0.0813 0.0544  0.0528  141 ASP A CA    
1054 C C     . ASP A 131 ? 1.4822 1.4652 1.4532 -0.0825 0.0526  0.0498  141 ASP A C     
1055 O O     . ASP A 131 ? 1.4811 1.4779 1.4456 -0.0791 0.0523  0.0443  141 ASP A O     
1056 C CB    . ASP A 131 ? 1.9332 1.9600 1.9004 -0.0689 0.0577  0.0561  141 ASP A CB    
1057 C CG    . ASP A 131 ? 1.9426 1.9760 1.9124 -0.0585 0.0639  0.0736  141 ASP A CG    
1058 O OD1   . ASP A 131 ? 1.9483 1.9622 1.9296 -0.0617 0.0663  0.0859  141 ASP A OD1   
1059 O OD2   . ASP A 131 ? 1.9467 2.0049 1.9080 -0.0465 0.0656  0.0747  141 ASP A OD2   
1060 N N     . LEU A 132 ? 1.4880 1.4468 1.4653 -0.0856 0.0510  0.0537  142 LEU A N     
1061 C CA    . LEU A 132 ? 1.4940 1.4392 1.4665 -0.0839 0.0485  0.0492  142 LEU A CA    
1062 C C     . LEU A 132 ? 1.5076 1.4415 1.4874 -0.0768 0.0495  0.0607  142 LEU A C     
1063 O O     . LEU A 132 ? 1.5137 1.4350 1.5074 -0.0798 0.0491  0.0697  142 LEU A O     
1064 C CB    . LEU A 132 ? 1.4946 1.4187 1.4649 -0.0909 0.0431  0.0395  142 LEU A CB    
1065 C CG    . LEU A 132 ? 1.4914 1.4196 1.4505 -0.0927 0.0426  0.0295  142 LEU A CG    
1066 C CD1   . LEU A 132 ? 1.4821 1.4342 1.4398 -0.0952 0.0454  0.0269  142 LEU A CD1   
1067 C CD2   . LEU A 132 ? 1.4925 1.4038 1.4486 -0.0987 0.0384  0.0230  142 LEU A CD2   
1068 N N     . LYS A 133 ? 1.5144 1.4526 1.4871 -0.0675 0.0506  0.0610  143 LYS A N     
1069 C CA    . LYS A 133 ? 1.5311 1.4582 1.5096 -0.0584 0.0517  0.0728  143 LYS A CA    
1070 C C     . LYS A 133 ? 1.5377 1.4720 1.5045 -0.0466 0.0520  0.0689  143 LYS A C     
1071 O O     . LYS A 133 ? 1.5266 1.4847 1.4842 -0.0458 0.0535  0.0610  143 LYS A O     
1072 C CB    . LYS A 133 ? 1.8773 1.8204 1.8635 -0.0543 0.0586  0.0902  143 LYS A CB    
1073 C CG    . LYS A 133 ? 1.8664 1.8459 1.8414 -0.0484 0.0630  0.0886  143 LYS A CG    
1074 C CD    . LYS A 133 ? 1.8716 1.8693 1.8512 -0.0411 0.0702  0.1064  143 LYS A CD    
1075 C CE    . LYS A 133 ? 1.8641 1.8992 1.8307 -0.0328 0.0719  0.1010  143 LYS A CE    
1076 N NZ    . LYS A 133 ? 1.8705 1.9269 1.8381 -0.0233 0.0791  0.1171  143 LYS A NZ    
1077 N N     . PRO A 134 ? 1.5577 1.4715 1.5269 -0.0373 0.0498  0.0740  144 PRO A N     
1078 C CA    . PRO A 134 ? 1.5668 1.4887 1.5244 -0.0229 0.0503  0.0711  144 PRO A CA    
1079 C C     . PRO A 134 ? 1.5613 1.5172 1.5145 -0.0143 0.0569  0.0794  144 PRO A C     
1080 O O     . PRO A 134 ? 1.5603 1.5371 1.5043 -0.0050 0.0578  0.0741  144 PRO A O     
1081 C CB    . PRO A 134 ? 1.5941 1.4815 1.5581 -0.0144 0.0456  0.0765  144 PRO A CB    
1082 C CG    . PRO A 134 ? 1.5980 1.4687 1.5814 -0.0246 0.0457  0.0891  144 PRO A CG    
1083 C CD    . PRO A 134 ? 1.5757 1.4568 1.5608 -0.0397 0.0457  0.0820  144 PRO A CD    
1084 N N     . GLU A 135 ? 1.6188 1.5834 1.5789 -0.0161 0.0613  0.0922  145 GLU A N     
1085 C CA    . GLU A 135 ? 1.6154 1.6153 1.5693 -0.0060 0.0664  0.0988  145 GLU A CA    
1086 C C     . GLU A 135 ? 1.5948 1.6250 1.5432 -0.0127 0.0647  0.0838  145 GLU A C     
1087 O O     . GLU A 135 ? 1.5923 1.6551 1.5352 -0.0040 0.0658  0.0832  145 GLU A O     
1088 C CB    . GLU A 135 ? 2.4417 2.4442 2.4032 -0.0036 0.0723  0.1182  145 GLU A CB    
1089 C CG    . GLU A 135 ? 2.4663 2.4396 2.4386 0.0023  0.0745  0.1370  145 GLU A CG    
1090 C CD    . GLU A 135 ? 2.4719 2.4403 2.4602 -0.0031 0.0804  0.1567  145 GLU A CD    
1091 O OE1   . GLU A 135 ? 2.4917 2.4598 2.4858 0.0077  0.0872  0.1796  145 GLU A OE1   
1092 O OE2   . GLU A 135 ? 2.4581 2.4242 2.4542 -0.0174 0.0789  0.1509  145 GLU A OE2   
1093 N N     . ASN A 136 ? 1.5232 1.5418 1.4743 -0.0276 0.0612  0.0719  146 ASN A N     
1094 C CA    . ASN A 136 ? 1.5076 1.5479 1.4570 -0.0361 0.0588  0.0578  146 ASN A CA    
1095 C C     . ASN A 136 ? 1.5039 1.5485 1.4518 -0.0392 0.0569  0.0471  146 ASN A C     
1096 O O     . ASN A 136 ? 1.4938 1.5576 1.4449 -0.0470 0.0552  0.0376  146 ASN A O     
1097 C CB    . ASN A 136 ? 1.5868 1.6151 1.5406 -0.0499 0.0572  0.0537  146 ASN A CB    
1098 C CG    . ASN A 136 ? 1.5845 1.6319 1.5383 -0.0469 0.0585  0.0571  146 ASN A CG    
1099 O OD1   . ASN A 136 ? 1.5896 1.6614 1.5389 -0.0343 0.0603  0.0620  146 ASN A OD1   
1100 N ND2   . ASN A 136 ? 1.5789 1.6172 1.5360 -0.0559 0.0574  0.0544  146 ASN A ND2   
1101 N N     . VAL A 137 ? 1.5147 1.5426 1.4589 -0.0324 0.0572  0.0488  147 VAL A N     
1102 C CA    . VAL A 137 ? 1.5136 1.5496 1.4550 -0.0324 0.0572  0.0408  147 VAL A CA    
1103 C C     . VAL A 137 ? 1.5231 1.5775 1.4603 -0.0159 0.0589  0.0432  147 VAL A C     
1104 O O     . VAL A 137 ? 1.5391 1.5771 1.4714 -0.0027 0.0587  0.0497  147 VAL A O     
1105 C CB    . VAL A 137 ? 1.5205 1.5258 1.4574 -0.0355 0.0552  0.0370  147 VAL A CB    
1106 C CG1   . VAL A 137 ? 1.5106 1.5031 1.4514 -0.0511 0.0534  0.0337  147 VAL A CG1   
1107 C CG2   . VAL A 137 ? 1.5390 1.5144 1.4731 -0.0252 0.0523  0.0416  147 VAL A CG2   
1108 N N     . LEU A 138 ? 1.5151 1.6038 1.4566 -0.0167 0.0601  0.0381  148 LEU A N     
1109 C CA    . LEU A 138 ? 1.5221 1.6374 1.4619 -0.0008 0.0617  0.0397  148 LEU A CA    
1110 C C     . LEU A 138 ? 1.5308 1.6459 1.4653 0.0073  0.0641  0.0374  148 LEU A C     
1111 O O     . LEU A 138 ? 1.5319 1.6271 1.4629 0.0008  0.0644  0.0343  148 LEU A O     
1112 C CB    . LEU A 138 ? 1.5101 1.6687 1.4615 -0.0056 0.0604  0.0349  148 LEU A CB    
1113 C CG    . LEU A 138 ? 1.5035 1.6687 1.4582 -0.0112 0.0567  0.0335  148 LEU A CG    
1114 C CD1   . LEU A 138 ? 1.4925 1.6926 1.4627 -0.0224 0.0522  0.0228  148 LEU A CD1   
1115 C CD2   . LEU A 138 ? 1.5149 1.6876 1.4609 0.0078  0.0571  0.0420  148 LEU A CD2   
1116 N N     . LEU A 139 ? 1.5387 1.6792 1.4712 0.0238  0.0657  0.0387  149 LEU A N     
1117 C CA    . LEU A 139 ? 1.5489 1.6980 1.4755 0.0358  0.0689  0.0366  149 LEU A CA    
1118 C C     . LEU A 139 ? 1.5435 1.7446 1.4806 0.0417  0.0719  0.0366  149 LEU A C     
1119 O O     . LEU A 139 ? 1.5445 1.7654 1.4840 0.0508  0.0699  0.0386  149 LEU A O     
1120 C CB    . LEU A 139 ? 1.5739 1.6917 1.4843 0.0571  0.0665  0.0380  149 LEU A CB    
1121 C CG    . LEU A 139 ? 1.5845 1.6501 1.4886 0.0531  0.0615  0.0376  149 LEU A CG    
1122 C CD1   . LEU A 139 ? 1.5874 1.6359 1.4956 0.0521  0.0594  0.0465  149 LEU A CD1   
1123 C CD2   . LEU A 139 ? 1.6113 1.6499 1.5010 0.0717  0.0579  0.0321  149 LEU A CD2   
1124 N N     . ASP A 140 ? 1.5393 1.7652 1.4840 0.0374  0.0769  0.0355  150 ASP A N     
1125 C CA    . ASP A 140 ? 1.5347 1.8143 1.4948 0.0419  0.0800  0.0364  150 ASP A CA    
1126 C C     . ASP A 140 ? 1.5537 1.8437 1.5000 0.0708  0.0821  0.0380  150 ASP A C     
1127 O O     . ASP A 140 ? 1.5718 1.8234 1.4973 0.0865  0.0796  0.0375  150 ASP A O     
1128 C CB    . ASP A 140 ? 1.5253 1.8306 1.5033 0.0256  0.0862  0.0384  150 ASP A CB    
1129 C CG    . ASP A 140 ? 1.5372 1.8213 1.4990 0.0320  0.0922  0.0409  150 ASP A CG    
1130 O OD1   . ASP A 140 ? 1.5548 1.8104 1.4927 0.0521  0.0903  0.0383  150 ASP A OD1   
1131 O OD2   . ASP A 140 ? 1.5319 1.8281 1.5052 0.0180  0.0981  0.0453  150 ASP A OD2   
1132 N N     . ALA A 141 ? 1.5516 1.8936 1.5115 0.0779  0.0859  0.0394  151 ALA A N     
1133 C CA    . ALA A 141 ? 1.5704 1.9291 1.5180 0.1076  0.0881  0.0406  151 ALA A CA    
1134 C C     . ALA A 141 ? 1.5899 1.9244 1.5163 0.1233  0.0921  0.0397  151 ALA A C     
1135 O O     . ALA A 141 ? 1.6128 1.9389 1.5208 0.1509  0.0909  0.0379  151 ALA A O     
1136 C CB    . ALA A 141 ? 2.5513 2.9773 2.5225 0.1097  0.0920  0.0426  151 ALA A CB    
1137 N N     . HIS A 142 ? 1.5838 1.9069 1.5117 0.1075  0.0959  0.0401  152 HIS A N     
1138 C CA    . HIS A 142 ? 1.6037 1.9068 1.5099 0.1229  0.0989  0.0378  152 HIS A CA    
1139 C C     . HIS A 142 ? 1.6158 1.8536 1.5020 0.1230  0.0901  0.0309  152 HIS A C     
1140 O O     . HIS A 142 ? 1.6334 1.8482 1.5011 0.1337  0.0894  0.0258  152 HIS A O     
1141 C CB    . HIS A 142 ? 2.1574 2.4875 2.0752 0.1088  0.1087  0.0442  152 HIS A CB    
1142 C CG    . HIS A 142 ? 2.1466 2.5427 2.0913 0.1053  0.1176  0.0530  152 HIS A CG    
1143 N ND1   . HIS A 142 ? 2.1245 2.5476 2.1004 0.0824  0.1157  0.0554  152 HIS A ND1   
1144 C CD2   . HIS A 142 ? 2.1567 2.5993 2.1038 0.1222  0.1280  0.0596  152 HIS A CD2   
1145 C CE1   . HIS A 142 ? 2.1207 2.6035 2.1206 0.0830  0.1237  0.0630  152 HIS A CE1   
1146 N NE2   . HIS A 142 ? 2.1392 2.6364 2.1225 0.1069  0.1324  0.0672  152 HIS A NE2   
1147 N N     . MET A 143 ? 1.6075 1.8191 1.4988 0.1114  0.0833  0.0309  153 MET A N     
1148 C CA    . MET A 143 ? 1.6169 1.7703 1.4970 0.1077  0.0751  0.0268  153 MET A CA    
1149 C C     . MET A 143 ? 1.6100 1.7432 1.4887 0.0906  0.0752  0.0240  153 MET A C     
1150 O O     . MET A 143 ? 1.6272 1.7203 1.4915 0.0968  0.0690  0.0172  153 MET A O     
1151 C CB    . MET A 143 ? 2.1731 2.2942 2.0330 0.1356  0.0688  0.0209  153 MET A CB    
1152 C CG    . MET A 143 ? 2.1839 2.3108 2.0440 0.1523  0.0670  0.0254  153 MET A CG    
1153 S SD    . MET A 143 ? 2.1737 2.2747 2.0453 0.1359  0.0628  0.0342  153 MET A SD    
1154 C CE    . MET A 143 ? 2.1769 2.3178 2.0513 0.1543  0.0655  0.0420  153 MET A CE    
1155 N N     . ASN A 144 ? 1.5871 1.7480 1.4823 0.0693  0.0812  0.0287  154 ASN A N     
1156 C CA    . ASN A 144 ? 1.5791 1.7217 1.4752 0.0510  0.0815  0.0282  154 ASN A CA    
1157 C C     . ASN A 144 ? 1.5655 1.6796 1.4697 0.0319  0.0753  0.0277  154 ASN A C     
1158 O O     . ASN A 144 ? 1.5658 1.6720 1.4721 0.0353  0.0712  0.0285  154 ASN A O     
1159 C CB    . ASN A 144 ? 1.6700 1.8532 1.5822 0.0374  0.0911  0.0355  154 ASN A CB    
1160 C CG    . ASN A 144 ? 1.6848 1.9001 1.5893 0.0567  0.0998  0.0391  154 ASN A CG    
1161 O OD1   . ASN A 144 ? 1.7073 1.9047 1.5878 0.0785  0.0979  0.0335  154 ASN A OD1   
1162 N ND2   . ASN A 144 ? 1.6742 1.9389 1.6006 0.0492  0.1087  0.0482  154 ASN A ND2   
1163 N N     . ALA A 145 ? 1.5556 1.6563 1.4637 0.0137  0.0753  0.0276  155 ALA A N     
1164 C CA    . ALA A 145 ? 1.5435 1.6207 1.4590 -0.0030 0.0700  0.0270  155 ALA A CA    
1165 C C     . ALA A 145 ? 1.5234 1.6261 1.4580 -0.0227 0.0726  0.0296  155 ALA A C     
1166 O O     . ALA A 145 ? 1.5190 1.6425 1.4622 -0.0310 0.0779  0.0323  155 ALA A O     
1167 C CB    . ALA A 145 ? 3.4889 3.5289 3.3951 -0.0078 0.0657  0.0230  155 ALA A CB    
1168 N N     . LYS A 146 ? 1.5142 1.6167 1.4565 -0.0289 0.0686  0.0292  156 LYS A N     
1169 C CA    . LYS A 146 ? 1.4991 1.6201 1.4584 -0.0464 0.0676  0.0277  156 LYS A CA    
1170 C C     . LYS A 146 ? 1.4936 1.5920 1.4520 -0.0541 0.0624  0.0257  156 LYS A C     
1171 O O     . LYS A 146 ? 1.4961 1.5928 1.4506 -0.0453 0.0603  0.0277  156 LYS A O     
1172 C CB    . LYS A 146 ? 1.4949 1.6576 1.4669 -0.0425 0.0676  0.0271  156 LYS A CB    
1173 C CG    . LYS A 146 ? 1.4990 1.6937 1.4771 -0.0356 0.0736  0.0301  156 LYS A CG    
1174 C CD    . LYS A 146 ? 1.4913 1.7093 1.4920 -0.0544 0.0763  0.0312  156 LYS A CD    
1175 C CE    . LYS A 146 ? 1.4951 1.7540 1.5068 -0.0474 0.0834  0.0369  156 LYS A CE    
1176 N NZ    . LYS A 146 ? 1.4906 1.7723 1.5296 -0.0673 0.0874  0.0417  156 LYS A NZ    
1177 N N     . ILE A 147 ? 1.4879 1.5715 1.4501 -0.0691 0.0611  0.0233  157 ILE A N     
1178 C CA    . ILE A 147 ? 1.4830 1.5503 1.4453 -0.0755 0.0568  0.0213  157 ILE A CA    
1179 C C     . ILE A 147 ? 1.4764 1.5700 1.4498 -0.0798 0.0530  0.0161  157 ILE A C     
1180 O O     . ILE A 147 ? 1.4731 1.5844 1.4602 -0.0901 0.0516  0.0113  157 ILE A O     
1181 C CB    . ILE A 147 ? 1.4815 1.5244 1.4429 -0.0877 0.0559  0.0195  157 ILE A CB    
1182 C CG1   . ILE A 147 ? 1.4904 1.5061 1.4393 -0.0811 0.0566  0.0219  157 ILE A CG1   
1183 C CG2   . ILE A 147 ? 1.4763 1.5107 1.4401 -0.0936 0.0516  0.0165  157 ILE A CG2   
1184 C CD1   . ILE A 147 ? 1.4907 1.4837 1.4369 -0.0902 0.0550  0.0202  157 ILE A CD1   
1185 N N     . ALA A 148 ? 1.4773 1.5738 1.4459 -0.0714 0.0508  0.0173  158 ALA A N     
1186 C CA    . ALA A 148 ? 1.4755 1.6023 1.4506 -0.0690 0.0461  0.0110  158 ALA A CA    
1187 C C     . ALA A 148 ? 1.4737 1.5965 1.4496 -0.0748 0.0408  0.0041  158 ALA A C     
1188 O O     . ALA A 148 ? 1.4721 1.6021 1.4592 -0.0860 0.0351  -0.0066 158 ALA A O     
1189 C CB    . ALA A 148 ? 2.9402 3.0821 2.9072 -0.0504 0.0477  0.0178  158 ALA A CB    
1190 N N     . ASP A 149 ? 1.8308 1.9426 1.7964 -0.0665 0.0426  0.0107  159 ASP A N     
1191 C CA    . ASP A 149 ? 1.8321 1.9487 1.7953 -0.0654 0.0383  0.0049  159 ASP A CA    
1192 C C     . ASP A 149 ? 1.8289 1.9230 1.7960 -0.0798 0.0356  -0.0018 159 ASP A C     
1193 O O     . ASP A 149 ? 1.8266 1.8946 1.7920 -0.0855 0.0397  0.0048  159 ASP A O     
1194 C CB    . ASP A 149 ? 1.7766 1.8904 1.7298 -0.0521 0.0437  0.0184  159 ASP A CB    
1195 C CG    . ASP A 149 ? 1.7813 1.9131 1.7289 -0.0437 0.0404  0.0137  159 ASP A CG    
1196 O OD1   . ASP A 149 ? 1.7810 1.9190 1.7319 -0.0498 0.0323  -0.0027 159 ASP A OD1   
1197 O OD2   . ASP A 149 ? 1.7882 1.9279 1.7282 -0.0299 0.0460  0.0270  159 ASP A OD2   
1198 N N     . PHE A 150 ? 1.4768 1.5802 1.4502 -0.0853 0.0276  -0.0162 160 PHE A N     
1199 C CA    . PHE A 150 ? 1.4779 1.5593 1.4529 -0.0952 0.0243  -0.0225 160 PHE A CA    
1200 C C     . PHE A 150 ? 1.4846 1.5718 1.4521 -0.0864 0.0192  -0.0302 160 PHE A C     
1201 O O     . PHE A 150 ? 1.4885 1.5599 1.4577 -0.0929 0.0146  -0.0384 160 PHE A O     
1202 C CB    . PHE A 150 ? 1.4798 1.5566 1.4701 -0.1110 0.0193  -0.0316 160 PHE A CB    
1203 C CG    . PHE A 150 ? 1.4757 1.5328 1.4683 -0.1205 0.0266  -0.0212 160 PHE A CG    
1204 C CD1   . PHE A 150 ? 1.4765 1.5050 1.4643 -0.1263 0.0286  -0.0180 160 PHE A CD1   
1205 C CD2   . PHE A 150 ? 1.4728 1.5427 1.4699 -0.1203 0.0317  -0.0146 160 PHE A CD2   
1206 C CE1   . PHE A 150 ? 1.4758 1.4889 1.4623 -0.1313 0.0347  -0.0092 160 PHE A CE1   
1207 C CE2   . PHE A 150 ? 1.4723 1.5270 1.4678 -0.1249 0.0384  -0.0056 160 PHE A CE2   
1208 C CZ    . PHE A 150 ? 1.4744 1.5007 1.4638 -0.1301 0.0397  -0.0032 160 PHE A CZ    
1209 N N     . GLY A 151 ? 1.8780 1.9899 1.8367 -0.0698 0.0198  -0.0278 161 GLY A N     
1210 C CA    . GLY A 151 ? 1.8877 2.0134 1.8371 -0.0570 0.0149  -0.0360 161 GLY A CA    
1211 C C     . GLY A 151 ? 1.8872 1.9959 1.8304 -0.0555 0.0202  -0.0282 161 GLY A C     
1212 O O     . GLY A 151 ? 1.8962 2.0101 1.8331 -0.0479 0.0151  -0.0383 161 GLY A O     
1213 N N     . LEU A 152 ? 1.7871 1.8772 1.7330 -0.0614 0.0296  -0.0112 162 LEU A N     
1214 C CA    . LEU A 152 ? 1.7857 1.8621 1.7305 -0.0614 0.0347  -0.0022 162 LEU A CA    
1215 C C     . LEU A 152 ? 1.7816 1.8281 1.7321 -0.0770 0.0315  -0.0084 162 LEU A C     
1216 O O     . LEU A 152 ? 1.7796 1.8123 1.7314 -0.0791 0.0346  -0.0019 162 LEU A O     
1217 C CB    . LEU A 152 ? 1.8447 1.9189 1.7924 -0.0581 0.0451  0.0198  162 LEU A CB    
1218 C CG    . LEU A 152 ? 1.8512 1.9517 1.7935 -0.0426 0.0499  0.0306  162 LEU A CG    
1219 C CD1   . LEU A 152 ? 1.8490 1.9485 1.7932 -0.0452 0.0491  0.0304  162 LEU A CD1   
1220 C CD2   . LEU A 152 ? 1.8550 1.9575 1.8016 -0.0358 0.0604  0.0539  162 LEU A CD2   
1221 N N     . SER A 153 ? 1.4838 1.5220 1.4392 -0.0876 0.0257  -0.0194 163 SER A N     
1222 C CA    . SER A 153 ? 1.4832 1.4940 1.4432 -0.1012 0.0237  -0.0228 163 SER A CA    
1223 C C     . SER A 153 ? 1.4923 1.4934 1.4505 -0.1010 0.0169  -0.0346 163 SER A C     
1224 O O     . SER A 153 ? 1.5000 1.5171 1.4528 -0.0896 0.0125  -0.0431 163 SER A O     
1225 C CB    . SER A 153 ? 1.4832 1.4922 1.4519 -0.1121 0.0216  -0.0270 163 SER A CB    
1226 O OG    . SER A 153 ? 1.4878 1.4737 1.4613 -0.1237 0.0192  -0.0303 163 SER A OG    
1227 N N     . ASN A 154 ? 1.4943 1.4696 1.4555 -0.1115 0.0158  -0.0354 164 ASN A N     
1228 C CA    . ASN A 154 ? 1.5058 1.4660 1.4652 -0.1112 0.0092  -0.0455 164 ASN A CA    
1229 C C     . ASN A 154 ? 1.5123 1.4459 1.4782 -0.1250 0.0074  -0.0461 164 ASN A C     
1230 O O     . ASN A 154 ? 1.5063 1.4346 1.4755 -0.1330 0.0129  -0.0364 164 ASN A O     
1231 C CB    . ASN A 154 ? 1.5103 1.4687 1.4627 -0.1026 0.0129  -0.0392 164 ASN A CB    
1232 C CG    . ASN A 154 ? 1.5242 1.4805 1.4712 -0.0937 0.0058  -0.0519 164 ASN A CG    
1233 O OD1   . ASN A 154 ? 1.5382 1.4803 1.4874 -0.0977 -0.0029 -0.0653 164 ASN A OD1   
1234 N ND2   . ASN A 154 ? 1.5228 1.4937 1.4643 -0.0811 0.0094  -0.0473 164 ASN A ND2   
1235 N N     . MET A 155 ? 1.8631 1.7804 1.8301 -0.1259 -0.0002 -0.0567 165 MET A N     
1236 C CA    . MET A 155 ? 1.8737 1.7643 1.8476 -0.1379 -0.0012 -0.0543 165 MET A CA    
1237 C C     . MET A 155 ? 1.8776 1.7474 1.8417 -0.1338 0.0004  -0.0494 165 MET A C     
1238 O O     . MET A 155 ? 1.8808 1.7527 1.8373 -0.1227 -0.0029 -0.0557 165 MET A O     
1239 C CB    . MET A 155 ? 1.8635 1.7459 1.8500 -0.1437 -0.0123 -0.0690 165 MET A CB    
1240 C CG    . MET A 155 ? 1.8785 1.7333 1.8767 -0.1575 -0.0125 -0.0633 165 MET A CG    
1241 S SD    . MET A 155 ? 1.8997 1.7513 1.9248 -0.1706 -0.0247 -0.0770 165 MET A SD    
1242 C CE    . MET A 155 ? 1.9132 1.7704 1.9300 -0.1544 -0.0404 -0.1037 165 MET A CE    
1243 N N     . MET A 156 ? 1.7862 1.6392 1.7500 -0.1409 0.0057  -0.0379 166 MET A N     
1244 C CA    . MET A 156 ? 1.7908 1.6260 1.7448 -0.1360 0.0067  -0.0329 166 MET A CA    
1245 C C     . MET A 156 ? 1.8142 1.6225 1.7698 -0.1380 0.0011  -0.0369 166 MET A C     
1246 O O     . MET A 156 ? 1.8265 1.6205 1.7904 -0.1482 0.0024  -0.0310 166 MET A O     
1247 C CB    . MET A 156 ? 1.9045 1.7369 1.8537 -0.1385 0.0142  -0.0193 166 MET A CB    
1248 C CG    . MET A 156 ? 1.8876 1.7406 1.8382 -0.1389 0.0192  -0.0150 166 MET A CG    
1249 S SD    . MET A 156 ? 1.8866 1.7342 1.8295 -0.1389 0.0255  -0.0030 166 MET A SD    
1250 C CE    . MET A 156 ? 1.8826 1.7255 1.8179 -0.1297 0.0221  -0.0041 166 MET A CE    
1251 N N     . SER A 157 ? 1.6964 1.4983 1.6452 -0.1275 -0.0047 -0.0454 167 SER A N     
1252 C CA    . SER A 157 ? 1.7225 1.4959 1.6715 -0.1263 -0.0114 -0.0507 167 SER A CA    
1253 C C     . SER A 157 ? 1.7279 1.4851 1.6661 -0.1211 -0.0081 -0.0404 167 SER A C     
1254 O O     . SER A 157 ? 1.7121 1.4835 1.6424 -0.1142 -0.0045 -0.0360 167 SER A O     
1255 C CB    . SER A 157 ? 3.1662 2.9424 3.1123 -0.1143 -0.0213 -0.0689 167 SER A CB    
1256 O OG    . SER A 157 ? 3.1675 2.9570 3.1229 -0.1175 -0.0270 -0.0810 167 SER A OG    
1257 N N     . ASP A 158 ? 1.6355 1.3634 1.5752 -0.1245 -0.0098 -0.0357 168 ASP A N     
1258 C CA    . ASP A 158 ? 1.6452 1.3574 1.5727 -0.1173 -0.0072 -0.0254 168 ASP A CA    
1259 C C     . ASP A 158 ? 1.6468 1.3614 1.5639 -0.1012 -0.0128 -0.0345 168 ASP A C     
1260 O O     . ASP A 158 ? 1.6620 1.3678 1.5799 -0.0944 -0.0207 -0.0475 168 ASP A O     
1261 C CB    . ASP A 158 ? 2.0074 1.6865 1.9395 -0.1230 -0.0074 -0.0164 168 ASP A CB    
1262 C CG    . ASP A 158 ? 2.0067 1.6877 1.9476 -0.1367 0.0019  0.0000  168 ASP A CG    
1263 O OD1   . ASP A 158 ? 1.9863 1.6907 1.9354 -0.1446 0.0050  -0.0017 168 ASP A OD1   
1264 O OD2   . ASP A 158 ? 2.0283 1.6894 1.9677 -0.1380 0.0067  0.0157  168 ASP A OD2   
1265 N N     . GLY A 159 ? 1.6331 1.3609 1.5416 -0.0942 -0.0095 -0.0285 169 GLY A N     
1266 C CA    . GLY A 159 ? 1.6326 1.3689 1.5349 -0.0794 -0.0137 -0.0346 169 GLY A CA    
1267 C C     . GLY A 159 ? 1.6162 1.3807 1.5239 -0.0747 -0.0149 -0.0446 169 GLY A C     
1268 O O     . GLY A 159 ? 1.6217 1.3938 1.5262 -0.0612 -0.0188 -0.0519 169 GLY A O     
1269 N N     . GLU A 160 ? 1.5978 1.3800 1.5130 -0.0839 -0.0108 -0.0436 170 GLU A N     
1270 C CA    . GLU A 160 ? 1.5848 1.3955 1.5042 -0.0786 -0.0104 -0.0502 170 GLU A CA    
1271 C C     . GLU A 160 ? 1.5595 1.3948 1.4859 -0.0841 -0.0035 -0.0409 170 GLU A C     
1272 O O     . GLU A 160 ? 1.5523 1.3823 1.4808 -0.0948 0.0000  -0.0340 170 GLU A O     
1273 C CB    . GLU A 160 ? 2.1890 1.9968 2.1110 -0.0814 -0.0146 -0.0613 170 GLU A CB    
1274 C CG    . GLU A 160 ? 2.2191 1.9990 2.1378 -0.0764 -0.0240 -0.0733 170 GLU A CG    
1275 C CD    . GLU A 160 ? 2.2306 2.0175 2.1406 -0.0567 -0.0291 -0.0836 170 GLU A CD    
1276 O OE1   . GLU A 160 ? 2.2166 2.0368 2.1254 -0.0470 -0.0259 -0.0849 170 GLU A OE1   
1277 O OE2   . GLU A 160 ? 2.2555 2.0157 2.1602 -0.0498 -0.0356 -0.0890 170 GLU A OE2   
1278 N N     . PHE A 161 ? 1.5486 1.4110 1.4797 -0.0761 -0.0013 -0.0397 171 PHE A N     
1279 C CA    . PHE A 161 ? 1.5286 1.4123 1.4698 -0.0814 0.0048  -0.0299 171 PHE A CA    
1280 C C     . PHE A 161 ? 1.5229 1.4283 1.4662 -0.0791 0.0082  -0.0311 171 PHE A C     
1281 O O     . PHE A 161 ? 1.5345 1.4409 1.4710 -0.0721 0.0045  -0.0418 171 PHE A O     
1282 C CB    . PHE A 161 ? 1.6129 1.5142 1.5637 -0.0760 0.0060  -0.0233 171 PHE A CB    
1283 C CG    . PHE A 161 ? 1.6184 1.5028 1.5673 -0.0767 0.0015  -0.0226 171 PHE A CG    
1284 C CD1   . PHE A 161 ? 1.6133 1.4876 1.5644 -0.0856 0.0011  -0.0178 171 PHE A CD1   
1285 C CD2   . PHE A 161 ? 1.6313 1.5113 1.5745 -0.0659 -0.0029 -0.0276 171 PHE A CD2   
1286 C CE1   . PHE A 161 ? 1.6211 1.4830 1.5680 -0.0832 -0.0040 -0.0182 171 PHE A CE1   
1287 C CE2   . PHE A 161 ? 1.6382 1.5050 1.5782 -0.0644 -0.0075 -0.0267 171 PHE A CE2   
1288 C CZ    . PHE A 161 ? 1.6332 1.4918 1.5746 -0.0728 -0.0082 -0.0221 171 PHE A CZ    
1289 N N     . LEU A 162 ? 1.6874 1.6098 1.6401 -0.0834 0.0142  -0.0206 172 LEU A N     
1290 C CA    . LEU A 162 ? 1.6832 1.6285 1.6368 -0.0792 0.0184  -0.0189 172 LEU A CA    
1291 C C     . LEU A 162 ? 1.6762 1.6511 1.6407 -0.0718 0.0252  -0.0065 172 LEU A C     
1292 O O     . LEU A 162 ? 1.6675 1.6435 1.6460 -0.0786 0.0282  0.0050  172 LEU A O     
1293 C CB    . LEU A 162 ? 1.4962 1.4364 1.4518 -0.0896 0.0207  -0.0149 172 LEU A CB    
1294 C CG    . LEU A 162 ? 1.5030 1.4206 1.4523 -0.0979 0.0161  -0.0236 172 LEU A CG    
1295 C CD1   . LEU A 162 ? 1.4947 1.4145 1.4472 -0.1057 0.0197  -0.0181 172 LEU A CD1   
1296 C CD2   . LEU A 162 ? 1.5163 1.4348 1.4597 -0.0923 0.0102  -0.0375 172 LEU A CD2   
1297 N N     . ARG A 163 ? 1.5147 1.5142 1.4737 -0.0571 0.0272  -0.0090 173 ARG A N     
1298 C CA    . ARG A 163 ? 1.5113 1.5453 1.4809 -0.0475 0.0360  0.0059  173 ARG A CA    
1299 C C     . ARG A 163 ? 1.5055 1.5583 1.4808 -0.0479 0.0442  0.0199  173 ARG A C     
1300 O O     . ARG A 163 ? 1.4994 1.5679 1.4930 -0.0505 0.0522  0.0389  173 ARG A O     
1301 C CB    . ARG A 163 ? 2.3832 2.4388 2.3411 -0.0271 0.0351  -0.0025 173 ARG A CB    
1302 C CG    . ARG A 163 ? 2.3830 2.4818 2.3501 -0.0134 0.0463  0.0148  173 ARG A CG    
1303 C CD    . ARG A 163 ? 2.3717 2.4780 2.3656 -0.0234 0.0523  0.0336  173 ARG A CD    
1304 N NE    . ARG A 163 ? 2.3772 2.5185 2.3785 -0.0081 0.0583  0.0416  173 ARG A NE    
1305 C CZ    . ARG A 163 ? 2.3706 2.5380 2.3999 -0.0116 0.0676  0.0639  173 ARG A CZ    
1306 N NH1   . ARG A 163 ? 2.3602 2.5183 2.4124 -0.0301 0.0704  0.0788  173 ARG A NH1   
1307 N NH2   . ARG A 163 ? 2.3766 2.5801 2.4129 0.0037  0.0736  0.0713  173 ARG A NH2   
1308 N N     . TPO A 164 ? 1.5768 1.6281 1.5386 -0.0454 0.0416  0.0109  174 TPO A N     
1309 C CA    . TPO A 164 ? 1.5750 1.6462 1.5375 -0.0415 0.0485  0.0223  174 TPO A CA    
1310 C CB    . TPO A 164 ? 1.7347 1.8033 1.6816 -0.0383 0.0418  0.0061  174 TPO A CB    
1311 C CG2   . TPO A 164 ? 1.7380 1.8377 1.6809 -0.0257 0.0489  0.0170  174 TPO A CG2   
1312 O OG1   . TPO A 164 ? 1.7482 1.8169 1.6818 -0.0278 0.0331  -0.0137 174 TPO A OG1   
1313 P P     . TPO A 164 ? 1.7526 1.7933 1.6815 -0.0389 0.0213  -0.0337 174 TPO A P     
1314 O O1P   . TPO A 164 ? 1.7558 1.8131 1.6796 -0.0342 0.0192  -0.0388 174 TPO A O1P   
1315 O O2P   . TPO A 164 ? 1.7399 1.7491 1.6798 -0.0604 0.0223  -0.0270 174 TPO A O2P   
1316 O O3P   . TPO A 164 ? 1.7707 1.7988 1.6906 -0.0312 0.0103  -0.0547 174 TPO A O3P   
1317 C C     . TPO A 164 ? 1.5644 1.6242 1.5435 -0.0558 0.0534  0.0384  174 TPO A C     
1318 O O     . TPO A 164 ? 1.5590 1.5902 1.5403 -0.0696 0.0481  0.0325  174 TPO A O     
1319 N N     . SER A 165 ? 1.5363 1.6184 1.5270 -0.0511 0.0634  0.0592  175 SER A N     
1320 C CA    . SER A 165 ? 1.5313 1.6008 1.5394 -0.0630 0.0670  0.0744  175 SER A CA    
1321 C C     . SER A 165 ? 1.5349 1.6131 1.5345 -0.0570 0.0709  0.0798  175 SER A C     
1322 O O     . SER A 165 ? 1.5423 1.6504 1.5389 -0.0427 0.0791  0.0924  175 SER A O     
1323 C CB    . SER A 165 ? 1.4821 1.5661 1.5165 -0.0648 0.0750  0.0967  175 SER A CB    
1324 O OG    . SER A 165 ? 1.4899 1.6119 1.5238 -0.0487 0.0860  0.1124  175 SER A OG    
1325 N N     . CYS A 166 ? 1.4811 1.5361 1.4759 -0.0659 0.0654  0.0711  176 CYS A N     
1326 C CA    . CYS A 166 ? 1.4846 1.5486 1.4700 -0.0593 0.0675  0.0733  176 CYS A CA    
1327 C C     . CYS A 166 ? 1.4831 1.5244 1.4772 -0.0690 0.0671  0.0795  176 CYS A C     
1328 O O     . CYS A 166 ? 1.4793 1.4947 1.4819 -0.0812 0.0624  0.0754  176 CYS A O     
1329 C CB    . CYS A 166 ? 2.6478 2.7145 2.6146 -0.0558 0.0595  0.0511  176 CYS A CB    
1330 S SG    . CYS A 166 ? 2.6562 2.7534 2.6091 -0.0391 0.0612  0.0512  176 CYS A SG    
1331 N N     . GLY A 167 ? 1.5895 1.6411 1.5792 -0.0611 0.0712  0.0878  177 GLY A N     
1332 C CA    . GLY A 167 ? 1.5924 1.6242 1.5889 -0.0661 0.0712  0.0944  177 GLY A CA    
1333 C C     . GLY A 167 ? 1.6038 1.6376 1.6159 -0.0620 0.0795  0.1196  177 GLY A C     
1334 O O     . GLY A 167 ? 1.6094 1.6654 1.6281 -0.0545 0.0878  0.1362  177 GLY A O     
1335 N N     . SER A 168 ? 1.5093 1.5200 1.5276 -0.0657 0.0774  0.1232  178 SER A N     
1336 C CA    . SER A 168 ? 1.5249 1.5297 1.5602 -0.0626 0.0838  0.1470  178 SER A CA    
1337 C C     . SER A 168 ? 1.5294 1.5253 1.5934 -0.0729 0.0857  0.1613  178 SER A C     
1338 O O     . SER A 168 ? 1.5200 1.5075 1.5901 -0.0834 0.0796  0.1493  178 SER A O     
1339 C CB    . SER A 168 ? 2.0149 1.9921 2.0491 -0.0636 0.0783  0.1425  178 SER A CB    
1340 O OG    . SER A 168 ? 2.0157 2.0091 2.0297 -0.0509 0.0800  0.1388  178 SER A OG    
1341 N N     . PRO A 169 ? 1.5453 1.5450 1.6292 -0.0698 0.0945  0.1884  179 PRO A N     
1342 C CA    . PRO A 169 ? 1.5511 1.5457 1.6695 -0.0814 0.0965  0.2045  179 PRO A CA    
1343 C C     . PRO A 169 ? 1.5557 1.5099 1.6947 -0.0976 0.0833  0.1933  179 PRO A C     
1344 O O     . PRO A 169 ? 1.5512 1.5031 1.7108 -0.1091 0.0790  0.1909  179 PRO A O     
1345 C CB    . PRO A 169 ? 2.4143 2.4209 2.5492 -0.0735 0.1097  0.2386  179 PRO A CB    
1346 C CG    . PRO A 169 ? 2.4227 2.4213 2.5355 -0.0613 0.1093  0.2362  179 PRO A CG    
1347 C CD    . PRO A 169 ? 2.4036 2.4141 2.4816 -0.0554 0.1032  0.2075  179 PRO A CD    
1348 N N     . ASN A 170 ? 1.5668 1.4919 1.7006 -0.0965 0.0764  0.1863  180 ASN A N     
1349 C CA    . ASN A 170 ? 1.5765 1.4627 1.7266 -0.1078 0.0619  0.1729  180 ASN A CA    
1350 C C     . ASN A 170 ? 1.5616 1.4385 1.6893 -0.1105 0.0505  0.1421  180 ASN A C     
1351 O O     . ASN A 170 ? 1.5658 1.4206 1.7062 -0.1197 0.0384  0.1292  180 ASN A O     
1352 C CB    . ASN A 170 ? 1.7163 1.5743 1.8690 -0.1022 0.0586  0.1777  180 ASN A CB    
1353 C CG    . ASN A 170 ? 1.7267 1.6029 1.8763 -0.0895 0.0730  0.2039  180 ASN A CG    
1354 O OD1   . ASN A 170 ? 1.7159 1.6168 1.8354 -0.0765 0.0795  0.2007  180 ASN A OD1   
1355 N ND2   . ASN A 170 ? 1.7503 1.6146 1.9323 -0.0928 0.0775  0.2304  180 ASN A ND2   
1356 N N     . TYR A 171 ? 1.5468 1.4414 1.6424 -0.1019 0.0541  0.1311  181 TYR A N     
1357 C CA    . TYR A 171 ? 1.5358 1.4225 1.6094 -0.1031 0.0457  0.1059  181 TYR A CA    
1358 C C     . TYR A 171 ? 1.5196 1.4204 1.5903 -0.1089 0.0451  0.0977  181 TYR A C     
1359 O O     . TYR A 171 ? 1.5129 1.4056 1.5692 -0.1111 0.0383  0.0796  181 TYR A O     
1360 C CB    . TYR A 171 ? 1.5307 1.4288 1.5766 -0.0925 0.0492  0.0991  181 TYR A CB    
1361 C CG    . TYR A 171 ? 1.5477 1.4300 1.5924 -0.0845 0.0481  0.1030  181 TYR A CG    
1362 C CD1   . TYR A 171 ? 1.5622 1.4458 1.6202 -0.0791 0.0546  0.1244  181 TYR A CD1   
1363 C CD2   . TYR A 171 ? 1.5519 1.4190 1.5815 -0.0805 0.0410  0.0866  181 TYR A CD2   
1364 C CE1   . TYR A 171 ? 1.5810 1.4474 1.6373 -0.0701 0.0529  0.1280  181 TYR A CE1   
1365 C CE2   . TYR A 171 ? 1.5698 1.4227 1.5969 -0.0706 0.0394  0.0890  181 TYR A CE2   
1366 C CZ    . TYR A 171 ? 1.5846 1.4355 1.6250 -0.0655 0.0448  0.1090  181 TYR A CZ    
1367 O OH    . TYR A 171 ? 1.6056 1.4398 1.6429 -0.0540 0.0426  0.1115  181 TYR A OH    
1368 N N     . ALA A 172 ? 1.5157 1.4387 1.5996 -0.1096 0.0528  0.1124  182 ALA A N     
1369 C CA    . ALA A 172 ? 1.5032 1.4408 1.5848 -0.1125 0.0525  0.1054  182 ALA A CA    
1370 C C     . ALA A 172 ? 1.5056 1.4242 1.6050 -0.1232 0.0420  0.0974  182 ALA A C     
1371 O O     . ALA A 172 ? 1.5172 1.4244 1.6451 -0.1299 0.0388  0.1071  182 ALA A O     
1372 C CB    . ALA A 172 ? 3.3041 3.2739 3.3949 -0.1071 0.0639  0.1240  182 ALA A CB    
1373 N N     . ALA A 173 ? 1.5339 1.4490 1.6178 -0.1244 0.0358  0.0798  183 ALA A N     
1374 C CA    . ALA A 173 ? 1.5366 1.4368 1.6317 -0.1314 0.0247  0.0692  183 ALA A CA    
1375 C C     . ALA A 173 ? 1.5373 1.4518 1.6645 -0.1376 0.0256  0.0815  183 ALA A C     
1376 O O     . ALA A 173 ? 1.5323 1.4733 1.6657 -0.1343 0.0366  0.0965  183 ALA A O     
1377 C CB    . ALA A 173 ? 1.7946 1.6935 1.8644 -0.1288 0.0211  0.0524  183 ALA A CB    
1378 N N     . PRO A 174 ? 1.5081 1.4082 1.6567 -0.1454 0.0136  0.0750  184 PRO A N     
1379 C CA    . PRO A 174 ? 1.5098 1.4258 1.6961 -0.1532 0.0136  0.0876  184 PRO A CA    
1380 C C     . PRO A 174 ? 1.4968 1.4414 1.6771 -0.1488 0.0197  0.0887  184 PRO A C     
1381 O O     . PRO A 174 ? 1.4960 1.4655 1.7043 -0.1517 0.0258  0.1049  184 PRO A O     
1382 C CB    . PRO A 174 ? 2.1187 2.0115 2.3228 -0.1608 -0.0046 0.0725  184 PRO A CB    
1383 C CG    . PRO A 174 ? 2.1286 1.9915 2.3095 -0.1562 -0.0117 0.0585  184 PRO A CG    
1384 C CD    . PRO A 174 ? 2.1158 1.9863 2.2569 -0.1463 -0.0010 0.0562  184 PRO A CD    
1385 N N     . GLU A 175 ? 1.4892 1.4302 1.6354 -0.1416 0.0178  0.0723  185 GLU A N     
1386 C CA    . GLU A 175 ? 1.4807 1.4444 1.6181 -0.1351 0.0223  0.0711  185 GLU A CA    
1387 C C     . GLU A 175 ? 1.4756 1.4620 1.5973 -0.1253 0.0359  0.0806  185 GLU A C     
1388 O O     . GLU A 175 ? 1.4727 1.4855 1.5969 -0.1185 0.0419  0.0861  185 GLU A O     
1389 C CB    . GLU A 175 ? 1.4797 1.4270 1.5901 -0.1314 0.0134  0.0505  185 GLU A CB    
1390 C CG    . GLU A 175 ? 1.4796 1.4085 1.5579 -0.1278 0.0142  0.0409  185 GLU A CG    
1391 C CD    . GLU A 175 ? 1.4858 1.3905 1.5486 -0.1279 0.0034  0.0251  185 GLU A CD    
1392 O OE1   . GLU A 175 ? 1.4938 1.3823 1.5632 -0.1312 -0.0038 0.0215  185 GLU A OE1   
1393 O OE2   . GLU A 175 ? 1.4857 1.3874 1.5291 -0.1230 0.0020  0.0165  185 GLU A OE2   
1394 N N     . VAL A 176 ? 1.4763 1.4546 1.5805 -0.1224 0.0400  0.0809  186 VAL A N     
1395 C CA    . VAL A 176 ? 1.4741 1.4753 1.5622 -0.1112 0.0505  0.0871  186 VAL A CA    
1396 C C     . VAL A 176 ? 1.4788 1.5054 1.5885 -0.1083 0.0621  0.1120  186 VAL A C     
1397 O O     . VAL A 176 ? 1.4793 1.5352 1.5806 -0.0960 0.0713  0.1195  186 VAL A O     
1398 C CB    . VAL A 176 ? 1.5490 1.5373 1.6104 -0.1079 0.0500  0.0774  186 VAL A CB    
1399 C CG1   . VAL A 176 ? 1.5467 1.5123 1.5894 -0.1110 0.0408  0.0572  186 VAL A CG1   
1400 C CG2   . VAL A 176 ? 1.5545 1.5306 1.6249 -0.1117 0.0513  0.0867  186 VAL A CG2   
1401 N N     . ILE A 177 ? 1.4855 1.5011 1.6230 -0.1181 0.0615  0.1251  187 ILE A N     
1402 C CA    . ILE A 177 ? 1.4935 1.5317 1.6563 -0.1166 0.0736  0.1532  187 ILE A CA    
1403 C C     . ILE A 177 ? 1.4919 1.5621 1.6770 -0.1154 0.0794  0.1653  187 ILE A C     
1404 O O     . ILE A 177 ? 1.4969 1.6003 1.6918 -0.1070 0.0934  0.1881  187 ILE A O     
1405 C CB    . ILE A 177 ? 1.5541 1.5683 1.7474 -0.1290 0.0701  0.1650  187 ILE A CB    
1406 C CG1   . ILE A 177 ? 1.5557 1.5494 1.7742 -0.1435 0.0557  0.1538  187 ILE A CG1   
1407 C CG2   . ILE A 177 ? 1.5585 1.5468 1.7297 -0.1262 0.0668  0.1568  187 ILE A CG2   
1408 C CD1   . ILE A 177 ? 1.5616 1.5751 1.8277 -0.1528 0.0591  0.1745  187 ILE A CD1   
1409 N N     . SER A 178 ? 1.4863 1.5497 1.6786 -0.1220 0.0692  0.1507  188 SER A N     
1410 C CA    . SER A 178 ? 1.4847 1.5801 1.6997 -0.1206 0.0735  0.1606  188 SER A CA    
1411 C C     . SER A 178 ? 1.4798 1.5993 1.6631 -0.1026 0.0785  0.1515  188 SER A C     
1412 O O     . SER A 178 ? 1.4801 1.6334 1.6758 -0.0954 0.0850  0.1609  188 SER A O     
1413 C CB    . SER A 178 ? 1.4831 1.5632 1.7206 -0.1335 0.0590  0.1481  188 SER A CB    
1414 O OG    . SER A 178 ? 1.4784 1.5302 1.6830 -0.1317 0.0468  0.1204  188 SER A OG    
1415 N N     . GLY A 179 ? 1.5343 1.6370 1.6787 -0.0950 0.0750  0.1331  189 GLY A N     
1416 C CA    . GLY A 179 ? 1.5340 1.6521 1.6478 -0.0783 0.0762  0.1201  189 GLY A CA    
1417 C C     . GLY A 179 ? 1.5311 1.6392 1.6389 -0.0786 0.0660  0.1015  189 GLY A C     
1418 O O     . GLY A 179 ? 1.5337 1.6670 1.6392 -0.0664 0.0689  0.1010  189 GLY A O     
1419 N N     . ARG A 180 ? 1.4712 1.5436 1.5752 -0.0904 0.0543  0.0867  190 ARG A N     
1420 C CA    . ARG A 180 ? 1.4711 1.5308 1.5676 -0.0900 0.0443  0.0702  190 ARG A CA    
1421 C C     . ARG A 180 ? 1.4731 1.5034 1.5354 -0.0877 0.0378  0.0504  190 ARG A C     
1422 O O     . ARG A 180 ? 1.4721 1.4878 1.5236 -0.0916 0.0385  0.0488  190 ARG A O     
1423 C CB    . ARG A 180 ? 1.8275 1.8736 1.9502 -0.1039 0.0354  0.0706  190 ARG A CB    
1424 C CG    . ARG A 180 ? 1.8292 1.8700 1.9484 -0.1013 0.0257  0.0570  190 ARG A CG    
1425 C CD    . ARG A 180 ? 1.8306 1.8610 1.9763 -0.1136 0.0149  0.0555  190 ARG A CD    
1426 N NE    . ARG A 180 ? 1.8300 1.8837 2.0184 -0.1224 0.0192  0.0744  190 ARG A NE    
1427 C CZ    . ARG A 180 ? 1.8289 1.9182 2.0444 -0.1199 0.0238  0.0862  190 ARG A CZ    
1428 N NH1   . ARG A 180 ? 1.8284 1.9337 2.0294 -0.1068 0.0240  0.0791  190 ARG A NH1   
1429 N NH2   . ARG A 180 ? 1.8303 1.9400 2.0892 -0.1302 0.0284  0.1063  190 ARG A NH2   
1430 N N     . LEU A 181 ? 1.5844 1.6073 1.6320 -0.0810 0.0318  0.0369  191 LEU A N     
1431 C CA    . LEU A 181 ? 1.5897 1.5835 1.6098 -0.0802 0.0256  0.0205  191 LEU A CA    
1432 C C     . LEU A 181 ? 1.5880 1.5526 1.6067 -0.0925 0.0197  0.0169  191 LEU A C     
1433 O O     . LEU A 181 ? 1.5867 1.5477 1.6211 -0.0986 0.0151  0.0194  191 LEU A O     
1434 C CB    . LEU A 181 ? 1.4922 1.4813 1.5002 -0.0703 0.0201  0.0094  191 LEU A CB    
1435 C CG    . LEU A 181 ? 1.4993 1.5136 1.5009 -0.0536 0.0240  0.0076  191 LEU A CG    
1436 C CD1   . LEU A 181 ? 1.5108 1.5180 1.5034 -0.0433 0.0175  -0.0028 191 LEU A CD1   
1437 C CD2   . LEU A 181 ? 1.5052 1.5149 1.4876 -0.0487 0.0250  -0.0004 191 LEU A CD2   
1438 N N     . TYR A 182 ? 1.6085 1.5547 1.6093 -0.0950 0.0193  0.0103  192 TYR A N     
1439 C CA    . TYR A 182 ? 1.6091 1.5312 1.6053 -0.1035 0.0151  0.0073  192 TYR A CA    
1440 C C     . TYR A 182 ? 1.6164 1.5181 1.5913 -0.1035 0.0132  -0.0018 192 TYR A C     
1441 O O     . TYR A 182 ? 1.6205 1.5248 1.5867 -0.0993 0.0145  -0.0067 192 TYR A O     
1442 C CB    . TYR A 182 ? 1.4778 1.4031 1.4834 -0.1095 0.0190  0.0153  192 TYR A CB    
1443 C CG    . TYR A 182 ? 1.4752 1.4122 1.4738 -0.1065 0.0256  0.0177  192 TYR A CG    
1444 C CD1   . TYR A 182 ? 1.4729 1.4361 1.4803 -0.1004 0.0322  0.0270  192 TYR A CD1   
1445 C CD2   . TYR A 182 ? 1.4767 1.4018 1.4606 -0.1087 0.0254  0.0114  192 TYR A CD2   
1446 C CE1   . TYR A 182 ? 1.4731 1.4495 1.4717 -0.0949 0.0371  0.0280  192 TYR A CE1   
1447 C CE2   . TYR A 182 ? 1.4754 1.4138 1.4543 -0.1054 0.0295  0.0117  192 TYR A CE2   
1448 C CZ    . TYR A 182 ? 1.4741 1.4376 1.4588 -0.0976 0.0347  0.0191  192 TYR A CZ    
1449 O OH    . TYR A 182 ? 1.4753 1.4542 1.4527 -0.0916 0.0377  0.0182  192 TYR A OH    
1450 N N     . ALA A 183 ? 1.4953 1.3775 1.4633 -0.1077 0.0098  -0.0039 193 ALA A N     
1451 C CA    . ALA A 183 ? 1.5043 1.3681 1.4560 -0.1089 0.0096  -0.0082 193 ALA A CA    
1452 C C     . ALA A 183 ? 1.5002 1.3669 1.4501 -0.1138 0.0143  -0.0071 193 ALA A C     
1453 O O     . ALA A 183 ? 1.5057 1.3683 1.4503 -0.1152 0.0149  -0.0110 193 ALA A O     
1454 C CB    . ALA A 183 ? 3.7554 3.6034 3.6994 -0.1087 0.0058  -0.0082 193 ALA A CB    
1455 N N     . GLY A 184 ? 2.0287 1.9029 1.9855 -0.1163 0.0165  -0.0024 194 GLY A N     
1456 C CA    . GLY A 184 ? 2.0247 1.9044 1.9806 -0.1192 0.0207  -0.0006 194 GLY A CA    
1457 C C     . GLY A 184 ? 2.0275 1.8984 1.9778 -0.1213 0.0215  0.0010  194 GLY A C     
1458 O O     . GLY A 184 ? 2.0232 1.9024 1.9759 -0.1218 0.0248  0.0037  194 GLY A O     
1459 N N     . PRO A 185 ? 1.5002 1.3567 1.4418 -0.1199 0.0188  -0.0003 195 PRO A N     
1460 C CA    . PRO A 185 ? 1.5046 1.3573 1.4403 -0.1178 0.0193  0.0008  195 PRO A CA    
1461 C C     . PRO A 185 ? 1.5033 1.3558 1.4480 -0.1154 0.0148  0.0001  195 PRO A C     
1462 O O     . PRO A 185 ? 1.5039 1.3581 1.4491 -0.1137 0.0161  0.0013  195 PRO A O     
1463 C CB    . PRO A 185 ? 2.1628 2.0030 2.0847 -0.1138 0.0174  0.0000  195 PRO A CB    
1464 C CG    . PRO A 185 ? 2.1654 2.0010 2.0867 -0.1164 0.0179  0.0003  195 PRO A CG    
1465 C CD    . PRO A 185 ? 2.1548 1.9992 2.0884 -0.1179 0.0159  -0.0024 195 PRO A CD    
1466 N N     . GLU A 186 ? 1.5035 1.3538 1.4575 -0.1153 0.0090  -0.0016 196 GLU A N     
1467 C CA    . GLU A 186 ? 1.5069 1.3536 1.4744 -0.1147 0.0022  -0.0029 196 GLU A CA    
1468 C C     . GLU A 186 ? 1.4999 1.3555 1.4833 -0.1181 0.0065  0.0048  196 GLU A C     
1469 O O     . GLU A 186 ? 1.5065 1.3550 1.4997 -0.1177 0.0023  0.0050  196 GLU A O     
1470 C CB    . GLU A 186 ? 1.5088 1.3555 1.4877 -0.1151 -0.0053 -0.0057 196 GLU A CB    
1471 C CG    . GLU A 186 ? 1.4981 1.3606 1.4922 -0.1187 -0.0011 0.0008  196 GLU A CG    
1472 C CD    . GLU A 186 ? 1.4954 1.3616 1.4754 -0.1164 0.0038  0.0000  196 GLU A CD    
1473 O OE1   . GLU A 186 ? 1.4956 1.3583 1.4616 -0.1166 0.0088  -0.0004 196 GLU A OE1   
1474 O OE2   . GLU A 186 ? 1.4948 1.3677 1.4799 -0.1143 0.0021  -0.0006 196 GLU A OE2   
1475 N N     . VAL A 187 ? 1.5505 1.4210 1.5356 -0.1198 0.0141  0.0107  197 VAL A N     
1476 C CA    . VAL A 187 ? 1.5459 1.4286 1.5440 -0.1203 0.0194  0.0203  197 VAL A CA    
1477 C C     . VAL A 187 ? 1.5482 1.4291 1.5383 -0.1177 0.0225  0.0213  197 VAL A C     
1478 O O     . VAL A 187 ? 1.5511 1.4332 1.5518 -0.1165 0.0241  0.0288  197 VAL A O     
1479 C CB    . VAL A 187 ? 1.4773 1.3805 1.4764 -0.1189 0.0259  0.0249  197 VAL A CB    
1480 C CG1   . VAL A 187 ? 1.4764 1.3846 1.4848 -0.1192 0.0234  0.0251  197 VAL A CG1   
1481 C CG2   . VAL A 187 ? 1.4757 1.3809 1.4572 -0.1176 0.0278  0.0177  197 VAL A CG2   
1482 N N     . ASP A 188 ? 1.4882 1.3670 1.4614 -0.1163 0.0237  0.0152  198 ASP A N     
1483 C CA    . ASP A 188 ? 1.4908 1.3717 1.4568 -0.1127 0.0267  0.0157  198 ASP A CA    
1484 C C     . ASP A 188 ? 1.5035 1.3676 1.4667 -0.1080 0.0208  0.0116  198 ASP A C     
1485 O O     . ASP A 188 ? 1.5093 1.3720 1.4726 -0.1029 0.0214  0.0134  198 ASP A O     
1486 C CB    . ASP A 188 ? 1.8661 1.7546 1.8200 -0.1138 0.0306  0.0123  198 ASP A CB    
1487 C CG    . ASP A 188 ? 1.8581 1.7614 1.8150 -0.1172 0.0334  0.0124  198 ASP A CG    
1488 O OD1   . ASP A 188 ? 1.8542 1.7653 1.8190 -0.1160 0.0339  0.0160  198 ASP A OD1   
1489 O OD2   . ASP A 188 ? 1.8582 1.7661 1.8107 -0.1204 0.0348  0.0090  198 ASP A OD2   
1490 N N     . ILE A 189 ? 1.5103 1.3619 1.4700 -0.1077 0.0141  0.0049  199 ILE A N     
1491 C CA    . ILE A 189 ? 1.5264 1.3624 1.4812 -0.1006 0.0058  -0.0027 199 ILE A CA    
1492 C C     . ILE A 189 ? 1.5334 1.3592 1.5085 -0.1018 -0.0005 -0.0011 199 ILE A C     
1493 O O     . ILE A 189 ? 1.5480 1.3618 1.5217 -0.0948 -0.0057 -0.0056 199 ILE A O     
1494 C CB    . ILE A 189 ? 1.5343 1.3620 1.4801 -0.0981 -0.0013 -0.0108 199 ILE A CB    
1495 C CG1   . ILE A 189 ? 1.5335 1.3681 1.4595 -0.0958 0.0059  -0.0094 199 ILE A CG1   
1496 C CG2   . ILE A 189 ? 1.5543 1.3667 1.4963 -0.0888 -0.0131 -0.0218 199 ILE A CG2   
1497 C CD1   . ILE A 189 ? 1.5390 1.3684 1.4571 -0.0943 0.0020  -0.0126 199 ILE A CD1   
1498 N N     . TRP A 190 ? 1.5253 1.3564 1.5207 -0.1099 0.0002  0.0062  200 TRP A N     
1499 C CA    . TRP A 190 ? 1.5333 1.3562 1.5543 -0.1134 -0.0043 0.0121  200 TRP A CA    
1500 C C     . TRP A 190 ? 1.5346 1.3609 1.5569 -0.1101 0.0033  0.0224  200 TRP A C     
1501 O O     . TRP A 190 ? 1.5501 1.3609 1.5847 -0.1081 -0.0017 0.0242  200 TRP A O     
1502 C CB    . TRP A 190 ? 1.7991 1.6333 1.8431 -0.1222 -0.0028 0.0210  200 TRP A CB    
1503 C CG    . TRP A 190 ? 1.8113 1.6352 1.8879 -0.1282 -0.0098 0.0266  200 TRP A CG    
1504 C CD1   . TRP A 190 ? 1.8229 1.6341 1.9172 -0.1322 -0.0238 0.0173  200 TRP A CD1   
1505 C CD2   . TRP A 190 ? 1.8161 1.6416 1.9141 -0.1310 -0.0039 0.0436  200 TRP A CD2   
1506 N NE1   . TRP A 190 ? 1.8346 1.6382 1.9641 -0.1396 -0.0275 0.0272  200 TRP A NE1   
1507 C CE2   . TRP A 190 ? 1.8312 1.6426 1.9630 -0.1388 -0.0144 0.0450  200 TRP A CE2   
1508 C CE3   . TRP A 190 ? 1.8113 1.6495 1.9041 -0.1270 0.0088  0.0582  200 TRP A CE3   
1509 C CZ2   . TRP A 190 ? 1.8424 1.6499 2.0046 -0.1440 -0.0112 0.0632  200 TRP A CZ2   
1510 C CZ3   . TRP A 190 ? 1.8223 1.6582 1.9406 -0.1296 0.0125  0.0762  200 TRP A CZ3   
1511 C CH2   . TRP A 190 ? 1.8381 1.6577 1.9917 -0.1387 0.0033  0.0799  200 TRP A CH2   
1512 N N     . SER A 191 ? 1.5208 1.3670 1.5311 -0.1088 0.0141  0.0283  201 SER A N     
1513 C CA    . SER A 191 ? 1.5218 1.3760 1.5298 -0.1034 0.0212  0.0371  201 SER A CA    
1514 C C     . SER A 191 ? 1.5335 1.3769 1.5261 -0.0942 0.0180  0.0285  201 SER A C     
1515 O O     . SER A 191 ? 1.5429 1.3832 1.5372 -0.0876 0.0195  0.0338  201 SER A O     
1516 C CB    . SER A 191 ? 1.5061 1.3866 1.5047 -0.1031 0.0308  0.0415  201 SER A CB    
1517 O OG    . SER A 191 ? 1.4983 1.3915 1.5083 -0.1076 0.0341  0.0489  201 SER A OG    
1518 N N     . SER A 192 ? 1.5351 1.3741 1.5120 -0.0921 0.0140  0.0162  202 SER A N     
1519 C CA    . SER A 192 ? 1.5477 1.3813 1.5081 -0.0809 0.0119  0.0084  202 SER A CA    
1520 C C     . SER A 192 ? 1.5704 1.3780 1.5381 -0.0749 0.0001  0.0015  202 SER A C     
1521 O O     . SER A 192 ? 1.5858 1.3857 1.5468 -0.0636 -0.0020 -0.0016 202 SER A O     
1522 C CB    . SER A 192 ? 1.5458 1.3852 1.4875 -0.0788 0.0126  0.0005  202 SER A CB    
1523 O OG    . SER A 192 ? 1.5283 1.3881 1.4675 -0.0858 0.0218  0.0061  202 SER A OG    
1524 N N     . GLY A 193 ? 1.5744 1.3686 1.5576 -0.0822 -0.0087 -0.0019 203 GLY A N     
1525 C CA    . GLY A 193 ? 1.5989 1.3664 1.5939 -0.0785 -0.0235 -0.0115 203 GLY A CA    
1526 C C     . GLY A 193 ? 1.6114 1.3659 1.6260 -0.0785 -0.0238 -0.0017 203 GLY A C     
1527 O O     . GLY A 193 ? 1.6368 1.3686 1.6518 -0.0690 -0.0339 -0.0104 203 GLY A O     
1528 N N     . VAL A 194 ? 1.5967 1.3653 1.6268 -0.0874 -0.0130 0.0169  204 VAL A N     
1529 C CA    . VAL A 194 ? 1.6100 1.3683 1.6591 -0.0868 -0.0109 0.0311  204 VAL A CA    
1530 C C     . VAL A 194 ? 1.6145 1.3781 1.6428 -0.0727 -0.0044 0.0328  204 VAL A C     
1531 O O     . VAL A 194 ? 1.6348 1.3816 1.6721 -0.0663 -0.0064 0.0390  204 VAL A O     
1532 C CB    . VAL A 194 ? 1.5958 1.3723 1.6662 -0.0976 0.0000  0.0528  204 VAL A CB    
1533 C CG1   . VAL A 194 ? 1.5930 1.3671 1.6878 -0.1107 -0.0064 0.0522  204 VAL A CG1   
1534 C CG2   . VAL A 194 ? 1.5710 1.3800 1.6211 -0.0957 0.0134  0.0577  204 VAL A CG2   
1535 N N     . ILE A 195 ? 1.5975 1.3843 1.6005 -0.0679 0.0029  0.0277  205 ILE A N     
1536 C CA    . ILE A 195 ? 1.6012 1.3981 1.5856 -0.0542 0.0082  0.0274  205 ILE A CA    
1537 C C     . ILE A 195 ? 1.6267 1.4014 1.5993 -0.0403 -0.0027 0.0116  205 ILE A C     
1538 O O     . ILE A 195 ? 1.6446 1.4110 1.6131 -0.0272 -0.0036 0.0125  205 ILE A O     
1539 C CB    . ILE A 195 ? 1.5779 1.4071 1.5441 -0.0549 0.0180  0.0262  205 ILE A CB    
1540 C CG1   . ILE A 195 ? 1.5585 1.4107 1.5334 -0.0632 0.0276  0.0398  205 ILE A CG1   
1541 C CG2   . ILE A 195 ? 1.5838 1.4253 1.5329 -0.0404 0.0216  0.0231  205 ILE A CG2   
1542 C CD1   . ILE A 195 ? 1.5379 1.4171 1.5012 -0.0677 0.0338  0.0362  205 ILE A CD1   
1543 N N     . LEU A 196 ? 1.6310 1.3969 1.5966 -0.0408 -0.0115 -0.0034 206 LEU A N     
1544 C CA    . LEU A 196 ? 1.6591 1.4047 1.6114 -0.0249 -0.0240 -0.0214 206 LEU A CA    
1545 C C     . LEU A 196 ? 1.6886 1.3985 1.6617 -0.0226 -0.0370 -0.0238 206 LEU A C     
1546 O O     . LEU A 196 ? 1.7163 1.4087 1.6796 -0.0054 -0.0452 -0.0346 206 LEU A O     
1547 C CB    . LEU A 196 ? 1.6602 1.4045 1.6019 -0.0252 -0.0319 -0.0361 206 LEU A CB    
1548 C CG    . LEU A 196 ? 1.6927 1.4183 1.6176 -0.0060 -0.0468 -0.0575 206 LEU A CG    
1549 C CD1   . LEU A 196 ? 1.7016 1.4414 1.6008 0.0141  -0.0399 -0.0595 206 LEU A CD1   
1550 C CD2   . LEU A 196 ? 1.6920 1.4222 1.6048 -0.0057 -0.0527 -0.0691 206 LEU A CD2   
1551 N N     . TYR A 197 ? 1.6846 1.3843 1.6882 -0.0394 -0.0389 -0.0132 207 TYR A N     
1552 C CA    . TYR A 197 ? 1.7136 1.3787 1.7456 -0.0415 -0.0506 -0.0114 207 TYR A CA    
1553 C C     . TYR A 197 ? 1.7248 1.3856 1.7578 -0.0325 -0.0429 0.0034  207 TYR A C     
1554 O O     . TYR A 197 ? 1.7587 1.3883 1.7973 -0.0216 -0.0539 -0.0029 207 TYR A O     
1555 C CB    . TYR A 197 ? 1.7041 1.3676 1.7719 -0.0630 -0.0511 0.0013  207 TYR A CB    
1556 C CG    . TYR A 197 ? 1.7358 1.3633 1.8411 -0.0692 -0.0644 0.0041  207 TYR A CG    
1557 C CD1   . TYR A 197 ? 1.7481 1.3657 1.8722 -0.0699 -0.0572 0.0260  207 TYR A CD1   
1558 C CD2   . TYR A 197 ? 1.7557 1.3595 1.8799 -0.0744 -0.0848 -0.0144 207 TYR A CD2   
1559 C CE1   . TYR A 197 ? 1.7803 1.3628 1.9432 -0.0771 -0.0689 0.0313  207 TYR A CE1   
1560 C CE2   . TYR A 197 ? 1.7873 1.3569 1.9519 -0.0824 -0.0986 -0.0121 207 TYR A CE2   
1561 C CZ    . TYR A 197 ? 1.7999 1.3576 1.9850 -0.0846 -0.0901 0.0118  207 TYR A CZ    
1562 O OH    . TYR A 197 ? 1.8348 1.3560 2.0645 -0.0940 -0.1035 0.0166  207 TYR A OH    
1563 N N     . ALA A 198 ? 1.6987 1.3908 1.7257 -0.0354 -0.0251 0.0219  208 ALA A N     
1564 C CA    . ALA A 198 ? 1.7073 1.4018 1.7333 -0.0255 -0.0164 0.0377  208 ALA A CA    
1565 C C     . ALA A 198 ? 1.7202 1.4166 1.7173 -0.0036 -0.0180 0.0245  208 ALA A C     
1566 O O     . ALA A 198 ? 1.7404 1.4267 1.7362 0.0097  -0.0170 0.0314  208 ALA A O     
1567 C CB    . ALA A 198 ? 3.7104 3.4423 3.7353 -0.0323 0.0012  0.0577  208 ALA A CB    
1568 N N     . LEU A 199 ? 1.7102 1.4212 1.6842 0.0013  -0.0198 0.0072  209 LEU A N     
1569 C CA    . LEU A 199 ? 1.7228 1.4412 1.6696 0.0232  -0.0204 -0.0051 209 LEU A CA    
1570 C C     . LEU A 199 ? 1.7650 1.4439 1.7094 0.0393  -0.0384 -0.0235 209 LEU A C     
1571 O O     . LEU A 199 ? 1.7826 1.4644 1.7039 0.0614  -0.0407 -0.0352 209 LEU A O     
1572 C CB    . LEU A 199 ? 1.7004 1.4504 1.6253 0.0231  -0.0145 -0.0139 209 LEU A CB    
1573 C CG    . LEU A 199 ? 1.6664 1.4589 1.5863 0.0156  0.0022  -0.0008 209 LEU A CG    
1574 C CD1   . LEU A 199 ? 1.6483 1.4621 1.5555 0.0099  0.0058  -0.0078 209 LEU A CD1   
1575 C CD2   . LEU A 199 ? 1.6719 1.4840 1.5798 0.0328  0.0090  0.0030  209 LEU A CD2   
1576 N N     . LEU A 200 ? 1.7829 1.4264 1.7526 0.0286  -0.0520 -0.0271 210 LEU A N     
1577 C CA    . LEU A 200 ? 1.8263 1.4288 1.7977 0.0422  -0.0732 -0.0486 210 LEU A CA    
1578 C C     . LEU A 200 ? 1.8561 1.4180 1.8606 0.0373  -0.0816 -0.0386 210 LEU A C     
1579 O O     . LEU A 200 ? 1.8901 1.4276 1.8900 0.0557  -0.0882 -0.0430 210 LEU A O     
1580 C CB    . LEU A 200 ? 1.8283 1.4230 1.8012 0.0355  -0.0872 -0.0683 210 LEU A CB    
1581 C CG    . LEU A 200 ? 1.8085 1.4381 1.7469 0.0442  -0.0804 -0.0786 210 LEU A CG    
1582 C CD1   . LEU A 200 ? 1.7986 1.4294 1.7428 0.0312  -0.0883 -0.0882 210 LEU A CD1   
1583 C CD2   . LEU A 200 ? 1.8401 1.4652 1.7474 0.0746  -0.0886 -0.0991 210 LEU A CD2   
1584 N N     . CYS A 201 ? 2.3484 1.9035 2.3875 0.0130  -0.0809 -0.0239 211 CYS A N     
1585 C CA    . CYS A 201 ? 2.3776 1.8951 2.4556 0.0044  -0.0880 -0.0103 211 CYS A CA    
1586 C C     . CYS A 201 ? 2.3755 1.9015 2.4569 0.0079  -0.0707 0.0191  211 CYS A C     
1587 O O     . CYS A 201 ? 2.4090 1.9005 2.5154 0.0088  -0.0757 0.0312  211 CYS A O     
1588 C CB    . CYS A 201 ? 1.8630 1.3779 1.9795 -0.0228 -0.0910 -0.0016 211 CYS A CB    
1589 S SG    . CYS A 201 ? 1.8659 1.3740 1.9807 -0.0269 -0.1121 -0.0349 211 CYS A SG    
1590 N N     . GLY A 202 ? 1.8359 1.4074 1.8935 0.0103  -0.0512 0.0308  212 GLY A N     
1591 C CA    . GLY A 202 ? 1.8322 1.4191 1.8893 0.0159  -0.0350 0.0573  212 GLY A CA    
1592 C C     . GLY A 202 ? 1.8207 1.4148 1.9097 -0.0038 -0.0242 0.0868  212 GLY A C     
1593 O O     . GLY A 202 ? 1.8158 1.4287 1.9036 0.0007  -0.0093 0.1112  212 GLY A O     
1594 N N     . THR A 203 ? 1.8181 1.4003 1.9351 -0.0239 -0.0318 0.0846  213 THR A N     
1595 C CA    . THR A 203 ? 1.8065 1.4005 1.9559 -0.0431 -0.0213 0.1123  213 THR A CA    
1596 C C     . THR A 203 ? 1.7691 1.3935 1.9167 -0.0584 -0.0185 0.1047  213 THR A C     
1597 O O     . THR A 203 ? 1.7602 1.3852 1.8891 -0.0567 -0.0283 0.0781  213 THR A O     
1598 C CB    . THR A 203 ? 1.8439 1.3941 2.0407 -0.0551 -0.0330 0.1221  213 THR A CB    
1599 O OG1   . THR A 203 ? 1.8493 1.3799 2.0598 -0.0658 -0.0525 0.0959  213 THR A OG1   
1600 C CG2   . THR A 203 ? 1.8885 1.3985 2.0872 -0.0386 -0.0402 0.1243  213 THR A CG2   
1601 N N     . LEU A 204 ? 1.7498 1.4003 1.9152 -0.0712 -0.0047 0.1287  214 LEU A N     
1602 C CA    . LEU A 204 ? 1.7164 1.3960 1.8797 -0.0838 -0.0015 0.1228  214 LEU A CA    
1603 C C     . LEU A 204 ? 1.7274 1.3846 1.9258 -0.1006 -0.0163 0.1146  214 LEU A C     
1604 O O     . LEU A 204 ? 1.7555 1.3858 1.9922 -0.1085 -0.0220 0.1277  214 LEU A O     
1605 C CB    . LEU A 204 ? 1.6939 1.4133 1.8598 -0.0872 0.0184  0.1495  214 LEU A CB    
1606 C CG    . LEU A 204 ? 1.6692 1.4248 1.7957 -0.0743 0.0304  0.1471  214 LEU A CG    
1607 C CD1   . LEU A 204 ? 1.6863 1.4341 1.7935 -0.0557 0.0320  0.1487  214 LEU A CD1   
1608 C CD2   . LEU A 204 ? 1.6508 1.4450 1.7810 -0.0769 0.0466  0.1694  214 LEU A CD2   
1609 N N     . PRO A 205 ? 1.7080 1.3756 1.8948 -0.1057 -0.0235 0.0930  215 PRO A N     
1610 C CA    . PRO A 205 ? 1.7175 1.3683 1.9352 -0.1199 -0.0396 0.0814  215 PRO A CA    
1611 C C     . PRO A 205 ? 1.7100 1.3775 1.9691 -0.1378 -0.0313 0.1069  215 PRO A C     
1612 O O     . PRO A 205 ? 1.7318 1.3781 2.0345 -0.1510 -0.0427 0.1105  215 PRO A O     
1613 C CB    . PRO A 205 ? 1.6949 1.3619 1.8811 -0.1166 -0.0444 0.0563  215 PRO A CB    
1614 C CG    . PRO A 205 ? 1.6651 1.3671 1.8185 -0.1097 -0.0254 0.0652  215 PRO A CG    
1615 C CD    . PRO A 205 ? 1.6770 1.3750 1.8235 -0.0987 -0.0163 0.0802  215 PRO A CD    
1616 N N     . PHE A 206 ? 1.9324 1.6394 2.1789 -0.1377 -0.0121 0.1242  216 PHE A N     
1617 C CA    . PHE A 206 ? 1.9257 1.6558 2.2072 -0.1505 -0.0008 0.1515  216 PHE A CA    
1618 C C     . PHE A 206 ? 1.9281 1.6754 2.2065 -0.1423 0.0190  0.1825  216 PHE A C     
1619 O O     . PHE A 206 ? 1.9072 1.6832 2.1500 -0.1306 0.0316  0.1840  216 PHE A O     
1620 C CB    . PHE A 206 ? 1.6425 1.4076 1.9122 -0.1545 0.0040  0.1448  216 PHE A CB    
1621 C CG    . PHE A 206 ? 1.6397 1.3920 1.9057 -0.1590 -0.0143 0.1146  216 PHE A CG    
1622 C CD1   . PHE A 206 ? 1.6346 1.3778 1.8592 -0.1475 -0.0215 0.0883  216 PHE A CD1   
1623 C CD2   . PHE A 206 ? 1.6435 1.3964 1.9480 -0.1737 -0.0238 0.1139  216 PHE A CD2   
1624 C CE1   . PHE A 206 ? 1.6352 1.3689 1.8537 -0.1487 -0.0374 0.0625  216 PHE A CE1   
1625 C CE2   . PHE A 206 ? 1.6430 1.3865 1.9423 -0.1754 -0.0415 0.0858  216 PHE A CE2   
1626 C CZ    . PHE A 206 ? 1.6397 1.3731 1.8942 -0.1620 -0.0481 0.0604  216 PHE A CZ    
1627 N N     . ASP A 207 ? 1.7050 1.4348 2.0216 -0.1479 0.0212  0.2075  217 ASP A N     
1628 C CA    . ASP A 207 ? 1.7126 1.4585 2.0265 -0.1378 0.0404  0.2402  217 ASP A CA    
1629 C C     . ASP A 207 ? 1.7332 1.4808 2.1008 -0.1506 0.0488  0.2769  217 ASP A C     
1630 O O     . ASP A 207 ? 1.7591 1.4723 2.1698 -0.1651 0.0353  0.2772  217 ASP A O     
1631 C CB    . ASP A 207 ? 2.4092 2.1254 2.7016 -0.1224 0.0364  0.2352  217 ASP A CB    
1632 C CG    . ASP A 207 ? 2.4139 2.1525 2.6919 -0.1070 0.0563  0.2650  217 ASP A CG    
1633 O OD1   . ASP A 207 ? 2.3907 2.1743 2.6544 -0.1024 0.0720  0.2778  217 ASP A OD1   
1634 O OD2   . ASP A 207 ? 2.4433 2.1546 2.7232 -0.0975 0.0552  0.2746  217 ASP A OD2   
1635 N N     . ASP A 208 ? 1.7237 1.5131 2.0896 -0.1447 0.0708  0.3076  218 ASP A N     
1636 C CA    . ASP A 208 ? 1.7444 1.5437 2.1593 -0.1539 0.0838  0.3495  218 ASP A CA    
1637 C C     . ASP A 208 ? 1.7408 1.5836 2.1343 -0.1356 0.1090  0.3818  218 ASP A C     
1638 O O     . ASP A 208 ? 1.7149 1.5894 2.0616 -0.1203 0.1152  0.3684  218 ASP A O     
1639 C CB    . ASP A 208 ? 1.9501 1.7675 2.4046 -0.1737 0.0808  0.3508  218 ASP A CB    
1640 C CG    . ASP A 208 ? 1.9808 1.7887 2.5033 -0.1913 0.0845  0.3865  218 ASP A CG    
1641 O OD1   . ASP A 208 ? 2.0119 1.7702 2.5658 -0.2019 0.0686  0.3822  218 ASP A OD1   
1642 O OD2   . ASP A 208 ? 1.9758 1.8265 2.5222 -0.1945 0.1028  0.4186  218 ASP A OD2   
1643 N N     . ASP A 209 ? 1.7697 1.6144 2.1984 -0.1366 0.1230  0.4244  219 ASP A N     
1644 C CA    . ASP A 209 ? 1.7721 1.6604 2.1815 -0.1165 0.1476  0.4584  219 ASP A CA    
1645 C C     . ASP A 209 ? 1.7514 1.6957 2.1685 -0.1178 0.1623  0.4733  219 ASP A C     
1646 O O     . ASP A 209 ? 1.7348 1.7241 2.1123 -0.0978 0.1753  0.4753  219 ASP A O     
1647 C CB    . ASP A 209 ? 1.8231 1.6923 2.2665 -0.1150 0.1585  0.5021  219 ASP A CB    
1648 C CG    . ASP A 209 ? 1.8485 1.6606 2.2838 -0.1108 0.1436  0.4878  219 ASP A CG    
1649 O OD1   . ASP A 209 ? 1.8347 1.6452 2.2183 -0.0935 0.1379  0.4604  219 ASP A OD1   
1650 O OD2   . ASP A 209 ? 1.8843 1.6532 2.3671 -0.1247 0.1369  0.5039  219 ASP A OD2   
1651 N N     . HIS A 210 ? 2.4325 2.3746 2.9021 -0.1405 0.1588  0.4820  220 HIS A N     
1652 C CA    . HIS A 210 ? 2.4171 2.4124 2.9029 -0.1428 0.1729  0.4994  220 HIS A CA    
1653 C C     . HIS A 210 ? 2.3813 2.3859 2.8460 -0.1481 0.1587  0.4572  220 HIS A C     
1654 O O     . HIS A 210 ? 2.3765 2.3420 2.8492 -0.1632 0.1367  0.4250  220 HIS A O     
1655 C CB    . HIS A 210 ? 1.8436 1.8362 2.4045 -0.1648 0.1784  0.5370  220 HIS A CB    
1656 C CG    . HIS A 210 ? 1.8283 1.8733 2.4161 -0.1712 0.1896  0.5522  220 HIS A CG    
1657 N ND1   . HIS A 210 ? 1.8105 1.9155 2.3626 -0.1491 0.2085  0.5616  220 HIS A ND1   
1658 C CD2   . HIS A 210 ? 1.8305 1.8790 2.4790 -0.1960 0.1841  0.5595  220 HIS A CD2   
1659 C CE1   . HIS A 210 ? 1.8020 1.9452 2.3896 -0.1589 0.2150  0.5744  220 HIS A CE1   
1660 N NE2   . HIS A 210 ? 1.8127 1.9240 2.4603 -0.1881 0.2008  0.5740  220 HIS A NE2   
1661 N N     . VAL A 211 ? 1.8730 1.9288 2.3084 -0.1333 0.1709  0.4567  221 VAL A N     
1662 C CA    . VAL A 211 ? 1.8423 1.9101 2.2593 -0.1366 0.1598  0.4215  221 VAL A CA    
1663 C C     . VAL A 211 ? 1.8365 1.9553 2.2814 -0.1382 0.1735  0.4438  221 VAL A C     
1664 O O     . VAL A 211 ? 1.8523 2.0066 2.3135 -0.1292 0.1947  0.4845  221 VAL A O     
1665 C CB    . VAL A 211 ? 1.6296 1.7077 1.9800 -0.1156 0.1578  0.3917  221 VAL A CB    
1666 C CG1   . VAL A 211 ? 1.6347 1.6677 1.9609 -0.1141 0.1450  0.3707  221 VAL A CG1   
1667 C CG2   . VAL A 211 ? 1.6335 1.7613 1.9579 -0.0904 0.1791  0.4159  221 VAL A CG2   
1668 N N     . PRO A 212 ? 2.1933 2.3190 2.6438 -0.1478 0.1624  0.4192  222 PRO A N     
1669 C CA    . PRO A 212 ? 2.1744 2.2684 2.6072 -0.1568 0.1392  0.3738  222 PRO A CA    
1670 C C     . PRO A 212 ? 2.1874 2.2278 2.6536 -0.1789 0.1187  0.3604  222 PRO A C     
1671 O O     . PRO A 212 ? 2.1746 2.1907 2.6242 -0.1839 0.0999  0.3237  222 PRO A O     
1672 C CB    . PRO A 212 ? 2.0271 2.1588 2.4706 -0.1585 0.1404  0.3688  222 PRO A CB    
1673 C CG    . PRO A 212 ? 2.0415 2.2123 2.5332 -0.1619 0.1589  0.4126  222 PRO A CG    
1674 C CD    . PRO A 212 ? 2.0601 2.2389 2.5394 -0.1471 0.1770  0.4436  222 PRO A CD    
1675 N N     . THR A 213 ? 1.6453 1.6690 2.1595 -0.1912 0.1215  0.3890  223 THR A N     
1676 C CA    . THR A 213 ? 1.6630 1.6341 2.2118 -0.2112 0.0994  0.3739  223 THR A CA    
1677 C C     . THR A 213 ? 1.6572 1.5857 2.1589 -0.2044 0.0810  0.3327  223 THR A C     
1678 O O     . THR A 213 ? 1.6614 1.5563 2.1756 -0.2163 0.0588  0.3050  223 THR A O     
1679 C CB    . THR A 213 ? 1.7350 1.6840 2.3303 -0.2203 0.1052  0.4095  223 THR A CB    
1680 O OG1   . THR A 213 ? 1.7405 1.7206 2.3169 -0.2019 0.1309  0.4446  223 THR A OG1   
1681 C CG2   . THR A 213 ? 1.7502 1.7075 2.4224 -0.2447 0.1032  0.4321  223 THR A CG2   
1682 N N     . LEU A 214 ? 1.6492 1.5820 2.0977 -0.1843 0.0898  0.3285  224 LEU A N     
1683 C CA    . LEU A 214 ? 1.6400 1.5427 2.0422 -0.1765 0.0750  0.2906  224 LEU A CA    
1684 C C     . LEU A 214 ? 1.6132 1.5276 1.9935 -0.1776 0.0652  0.2592  224 LEU A C     
1685 O O     . LEU A 214 ? 1.6123 1.4963 1.9826 -0.1819 0.0465  0.2285  224 LEU A O     
1686 C CB    . LEU A 214 ? 1.6363 1.5486 1.9906 -0.1553 0.0871  0.2944  224 LEU A CB    
1687 C CG    . LEU A 214 ? 1.6352 1.5153 1.9492 -0.1467 0.0749  0.2646  224 LEU A CG    
1688 C CD1   . LEU A 214 ? 1.6431 1.5306 1.9300 -0.1286 0.0874  0.2795  224 LEU A CD1   
1689 C CD2   . LEU A 214 ? 1.6074 1.4969 1.8832 -0.1427 0.0676  0.2316  224 LEU A CD2   
1690 N N     . PHE A 215 ? 2.1462 2.1047 2.5170 -0.1714 0.0780  0.2673  225 PHE A N     
1691 C CA    . PHE A 215 ? 2.1235 2.0937 2.4740 -0.1709 0.0700  0.2404  225 PHE A CA    
1692 C C     . PHE A 215 ? 2.1275 2.0875 2.5202 -0.1889 0.0548  0.2318  225 PHE A C     
1693 O O     . PHE A 215 ? 2.1173 2.0657 2.4940 -0.1903 0.0402  0.2023  225 PHE A O     
1694 C CB    . PHE A 215 ? 1.8468 1.8662 2.1801 -0.1581 0.0866  0.2518  225 PHE A CB    
1695 C CG    . PHE A 215 ? 1.8450 1.8798 2.1386 -0.1389 0.0999  0.2587  225 PHE A CG    
1696 C CD1   . PHE A 215 ? 1.8420 1.8517 2.0974 -0.1320 0.0929  0.2375  225 PHE A CD1   
1697 C CD2   . PHE A 215 ? 1.8482 1.9261 2.1432 -0.1264 0.1192  0.2867  225 PHE A CD2   
1698 C CE1   . PHE A 215 ? 1.8413 1.8679 2.0631 -0.1145 0.1034  0.2424  225 PHE A CE1   
1699 C CE2   . PHE A 215 ? 1.8493 1.9434 2.1069 -0.1067 0.1294  0.2909  225 PHE A CE2   
1700 C CZ    . PHE A 215 ? 1.8454 1.9134 2.0676 -0.1016 0.1206  0.2679  225 PHE A CZ    
1701 N N     . LYS A 216 ? 1.5925 1.5582 2.0406 -0.2023 0.0583  0.2585  226 LYS A N     
1702 C CA    . LYS A 216 ? 1.6008 1.5556 2.0973 -0.2213 0.0414  0.2506  226 LYS A CA    
1703 C C     . LYS A 216 ? 1.6187 1.5193 2.1157 -0.2277 0.0182  0.2244  226 LYS A C     
1704 O O     . LYS A 216 ? 1.6211 1.5066 2.1316 -0.2362 -0.0023 0.1993  226 LYS A O     
1705 C CB    . LYS A 216 ? 1.6171 1.5933 2.1789 -0.2356 0.0516  0.2890  226 LYS A CB    
1706 C CG    . LYS A 216 ? 1.6034 1.6384 2.1670 -0.2268 0.0755  0.3172  226 LYS A CG    
1707 C CD    . LYS A 216 ? 1.5815 1.6453 2.1386 -0.2253 0.0701  0.2981  226 LYS A CD    
1708 C CE    . LYS A 216 ? 1.5675 1.6870 2.1060 -0.2081 0.0932  0.3182  226 LYS A CE    
1709 N NZ    . LYS A 216 ? 1.5505 1.7007 2.0898 -0.2061 0.0889  0.3039  226 LYS A NZ    
1710 N N     . LYS A 217 ? 1.6333 1.5066 2.1138 -0.2210 0.0211  0.2295  227 LYS A N     
1711 C CA    . LYS A 217 ? 1.6521 1.4753 2.1243 -0.2215 0.0004  0.2034  227 LYS A CA    
1712 C C     . LYS A 217 ? 1.6332 1.4508 2.0495 -0.2089 -0.0087 0.1673  227 LYS A C     
1713 O O     . LYS A 217 ? 1.6443 1.4314 2.0557 -0.2098 -0.0295 0.1388  227 LYS A O     
1714 C CB    . LYS A 217 ? 1.6728 1.4724 2.1384 -0.2142 0.0080  0.2201  227 LYS A CB    
1715 C CG    . LYS A 217 ? 1.7094 1.4582 2.2072 -0.2229 -0.0112 0.2128  227 LYS A CG    
1716 C CD    . LYS A 217 ? 1.7316 1.4633 2.2290 -0.2153 0.0006  0.2382  227 LYS A CD    
1717 C CE    . LYS A 217 ? 1.7740 1.4533 2.3115 -0.2248 -0.0182 0.2351  227 LYS A CE    
1718 N NZ    . LYS A 217 ? 1.7992 1.4613 2.3397 -0.2170 -0.0058 0.2639  227 LYS A NZ    
1719 N N     . ILE A 218 ? 1.6076 1.4554 1.9828 -0.1964 0.0067  0.1693  228 ILE A N     
1720 C CA    . ILE A 218 ? 1.5898 1.4360 1.9150 -0.1856 0.0011  0.1402  228 ILE A CA    
1721 C C     . ILE A 218 ? 1.5784 1.4368 1.9099 -0.1908 -0.0091 0.1235  228 ILE A C     
1722 O O     . ILE A 218 ? 1.5797 1.4192 1.8906 -0.1876 -0.0244 0.0959  228 ILE A O     
1723 C CB    . ILE A 218 ? 1.5700 1.4424 1.8536 -0.1714 0.0193  0.1474  228 ILE A CB    
1724 C CG1   . ILE A 218 ? 1.5799 1.4349 1.8414 -0.1617 0.0237  0.1507  228 ILE A CG1   
1725 C CG2   . ILE A 218 ? 1.5506 1.4300 1.7955 -0.1645 0.0154  0.1230  228 ILE A CG2   
1726 C CD1   . ILE A 218 ? 1.5629 1.4433 1.7848 -0.1477 0.0383  0.1540  228 ILE A CD1   
1727 N N     . CYS A 219 ? 1.6709 1.5630 2.0295 -0.1968 -0.0003 0.1409  229 CYS A N     
1728 C CA    . CYS A 219 ? 1.6619 1.5689 2.0310 -0.2012 -0.0099 0.1273  229 CYS A CA    
1729 C C     . CYS A 219 ? 1.6804 1.5587 2.0760 -0.2112 -0.0344 0.1067  229 CYS A C     
1730 O O     . CYS A 219 ? 1.6765 1.5518 2.0568 -0.2079 -0.0480 0.0822  229 CYS A O     
1731 C CB    . CYS A 219 ? 2.4226 2.3715 2.8281 -0.2070 0.0030  0.1530  229 CYS A CB    
1732 S SG    . CYS A 219 ? 2.4005 2.3907 2.7672 -0.1899 0.0262  0.1657  229 CYS A SG    
1733 N N     . ASP A 220 ? 1.6022 1.4588 2.0377 -0.2223 -0.0408 0.1165  230 ASP A N     
1734 C CA    . ASP A 220 ? 1.6263 1.4493 2.0853 -0.2298 -0.0670 0.0935  230 ASP A CA    
1735 C C     . ASP A 220 ? 1.6364 1.4230 2.0492 -0.2160 -0.0765 0.0690  230 ASP A C     
1736 O O     . ASP A 220 ? 1.6361 1.4140 2.0241 -0.2079 -0.0640 0.0792  230 ASP A O     
1737 C CB    . ASP A 220 ? 1.7011 1.5117 2.2249 -0.2476 -0.0714 0.1135  230 ASP A CB    
1738 C CG    . ASP A 220 ? 1.6932 1.5443 2.2689 -0.2619 -0.0616 0.1398  230 ASP A CG    
1739 O OD1   . ASP A 220 ? 1.6671 1.5568 2.2231 -0.2552 -0.0489 0.1442  230 ASP A OD1   
1740 O OD2   . ASP A 220 ? 1.7153 1.5599 2.3529 -0.2795 -0.0666 0.1569  230 ASP A OD2   
1741 N N     . GLY A 221 ? 2.0173 1.7852 2.4194 -0.2118 -0.0989 0.0373  231 GLY A N     
1742 C CA    . GLY A 221 ? 2.0264 1.7672 2.3806 -0.1954 -0.1068 0.0135  231 GLY A CA    
1743 C C     . GLY A 221 ? 2.0606 1.7613 2.4325 -0.1961 -0.1212 0.0066  231 GLY A C     
1744 O O     . GLY A 221 ? 2.0788 1.7543 2.4241 -0.1832 -0.1372 -0.0204 231 GLY A O     
1745 N N     . ILE A 222 ? 1.7030 1.3980 2.1212 -0.2100 -0.1158 0.0313  232 ILE A N     
1746 C CA    . ILE A 222 ? 1.7407 1.3936 2.1841 -0.2124 -0.1307 0.0268  232 ILE A CA    
1747 C C     . ILE A 222 ? 1.7436 1.3831 2.1569 -0.2003 -0.1152 0.0404  232 ILE A C     
1748 O O     . ILE A 222 ? 1.7235 1.3873 2.1304 -0.2007 -0.0908 0.0692  232 ILE A O     
1749 C CB    . ILE A 222 ? 2.1792 1.8288 2.6978 -0.2358 -0.1362 0.0470  232 ILE A CB    
1750 C CG1   . ILE A 222 ? 2.2258 1.8245 2.7759 -0.2394 -0.1601 0.0333  232 ILE A CG1   
1751 C CG2   . ILE A 222 ? 2.1633 1.8404 2.7011 -0.2440 -0.1071 0.0913  232 ILE A CG2   
1752 C CD1   . ILE A 222 ? 2.2493 1.8417 2.8795 -0.2646 -0.1737 0.0438  232 ILE A CD1   
1753 N N     . PHE A 223 ? 1.7797 1.3834 2.1705 -0.1867 -0.1300 0.0175  233 PHE A N     
1754 C CA    . PHE A 223 ? 1.7867 1.3760 2.1490 -0.1729 -0.1184 0.0269  233 PHE A CA    
1755 C C     . PHE A 223 ? 1.8305 1.3715 2.1943 -0.1629 -0.1412 0.0038  233 PHE A C     
1756 O O     . PHE A 223 ? 1.8486 1.3730 2.2098 -0.1582 -0.1651 -0.0285 233 PHE A O     
1757 C CB    . PHE A 223 ? 1.7851 1.4009 2.0860 -0.1562 -0.1025 0.0220  233 PHE A CB    
1758 C CG    . PHE A 223 ? 1.7842 1.3984 2.0487 -0.1435 -0.1168 -0.0118 233 PHE A CG    
1759 C CD1   . PHE A 223 ? 1.7700 1.4028 2.0389 -0.1499 -0.1236 -0.0228 233 PHE A CD1   
1760 C CD2   . PHE A 223 ? 1.7987 1.3962 2.0231 -0.1231 -0.1222 -0.0307 233 PHE A CD2   
1761 C CE1   . PHE A 223 ? 1.7722 1.4048 2.0059 -0.1361 -0.1357 -0.0512 233 PHE A CE1   
1762 C CE2   . PHE A 223 ? 1.8003 1.4002 1.9901 -0.1093 -0.1333 -0.0585 233 PHE A CE2   
1763 C CZ    . PHE A 223 ? 1.7877 1.4044 1.9817 -0.1157 -0.1400 -0.0682 233 PHE A CZ    
1764 N N     . TYR A 224 ? 2.1165 1.6357 2.4825 -0.1572 -0.1344 0.0194  234 TYR A N     
1765 C CA    . TYR A 224 ? 2.1629 1.6330 2.5319 -0.1460 -0.1557 -0.0007 234 TYR A CA    
1766 C C     . TYR A 224 ? 2.1646 1.6318 2.4736 -0.1198 -0.1633 -0.0332 234 TYR A C     
1767 O O     . TYR A 224 ? 2.1408 1.6309 2.4060 -0.1061 -0.1443 -0.0259 234 TYR A O     
1768 C CB    . TYR A 224 ? 2.3603 1.8104 2.7444 -0.1447 -0.1436 0.0282  234 TYR A CB    
1769 C CG    . TYR A 224 ? 2.4122 1.8083 2.7997 -0.1313 -0.1644 0.0100  234 TYR A CG    
1770 C CD1   . TYR A 224 ? 2.4481 1.8090 2.8516 -0.1302 -0.1966 -0.0257 234 TYR A CD1   
1771 C CD2   . TYR A 224 ? 2.4282 1.8086 2.8020 -0.1178 -0.1530 0.0274  234 TYR A CD2   
1772 C CE1   . TYR A 224 ? 2.4999 1.8094 2.9052 -0.1155 -0.2173 -0.0448 234 TYR A CE1   
1773 C CE2   . TYR A 224 ? 2.4787 1.8081 2.8545 -0.1033 -0.1722 0.0105  234 TYR A CE2   
1774 C CZ    . TYR A 224 ? 2.5152 1.8081 2.9067 -0.1021 -0.2047 -0.0262 234 TYR A CZ    
1775 O OH    . TYR A 224 ? 2.5696 1.8098 2.9620 -0.0855 -0.2257 -0.0457 234 TYR A OH    
1776 N N     . THR A 225 ? 1.9497 1.3903 2.2590 -0.1120 -0.1915 -0.0687 235 THR A N     
1777 C CA    . THR A 225 ? 1.9580 1.3968 2.2121 -0.0846 -0.2004 -0.1003 235 THR A CA    
1778 C C     . THR A 225 ? 2.0126 1.4021 2.2697 -0.0683 -0.2233 -0.1223 235 THR A C     
1779 O O     . THR A 225 ? 2.0471 1.4105 2.3187 -0.0651 -0.2524 -0.1529 235 THR A O     
1780 C CB    . THR A 225 ? 1.9193 1.3751 2.1590 -0.0819 -0.2149 -0.1277 235 THR A CB    
1781 O OG1   . THR A 225 ? 1.9509 1.3804 2.2384 -0.0944 -0.2428 -0.1449 235 THR A OG1   
1782 C CG2   . THR A 225 ? 1.8687 1.3707 2.1015 -0.0949 -0.1932 -0.1083 235 THR A CG2   
1783 N N     . PRO A 226 ? 2.3561 1.7323 2.5998 -0.0565 -0.2117 -0.1079 236 PRO A N     
1784 C CA    . PRO A 226 ? 2.4119 1.7375 2.6606 -0.0400 -0.2328 -0.1263 236 PRO A CA    
1785 C C     . PRO A 226 ? 2.4375 1.7548 2.6421 -0.0104 -0.2536 -0.1693 236 PRO A C     
1786 O O     . PRO A 226 ? 2.4074 1.7632 2.5688 0.0006  -0.2441 -0.1776 236 PRO A O     
1787 C CB    . PRO A 226 ? 2.0432 1.3712 2.2747 -0.0301 -0.2099 -0.0991 236 PRO A CB    
1788 C CG    . PRO A 226 ? 1.9864 1.3704 2.1829 -0.0308 -0.1814 -0.0815 236 PRO A CG    
1789 C CD    . PRO A 226 ? 1.9554 1.3644 2.1759 -0.0552 -0.1797 -0.0763 236 PRO A CD    
1790 N N     . GLN A 227 ? 2.1317 1.3995 2.3473 0.0037  -0.2814 -0.1953 237 GLN A N     
1791 C CA    . GLN A 227 ? 2.1658 1.4229 2.3389 0.0366  -0.3037 -0.2385 237 GLN A CA    
1792 C C     . GLN A 227 ? 2.1578 1.4357 2.2717 0.0672  -0.2852 -0.2364 237 GLN A C     
1793 O O     . GLN A 227 ? 2.1821 1.4611 2.2528 0.0989  -0.2974 -0.2672 237 GLN A O     
1794 C CB    . GLN A 227 ? 2.4165 1.6117 2.6218 0.0432  -0.3409 -0.2684 237 GLN A CB    
1795 C CG    . GLN A 227 ? 2.4600 1.6164 2.6528 0.0669  -0.3451 -0.2717 237 GLN A CG    
1796 C CD    . GLN A 227 ? 2.5055 1.6473 2.6510 0.1083  -0.3690 -0.3177 237 GLN A CD    
1797 O OE1   . GLN A 227 ? 2.4894 1.6677 2.5909 0.1255  -0.3688 -0.3372 237 GLN A OE1   
1798 N NE2   . GLN A 227 ? 2.5661 1.6539 2.7199 0.1262  -0.3899 -0.3346 237 GLN A NE2   
1799 N N     . TYR A 228 ? 2.1299 1.4290 2.2431 0.0578  -0.2554 -0.1991 238 TYR A N     
1800 C CA    . TYR A 228 ? 2.1147 1.4405 2.1808 0.0809  -0.2339 -0.1897 238 TYR A CA    
1801 C C     . TYR A 228 ? 2.1012 1.4649 2.1130 0.1045  -0.2312 -0.2111 238 TYR A C     
1802 O O     . TYR A 228 ? 2.1202 1.4887 2.0927 0.1356  -0.2305 -0.2238 238 TYR A O     
1803 C CB    . TYR A 228 ? 2.1890 1.5494 2.2649 0.0594  -0.2015 -0.1471 238 TYR A CB    
1804 C CG    . TYR A 228 ? 2.1870 1.5551 2.2438 0.0742  -0.1829 -0.1273 238 TYR A CG    
1805 C CD1   . TYR A 228 ? 2.1933 1.5789 2.2021 0.1055  -0.1790 -0.1414 238 TYR A CD1   
1806 C CD2   . TYR A 228 ? 2.1793 1.5415 2.2663 0.0580  -0.1684 -0.0929 238 TYR A CD2   
1807 C CE1   . TYR A 228 ? 2.1912 1.5875 2.1846 0.1194  -0.1626 -0.1237 238 TYR A CE1   
1808 C CE2   . TYR A 228 ? 2.1788 1.5503 2.2477 0.0731  -0.1522 -0.0752 238 TYR A CE2   
1809 C CZ    . TYR A 228 ? 2.1841 1.5726 2.2070 0.1033  -0.1500 -0.0915 238 TYR A CZ    
1810 O OH    . TYR A 228 ? 2.1837 1.5848 2.1903 0.1190  -0.1348 -0.0744 238 TYR A OH    
1811 N N     . LEU A 229 ? 2.1611 1.5517 2.1722 0.0909  -0.2301 -0.2144 239 LEU A N     
1812 C CA    . LEU A 229 ? 2.1445 1.5752 2.1073 0.1097  -0.2234 -0.2273 239 LEU A CA    
1813 C C     . LEU A 229 ? 2.1618 1.5878 2.1235 0.1127  -0.2470 -0.2568 239 LEU A C     
1814 O O     . LEU A 229 ? 2.1791 1.5754 2.1823 0.0951  -0.2674 -0.2658 239 LEU A O     
1815 C CB    . LEU A 229 ? 1.9882 1.4684 1.9414 0.0929  -0.1914 -0.1961 239 LEU A CB    
1816 C CG    . LEU A 229 ? 1.9514 1.4393 1.9444 0.0565  -0.1822 -0.1722 239 LEU A CG    
1817 C CD1   . LEU A 229 ? 1.9446 1.4410 1.9421 0.0477  -0.1939 -0.1867 239 LEU A CD1   
1818 C CD2   . LEU A 229 ? 1.9025 1.4309 1.8852 0.0459  -0.1511 -0.1411 239 LEU A CD2   
1819 N N     . ASN A 230 ? 2.2824 1.7403 2.1974 0.1358  -0.2436 -0.2706 240 ASN A N     
1820 C CA    . ASN A 230 ? 2.3012 1.7617 2.2040 0.1461  -0.2646 -0.2993 240 ASN A CA    
1821 C C     . ASN A 230 ? 2.2621 1.7428 2.1877 0.1166  -0.2587 -0.2860 240 ASN A C     
1822 O O     . ASN A 230 ? 2.2161 1.7173 2.1567 0.0919  -0.2343 -0.2538 240 ASN A O     
1823 C CB    . ASN A 230 ? 2.1503 1.6437 1.9930 0.1826  -0.2581 -0.3120 240 ASN A CB    
1824 C CG    . ASN A 230 ? 2.0986 1.6412 1.9193 0.1757  -0.2225 -0.2798 240 ASN A CG    
1825 O OD1   . ASN A 230 ? 2.0606 1.6254 1.8908 0.1534  -0.2107 -0.2636 240 ASN A OD1   
1826 N ND2   . ASN A 230 ? 2.0990 1.6592 1.8919 0.1952  -0.2062 -0.2712 240 ASN A ND2   
1827 N N     . PRO A 231 ? 2.1642 1.6409 2.0913 0.1212  -0.2822 -0.3120 241 PRO A N     
1828 C CA    . PRO A 231 ? 2.1301 1.6267 2.0790 0.0956  -0.2782 -0.3010 241 PRO A CA    
1829 C C     . PRO A 231 ? 2.0868 1.6308 2.0009 0.0964  -0.2502 -0.2802 241 PRO A C     
1830 O O     . PRO A 231 ? 2.0511 1.6113 1.9861 0.0715  -0.2399 -0.2622 241 PRO A O     
1831 C CB    . PRO A 231 ? 2.0693 1.5513 2.0211 0.1085  -0.3131 -0.3391 241 PRO A CB    
1832 C CG    . PRO A 231 ? 2.1155 1.5883 2.0230 0.1491  -0.3265 -0.3675 241 PRO A CG    
1833 C CD    . PRO A 231 ? 2.1210 1.5727 2.0344 0.1500  -0.3161 -0.3545 241 PRO A CD    
1834 N N     . SER A 232 ? 2.0493 1.6149 1.9135 0.1246  -0.2386 -0.2822 242 SER A N     
1835 C CA    . SER A 232 ? 2.0125 1.6211 1.8470 0.1247  -0.2119 -0.2608 242 SER A CA    
1836 C C     . SER A 232 ? 1.9628 1.5841 1.8213 0.0938  -0.1854 -0.2252 242 SER A C     
1837 O O     . SER A 232 ? 1.9292 1.5730 1.7905 0.0776  -0.1718 -0.2088 242 SER A O     
1838 C CB    . SER A 232 ? 2.9214 2.5522 2.7052 0.1588  -0.2015 -0.2643 242 SER A CB    
1839 O OG    . SER A 232 ? 2.9693 2.5937 2.7251 0.1916  -0.2253 -0.2976 242 SER A OG    
1840 N N     . VAL A 233 ? 1.9032 1.5094 1.7781 0.0877  -0.1792 -0.2145 243 VAL A N     
1841 C CA    . VAL A 233 ? 1.8615 1.4795 1.7586 0.0617  -0.1563 -0.1829 243 VAL A CA    
1842 C C     . VAL A 233 ? 1.8463 1.4524 1.7882 0.0322  -0.1623 -0.1752 243 VAL A C     
1843 O O     . VAL A 233 ? 1.8082 1.4351 1.7612 0.0121  -0.1446 -0.1526 243 VAL A O     
1844 C CB    . VAL A 233 ? 1.8692 1.4742 1.7714 0.0660  -0.1498 -0.1740 243 VAL A CB    
1845 C CG1   . VAL A 233 ? 1.8284 1.4494 1.7504 0.0421  -0.1270 -0.1425 243 VAL A CG1   
1846 C CG2   . VAL A 233 ? 1.8839 1.5057 1.7434 0.0961  -0.1430 -0.1808 243 VAL A CG2   
1847 N N     . ILE A 234 ? 1.8781 1.4522 1.8474 0.0302  -0.1879 -0.1944 244 ILE A N     
1848 C CA    . ILE A 234 ? 1.8669 1.4324 1.8845 0.0022  -0.1945 -0.1865 244 ILE A CA    
1849 C C     . ILE A 234 ? 1.8437 1.4356 1.8563 -0.0053 -0.1925 -0.1866 244 ILE A C     
1850 O O     . ILE A 234 ? 1.8126 1.4185 1.8510 -0.0285 -0.1811 -0.1664 244 ILE A O     
1851 C CB    . ILE A 234 ? 1.9108 1.4359 1.9634 0.0012  -0.2251 -0.2091 244 ILE A CB    
1852 C CG1   . ILE A 234 ? 1.9358 1.4303 1.9975 0.0070  -0.2265 -0.2057 244 ILE A CG1   
1853 C CG2   . ILE A 234 ? 1.8992 1.4211 2.0063 -0.0289 -0.2312 -0.1991 244 ILE A CG2   
1854 C CD1   . ILE A 234 ? 1.9853 1.4339 2.0829 0.0069  -0.2577 -0.2284 244 ILE A CD1   
1855 N N     . SER A 235 ? 2.1247 1.7248 2.1023 0.0169  -0.2031 -0.2087 245 SER A N     
1856 C CA    . SER A 235 ? 2.1075 1.7323 2.0746 0.0146  -0.2014 -0.2092 245 SER A CA    
1857 C C     . SER A 235 ? 2.0650 1.7203 2.0142 0.0063  -0.1709 -0.1808 245 SER A C     
1858 O O     . SER A 235 ? 2.0402 1.7123 1.9986 -0.0077 -0.1641 -0.1701 245 SER A O     
1859 C CB    . SER A 235 ? 2.3058 1.9345 2.2338 0.0448  -0.2178 -0.2370 245 SER A CB    
1860 O OG    . SER A 235 ? 2.3111 1.9522 2.1940 0.0682  -0.2037 -0.2344 245 SER A OG    
1861 N N     . LEU A 236 ? 1.7955 1.4579 1.7206 0.0156  -0.1538 -0.1699 246 LEU A N     
1862 C CA    . LEU A 236 ? 1.7582 1.4474 1.6714 0.0065  -0.1265 -0.1441 246 LEU A CA    
1863 C C     . LEU A 236 ? 1.7290 1.4185 1.6793 -0.0208 -0.1160 -0.1227 246 LEU A C     
1864 O O     . LEU A 236 ? 1.7014 1.4086 1.6575 -0.0346 -0.1050 -0.1091 246 LEU A O     
1865 C CB    . LEU A 236 ? 1.7619 1.4602 1.6461 0.0229  -0.1131 -0.1390 246 LEU A CB    
1866 C CG    . LEU A 236 ? 1.7270 1.4522 1.6034 0.0133  -0.0867 -0.1140 246 LEU A CG    
1867 C CD1   . LEU A 236 ? 1.7123 1.4593 1.5713 0.0121  -0.0777 -0.1077 246 LEU A CD1   
1868 C CD2   . LEU A 236 ? 1.7344 1.4692 1.5890 0.0296  -0.0765 -0.1108 246 LEU A CD2   
1869 N N     . LEU A 237 ? 1.7387 1.4085 1.7131 -0.0262 -0.1197 -0.1196 247 LEU A N     
1870 C CA    . LEU A 237 ? 1.7162 1.3881 1.7243 -0.0484 -0.1088 -0.0973 247 LEU A CA    
1871 C C     . LEU A 237 ? 1.7067 1.3813 1.7466 -0.0662 -0.1157 -0.0952 247 LEU A C     
1872 O O     . LEU A 237 ? 1.6782 1.3716 1.7303 -0.0810 -0.1011 -0.0759 247 LEU A O     
1873 C CB    . LEU A 237 ? 1.7368 1.3833 1.7661 -0.0485 -0.1139 -0.0944 247 LEU A CB    
1874 C CG    . LEU A 237 ? 1.7382 1.3885 1.7424 -0.0343 -0.1014 -0.0881 247 LEU A CG    
1875 C CD1   . LEU A 237 ? 1.7704 1.3883 1.7914 -0.0284 -0.1124 -0.0919 247 LEU A CD1   
1876 C CD2   . LEU A 237 ? 1.7027 1.3800 1.7063 -0.0453 -0.0777 -0.0625 247 LEU A CD2   
1877 N N     . LYS A 238 ? 1.7320 1.3903 1.7851 -0.0635 -0.1387 -0.1161 248 LYS A N     
1878 C CA    . LYS A 238 ? 1.7246 1.3889 1.8111 -0.0798 -0.1469 -0.1155 248 LYS A CA    
1879 C C     . LYS A 238 ? 1.6992 1.3916 1.7642 -0.0796 -0.1365 -0.1111 248 LYS A C     
1880 O O     . LYS A 238 ? 1.6771 1.3855 1.7645 -0.0952 -0.1291 -0.0969 248 LYS A O     
1881 C CB    . LYS A 238 ? 1.7604 1.4026 1.8654 -0.0752 -0.1766 -0.1425 248 LYS A CB    
1882 C CG    . LYS A 238 ? 1.7828 1.3969 1.9350 -0.0877 -0.1891 -0.1413 248 LYS A CG    
1883 C CD    . LYS A 238 ? 1.8216 1.4130 1.9941 -0.0832 -0.2220 -0.1721 248 LYS A CD    
1884 C CE    . LYS A 238 ? 1.8412 1.4077 2.0761 -0.1037 -0.2347 -0.1666 248 LYS A CE    
1885 N NZ    . LYS A 238 ? 1.8546 1.3958 2.0940 -0.1026 -0.2271 -0.1539 248 LYS A NZ    
1886 N N     . HIS A 239 ? 1.7049 1.4037 1.7268 -0.0607 -0.1356 -0.1221 249 HIS A N     
1887 C CA    . HIS A 239 ? 1.6860 1.4076 1.6853 -0.0586 -0.1256 -0.1169 249 HIS A CA    
1888 C C     . HIS A 239 ? 1.6538 1.3926 1.6465 -0.0682 -0.1003 -0.0926 249 HIS A C     
1889 O O     . HIS A 239 ? 1.6341 1.3891 1.6255 -0.0749 -0.0915 -0.0833 249 HIS A O     
1890 C CB    . HIS A 239 ? 1.8286 1.5525 1.7843 -0.0341 -0.1308 -0.1326 249 HIS A CB    
1891 C CG    . HIS A 239 ? 1.8153 1.5592 1.7468 -0.0302 -0.1206 -0.1257 249 HIS A CG    
1892 N ND1   . HIS A 239 ? 1.7962 1.5509 1.7456 -0.0438 -0.1180 -0.1174 249 HIS A ND1   
1893 C CD2   . HIS A 239 ? 1.8213 1.5762 1.7130 -0.0131 -0.1120 -0.1244 249 HIS A CD2   
1894 C CE1   . HIS A 239 ? 1.7921 1.5597 1.7131 -0.0353 -0.1093 -0.1123 249 HIS A CE1   
1895 N NE2   . HIS A 239 ? 1.8071 1.5753 1.6940 -0.0176 -0.1050 -0.1152 249 HIS A NE2   
1896 N N     . MET A 240 ? 1.6512 1.3862 1.6397 -0.0674 -0.0900 -0.0839 250 MET A N     
1897 C CA    . MET A 240 ? 1.6242 1.3762 1.6070 -0.0750 -0.0685 -0.0637 250 MET A CA    
1898 C C     . MET A 240 ? 1.6065 1.3640 1.6235 -0.0930 -0.0623 -0.0475 250 MET A C     
1899 O O     . MET A 240 ? 1.5837 1.3593 1.5992 -0.1001 -0.0484 -0.0342 250 MET A O     
1900 C CB    . MET A 240 ? 1.6296 1.3798 1.5947 -0.0651 -0.0608 -0.0613 250 MET A CB    
1901 C CG    . MET A 240 ? 1.6086 1.3801 1.5543 -0.0656 -0.0419 -0.0483 250 MET A CG    
1902 S SD    . MET A 240 ? 1.6113 1.3864 1.5467 -0.0573 -0.0323 -0.0424 250 MET A SD    
1903 C CE    . MET A 240 ? 1.6465 1.4055 1.5616 -0.0347 -0.0465 -0.0625 250 MET A CE    
1904 N N     . LEU A 241 ? 1.6204 1.3624 1.6685 -0.0991 -0.0728 -0.0486 251 LEU A N     
1905 C CA    . LEU A 241 ? 1.6095 1.3575 1.6940 -0.1149 -0.0669 -0.0305 251 LEU A CA    
1906 C C     . LEU A 241 ? 1.6074 1.3620 1.7213 -0.1257 -0.0758 -0.0319 251 LEU A C     
1907 O O     . LEU A 241 ? 1.6063 1.3640 1.7578 -0.1384 -0.0747 -0.0183 251 LEU A O     
1908 C CB    . LEU A 241 ? 1.6282 1.3559 1.7348 -0.1166 -0.0708 -0.0254 251 LEU A CB    
1909 C CG    . LEU A 241 ? 1.6277 1.3544 1.7105 -0.1065 -0.0594 -0.0192 251 LEU A CG    
1910 C CD1   . LEU A 241 ? 1.6524 1.3541 1.7561 -0.1056 -0.0658 -0.0159 251 LEU A CD1   
1911 C CD2   . LEU A 241 ? 1.6000 1.3537 1.6756 -0.1109 -0.0389 0.0004  251 LEU A CD2   
1912 N N     . GLN A 242 ? 1.6107 1.3678 1.7094 -0.1195 -0.0856 -0.0479 252 GLN A N     
1913 C CA    . GLN A 242 ? 1.6092 1.3760 1.7336 -0.1275 -0.0952 -0.0512 252 GLN A CA    
1914 C C     . GLN A 242 ? 1.5844 1.3764 1.7274 -0.1391 -0.0798 -0.0299 252 GLN A C     
1915 O O     . GLN A 242 ? 1.5660 1.3720 1.6846 -0.1358 -0.0641 -0.0211 252 GLN A O     
1916 C CB    . GLN A 242 ? 2.0434 1.8135 2.1383 -0.1150 -0.1038 -0.0686 252 GLN A CB    
1917 C CG    . GLN A 242 ? 2.0545 1.8278 2.1744 -0.1179 -0.1227 -0.0816 252 GLN A CG    
1918 C CD    . GLN A 242 ? 2.0861 1.8366 2.2201 -0.1137 -0.1463 -0.1026 252 GLN A CD    
1919 O OE1   . GLN A 242 ? 2.0963 1.8323 2.2626 -0.1237 -0.1510 -0.0990 252 GLN A OE1   
1920 N NE2   . GLN A 242 ? 2.1051 1.8516 2.2142 -0.0975 -0.1616 -0.1249 252 GLN A NE2   
1921 N N     . VAL A 243 ? 1.5865 1.3853 1.7742 -0.1519 -0.0848 -0.0222 253 VAL A N     
1922 C CA    . VAL A 243 ? 1.5666 1.3931 1.7744 -0.1608 -0.0697 -0.0005 253 VAL A CA    
1923 C C     . VAL A 243 ? 1.5508 1.3981 1.7379 -0.1550 -0.0651 -0.0037 253 VAL A C     
1924 O O     . VAL A 243 ? 1.5336 1.4010 1.7134 -0.1545 -0.0492 0.0103  253 VAL A O     
1925 C CB    . VAL A 243 ? 1.5745 1.4083 1.8392 -0.1758 -0.0764 0.0097  253 VAL A CB    
1926 C CG1   . VAL A 243 ? 1.5900 1.4044 1.8785 -0.1825 -0.0760 0.0206  253 VAL A CG1   
1927 C CG2   . VAL A 243 ? 1.5895 1.4177 1.8725 -0.1776 -0.0995 -0.0114 253 VAL A CG2   
1928 N N     . ASP A 244 ? 1.5599 1.4018 1.7366 -0.1489 -0.0800 -0.0229 254 ASP A N     
1929 C CA    . ASP A 244 ? 1.5500 1.4072 1.7055 -0.1415 -0.0773 -0.0266 254 ASP A CA    
1930 C C     . ASP A 244 ? 1.5458 1.3938 1.6535 -0.1303 -0.0676 -0.0293 254 ASP A C     
1931 O O     . ASP A 244 ? 1.5587 1.3884 1.6442 -0.1227 -0.0738 -0.0408 254 ASP A O     
1932 C CB    . ASP A 244 ? 1.8040 1.6603 1.9670 -0.1374 -0.0974 -0.0451 254 ASP A CB    
1933 C CG    . ASP A 244 ? 1.7952 1.6716 1.9485 -0.1313 -0.0953 -0.0452 254 ASP A CG    
1934 O OD1   . ASP A 244 ? 1.7882 1.6633 1.9046 -0.1221 -0.0844 -0.0430 254 ASP A OD1   
1935 O OD2   . ASP A 244 ? 1.7972 1.6905 1.9822 -0.1357 -0.1051 -0.0474 254 ASP A OD2   
1936 N N     . PRO A 245 ? 1.5300 1.3917 1.6232 -0.1288 -0.0529 -0.0189 255 PRO A N     
1937 C CA    . PRO A 245 ? 1.5270 1.3806 1.5816 -0.1211 -0.0437 -0.0199 255 PRO A CA    
1938 C C     . PRO A 245 ? 1.5387 1.3830 1.5657 -0.1101 -0.0512 -0.0324 255 PRO A C     
1939 O O     . PRO A 245 ? 1.5434 1.3773 1.5415 -0.1036 -0.0466 -0.0342 255 PRO A O     
1940 C CB    . PRO A 245 ? 1.5116 1.3828 1.5650 -0.1224 -0.0302 -0.0083 255 PRO A CB    
1941 C CG    . PRO A 245 ? 1.5091 1.3985 1.5896 -0.1251 -0.0346 -0.0057 255 PRO A CG    
1942 C CD    . PRO A 245 ? 1.5172 1.4037 1.6304 -0.1330 -0.0453 -0.0070 255 PRO A CD    
1943 N N     . MET A 246 ? 1.5450 1.3955 1.5817 -0.1072 -0.0622 -0.0395 256 MET A N     
1944 C CA    . MET A 246 ? 1.5595 1.4032 1.5696 -0.0942 -0.0698 -0.0501 256 MET A CA    
1945 C C     . MET A 246 ? 1.5790 1.4085 1.5794 -0.0869 -0.0823 -0.0636 256 MET A C     
1946 O O     . MET A 246 ? 1.5928 1.4150 1.5613 -0.0736 -0.0835 -0.0690 256 MET A O     
1947 C CB    . MET A 246 ? 1.7093 1.5670 1.7328 -0.0913 -0.0788 -0.0543 256 MET A CB    
1948 C CG    . MET A 246 ? 1.6936 1.5673 1.7254 -0.0949 -0.0675 -0.0426 256 MET A CG    
1949 S SD    . MET A 246 ? 1.6918 1.5543 1.6855 -0.0883 -0.0525 -0.0357 256 MET A SD    
1950 C CE    . MET A 246 ? 1.7128 1.5668 1.6791 -0.0719 -0.0614 -0.0439 256 MET A CE    
1951 N N     . LYS A 247 ? 1.5831 1.4088 1.6113 -0.0943 -0.0916 -0.0685 257 LYS A N     
1952 C CA    . LYS A 247 ? 1.6055 1.4156 1.6261 -0.0859 -0.1057 -0.0842 257 LYS A CA    
1953 C C     . LYS A 247 ? 1.6058 1.4037 1.6110 -0.0847 -0.0962 -0.0798 257 LYS A C     
1954 O O     . LYS A 247 ? 1.6258 1.4106 1.6210 -0.0753 -0.1063 -0.0926 257 LYS A O     
1955 C CB    . LYS A 247 ? 1.7329 1.5409 1.7947 -0.0942 -0.1242 -0.0944 257 LYS A CB    
1956 C CG    . LYS A 247 ? 1.7400 1.5609 1.8174 -0.0920 -0.1398 -0.1051 257 LYS A CG    
1957 C CD    . LYS A 247 ? 1.7643 1.5757 1.8695 -0.0927 -0.1650 -0.1252 257 LYS A CD    
1958 C CE    . LYS A 247 ? 1.7657 1.5958 1.9074 -0.0990 -0.1796 -0.1313 257 LYS A CE    
1959 N NZ    . LYS A 247 ? 1.7428 1.5899 1.9273 -0.1194 -0.1675 -0.1100 257 LYS A NZ    
1960 N N     . ARG A 248 ? 1.5856 1.3894 1.5886 -0.0925 -0.0778 -0.0631 258 ARG A N     
1961 C CA    . ARG A 248 ? 1.5842 1.3807 1.5769 -0.0921 -0.0686 -0.0578 258 ARG A CA    
1962 C C     . ARG A 248 ? 1.5946 1.3878 1.5488 -0.0776 -0.0645 -0.0618 258 ARG A C     
1963 O O     . ARG A 248 ? 1.5975 1.3954 1.5320 -0.0705 -0.0628 -0.0620 258 ARG A O     
1964 C CB    . ARG A 248 ? 1.5612 1.3689 1.5626 -0.1030 -0.0515 -0.0402 258 ARG A CB    
1965 C CG    . ARG A 248 ? 1.5590 1.3624 1.5578 -0.1040 -0.0432 -0.0337 258 ARG A CG    
1966 C CD    . ARG A 248 ? 1.5396 1.3568 1.5524 -0.1137 -0.0298 -0.0177 258 ARG A CD    
1967 N NE    . ARG A 248 ? 1.5368 1.3598 1.5835 -0.1229 -0.0334 -0.0115 258 ARG A NE    
1968 C CZ    . ARG A 248 ? 1.5222 1.3630 1.5823 -0.1289 -0.0231 0.0021  258 ARG A CZ    
1969 N NH1   . ARG A 248 ? 1.5101 1.3618 1.5518 -0.1266 -0.0111 0.0076  258 ARG A NH1   
1970 N NH2   . ARG A 248 ? 1.5219 1.3712 1.6152 -0.1366 -0.0254 0.0100  258 ARG A NH2   
1971 N N     . ALA A 249 ? 1.6415 1.4279 1.5860 -0.0723 -0.0620 -0.0631 259 ALA A N     
1972 C CA    . ALA A 249 ? 1.6522 1.4403 1.5628 -0.0579 -0.0561 -0.0642 259 ALA A CA    
1973 C C     . ALA A 249 ? 1.6345 1.4344 1.5341 -0.0636 -0.0374 -0.0481 259 ALA A C     
1974 O O     . ALA A 249 ? 1.6151 1.4203 1.5307 -0.0764 -0.0287 -0.0381 259 ALA A O     
1975 C CB    . ALA A 249 ? 1.6262 1.4061 1.5320 -0.0497 -0.0589 -0.0703 259 ALA A CB    
1976 N N     . SER A 250 ? 1.6043 1.4090 1.4778 -0.0533 -0.0319 -0.0455 260 SER A N     
1977 C CA    . SER A 250 ? 1.5930 1.4068 1.4588 -0.0589 -0.0155 -0.0306 260 SER A CA    
1978 C C     . SER A 250 ? 1.5974 1.4184 1.4519 -0.0529 -0.0070 -0.0266 260 SER A C     
1979 O O     . SER A 250 ? 1.6123 1.4302 1.4591 -0.0408 -0.0140 -0.0360 260 SER A O     
1980 C CB    . SER A 250 ? 1.6381 1.4529 1.4862 -0.0524 -0.0126 -0.0256 260 SER A CB    
1981 O OG    . SER A 250 ? 1.6356 1.4456 1.4930 -0.0556 -0.0210 -0.0301 260 SER A OG    
1982 N N     . ILE A 251 ? 1.8981 1.7294 1.7522 -0.0601 0.0070  -0.0135 261 ILE A N     
1983 C CA    . ILE A 251 ? 1.9008 1.7447 1.7478 -0.0552 0.0163  -0.0079 261 ILE A CA    
1984 C C     . ILE A 251 ? 1.9257 1.7741 1.7470 -0.0354 0.0161  -0.0094 261 ILE A C     
1985 O O     . ILE A 251 ? 1.9364 1.7929 1.7474 -0.0230 0.0176  -0.0120 261 ILE A O     
1986 C CB    . ILE A 251 ? 1.5770 1.4335 1.4323 -0.0679 0.0301  0.0062  261 ILE A CB    
1987 C CG1   . ILE A 251 ? 1.5622 1.4118 1.4331 -0.0829 0.0291  0.0078  261 ILE A CG1   
1988 C CG2   . ILE A 251 ? 1.5682 1.4385 1.4316 -0.0701 0.0359  0.0085  261 ILE A CG2   
1989 C CD1   . ILE A 251 ? 1.5558 1.4135 1.4354 -0.0947 0.0391  0.0184  261 ILE A CD1   
1990 N N     . LYS A 252 ? 1.9644 1.8086 1.7735 -0.0299 0.0142  -0.0078 262 LYS A N     
1991 C CA    . LYS A 252 ? 1.9914 1.8422 1.7729 -0.0082 0.0143  -0.0079 262 LYS A CA    
1992 C C     . LYS A 252 ? 2.0089 1.8519 1.7802 0.0087  -0.0028 -0.0288 262 LYS A C     
1993 O O     . LYS A 252 ? 2.0302 1.8820 1.7806 0.0290  -0.0031 -0.0332 262 LYS A O     
1994 C CB    . LYS A 252 ? 2.3805 2.2278 2.1520 -0.0061 0.0161  0.0003  262 LYS A CB    
1995 C CG    . LYS A 252 ? 2.4112 2.2689 2.1515 0.0184  0.0188  0.0045  262 LYS A CG    
1996 C CD    . LYS A 252 ? 2.4223 2.2747 2.1533 0.0211  0.0203  0.0140  262 LYS A CD    
1997 C CE    . LYS A 252 ? 2.4103 2.2614 2.1573 0.0019  0.0358  0.0355  262 LYS A CE    
1998 N NZ    . LYS A 252 ? 2.4251 2.2672 2.1629 0.0057  0.0372  0.0458  262 LYS A NZ    
1999 N N     . ASP A 253 ? 1.6641 1.4913 1.4522 0.0007  -0.0174 -0.0419 263 ASP A N     
2000 C CA    . ASP A 253 ? 1.6829 1.4992 1.4687 0.0136  -0.0370 -0.0635 263 ASP A CA    
2001 C C     . ASP A 253 ? 1.6894 1.5038 1.4757 0.0201  -0.0388 -0.0706 263 ASP A C     
2002 O O     . ASP A 253 ? 1.7159 1.5247 1.4885 0.0395  -0.0523 -0.0879 263 ASP A O     
2003 C CB    . ASP A 253 ? 1.8015 1.6040 1.6152 -0.0014 -0.0503 -0.0723 263 ASP A CB    
2004 C CG    . ASP A 253 ? 1.8037 1.6075 1.6134 -0.0007 -0.0543 -0.0717 263 ASP A CG    
2005 O OD1   . ASP A 253 ? 1.8288 1.6356 1.6144 0.0193  -0.0621 -0.0799 263 ASP A OD1   
2006 O OD2   . ASP A 253 ? 1.7824 1.5855 1.6115 -0.0180 -0.0499 -0.0632 263 ASP A OD2   
2007 N N     . ILE A 254 ? 1.6676 1.4866 1.4693 0.0056  -0.0265 -0.0585 264 ILE A N     
2008 C CA    . ILE A 254 ? 1.6731 1.4916 1.4756 0.0121  -0.0266 -0.0629 264 ILE A CA    
2009 C C     . ILE A 254 ? 1.6900 1.5281 1.4644 0.0324  -0.0165 -0.0583 264 ILE A C     
2010 O O     . ILE A 254 ? 1.7104 1.5475 1.4726 0.0507  -0.0223 -0.0693 264 ILE A O     
2011 C CB    . ILE A 254 ? 1.6461 1.4670 1.4726 -0.0075 -0.0168 -0.0510 264 ILE A CB    
2012 C CG1   . ILE A 254 ? 1.6282 1.4373 1.4812 -0.0271 -0.0223 -0.0502 264 ILE A CG1   
2013 C CG2   . ILE A 254 ? 1.6556 1.4710 1.4847 0.0007  -0.0204 -0.0574 264 ILE A CG2   
2014 C CD1   . ILE A 254 ? 1.6013 1.4197 1.4719 -0.0448 -0.0097 -0.0356 264 ILE A CD1   
2015 N N     . ARG A 255 ? 1.6842 1.5404 1.4493 0.0302  -0.0013 -0.0413 265 ARG A N     
2016 C CA    . ARG A 255 ? 1.7015 1.5815 1.4424 0.0491  0.0109  -0.0323 265 ARG A CA    
2017 C C     . ARG A 255 ? 1.7375 1.6173 1.4471 0.0790  -0.0005 -0.0470 265 ARG A C     
2018 O O     . ARG A 255 ? 1.7598 1.6562 1.4467 0.1026  0.0032  -0.0486 265 ARG A O     
2019 C CB    . ARG A 255 ? 2.2783 2.1751 2.0220 0.0374  0.0293  -0.0084 265 ARG A CB    
2020 C CG    . ARG A 255 ? 2.2919 2.2189 2.0203 0.0515  0.0462  0.0076  265 ARG A CG    
2021 C CD    . ARG A 255 ? 2.2901 2.2294 2.0215 0.0418  0.0622  0.0318  265 ARG A CD    
2022 N NE    . ARG A 255 ? 2.2614 2.1963 2.0243 0.0120  0.0685  0.0420  265 ARG A NE    
2023 C CZ    . ARG A 255 ? 2.2585 2.2002 2.0326 -0.0014 0.0813  0.0624  265 ARG A CZ    
2024 N NH1   . ARG A 255 ? 2.2820 2.2355 2.0391 0.0115  0.0914  0.0785  265 ARG A NH1   
2025 N NH2   . ARG A 255 ? 2.2355 2.1715 2.0380 -0.0267 0.0835  0.0667  265 ARG A NH2   
2026 N N     . GLU A 256 ? 2.0402 1.9035 1.7483 0.0795  -0.0152 -0.0589 266 GLU A N     
2027 C CA    . GLU A 256 ? 2.0760 1.9397 1.7544 0.1083  -0.0288 -0.0752 266 GLU A CA    
2028 C C     . GLU A 256 ? 2.0956 1.9398 1.7755 0.1204  -0.0523 -0.1045 266 GLU A C     
2029 O O     . GLU A 256 ? 2.1297 1.9733 1.7850 0.1470  -0.0673 -0.1235 266 GLU A O     
2030 C CB    . GLU A 256 ? 2.5598 2.4180 2.2358 0.1052  -0.0347 -0.0746 266 GLU A CB    
2031 C CG    . GLU A 256 ? 2.5768 2.4567 2.2241 0.1215  -0.0202 -0.0563 266 GLU A CG    
2032 C CD    . GLU A 256 ? 2.5557 2.4500 2.2141 0.1039  0.0055  -0.0258 266 GLU A CD    
2033 O OE1   . GLU A 256 ? 2.5263 2.4091 2.2130 0.0757  0.0094  -0.0178 266 GLU A OE1   
2034 O OE2   . GLU A 256 ? 2.5705 2.4890 2.2107 0.1188  0.0213  -0.0101 266 GLU A OE2   
2035 N N     . HIS A 257 ? 1.7821 1.6096 1.4909 0.1021  -0.0563 -0.1083 267 HIS A N     
2036 C CA    . HIS A 257 ? 1.8031 1.6072 1.5191 0.1108  -0.0785 -0.1339 267 HIS A CA    
2037 C C     . HIS A 257 ? 1.8307 1.6432 1.5212 0.1388  -0.0781 -0.1423 267 HIS A C     
2038 O O     . HIS A 257 ? 1.8222 1.6589 1.5016 0.1427  -0.0575 -0.1241 267 HIS A O     
2039 C CB    . HIS A 257 ? 1.8227 1.6068 1.5787 0.0830  -0.0809 -0.1309 267 HIS A CB    
2040 C CG    . HIS A 257 ? 1.8458 1.6010 1.6171 0.0874  -0.1046 -0.1547 267 HIS A CG    
2041 N ND1   . HIS A 257 ? 1.8670 1.6130 1.6317 0.1029  -0.1095 -0.1646 267 HIS A ND1   
2042 C CD2   . HIS A 257 ? 1.8533 1.5863 1.6493 0.0780  -0.1256 -0.1701 267 HIS A CD2   
2043 C CE1   . HIS A 257 ? 1.8885 1.6038 1.6733 0.1024  -0.1330 -0.1854 267 HIS A CE1   
2044 N NE2   . HIS A 257 ? 1.8800 1.5881 1.6860 0.0863  -0.1430 -0.1887 267 HIS A NE2   
2045 N N     . GLU A 258 ? 1.8708 1.6633 1.5550 0.1580  -0.1018 -0.1706 268 GLU A N     
2046 C CA    . GLU A 258 ? 1.9061 1.7059 1.5601 0.1918  -0.1054 -0.1841 268 GLU A CA    
2047 C C     . GLU A 258 ? 1.8951 1.6929 1.5617 0.1863  -0.0953 -0.1756 268 GLU A C     
2048 O O     . GLU A 258 ? 1.8939 1.7205 1.5416 0.1991  -0.0764 -0.1614 268 GLU A O     
2049 C CB    . GLU A 258 ? 2.6916 2.4661 2.3372 0.2142  -0.1376 -0.2209 268 GLU A CB    
2050 C CG    . GLU A 258 ? 2.7329 2.5089 2.3491 0.2508  -0.1453 -0.2397 268 GLU A CG    
2051 C CD    . GLU A 258 ? 2.7437 2.5629 2.3169 0.2793  -0.1247 -0.2258 268 GLU A CD    
2052 O OE1   . GLU A 258 ? 2.7512 2.5847 2.3116 0.2949  -0.1135 -0.2207 268 GLU A OE1   
2053 O OE2   . GLU A 258 ? 2.7462 2.5866 2.2994 0.2868  -0.1191 -0.2184 268 GLU A OE2   
2054 N N     . TRP A 259 ? 1.9146 1.6803 1.6138 0.1685  -0.1076 -0.1833 269 TRP A N     
2055 C CA    . TRP A 259 ? 1.9073 1.6674 1.6196 0.1642  -0.1002 -0.1759 269 TRP A CA    
2056 C C     . TRP A 259 ? 1.8703 1.6633 1.5849 0.1504  -0.0711 -0.1454 269 TRP A C     
2057 O O     . TRP A 259 ? 1.8717 1.6778 1.5804 0.1603  -0.0610 -0.1390 269 TRP A O     
2058 C CB    . TRP A 259 ? 1.8693 1.5924 1.6224 0.1401  -0.1136 -0.1800 269 TRP A CB    
2059 C CG    . TRP A 259 ? 1.8665 1.5805 1.6330 0.1376  -0.1077 -0.1723 269 TRP A CG    
2060 C CD1   . TRP A 259 ? 1.9027 1.5969 1.6613 0.1602  -0.1203 -0.1892 269 TRP A CD1   
2061 C CD2   . TRP A 259 ? 1.8288 1.5529 1.6176 0.1133  -0.0889 -0.1465 269 TRP A CD2   
2062 N NE1   . TRP A 259 ? 1.8889 1.5804 1.6637 0.1512  -0.1094 -0.1736 269 TRP A NE1   
2063 C CE2   . TRP A 259 ? 1.8434 1.5547 1.6365 0.1228  -0.0902 -0.1476 269 TRP A CE2   
2064 C CE3   . TRP A 259 ? 1.7870 1.5297 1.5914 0.0866  -0.0721 -0.1240 269 TRP A CE3   
2065 C CZ2   . TRP A 259 ? 1.8170 1.5361 1.6283 0.1069  -0.0750 -0.1261 269 TRP A CZ2   
2066 C CZ3   . TRP A 259 ? 1.7617 1.5117 1.5841 0.0712  -0.0582 -0.1049 269 TRP A CZ3   
2067 C CH2   . TRP A 259 ? 1.7762 1.5159 1.6017 0.0815  -0.0594 -0.1056 269 TRP A CH2   
2068 N N     . PHE A 260 ? 1.8086 1.6149 1.5329 0.1284  -0.0590 -0.1278 270 PHE A N     
2069 C CA    . PHE A 260 ? 1.7756 1.6111 1.5061 0.1131  -0.0342 -0.1010 270 PHE A CA    
2070 C C     . PHE A 260 ? 1.7870 1.6593 1.4882 0.1349  -0.0185 -0.0914 270 PHE A C     
2071 O O     . PHE A 260 ? 1.7724 1.6694 1.4778 0.1317  -0.0015 -0.0751 270 PHE A O     
2072 C CB    . PHE A 260 ? 1.7459 1.5815 1.4941 0.0859  -0.0284 -0.0877 270 PHE A CB    
2073 C CG    . PHE A 260 ? 1.7133 1.5725 1.4742 0.0666  -0.0069 -0.0634 270 PHE A CG    
2074 C CD1   . PHE A 260 ? 1.6920 1.5485 1.4765 0.0504  -0.0026 -0.0563 270 PHE A CD1   
2075 C CD2   . PHE A 260 ? 1.7067 1.5904 1.4574 0.0652  0.0080  -0.0477 270 PHE A CD2   
2076 C CE1   . PHE A 260 ? 1.6648 1.5437 1.4616 0.0338  0.0143  -0.0374 270 PHE A CE1   
2077 C CE2   . PHE A 260 ? 1.6800 1.5830 1.4467 0.0461  0.0250  -0.0275 270 PHE A CE2   
2078 C CZ    . PHE A 260 ? 1.6590 1.5602 1.4484 0.0308  0.0272  -0.0241 270 PHE A CZ    
2079 N N     . LYS A 261 ? 1.8145 1.6932 1.4873 0.1576  -0.0242 -0.1006 271 LYS A N     
2080 C CA    . LYS A 261 ? 1.8297 1.7467 1.4736 0.1808  -0.0080 -0.0887 271 LYS A CA    
2081 C C     . LYS A 261 ? 1.8490 1.7817 1.4789 0.2056  -0.0047 -0.0935 271 LYS A C     
2082 O O     . LYS A 261 ? 1.8445 1.8154 1.4680 0.2121  0.0160  -0.0739 271 LYS A O     
2083 C CB    . LYS A 261 ? 2.0373 1.9570 1.6496 0.2056  -0.0173 -0.1001 271 LYS A CB    
2084 C CG    . LYS A 261 ? 2.0221 1.9376 1.6411 0.1873  -0.0153 -0.0898 271 LYS A CG    
2085 C CD    . LYS A 261 ? 2.0589 1.9719 1.6465 0.2151  -0.0309 -0.1077 271 LYS A CD    
2086 C CE    . LYS A 261 ? 2.0463 1.9543 1.6398 0.1993  -0.0305 -0.0986 271 LYS A CE    
2087 N NZ    . LYS A 261 ? 2.0823 1.9848 1.6487 0.2257  -0.0506 -0.1206 271 LYS A NZ    
2088 N N     . GLN A 262 ? 1.8723 1.7755 1.5000 0.2193  -0.0255 -0.1193 272 GLN A N     
2089 C CA    . GLN A 262 ? 1.9003 1.8133 1.5093 0.2497  -0.0269 -0.1296 272 GLN A CA    
2090 C C     . GLN A 262 ? 1.8743 1.8148 1.4988 0.2391  -0.0058 -0.1072 272 GLN A C     
2091 O O     . GLN A 262 ? 1.8435 1.7704 1.4993 0.2103  -0.0035 -0.0985 272 GLN A O     
2092 C CB    . GLN A 262 ? 2.3306 2.1979 1.9446 0.2586  -0.0542 -0.1596 272 GLN A CB    
2093 C CG    . GLN A 262 ? 2.3670 2.2094 1.9638 0.2765  -0.0797 -0.1884 272 GLN A CG    
2094 C CD    . GLN A 262 ? 2.4020 2.2006 2.0044 0.2894  -0.1075 -0.2193 272 GLN A CD    
2095 O OE1   . GLN A 262 ? 2.4207 2.2183 2.0153 0.3084  -0.1077 -0.2251 272 GLN A OE1   
2096 N NE2   . GLN A 262 ? 2.4128 2.1748 2.0313 0.2789  -0.1315 -0.2390 272 GLN A NE2   
2097 N N     . ASP A 263 ? 1.8886 1.8710 1.4912 0.2643  0.0094  -0.0980 273 ASP A N     
2098 C CA    . ASP A 263 ? 1.8687 1.8851 1.4851 0.2592  0.0289  -0.0780 273 ASP A CA    
2099 C C     . ASP A 263 ? 1.8216 1.8461 1.4733 0.2178  0.0433  -0.0537 273 ASP A C     
2100 O O     . ASP A 263 ? 1.7994 1.8216 1.4752 0.2010  0.0460  -0.0482 273 ASP A O     
2101 C CB    . ASP A 263 ? 2.0618 2.0576 1.6819 0.2709  0.0173  -0.0939 273 ASP A CB    
2102 C CG    . ASP A 263 ? 2.1134 2.0946 1.6995 0.3129  -0.0007 -0.1224 273 ASP A CG    
2103 O OD1   . ASP A 263 ? 2.1392 2.1483 1.6936 0.3412  0.0037  -0.1242 273 ASP A OD1   
2104 O OD2   . ASP A 263 ? 2.1312 2.0724 1.7223 0.3186  -0.0198 -0.1427 273 ASP A OD2   
2105 N N     . LEU A 264 ? 1.8097 1.8430 1.4632 0.2033  0.0516  -0.0399 274 LEU A N     
2106 C CA    . LEU A 264 ? 1.7701 1.8087 1.4555 0.1658  0.0634  -0.0191 274 LEU A CA    
2107 C C     . LEU A 264 ? 1.7617 1.8496 1.4528 0.1628  0.0877  0.0084  274 LEU A C     
2108 O O     . LEU A 264 ? 1.7774 1.8824 1.4514 0.1738  0.0959  0.0185  274 LEU A O     
2109 C CB    . LEU A 264 ? 1.7624 1.7710 1.4516 0.1482  0.0543  -0.0226 274 LEU A CB    
2110 C CG    . LEU A 264 ? 1.7263 1.7354 1.4455 0.1118  0.0639  -0.0042 274 LEU A CG    
2111 C CD1   . LEU A 264 ? 1.7134 1.6814 1.4462 0.0929  0.0478  -0.0169 274 LEU A CD1   
2112 C CD2   . LEU A 264 ? 1.7290 1.7599 1.4423 0.1094  0.0783  0.0154  274 LEU A CD2   
2113 N N     . PRO A 265 ? 1.8403 1.9525 1.5570 0.1483  0.0990  0.0215  275 PRO A N     
2114 C CA    . PRO A 265 ? 1.8302 1.9896 1.5629 0.1393  0.1212  0.0489  275 PRO A CA    
2115 C C     . PRO A 265 ? 1.8165 1.9696 1.5636 0.1135  0.1276  0.0649  275 PRO A C     
2116 O O     . PRO A 265 ? 1.7992 1.9163 1.5579 0.0916  0.1167  0.0570  275 PRO A O     
2117 C CB    . PRO A 265 ? 1.7043 1.8787 1.4670 0.1231  0.1245  0.0528  275 PRO A CB    
2118 C CG    . PRO A 265 ? 1.7155 1.8648 1.4642 0.1412  0.1088  0.0298  275 PRO A CG    
2119 C CD    . PRO A 265 ? 1.7279 1.8283 1.4587 0.1442  0.0911  0.0111  275 PRO A CD    
2120 N N     . LYS A 266 ? 2.3366 2.5252 2.0836 0.1171  0.1458  0.0885  276 LYS A N     
2121 C CA    . LYS A 266 ? 2.3328 2.5137 2.0890 0.0980  0.1523  0.1052  276 LYS A CA    
2122 C C     . LYS A 266 ? 2.3051 2.4971 2.1054 0.0620  0.1617  0.1231  276 LYS A C     
2123 O O     . LYS A 266 ? 2.3045 2.4943 2.1181 0.0451  0.1695  0.1408  276 LYS A O     
2124 C CB    . LYS A 266 ? 2.4268 2.6373 2.1590 0.1222  0.1671  0.1237  276 LYS A CB    
2125 C CG    . LYS A 266 ? 2.4391 2.6228 2.1543 0.1220  0.1630  0.1257  276 LYS A CG    
2126 C CD    . LYS A 266 ? 2.4785 2.6870 2.1547 0.1591  0.1714  0.1341  276 LYS A CD    
2127 C CE    . LYS A 266 ? 2.4930 2.6768 2.1505 0.1615  0.1667  0.1362  276 LYS A CE    
2128 N NZ    . LYS A 266 ? 2.4774 2.6560 2.1669 0.1285  0.1785  0.1624  276 LYS A NZ    
2129 N N     . TYR A 267 ? 2.2085 2.4129 2.0315 0.0521  0.1601  0.1182  277 TYR A N     
2130 C CA    . TYR A 267 ? 2.1838 2.3987 2.0496 0.0191  0.1650  0.1298  277 TYR A CA    
2131 C C     . TYR A 267 ? 2.1619 2.3339 2.0394 -0.0044 0.1494  0.1146  277 TYR A C     
2132 O O     . TYR A 267 ? 2.1439 2.3186 2.0541 -0.0309 0.1500  0.1200  277 TYR A O     
2133 C CB    . TYR A 267 ? 1.9809 2.2351 1.8663 0.0210  0.1702  0.1316  277 TYR A CB    
2134 C CG    . TYR A 267 ? 1.9635 2.1982 1.8514 0.0185  0.1549  0.1096  277 TYR A CG    
2135 C CD1   . TYR A 267 ? 1.9742 2.1831 1.8309 0.0415  0.1428  0.0894  277 TYR A CD1   
2136 C CD2   . TYR A 267 ? 1.9399 2.1826 1.8621 -0.0059 0.1522  0.1094  277 TYR A CD2   
2137 C CE1   . TYR A 267 ? 1.9617 2.1523 1.8223 0.0394  0.1305  0.0732  277 TYR A CE1   
2138 C CE2   . TYR A 267 ? 1.9269 2.1546 1.8492 -0.0055 0.1397  0.0920  277 TYR A CE2   
2139 C CZ    . TYR A 267 ? 1.9379 2.1393 1.8298 0.0168  0.1299  0.0758  277 TYR A CZ    
2140 O OH    . TYR A 267 ? 1.9285 2.1141 1.8217 0.0176  0.1190  0.0623  277 TYR A OH    
2141 N N     . LEU A 268 ? 1.8927 2.0270 1.7447 0.0060  0.1351  0.0952  278 LEU A N     
2142 C CA    . LEU A 268 ? 1.8741 1.9708 1.7353 -0.0129 0.1213  0.0818  278 LEU A CA    
2143 C C     . LEU A 268 ? 1.8732 1.9516 1.7414 -0.0301 0.1226  0.0905  278 LEU A C     
2144 O O     . LEU A 268 ? 1.8572 1.9310 1.7517 -0.0542 0.1220  0.0940  278 LEU A O     
2145 C CB    . LEU A 268 ? 1.6200 1.6848 1.4569 0.0030  0.1060  0.0604  278 LEU A CB    
2146 C CG    . LEU A 268 ? 1.6250 1.6986 1.4541 0.0212  0.1021  0.0497  278 LEU A CG    
2147 C CD1   . LEU A 268 ? 1.6378 1.6746 1.4462 0.0356  0.0857  0.0293  278 LEU A CD1   
2148 C CD2   . LEU A 268 ? 1.6023 1.6878 1.4580 0.0056  0.1024  0.0505  278 LEU A CD2   
2149 N N     . PHE A 269 ? 1.9808 2.0480 1.8237 -0.0155 0.1229  0.0925  279 PHE A N     
2150 C CA    . PHE A 269 ? 1.9853 2.0355 1.8307 -0.0272 0.1248  0.1025  279 PHE A CA    
2151 C C     . PHE A 269 ? 2.0028 2.0828 1.8529 -0.0249 0.1434  0.1294  279 PHE A C     
2152 O O     . PHE A 269 ? 2.0235 2.1267 1.8517 -0.0006 0.1515  0.1361  279 PHE A O     
2153 C CB    . PHE A 269 ? 1.8116 1.8321 1.6277 -0.0123 0.1129  0.0887  279 PHE A CB    
2154 C CG    . PHE A 269 ? 1.8008 1.7976 1.6121 -0.0097 0.0959  0.0642  279 PHE A CG    
2155 C CD1   . PHE A 269 ? 1.7761 1.7642 1.6111 -0.0292 0.0905  0.0576  279 PHE A CD1   
2156 C CD2   . PHE A 269 ? 1.8186 1.8025 1.6030 0.0130  0.0848  0.0482  279 PHE A CD2   
2157 C CE1   . PHE A 269 ? 1.7689 1.7366 1.6019 -0.0269 0.0769  0.0396  279 PHE A CE1   
2158 C CE2   . PHE A 269 ? 1.8116 1.7722 1.5975 0.0132  0.0692  0.0280  279 PHE A CE2   
2159 C CZ    . PHE A 269 ? 1.7866 1.7395 1.5973 -0.0071 0.0665  0.0257  279 PHE A CZ    
2160 N N     . PRO A 270 ? 2.3986 2.4785 2.2783 -0.0494 0.1501  0.1454  280 PRO A N     
2161 C CA    . PRO A 270 ? 2.4126 2.5250 2.3109 -0.0541 0.1690  0.1745  280 PRO A CA    
2162 C C     . PRO A 270 ? 2.4426 2.5570 2.3178 -0.0376 0.1800  0.1943  280 PRO A C     
2163 O O     . PRO A 270 ? 2.4513 2.5461 2.3352 -0.0502 0.1824  0.2072  280 PRO A O     
2164 C CB    . PRO A 270 ? 1.8820 1.9833 1.8217 -0.0874 0.1673  0.1798  280 PRO A CB    
2165 C CG    . PRO A 270 ? 1.8724 1.9292 1.8014 -0.0935 0.1508  0.1600  280 PRO A CG    
2166 C CD    . PRO A 270 ? 1.8651 1.9133 1.7637 -0.0735 0.1395  0.1368  280 PRO A CD    
2167 N N     . GLU A 271 ? 2.3466 2.4842 2.1901 -0.0069 0.1858  0.1957  281 GLU A N     
2168 C CA    . GLU A 271 ? 2.3794 2.5326 2.1995 0.0143  0.1998  0.2183  281 GLU A CA    
2169 C C     . GLU A 271 ? 2.3923 2.5995 2.2206 0.0256  0.2203  0.2418  281 GLU A C     
2170 O O     . GLU A 271 ? 2.4070 2.6368 2.2556 0.0175  0.2390  0.2749  281 GLU A O     
2171 C CB    . GLU A 271 ? 1.8592 1.9960 1.6303 0.0461  0.1879  0.1984  281 GLU A CB    
2172 C CG    . GLU A 271 ? 1.8598 1.9532 1.6210 0.0394  0.1749  0.1891  281 GLU A CG    
2173 C CD    . GLU A 271 ? 1.8282 1.8864 1.6067 0.0170  0.1558  0.1628  281 GLU A CD    
2174 O OE1   . GLU A 271 ? 1.8119 1.8735 1.5936 0.0179  0.1478  0.1440  281 GLU A OE1   
2175 O OE2   . GLU A 271 ? 1.8218 1.8498 1.6099 0.0003  0.1494  0.1617  281 GLU A OE2   
2176 N N     . ASP A 272 ? 2.5668 2.7946 2.3798 0.0455  0.2167  0.2255  282 ASP A N     
2177 C CA    . ASP A 272 ? 2.5766 2.8595 2.3971 0.0588  0.2346  0.2438  282 ASP A CA    
2178 C C     . ASP A 272 ? 2.5506 2.8540 2.4233 0.0279  0.2393  0.2514  282 ASP A C     
2179 O O     . ASP A 272 ? 2.5264 2.7990 2.4252 -0.0016 0.2271  0.2397  282 ASP A O     
2180 C CB    . ASP A 272 ? 1.9969 2.2900 1.7777 0.0954  0.2265  0.2200  282 ASP A CB    
2181 C CG    . ASP A 272 ? 2.0355 2.3422 1.7696 0.1345  0.2326  0.2259  282 ASP A CG    
2182 O OD1   . ASP A 272 ? 2.0485 2.3305 1.7670 0.1353  0.2302  0.2305  282 ASP A OD1   
2183 O OD2   . ASP A 272 ? 2.0549 2.3984 1.7665 0.1665  0.2393  0.2253  282 ASP A OD2   
2184 N N     . PRO A 273 ? 2.7120 3.0704 2.6005 0.0358  0.2564  0.2704  283 PRO A N     
2185 C CA    . PRO A 273 ? 2.6885 3.0702 2.6292 0.0067  0.2591  0.2762  283 PRO A CA    
2186 C C     . PRO A 273 ? 2.6602 3.0235 2.6041 0.0004  0.2393  0.2430  283 PRO A C     
2187 O O     . PRO A 273 ? 2.6588 2.9902 2.5661 0.0179  0.2239  0.2161  283 PRO A O     
2188 C CB    . PRO A 273 ? 2.6840 3.1330 2.6330 0.0248  0.2812  0.3015  283 PRO A CB    
2189 C CG    . PRO A 273 ? 2.7126 3.1689 2.6040 0.0694  0.2847  0.2975  283 PRO A CG    
2190 C CD    . PRO A 273 ? 2.7227 3.1289 2.5880 0.0689  0.2761  0.2926  283 PRO A CD    
2191 N N     . SER A 274 ? 4.0165 4.4017 4.0059 -0.0242 0.2397  0.2460  284 SER A N     
2192 C CA    . SER A 274 ? 3.9909 4.3632 3.9875 -0.0316 0.2224  0.2183  284 SER A CA    
2193 C C     . SER A 274 ? 3.9916 4.4071 3.9816 -0.0080 0.2266  0.2138  284 SER A C     
2194 O O     . SER A 274 ? 4.0031 4.4714 4.0084 -0.0004 0.2443  0.2363  284 SER A O     
2195 C CB    . SER A 274 ? 1.7893 2.1592 1.8374 -0.0700 0.2171  0.2201  284 SER A CB    
2196 O OG    . SER A 274 ? 1.7667 2.1196 1.8166 -0.0755 0.1994  0.1930  284 SER A OG    
2197 N N     . TYR A 275 ? 2.8741 3.2674 2.8422 0.0044  0.2108  0.1861  285 TYR A N     
2198 C CA    . TYR A 275 ? 2.8775 3.3039 2.8349 0.0298  0.2120  0.1784  285 TYR A CA    
2199 C C     . TYR A 275 ? 2.8534 3.2933 2.8431 0.0134  0.2038  0.1686  285 TYR A C     
2200 O O     . TYR A 275 ? 2.8502 3.3424 2.8708 0.0099  0.2138  0.1817  285 TYR A O     
2201 C CB    . TYR A 275 ? 2.9586 3.3505 2.8652 0.0613  0.2000  0.1550  285 TYR A CB    
2202 C CG    . TYR A 275 ? 2.9901 3.4082 2.8624 0.0987  0.2110  0.1618  285 TYR A CG    
2203 C CD1   . TYR A 275 ? 3.0001 3.4801 2.8827 0.1144  0.2278  0.1789  285 TYR A CD1   
2204 C CD2   . TYR A 275 ? 3.0118 3.3958 2.8415 0.1201  0.2040  0.1505  285 TYR A CD2   
2205 C CE1   . TYR A 275 ? 3.0320 3.5394 2.8802 0.1524  0.2383  0.1849  285 TYR A CE1   
2206 C CE2   . TYR A 275 ? 3.0446 3.4539 2.8395 0.1578  0.2125  0.1544  285 TYR A CE2   
2207 C CZ    . TYR A 275 ? 3.0551 3.5262 2.8579 0.1749  0.2301  0.1718  285 TYR A CZ    
2208 O OH    . TYR A 275 ? 3.0905 3.5901 2.8560 0.2160  0.2390  0.1754  285 TYR A OH    
2209 N N     . SER A 276 ? 3.3626 3.7583 3.3455 0.0045  0.1859  0.1463  286 SER A N     
2210 C CA    . SER A 276 ? 3.3426 3.7481 3.3494 -0.0068 0.1765  0.1351  286 SER A CA    
2211 C C     . SER A 276 ? 3.3243 3.7209 3.3694 -0.0432 0.1708  0.1366  286 SER A C     
2212 O O     . SER A 276 ? 3.3269 3.7399 3.4005 -0.0623 0.1800  0.1545  286 SER A O     
2213 C CB    . SER A 276 ? 2.5596 2.9263 2.5357 0.0091  0.1610  0.1115  286 SER A CB    
2214 O OG    . SER A 276 ? 2.5808 2.9509 2.5223 0.0436  0.1633  0.1068  286 SER A OG    
2215 N N     . ASP A 281 ? 2.3647 2.6425 2.5614 -0.1991 0.2017  0.2495  291 ASP A N     
2216 C CA    . ASP A 281 ? 2.3591 2.5885 2.5638 -0.2181 0.1833  0.2302  291 ASP A CA    
2217 C C     . ASP A 281 ? 2.3558 2.5402 2.5079 -0.1999 0.1748  0.2130  291 ASP A C     
2218 O O     . ASP A 281 ? 2.3433 2.5303 2.4601 -0.1783 0.1710  0.1971  291 ASP A O     
2223 N N     . ASP A 282 ? 2.5296 2.6731 2.6793 -0.2088 0.1714  0.2168  292 ASP A N     
2224 C CA    . ASP A 282 ? 2.5279 2.6296 2.6337 -0.1941 0.1626  0.2015  292 ASP A CA    
2225 C C     . ASP A 282 ? 2.5405 2.5988 2.6580 -0.2107 0.1550  0.2018  292 ASP A C     
2226 O O     . ASP A 282 ? 2.5487 2.6051 2.7089 -0.2346 0.1528  0.2080  292 ASP A O     
2227 C CB    . ASP A 282 ? 3.1058 3.2145 3.1703 -0.1664 0.1752  0.2146  292 ASP A CB    
2228 C CG    . ASP A 282 ? 3.1350 3.2522 3.2096 -0.1680 0.1930  0.2490  292 ASP A CG    
2229 O OD1   . ASP A 282 ? 3.1424 3.2925 3.2558 -0.1817 0.2049  0.2706  292 ASP A OD1   
2230 O OD2   . ASP A 282 ? 3.1519 3.2446 3.1969 -0.1551 0.1953  0.2558  292 ASP A OD2   
2231 N N     . GLU A 283 ? 2.5759 2.5995 2.6570 -0.1975 0.1494  0.1934  293 GLU A N     
2232 C CA    . GLU A 283 ? 2.5893 2.5704 2.6756 -0.2086 0.1417  0.1922  293 GLU A CA    
2233 C C     . GLU A 283 ? 2.6206 2.5983 2.7300 -0.2190 0.1552  0.2244  293 GLU A C     
2234 O O     . GLU A 283 ? 2.6356 2.5817 2.7664 -0.2353 0.1487  0.2260  293 GLU A O     
2235 C CB    . GLU A 283 ? 2.8033 2.7551 2.8451 -0.1893 0.1349  0.1794  293 GLU A CB    
2236 C CG    . GLU A 283 ? 2.8109 2.7199 2.8555 -0.1983 0.1228  0.1697  293 GLU A CG    
2237 C CD    . GLU A 283 ? 2.8140 2.6992 2.8181 -0.1787 0.1186  0.1630  293 GLU A CD    
2238 O OE1   . GLU A 283 ? 2.8084 2.6659 2.8078 -0.1809 0.1053  0.1450  293 GLU A OE1   
2239 O OE2   . GLU A 283 ? 2.8236 2.7202 2.8011 -0.1600 0.1282  0.1752  293 GLU A OE2   
2240 N N     . ALA A 284 ? 3.6504 3.6610 3.7561 -0.2085 0.1742  0.2509  294 ALA A N     
2241 C CA    . ALA A 284 ? 3.6828 3.6966 3.8112 -0.2166 0.1908  0.2877  294 ALA A CA    
2242 C C     . ALA A 284 ? 3.6888 3.7085 3.8795 -0.2491 0.1894  0.2962  294 ALA A C     
2243 O O     . ALA A 284 ? 3.7179 3.7337 3.9391 -0.2625 0.2007  0.3265  294 ALA A O     
2244 C CB    . ALA A 284 ? 1.8947 1.9512 2.0048 -0.1953 0.2122  0.3138  294 ALA A CB    
2245 N N     . LEU A 285 ? 3.5623 3.5922 3.7729 -0.2610 0.1751  0.2697  295 LEU A N     
2246 C CA    . LEU A 285 ? 3.5669 3.6010 3.8367 -0.2915 0.1678  0.2691  295 LEU A CA    
2247 C C     . LEU A 285 ? 3.5895 3.5715 3.8789 -0.3090 0.1557  0.2660  295 LEU A C     
2248 O O     . LEU A 285 ? 3.6077 3.5870 3.9510 -0.3352 0.1530  0.2753  295 LEU A O     
2249 C CB    . LEU A 285 ? 2.4688 2.5221 2.7466 -0.2952 0.1518  0.2363  295 LEU A CB    
2250 C CG    . LEU A 285 ? 2.4706 2.5294 2.8061 -0.3240 0.1380  0.2251  295 LEU A CG    
2251 C CD1   . LEU A 285 ? 2.4879 2.5841 2.8773 -0.3426 0.1530  0.2571  295 LEU A CD1   
2252 C CD2   . LEU A 285 ? 2.4401 2.5192 2.7696 -0.3193 0.1228  0.1920  295 LEU A CD2   
2253 N N     . LYS A 286 ? 2.6800 2.6202 2.9292 -0.2950 0.1482  0.2538  296 LYS A N     
2254 C CA    . LYS A 286 ? 2.7032 2.5951 2.9732 -0.3107 0.1353  0.2484  296 LYS A CA    
2255 C C     . LYS A 286 ? 2.7400 2.6133 3.0112 -0.3095 0.1516  0.2857  296 LYS A C     
2256 O O     . LYS A 286 ? 2.7518 2.5915 2.9874 -0.2941 0.1507  0.2864  296 LYS A O     
2257 C CB    . LYS A 286 ? 2.0080 1.8649 2.2385 -0.2969 0.1172  0.2149  296 LYS A CB    
2258 C CG    . LYS A 286 ? 1.9692 1.8498 2.1755 -0.2851 0.1080  0.1847  296 LYS A CG    
2259 C CD    . LYS A 286 ? 1.9565 1.8113 2.1149 -0.2647 0.0989  0.1637  296 LYS A CD    
2260 C CE    . LYS A 286 ? 1.9217 1.7992 2.0605 -0.2543 0.0910  0.1378  296 LYS A CE    
2261 N NZ    . LYS A 286 ? 1.9096 1.7670 2.0065 -0.2355 0.0839  0.1210  296 LYS A NZ    
2262 N N     . GLU A 287 ? 3.0434 2.9393 3.3604 -0.3270 0.1658  0.3175  297 GLU A N     
2263 C CA    . GLU A 287 ? 3.0860 2.9624 3.4239 -0.3347 0.1803  0.3568  297 GLU A CA    
2264 C C     . GLU A 287 ? 3.1114 2.9685 3.5193 -0.3699 0.1710  0.3618  297 GLU A C     
2265 O O     . GLU A 287 ? 3.1512 2.9885 3.5887 -0.3819 0.1815  0.3958  297 GLU A O     
2266 C CB    . GLU A 287 ? 4.5278 4.4513 4.8591 -0.3221 0.2091  0.3974  297 GLU A CB    
2267 C CG    . GLU A 287 ? 4.5690 4.4717 4.8881 -0.3123 0.2267  0.4371  297 GLU A CG    
2268 C CD    . GLU A 287 ? 4.5966 4.5363 4.9584 -0.3236 0.2523  0.4865  297 GLU A CD    
2269 O OE1   . GLU A 287 ? 4.6328 4.5638 4.9848 -0.3135 0.2706  0.5250  297 GLU A OE1   
2270 O OE2   . GLU A 287 ? 4.5831 4.5633 4.9893 -0.3420 0.2546  0.4881  297 GLU A OE2   
2271 N N     . VAL A 288 ? 3.2987 3.1643 3.7352 -0.3861 0.1514  0.3291  298 VAL A N     
2272 C CA    . VAL A 288 ? 3.3204 3.1824 3.8306 -0.4205 0.1422  0.3325  298 VAL A CA    
2273 C C     . VAL A 288 ? 3.3542 3.1500 3.8827 -0.4336 0.1228  0.3200  298 VAL A C     
2274 O O     . VAL A 288 ? 3.3922 3.1696 3.9778 -0.4590 0.1231  0.3415  298 VAL A O     
2275 C CB    . VAL A 288 ? 2.6879 2.5872 3.2227 -0.4312 0.1265  0.3001  298 VAL A CB    
2276 C CG1   . VAL A 288 ? 2.6601 2.6254 3.1836 -0.4192 0.1462  0.3154  298 VAL A CG1   
2277 C CG2   . VAL A 288 ? 2.6628 2.5390 3.1584 -0.4176 0.1019  0.2511  298 VAL A CG2   
2278 N N     . CYS A 289 ? 4.0212 3.7815 4.5021 -0.4154 0.1064  0.2868  299 CYS A N     
2279 C CA    . CYS A 289 ? 4.0513 3.7496 4.5423 -0.4227 0.0849  0.2675  299 CYS A CA    
2280 C C     . CYS A 289 ? 4.1027 3.7621 4.6202 -0.4334 0.0959  0.3063  299 CYS A C     
2281 O O     . CYS A 289 ? 4.1394 3.7567 4.7015 -0.4541 0.0799  0.3009  299 CYS A O     
2282 C CB    . CYS A 289 ? 2.8407 2.5143 3.2666 -0.3946 0.0740  0.2370  299 CYS A CB    
2283 S SG    . CYS A 289 ? 2.7832 2.5001 3.1733 -0.3788 0.0640  0.1968  299 CYS A SG    
2284 N N     . GLU A 290 ? 3.5321 3.2049 4.0209 -0.4174 0.1224  0.3451  300 GLU A N     
2285 C CA    . GLU A 290 ? 3.5824 3.2240 4.0918 -0.4238 0.1373  0.3888  300 GLU A CA    
2286 C C     . GLU A 290 ? 3.6071 3.2749 4.1880 -0.4534 0.1522  0.4280  300 GLU A C     
2287 O O     . GLU A 290 ? 3.6529 3.2819 4.2865 -0.4769 0.1477  0.4451  300 GLU A O     
2288 C CB    . GLU A 290 ? 2.6758 2.3255 3.1230 -0.3914 0.1597  0.4152  300 GLU A CB    
2289 C CG    . GLU A 290 ? 2.7297 2.3466 3.1873 -0.3913 0.1763  0.4620  300 GLU A CG    
2290 C CD    . GLU A 290 ? 2.7603 2.3063 3.2042 -0.3860 0.1582  0.4464  300 GLU A CD    
2291 O OE1   . GLU A 290 ? 2.7447 2.2657 3.1847 -0.3886 0.1313  0.3997  300 GLU A OE1   
2292 O OE2   . GLU A 290 ? 2.8021 2.3189 3.2375 -0.3771 0.1714  0.4816  300 GLU A OE2   
2293 N N     . LYS A 291 ? 4.4165 4.1502 5.0011 -0.4519 0.1699  0.4428  301 LYS A N     
2294 C CA    . LYS A 291 ? 4.4381 4.2081 5.0867 -0.4759 0.1895  0.4865  301 LYS A CA    
2295 C C     . LYS A 291 ? 4.4459 4.2174 5.1754 -0.5147 0.1700  0.4707  301 LYS A C     
2296 O O     . LYS A 291 ? 4.4905 4.2393 5.2846 -0.5425 0.1716  0.4982  301 LYS A O     
2297 C CB    . LYS A 291 ? 2.1167 1.9608 2.7400 -0.4579 0.2143  0.5051  301 LYS A CB    
2298 C CG    . LYS A 291 ? 2.1406 2.0017 2.7355 -0.4367 0.2474  0.5576  301 LYS A CG    
2299 C CD    . LYS A 291 ? 2.1841 2.0594 2.8505 -0.4631 0.2680  0.6121  301 LYS A CD    
2300 C CE    . LYS A 291 ? 2.2015 2.1165 2.8385 -0.4381 0.3047  0.6654  301 LYS A CE    
2301 N NZ    . LYS A 291 ? 2.1619 2.1512 2.7708 -0.4179 0.3184  0.6624  301 LYS A NZ    
2302 N N     . PHE A 292 ? 3.1782 2.9756 3.9053 -0.5160 0.1507  0.4263  302 PHE A N     
2303 C CA    . PHE A 292 ? 3.1807 2.9957 3.9829 -0.5496 0.1332  0.4106  302 PHE A CA    
2304 C C     . PHE A 292 ? 3.1490 2.9581 3.9338 -0.5454 0.1006  0.3485  302 PHE A C     
2305 O O     . PHE A 292 ? 3.1293 2.9141 3.8489 -0.5193 0.0914  0.3196  302 PHE A O     
2306 C CB    . PHE A 292 ? 2.3557 2.2483 3.1930 -0.5583 0.1563  0.4419  302 PHE A CB    
2307 C CG    . PHE A 292 ? 2.3931 2.2957 3.3275 -0.5985 0.1589  0.4722  302 PHE A CG    
2308 C CD1   . PHE A 292 ? 2.4474 2.3027 3.4190 -0.6155 0.1660  0.5084  302 PHE A CD1   
2309 C CD2   . PHE A 292 ? 2.3755 2.3367 3.3662 -0.6191 0.1549  0.4663  302 PHE A CD2   
2310 C CE1   . PHE A 292 ? 2.4843 2.3482 3.5510 -0.6545 0.1685  0.5384  302 PHE A CE1   
2311 C CE2   . PHE A 292 ? 2.4102 2.3840 3.4960 -0.6578 0.1568  0.4947  302 PHE A CE2   
2312 C CZ    . PHE A 292 ? 2.4650 2.3894 3.5905 -0.6765 0.1636  0.5313  302 PHE A CZ    
2313 N N     . GLU A 293 ? 3.7806 3.6154 4.6257 -0.5707 0.0836  0.3295  303 GLU A N     
2314 C CA    . GLU A 293 ? 3.7547 3.5914 4.5897 -0.5672 0.0526  0.2724  303 GLU A CA    
2315 C C     . GLU A 293 ? 3.7004 3.5853 4.4716 -0.5372 0.0617  0.2578  303 GLU A C     
2316 O O     . GLU A 293 ? 3.6849 3.6056 4.4305 -0.5232 0.0900  0.2905  303 GLU A O     
2317 C CB    . GLU A 293 ? 2.3878 2.2464 3.3065 -0.6011 0.0328  0.2585  303 GLU A CB    
2318 C CG    . GLU A 293 ? 2.3825 2.2217 3.2995 -0.6003 -0.0059 0.1977  303 GLU A CG    
2319 C CD    . GLU A 293 ? 2.4164 2.2512 3.4224 -0.6365 -0.0318 0.1827  303 GLU A CD    
2320 O OE1   . GLU A 293 ? 2.4390 2.2935 3.5141 -0.6651 -0.0188 0.2204  303 GLU A OE1   
2321 O OE2   . GLU A 293 ? 2.4226 2.2353 3.4304 -0.6356 -0.0658 0.1327  303 GLU A OE2   
2322 N N     . CYS A 294 ? 3.5234 3.4084 4.2696 -0.5264 0.0373  0.2092  304 CYS A N     
2323 C CA    . CYS A 294 ? 3.4774 3.3891 4.1546 -0.4950 0.0413  0.1897  304 CYS A CA    
2324 C C     . CYS A 294 ? 3.4496 3.4220 4.1123 -0.4839 0.0691  0.2187  304 CYS A C     
2325 O O     . CYS A 294 ? 3.4283 3.4044 4.0287 -0.4563 0.0836  0.2244  304 CYS A O     
2326 C CB    . CYS A 294 ? 3.4696 3.3953 4.1507 -0.4941 0.0130  0.1413  304 CYS A CB    
2327 S SG    . CYS A 294 ? 3.4697 3.4544 4.2319 -0.5232 0.0050  0.1399  304 CYS A SG    
2328 N N     . SER A 295 ? 3.5094 3.5302 4.2307 -0.5044 0.0749  0.2347  305 SER A N     
2329 C CA    . SER A 295 ? 3.4952 3.5740 4.2157 -0.4973 0.1044  0.2712  305 SER A CA    
2330 C C     . SER A 295 ? 3.4512 3.5749 4.1222 -0.4699 0.1086  0.2540  305 SER A C     
2331 O O     . SER A 295 ? 3.4395 3.6170 4.1140 -0.4633 0.1294  0.2783  305 SER A O     
2332 C CB    . SER A 295 ? 3.7112 3.7695 4.4038 -0.4861 0.1308  0.3129  305 SER A CB    
2333 O OG    . SER A 295 ? 3.7072 3.8215 4.4064 -0.4804 0.1598  0.3519  305 SER A OG    
2334 N N     . GLU A 296 ? 4.3408 4.4433 4.9670 -0.4532 0.0893  0.2137  306 GLU A N     
2335 C CA    . GLU A 296 ? 4.3029 4.4410 4.8815 -0.4269 0.0924  0.1979  306 GLU A CA    
2336 C C     . GLU A 296 ? 4.2881 4.4895 4.9076 -0.4355 0.0911  0.1948  306 GLU A C     
2337 O O     . GLU A 296 ? 4.2669 4.5127 4.8638 -0.4175 0.1064  0.2046  306 GLU A O     
2338 C CB    . GLU A 296 ? 2.7414 2.8457 3.2739 -0.4107 0.0710  0.1567  306 GLU A CB    
2339 C CG    . GLU A 296 ? 2.7454 2.7999 3.2228 -0.3928 0.0755  0.1587  306 GLU A CG    
2340 C CD    . GLU A 296 ? 2.7256 2.7585 3.1565 -0.3741 0.0581  0.1217  306 GLU A CD    
2341 O OE1   . GLU A 296 ? 2.7238 2.7573 3.1729 -0.3810 0.0363  0.0916  306 GLU A OE1   
2342 O OE2   . GLU A 296 ? 2.7134 2.7310 3.0905 -0.3517 0.0661  0.1231  306 GLU A OE2   
2343 N N     . GLU A 297 ? 3.7143 3.9194 4.3935 -0.4616 0.0709  0.1789  307 GLU A N     
2344 C CA    . GLU A 297 ? 3.7037 3.9703 4.4303 -0.4725 0.0665  0.1745  307 GLU A CA    
2345 C C     . GLU A 297 ? 3.7202 4.0277 4.5058 -0.4929 0.0880  0.2175  307 GLU A C     
2346 O O     . GLU A 297 ? 3.7050 4.0756 4.5094 -0.4901 0.0983  0.2278  307 GLU A O     
2347 C CB    . GLU A 297 ? 2.5978 2.8539 3.3650 -0.4908 0.0328  0.1359  307 GLU A CB    
2348 C CG    . GLU A 297 ? 2.5869 2.8042 3.2997 -0.4708 0.0111  0.0941  307 GLU A CG    
2349 C CD    . GLU A 297 ? 2.5525 2.8093 3.2261 -0.4453 0.0077  0.0723  307 GLU A CD    
2350 O OE1   . GLU A 297 ? 2.5326 2.8318 3.1911 -0.4322 0.0285  0.0928  307 GLU A OE1   
2351 O OE2   . GLU A 297 ? 2.5482 2.7936 3.2052 -0.4366 -0.0159 0.0350  307 GLU A OE2   
2352 N N     . GLU A 298 ? 4.5105 4.7830 5.3260 -0.5123 0.0952  0.2440  308 GLU A N     
2353 C CA    . GLU A 298 ? 4.5334 4.8408 5.4174 -0.5372 0.1135  0.2865  308 GLU A CA    
2354 C C     . GLU A 298 ? 4.5260 4.8761 5.3835 -0.5174 0.1499  0.3296  308 GLU A C     
2355 O O     . GLU A 298 ? 4.5225 4.9373 5.4208 -0.5240 0.1643  0.3520  308 GLU A O     
2356 C CB    . GLU A 298 ? 3.0319 3.2829 3.9572 -0.5640 0.1090  0.3025  308 GLU A CB    
2357 C CG    . GLU A 298 ? 3.0496 3.2643 4.0195 -0.5883 0.0721  0.2632  308 GLU A CG    
2358 C CD    . GLU A 298 ? 3.0534 3.3204 4.1065 -0.6167 0.0596  0.2577  308 GLU A CD    
2359 O OE1   . GLU A 298 ? 3.0698 3.3737 4.1832 -0.6378 0.0789  0.2993  308 GLU A OE1   
2360 O OE2   . GLU A 298 ? 3.0413 3.3154 4.1001 -0.6170 0.0304  0.2125  308 GLU A OE2   
2361 N N     . VAL A 299 ? 3.7141 4.0309 4.5038 -0.4917 0.1641  0.3401  309 VAL A N     
2362 C CA    . VAL A 299 ? 3.7169 4.0679 4.4814 -0.4721 0.1980  0.3824  309 VAL A CA    
2363 C C     . VAL A 299 ? 3.6831 4.0727 4.3869 -0.4362 0.2061  0.3703  309 VAL A C     
2364 O O     . VAL A 299 ? 3.6856 4.0979 4.3538 -0.4124 0.2312  0.3980  309 VAL A O     
2365 C CB    . VAL A 299 ? 2.2110 2.5093 2.9384 -0.4625 0.2107  0.4055  309 VAL A CB    
2366 C CG1   . VAL A 299 ? 2.2483 2.5033 3.0355 -0.4970 0.2018  0.4174  309 VAL A CG1   
2367 C CG2   . VAL A 299 ? 2.1917 2.4432 2.8387 -0.4343 0.1985  0.3719  309 VAL A CG2   
2368 N N     . LEU A 300 ? 3.0004 3.3949 3.6899 -0.4300 0.1843  0.3286  310 LEU A N     
2369 C CA    . LEU A 300 ? 2.9715 3.4069 3.6154 -0.3991 0.1907  0.3178  310 LEU A CA    
2370 C C     . LEU A 300 ? 2.9740 3.4847 3.6536 -0.3984 0.2138  0.3509  310 LEU A C     
2371 O O     . LEU A 300 ? 2.9687 3.5079 3.6058 -0.3690 0.2338  0.3663  310 LEU A O     
2372 C CB    . LEU A 300 ? 1.9651 2.4001 2.6015 -0.3967 0.1638  0.2721  310 LEU A CB    
2373 C CG    . LEU A 300 ? 1.9516 2.3303 2.5228 -0.3776 0.1483  0.2395  310 LEU A CG    
2374 C CD1   . LEU A 300 ? 1.9315 2.3150 2.5035 -0.3771 0.1228  0.1986  310 LEU A CD1   
2375 C CD2   . LEU A 300 ? 1.9406 2.3188 2.4422 -0.3422 0.1649  0.2470  310 LEU A CD2   
2376 N N     . SER A 301 ? 3.5149 4.0583 4.2739 -0.4303 0.2103  0.3614  311 SER A N     
2377 C CA    . SER A 301 ? 3.5197 4.1394 4.3236 -0.4336 0.2327  0.3959  311 SER A CA    
2378 C C     . SER A 301 ? 3.5465 4.1731 4.3465 -0.4278 0.2647  0.4466  311 SER A C     
2379 O O     . SER A 301 ? 3.5480 4.2360 4.3482 -0.4114 0.2898  0.4761  311 SER A O     
2380 C CB    . SER A 301 ? 2.3434 2.9930 3.2412 -0.4733 0.2192  0.3954  311 SER A CB    
2381 O OG    . SER A 301 ? 2.3731 2.9728 3.3148 -0.5057 0.2114  0.4051  311 SER A OG    
2382 N N     . CYS A 302 ? 4.5061 5.0712 5.3011 -0.4391 0.2639  0.4567  312 CYS A N     
2383 C CA    . CYS A 302 ? 4.5359 5.1017 5.3245 -0.4326 0.2933  0.5054  312 CYS A CA    
2384 C C     . CYS A 302 ? 4.5279 5.0937 5.2273 -0.3867 0.3090  0.5076  312 CYS A C     
2385 O O     . CYS A 302 ? 4.5496 5.1396 5.2363 -0.3710 0.3371  0.5484  312 CYS A O     
2386 C CB    . CYS A 302 ? 3.1928 3.6888 4.0012 -0.4568 0.2857  0.5139  312 CYS A CB    
2387 S SG    . CYS A 302 ? 3.2140 3.7037 4.1335 -0.5122 0.2670  0.5149  312 CYS A SG    
2388 N N     . LEU A 303 ? 3.7340 4.2680 4.3718 -0.3651 0.2902  0.4643  313 LEU A N     
2389 C CA    . LEU A 303 ? 3.7248 4.2652 4.2833 -0.3214 0.3012  0.4604  313 LEU A CA    
2390 C C     . LEU A 303 ? 3.6971 4.2859 4.2330 -0.2977 0.2988  0.4387  313 LEU A C     
2391 O O     . LEU A 303 ? 3.6940 4.2918 4.1687 -0.2607 0.3082  0.4365  313 LEU A O     
2392 C CB    . LEU A 303 ? 1.7332 2.1996 2.2312 -0.3090 0.2852  0.4329  313 LEU A CB    
2393 C CG    . LEU A 303 ? 1.7089 2.1322 2.2015 -0.3201 0.2536  0.3852  313 LEU A CG    
2394 C CD1   . LEU A 303 ? 1.6812 2.1086 2.1136 -0.2883 0.2456  0.3536  313 LEU A CD1   
2395 C CD2   . LEU A 303 ? 1.7223 2.0734 2.2030 -0.3312 0.2411  0.3770  313 LEU A CD2   
2396 N N     . TYR A 304 ? 3.9882 4.6072 4.5723 -0.3170 0.2854  0.4219  314 TYR A N     
2397 C CA    . TYR A 304 ? 3.9643 4.6297 4.5298 -0.2942 0.2827  0.4024  314 TYR A CA    
2398 C C     . TYR A 304 ? 3.9748 4.7191 4.5626 -0.2821 0.3101  0.4386  314 TYR A C     
2399 O O     . TYR A 304 ? 3.9661 4.7453 4.5140 -0.2482 0.3178  0.4333  314 TYR A O     
2400 C CB    . TYR A 304 ? 2.8237 3.4945 3.4290 -0.3160 0.2568  0.3693  314 TYR A CB    
2401 C CG    . TYR A 304 ? 2.8028 3.4199 3.3603 -0.3062 0.2310  0.3242  314 TYR A CG    
2402 C CD1   . TYR A 304 ? 2.7935 3.3874 3.2759 -0.2709 0.2324  0.3101  314 TYR A CD1   
2403 C CD2   . TYR A 304 ? 2.7952 3.3865 3.3845 -0.3316 0.2050  0.2960  314 TYR A CD2   
2404 C CE1   . TYR A 304 ? 2.7759 3.3235 3.2196 -0.2633 0.2104  0.2727  314 TYR A CE1   
2405 C CE2   . TYR A 304 ? 2.7782 3.3254 3.3244 -0.3211 0.1834  0.2580  314 TYR A CE2   
2406 C CZ    . TYR A 304 ? 2.7680 3.2942 3.2431 -0.2879 0.1872  0.2483  314 TYR A CZ    
2407 O OH    . TYR A 304 ? 2.7525 3.2375 3.1894 -0.2788 0.1674  0.2141  314 TYR A OH    
2408 N N     . ASN A 305 ? 4.4524 5.2241 5.1053 -0.3092 0.3251  0.4765  315 ASN A N     
2409 C CA    . ASN A 305 ? 4.4645 5.3181 5.1522 -0.3030 0.3524  0.5156  315 ASN A CA    
2410 C C     . ASN A 305 ? 4.4880 5.3524 5.1255 -0.2696 0.3812  0.5493  315 ASN A C     
2411 O O     . ASN A 305 ? 4.5045 5.4362 5.1653 -0.2606 0.4083  0.5883  315 ASN A O     
2412 C CB    . ASN A 305 ? 2.2212 3.1019 3.0068 -0.3482 0.3567  0.5448  315 ASN A CB    
2413 C CG    . ASN A 305 ? 2.2008 3.0888 3.0418 -0.3777 0.3287  0.5119  315 ASN A CG    
2414 O OD1   . ASN A 305 ? 2.1742 3.0744 2.9874 -0.3603 0.3134  0.4763  315 ASN A OD1   
2415 N ND2   . ASN A 305 ? 2.2163 3.0968 3.1367 -0.4217 0.3210  0.5235  315 ASN A ND2   
2416 N N     . ARG A 306 ? 3.5777 4.3775 4.1479 -0.2510 0.3748  0.5342  316 ARG A N     
2417 C CA    . ARG A 306 ? 3.6020 4.4023 4.1155 -0.2164 0.3971  0.5593  316 ARG A CA    
2418 C C     . ARG A 306 ? 3.6371 4.4533 4.1946 -0.2341 0.4222  0.6132  316 ARG A C     
2419 O O     . ARG A 306 ? 3.6621 4.5146 4.1942 -0.2061 0.4493  0.6480  316 ARG A O     
2420 C CB    . ARG A 306 ? 2.8658 3.7272 3.3385 -0.1726 0.4118  0.5606  316 ARG A CB    
2421 C CG    . ARG A 306 ? 2.8372 3.6797 3.2603 -0.1500 0.3890  0.5105  316 ARG A CG    
2422 C CD    . ARG A 306 ? 2.8351 3.6004 3.1894 -0.1340 0.3726  0.4815  316 ARG A CD    
2423 N NE    . ARG A 306 ? 2.8096 3.5538 3.1236 -0.1164 0.3504  0.4360  316 ARG A NE    
2424 C CZ    . ARG A 306 ? 2.8020 3.4822 3.0630 -0.1050 0.3322  0.4048  316 ARG A CZ    
2425 N NH1   . ARG A 306 ? 2.7813 3.4467 3.0125 -0.0903 0.3139  0.3679  316 ARG A NH1   
2426 N NH2   . ARG A 306 ? 2.8167 3.4486 3.0563 -0.1081 0.3325  0.4120  316 ARG A NH2   
2427 N N     . ASN A 307 ? 3.0835 3.8716 3.7067 -0.2793 0.4127  0.6201  317 ASN A N     
2428 C CA    . ASN A 307 ? 3.1202 3.9137 3.7904 -0.3001 0.4346  0.6721  317 ASN A CA    
2429 C C     . ASN A 307 ? 3.1390 3.8549 3.7674 -0.2971 0.4299  0.6723  317 ASN A C     
2430 O O     . ASN A 307 ? 3.1317 3.7827 3.7709 -0.3220 0.4048  0.6450  317 ASN A O     
2431 C CB    . ASN A 307 ? 6.2616 7.0673 7.0332 -0.3518 0.4267  0.6822  317 ASN A CB    
2432 C CG    . ASN A 307 ? 6.2275 7.0060 7.0145 -0.3716 0.3905  0.6274  317 ASN A CG    
2433 O OD1   . ASN A 307 ? 6.2029 6.9465 6.9256 -0.3492 0.3718  0.5842  317 ASN A OD1   
2434 N ND2   . ASN A 307 ? 6.2285 7.0245 7.1025 -0.4132 0.3802  0.6296  317 ASN A ND2   
2435 N N     . HIS A 308 ? 4.2437 4.9702 4.8239 -0.2643 0.4542  0.7034  318 HIS A N     
2436 C CA    . HIS A 308 ? 4.2627 4.9223 4.7926 -0.2529 0.4511  0.7035  318 HIS A CA    
2437 C C     . HIS A 308 ? 4.3051 4.9526 4.8802 -0.2753 0.4701  0.7558  318 HIS A C     
2438 O O     . HIS A 308 ? 4.3269 4.9236 4.8639 -0.2648 0.4709  0.7632  318 HIS A O     
2439 C CB    . HIS A 308 ? 3.0734 3.7450 3.5130 -0.1984 0.4614  0.6987  318 HIS A CB    
2440 C CG    . HIS A 308 ? 3.0924 3.8478 3.5289 -0.1700 0.4935  0.7377  318 HIS A CG    
2441 N ND1   . HIS A 308 ? 3.1338 3.9216 3.5915 -0.1675 0.5252  0.7969  318 HIS A ND1   
2442 C CD2   . HIS A 308 ? 3.0783 3.8930 3.4916 -0.1405 0.4994  0.7266  318 HIS A CD2   
2443 C CE1   . HIS A 308 ? 3.1435 4.0103 3.5909 -0.1372 0.5499  0.8208  318 HIS A CE1   
2444 N NE2   . HIS A 308 ? 3.1105 3.9942 3.5306 -0.1200 0.5341  0.7777  318 HIS A NE2   
2445 N N     . GLN A 309 ? 2.7732 3.4696 3.4302 -0.3045 0.4863  0.7940  319 GLN A N     
2446 C CA    . GLN A 309 ? 2.8165 3.5010 3.5285 -0.3308 0.5043  0.8468  319 GLN A CA    
2447 C C     . GLN A 309 ? 2.8177 3.4504 3.6061 -0.3847 0.4803  0.8343  319 GLN A C     
2448 O O     . GLN A 309 ? 2.8556 3.4721 3.6999 -0.4120 0.4917  0.8759  319 GLN A O     
2449 C CB    . GLN A 309 ? 2.6369 3.4102 3.3948 -0.3282 0.5416  0.9065  319 GLN A CB    
2450 C CG    . GLN A 309 ? 2.6548 3.4726 3.3376 -0.2729 0.5705  0.9324  319 GLN A CG    
2451 C CD    . GLN A 309 ? 2.6961 3.5848 3.4236 -0.2715 0.6121  1.0058  319 GLN A CD    
2452 O OE1   . GLN A 309 ? 2.6941 3.6428 3.4988 -0.2971 0.6232  1.0293  319 GLN A OE1   
2453 N NE2   . GLN A 309 ? 2.7354 3.6199 3.4155 -0.2407 0.6355  1.0436  319 GLN A NE2   
2454 N N     . ASP A 310 ? 6.2137 6.8209 7.0048 -0.3985 0.4469  0.7777  320 ASP A N     
2455 C CA    . ASP A 310 ? 6.2150 6.7702 7.0698 -0.4445 0.4193  0.7565  320 ASP A CA    
2456 C C     . ASP A 310 ? 6.2374 6.7043 7.0622 -0.4465 0.4077  0.7507  320 ASP A C     
2457 O O     . ASP A 310 ? 6.2326 6.6718 6.9748 -0.4110 0.4085  0.7378  320 ASP A O     
2458 C CB    . ASP A 310 ? 3.2040 3.7572 4.0570 -0.4509 0.3868  0.6956  320 ASP A CB    
2459 C CG    . ASP A 310 ? 3.1839 3.8224 4.0767 -0.4531 0.3950  0.6998  320 ASP A CG    
2460 O OD1   . ASP A 310 ? 3.1970 3.8998 4.0913 -0.4356 0.4271  0.7430  320 ASP A OD1   
2461 O OD2   . ASP A 310 ? 3.1565 3.8004 4.0775 -0.4701 0.3694  0.6601  320 ASP A OD2   
2462 N N     . PRO A 311 ? 2.1406 2.5627 3.0335 -0.4876 0.3956  0.7587  321 PRO A N     
2463 C CA    . PRO A 311 ? 2.1669 2.5045 3.0355 -0.4896 0.3850  0.7555  321 PRO A CA    
2464 C C     . PRO A 311 ? 2.1341 2.4175 2.9343 -0.4719 0.3543  0.6933  321 PRO A C     
2465 O O     . PRO A 311 ? 2.1480 2.3748 2.8975 -0.4556 0.3508  0.6893  321 PRO A O     
2466 C CB    . PRO A 311 ? 3.9970 4.3035 4.9628 -0.5402 0.3724  0.7670  321 PRO A CB    
2467 C CG    . PRO A 311 ? 3.9709 4.3324 4.9990 -0.5643 0.3615  0.7488  321 PRO A CG    
2468 C CD    . PRO A 311 ? 3.9485 4.3947 4.9456 -0.5338 0.3888  0.7682  321 PRO A CD    
2469 N N     . LEU A 312 ? 2.5732 2.8756 3.3750 -0.4755 0.3326  0.6472  322 LEU A N     
2470 C CA    . LEU A 312 ? 2.5393 2.8014 3.2779 -0.4573 0.3057  0.5900  322 LEU A CA    
2471 C C     . LEU A 312 ? 2.5138 2.8038 3.1679 -0.4117 0.3178  0.5821  322 LEU A C     
2472 O O     . LEU A 312 ? 2.4999 2.7481 3.0886 -0.3892 0.3048  0.5517  322 LEU A O     
2473 C CB    . LEU A 312 ? 2.4472 2.7172 3.2245 -0.4796 0.2770  0.5453  322 LEU A CB    
2474 C CG    . LEU A 312 ? 2.4713 2.7207 3.3387 -0.5254 0.2597  0.5450  322 LEU A CG    
2475 C CD1   . LEU A 312 ? 2.5157 2.6952 3.3968 -0.5396 0.2581  0.5641  322 LEU A CD1   
2476 C CD2   . LEU A 312 ? 2.4793 2.7988 3.4263 -0.5495 0.2752  0.5783  322 LEU A CD2   
2477 N N     . ALA A 313 ? 3.6086 3.9705 4.2668 -0.3980 0.3418  0.6090  323 ALA A N     
2478 C CA    . ALA A 313 ? 3.5897 3.9826 4.1726 -0.3538 0.3531  0.6020  323 ALA A CA    
2479 C C     . ALA A 313 ? 3.6189 3.9944 4.1474 -0.3246 0.3728  0.6316  323 ALA A C     
2480 O O     . ALA A 313 ? 3.6064 3.9672 4.0606 -0.2902 0.3685  0.6094  323 ALA A O     
2481 C CB    . ALA A 313 ? 3.8068 4.2838 4.4130 -0.3468 0.3715  0.6200  323 ALA A CB    
2482 N N     . VAL A 314 ? 3.5335 3.9112 4.1006 -0.3380 0.3938  0.6821  324 VAL A N     
2483 C CA    . VAL A 314 ? 3.5669 3.9283 4.0850 -0.3102 0.4129  0.7138  324 VAL A CA    
2484 C C     . VAL A 314 ? 3.5709 3.8502 4.0522 -0.3091 0.3911  0.6868  324 VAL A C     
2485 O O     . VAL A 314 ? 3.5948 3.8535 4.0266 -0.2830 0.4013  0.7035  324 VAL A O     
2486 C CB    . VAL A 314 ? 3.9490 4.3337 4.5211 -0.3252 0.4430  0.7803  324 VAL A CB    
2487 C CG1   . VAL A 314 ? 3.9483 4.4222 4.5549 -0.3222 0.4686  0.8127  324 VAL A CG1   
2488 C CG2   . VAL A 314 ? 3.9688 4.3038 4.6168 -0.3731 0.4294  0.7866  324 VAL A CG2   
2489 N N     . ALA A 315 ? 2.7737 3.0086 3.2817 -0.3367 0.3615  0.6469  325 ALA A N     
2490 C CA    . ALA A 315 ? 2.7720 2.9335 3.2425 -0.3332 0.3384  0.6145  325 ALA A CA    
2491 C C     . ALA A 315 ? 2.7287 2.8818 3.1384 -0.3102 0.3177  0.5610  325 ALA A C     
2492 O O     . ALA A 315 ? 2.7253 2.8266 3.0936 -0.2998 0.3015  0.5354  325 ALA A O     
2493 C CB    . ALA A 315 ? 3.3191 3.4323 3.8527 -0.3744 0.3179  0.6036  325 ALA A CB    
2494 N N     . TYR A 316 ? 3.3961 3.6008 3.8022 -0.3020 0.3186  0.5459  326 TYR A N     
2495 C CA    . TYR A 316 ? 3.3563 3.5543 3.7144 -0.2841 0.2986  0.4966  326 TYR A CA    
2496 C C     . TYR A 316 ? 3.3528 3.5731 3.6402 -0.2409 0.3102  0.4971  326 TYR A C     
2497 O O     . TYR A 316 ? 3.3441 3.5286 3.5775 -0.2209 0.2974  0.4710  326 TYR A O     
2498 C CB    . TYR A 316 ? 2.1978 2.4328 2.5936 -0.3005 0.2884  0.4743  326 TYR A CB    
2499 C CG    . TYR A 316 ? 2.1594 2.3900 2.5089 -0.2819 0.2695  0.4274  326 TYR A CG    
2500 C CD1   . TYR A 316 ? 2.1466 2.3213 2.4675 -0.2814 0.2464  0.3918  326 TYR A CD1   
2501 C CD2   . TYR A 316 ? 2.1382 2.4214 2.4746 -0.2645 0.2754  0.4205  326 TYR A CD2   
2502 C CE1   . TYR A 316 ? 2.1140 2.2860 2.3965 -0.2653 0.2308  0.3530  326 TYR A CE1   
2503 C CE2   . TYR A 316 ? 2.1071 2.3837 2.4040 -0.2480 0.2586  0.3805  326 TYR A CE2   
2504 C CZ    . TYR A 316 ? 2.0952 2.3165 2.3665 -0.2493 0.2369  0.3482  326 TYR A CZ    
2505 O OH    . TYR A 316 ? 2.0667 2.2830 2.3024 -0.2336 0.2220  0.3125  326 TYR A OH    
2506 N N     . HIS A 317 ? 2.9632 3.2450 3.2529 -0.2260 0.3330  0.5246  327 HIS A N     
2507 C CA    . HIS A 317 ? 2.9631 3.2729 3.1880 -0.1827 0.3431  0.5229  327 HIS A CA    
2508 C C     . HIS A 317 ? 2.9906 3.2688 3.1620 -0.1566 0.3483  0.5341  327 HIS A C     
2509 O O     . HIS A 317 ? 2.9824 3.2524 3.0932 -0.1251 0.3401  0.5093  327 HIS A O     
2510 C CB    . HIS A 317 ? 2.2841 2.6685 2.5266 -0.1714 0.3698  0.5575  327 HIS A CB    
2511 C CG    . HIS A 317 ? 2.2719 2.6926 2.4593 -0.1313 0.3720  0.5396  327 HIS A CG    
2512 N ND1   . HIS A 317 ? 2.2704 2.6625 2.3883 -0.0989 0.3610  0.5132  327 HIS A ND1   
2513 C CD2   . HIS A 317 ? 2.2632 2.7459 2.4572 -0.1184 0.3828  0.5432  327 HIS A CD2   
2514 C CE1   . HIS A 317 ? 2.2632 2.6947 2.3469 -0.0677 0.3640  0.5005  327 HIS A CE1   
2515 N NE2   . HIS A 317 ? 2.2587 2.7454 2.3856 -0.0777 0.3775  0.5184  327 HIS A NE2   
2516 N N     . LEU A 318 ? 2.6256 2.8856 2.8204 -0.1690 0.3608  0.5710  328 LEU A N     
2517 C CA    . LEU A 318 ? 2.6556 2.8898 2.7999 -0.1420 0.3670  0.5852  328 LEU A CA    
2518 C C     . LEU A 318 ? 2.6406 2.8109 2.7500 -0.1400 0.3399  0.5444  328 LEU A C     
2519 O O     . LEU A 318 ? 2.6598 2.8088 2.7206 -0.1141 0.3401  0.5464  328 LEU A O     
2520 C CB    . LEU A 318 ? 2.4325 2.6623 2.6131 -0.1558 0.3883  0.6386  328 LEU A CB    
2521 C CG    . LEU A 318 ? 2.4405 2.6441 2.6990 -0.2035 0.3847  0.6532  328 LEU A CG    
2522 C CD1   . LEU A 318 ? 2.4176 2.5572 2.6826 -0.2254 0.3526  0.6081  328 LEU A CD1   
2523 C CD2   . LEU A 318 ? 2.4924 2.6859 2.7716 -0.2075 0.4069  0.7083  328 LEU A CD2   
2524 N N     . ILE A 319 ? 2.6952 2.8381 2.8298 -0.1659 0.3168  0.5081  329 ILE A N     
2525 C CA    . ILE A 319 ? 2.6787 2.7668 2.7839 -0.1645 0.2916  0.4690  329 ILE A CA    
2526 C C     . ILE A 319 ? 2.6535 2.7515 2.7022 -0.1340 0.2808  0.4343  329 ILE A C     
2527 O O     . ILE A 319 ? 2.6525 2.7172 2.6595 -0.1176 0.2679  0.4139  329 ILE A O     
2528 C CB    . ILE A 319 ? 2.9015 2.9588 3.0530 -0.2008 0.2708  0.4431  329 ILE A CB    
2529 C CG1   . ILE A 319 ? 2.9310 2.9730 3.1425 -0.2322 0.2781  0.4745  329 ILE A CG1   
2530 C CG2   . ILE A 319 ? 2.8860 2.8915 3.0060 -0.1966 0.2466  0.4049  329 ILE A CG2   
2531 C CD1   . ILE A 319 ? 2.9694 2.9702 3.1667 -0.2260 0.2837  0.4984  329 ILE A CD1   
2532 N N     . ILE A 320 ? 3.2897 3.4334 3.3391 -0.1263 0.2854  0.4277  330 ILE A N     
2533 C CA    . ILE A 320 ? 3.2707 3.4228 3.2699 -0.0973 0.2751  0.3960  330 ILE A CA    
2534 C C     . ILE A 320 ? 3.3003 3.4682 3.2471 -0.0580 0.2874  0.4114  330 ILE A C     
2535 O O     . ILE A 320 ? 3.2952 3.4504 3.1943 -0.0328 0.2744  0.3842  330 ILE A O     
2536 C CB    . ILE A 320 ? 2.1057 2.3013 2.1199 -0.0979 0.2760  0.3841  330 ILE A CB    
2537 C CG1   . ILE A 320 ? 2.0799 2.2630 2.0549 -0.0800 0.2563  0.3415  330 ILE A CG1   
2538 C CG2   . ILE A 320 ? 2.1275 2.3824 2.1394 -0.0779 0.3013  0.4169  330 ILE A CG2   
2539 C CD1   . ILE A 320 ? 2.0541 2.1900 2.0378 -0.1007 0.2328  0.3093  330 ILE A CD1   
2540 N N     . ASP A 321 ? 2.4020 2.5985 2.3591 -0.0526 0.3119  0.4554  331 ASP A N     
2541 C CA    . ASP A 321 ? 2.4363 2.6513 2.3434 -0.0132 0.3253  0.4741  331 ASP A CA    
2542 C C     . ASP A 321 ? 2.4527 2.6176 2.3335 -0.0077 0.3152  0.4706  331 ASP A C     
2543 O O     . ASP A 321 ? 2.4671 2.6291 2.2939 0.0264  0.3102  0.4595  331 ASP A O     
2544 C CB    . ASP A 321 ? 2.7798 3.0436 2.7090 -0.0093 0.3568  0.5269  331 ASP A CB    
2545 C CG    . ASP A 321 ? 2.8105 3.1162 2.6845 0.0392  0.3720  0.5412  331 ASP A CG    
2546 O OD1   . ASP A 321 ? 2.8187 3.1036 2.6371 0.0687  0.3589  0.5183  331 ASP A OD1   
2547 O OD2   . ASP A 321 ? 2.8283 3.1903 2.7153 0.0488  0.3967  0.5750  331 ASP A OD2   
2548 N N     . ASN A 322 ? 2.7694 2.8953 2.6897 -0.0407 0.3109  0.4783  332 ASN A N     
2549 C CA    . ASN A 322 ? 2.7841 2.8597 2.6856 -0.0387 0.3003  0.4744  332 ASN A CA    
2550 C C     . ASN A 322 ? 2.7579 2.8050 2.6209 -0.0262 0.2738  0.4259  332 ASN A C     
2551 O O     . ASN A 322 ? 2.7744 2.8029 2.5964 -0.0028 0.2674  0.4201  332 ASN A O     
2552 C CB    . ASN A 322 ? 2.7125 2.7501 2.6684 -0.0784 0.2974  0.4858  332 ASN A CB    
2553 C CG    . ASN A 322 ? 2.7315 2.7166 2.6696 -0.0754 0.2873  0.4838  332 ASN A CG    
2554 O OD1   . ASN A 322 ? 2.7578 2.7432 2.6514 -0.0446 0.2927  0.4950  332 ASN A OD1   
2555 N ND2   . ASN A 322 ? 2.7202 2.6615 2.6920 -0.1053 0.2718  0.4685  332 ASN A ND2   
2556 N N     . ARG A 323 ? 2.4909 2.5368 2.3689 -0.0414 0.2586  0.3924  333 ARG A N     
2557 C CA    . ARG A 323 ? 2.4652 2.4848 2.3151 -0.0338 0.2341  0.3487  333 ARG A CA    
2558 C C     . ARG A 323 ? 2.4692 2.5131 2.2693 0.0035  0.2312  0.3329  333 ARG A C     
2559 O O     . ARG A 323 ? 2.4612 2.4832 2.2313 0.0169  0.2127  0.3032  333 ARG A O     
2560 C CB    . ARG A 323 ? 2.4980 2.5090 2.3813 -0.0615 0.2200  0.3212  333 ARG A CB    
2561 C CG    . ARG A 323 ? 2.4939 2.4721 2.4207 -0.0957 0.2147  0.3246  333 ARG A CG    
2562 C CD    . ARG A 323 ? 2.4587 2.4124 2.3940 -0.1107 0.1924  0.2860  333 ARG A CD    
2563 N NE    . ARG A 323 ? 2.4331 2.4121 2.3970 -0.1260 0.1912  0.2758  333 ARG A NE    
2564 C CZ    . ARG A 323 ? 2.4125 2.4145 2.3588 -0.1127 0.1871  0.2567  333 ARG A CZ    
2565 N NH1   . ARG A 323 ? 2.4150 2.4167 2.3172 -0.0850 0.1826  0.2442  333 ARG A NH1   
2566 N NH2   . ARG A 323 ? 2.3917 2.4165 2.3657 -0.1265 0.1862  0.2494  333 ARG A NH2   
2567 N N     . ARG A 324 ? 2.7390 2.8291 2.5321 0.0207  0.2488  0.3522  334 ARG A N     
2568 C CA    . ARG A 324 ? 2.7497 2.8645 2.4944 0.0596  0.2459  0.3373  334 ARG A CA    
2569 C C     . ARG A 324 ? 2.7873 2.8982 2.4883 0.0910  0.2485  0.3485  334 ARG A C     
2570 O O     . ARG A 324 ? 2.7929 2.8985 2.4519 0.1185  0.2330  0.3213  334 ARG A O     
2571 C CB    . ARG A 324 ? 2.5317 2.7008 2.2813 0.0715  0.2646  0.3549  334 ARG A CB    
2572 C CG    . ARG A 324 ? 2.5441 2.7382 2.2443 0.1130  0.2593  0.3346  334 ARG A CG    
2573 C CD    . ARG A 324 ? 2.5570 2.8089 2.2601 0.1286  0.2807  0.3567  334 ARG A CD    
2574 N NE    . ARG A 324 ? 2.5905 2.8721 2.3008 0.1339  0.3082  0.4056  334 ARG A NE    
2575 C CZ    . ARG A 324 ? 2.6088 2.9466 2.3239 0.1485  0.3321  0.4351  334 ARG A CZ    
2576 N NH1   . ARG A 324 ? 2.5965 2.9665 2.3079 0.1608  0.3308  0.4184  334 ARG A NH1   
2577 N NH2   . ARG A 324 ? 2.6413 3.0041 2.3657 0.1518  0.3578  0.4829  334 ARG A NH2   
2578 N N     . ILE A 325 ? 2.7872 2.9004 2.4996 0.0870  0.2673  0.3888  335 ILE A N     
2579 C CA    . ILE A 325 ? 2.8273 2.9384 2.4991 0.1174  0.2722  0.4053  335 ILE A CA    
2580 C C     . ILE A 325 ? 2.8203 2.8801 2.4832 0.1107  0.2506  0.3825  335 ILE A C     
2581 O O     . ILE A 325 ? 2.8456 2.9003 2.4668 0.1401  0.2446  0.3788  335 ILE A O     
2582 C CB    . ILE A 325 ? 2.6416 2.7722 2.3314 0.1152  0.3018  0.4612  335 ILE A CB    
2583 C CG1   . ILE A 325 ? 2.6480 2.8357 2.3508 0.1215  0.3246  0.4859  335 ILE A CG1   
2584 C CG2   . ILE A 325 ? 2.6871 2.8189 2.3308 0.1510  0.3081  0.4808  335 ILE A CG2   
2585 C CD1   . ILE A 325 ? 2.6645 2.8934 2.3133 0.1684  0.3252  0.4729  335 ILE A CD1   
2586 N N     . MET A 326 ? 2.1795 2.2046 1.8806 0.0742  0.2383  0.3662  336 MET A N     
2587 C CA    . MET A 326 ? 2.1692 2.1493 1.8638 0.0678  0.2171  0.3414  336 MET A CA    
2588 C C     . MET A 326 ? 2.1559 2.1347 1.8143 0.0900  0.1947  0.2998  336 MET A C     
2589 O O     . MET A 326 ? 2.1643 2.1216 1.7990 0.1031  0.1805  0.2854  336 MET A O     
2590 C CB    . MET A 326 ? 2.7847 2.7332 2.5269 0.0266  0.2086  0.3308  336 MET A CB    
2591 C CG    . MET A 326 ? 2.8043 2.7349 2.5820 0.0038  0.2224  0.3655  336 MET A CG    
2592 S SD    . MET A 326 ? 2.7712 2.6690 2.6046 -0.0417 0.2103  0.3489  336 MET A SD    
2593 C CE    . MET A 326 ? 2.7560 2.6113 2.5677 -0.0374 0.1841  0.3117  336 MET A CE    
2594 N N     . ASN A 327 ? 2.8260 2.8276 2.4827 0.0940  0.1911  0.2808  337 ASN A N     
2595 C CA    . ASN A 327 ? 2.8185 2.8196 2.4444 0.1154  0.1700  0.2425  337 ASN A CA    
2596 C C     . ASN A 327 ? 2.8588 2.8836 2.4348 0.1594  0.1719  0.2461  337 ASN A C     
2597 O O     . ASN A 327 ? 2.8655 2.8794 2.4131 0.1791  0.1518  0.2185  337 ASN A O     
2598 C CB    . ASN A 327 ? 2.6514 2.6673 2.2912 0.1076  0.1659  0.2227  337 ASN A CB    
2599 C CG    . ASN A 327 ? 2.6114 2.6030 2.2936 0.0692  0.1583  0.2104  337 ASN A CG    
2600 O OD1   . ASN A 327 ? 2.6061 2.5835 2.3184 0.0439  0.1660  0.2287  337 ASN A OD1   
2601 N ND2   . ASN A 327 ? 2.5863 2.5722 2.2709 0.0661  0.1423  0.1790  337 ASN A ND2   
2602 N N     . GLU A 328 ? 2.3706 2.4306 1.9372 0.1755  0.1956  0.2802  338 GLU A N     
2603 C CA    . GLU A 328 ? 2.4153 2.5008 1.9327 0.2197  0.2005  0.2899  338 GLU A CA    
2604 C C     . GLU A 328 ? 2.4365 2.4971 1.9404 0.2253  0.1970  0.3005  338 GLU A C     
2605 O O     . GLU A 328 ? 2.4401 2.4854 1.9702 0.2035  0.2111  0.3316  338 GLU A O     
2606 C CB    . GLU A 328 ? 2.9072 3.0390 2.4219 0.2341  0.2305  0.3308  338 GLU A CB    
2607 C CG    . GLU A 328 ? 2.9124 3.0836 2.4050 0.2607  0.2313  0.3162  338 GLU A CG    
2608 C CD    . GLU A 328 ? 2.9531 3.1441 2.3851 0.3125  0.2224  0.3017  338 GLU A CD    
2609 O OE1   . GLU A 328 ? 2.9913 3.1938 2.3970 0.3358  0.2339  0.3285  338 GLU A OE1   
2610 O OE2   . GLU A 328 ? 2.9496 3.1438 2.3604 0.3310  0.2029  0.2630  338 GLU A OE2   
2611 N N     . ALA A 329 ? 3.1617 3.2182 2.6254 0.2555  0.1772  0.2741  339 ALA A N     
2612 C CA    . ALA A 329 ? 3.1782 3.2099 2.6281 0.2620  0.1685  0.2760  339 ALA A CA    
2613 C C     . ALA A 329 ? 3.1421 3.1303 2.6351 0.2196  0.1602  0.2693  339 ALA A C     
2614 O O     . ALA A 329 ? 3.1530 3.1222 2.6597 0.2073  0.1706  0.2964  339 ALA A O     
2615 C CB    . ALA A 329 ? 2.1267 2.1767 1.5564 0.2836  0.1930  0.3231  339 ALA A CB    
2616 N N     . LYS A 330 ? 2.2467 2.2196 1.7602 0.1992  0.1415  0.2334  340 LYS A N     
2617 C CA    . LYS A 330 ? 2.2113 2.1476 1.7633 0.1621  0.1320  0.2224  340 LYS A CA    
2618 C C     . LYS A 330 ? 2.2199 2.1305 1.7608 0.1681  0.1170  0.2127  340 LYS A C     
2619 O O     . LYS A 330 ? 2.1963 2.0776 1.7651 0.1419  0.1096  0.2053  340 LYS A O     
2620 C CB    . LYS A 330 ? 2.4038 2.3350 1.9756 0.1445  0.1161  0.1874  340 LYS A CB    
2621 C CG    . LYS A 330 ? 2.4077 2.3456 1.9515 0.1695  0.0936  0.1512  340 LYS A CG    
2622 C CD    . LYS A 330 ? 2.3837 2.3301 1.9397 0.1620  0.0876  0.1295  340 LYS A CD    
2623 C CE    . LYS A 330 ? 2.4037 2.3635 1.9260 0.1950  0.0700  0.1008  340 LYS A CE    
2624 N NZ    . LYS A 330 ? 2.3879 2.3562 1.9192 0.1919  0.0664  0.0834  340 LYS A NZ    
2625 N N     . ASP A 331 ? 2.7405 2.6649 2.2397 0.2049  0.1117  0.2113  341 ASP A N     
2626 C CA    . ASP A 331 ? 2.7554 2.6615 2.2402 0.2162  0.0988  0.2056  341 ASP A CA    
2627 C C     . ASP A 331 ? 2.7724 2.6587 2.2696 0.2052  0.1160  0.2429  341 ASP A C     
2628 O O     . ASP A 331 ? 2.7838 2.6510 2.2739 0.2112  0.1072  0.2415  341 ASP A O     
2629 C CB    . ASP A 331 ? 2.6106 2.5412 2.0456 0.2619  0.0899  0.1973  341 ASP A CB    
2630 C CG    . ASP A 331 ? 2.5998 2.5439 2.0231 0.2745  0.0674  0.1553  341 ASP A CG    
2631 O OD1   . ASP A 331 ? 2.5675 2.4926 2.0142 0.2549  0.0468  0.1239  341 ASP A OD1   
2632 O OD2   . ASP A 331 ? 2.6260 2.5998 2.0177 0.3047  0.0704  0.1545  341 ASP A OD2   
2633 N N     . PHE A 332 ? 2.3792 2.2709 1.8956 0.1905  0.1402  0.2767  342 PHE A N     
2634 C CA    . PHE A 332 ? 2.3977 2.2670 1.9337 0.1758  0.1568  0.3137  342 PHE A CA    
2635 C C     . PHE A 332 ? 2.3641 2.1959 1.9447 0.1360  0.1493  0.3028  342 PHE A C     
2636 O O     . PHE A 332 ? 2.3765 2.1779 1.9644 0.1303  0.1473  0.3118  342 PHE A O     
2637 C CB    . PHE A 332 ? 2.1603 2.0532 1.7043 0.1750  0.1854  0.3555  342 PHE A CB    
2638 C CG    . PHE A 332 ? 2.1955 2.0702 1.7517 0.1697  0.2043  0.4001  342 PHE A CG    
2639 C CD1   . PHE A 332 ? 2.2349 2.1005 1.7589 0.1973  0.2040  0.4145  342 PHE A CD1   
2640 C CD2   . PHE A 332 ? 2.1926 2.0599 1.7937 0.1380  0.2221  0.4285  342 PHE A CD2   
2641 C CE1   . PHE A 332 ? 2.2714 2.1173 1.8075 0.1931  0.2219  0.4579  342 PHE A CE1   
2642 C CE2   . PHE A 332 ? 2.2290 2.0764 1.8457 0.1317  0.2389  0.4706  342 PHE A CE2   
2643 C CZ    . PHE A 332 ? 2.2693 2.1046 1.8530 0.1595  0.2394  0.4864  342 PHE A CZ    
2644 N N     . TYR A 333 ? 1.9952 1.8305 1.6045 0.1106  0.1459  0.2847  343 TYR A N     
2645 C CA    . TYR A 333 ? 1.9630 1.7683 1.6125 0.0753  0.1379  0.2712  343 TYR A CA    
2646 C C     . TYR A 333 ? 1.9329 1.7237 1.5823 0.0718  0.1133  0.2311  343 TYR A C     
2647 O O     . TYR A 333 ? 1.9213 1.6837 1.5922 0.0536  0.1059  0.2241  343 TYR A O     
2648 C CB    . TYR A 333 ? 2.0043 1.8227 1.6867 0.0500  0.1475  0.2746  343 TYR A CB    
2649 C CG    . TYR A 333 ? 2.0300 1.8512 1.7336 0.0392  0.1709  0.3165  343 TYR A CG    
2650 C CD1   . TYR A 333 ? 2.0606 1.9139 1.7444 0.0608  0.1901  0.3462  343 TYR A CD1   
2651 C CD2   . TYR A 333 ? 2.0272 1.8195 1.7721 0.0083  0.1734  0.3269  343 TYR A CD2   
2652 C CE1   . TYR A 333 ? 2.0858 1.9441 1.7940 0.0496  0.2129  0.3883  343 TYR A CE1   
2653 C CE2   . TYR A 333 ? 2.0535 1.8469 1.8242 -0.0040 0.1937  0.3659  343 TYR A CE2   
2654 C CZ    . TYR A 333 ? 2.0820 1.9091 1.8359 0.0157  0.2142  0.3981  343 TYR A CZ    
2655 O OH    . TYR A 333 ? 2.1095 1.9402 1.8937 0.0022  0.2357  0.4403  343 TYR A OH    
2656 N N     . LEU A 334 ? 1.9225 1.7331 1.5500 0.0891  0.1003  0.2052  344 LEU A N     
2657 C CA    . LEU A 334 ? 1.8946 1.6955 1.5271 0.0844  0.0777  0.1693  344 LEU A CA    
2658 C C     . LEU A 334 ? 1.9119 1.7245 1.5102 0.1154  0.0625  0.1521  344 LEU A C     
2659 O O     . LEU A 334 ? 1.9368 1.7722 1.5054 0.1413  0.0665  0.1578  344 LEU A O     
2660 C CB    . LEU A 334 ? 1.9579 1.7680 1.6111 0.0665  0.0725  0.1480  344 LEU A CB    
2661 C CG    . LEU A 334 ? 1.9315 1.7291 1.6231 0.0334  0.0791  0.1521  344 LEU A CG    
2662 C CD1   . LEU A 334 ? 1.9009 1.7134 1.6059 0.0226  0.0753  0.1338  344 LEU A CD1   
2663 C CD2   . LEU A 334 ? 1.9192 1.6896 1.6286 0.0189  0.0689  0.1421  344 LEU A CD2   
2664 N N     . ALA A 335 ? 1.9001 1.6999 1.5033 0.1141  0.0445  0.1303  345 ALA A N     
2665 C CA    . ALA A 335 ? 1.9151 1.7271 1.4918 0.1413  0.0265  0.1102  345 ALA A CA    
2666 C C     . ALA A 335 ? 1.8966 1.7245 1.4751 0.1430  0.0112  0.0796  345 ALA A C     
2667 O O     . ALA A 335 ? 1.8642 1.6880 1.4700 0.1192  0.0105  0.0692  345 ALA A O     
2668 C CB    . ALA A 335 ? 2.2547 2.0507 1.8393 0.1395  0.0130  0.0996  345 ALA A CB    
2669 N N     . THR A 336 ? 2.6919 2.5370 2.2411 0.1727  -0.0021 0.0648  346 THR A N     
2670 C CA    . THR A 336 ? 2.6839 2.5416 2.2324 0.1784  -0.0188 0.0347  346 THR A CA    
2671 C C     . THR A 336 ? 2.6748 2.5294 2.2354 0.1786  -0.0452 0.0040  346 THR A C     
2672 O O     . THR A 336 ? 2.6884 2.5414 2.2409 0.1895  -0.0519 0.0050  346 THR A O     
2673 C CB    . THR A 336 ? 2.7348 2.6165 2.2423 0.2139  -0.0175 0.0358  346 THR A CB    
2674 O OG1   . THR A 336 ? 2.7443 2.6335 2.2439 0.2135  0.0093  0.0686  346 THR A OG1   
2675 C CG2   . THR A 336 ? 2.7304 2.6213 2.2381 0.2202  -0.0356 0.0032  346 THR A CG2   
2676 N N     . SER A 337 ? 3.3781 3.2323 2.9611 0.1659  -0.0596 -0.0217 347 SER A N     
2677 C CA    . SER A 337 ? 3.3709 3.2254 2.9716 0.1645  -0.0854 -0.0511 347 SER A CA    
2678 C C     . SER A 337 ? 3.4094 3.2805 2.9784 0.2000  -0.1047 -0.0697 347 SER A C     
2679 O O     . SER A 337 ? 3.4400 3.3232 2.9722 0.2261  -0.0980 -0.0623 347 SER A O     
2680 C CB    . SER A 337 ? 2.2329 2.0817 1.8663 0.1424  -0.0939 -0.0699 347 SER A CB    
2681 O OG    . SER A 337 ? 2.1984 2.0347 1.8609 0.1117  -0.0787 -0.0551 347 SER A OG    
2682 N N     . PRO A 338 ? 2.3332 2.2080 1.9168 0.2024  -0.1290 -0.0938 348 PRO A N     
2683 C CA    . PRO A 338 ? 2.3717 2.2638 1.9270 0.2369  -0.1511 -0.1154 348 PRO A CA    
2684 C C     . PRO A 338 ? 2.3928 2.2922 1.9307 0.2544  -0.1619 -0.1361 348 PRO A C     
2685 O O     . PRO A 338 ? 2.3717 2.2605 1.9326 0.2344  -0.1604 -0.1425 348 PRO A O     
2686 C CB    . PRO A 338 ? 2.7597 2.6536 2.3502 0.2258  -0.1760 -0.1399 348 PRO A CB    
2687 C CG    . PRO A 338 ? 2.7146 2.5930 2.3519 0.1860  -0.1678 -0.1346 348 PRO A CG    
2688 C CD    . PRO A 338 ? 2.7022 2.5691 2.3286 0.1756  -0.1370 -0.1011 348 PRO A CD    
2689 N N     . PRO A 339 ? 2.5587 2.4764 2.0544 0.2940  -0.1732 -0.1467 349 PRO A N     
2690 C CA    . PRO A 339 ? 2.5868 2.5136 2.0587 0.3179  -0.1845 -0.1679 349 PRO A CA    
2691 C C     . PRO A 339 ? 2.5855 2.5058 2.0882 0.3108  -0.2182 -0.2102 349 PRO A C     
2692 O O     . PRO A 339 ? 2.6077 2.5295 2.0972 0.3271  -0.2305 -0.2319 349 PRO A O     
2693 C CB    . PRO A 339 ? 2.8066 2.7576 2.2240 0.3644  -0.1875 -0.1658 349 PRO A CB    
2694 C CG    . PRO A 339 ? 2.8055 2.7588 2.2308 0.3639  -0.1961 -0.1641 349 PRO A CG    
2695 C CD    . PRO A 339 ? 2.7580 2.6902 2.2240 0.3216  -0.1769 -0.1402 349 PRO A CD    
2696 N N     . ASP A 344 ? 3.4234 3.3190 2.9261 0.3847  -0.3551 -0.3968 354 ASP A N     
2697 C CA    . ASP A 344 ? 3.4718 3.3646 2.9713 0.4107  -0.3973 -0.4469 354 ASP A CA    
2698 C C     . ASP A 344 ? 3.5166 3.4408 2.9664 0.4564  -0.4118 -0.4606 354 ASP A C     
2699 O O     . ASP A 344 ? 3.5028 3.4429 2.9520 0.4526  -0.4040 -0.4426 354 ASP A O     
2700 C CB    . ASP A 344 ? 3.6343 3.5141 3.1150 0.4278  -0.4006 -0.4628 354 ASP A CB    
2701 C CG    . ASP A 344 ? 3.6663 3.5227 3.1780 0.4294  -0.4448 -0.5134 354 ASP A CG    
2702 O OD1   . ASP A 344 ? 3.6426 3.4789 3.2169 0.3915  -0.4603 -0.5220 354 ASP A OD1   
2703 O OD2   . ASP A 344 ? 3.7177 3.5762 3.1925 0.4690  -0.4644 -0.5444 354 ASP A OD2   
2704 N N     . ASP A 345 ? 3.8708 3.8058 3.2754 0.5024  -0.4317 -0.4911 355 ASP A N     
2705 C CA    . ASP A 345 ? 3.9150 3.8830 3.2712 0.5478  -0.4458 -0.5035 355 ASP A CA    
2706 C C     . ASP A 345 ? 3.9181 3.9117 3.2158 0.5727  -0.4048 -0.4594 355 ASP A C     
2707 O O     . ASP A 345 ? 3.9570 3.9671 3.2026 0.6132  -0.3995 -0.4625 355 ASP A O     
2708 C CB    . ASP A 345 ? 4.4365 4.4081 3.7681 0.5904  -0.4886 -0.5588 355 ASP A CB    
2709 C CG    . ASP A 345 ? 4.4359 4.3743 3.8320 0.5617  -0.5275 -0.6012 355 ASP A CG    
2710 O OD1   . ASP A 345 ? 4.4223 4.3593 3.8638 0.5389  -0.5482 -0.6133 355 ASP A OD1   
2711 O OD2   . ASP A 345 ? 4.4510 4.3653 3.8541 0.5624  -0.5375 -0.6214 355 ASP A OD2   
2712 N N     . HIS A 346 ? 4.7104 4.7093 4.0180 0.5503  -0.3777 -0.4191 356 HIS A N     
2713 C CA    . HIS A 346 ? 4.7056 4.7236 3.9722 0.5625  -0.3356 -0.3697 356 HIS A CA    
2714 C C     . HIS A 346 ? 4.6946 4.7236 3.9627 0.5579  -0.3289 -0.3482 356 HIS A C     
2715 O O     . HIS A 346 ? 4.6524 4.6634 3.9716 0.5169  -0.3304 -0.3435 356 HIS A O     
2716 C CB    . HIS A 346 ? 3.8462 3.8449 3.1386 0.5240  -0.3008 -0.3350 356 HIS A CB    
2717 C CG    . HIS A 346 ? 3.8642 3.8824 3.1094 0.5502  -0.2700 -0.3067 356 HIS A CG    
2718 N ND1   . HIS A 346 ? 3.9009 3.9276 3.1159 0.5824  -0.2794 -0.3295 356 HIS A ND1   
2719 C CD2   . HIS A 346 ? 3.8521 3.8843 3.0782 0.5487  -0.2299 -0.2568 356 HIS A CD2   
2720 C CE1   . HIS A 346 ? 3.9090 3.9580 3.0878 0.6002  -0.2451 -0.2935 356 HIS A CE1   
2721 N NE2   . HIS A 346 ? 3.8798 3.9322 3.0666 0.5789  -0.2147 -0.2485 356 HIS A NE2   
2722 N N     . HIS A 347 ? 5.1332 5.1923 4.3451 0.6005  -0.3196 -0.3323 357 HIS A N     
2723 C CA    . HIS A 347 ? 5.1348 5.2057 4.3426 0.6052  -0.3201 -0.3190 357 HIS A CA    
2724 C C     . HIS A 347 ? 5.1275 5.2066 4.3090 0.6071  -0.2767 -0.2615 357 HIS A C     
2725 O O     . HIS A 347 ? 5.0906 5.1551 4.3027 0.5746  -0.2615 -0.2356 357 HIS A O     
2726 C CB    . HIS A 347 ? 3.6108 3.7104 2.7785 0.6564  -0.3543 -0.3546 357 HIS A CB    
2727 C CG    . HIS A 347 ? 3.6191 3.7352 2.7741 0.6687  -0.3532 -0.3383 357 HIS A CG    
2728 N ND1   . HIS A 347 ? 3.6621 3.8080 2.7545 0.7149  -0.3372 -0.3127 357 HIS A ND1   
2729 C CD2   . HIS A 347 ? 3.5912 3.6992 2.7881 0.6418  -0.3648 -0.3418 357 HIS A CD2   
2730 C CE1   . HIS A 347 ? 3.6614 3.8142 2.7567 0.7165  -0.3402 -0.3022 357 HIS A CE1   
2731 N NE2   . HIS A 347 ? 3.6181 3.7491 2.7763 0.6728  -0.3570 -0.3204 357 HIS A NE2   
2732 N N     . LEU A 348 ? 5.1004 5.2035 4.2263 0.6463  -0.2575 -0.2417 358 LEU A N     
2733 C CA    . LEU A 348 ? 5.1121 5.2302 4.2047 0.6606  -0.2211 -0.1889 358 LEU A CA    
2734 C C     . LEU A 348 ? 5.0575 5.1481 4.1931 0.6093  -0.1892 -0.1475 358 LEU A C     
2735 O O     . LEU A 348 ? 5.0216 5.0943 4.1876 0.5761  -0.1748 -0.1399 358 LEU A O     
2736 C CB    . LEU A 348 ? 3.4649 3.6124 2.5022 0.7023  -0.2003 -0.1702 358 LEU A CB    
2737 C CG    . LEU A 348 ? 3.4472 3.5909 2.4916 0.6877  -0.1761 -0.1546 358 LEU A CG    
2738 C CD1   . LEU A 348 ? 3.4103 3.5246 2.5031 0.6519  -0.1971 -0.1924 358 LEU A CD1   
2739 C CD2   . LEU A 348 ? 3.4190 3.5568 2.4766 0.6600  -0.1302 -0.0942 358 LEU A CD2   
2740 N N     . THR A 349 ? 2.9030 2.9897 2.0421 0.6039  -0.1811 -0.1241 359 THR A N     
2741 C CA    . THR A 349 ? 2.8640 2.9273 2.0336 0.5645  -0.1495 -0.0812 359 THR A CA    
2742 C C     . THR A 349 ? 2.8968 2.9718 2.0309 0.5900  -0.1289 -0.0405 359 THR A C     
2743 O O     . THR A 349 ? 2.9064 2.9818 2.0384 0.5990  -0.1435 -0.0468 359 THR A O     
2744 C CB    . THR A 349 ? 2.7371 2.7719 1.9654 0.5192  -0.1647 -0.0988 359 THR A CB    
2745 O OG1   . THR A 349 ? 2.7556 2.8014 1.9804 0.5381  -0.1973 -0.1304 359 THR A OG1   
2746 C CG2   . THR A 349 ? 2.6999 2.7178 1.9695 0.4862  -0.1755 -0.1259 359 THR A CG2   
2747 N N     . ARG A 350 ? 2.7854 2.8683 1.8972 0.5981  -0.0939 0.0041  360 ARG A N     
2748 C CA    . ARG A 350 ? 2.8218 2.9144 1.9008 0.6230  -0.0721 0.0475  360 ARG A CA    
2749 C C     . ARG A 350 ? 2.7858 2.8429 1.9066 0.5797  -0.0531 0.0787  360 ARG A C     
2750 O O     . ARG A 350 ? 2.7555 2.7951 1.9062 0.5451  -0.0295 0.1024  360 ARG A O     
2751 C CB    . ARG A 350 ? 2.5252 2.6465 1.5616 0.6548  -0.0426 0.0842  360 ARG A CB    
2752 C CG    . ARG A 350 ? 2.4965 2.6142 1.5565 0.6276  -0.0221 0.0956  360 ARG A CG    
2753 C CD    . ARG A 350 ? 2.5417 2.6971 1.5567 0.6657  0.0049  0.1294  360 ARG A CD    
2754 N NE    . ARG A 350 ? 2.5296 2.6976 1.5487 0.6627  0.0060  0.1127  360 ARG A NE    
2755 C CZ    . ARG A 350 ? 2.5658 2.7715 1.5476 0.6972  0.0251  0.1320  360 ARG A CZ    
2756 N NH1   . ARG A 350 ? 2.6170 2.8529 1.5547 0.7370  0.0460  0.1712  360 ARG A NH1   
2757 N NH2   . ARG A 350 ? 2.5528 2.7678 1.5410 0.6935  0.0239  0.1136  360 ARG A NH2   
2758 N N     . PRO A 351 ? 2.3660 2.4132 1.4897 0.5827  -0.0651 0.0764  361 PRO A N     
2759 C CA    . PRO A 351 ? 2.3324 2.3437 1.4971 0.5429  -0.0529 0.0977  361 PRO A CA    
2760 C C     . PRO A 351 ? 2.3515 2.3517 1.5083 0.5407  -0.0152 0.1557  361 PRO A C     
2761 O O     . PRO A 351 ? 2.4007 2.4241 1.5133 0.5789  -0.0005 0.1834  361 PRO A O     
2762 C CB    . PRO A 351 ? 2.3441 2.3567 1.5037 0.5588  -0.0776 0.0782  361 PRO A CB    
2763 C CG    . PRO A 351 ? 2.4006 2.4498 1.5033 0.6146  -0.0881 0.0721  361 PRO A CG    
2764 C CD    . PRO A 351 ? 2.4065 2.4773 1.4934 0.6262  -0.0909 0.0540  361 PRO A CD    
2765 N N     . HIS A 352 ? 2.3148 2.2805 1.5160 0.4964  -0.0002 0.1737  362 HIS A N     
2766 C CA    . HIS A 352 ? 2.3320 2.2793 1.5366 0.4880  0.0321  0.2268  362 HIS A CA    
2767 C C     . HIS A 352 ? 2.3773 2.3233 1.5511 0.5201  0.0322  0.2473  362 HIS A C     
2768 O O     . HIS A 352 ? 2.3724 2.3141 1.5474 0.5262  0.0081  0.2203  362 HIS A O     
2769 C CB    . HIS A 352 ? 2.2842 2.1922 1.5444 0.4352  0.0395  0.2312  362 HIS A CB    
2770 C CG    . HIS A 352 ? 2.2989 2.1849 1.5723 0.4196  0.0713  0.2823  362 HIS A CG    
2771 N ND1   . HIS A 352 ? 2.3179 2.1743 1.5970 0.4173  0.0780  0.3072  362 HIS A ND1   
2772 C CD2   . HIS A 352 ? 2.2984 2.1870 1.5847 0.4041  0.0971  0.3125  362 HIS A CD2   
2773 C CE1   . HIS A 352 ? 2.3303 2.1693 1.6264 0.4002  0.1059  0.3505  362 HIS A CE1   
2774 N NE2   . HIS A 352 ? 2.3178 2.1778 1.6199 0.3912  0.1182  0.3550  362 HIS A NE2   
2775 N N     . PRO A 353 ? 2.4234 2.3751 1.5706 0.5417  0.0598  0.2965  363 PRO A N     
2776 C CA    . PRO A 353 ? 2.4742 2.4268 1.5865 0.5780  0.0616  0.3199  363 PRO A CA    
2777 C C     . PRO A 353 ? 2.4593 2.3726 1.5994 0.5575  0.0523  0.3169  363 PRO A C     
2778 O O     . PRO A 353 ? 2.4886 2.4069 1.6026 0.5879  0.0389  0.3126  363 PRO A O     
2779 C CB    . PRO A 353 ? 2.5167 2.4722 1.6139 0.5887  0.0993  0.3814  363 PRO A CB    
2780 C CG    . PRO A 353 ? 2.4802 2.4301 1.6152 0.5494  0.1165  0.3891  363 PRO A CG    
2781 C CD    . PRO A 353 ? 2.4344 2.3974 1.5810 0.5373  0.0904  0.3334  363 PRO A CD    
2782 N N     . GLU A 354 ? 2.4159 2.2930 1.6070 0.5089  0.0582  0.3174  364 GLU A N     
2783 C CA    . GLU A 354 ? 2.4008 2.2414 1.6192 0.4897  0.0489  0.3115  364 GLU A CA    
2784 C C     . GLU A 354 ? 2.3554 2.2022 1.5941 0.4770  0.0166  0.2565  364 GLU A C     
2785 O O     . GLU A 354 ? 2.3368 2.1593 1.6005 0.4606  0.0064  0.2454  364 GLU A O     
2786 C CB    . GLU A 354 ? 2.4106 2.2089 1.6733 0.4462  0.0698  0.3383  364 GLU A CB    
2787 C CG    . GLU A 354 ? 2.4587 2.2441 1.7115 0.4542  0.1015  0.3968  364 GLU A CG    
2788 C CD    . GLU A 354 ? 2.4415 2.1840 1.7437 0.4091  0.1184  0.4193  364 GLU A CD    
2789 O OE1   . GLU A 354 ? 2.3946 2.1157 1.7343 0.3752  0.1049  0.3892  364 GLU A OE1   
2790 O OE2   . GLU A 354 ? 2.4773 2.2089 1.7818 0.4085  0.1450  0.4675  364 GLU A OE2   
2791 N N     . ARG A 355 ? 2.3383 2.2170 1.5696 0.4832  0.0013  0.2231  365 ARG A N     
2792 C CA    . ARG A 355 ? 2.3012 2.1898 1.5526 0.4736  -0.0302 0.1720  365 ARG A CA    
2793 C C     . ARG A 355 ? 2.3324 2.2550 1.5473 0.5172  -0.0559 0.1465  365 ARG A C     
2794 O O     . ARG A 355 ? 2.3081 2.2435 1.5401 0.5128  -0.0842 0.1041  365 ARG A O     
2795 C CB    . ARG A 355 ? 2.3152 2.2114 1.5911 0.4470  -0.0341 0.1474  365 ARG A CB    
2796 C CG    . ARG A 355 ? 2.2689 2.1650 1.5819 0.4230  -0.0610 0.1021  365 ARG A CG    
2797 C CD    . ARG A 355 ? 2.2216 2.0869 1.5834 0.3756  -0.0513 0.1054  365 ARG A CD    
2798 N NE    . ARG A 355 ? 2.2019 2.0653 1.5756 0.3545  -0.0363 0.1120  365 ARG A NE    
2799 C CZ    . ARG A 355 ? 2.1567 2.0035 1.5716 0.3153  -0.0337 0.1034  365 ARG A CZ    
2800 N NH1   . ARG A 355 ? 2.1428 1.9914 1.5654 0.3002  -0.0203 0.1101  365 ARG A NH1   
2801 N NH2   . ARG A 355 ? 2.1270 1.9584 1.5745 0.2933  -0.0442 0.0886  365 ARG A NH2   
2802 N N     . VAL A 356 ? 4.3774 4.3166 3.5436 0.5599  -0.0464 0.1728  366 VAL A N     
2803 C CA    . VAL A 356 ? 4.4124 4.3891 3.5386 0.6061  -0.0711 0.1477  366 VAL A CA    
2804 C C     . VAL A 356 ? 4.4118 4.3916 3.5451 0.6159  -0.0980 0.1223  366 VAL A C     
2805 O O     . VAL A 356 ? 4.4160 4.4262 3.5404 0.6357  -0.1276 0.0826  366 VAL A O     
2806 C CB    . VAL A 356 ? 3.9336 3.9311 3.0008 0.6549  -0.0529 0.1855  366 VAL A CB    
2807 C CG1   . VAL A 356 ? 3.9390 3.9481 2.9942 0.6540  -0.0308 0.2041  366 VAL A CG1   
2808 C CG2   . VAL A 356 ? 3.9636 3.9341 3.0237 0.6604  -0.0305 0.2335  366 VAL A CG2   
2809 N N     . PRO A 357 ? 3.8942 3.8446 3.0431 0.6046  -0.0889 0.1443  367 PRO A N     
2810 C CA    . PRO A 357 ? 3.9039 3.8657 3.0505 0.6243  -0.1136 0.1232  367 PRO A CA    
2811 C C     . PRO A 357 ? 3.8535 3.8225 3.0469 0.5970  -0.1424 0.0755  367 PRO A C     
2812 O O     . PRO A 357 ? 3.8638 3.8595 3.0525 0.6192  -0.1696 0.0475  367 PRO A O     
2813 C CB    . PRO A 357 ? 3.2566 3.1811 2.4066 0.6198  -0.0930 0.1632  367 PRO A CB    
2814 C CG    . PRO A 357 ? 3.2212 3.1094 2.4077 0.5737  -0.0699 0.1816  367 PRO A CG    
2815 C CD    . PRO A 357 ? 3.2157 3.1217 2.3926 0.5703  -0.0616 0.1803  367 PRO A CD    
2816 N N     . PHE A 358 ? 3.6805 3.6279 2.9195 0.5502  -0.1363 0.0680  368 PHE A N     
2817 C CA    . PHE A 358 ? 3.6331 3.5817 2.9216 0.5206  -0.1569 0.0335  368 PHE A CA    
2818 C C     . PHE A 358 ? 3.6186 3.6009 2.9192 0.5224  -0.1872 -0.0127 368 PHE A C     
2819 O O     . PHE A 358 ? 3.6096 3.6123 2.9307 0.5253  -0.2132 -0.0423 368 PHE A O     
2820 C CB    . PHE A 358 ? 3.0311 2.9454 2.3623 0.4721  -0.1387 0.0440  368 PHE A CB    
2821 C CG    . PHE A 358 ? 3.0487 2.9265 2.3692 0.4670  -0.1077 0.0895  368 PHE A CG    
2822 C CD1   . PHE A 358 ? 3.0711 2.9299 2.3856 0.4785  -0.1028 0.1093  368 PHE A CD1   
2823 C CD2   . PHE A 358 ? 3.0456 2.9082 2.3641 0.4512  -0.0844 0.1124  368 PHE A CD2   
2824 C CE1   . PHE A 358 ? 3.0917 2.9130 2.4003 0.4727  -0.0759 0.1508  368 PHE A CE1   
2825 C CE2   . PHE A 358 ? 3.0640 2.8932 2.3788 0.4442  -0.0571 0.1544  368 PHE A CE2   
2826 C CZ    . PHE A 358 ? 3.0881 2.8946 2.3987 0.4544  -0.0533 0.1735  368 PHE A CZ    
2827 N N     . LEU A 359 ? 5.9894 5.9779 5.2794 0.5210  -0.1842 -0.0189 369 LEU A N     
2828 C CA    . LEU A 359 ? 5.9800 5.9948 5.2823 0.5221  -0.2133 -0.0633 369 LEU A CA    
2829 C C     . LEU A 359 ? 6.0215 6.0727 5.2946 0.5662  -0.2422 -0.0877 369 LEU A C     
2830 O O     . LEU A 359 ? 6.0117 6.0844 5.3095 0.5641  -0.2739 -0.1294 369 LEU A O     
2831 C CB    . LEU A 359 ? 2.3858 2.4002 1.6722 0.5210  -0.2034 -0.0624 369 LEU A CB    
2832 C CG    . LEU A 359 ? 2.4414 2.4744 1.6653 0.5673  -0.1948 -0.0458 369 LEU A CG    
2833 C CD1   . LEU A 359 ? 2.4472 2.4960 1.6599 0.5750  -0.2049 -0.0707 369 LEU A CD1   
2834 C CD2   . LEU A 359 ? 2.4540 2.4647 1.6583 0.5658  -0.1558 0.0078  369 LEU A CD2   
2835 N N     . VAL A 360 ? 5.1118 5.1701 4.3341 0.6064  -0.2316 -0.0611 370 VAL A N     
2836 C CA    . VAL A 360 ? 5.1575 5.2527 4.3447 0.6540  -0.2577 -0.0814 370 VAL A CA    
2837 C C     . VAL A 360 ? 5.1488 5.2539 4.3621 0.6535  -0.2777 -0.0966 370 VAL A C     
2838 O O     . VAL A 360 ? 5.1584 5.2965 4.3786 0.6700  -0.3120 -0.1355 370 VAL A O     
2839 C CB    . VAL A 360 ? 3.7598 3.8616 2.8821 0.7003  -0.2383 -0.0441 370 VAL A CB    
2840 C CG1   . VAL A 360 ? 3.8046 3.9459 2.8834 0.7459  -0.2607 -0.0700 370 VAL A CG1   
2841 C CG2   . VAL A 360 ? 3.7570 3.8307 2.8690 0.6851  -0.2000 -0.0012 370 VAL A CG2   
2842 N N     . ALA A 361 ? 5.9333 6.0110 5.1609 0.6365  -0.2568 -0.0659 371 ALA A N     
2843 C CA    . ALA A 361 ? 5.9248 6.0111 5.1771 0.6365  -0.2721 -0.0761 371 ALA A CA    
2844 C C     . ALA A 361 ? 5.8749 5.9734 5.1899 0.6003  -0.2961 -0.1163 371 ALA A C     
2845 O O     . ALA A 361 ? 5.8732 5.9993 5.2099 0.6076  -0.3217 -0.1413 371 ALA A O     
2846 C CB    . ALA A 361 ? 2.4306 2.4797 1.6863 0.6239  -0.2437 -0.0357 371 ALA A CB    
2847 N N     . GLU A 362 ? 5.9968 6.0766 5.3420 0.5619  -0.2872 -0.1207 372 GLU A N     
2848 C CA    . GLU A 362 ? 5.9517 6.0409 5.3572 0.5261  -0.3073 -0.1550 372 GLU A CA    
2849 C C     . GLU A 362 ? 5.9705 6.0969 5.3781 0.5452  -0.3446 -0.1989 372 GLU A C     
2850 O O     . GLU A 362 ? 5.9553 6.1057 5.4058 0.5357  -0.3713 -0.2286 372 GLU A O     
2851 C CB    . GLU A 362 ? 3.3808 3.4401 2.8115 0.4848  -0.2877 -0.1466 372 GLU A CB    
2852 C CG    . GLU A 362 ? 3.3548 3.3785 2.7983 0.4582  -0.2563 -0.1114 372 GLU A CG    
2853 C CD    . GLU A 362 ? 3.3073 3.3303 2.8105 0.4217  -0.2615 -0.1231 372 GLU A CD    
2854 O OE1   . GLU A 362 ? 3.3032 3.3184 2.8135 0.4208  -0.2530 -0.1076 372 GLU A OE1   
2855 O OE2   . GLU A 362 ? 3.2764 3.3066 2.8191 0.3951  -0.2734 -0.1467 372 GLU A OE2   
2856 N N     . THR A 363 ? 5.6547 5.7867 5.0176 0.5725  -0.3467 -0.2031 373 THR A N     
2857 C CA    . THR A 363 ? 5.6828 5.8483 5.0390 0.5973  -0.3836 -0.2463 373 THR A CA    
2858 C C     . THR A 363 ? 5.7458 5.9339 5.0318 0.6557  -0.3877 -0.2404 373 THR A C     
2859 O O     . THR A 363 ? 5.7746 5.9624 5.0171 0.6778  -0.3804 -0.2360 373 THR A O     
2860 C CB    . THR A 363 ? 3.2805 3.4359 2.6504 0.5783  -0.3891 -0.2673 373 THR A CB    
2861 O OG1   . THR A 363 ? 3.2735 3.3986 2.6181 0.5691  -0.3523 -0.2310 373 THR A OG1   
2862 C CG2   . THR A 363 ? 3.2304 3.3798 2.6755 0.5300  -0.4033 -0.2911 373 THR A CG2   
2863 N N     . PRO A 364 ? 4.2806 4.4907 3.5540 0.6831  -0.3987 -0.2391 374 PRO A N     
2864 C CA    . PRO A 364 ? 4.3437 4.5775 3.5484 0.7419  -0.4020 -0.2306 374 PRO A CA    
2865 C C     . PRO A 364 ? 4.3800 4.6546 3.5709 0.7753  -0.4439 -0.2799 374 PRO A C     
2866 O O     . PRO A 364 ? 4.3841 4.6574 3.5702 0.7734  -0.4516 -0.3004 374 PRO A O     
2867 C CB    . PRO A 364 ? 4.2617 4.5013 3.4672 0.7536  -0.3992 -0.2123 374 PRO A CB    
2868 C CG    . PRO A 364 ? 4.2115 4.4557 3.4907 0.7125  -0.4178 -0.2390 374 PRO A CG    
2869 C CD    . PRO A 364 ? 4.1628 4.3784 3.4840 0.6626  -0.4066 -0.2427 374 PRO A CD    
2870 N N     . ARG A 384 ? 3.1851 3.1947 2.8090 0.3471  -0.2460 -0.1141 394 ARG A N     
2871 C CA    . ARG A 384 ? 3.1600 3.2045 2.8347 0.3342  -0.2667 -0.1388 394 ARG A CA    
2872 C C     . ARG A 384 ? 3.1146 3.1489 2.8339 0.2957  -0.2533 -0.1339 394 ARG A C     
2873 O O     . ARG A 384 ? 3.0889 3.1239 2.8370 0.2695  -0.2555 -0.1445 394 ARG A O     
2874 C CB    . ARG A 384 ? 3.0440 3.1131 2.7153 0.3609  -0.2782 -0.1408 394 ARG A CB    
2875 C CG    . ARG A 384 ? 3.0875 3.1806 2.7241 0.4004  -0.2991 -0.1534 394 ARG A CG    
2876 C CD    . ARG A 384 ? 3.1277 3.1915 2.7006 0.4277  -0.2822 -0.1282 394 ARG A CD    
2877 N NE    . ARG A 384 ? 3.1736 3.2568 2.7086 0.4719  -0.2945 -0.1279 394 ARG A NE    
2878 C CZ    . ARG A 384 ? 3.2153 3.2776 2.6951 0.5014  -0.2796 -0.1015 394 ARG A CZ    
2879 N NH1   . ARG A 384 ? 3.2156 3.2377 2.6755 0.4893  -0.2523 -0.0739 394 ARG A NH1   
2880 N NH2   . ARG A 384 ? 3.2582 3.3413 2.7043 0.5433  -0.2919 -0.1015 394 ARG A NH2   
2881 N N     . LYS A 385 ? 3.3229 3.3478 3.0465 0.2945  -0.2399 -0.1181 395 LYS A N     
2882 C CA    . LYS A 385 ? 3.2840 3.3010 3.0447 0.2625  -0.2264 -0.1127 395 LYS A CA    
2883 C C     . LYS A 385 ? 3.2862 3.2598 3.0233 0.2578  -0.2004 -0.0871 395 LYS A C     
2884 O O     . LYS A 385 ? 3.3045 3.2670 3.0249 0.2747  -0.1942 -0.0749 395 LYS A O     
2885 C CB    . LYS A 385 ? 2.4475 2.5012 2.2487 0.2612  -0.2369 -0.1224 395 LYS A CB    
2886 C CG    . LYS A 385 ? 2.4321 2.5286 2.2789 0.2501  -0.2604 -0.1473 395 LYS A CG    
2887 C CD    . LYS A 385 ? 2.4100 2.5448 2.3061 0.2417  -0.2655 -0.1520 395 LYS A CD    
2888 C CE    . LYS A 385 ? 2.3845 2.5513 2.3390 0.2153  -0.2807 -0.1697 395 LYS A CE    
2889 N NZ    . LYS A 385 ? 2.3677 2.5817 2.3740 0.2099  -0.2881 -0.1740 395 LYS A NZ    
2890 N N     . ALA A 386 ? 3.1654 3.1144 2.9032 0.2348  -0.1866 -0.0801 396 ALA A N     
2891 C CA    . ALA A 386 ? 3.1583 3.0711 2.8896 0.2214  -0.1642 -0.0606 396 ALA A CA    
2892 C C     . ALA A 386 ? 3.1185 3.0316 2.8839 0.1877  -0.1577 -0.0653 396 ALA A C     
2893 O O     . ALA A 386 ? 3.1110 3.0190 2.8752 0.1759  -0.1568 -0.0682 396 ALA A O     
2894 C CB    . ALA A 386 ? 1.9063 1.7836 1.5941 0.2328  -0.1506 -0.0406 396 ALA A CB    
2895 N N     . LYS A 387 ? 1.8134 1.7328 1.6070 0.1745  -0.1526 -0.0652 397 LYS A N     
2896 C CA    . LYS A 387 ? 1.7772 1.7011 1.6039 0.1450  -0.1462 -0.0682 397 LYS A CA    
2897 C C     . LYS A 387 ? 1.7682 1.6715 1.5965 0.1360  -0.1298 -0.0569 397 LYS A C     
2898 O O     . LYS A 387 ? 1.7713 1.6841 1.6061 0.1460  -0.1301 -0.0568 397 LYS A O     
2899 C CB    . LYS A 387 ? 2.4671 2.4344 2.3388 0.1358  -0.1601 -0.0835 397 LYS A CB    
2900 C CG    . LYS A 387 ? 2.4625 2.4455 2.3495 0.1279  -0.1749 -0.0980 397 LYS A CG    
2901 C CD    . LYS A 387 ? 2.4296 2.4356 2.3677 0.1011  -0.1767 -0.1040 397 LYS A CD    
2902 C CE    . LYS A 387 ? 2.4304 2.4673 2.4003 0.0987  -0.1997 -0.1230 397 LYS A CE    
2903 N NZ    . LYS A 387 ? 2.4335 2.5094 2.4286 0.1100  -0.2127 -0.1299 397 LYS A NZ    
2904 N N     . TRP A 388 ? 2.0149 1.8924 1.8383 0.1185  -0.1166 -0.0491 398 TRP A N     
2905 C CA    . TRP A 388 ? 2.0083 1.8659 1.8337 0.1097  -0.1031 -0.0412 398 TRP A CA    
2906 C C     . TRP A 388 ? 1.9738 1.8560 1.8357 0.0904  -0.1008 -0.0473 398 TRP A C     
2907 O O     . TRP A 388 ? 1.9530 1.8432 1.8312 0.0723  -0.1002 -0.0501 398 TRP A O     
2908 C CB    . TRP A 388 ? 2.0543 1.8731 1.8579 0.1011  -0.0903 -0.0290 398 TRP A CB    
2909 C CG    . TRP A 388 ? 2.0922 1.8826 1.8613 0.1198  -0.0877 -0.0165 398 TRP A CG    
2910 C CD1   . TRP A 388 ? 2.1176 1.8770 1.8714 0.1291  -0.0811 -0.0059 398 TRP A CD1   
2911 C CD2   . TRP A 388 ? 2.1130 1.9031 1.8586 0.1329  -0.0915 -0.0122 398 TRP A CD2   
2912 N NE1   . TRP A 388 ? 2.1527 1.8920 1.8768 0.1459  -0.0793 0.0078  398 TRP A NE1   
2913 C CE2   . TRP A 388 ? 2.1503 1.9102 1.8670 0.1498  -0.0850 0.0044  398 TRP A CE2   
2914 C CE3   . TRP A 388 ? 2.1071 1.9193 1.8528 0.1337  -0.1004 -0.0214 398 TRP A CE3   
2915 C CZ2   . TRP A 388 ? 2.1810 1.9359 1.8674 0.1684  -0.0852 0.0150  398 TRP A CZ2   
2916 C CZ3   . TRP A 388 ? 2.1379 1.9454 1.8516 0.1536  -0.1024 -0.0146 398 TRP A CZ3   
2917 C CH2   . TRP A 388 ? 2.1739 1.9548 1.8576 0.1711  -0.0938 0.0048  398 TRP A CH2   
2918 N N     . HIS A 389 ? 1.7140 1.6087 1.5873 0.0964  -0.0990 -0.0485 399 HIS A N     
2919 C CA    . HIS A 389 ? 1.6857 1.6047 1.5900 0.0816  -0.0938 -0.0505 399 HIS A CA    
2920 C C     . HIS A 389 ? 1.6790 1.5700 1.5750 0.0673  -0.0810 -0.0451 399 HIS A C     
2921 O O     . HIS A 389 ? 1.6985 1.5517 1.5678 0.0704  -0.0763 -0.0397 399 HIS A O     
2922 C CB    . HIS A 389 ? 2.8221 2.7661 2.7372 0.0968  -0.0951 -0.0530 399 HIS A CB    
2923 C CG    . HIS A 389 ? 2.8032 2.7986 2.7566 0.0939  -0.1024 -0.0576 399 HIS A CG    
2924 N ND1   . HIS A 389 ? 2.8000 2.8136 2.7686 0.0901  -0.1148 -0.0632 399 HIS A ND1   
2925 C CD2   . HIS A 389 ? 2.7888 2.8230 2.7709 0.0946  -0.0992 -0.0570 399 HIS A CD2   
2926 C CE1   . HIS A 389 ? 2.7839 2.8438 2.7928 0.0859  -0.1197 -0.0657 399 HIS A CE1   
2927 N NE2   . HIS A 389 ? 2.7762 2.8511 2.7940 0.0887  -0.1091 -0.0603 399 HIS A NE2   
2928 N N     . LEU A 390 ? 1.8242 1.7354 1.7451 0.0517  -0.0754 -0.0454 400 LEU A N     
2929 C CA    . LEU A 390 ? 1.8169 1.7080 1.7325 0.0394  -0.0645 -0.0419 400 LEU A CA    
2930 C C     . LEU A 390 ? 1.8347 1.7076 1.7343 0.0519  -0.0605 -0.0430 400 LEU A C     
2931 O O     . LEU A 390 ? 1.8483 1.6852 1.7294 0.0490  -0.0563 -0.0409 400 LEU A O     
2932 C CB    . LEU A 390 ? 1.9678 1.8888 1.9133 0.0235  -0.0597 -0.0408 400 LEU A CB    
2933 C CG    . LEU A 390 ? 1.9597 1.8695 1.9019 0.0140  -0.0492 -0.0385 400 LEU A CG    
2934 C CD1   . LEU A 390 ? 1.9675 1.8385 1.8884 0.0053  -0.0461 -0.0365 400 LEU A CD1   
2935 C CD2   . LEU A 390 ? 1.9338 1.8745 1.9054 -0.0003 -0.0448 -0.0345 400 LEU A CD2   
2936 N N     . GLY A 391 ? 1.6654 1.5641 1.5742 0.0662  -0.0624 -0.0468 401 GLY A N     
2937 C CA    . GLY A 391 ? 1.6855 1.5692 1.5796 0.0814  -0.0606 -0.0509 401 GLY A CA    
2938 C C     . GLY A 391 ? 1.6887 1.6089 1.5934 0.1009  -0.0645 -0.0546 401 GLY A C     
2939 O O     . GLY A 391 ? 1.6816 1.6293 1.6008 0.1033  -0.0703 -0.0533 401 GLY A O     
2940 N N     . ILE A 392 ? 1.7016 1.6237 1.5996 0.1163  -0.0625 -0.0602 402 ILE A N     
2941 C CA    . ILE A 392 ? 1.7032 1.6678 1.6132 0.1362  -0.0643 -0.0629 402 ILE A CA    
2942 C C     . ILE A 392 ? 1.6702 1.6906 1.6154 0.1248  -0.0579 -0.0570 402 ILE A C     
2943 O O     . ILE A 392 ? 1.6560 1.6837 1.6077 0.1140  -0.0496 -0.0548 402 ILE A O     
2944 C CB    . ILE A 392 ? 2.3672 2.3182 2.2574 0.1599  -0.0645 -0.0721 402 ILE A CB    
2945 C CG1   . ILE A 392 ? 2.3737 2.3684 2.2728 0.1851  -0.0669 -0.0746 402 ILE A CG1   
2946 C CG2   . ILE A 392 ? 2.3598 2.3116 2.2500 0.1533  -0.0574 -0.0759 402 ILE A CG2   
2947 C CD1   . ILE A 392 ? 2.4094 2.3848 2.2841 0.2136  -0.0702 -0.0859 402 ILE A CD1   
2948 N N     . ARG A 393 ? 1.9034 1.9637 1.8732 0.1269  -0.0621 -0.0535 403 ARG A N     
2949 C CA    . ARG A 393 ? 1.8750 1.9881 1.8851 0.1137  -0.0566 -0.0450 403 ARG A CA    
2950 C C     . ARG A 393 ? 1.8772 2.0434 1.9062 0.1337  -0.0550 -0.0433 403 ARG A C     
2951 O O     . ARG A 393 ? 1.8930 2.0658 1.9170 0.1520  -0.0634 -0.0482 403 ARG A O     
2952 C CB    . ARG A 393 ? 1.9182 2.0381 1.9523 0.0938  -0.0639 -0.0419 403 ARG A CB    
2953 C CG    . ARG A 393 ? 1.9009 2.0007 1.9398 0.0678  -0.0594 -0.0375 403 ARG A CG    
2954 C CD    . ARG A 393 ? 1.8860 2.0015 1.9563 0.0494  -0.0671 -0.0355 403 ARG A CD    
2955 N NE    . ARG A 393 ? 1.8930 1.9658 1.9409 0.0415  -0.0742 -0.0411 403 ARG A NE    
2956 C CZ    . ARG A 393 ? 1.8822 1.9532 1.9475 0.0232  -0.0795 -0.0414 403 ARG A CZ    
2957 N NH1   . ARG A 393 ? 1.8644 1.9699 1.9729 0.0084  -0.0790 -0.0356 403 ARG A NH1   
2958 N NH2   . ARG A 393 ? 1.8920 1.9265 1.9322 0.0207  -0.0851 -0.0466 403 ARG A NH2   
2959 N N     . SER A 394 ? 1.6195 1.8258 1.6696 0.1319  -0.0436 -0.0349 404 SER A N     
2960 C CA    . SER A 394 ? 1.6193 1.8861 1.6927 0.1499  -0.0390 -0.0295 404 SER A CA    
2961 C C     . SER A 394 ? 1.5947 1.9109 1.7080 0.1343  -0.0262 -0.0125 404 SER A C     
2962 O O     . SER A 394 ? 1.5842 1.8838 1.6942 0.1184  -0.0188 -0.0076 404 SER A O     
2963 C CB    . SER A 394 ? 2.4571 2.7180 2.4969 0.1819  -0.0367 -0.0390 404 SER A CB    
2964 O OG    . SER A 394 ? 2.4594 2.7012 2.4793 0.1809  -0.0285 -0.0410 404 SER A OG    
2965 N N     . GLN A 395 ? 1.5866 1.9648 1.7399 0.1385  -0.0234 -0.0018 405 GLN A N     
2966 C CA    . GLN A 395 ? 1.5667 1.9946 1.7622 0.1242  -0.0097 0.0186  405 GLN A CA    
2967 C C     . GLN A 395 ? 1.5743 2.0584 1.7739 0.1505  0.0040  0.0275  405 GLN A C     
2968 O O     . GLN A 395 ? 1.5739 2.1134 1.8049 0.1609  0.0053  0.0353  405 GLN A O     
2969 C CB    . GLN A 395 ? 1.8299 2.2895 2.0806 0.1017  -0.0164 0.0281  405 GLN A CB    
2970 C CG    . GLN A 395 ? 1.8395 2.3221 2.1008 0.1168  -0.0294 0.0194  405 GLN A CG    
2971 C CD    . GLN A 395 ? 1.8258 2.3391 2.1440 0.0942  -0.0396 0.0251  405 GLN A CD    
2972 O OE1   . GLN A 395 ? 1.8110 2.3192 2.1592 0.0656  -0.0390 0.0338  405 GLN A OE1   
2973 N NE2   . GLN A 395 ? 1.8333 2.3780 2.1674 0.1079  -0.0505 0.0190  405 GLN A NE2   
2974 N N     . SER A 396 ? 1.8326 2.3079 2.0047 0.1599  0.0150  0.0282  406 SER A N     
2975 C CA    . SER A 396 ? 1.8426 2.3707 2.0125 0.1872  0.0293  0.0364  406 SER A CA    
2976 C C     . SER A 396 ? 1.8368 2.3603 1.9976 0.1793  0.0420  0.0457  406 SER A C     
2977 O O     . SER A 396 ? 1.8239 2.3072 1.9853 0.1522  0.0392  0.0463  406 SER A O     
2978 C CB    . SER A 396 ? 1.6205 2.1333 1.7451 0.2245  0.0227  0.0152  406 SER A CB    
2979 O OG    . SER A 396 ? 1.6343 2.1897 1.7466 0.2532  0.0359  0.0193  406 SER A OG    
2980 N N     . ARG A 397 ? 1.5958 2.1620 1.7468 0.2047  0.0558  0.0527  407 ARG A N     
2981 C CA    . ARG A 397 ? 1.5908 2.1660 1.7384 0.1994  0.0696  0.0658  407 ARG A CA    
2982 C C     . ARG A 397 ? 1.6016 2.1106 1.6998 0.1998  0.0615  0.0437  407 ARG A C     
2983 O O     . ARG A 397 ? 1.6223 2.0915 1.6827 0.2169  0.0488  0.0186  407 ARG A O     
2984 C CB    . ARG A 397 ? 2.0066 2.6528 2.1559 0.2310  0.0870  0.0801  407 ARG A CB    
2985 C CG    . ARG A 397 ? 2.0055 2.7174 2.1928 0.2426  0.0925  0.0944  407 ARG A CG    
2986 C CD    . ARG A 397 ? 2.0185 2.8050 2.2076 0.2740  0.1128  0.1126  407 ARG A CD    
2987 N NE    . ARG A 397 ? 2.0174 2.8751 2.2470 0.2857  0.1202  0.1293  407 ARG A NE    
2988 C CZ    . ARG A 397 ? 2.0220 2.9609 2.2749 0.3046  0.1415  0.1565  407 ARG A CZ    
2989 N NH1   . ARG A 397 ? 2.0292 2.9875 2.2658 0.3153  0.1575  0.1700  407 ARG A NH1   
2990 N NH2   . ARG A 397 ? 2.0205 3.0245 2.3137 0.3137  0.1472  0.1712  407 ARG A NH2   
2991 N N     . PRO A 398 ? 1.5897 2.0879 1.6904 0.1812  0.0686  0.0540  408 PRO A N     
2992 C CA    . PRO A 398 ? 1.5963 2.0314 1.6580 0.1754  0.0595  0.0340  408 PRO A CA    
2993 C C     . PRO A 398 ? 1.6261 2.0539 1.6415 0.2096  0.0563  0.0125  408 PRO A C     
2994 O O     . PRO A 398 ? 1.6406 2.0104 1.6241 0.2109  0.0418  -0.0121 408 PRO A O     
2995 C CB    . PRO A 398 ? 3.3161 3.7588 3.3959 0.1531  0.0708  0.0541  408 PRO A CB    
2996 C CG    . PRO A 398 ? 3.3121 3.8291 3.4251 0.1622  0.0892  0.0827  408 PRO A CG    
2997 C CD    . PRO A 398 ? 3.3121 3.8608 3.4503 0.1693  0.0868  0.0855  408 PRO A CD    
2998 N N     . ASN A 399 ? 1.8033 2.2893 1.8160 0.2374  0.0693  0.0218  409 ASN A N     
2999 C CA    . ASN A 399 ? 1.8365 2.3219 1.8052 0.2750  0.0648  -0.0009 409 ASN A CA    
3000 C C     . ASN A 399 ? 1.8587 2.3450 1.8148 0.3015  0.0555  -0.0175 409 ASN A C     
3001 O O     . ASN A 399 ? 1.8903 2.3475 1.8075 0.3274  0.0435  -0.0451 409 ASN A O     
3002 C CB    . ASN A 399 ? 2.3780 2.9295 2.3448 0.2991  0.0827  0.0156  409 ASN A CB    
3003 C CG    .