data_4RYL
# 
_entry.id   4RYL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4RYL         
RCSB  RCSB087956   
WWPDB D_1000087956 
# 
_pdbx_database_status.entry_id                        4RYL 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-15 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dong, A.'                             1  
'Dobrovetsky, E.'                      2  
'Kaniskan, H.U.'                       3  
'Szewczyk, M.'                         4  
'Yu, Z.'                               5  
'Eram, M.S.'                           6  
'Yang, X.'                             7  
'Schmidt, K.'                          8  
'Luo, X.'                              9  
'Dai, M.'                              10 
'He, F.'                               11 
'Zang, I.'                             12 
'Lin, Y.'                              13 
'Kennedy, S.'                          14 
'Li, F.'                               15 
'Tempel, W.'                           16 
'Smil, D.'                             17 
'Min, S.J.'                            18 
'Landon, M.'                           19 
'Lin-Jones, J.'                        20 
'Huang, X.P.'                          21 
'Roth, B.L.'                           22 
'Schapira, M.'                         23 
'Atadja, P.'                           24 
'Barsyte-Lovejoy, D.'                  25 
'Bountra, C.'                          26 
'Edwards, A.M.'                        27 
'Arrowsmith, C.H.'                     28 
'Brown, P.J.'                          29 
'Zhao, K.'                             30 
'Jin, J.'                              31 
'Vedadi, M.'                           32 
'Structural Genomics Consortium (SGC)' 33 
# 
_citation.id                        primary 
_citation.title                     
'A Potent, Selective and Cell-Active Allosteric Inhibitor of Protein Arginine Methyltransferase 3 (PRMT3).' 
_citation.journal_abbrev            Angew.Chem.Int.Ed.Engl. 
_citation.journal_volume            54 
_citation.page_first                5166 
_citation.page_last                 5170 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   GE 
_citation.journal_id_ISSN           1433-7851 
_citation.journal_id_CSD            9999 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25728001 
_citation.pdbx_database_id_DOI      10.1002/anie.201412154 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kaniskan, H.U.'      1  
primary 'Szewczyk, M.M.'      2  
primary 'Yu, Z.'              3  
primary 'Eram, M.S.'          4  
primary 'Yang, X.'            5  
primary 'Schmidt, K.'         6  
primary 'Luo, X.'             7  
primary 'Dai, M.'             8  
primary 'He, F.'              9  
primary 'Zang, I.'            10 
primary 'Lin, Y.'             11 
primary 'Kennedy, S.'         12 
primary 'Li, F.'              13 
primary 'Dobrovetsky, E.'     14 
primary 'Dong, A.'            15 
primary 'Smil, D.'            16 
primary 'Min, S.J.'           17 
primary 'Landon, M.'          18 
primary 'Lin-Jones, J.'       19 
primary 'Huang, X.P.'         20 
primary 'Roth, B.L.'          21 
primary 'Schapira, M.'        22 
primary 'Atadja, P.'          23 
primary 'Barsyte-Lovejoy, D.' 24 
primary 'Arrowsmith, C.H.'    25 
primary 'Brown, P.J.'         26 
primary 'Zhao, K.'            27 
primary 'Jin, J.'             28 
primary 'Vedadi, M.'          29 
# 
_cell.length_a           70.691 
_cell.length_b           70.691 
_cell.length_c           173.559 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4RYL 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.entry_id                         4RYL 
_symmetry.Int_Tables_number                96 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PRMT3 protein'                                             38281.914 1   ? ? ? ? 
2 non-polymer syn '1-isoquinolin-6-yl-3-[2-oxo-2-(pyrrolidin-1-yl)ethyl]urea' 298.340   1   ? ? ? ? 
3 non-polymer syn 'UNKNOWN ATOM OR ION'                                       ?         2   ? ? ? ? 
4 water       nat water                                                       18.015    169 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  ASP n 
1 21  LEU n 
1 22  GLN n 
1 23  GLU n 
1 24  ASP n 
1 25  GLU n 
1 26  ASP n 
1 27  GLY n 
1 28  VAL n 
1 29  TYR n 
1 30  PHE n 
1 31  SER n 
1 32  SER n 
1 33  TYR n 
1 34  GLY n 
1 35  HIS n 
1 36  TYR n 
1 37  GLY n 
1 38  ILE n 
1 39  HIS n 
1 40  GLU n 
1 41  GLU n 
1 42  MET n 
1 43  LEU n 
1 44  LYS n 
1 45  ASP n 
1 46  LYS n 
1 47  ILE n 
1 48  ARG n 
1 49  THR n 
1 50  GLU n 
1 51  SER n 
1 52  TYR n 
1 53  ARG n 
1 54  ASP n 
1 55  PHE n 
1 56  ILE n 
1 57  TYR n 
1 58  GLN n 
1 59  ASN n 
1 60  PRO n 
1 61  HIS n 
1 62  ILE n 
1 63  PHE n 
1 64  LYS n 
1 65  ASP n 
1 66  LYS n 
1 67  VAL n 
1 68  VAL n 
1 69  LEU n 
1 70  ASP n 
1 71  VAL n 
1 72  GLY n 
1 73  CYS n 
1 74  GLY n 
1 75  THR n 
1 76  GLY n 
1 77  ILE n 
1 78  LEU n 
1 79  SER n 
1 80  MET n 
1 81  PHE n 
1 82  ALA n 
1 83  ALA n 
1 84  LYS n 
1 85  ALA n 
1 86  GLY n 
1 87  ALA n 
1 88  LYS n 
1 89  LYS n 
1 90  VAL n 
1 91  LEU n 
1 92  GLY n 
1 93  VAL n 
1 94  ASP n 
1 95  GLN n 
1 96  SER n 
1 97  GLU n 
1 98  ILE n 
1 99  LEU n 
1 100 TYR n 
1 101 GLN n 
1 102 ALA n 
1 103 MET n 
1 104 ASP n 
1 105 ILE n 
1 106 ILE n 
1 107 ARG n 
1 108 LEU n 
1 109 ASN n 
1 110 LYS n 
1 111 LEU n 
1 112 GLU n 
1 113 ASP n 
1 114 THR n 
1 115 ILE n 
1 116 THR n 
1 117 LEU n 
1 118 ILE n 
1 119 LYS n 
1 120 GLY n 
1 121 LYS n 
1 122 ILE n 
1 123 GLU n 
1 124 GLU n 
1 125 VAL n 
1 126 HIS n 
1 127 LEU n 
1 128 PRO n 
1 129 VAL n 
1 130 GLU n 
1 131 LYS n 
1 132 VAL n 
1 133 ASP n 
1 134 VAL n 
1 135 ILE n 
1 136 ILE n 
1 137 SER n 
1 138 GLU n 
1 139 TRP n 
1 140 MET n 
1 141 GLY n 
1 142 TYR n 
1 143 PHE n 
1 144 LEU n 
1 145 LEU n 
1 146 PHE n 
1 147 GLU n 
1 148 SER n 
1 149 MET n 
1 150 LEU n 
1 151 ASP n 
1 152 SER n 
1 153 VAL n 
1 154 LEU n 
1 155 TYR n 
1 156 ALA n 
1 157 LYS n 
1 158 ASN n 
1 159 LYS n 
1 160 TYR n 
1 161 LEU n 
1 162 ALA n 
1 163 LYS n 
1 164 GLY n 
1 165 GLY n 
1 166 SER n 
1 167 VAL n 
1 168 TYR n 
1 169 PRO n 
1 170 ASP n 
1 171 ILE n 
1 172 CYS n 
1 173 THR n 
1 174 ILE n 
1 175 SER n 
1 176 LEU n 
1 177 VAL n 
1 178 ALA n 
1 179 VAL n 
1 180 SER n 
1 181 ASP n 
1 182 VAL n 
1 183 ASN n 
1 184 LYS n 
1 185 HIS n 
1 186 ALA n 
1 187 ASP n 
1 188 ARG n 
1 189 ILE n 
1 190 ALA n 
1 191 PHE n 
1 192 TRP n 
1 193 ASP n 
1 194 ASP n 
1 195 VAL n 
1 196 TYR n 
1 197 GLY n 
1 198 PHE n 
1 199 LYS n 
1 200 MET n 
1 201 SER n 
1 202 CYS n 
1 203 MET n 
1 204 LYS n 
1 205 LYS n 
1 206 ALA n 
1 207 VAL n 
1 208 ILE n 
1 209 PRO n 
1 210 GLU n 
1 211 ALA n 
1 212 VAL n 
1 213 VAL n 
1 214 GLU n 
1 215 VAL n 
1 216 LEU n 
1 217 ASP n 
1 218 PRO n 
1 219 LYS n 
1 220 THR n 
1 221 LEU n 
1 222 ILE n 
1 223 SER n 
1 224 GLU n 
1 225 PRO n 
1 226 CYS n 
1 227 GLY n 
1 228 ILE n 
1 229 LYS n 
1 230 HIS n 
1 231 ILE n 
1 232 ASP n 
1 233 CYS n 
1 234 HIS n 
1 235 THR n 
1 236 THR n 
1 237 SER n 
1 238 ILE n 
1 239 SER n 
1 240 ASP n 
1 241 LEU n 
1 242 GLU n 
1 243 PHE n 
1 244 SER n 
1 245 SER n 
1 246 ASP n 
1 247 PHE n 
1 248 THR n 
1 249 LEU n 
1 250 LYS n 
1 251 ILE n 
1 252 THR n 
1 253 ARG n 
1 254 THR n 
1 255 SER n 
1 256 MET n 
1 257 CYS n 
1 258 THR n 
1 259 ALA n 
1 260 ILE n 
1 261 ALA n 
1 262 GLY n 
1 263 TYR n 
1 264 PHE n 
1 265 ASP n 
1 266 ILE n 
1 267 TYR n 
1 268 PHE n 
1 269 GLU n 
1 270 LYS n 
1 271 ASN n 
1 272 CYS n 
1 273 HIS n 
1 274 ASN n 
1 275 ARG n 
1 276 VAL n 
1 277 VAL n 
1 278 PHE n 
1 279 SER n 
1 280 THR n 
1 281 GLY n 
1 282 PRO n 
1 283 GLN n 
1 284 SER n 
1 285 THR n 
1 286 LYS n 
1 287 THR n 
1 288 HIS n 
1 289 TRP n 
1 290 LYS n 
1 291 GLN n 
1 292 THR n 
1 293 VAL n 
1 294 PHE n 
1 295 LEU n 
1 296 LEU n 
1 297 GLU n 
1 298 LYS n 
1 299 PRO n 
1 300 PHE n 
1 301 SER n 
1 302 VAL n 
1 303 LYS n 
1 304 ALA n 
1 305 GLY n 
1 306 GLU n 
1 307 ALA n 
1 308 LEU n 
1 309 LYS n 
1 310 GLY n 
1 311 LYS n 
1 312 VAL n 
1 313 THR n 
1 314 VAL n 
1 315 HIS n 
1 316 LYS n 
1 317 ASN n 
1 318 LYS n 
1 319 LYS n 
1 320 ASP n 
1 321 PRO n 
1 322 ARG n 
1 323 SER n 
1 324 LEU n 
1 325 THR n 
1 326 VAL n 
1 327 THR n 
1 328 LEU n 
1 329 THR n 
1 330 LEU n 
1 331 ASN n 
1 332 ASN n 
1 333 SER n 
1 334 THR n 
1 335 GLN n 
1 336 THR n 
1 337 TYR n 
1 338 GLY n 
1 339 LEU n 
1 340 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PRMT3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V2R-PRAR2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28A-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8WUV3_HUMAN 
_struct_ref.pdbx_db_accession          Q8WUV3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEIL
YQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAV
SDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTA
IAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGL
Q
;
_struct_ref.pdbx_align_begin           228 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4RYL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 340 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8WUV3 
_struct_ref_seq.db_align_beg                  228 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  548 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       228 
_struct_ref_seq.pdbx_auth_seq_align_end       548 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4RYL MET A 1  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 209 1  
1 4RYL GLY A 2  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 210 2  
1 4RYL SER A 3  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 211 3  
1 4RYL SER A 4  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 212 4  
1 4RYL HIS A 5  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 213 5  
1 4RYL HIS A 6  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 214 6  
1 4RYL HIS A 7  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 215 7  
1 4RYL HIS A 8  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 216 8  
1 4RYL HIS A 9  ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 217 9  
1 4RYL HIS A 10 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 218 10 
1 4RYL SER A 11 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 219 11 
1 4RYL SER A 12 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 220 12 
1 4RYL GLY A 13 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 221 13 
1 4RYL LEU A 14 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 222 14 
1 4RYL VAL A 15 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 223 15 
1 4RYL PRO A 16 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 224 16 
1 4RYL ARG A 17 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 225 17 
1 4RYL GLY A 18 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 226 18 
1 4RYL SER A 19 ? UNP Q8WUV3 ? ? 'EXPRESSION TAG' 227 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3ZG non-polymer         . '1-isoquinolin-6-yl-3-[2-oxo-2-(pyrrolidin-1-yl)ethyl]urea' ? 'C16 H18 N4 O2'  298.340 
ALA 'L-peptide linking' y ALANINE                                                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                    ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                       ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                  ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                      ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                  ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                      ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                    ? 'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'                                       ? ?                ?       
VAL 'L-peptide linking' y VALINE                                                      ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4RYL 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.83 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.57 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    '20% PEG 3350 and 0.2 M di Na tartrate, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU SATURN A200' 
_diffrn_detector.pdbx_collection_date   2014-06-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.pdbx_wavelength_list        1.54178 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.d_resolution_high            2.100 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   26698 
_reflns.pdbx_Rmerge_I_obs            0.099 
_reflns.pdbx_netI_over_sigmaI        30.4 
_reflns.pdbx_chi_squared             0.946 
_reflns.pdbx_redundancy              14.900 
_reflns.percent_possible_obs         99.900 
_reflns.entry_id                     4RYL 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        27.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.100 2.140  ? ? ? 0.951 ? ? 0.763 15.000 ? 1307 99.900  1  1 
2.140 2.180  ? ? ? 0.791 ? ? 0.743 14.900 ? 1307 99.800  2  1 
2.180 2.220  ? ? ? 0.743 ? ? 0.779 15.000 ? 1297 99.900  3  1 
2.220 2.260  ? ? ? 0.554 ? ? 1.162 15.000 ? 1291 99.800  4  1 
2.260 2.310  ? ? ? 0.707 ? ? 0.822 15.000 ? 1303 100.000 5  1 
2.310 2.370  ? ? ? 0.470 ? ? 0.813 15.000 ? 1321 100.000 6  1 
2.370 2.420  ? ? ? 0.437 ? ? 0.813 15.100 ? 1301 100.000 7  1 
2.420 2.490  ? ? ? 0.408 ? ? 0.818 15.000 ? 1314 100.000 8  1 
2.490 2.560  ? ? ? 0.324 ? ? 0.820 15.000 ? 1308 100.000 9  1 
2.560 2.650  ? ? ? 0.273 ? ? 0.831 15.100 ? 1330 100.000 10 1 
2.650 2.740  ? ? ? 0.230 ? ? 0.878 15.100 ? 1309 100.000 11 1 
2.740 2.850  ? ? ? 0.186 ? ? 0.876 15.100 ? 1338 100.000 12 1 
2.850 2.980  ? ? ? 0.143 ? ? 0.899 15.100 ? 1329 100.000 13 1 
2.980 3.140  ? ? ? 0.111 ? ? 0.938 15.100 ? 1322 100.000 14 1 
3.140 3.330  ? ? ? 0.081 ? ? 1.004 15.100 ? 1338 100.000 15 1 
3.330 3.590  ? ? ? 0.067 ? ? 1.122 15.000 ? 1350 100.000 16 1 
3.590 3.950  ? ? ? 0.061 ? ? 1.396 15.000 ? 1357 100.000 17 1 
3.950 4.520  ? ? ? 0.049 ? ? 1.308 15.000 ? 1368 100.000 18 1 
4.520 5.700  ? ? ? 0.041 ? ? 1.093 14.700 ? 1397 100.000 19 1 
5.700 50.000 ? ? ? 0.033 ? ? 0.995 13.300 ? 1511 98.800  20 1 
# 
_refine.entry_id                                 4RYL 
_refine.ls_d_res_high                            2.1000 
_refine.ls_d_res_low                             50.0000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.7300 
_refine.ls_number_reflns_obs                     25762 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          0.1875 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.1861 
_refine.ls_wR_factor_R_work                      0.1600 
_refine.ls_R_factor_R_free                       0.2318 
_refine.ls_wR_factor_R_free                      0.1988 
_refine.ls_percent_reflns_R_free                 3.1000 
_refine.ls_number_reflns_R_free                  818 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               33.7170 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.6900 
_refine.aniso_B[2][2]                            0.6900 
_refine.aniso_B[3][3]                            -1.3900 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9590 
_refine.correlation_coeff_Fo_to_Fc_free          0.9380 
_refine.overall_SU_R_Cruickshank_DPI             0.1614 
_refine.overall_SU_R_free                        0.1556 
_refine.pdbx_overall_ESU_R                       0.1610 
_refine.pdbx_overall_ESU_R_Free                  0.1560 
_refine.overall_SU_ML                            0.1070 
_refine.overall_SU_B                             4.0260 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      2FYT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8305 
_refine.B_iso_max                                76.200 
_refine.B_iso_min                                22.490 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2328 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             169 
_refine_hist.number_atoms_total               2521 
_refine_hist.d_res_high                       2.1000 
_refine_hist.d_res_low                        50.0000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       2466 0.010  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         2360 0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    3350 1.362  1.952  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      5444 0.738  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 315  6.170  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 97   35.358 24.330 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 434  13.786 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 8    20.681 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         390  0.080  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   2817 0.005  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     545  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1222 1.977  3.257  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         1220 1.976  3.254  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1529 2.836  4.865  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.0980 
_refine_ls_shell.d_res_low                        2.1520 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.9000 
_refine_ls_shell.number_reflns_R_work             1875 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2120 
_refine_ls_shell.R_factor_R_free                  0.2530 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             51 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1926 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4RYL 
_struct.title                     
'Human Protein Arginine Methyltransferase 3 in complex with 1-isoquinolin-6-yl-3-[2-oxo-2-(pyrrolidin-1-yl)ethyl]urea' 
_struct.pdbx_descriptor           'PRMT3 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4RYL 
_struct_keywords.text            'PRMT3, SGC707, Structural Genomics, Structural Genomics Consortium, transferase' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 36  ? LYS A 44  ? TYR A 244 LYS A 252 1 ? 9  
HELX_P HELX_P2  2  ASP A 45  ? ASN A 59  ? ASP A 253 ASN A 267 1 ? 15 
HELX_P HELX_P3  3  PRO A 60  ? PHE A 63  ? PRO A 268 PHE A 271 5 ? 4  
HELX_P HELX_P4  4  GLY A 76  ? ALA A 85  ? GLY A 284 ALA A 293 1 ? 10 
HELX_P HELX_P5  5  GLU A 97  ? ASN A 109 ? GLU A 305 ASN A 317 1 ? 13 
HELX_P HELX_P6  6  MET A 149 ? TYR A 160 ? MET A 357 TYR A 368 1 ? 12 
HELX_P HELX_P7  7  ASP A 181 ? ILE A 189 ? ASP A 389 ILE A 397 1 ? 9  
HELX_P HELX_P8  8  ALA A 190 ? ASP A 194 ? ALA A 398 ASP A 402 5 ? 5  
HELX_P HELX_P9  9  MET A 200 ? CYS A 202 ? MET A 408 CYS A 410 5 ? 3  
HELX_P HELX_P10 10 MET A 203 ? ILE A 208 ? MET A 411 ILE A 416 1 ? 6  
HELX_P HELX_P11 11 ASP A 217 ? LEU A 221 ? ASP A 425 LEU A 429 5 ? 5  
HELX_P HELX_P12 12 SER A 237 ? GLU A 242 ? SER A 445 GLU A 450 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           168 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            376 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    169 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     377 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 115 ? LYS A 119 ? ILE A 323 LYS A 327 
A 2 LYS A 89  ? ASP A 94  ? LYS A 297 ASP A 302 
A 3 VAL A 67  ? VAL A 71  ? VAL A 275 VAL A 279 
A 4 VAL A 132 ? ILE A 136 ? VAL A 340 ILE A 344 
A 5 LEU A 161 ? TYR A 168 ? LEU A 369 TYR A 376 
B 1 VAL A 212 ? GLU A 214 ? VAL A 420 GLU A 422 
B 2 GLN A 291 ? VAL A 302 ? GLN A 499 VAL A 510 
B 3 SER A 255 ? PHE A 268 ? SER A 463 PHE A 476 
B 4 ILE A 171 ? VAL A 179 ? ILE A 379 VAL A 387 
B 5 CYS A 226 ? ASP A 232 ? CYS A 434 ASP A 440 
C 1 VAL A 212 ? GLU A 214 ? VAL A 420 GLU A 422 
C 2 GLN A 291 ? VAL A 302 ? GLN A 499 VAL A 510 
C 3 SER A 255 ? PHE A 268 ? SER A 463 PHE A 476 
C 4 VAL A 276 ? SER A 279 ? VAL A 484 SER A 487 
D 1 PHE A 243 ? LYS A 250 ? PHE A 451 LYS A 458 
D 2 ALA A 307 ? HIS A 315 ? ALA A 515 HIS A 523 
D 3 THR A 325 ? LEU A 330 ? THR A 533 LEU A 538 
D 4 SER A 333 ? GLY A 338 ? SER A 541 GLY A 546 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 118 ? O ILE A 326 N GLY A 92  ? N GLY A 300 
A 2 3 O LEU A 91  ? O LEU A 299 N ASP A 70  ? N ASP A 278 
A 3 4 N LEU A 69  ? N LEU A 277 O ILE A 136 ? O ILE A 344 
A 4 5 N VAL A 132 ? N VAL A 340 O ALA A 162 ? O ALA A 370 
B 1 2 N VAL A 212 ? N VAL A 420 O VAL A 293 ? O VAL A 501 
B 2 3 O PHE A 294 ? O PHE A 502 N ILE A 260 ? N ILE A 468 
B 3 4 O TYR A 267 ? O TYR A 475 N ILE A 171 ? N ILE A 379 
B 4 5 N ILE A 174 ? N ILE A 382 O ILE A 228 ? O ILE A 436 
C 1 2 N VAL A 212 ? N VAL A 420 O VAL A 293 ? O VAL A 501 
C 2 3 O PHE A 294 ? O PHE A 502 N ILE A 260 ? N ILE A 468 
C 3 4 N ILE A 266 ? N ILE A 474 O PHE A 278 ? O PHE A 486 
D 1 2 N LEU A 249 ? N LEU A 457 O LEU A 308 ? O LEU A 516 
D 2 3 N LYS A 311 ? N LYS A 519 O THR A 329 ? O THR A 537 
D 3 4 N VAL A 326 ? N VAL A 534 O TYR A 337 ? O TYR A 545 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'BINDING SITE FOR RESIDUE 3ZG A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 GLY A 37  ? GLY A 245 . ? 7_555 ? 
2  AC1 10 GLU A 40  ? GLU A 248 . ? 7_555 ? 
3  AC1 10 GLU A 41  ? GLU A 249 . ? 7_555 ? 
4  AC1 10 ASP A 181 ? ASP A 389 . ? 1_555 ? 
5  AC1 10 LYS A 184 ? LYS A 392 . ? 1_555 ? 
6  AC1 10 ARG A 188 ? ARG A 396 . ? 1_555 ? 
7  AC1 10 VAL A 212 ? VAL A 420 . ? 1_555 ? 
8  AC1 10 GLU A 214 ? GLU A 422 . ? 1_555 ? 
9  AC1 10 THR A 258 ? THR A 466 . ? 1_555 ? 
10 AC1 10 ALA A 259 ? ALA A 467 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4RYL 
_atom_sites.fract_transf_matrix[1][1]   0.014146 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014146 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005762 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
X 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   A HIS A 1 35  ? 11.719  1.806   6.870   0.50 50.51 ? 243 HIS A N   1 
ATOM   2    N N   B HIS A 1 35  ? 13.952  3.139   5.926   0.50 65.49 ? 243 HIS A N   1 
ATOM   3    C CA  A HIS A 1 35  ? 13.193  2.086   6.740   0.50 53.84 ? 243 HIS A CA  1 
ATOM   4    C CA  B HIS A 1 35  ? 13.380  2.193   6.923   0.50 63.56 ? 243 HIS A CA  1 
ATOM   5    C C   A HIS A 1 35  ? 13.999  0.770   6.825   0.50 56.47 ? 243 HIS A C   1 
ATOM   6    C C   B HIS A 1 35  ? 14.045  0.811   6.863   0.50 62.16 ? 243 HIS A C   1 
ATOM   7    O O   A HIS A 1 35  ? 14.734  0.410   5.904   0.50 58.64 ? 243 HIS A O   1 
ATOM   8    O O   B HIS A 1 35  ? 14.718  0.448   5.897   0.50 63.74 ? 243 HIS A O   1 
ATOM   9    C CB  A HIS A 1 35  ? 13.650  3.099   7.802   0.50 51.71 ? 243 HIS A CB  1 
ATOM   10   C CB  B HIS A 1 35  ? 11.864  2.042   6.719   0.50 61.89 ? 243 HIS A CB  1 
ATOM   11   N N   . TYR A 1 36  ? 13.843  0.060   7.935   1.00 56.38 ? 244 TYR A N   1 
ATOM   12   C CA  . TYR A 1 36  ? 14.262  -1.329  8.037   1.00 51.69 ? 244 TYR A CA  1 
ATOM   13   C C   . TYR A 1 36  ? 13.138  -2.235  7.517   1.00 51.76 ? 244 TYR A C   1 
ATOM   14   O O   . TYR A 1 36  ? 13.389  -3.284  6.910   1.00 41.39 ? 244 TYR A O   1 
ATOM   15   C CB  . TYR A 1 36  ? 14.580  -1.625  9.489   1.00 49.37 ? 244 TYR A CB  1 
ATOM   16   C CG  . TYR A 1 36  ? 15.799  -0.864  9.941   1.00 49.27 ? 244 TYR A CG  1 
ATOM   17   C CD1 . TYR A 1 36  ? 17.068  -1.325  9.614   1.00 47.84 ? 244 TYR A CD1 1 
ATOM   18   C CD2 . TYR A 1 36  ? 15.697  0.336   10.648  1.00 51.86 ? 244 TYR A CD2 1 
ATOM   19   C CE1 . TYR A 1 36  ? 18.208  -0.646  10.003  1.00 46.90 ? 244 TYR A CE1 1 
ATOM   20   C CE2 . TYR A 1 36  ? 16.846  1.029   11.041  1.00 52.73 ? 244 TYR A CE2 1 
ATOM   21   C CZ  . TYR A 1 36  ? 18.098  0.518   10.722  1.00 49.94 ? 244 TYR A CZ  1 
ATOM   22   O OH  . TYR A 1 36  ? 19.260  1.156   11.075  1.00 48.34 ? 244 TYR A OH  1 
ATOM   23   N N   . GLY A 1 37  ? 11.896  -1.797  7.737   1.00 49.64 ? 245 GLY A N   1 
ATOM   24   C CA  . GLY A 1 37  ? 10.720  -2.430  7.144   1.00 50.54 ? 245 GLY A CA  1 
ATOM   25   C C   . GLY A 1 37  ? 10.845  -2.834  5.673   1.00 47.49 ? 245 GLY A C   1 
ATOM   26   O O   . GLY A 1 37  ? 10.342  -3.879  5.270   1.00 44.27 ? 245 GLY A O   1 
ATOM   27   N N   . ILE A 1 38  ? 11.496  -1.997  4.876   1.00 45.21 ? 246 ILE A N   1 
ATOM   28   C CA  . ILE A 1 38  ? 11.681  -2.257  3.445   1.00 43.60 ? 246 ILE A CA  1 
ATOM   29   C C   . ILE A 1 38  ? 12.648  -3.420  3.090   1.00 42.00 ? 246 ILE A C   1 
ATOM   30   O O   . ILE A 1 38  ? 12.403  -4.175  2.133   1.00 37.28 ? 246 ILE A O   1 
ATOM   31   C CB  . ILE A 1 38  ? 12.075  -0.960  2.732   1.00 48.96 ? 246 ILE A CB  1 
ATOM   32   C CG1 . ILE A 1 38  ? 12.363  -1.196  1.264   1.00 49.96 ? 246 ILE A CG1 1 
ATOM   33   C CG2 . ILE A 1 38  ? 13.275  -0.292  3.389   1.00 53.28 ? 246 ILE A CG2 1 
ATOM   34   C CD1 . ILE A 1 38  ? 12.332  0.110   0.495   1.00 56.30 ? 246 ILE A CD1 1 
ATOM   35   N N   . HIS A 1 39  ? 13.739  -3.555  3.842   1.00 38.71 ? 247 HIS A N   1 
ATOM   36   C CA  . HIS A 1 39  ? 14.574  -4.766  3.768   1.00 37.15 ? 247 HIS A CA  1 
ATOM   37   C C   . HIS A 1 39  ? 13.793  -5.993  4.205   1.00 32.87 ? 247 HIS A C   1 
ATOM   38   O O   . HIS A 1 39  ? 13.891  -7.052  3.597   1.00 31.35 ? 247 HIS A O   1 
ATOM   39   C CB  . HIS A 1 39  ? 15.826  -4.574  4.608   1.00 38.59 ? 247 HIS A CB  1 
ATOM   40   C CG  . HIS A 1 39  ? 16.789  -3.620  3.973   1.00 38.74 ? 247 HIS A CG  1 
ATOM   41   N ND1 . HIS A 1 39  ? 16.876  -2.292  4.340   1.00 39.80 ? 247 HIS A ND1 1 
ATOM   42   C CD2 . HIS A 1 39  ? 17.655  -3.786  2.950   1.00 38.57 ? 247 HIS A CD2 1 
ATOM   43   C CE1 . HIS A 1 39  ? 17.783  -1.691  3.592   1.00 38.41 ? 247 HIS A CE1 1 
ATOM   44   N NE2 . HIS A 1 39  ? 18.271  -2.574  2.740   1.00 39.88 ? 247 HIS A NE2 1 
ATOM   45   N N   . GLU A 1 40  ? 12.955  -5.821  5.220   1.00 30.04 ? 248 GLU A N   1 
ATOM   46   C CA  . GLU A 1 40  ? 12.042  -6.865  5.655   1.00 29.90 ? 248 GLU A CA  1 
ATOM   47   C C   . GLU A 1 40  ? 11.060  -7.293  4.565   1.00 29.45 ? 248 GLU A C   1 
ATOM   48   O O   . GLU A 1 40  ? 10.807  -8.471  4.415   1.00 28.65 ? 248 GLU A O   1 
ATOM   49   C CB  . GLU A 1 40  ? 11.252  -6.397  6.886   1.00 29.96 ? 248 GLU A CB  1 
ATOM   50   C CG  . GLU A 1 40  ? 10.306  -7.449  7.444   1.00 29.26 ? 248 GLU A CG  1 
ATOM   51   C CD  . GLU A 1 40  ? 9.577   -6.969  8.687   1.00 30.32 ? 248 GLU A CD  1 
ATOM   52   O OE1 . GLU A 1 40  ? 8.494   -7.536  8.993   1.00 29.80 ? 248 GLU A OE1 1 
ATOM   53   O OE2 . GLU A 1 40  ? 10.102  -6.043  9.347   1.00 31.84 ? 248 GLU A OE2 1 
ATOM   54   N N   . GLU A 1 41  ? 10.505  -6.330  3.827   1.00 31.81 ? 249 GLU A N   1 
ATOM   55   C CA  A GLU A 1 41  ? 9.559   -6.637  2.747   0.50 30.57 ? 249 GLU A CA  1 
ATOM   56   C CA  B GLU A 1 41  ? 9.561   -6.615  2.736   0.50 32.39 ? 249 GLU A CA  1 
ATOM   57   C C   . GLU A 1 41  ? 10.247  -7.423  1.642   1.00 30.89 ? 249 GLU A C   1 
ATOM   58   O O   . GLU A 1 41  ? 9.671   -8.368  1.106   1.00 30.42 ? 249 GLU A O   1 
ATOM   59   C CB  A GLU A 1 41  ? 8.947   -5.367  2.151   0.50 29.20 ? 249 GLU A CB  1 
ATOM   60   C CB  B GLU A 1 41  ? 8.979   -5.315  2.144   0.50 33.45 ? 249 GLU A CB  1 
ATOM   61   C CG  A GLU A 1 41  ? 7.964   -5.630  1.017   0.50 29.73 ? 249 GLU A CG  1 
ATOM   62   C CG  B GLU A 1 41  ? 7.987   -4.623  3.073   0.50 37.35 ? 249 GLU A CG  1 
ATOM   63   C CD  A GLU A 1 41  ? 7.391   -4.358  0.406   0.50 31.02 ? 249 GLU A CD  1 
ATOM   64   C CD  B GLU A 1 41  ? 7.617   -3.187  2.694   0.50 39.65 ? 249 GLU A CD  1 
ATOM   65   O OE1 A GLU A 1 41  ? 7.441   -3.300  1.052   0.50 30.63 ? 249 GLU A OE1 1 
ATOM   66   O OE1 B GLU A 1 41  ? 8.433   -2.481  2.058   0.50 43.02 ? 249 GLU A OE1 1 
ATOM   67   O OE2 A GLU A 1 41  ? 6.877   -4.419  -0.727  0.50 33.65 ? 249 GLU A OE2 1 
ATOM   68   O OE2 B GLU A 1 41  ? 6.506   -2.750  3.069   0.50 40.08 ? 249 GLU A OE2 1 
ATOM   69   N N   . MET A 1 42  ? 11.473  -7.034  1.312   1.00 30.71 ? 250 MET A N   1 
ATOM   70   C CA  . MET A 1 42  ? 12.246  -7.742  0.295   1.00 31.77 ? 250 MET A CA  1 
ATOM   71   C C   . MET A 1 42  ? 12.619  -9.171  0.716   1.00 30.47 ? 250 MET A C   1 
ATOM   72   O O   . MET A 1 42  ? 12.518  -10.084 -0.092  1.00 26.58 ? 250 MET A O   1 
ATOM   73   C CB  . MET A 1 42  ? 13.479  -6.918  -0.090  1.00 38.26 ? 250 MET A CB  1 
ATOM   74   C CG  . MET A 1 42  ? 13.126  -5.654  -0.895  1.00 43.86 ? 250 MET A CG  1 
ATOM   75   S SD  . MET A 1 42  ? 14.529  -5.023  -1.829  1.00 56.83 ? 250 MET A SD  1 
ATOM   76   C CE  . MET A 1 42  ? 15.736  -4.704  -0.528  1.00 55.38 ? 250 MET A CE  1 
ATOM   77   N N   . LEU A 1 43  ? 13.020  -9.364  1.977   1.00 27.79 ? 251 LEU A N   1 
ATOM   78   C CA  . LEU A 1 43  ? 13.207  -10.687 2.529   1.00 30.05 ? 251 LEU A CA  1 
ATOM   79   C C   . LEU A 1 43  ? 11.947  -11.548 2.473   1.00 28.95 ? 251 LEU A C   1 
ATOM   80   O O   . LEU A 1 43  ? 12.000  -12.742 2.153   1.00 29.23 ? 251 LEU A O   1 
ATOM   81   C CB  . LEU A 1 43  ? 13.696  -10.611 3.989   1.00 29.57 ? 251 LEU A CB  1 
ATOM   82   C CG  . LEU A 1 43  ? 15.166  -10.264 4.111   1.00 31.67 ? 251 LEU A CG  1 
ATOM   83   C CD1 . LEU A 1 43  ? 15.467  -10.015 5.582   1.00 33.89 ? 251 LEU A CD1 1 
ATOM   84   C CD2 . LEU A 1 43  ? 16.049  -11.380 3.546   1.00 32.53 ? 251 LEU A CD2 1 
ATOM   85   N N   . LYS A 1 44  ? 10.811  -10.947 2.781   1.00 28.07 ? 252 LYS A N   1 
ATOM   86   C CA  . LYS A 1 44  ? 9.537   -11.669 2.737   1.00 28.25 ? 252 LYS A CA  1 
ATOM   87   C C   . LYS A 1 44  ? 8.997   -11.872 1.324   1.00 28.14 ? 252 LYS A C   1 
ATOM   88   O O   . LYS A 1 44  ? 8.000   -12.565 1.148   1.00 26.26 ? 252 LYS A O   1 
ATOM   89   C CB  . LYS A 1 44  ? 8.492   -10.951 3.610   1.00 31.19 ? 252 LYS A CB  1 
ATOM   90   C CG  . LYS A 1 44  ? 8.818   -11.052 5.088   1.00 32.30 ? 252 LYS A CG  1 
ATOM   91   C CD  . LYS A 1 44  ? 7.843   -10.259 5.953   1.00 35.06 ? 252 LYS A CD  1 
ATOM   92   C CE  . LYS A 1 44  ? 8.097   -10.534 7.447   1.00 36.95 ? 252 LYS A CE  1 
ATOM   93   N NZ  . LYS A 1 44  ? 7.203   -9.705  8.312   1.00 36.53 ? 252 LYS A NZ  1 
ATOM   94   N N   . ASP A 1 45  ? 9.649   -11.295 0.310   1.00 27.04 ? 253 ASP A N   1 
ATOM   95   C CA  . ASP A 1 45  ? 9.272   -11.586 -1.084  1.00 26.70 ? 253 ASP A CA  1 
ATOM   96   C C   . ASP A 1 45  ? 9.922   -12.934 -1.417  1.00 26.61 ? 253 ASP A C   1 
ATOM   97   O O   . ASP A 1 45  ? 11.117  -13.016 -1.688  1.00 26.18 ? 253 ASP A O   1 
ATOM   98   C CB  . ASP A 1 45  ? 9.732   -10.438 -1.975  1.00 27.18 ? 253 ASP A CB  1 
ATOM   99   C CG  . ASP A 1 45  ? 9.451   -10.658 -3.465  1.00 27.66 ? 253 ASP A CG  1 
ATOM   100  O OD1 . ASP A 1 45  ? 9.191   -11.791 -3.912  1.00 27.53 ? 253 ASP A OD1 1 
ATOM   101  O OD2 . ASP A 1 45  ? 9.552   -9.654  -4.194  1.00 28.52 ? 253 ASP A OD2 1 
ATOM   102  N N   . LYS A 1 46  ? 9.128   -13.993 -1.335  1.00 26.89 ? 254 LYS A N   1 
ATOM   103  C CA  . LYS A 1 46  ? 9.653   -15.350 -1.424  1.00 30.66 ? 254 LYS A CA  1 
ATOM   104  C C   . LYS A 1 46  ? 10.164  -15.662 -2.831  1.00 30.04 ? 254 LYS A C   1 
ATOM   105  O O   . LYS A 1 46  ? 11.193  -16.318 -2.975  1.00 27.84 ? 254 LYS A O   1 
ATOM   106  C CB  . LYS A 1 46  ? 8.591   -16.381 -1.021  1.00 33.75 ? 254 LYS A CB  1 
ATOM   107  C CG  . LYS A 1 46  ? 8.430   -16.477 0.494   1.00 39.13 ? 254 LYS A CG  1 
ATOM   108  C CD  . LYS A 1 46  ? 7.224   -17.307 0.918   1.00 42.38 ? 254 LYS A CD  1 
ATOM   109  C CE  . LYS A 1 46  ? 7.565   -18.775 1.133   1.00 44.56 ? 254 LYS A CE  1 
ATOM   110  N N   . ILE A 1 47  ? 9.447   -15.200 -3.853  1.00 26.95 ? 255 ILE A N   1 
ATOM   111  C CA  . ILE A 1 47  ? 9.892   -15.402 -5.234  1.00 29.67 ? 255 ILE A CA  1 
ATOM   112  C C   . ILE A 1 47  ? 11.286  -14.813 -5.392  1.00 28.12 ? 255 ILE A C   1 
ATOM   113  O O   . ILE A 1 47  ? 12.204  -15.480 -5.852  1.00 27.66 ? 255 ILE A O   1 
ATOM   114  C CB  . ILE A 1 47  ? 8.945   -14.740 -6.252  1.00 30.40 ? 255 ILE A CB  1 
ATOM   115  C CG1 . ILE A 1 47  ? 7.568   -15.421 -6.228  1.00 32.07 ? 255 ILE A CG1 1 
ATOM   116  C CG2 . ILE A 1 47  ? 9.557   -14.768 -7.648  1.00 31.62 ? 255 ILE A CG2 1 
ATOM   117  C CD1 . ILE A 1 47  ? 7.555   -16.909 -6.583  1.00 34.32 ? 255 ILE A CD1 1 
ATOM   118  N N   . ARG A 1 48  ? 11.454  -13.571 -4.972  1.00 26.48 ? 256 ARG A N   1 
ATOM   119  C CA  . ARG A 1 48  ? 12.767  -12.943 -5.021  1.00 26.86 ? 256 ARG A CA  1 
ATOM   120  C C   . ARG A 1 48  ? 13.840  -13.737 -4.269  1.00 26.66 ? 256 ARG A C   1 
ATOM   121  O O   . ARG A 1 48  ? 14.842  -14.169 -4.848  1.00 24.86 ? 256 ARG A O   1 
ATOM   122  C CB  . ARG A 1 48  ? 12.679  -11.562 -4.426  1.00 27.63 ? 256 ARG A CB  1 
ATOM   123  C CG  . ARG A 1 48  ? 13.981  -10.817 -4.316  1.00 30.65 ? 256 ARG A CG  1 
ATOM   124  C CD  . ARG A 1 48  ? 13.796  -9.758  -3.266  1.00 33.11 ? 256 ARG A CD  1 
ATOM   125  N NE  . ARG A 1 48  ? 14.976  -8.953  -2.987  1.00 34.66 ? 256 ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 48  ? 15.806  -9.152  -1.967  1.00 34.20 ? 256 ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 48  ? 16.815  -8.323  -1.807  1.00 34.68 ? 256 ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 48  ? 15.637  -10.162 -1.107  1.00 36.55 ? 256 ARG A NH2 1 
ATOM   129  N N   . THR A 1 49  ? 13.633  -13.907 -2.977  1.00 25.91 ? 257 THR A N   1 
ATOM   130  C CA  . THR A 1 49  ? 14.706  -14.356 -2.106  1.00 27.46 ? 257 THR A CA  1 
ATOM   131  C C   . THR A 1 49  ? 15.024  -15.850 -2.318  1.00 27.26 ? 257 THR A C   1 
ATOM   132  O O   . THR A 1 49  ? 16.190  -16.247 -2.342  1.00 28.14 ? 257 THR A O   1 
ATOM   133  C CB  . THR A 1 49  ? 14.350  -14.046 -0.639  1.00 28.84 ? 257 THR A CB  1 
ATOM   134  O OG1 . THR A 1 49  ? 14.154  -12.634 -0.504  1.00 28.92 ? 257 THR A OG1 1 
ATOM   135  C CG2 . THR A 1 49  ? 15.475  -14.471 0.285   1.00 29.44 ? 257 THR A CG2 1 
ATOM   136  N N   . GLU A 1 50  ? 13.983  -16.650 -2.509  1.00 29.67 ? 258 GLU A N   1 
ATOM   137  C CA  . GLU A 1 50  ? 14.142  -18.072 -2.769  1.00 29.61 ? 258 GLU A CA  1 
ATOM   138  C C   . GLU A 1 50  ? 14.747  -18.349 -4.149  1.00 30.22 ? 258 GLU A C   1 
ATOM   139  O O   . GLU A 1 50  ? 15.434  -19.337 -4.301  1.00 27.63 ? 258 GLU A O   1 
ATOM   140  C CB  . GLU A 1 50  ? 12.804  -18.811 -2.610  1.00 30.62 ? 258 GLU A CB  1 
ATOM   141  C CG  . GLU A 1 50  ? 12.325  -18.776 -1.168  1.00 34.96 ? 258 GLU A CG  1 
ATOM   142  C CD  . GLU A 1 50  ? 11.084  -19.600 -0.888  1.00 37.44 ? 258 GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 50  ? 10.820  -19.834 0.299   1.00 46.64 ? 258 GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 50  ? 10.370  -19.994 -1.826  1.00 42.03 ? 258 GLU A OE2 1 
ATOM   145  N N   . SER A 1 51  ? 14.506  -17.489 -5.138  1.00 27.39 ? 259 SER A N   1 
ATOM   146  C CA  . SER A 1 51  ? 15.158  -17.657 -6.452  1.00 28.57 ? 259 SER A CA  1 
ATOM   147  C C   . SER A 1 51  ? 16.676  -17.525 -6.312  1.00 29.09 ? 259 SER A C   1 
ATOM   148  O O   . SER A 1 51  ? 17.440  -18.323 -6.898  1.00 27.22 ? 259 SER A O   1 
ATOM   149  C CB  . SER A 1 51  ? 14.656  -16.629 -7.472  1.00 28.89 ? 259 SER A CB  1 
ATOM   150  O OG  . SER A 1 51  ? 13.320  -16.888 -7.846  1.00 29.07 ? 259 SER A OG  1 
ATOM   151  N N   . TYR A 1 52  ? 17.112  -16.536 -5.530  1.00 25.88 ? 260 TYR A N   1 
ATOM   152  C CA  . TYR A 1 52  ? 18.534  -16.339 -5.303  1.00 25.12 ? 260 TYR A CA  1 
ATOM   153  C C   . TYR A 1 52  ? 19.112  -17.482 -4.457  1.00 25.60 ? 260 TYR A C   1 
ATOM   154  O O   . TYR A 1 52  ? 20.169  -17.998 -4.760  1.00 26.36 ? 260 TYR A O   1 
ATOM   155  C CB  . TYR A 1 52  ? 18.815  -15.013 -4.620  1.00 25.36 ? 260 TYR A CB  1 
ATOM   156  C CG  . TYR A 1 52  ? 18.907  -13.803 -5.541  1.00 24.91 ? 260 TYR A CG  1 
ATOM   157  C CD1 . TYR A 1 52  ? 17.754  -13.156 -5.999  1.00 26.09 ? 260 TYR A CD1 1 
ATOM   158  C CD2 . TYR A 1 52  ? 20.143  -13.299 -5.933  1.00 24.69 ? 260 TYR A CD2 1 
ATOM   159  C CE1 . TYR A 1 52  ? 17.845  -12.053 -6.845  1.00 26.23 ? 260 TYR A CE1 1 
ATOM   160  C CE2 . TYR A 1 52  ? 20.246  -12.187 -6.759  1.00 26.02 ? 260 TYR A CE2 1 
ATOM   161  C CZ  . TYR A 1 52  ? 19.090  -11.565 -7.201  1.00 25.36 ? 260 TYR A CZ  1 
ATOM   162  O OH  . TYR A 1 52  ? 19.202  -10.486 -8.029  1.00 26.44 ? 260 TYR A OH  1 
ATOM   163  N N   . ARG A 1 53  ? 18.400  -17.840 -3.393  1.00 26.12 ? 261 ARG A N   1 
ATOM   164  C CA  A ARG A 1 53  ? 18.736  -18.980 -2.543  0.50 26.34 ? 261 ARG A CA  1 
ATOM   165  C CA  B ARG A 1 53  ? 18.783  -18.960 -2.562  0.50 27.66 ? 261 ARG A CA  1 
ATOM   166  C C   . ARG A 1 53  ? 18.984  -20.224 -3.406  1.00 26.70 ? 261 ARG A C   1 
ATOM   167  O O   . ARG A 1 53  ? 20.038  -20.852 -3.326  1.00 26.12 ? 261 ARG A O   1 
ATOM   168  C CB  A ARG A 1 53  ? 17.587  -19.243 -1.530  0.50 26.68 ? 261 ARG A CB  1 
ATOM   169  C CB  B ARG A 1 53  ? 17.738  -19.195 -1.458  0.50 29.93 ? 261 ARG A CB  1 
ATOM   170  C CG  A ARG A 1 53  ? 17.928  -20.060 -0.271  0.50 27.58 ? 261 ARG A CG  1 
ATOM   171  C CG  B ARG A 1 53  ? 18.179  -20.180 -0.378  0.50 32.69 ? 261 ARG A CG  1 
ATOM   172  C CD  A ARG A 1 53  ? 17.539  -21.538 -0.365  0.50 28.38 ? 261 ARG A CD  1 
ATOM   173  C CD  B ARG A 1 53  ? 17.331  -21.443 -0.383  0.50 35.51 ? 261 ARG A CD  1 
ATOM   174  N NE  A ARG A 1 53  ? 16.265  -21.771 -1.053  0.50 25.58 ? 261 ARG A NE  1 
ATOM   175  N NE  B ARG A 1 53  ? 16.093  -21.255 0.359   0.50 34.57 ? 261 ARG A NE  1 
ATOM   176  C CZ  A ARG A 1 53  ? 15.110  -22.006 -0.444  0.50 24.10 ? 261 ARG A CZ  1 
ATOM   177  C CZ  B ARG A 1 53  ? 14.880  -21.506 -0.119  0.50 37.07 ? 261 ARG A CZ  1 
ATOM   178  N NH1 A ARG A 1 53  ? 15.056  -22.079 0.884   0.50 22.70 ? 261 ARG A NH1 1 
ATOM   179  N NH1 B ARG A 1 53  ? 14.719  -21.979 -1.342  0.50 36.25 ? 261 ARG A NH1 1 
ATOM   180  N NH2 A ARG A 1 53  ? 14.012  -22.199 -1.165  0.50 22.54 ? 261 ARG A NH2 1 
ATOM   181  N NH2 B ARG A 1 53  ? 13.819  -21.302 0.648   0.50 40.64 ? 261 ARG A NH2 1 
ATOM   182  N N   . ASP A 1 54  ? 17.980  -20.586 -4.199  1.00 27.03 ? 262 ASP A N   1 
ATOM   183  C CA  . ASP A 1 54  ? 18.013  -21.804 -5.038  1.00 27.34 ? 262 ASP A CA  1 
ATOM   184  C C   . ASP A 1 54  ? 19.153  -21.743 -6.039  1.00 27.66 ? 262 ASP A C   1 
ATOM   185  O O   . ASP A 1 54  ? 19.893  -22.704 -6.204  1.00 29.42 ? 262 ASP A O   1 
ATOM   186  C CB  . ASP A 1 54  ? 16.695  -21.986 -5.796  1.00 27.40 ? 262 ASP A CB  1 
ATOM   187  C CG  . ASP A 1 54  ? 15.516  -22.320 -4.873  1.00 29.72 ? 262 ASP A CG  1 
ATOM   188  O OD1 . ASP A 1 54  ? 15.714  -22.555 -3.676  1.00 29.00 ? 262 ASP A OD1 1 
ATOM   189  O OD2 . ASP A 1 54  ? 14.376  -22.285 -5.330  1.00 30.39 ? 262 ASP A OD2 1 
ATOM   190  N N   . PHE A 1 55  ? 19.298  -20.612 -6.719  1.00 27.21 ? 263 PHE A N   1 
ATOM   191  C CA  . PHE A 1 55  ? 20.408  -20.435 -7.641  1.00 24.12 ? 263 PHE A CA  1 
ATOM   192  C C   . PHE A 1 55  ? 21.742  -20.750 -6.953  1.00 26.35 ? 263 PHE A C   1 
ATOM   193  O O   . PHE A 1 55  ? 22.560  -21.537 -7.456  1.00 26.98 ? 263 PHE A O   1 
ATOM   194  C CB  . PHE A 1 55  ? 20.443  -19.024 -8.242  1.00 23.86 ? 263 PHE A CB  1 
ATOM   195  C CG  . PHE A 1 55  ? 21.811  -18.640 -8.758  1.00 23.92 ? 263 PHE A CG  1 
ATOM   196  C CD1 . PHE A 1 55  ? 22.412  -19.375 -9.765  1.00 23.89 ? 263 PHE A CD1 1 
ATOM   197  C CD2 . PHE A 1 55  ? 22.515  -17.599 -8.198  1.00 24.18 ? 263 PHE A CD2 1 
ATOM   198  C CE1 . PHE A 1 55  ? 23.679  -19.051 -10.227 1.00 23.96 ? 263 PHE A CE1 1 
ATOM   199  C CE2 . PHE A 1 55  ? 23.780  -17.269 -8.648  1.00 23.66 ? 263 PHE A CE2 1 
ATOM   200  C CZ  . PHE A 1 55  ? 24.369  -18.010 -9.656  1.00 23.90 ? 263 PHE A CZ  1 
ATOM   201  N N   . ILE A 1 56  ? 21.964  -20.149 -5.792  1.00 26.23 ? 264 ILE A N   1 
ATOM   202  C CA  . ILE A 1 56  ? 23.253  -20.247 -5.141  1.00 25.70 ? 264 ILE A CA  1 
ATOM   203  C C   . ILE A 1 56  ? 23.476  -21.658 -4.549  1.00 27.14 ? 264 ILE A C   1 
ATOM   204  O O   . ILE A 1 56  ? 24.560  -22.247 -4.741  1.00 29.20 ? 264 ILE A O   1 
ATOM   205  C CB  . ILE A 1 56  ? 23.420  -19.183 -4.057  1.00 24.81 ? 264 ILE A CB  1 
ATOM   206  C CG1 . ILE A 1 56  ? 23.448  -17.778 -4.663  1.00 27.10 ? 264 ILE A CG1 1 
ATOM   207  C CG2 . ILE A 1 56  ? 24.711  -19.416 -3.292  1.00 26.30 ? 264 ILE A CG2 1 
ATOM   208  C CD1 . ILE A 1 56  ? 23.204  -16.650 -3.678  1.00 26.55 ? 264 ILE A CD1 1 
ATOM   209  N N   . TYR A 1 57  ? 22.473  -22.178 -3.855  1.00 25.38 ? 265 TYR A N   1 
ATOM   210  C CA  . TYR A 1 57  ? 22.591  -23.460 -3.160  1.00 27.36 ? 265 TYR A CA  1 
ATOM   211  C C   . TYR A 1 57  ? 22.630  -24.628 -4.158  1.00 28.43 ? 265 TYR A C   1 
ATOM   212  O O   . TYR A 1 57  ? 23.301  -25.594 -3.901  1.00 27.52 ? 265 TYR A O   1 
ATOM   213  C CB  . TYR A 1 57  ? 21.433  -23.658 -2.170  1.00 28.30 ? 265 TYR A CB  1 
ATOM   214  C CG  . TYR A 1 57  ? 21.575  -22.925 -0.854  1.00 30.79 ? 265 TYR A CG  1 
ATOM   215  C CD1 . TYR A 1 57  ? 22.599  -21.987 -0.654  1.00 30.74 ? 265 TYR A CD1 1 
ATOM   216  C CD2 . TYR A 1 57  ? 20.678  -23.140 0.187   1.00 32.48 ? 265 TYR A CD2 1 
ATOM   217  C CE1 . TYR A 1 57  ? 22.723  -21.318 0.531   1.00 31.19 ? 265 TYR A CE1 1 
ATOM   218  C CE2 . TYR A 1 57  ? 20.809  -22.465 1.395   1.00 30.68 ? 265 TYR A CE2 1 
ATOM   219  C CZ  . TYR A 1 57  ? 21.832  -21.548 1.542   1.00 30.13 ? 265 TYR A CZ  1 
ATOM   220  O OH  . TYR A 1 57  ? 22.037  -20.877 2.723   1.00 30.23 ? 265 TYR A OH  1 
ATOM   221  N N   . GLN A 1 58  ? 21.919  -24.527 -5.277  1.00 27.26 ? 266 GLN A N   1 
ATOM   222  C CA  . GLN A 1 58  ? 21.872  -25.596 -6.260  1.00 27.67 ? 266 GLN A CA  1 
ATOM   223  C C   . GLN A 1 58  ? 22.942  -25.510 -7.340  1.00 27.67 ? 266 GLN A C   1 
ATOM   224  O O   . GLN A 1 58  ? 23.000  -26.381 -8.196  1.00 31.13 ? 266 GLN A O   1 
ATOM   225  C CB  . GLN A 1 58  ? 20.496  -25.621 -6.916  1.00 30.09 ? 266 GLN A CB  1 
ATOM   226  C CG  . GLN A 1 58  ? 19.381  -25.906 -5.921  1.00 32.79 ? 266 GLN A CG  1 
ATOM   227  C CD  . GLN A 1 58  ? 18.025  -25.803 -6.560  1.00 37.22 ? 266 GLN A CD  1 
ATOM   228  O OE1 . GLN A 1 58  ? 17.885  -25.877 -7.783  1.00 43.60 ? 266 GLN A OE1 1 
ATOM   229  N NE2 . GLN A 1 58  ? 17.004  -25.630 -5.737  1.00 38.56 ? 266 GLN A NE2 1 
ATOM   230  N N   . ASN A 1 59  ? 23.778  -24.469 -7.306  1.00 27.20 ? 267 ASN A N   1 
ATOM   231  C CA  . ASN A 1 59  ? 24.957  -24.375 -8.151  1.00 26.41 ? 267 ASN A CA  1 
ATOM   232  C C   . ASN A 1 59  ? 26.205  -24.010 -7.334  1.00 26.59 ? 267 ASN A C   1 
ATOM   233  O O   . ASN A 1 59  ? 26.904  -23.030 -7.651  1.00 26.50 ? 267 ASN A O   1 
ATOM   234  C CB  . ASN A 1 59  ? 24.719  -23.372 -9.279  1.00 25.46 ? 267 ASN A CB  1 
ATOM   235  C CG  . ASN A 1 59  ? 23.543  -23.764 -10.155 1.00 27.01 ? 267 ASN A CG  1 
ATOM   236  O OD1 . ASN A 1 59  ? 23.681  -24.545 -11.101 1.00 27.79 ? 267 ASN A OD1 1 
ATOM   237  N ND2 . ASN A 1 59  ? 22.370  -23.235 -9.839  1.00 26.40 ? 267 ASN A ND2 1 
ATOM   238  N N   . PRO A 1 60  ? 26.511  -24.809 -6.284  1.00 25.02 ? 268 PRO A N   1 
ATOM   239  C CA  . PRO A 1 60  ? 27.655  -24.493 -5.422  1.00 26.62 ? 268 PRO A CA  1 
ATOM   240  C C   . PRO A 1 60  ? 29.011  -24.438 -6.124  1.00 27.04 ? 268 PRO A C   1 
ATOM   241  O O   . PRO A 1 60  ? 29.959  -23.782 -5.629  1.00 27.70 ? 268 PRO A O   1 
ATOM   242  C CB  . PRO A 1 60  ? 27.634  -25.636 -4.374  1.00 28.05 ? 268 PRO A CB  1 
ATOM   243  C CG  . PRO A 1 60  ? 26.937  -26.790 -5.053  1.00 26.91 ? 268 PRO A CG  1 
ATOM   244  C CD  . PRO A 1 60  ? 25.912  -26.118 -5.963  1.00 27.38 ? 268 PRO A CD  1 
ATOM   245  N N   . HIS A 1 61  ? 29.134  -25.131 -7.252  1.00 27.49 ? 269 HIS A N   1 
ATOM   246  C CA  . HIS A 1 61  ? 30.385  -25.098 -8.038  1.00 28.45 ? 269 HIS A CA  1 
ATOM   247  C C   . HIS A 1 61  ? 30.689  -23.675 -8.500  1.00 28.98 ? 269 HIS A C   1 
ATOM   248  O O   . HIS A 1 61  ? 31.838  -23.313 -8.720  1.00 28.68 ? 269 HIS A O   1 
ATOM   249  C CB  . HIS A 1 61  ? 30.285  -26.036 -9.236  1.00 29.14 ? 269 HIS A CB  1 
ATOM   250  C CG  . HIS A 1 61  ? 29.191  -25.649 -10.196 1.00 27.97 ? 269 HIS A CG  1 
ATOM   251  N ND1 . HIS A 1 61  ? 27.854  -25.847 -9.925  1.00 28.37 ? 269 HIS A ND1 1 
ATOM   252  C CD2 . HIS A 1 61  ? 29.243  -25.033 -11.403 1.00 26.54 ? 269 HIS A CD2 1 
ATOM   253  C CE1 . HIS A 1 61  ? 27.131  -25.387 -10.930 1.00 28.16 ? 269 HIS A CE1 1 
ATOM   254  N NE2 . HIS A 1 61  ? 27.952  -24.887 -11.841 1.00 26.84 ? 269 HIS A NE2 1 
ATOM   255  N N   . ILE A 1 62  ? 29.663  -22.842 -8.642  1.00 28.43 ? 270 ILE A N   1 
ATOM   256  C CA  . ILE A 1 62  ? 29.898  -21.437 -8.996  1.00 28.14 ? 270 ILE A CA  1 
ATOM   257  C C   . ILE A 1 62  ? 30.582  -20.652 -7.847  1.00 28.59 ? 270 ILE A C   1 
ATOM   258  O O   . ILE A 1 62  ? 31.360  -19.711 -8.087  1.00 27.97 ? 270 ILE A O   1 
ATOM   259  C CB  . ILE A 1 62  ? 28.579  -20.780 -9.476  1.00 27.14 ? 270 ILE A CB  1 
ATOM   260  C CG1 . ILE A 1 62  ? 28.155  -21.431 -10.799 1.00 26.38 ? 270 ILE A CG1 1 
ATOM   261  C CG2 . ILE A 1 62  ? 28.739  -19.283 -9.597  1.00 28.62 ? 270 ILE A CG2 1 
ATOM   262  C CD1 . ILE A 1 62  ? 26.779  -21.071 -11.286 1.00 26.97 ? 270 ILE A CD1 1 
ATOM   263  N N   . PHE A 1 63  ? 30.338  -21.069 -6.616  1.00 27.77 ? 271 PHE A N   1 
ATOM   264  C CA  . PHE A 1 63  ? 30.829  -20.363 -5.432  1.00 29.18 ? 271 PHE A CA  1 
ATOM   265  C C   . PHE A 1 63  ? 32.015  -20.988 -4.699  1.00 30.87 ? 271 PHE A C   1 
ATOM   266  O O   . PHE A 1 63  ? 32.731  -20.294 -3.985  1.00 31.51 ? 271 PHE A O   1 
ATOM   267  C CB  . PHE A 1 63  ? 29.658  -20.156 -4.478  1.00 27.96 ? 271 PHE A CB  1 
ATOM   268  C CG  . PHE A 1 63  ? 28.607  -19.292 -5.086  1.00 28.47 ? 271 PHE A CG  1 
ATOM   269  C CD1 . PHE A 1 63  ? 27.609  -19.842 -5.867  1.00 26.42 ? 271 PHE A CD1 1 
ATOM   270  C CD2 . PHE A 1 63  ? 28.723  -17.916 -5.017  1.00 28.53 ? 271 PHE A CD2 1 
ATOM   271  C CE1 . PHE A 1 63  ? 26.699  -19.022 -6.517  1.00 27.87 ? 271 PHE A CE1 1 
ATOM   272  C CE2 . PHE A 1 63  ? 27.805  -17.088 -5.657  1.00 26.42 ? 271 PHE A CE2 1 
ATOM   273  C CZ  . PHE A 1 63  ? 26.800  -17.645 -6.414  1.00 26.37 ? 271 PHE A CZ  1 
ATOM   274  N N   . LYS A 1 64  ? 32.209  -22.284 -4.879  1.00 31.47 ? 272 LYS A N   1 
ATOM   275  C CA  . LYS A 1 64  ? 33.137  -23.057 -4.065  1.00 34.45 ? 272 LYS A CA  1 
ATOM   276  C C   . LYS A 1 64  ? 34.539  -22.512 -4.200  1.00 32.46 ? 272 LYS A C   1 
ATOM   277  O O   . LYS A 1 64  ? 35.071  -22.496 -5.290  1.00 32.78 ? 272 LYS A O   1 
ATOM   278  C CB  . LYS A 1 64  ? 33.113  -24.528 -4.504  1.00 39.79 ? 272 LYS A CB  1 
ATOM   279  C CG  . LYS A 1 64  ? 33.940  -25.438 -3.599  1.00 46.56 ? 272 LYS A CG  1 
ATOM   280  C CD  . LYS A 1 64  ? 33.937  -26.880 -4.094  1.00 50.90 ? 272 LYS A CD  1 
ATOM   281  C CE  . LYS A 1 64  ? 35.100  -27.679 -3.491  1.00 54.52 ? 272 LYS A CE  1 
ATOM   282  N NZ  . LYS A 1 64  ? 35.537  -28.776 -4.406  1.00 53.35 ? 272 LYS A NZ  1 
ATOM   283  N N   . ASP A 1 65  ? 35.128  -22.065 -3.087  1.00 31.87 ? 273 ASP A N   1 
ATOM   284  C CA  . ASP A 1 65  ? 36.477  -21.495 -3.071  1.00 33.38 ? 273 ASP A CA  1 
ATOM   285  C C   . ASP A 1 65  ? 36.637  -20.240 -3.919  1.00 33.58 ? 273 ASP A C   1 
ATOM   286  O O   . ASP A 1 65  ? 37.757  -19.857 -4.242  1.00 33.67 ? 273 ASP A O   1 
ATOM   287  C CB  . ASP A 1 65  ? 37.529  -22.531 -3.489  1.00 36.40 ? 273 ASP A CB  1 
ATOM   288  C CG  . ASP A 1 65  ? 37.557  -23.719 -2.561  1.00 35.85 ? 273 ASP A CG  1 
ATOM   289  O OD1 . ASP A 1 65  ? 37.460  -23.516 -1.338  1.00 38.45 ? 273 ASP A OD1 1 
ATOM   290  O OD2 . ASP A 1 65  ? 37.638  -24.854 -3.042  1.00 40.71 ? 273 ASP A OD2 1 
ATOM   291  N N   . LYS A 1 66  ? 35.539  -19.561 -4.237  1.00 31.93 ? 274 LYS A N   1 
ATOM   292  C CA  . LYS A 1 66  ? 35.637  -18.347 -5.047  1.00 31.34 ? 274 LYS A CA  1 
ATOM   293  C C   . LYS A 1 66  ? 35.602  -17.098 -4.182  1.00 30.35 ? 274 LYS A C   1 
ATOM   294  O O   . LYS A 1 66  ? 35.197  -17.146 -3.018  1.00 30.08 ? 274 LYS A O   1 
ATOM   295  C CB  . LYS A 1 66  ? 34.501  -18.290 -6.068  1.00 33.21 ? 274 LYS A CB  1 
ATOM   296  C CG  . LYS A 1 66  ? 34.425  -19.495 -6.964  1.00 34.16 ? 274 LYS A CG  1 
ATOM   297  C CD  . LYS A 1 66  ? 35.736  -19.762 -7.686  1.00 37.43 ? 274 LYS A CD  1 
ATOM   298  C CE  . LYS A 1 66  ? 35.578  -20.883 -8.707  1.00 38.65 ? 274 LYS A CE  1 
ATOM   299  N NZ  . LYS A 1 66  ? 36.600  -20.733 -9.764  1.00 40.32 ? 274 LYS A NZ  1 
ATOM   300  N N   . VAL A 1 67  ? 36.046  -15.988 -4.763  1.00 30.13 ? 275 VAL A N   1 
ATOM   301  C CA  . VAL A 1 67  ? 35.875  -14.665 -4.154  1.00 30.80 ? 275 VAL A CA  1 
ATOM   302  C C   . VAL A 1 67  ? 34.649  -14.000 -4.778  1.00 29.27 ? 275 VAL A C   1 
ATOM   303  O O   . VAL A 1 67  ? 34.586  -13.806 -5.989  1.00 28.24 ? 275 VAL A O   1 
ATOM   304  C CB  . VAL A 1 67  ? 37.115  -13.784 -4.381  1.00 30.73 ? 275 VAL A CB  1 
ATOM   305  C CG1 . VAL A 1 67  ? 36.918  -12.393 -3.792  1.00 31.64 ? 275 VAL A CG1 1 
ATOM   306  C CG2 . VAL A 1 67  ? 38.369  -14.478 -3.831  1.00 33.65 ? 275 VAL A CG2 1 
ATOM   307  N N   . VAL A 1 68  ? 33.679  -13.656 -3.932  1.00 30.46 ? 276 VAL A N   1 
ATOM   308  C CA  . VAL A 1 68  ? 32.383  -13.127 -4.342  1.00 29.00 ? 276 VAL A CA  1 
ATOM   309  C C   . VAL A 1 68  ? 32.198  -11.667 -3.868  1.00 29.68 ? 276 VAL A C   1 
ATOM   310  O O   . VAL A 1 68  ? 32.553  -11.349 -2.738  1.00 29.25 ? 276 VAL A O   1 
ATOM   311  C CB  . VAL A 1 68  ? 31.255  -13.993 -3.747  1.00 29.47 ? 276 VAL A CB  1 
ATOM   312  C CG1 . VAL A 1 68  ? 29.878  -13.514 -4.220  1.00 28.56 ? 276 VAL A CG1 1 
ATOM   313  C CG2 . VAL A 1 68  ? 31.466  -15.457 -4.103  1.00 29.41 ? 276 VAL A CG2 1 
ATOM   314  N N   . LEU A 1 69  ? 31.653  -10.812 -4.745  1.00 29.19 ? 277 LEU A N   1 
ATOM   315  C CA  . LEU A 1 69  ? 31.230  -9.439  -4.423  1.00 28.64 ? 277 LEU A CA  1 
ATOM   316  C C   . LEU A 1 69  ? 29.704  -9.327  -4.447  1.00 28.47 ? 277 LEU A C   1 
ATOM   317  O O   . LEU A 1 69  ? 29.075  -9.644  -5.459  1.00 29.68 ? 277 LEU A O   1 
ATOM   318  C CB  . LEU A 1 69  ? 31.808  -8.449  -5.424  1.00 28.28 ? 277 LEU A CB  1 
ATOM   319  C CG  . LEU A 1 69  ? 31.393  -6.985  -5.281  1.00 29.09 ? 277 LEU A CG  1 
ATOM   320  C CD1 . LEU A 1 69  ? 31.819  -6.408  -3.942  1.00 29.82 ? 277 LEU A CD1 1 
ATOM   321  C CD2 . LEU A 1 69  ? 31.971  -6.144  -6.401  1.00 31.13 ? 277 LEU A CD2 1 
ATOM   322  N N   . ASP A 1 70  ? 29.133  -8.886  -3.335  1.00 28.51 ? 278 ASP A N   1 
ATOM   323  C CA  . ASP A 1 70  ? 27.694  -8.699  -3.178  1.00 28.69 ? 278 ASP A CA  1 
ATOM   324  C C   . ASP A 1 70  ? 27.415  -7.191  -3.188  1.00 29.16 ? 278 ASP A C   1 
ATOM   325  O O   . ASP A 1 70  ? 27.614  -6.491  -2.174  1.00 28.77 ? 278 ASP A O   1 
ATOM   326  C CB  . ASP A 1 70  ? 27.238  -9.335  -1.876  1.00 29.06 ? 278 ASP A CB  1 
ATOM   327  C CG  . ASP A 1 70  ? 25.737  -9.187  -1.607  1.00 28.61 ? 278 ASP A CG  1 
ATOM   328  O OD1 . ASP A 1 70  ? 24.976  -8.608  -2.426  1.00 28.75 ? 278 ASP A OD1 1 
ATOM   329  O OD2 . ASP A 1 70  ? 25.326  -9.695  -0.533  1.00 30.08 ? 278 ASP A OD2 1 
ATOM   330  N N   . VAL A 1 71  ? 26.960  -6.705  -4.339  1.00 28.62 ? 279 VAL A N   1 
ATOM   331  C CA  . VAL A 1 71  ? 26.756  -5.279  -4.558  1.00 31.68 ? 279 VAL A CA  1 
ATOM   332  C C   . VAL A 1 71  ? 25.370  -4.875  -4.075  1.00 32.13 ? 279 VAL A C   1 
ATOM   333  O O   . VAL A 1 71  ? 24.351  -5.359  -4.602  1.00 31.74 ? 279 VAL A O   1 
ATOM   334  C CB  . VAL A 1 71  ? 26.874  -4.928  -6.056  1.00 31.78 ? 279 VAL A CB  1 
ATOM   335  C CG1 . VAL A 1 71  ? 26.603  -3.444  -6.285  1.00 33.29 ? 279 VAL A CG1 1 
ATOM   336  C CG2 . VAL A 1 71  ? 28.238  -5.335  -6.577  1.00 30.09 ? 279 VAL A CG2 1 
ATOM   337  N N   . GLY A 1 72  ? 25.347  -3.987  -3.085  1.00 31.15 ? 280 GLY A N   1 
ATOM   338  C CA  . GLY A 1 72  ? 24.114  -3.552  -2.451  1.00 31.63 ? 280 GLY A CA  1 
ATOM   339  C C   . GLY A 1 72  ? 23.612  -4.656  -1.563  1.00 32.19 ? 280 GLY A C   1 
ATOM   340  O O   . GLY A 1 72  ? 22.520  -5.157  -1.773  1.00 32.02 ? 280 GLY A O   1 
ATOM   341  N N   . CYS A 1 73  ? 24.414  -5.050  -0.578  1.00 32.37 ? 281 CYS A N   1 
ATOM   342  C CA  . CYS A 1 73  ? 24.169  -6.316  0.144   1.00 30.63 ? 281 CYS A CA  1 
ATOM   343  C C   . CYS A 1 73  ? 23.030  -6.266  1.129   1.00 30.21 ? 281 CYS A C   1 
ATOM   344  O O   . CYS A 1 73  ? 22.544  -7.317  1.583   1.00 30.66 ? 281 CYS A O   1 
ATOM   345  C CB  . CYS A 1 73  ? 25.433  -6.787  0.868   1.00 31.22 ? 281 CYS A CB  1 
ATOM   346  S SG  . CYS A 1 73  ? 26.059  -5.608  2.091   1.00 33.93 ? 281 CYS A SG  1 
ATOM   347  N N   . GLY A 1 74  ? 22.596  -5.071  1.510   1.00 32.57 ? 282 GLY A N   1 
ATOM   348  C CA  . GLY A 1 74  ? 21.483  -4.952  2.465   1.00 28.97 ? 282 GLY A CA  1 
ATOM   349  C C   . GLY A 1 74  ? 21.843  -5.630  3.793   1.00 29.78 ? 282 GLY A C   1 
ATOM   350  O O   . GLY A 1 74  ? 22.920  -5.397  4.370   1.00 30.26 ? 282 GLY A O   1 
ATOM   351  N N   . THR A 1 75  ? 20.946  -6.477  4.266   1.00 27.59 ? 283 THR A N   1 
ATOM   352  C CA  . THR A 1 75  ? 21.156  -7.241  5.476   1.00 30.08 ? 283 THR A CA  1 
ATOM   353  C C   . THR A 1 75  ? 22.234  -8.335  5.347   1.00 29.66 ? 283 THR A C   1 
ATOM   354  O O   . THR A 1 75  ? 22.585  -8.974  6.348   1.00 29.22 ? 283 THR A O   1 
ATOM   355  C CB  . THR A 1 75  ? 19.864  -7.946  5.904   1.00 32.58 ? 283 THR A CB  1 
ATOM   356  O OG1 . THR A 1 75  ? 19.482  -8.885  4.893   1.00 35.13 ? 283 THR A OG1 1 
ATOM   357  C CG2 . THR A 1 75  ? 18.741  -6.947  6.131   1.00 35.01 ? 283 THR A CG2 1 
ATOM   358  N N   . GLY A 1 76  ? 22.745  -8.557  4.128   1.00 28.93 ? 284 GLY A N   1 
ATOM   359  C CA  . GLY A 1 76  ? 23.828  -9.514  3.897   1.00 28.18 ? 284 GLY A CA  1 
ATOM   360  C C   . GLY A 1 76  ? 23.366  -10.919 3.575   1.00 27.83 ? 284 GLY A C   1 
ATOM   361  O O   . GLY A 1 76  ? 24.196  -11.851 3.529   1.00 27.26 ? 284 GLY A O   1 
ATOM   362  N N   . ILE A 1 77  ? 22.063  -11.092 3.340   1.00 26.79 ? 285 ILE A N   1 
ATOM   363  C CA  . ILE A 1 77  ? 21.500  -12.430 3.155   1.00 28.08 ? 285 ILE A CA  1 
ATOM   364  C C   . ILE A 1 77  ? 22.142  -13.176 1.973   1.00 27.38 ? 285 ILE A C   1 
ATOM   365  O O   . ILE A 1 77  ? 22.458  -14.349 2.083   1.00 26.22 ? 285 ILE A O   1 
ATOM   366  C CB  . ILE A 1 77  ? 19.963  -12.410 3.021   1.00 29.96 ? 285 ILE A CB  1 
ATOM   367  C CG1 . ILE A 1 77  ? 19.383  -13.831 3.021   1.00 32.63 ? 285 ILE A CG1 1 
ATOM   368  C CG2 . ILE A 1 77  ? 19.524  -11.704 1.753   1.00 30.23 ? 285 ILE A CG2 1 
ATOM   369  C CD1 . ILE A 1 77  ? 19.691  -14.642 4.254   1.00 34.76 ? 285 ILE A CD1 1 
ATOM   370  N N   . LEU A 1 78  ? 22.374  -12.492 0.861   1.00 25.84 ? 286 LEU A N   1 
ATOM   371  C CA  . LEU A 1 78  ? 22.967  -13.128 -0.300  1.00 26.18 ? 286 LEU A CA  1 
ATOM   372  C C   . LEU A 1 78  ? 24.425  -13.523 -0.045  1.00 28.59 ? 286 LEU A C   1 
ATOM   373  O O   . LEU A 1 78  ? 24.903  -14.565 -0.518  1.00 24.87 ? 286 LEU A O   1 
ATOM   374  C CB  . LEU A 1 78  ? 22.884  -12.197 -1.505  1.00 28.39 ? 286 LEU A CB  1 
ATOM   375  C CG  . LEU A 1 78  ? 21.481  -11.784 -1.983  1.00 27.67 ? 286 LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 78  ? 21.619  -10.944 -3.236  1.00 28.85 ? 286 LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 78  ? 20.613  -13.006 -2.290  1.00 28.76 ? 286 LEU A CD2 1 
ATOM   378  N N   . SER A 1 79  ? 25.130  -12.683 0.711   1.00 27.78 ? 287 SER A N   1 
ATOM   379  C CA  . SER A 1 79  ? 26.486  -12.991 1.102   1.00 26.85 ? 287 SER A CA  1 
ATOM   380  C C   . SER A 1 79  ? 26.552  -14.228 1.990   1.00 26.62 ? 287 SER A C   1 
ATOM   381  O O   . SER A 1 79  ? 27.471  -15.028 1.869   1.00 30.11 ? 287 SER A O   1 
ATOM   382  C CB  . SER A 1 79  ? 27.120  -11.777 1.798   1.00 28.38 ? 287 SER A CB  1 
ATOM   383  O OG  . SER A 1 79  ? 27.314  -10.716 0.850   1.00 27.49 ? 287 SER A OG  1 
ATOM   384  N N   . MET A 1 80  ? 25.593  -14.384 2.886   1.00 25.62 ? 288 MET A N   1 
ATOM   385  C CA  . MET A 1 80  ? 25.537  -15.557 3.720   1.00 26.58 ? 288 MET A CA  1 
ATOM   386  C C   . MET A 1 80  ? 25.194  -16.811 2.898   1.00 27.61 ? 288 MET A C   1 
ATOM   387  O O   . MET A 1 80  ? 25.779  -17.871 3.135   1.00 26.36 ? 288 MET A O   1 
ATOM   388  C CB  . MET A 1 80  ? 24.554  -15.358 4.886   1.00 26.70 ? 288 MET A CB  1 
ATOM   389  C CG  . MET A 1 80  ? 25.002  -14.280 5.856   1.00 27.42 ? 288 MET A CG  1 
ATOM   390  S SD  . MET A 1 80  ? 24.163  -14.266 7.445   1.00 28.28 ? 288 MET A SD  1 
ATOM   391  C CE  . MET A 1 80  ? 22.522  -13.724 6.949   1.00 29.25 ? 288 MET A CE  1 
ATOM   392  N N   . PHE A 1 81  ? 24.285  -16.706 1.931   1.00 24.97 ? 289 PHE A N   1 
ATOM   393  C CA  . PHE A 1 81  ? 24.052  -17.848 1.023   1.00 26.64 ? 289 PHE A CA  1 
ATOM   394  C C   . PHE A 1 81  ? 25.360  -18.285 0.331   1.00 27.50 ? 289 PHE A C   1 
ATOM   395  O O   . PHE A 1 81  ? 25.711  -19.496 0.260   1.00 25.45 ? 289 PHE A O   1 
ATOM   396  C CB  . PHE A 1 81  ? 23.048  -17.506 -0.073  1.00 25.82 ? 289 PHE A CB  1 
ATOM   397  C CG  . PHE A 1 81  ? 21.628  -17.279 0.379   1.00 23.95 ? 289 PHE A CG  1 
ATOM   398  C CD1 . PHE A 1 81  ? 21.093  -17.903 1.493   1.00 26.30 ? 289 PHE A CD1 1 
ATOM   399  C CD2 . PHE A 1 81  ? 20.797  -16.463 -0.384  1.00 24.47 ? 289 PHE A CD2 1 
ATOM   400  C CE1 . PHE A 1 81  ? 19.763  -17.719 1.853   1.00 26.16 ? 289 PHE A CE1 1 
ATOM   401  C CE2 . PHE A 1 81  ? 19.469  -16.267 -0.025  1.00 26.27 ? 289 PHE A CE2 1 
ATOM   402  C CZ  . PHE A 1 81  ? 18.950  -16.902 1.086   1.00 26.89 ? 289 PHE A CZ  1 
ATOM   403  N N   . ALA A 1 82  ? 26.067  -17.302 -0.202  1.00 25.54 ? 290 ALA A N   1 
ATOM   404  C CA  . ALA A 1 82  ? 27.298  -17.555 -0.911  1.00 26.70 ? 290 ALA A CA  1 
ATOM   405  C C   . ALA A 1 82  ? 28.360  -18.216 -0.004  1.00 27.92 ? 290 ALA A C   1 
ATOM   406  O O   . ALA A 1 82  ? 29.037  -19.122 -0.436  1.00 25.23 ? 290 ALA A O   1 
ATOM   407  C CB  . ALA A 1 82  ? 27.829  -16.256 -1.489  1.00 27.80 ? 290 ALA A CB  1 
ATOM   408  N N   . ALA A 1 83  ? 28.502  -17.746 1.234   1.00 28.36 ? 291 ALA A N   1 
ATOM   409  C CA  . ALA A 1 83  ? 29.384  -18.392 2.206   1.00 30.17 ? 291 ALA A CA  1 
ATOM   410  C C   . ALA A 1 83  ? 28.980  -19.835 2.458   1.00 32.01 ? 291 ALA A C   1 
ATOM   411  O O   . ALA A 1 83  ? 29.814  -20.743 2.440   1.00 32.31 ? 291 ALA A O   1 
ATOM   412  C CB  . ALA A 1 83  ? 29.394  -17.620 3.506   1.00 31.17 ? 291 ALA A CB  1 
ATOM   413  N N   . LYS A 1 84  ? 27.693  -20.064 2.653   1.00 31.43 ? 292 LYS A N   1 
ATOM   414  C CA  . LYS A 1 84  ? 27.187  -21.401 2.909   1.00 33.86 ? 292 LYS A CA  1 
ATOM   415  C C   . LYS A 1 84  ? 27.458  -22.311 1.711   1.00 31.77 ? 292 LYS A C   1 
ATOM   416  O O   . LYS A 1 84  ? 27.705  -23.499 1.877   1.00 27.97 ? 292 LYS A O   1 
ATOM   417  C CB  . LYS A 1 84  ? 25.695  -21.351 3.226   1.00 36.97 ? 292 LYS A CB  1 
ATOM   418  C CG  . LYS A 1 84  ? 25.025  -22.679 3.553   1.00 40.34 ? 292 LYS A CG  1 
ATOM   419  C CD  . LYS A 1 84  ? 25.411  -23.192 4.927   1.00 47.02 ? 292 LYS A CD  1 
ATOM   420  N N   . ALA A 1 85  ? 27.442  -21.751 0.510   1.00 28.35 ? 293 ALA A N   1 
ATOM   421  C CA  . ALA A 1 85  ? 27.676  -22.544 -0.677  1.00 30.33 ? 293 ALA A CA  1 
ATOM   422  C C   . ALA A 1 85  ? 29.186  -22.775 -0.940  1.00 29.30 ? 293 ALA A C   1 
ATOM   423  O O   . ALA A 1 85  ? 29.536  -23.342 -1.937  1.00 28.65 ? 293 ALA A O   1 
ATOM   424  C CB  . ALA A 1 85  ? 27.010  -21.887 -1.880  1.00 30.78 ? 293 ALA A CB  1 
ATOM   425  N N   . GLY A 1 86  ? 30.051  -22.252 -0.078  1.00 31.52 ? 294 GLY A N   1 
ATOM   426  C CA  . GLY A 1 86  ? 31.477  -22.588 -0.063  1.00 32.95 ? 294 GLY A CA  1 
ATOM   427  C C   . GLY A 1 86  ? 32.383  -21.470 -0.541  1.00 32.07 ? 294 GLY A C   1 
ATOM   428  O O   . GLY A 1 86  ? 33.531  -21.709 -0.877  1.00 28.47 ? 294 GLY A O   1 
ATOM   429  N N   . ALA A 1 87  ? 31.885  -20.232 -0.584  1.00 31.06 ? 295 ALA A N   1 
ATOM   430  C CA  . ALA A 1 87  ? 32.738  -19.137 -1.021  1.00 30.72 ? 295 ALA A CA  1 
ATOM   431  C C   . ALA A 1 87  ? 33.974  -19.056 -0.120  1.00 32.05 ? 295 ALA A C   1 
ATOM   432  O O   . ALA A 1 87  ? 33.880  -19.279 1.075   1.00 32.12 ? 295 ALA A O   1 
ATOM   433  C CB  . ALA A 1 87  ? 31.991  -17.820 -1.017  1.00 30.96 ? 295 ALA A CB  1 
ATOM   434  N N   . LYS A 1 88  ? 35.120  -18.734 -0.694  1.00 32.37 ? 296 LYS A N   1 
ATOM   435  C CA  . LYS A 1 88  ? 36.318  -18.589 0.109   1.00 35.48 ? 296 LYS A CA  1 
ATOM   436  C C   . LYS A 1 88  ? 36.254  -17.248 0.840   1.00 32.54 ? 296 LYS A C   1 
ATOM   437  O O   . LYS A 1 88  ? 36.560  -17.180 2.009   1.00 29.24 ? 296 LYS A O   1 
ATOM   438  C CB  . LYS A 1 88  ? 37.559  -18.669 -0.751  1.00 39.28 ? 296 LYS A CB  1 
ATOM   439  C CG  . LYS A 1 88  ? 38.850  -18.643 0.058   1.00 46.72 ? 296 LYS A CG  1 
ATOM   440  C CD  . LYS A 1 88  ? 40.040  -18.829 -0.865  1.00 54.31 ? 296 LYS A CD  1 
ATOM   441  C CE  . LYS A 1 88  ? 40.317  -17.559 -1.651  1.00 58.16 ? 296 LYS A CE  1 
ATOM   442  N NZ  . LYS A 1 88  ? 40.782  -17.886 -3.026  1.00 63.45 ? 296 LYS A NZ  1 
ATOM   443  N N   . LYS A 1 89  ? 35.806  -16.210 0.143   1.00 32.52 ? 297 LYS A N   1 
ATOM   444  C CA  . LYS A 1 89  ? 35.662  -14.875 0.716   1.00 31.67 ? 297 LYS A CA  1 
ATOM   445  C C   . LYS A 1 89  ? 34.462  -14.199 0.068   1.00 31.07 ? 297 LYS A C   1 
ATOM   446  O O   . LYS A 1 89  ? 34.251  -14.329 -1.150  1.00 31.16 ? 297 LYS A O   1 
ATOM   447  C CB  . LYS A 1 89  ? 36.954  -14.105 0.420   1.00 35.03 ? 297 LYS A CB  1 
ATOM   448  C CG  . LYS A 1 89  ? 36.975  -12.613 0.707   1.00 41.82 ? 297 LYS A CG  1 
ATOM   449  C CD  . LYS A 1 89  ? 37.808  -12.223 1.934   1.00 48.36 ? 297 LYS A CD  1 
ATOM   450  C CE  . LYS A 1 89  ? 37.047  -12.348 3.250   1.00 51.72 ? 297 LYS A CE  1 
ATOM   451  N NZ  . LYS A 1 89  ? 37.429  -13.561 4.038   1.00 52.87 ? 297 LYS A NZ  1 
ATOM   452  N N   . VAL A 1 90  ? 33.686  -13.462 0.855   1.00 29.45 ? 298 VAL A N   1 
ATOM   453  C CA  . VAL A 1 90  ? 32.611  -12.651 0.310   1.00 30.47 ? 298 VAL A CA  1 
ATOM   454  C C   . VAL A 1 90  ? 32.757  -11.217 0.760   1.00 30.64 ? 298 VAL A C   1 
ATOM   455  O O   . VAL A 1 90  ? 32.876  -10.954 1.946   1.00 29.90 ? 298 VAL A O   1 
ATOM   456  C CB  . VAL A 1 90  ? 31.198  -13.160 0.716   1.00 28.80 ? 298 VAL A CB  1 
ATOM   457  C CG1 . VAL A 1 90  ? 30.146  -12.407 -0.063  1.00 29.65 ? 298 VAL A CG1 1 
ATOM   458  C CG2 . VAL A 1 90  ? 31.063  -14.661 0.478   1.00 27.20 ? 298 VAL A CG2 1 
ATOM   459  N N   . LEU A 1 91  ? 32.693  -10.302 -0.199  1.00 29.09 ? 299 LEU A N   1 
ATOM   460  C CA  . LEU A 1 91  ? 32.692  -8.879  0.080   1.00 30.76 ? 299 LEU A CA  1 
ATOM   461  C C   . LEU A 1 91  ? 31.291  -8.279  -0.154  1.00 32.36 ? 299 LEU A C   1 
ATOM   462  O O   . LEU A 1 91  ? 30.781  -8.286  -1.287  1.00 32.74 ? 299 LEU A O   1 
ATOM   463  C CB  . LEU A 1 91  ? 33.738  -8.205  -0.788  1.00 32.11 ? 299 LEU A CB  1 
ATOM   464  C CG  . LEU A 1 91  ? 35.152  -8.788  -0.555  1.00 36.87 ? 299 LEU A CG  1 
ATOM   465  C CD1 . LEU A 1 91  ? 36.084  -8.503  -1.722  1.00 39.41 ? 299 LEU A CD1 1 
ATOM   466  C CD2 . LEU A 1 91  ? 35.758  -8.279  0.744   1.00 36.55 ? 299 LEU A CD2 1 
ATOM   467  N N   . GLY A 1 92  ? 30.669  -7.792  0.920   1.00 29.56 ? 300 GLY A N   1 
ATOM   468  C CA  . GLY A 1 92  ? 29.350  -7.185  0.865   1.00 33.54 ? 300 GLY A CA  1 
ATOM   469  C C   . GLY A 1 92  ? 29.426  -5.679  1.000   1.00 34.40 ? 300 GLY A C   1 
ATOM   470  O O   . GLY A 1 92  ? 29.968  -5.173  1.983   1.00 36.20 ? 300 GLY A O   1 
ATOM   471  N N   . VAL A 1 93  ? 28.919  -4.966  -0.001  1.00 34.29 ? 301 VAL A N   1 
ATOM   472  C CA  . VAL A 1 93  ? 29.008  -3.518  -0.022  1.00 36.09 ? 301 VAL A CA  1 
ATOM   473  C C   . VAL A 1 93  ? 27.615  -2.893  -0.017  1.00 35.60 ? 301 VAL A C   1 
ATOM   474  O O   . VAL A 1 93  ? 26.711  -3.335  -0.734  1.00 35.74 ? 301 VAL A O   1 
ATOM   475  C CB  . VAL A 1 93  ? 29.830  -3.016  -1.229  1.00 38.05 ? 301 VAL A CB  1 
ATOM   476  C CG1 . VAL A 1 93  ? 29.874  -1.491  -1.258  1.00 38.78 ? 301 VAL A CG1 1 
ATOM   477  C CG2 . VAL A 1 93  ? 31.247  -3.558  -1.167  1.00 39.93 ? 301 VAL A CG2 1 
ATOM   478  N N   . ASP A 1 94  ? 27.432  -1.883  0.815   1.00 36.95 ? 302 ASP A N   1 
ATOM   479  C CA  . ASP A 1 94  ? 26.188  -1.140  0.808   1.00 42.41 ? 302 ASP A CA  1 
ATOM   480  C C   . ASP A 1 94  ? 26.442  0.253   1.376   1.00 45.51 ? 302 ASP A C   1 
ATOM   481  O O   . ASP A 1 94  ? 27.180  0.408   2.340   1.00 39.78 ? 302 ASP A O   1 
ATOM   482  C CB  . ASP A 1 94  ? 25.116  -1.880  1.616   1.00 41.55 ? 302 ASP A CB  1 
ATOM   483  C CG  . ASP A 1 94  ? 23.692  -1.463  1.234   1.00 43.46 ? 302 ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 94  ? 23.359  -0.262  1.363   1.00 42.62 ? 302 ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 94  ? 22.905  -2.339  0.824   1.00 39.40 ? 302 ASP A OD2 1 
ATOM   486  N N   . GLN A 1 95  ? 25.830  1.262   0.772   1.00 48.19 ? 303 GLN A N   1 
ATOM   487  C CA  . GLN A 1 95  ? 26.046  2.645   1.216   1.00 50.99 ? 303 GLN A CA  1 
ATOM   488  C C   . GLN A 1 95  ? 25.163  2.985   2.392   1.00 47.88 ? 303 GLN A C   1 
ATOM   489  O O   . GLN A 1 95  ? 25.492  3.848   3.189   1.00 51.06 ? 303 GLN A O   1 
ATOM   490  C CB  . GLN A 1 95  ? 25.802  3.629   0.077   1.00 55.17 ? 303 GLN A CB  1 
ATOM   491  C CG  . GLN A 1 95  ? 24.359  3.736   -0.378  1.00 60.67 ? 303 GLN A CG  1 
ATOM   492  C CD  . GLN A 1 95  ? 24.272  4.374   -1.744  1.00 67.38 ? 303 GLN A CD  1 
ATOM   493  O OE1 . GLN A 1 95  ? 23.808  3.761   -2.709  1.00 69.90 ? 303 GLN A OE1 1 
ATOM   494  N NE2 . GLN A 1 95  ? 24.770  5.599   -1.846  1.00 68.72 ? 303 GLN A NE2 1 
ATOM   495  N N   . SER A 1 96  ? 24.049  2.280   2.502   1.00 46.41 ? 304 SER A N   1 
ATOM   496  C CA  . SER A 1 96  ? 23.045  2.525   3.530   1.00 46.22 ? 304 SER A CA  1 
ATOM   497  C C   . SER A 1 96  ? 23.462  2.084   4.951   1.00 47.93 ? 304 SER A C   1 
ATOM   498  O O   . SER A 1 96  ? 24.381  1.281   5.143   1.00 46.08 ? 304 SER A O   1 
ATOM   499  C CB  . SER A 1 96  ? 21.720  1.859   3.087   1.00 49.38 ? 304 SER A CB  1 
ATOM   500  O OG  . SER A 1 96  ? 20.923  1.411   4.166   1.00 53.71 ? 304 SER A OG  1 
ATOM   501  N N   . GLU A 1 97  ? 22.746  2.629   5.930   1.00 45.77 ? 305 GLU A N   1 
ATOM   502  C CA  . GLU A 1 97  ? 22.887  2.317   7.355   1.00 48.42 ? 305 GLU A CA  1 
ATOM   503  C C   . GLU A 1 97  ? 22.629  0.849   7.683   1.00 43.40 ? 305 GLU A C   1 
ATOM   504  O O   . GLU A 1 97  ? 23.061  0.342   8.732   1.00 41.09 ? 305 GLU A O   1 
ATOM   505  C CB  . GLU A 1 97  ? 21.870  3.137   8.165   1.00 53.17 ? 305 GLU A CB  1 
ATOM   506  C CG  . GLU A 1 97  ? 22.078  4.642   8.105   1.00 62.56 ? 305 GLU A CG  1 
ATOM   507  C CD  . GLU A 1 97  ? 23.187  5.095   9.031   1.00 68.99 ? 305 GLU A CD  1 
ATOM   508  O OE1 . GLU A 1 97  ? 24.230  5.567   8.530   1.00 76.20 ? 305 GLU A OE1 1 
ATOM   509  O OE2 . GLU A 1 97  ? 23.016  4.954   10.264  1.00 74.54 ? 305 GLU A OE2 1 
ATOM   510  N N   . ILE A 1 98  ? 21.855  0.193   6.824   1.00 39.44 ? 306 ILE A N   1 
ATOM   511  C CA  . ILE A 1 98  ? 21.579  -1.234  6.955   1.00 37.04 ? 306 ILE A CA  1 
ATOM   512  C C   . ILE A 1 98  ? 22.876  -2.031  7.123   1.00 34.30 ? 306 ILE A C   1 
ATOM   513  O O   . ILE A 1 98  ? 22.876  -3.077  7.769   1.00 32.87 ? 306 ILE A O   1 
ATOM   514  C CB  . ILE A 1 98  ? 20.748  -1.754  5.747   1.00 37.11 ? 306 ILE A CB  1 
ATOM   515  C CG1 . ILE A 1 98  ? 20.069  -3.077  6.085   1.00 38.30 ? 306 ILE A CG1 1 
ATOM   516  C CG2 . ILE A 1 98  ? 21.602  -1.856  4.485   1.00 36.47 ? 306 ILE A CG2 1 
ATOM   517  C CD1 . ILE A 1 98  ? 19.114  -2.985  7.260   1.00 38.48 ? 306 ILE A CD1 1 
ATOM   518  N N   . LEU A 1 99  ? 23.987  -1.528  6.582   1.00 35.85 ? 307 LEU A N   1 
ATOM   519  C CA  . LEU A 1 99  ? 25.257  -2.264  6.645   1.00 36.87 ? 307 LEU A CA  1 
ATOM   520  C C   . LEU A 1 99  ? 25.707  -2.577  8.077   1.00 39.02 ? 307 LEU A C   1 
ATOM   521  O O   . LEU A 1 99  ? 26.309  -3.624  8.339   1.00 37.45 ? 307 LEU A O   1 
ATOM   522  C CB  . LEU A 1 99  ? 26.352  -1.540  5.873   1.00 39.67 ? 307 LEU A CB  1 
ATOM   523  C CG  . LEU A 1 99  ? 27.518  -2.508  5.667   1.00 44.49 ? 307 LEU A CG  1 
ATOM   524  C CD1 . LEU A 1 99  ? 27.355  -3.369  4.426   1.00 43.51 ? 307 LEU A CD1 1 
ATOM   525  C CD2 . LEU A 1 99  ? 28.805  -1.759  5.634   1.00 46.48 ? 307 LEU A CD2 1 
ATOM   526  N N   . TYR A 1 100 ? 25.388  -1.692  9.015   1.00 39.75 ? 308 TYR A N   1 
ATOM   527  C CA  . TYR A 1 100 ? 25.727  -1.924  10.414  1.00 39.34 ? 308 TYR A CA  1 
ATOM   528  C C   . TYR A 1 100 ? 24.917  -3.061  10.969  1.00 35.32 ? 308 TYR A C   1 
ATOM   529  O O   . TYR A 1 100 ? 25.422  -3.834  11.750  1.00 32.07 ? 308 TYR A O   1 
ATOM   530  C CB  . TYR A 1 100 ? 25.505  -0.666  11.260  1.00 43.69 ? 308 TYR A CB  1 
ATOM   531  C CG  . TYR A 1 100 ? 26.346  0.511   10.794  1.00 49.14 ? 308 TYR A CG  1 
ATOM   532  C CD1 . TYR A 1 100 ? 27.730  0.399   10.680  1.00 51.13 ? 308 TYR A CD1 1 
ATOM   533  C CD2 . TYR A 1 100 ? 25.755  1.732   10.466  1.00 54.17 ? 308 TYR A CD2 1 
ATOM   534  C CE1 . TYR A 1 100 ? 28.495  1.472   10.247  1.00 57.16 ? 308 TYR A CE1 1 
ATOM   535  C CE2 . TYR A 1 100 ? 26.517  2.810   10.043  1.00 56.33 ? 308 TYR A CE2 1 
ATOM   536  C CZ  . TYR A 1 100 ? 27.880  2.670   9.936   1.00 55.55 ? 308 TYR A CZ  1 
ATOM   537  O OH  . TYR A 1 100 ? 28.633  3.724   9.519   1.00 62.84 ? 308 TYR A OH  1 
ATOM   538  N N   . GLN A 1 101 ? 23.659  -3.177  10.573  1.00 35.56 ? 309 GLN A N   1 
ATOM   539  C CA  . GLN A 1 101 ? 22.904  -4.385  10.922  1.00 38.24 ? 309 GLN A CA  1 
ATOM   540  C C   . GLN A 1 101 ? 23.563  -5.655  10.330  1.00 33.67 ? 309 GLN A C   1 
ATOM   541  O O   . GLN A 1 101 ? 23.753  -6.648  11.026  1.00 31.98 ? 309 GLN A O   1 
ATOM   542  C CB  . GLN A 1 101 ? 21.433  -4.276  10.487  1.00 40.64 ? 309 GLN A CB  1 
ATOM   543  C CG  . GLN A 1 101 ? 20.563  -3.501  11.475  1.00 45.61 ? 309 GLN A CG  1 
ATOM   544  C CD  . GLN A 1 101 ? 20.239  -4.285  12.751  1.00 49.86 ? 309 GLN A CD  1 
ATOM   545  O OE1 . GLN A 1 101 ? 20.474  -5.486  12.858  1.00 55.07 ? 309 GLN A OE1 1 
ATOM   546  N NE2 . GLN A 1 101 ? 19.678  -3.595  13.723  1.00 54.35 ? 309 GLN A NE2 1 
ATOM   547  N N   . ALA A 1 102 ? 23.915  -5.590  9.058   1.00 31.57 ? 310 ALA A N   1 
ATOM   548  C CA  . ALA A 1 102 ? 24.556  -6.714  8.354   1.00 32.11 ? 310 ALA A CA  1 
ATOM   549  C C   . ALA A 1 102 ? 25.794  -7.179  9.091   1.00 33.24 ? 310 ALA A C   1 
ATOM   550  O O   . ALA A 1 102 ? 26.031  -8.373  9.208   1.00 33.91 ? 310 ALA A O   1 
ATOM   551  C CB  . ALA A 1 102 ? 24.923  -6.314  6.941   1.00 30.41 ? 310 ALA A CB  1 
ATOM   552  N N   . MET A 1 103 ? 26.568  -6.231  9.611   1.00 33.70 ? 311 MET A N   1 
ATOM   553  C CA  . MET A 1 103 ? 27.769  -6.562  10.395  1.00 34.47 ? 311 MET A CA  1 
ATOM   554  C C   . MET A 1 103 ? 27.444  -7.386  11.613  1.00 32.64 ? 311 MET A C   1 
ATOM   555  O O   . MET A 1 103 ? 28.132  -8.367  11.887  1.00 31.95 ? 311 MET A O   1 
ATOM   556  C CB  . MET A 1 103 ? 28.501  -5.291  10.825  1.00 36.93 ? 311 MET A CB  1 
ATOM   557  C CG  . MET A 1 103 ? 29.188  -4.604  9.657   1.00 38.61 ? 311 MET A CG  1 
ATOM   558  S SD  . MET A 1 103 ? 29.817  -2.974  10.101  1.00 45.92 ? 311 MET A SD  1 
ATOM   559  C CE  . MET A 1 103 ? 31.211  -2.863  8.975   1.00 45.76 ? 311 MET A CE  1 
ATOM   560  N N   . ASP A 1 104 ? 26.410  -6.986  12.351  1.00 31.40 ? 312 ASP A N   1 
ATOM   561  C CA  . ASP A 1 104 ? 25.981  -7.744  13.509  1.00 33.45 ? 312 ASP A CA  1 
ATOM   562  C C   . ASP A 1 104 ? 25.377  -9.086  13.077  1.00 32.62 ? 312 ASP A C   1 
ATOM   563  O O   . ASP A 1 104 ? 25.585  -10.110 13.742  1.00 29.40 ? 312 ASP A O   1 
ATOM   564  C CB  . ASP A 1 104 ? 24.956  -6.960  14.346  1.00 39.24 ? 312 ASP A CB  1 
ATOM   565  C CG  . ASP A 1 104 ? 25.575  -5.753  15.062  1.00 43.66 ? 312 ASP A CG  1 
ATOM   566  O OD1 . ASP A 1 104 ? 26.804  -5.726  15.278  1.00 42.54 ? 312 ASP A OD1 1 
ATOM   567  O OD2 . ASP A 1 104 ? 24.825  -4.832  15.413  1.00 47.92 ? 312 ASP A OD2 1 
ATOM   568  N N   . ILE A 1 105 ? 24.635  -9.080  11.966  1.00 29.17 ? 313 ILE A N   1 
ATOM   569  C CA  . ILE A 1 105 ? 24.051  -10.316 11.461  1.00 29.50 ? 313 ILE A CA  1 
ATOM   570  C C   . ILE A 1 105 ? 25.138  -11.334 11.086  1.00 29.20 ? 313 ILE A C   1 
ATOM   571  O O   . ILE A 1 105 ? 25.030  -12.497 11.424  1.00 31.15 ? 313 ILE A O   1 
ATOM   572  C CB  . ILE A 1 105 ? 23.123  -10.047 10.266  1.00 28.93 ? 313 ILE A CB  1 
ATOM   573  C CG1 . ILE A 1 105 ? 21.848  -9.352  10.777  1.00 28.17 ? 313 ILE A CG1 1 
ATOM   574  C CG2 . ILE A 1 105 ? 22.778  -11.349 9.548   1.00 28.48 ? 313 ILE A CG2 1 
ATOM   575  C CD1 . ILE A 1 105 ? 20.952  -8.821  9.666   1.00 28.05 ? 313 ILE A CD1 1 
ATOM   576  N N   . ILE A 1 106 ? 26.175  -10.885 10.392  1.00 30.61 ? 314 ILE A N   1 
ATOM   577  C CA  . ILE A 1 106 ? 27.301  -11.750 10.032  1.00 32.24 ? 314 ILE A CA  1 
ATOM   578  C C   . ILE A 1 106 ? 27.958  -12.366 11.295  1.00 34.64 ? 314 ILE A C   1 
ATOM   579  O O   . ILE A 1 106 ? 28.203  -13.566 11.331  1.00 32.47 ? 314 ILE A O   1 
ATOM   580  C CB  . ILE A 1 106 ? 28.293  -11.013 9.090   1.00 32.96 ? 314 ILE A CB  1 
ATOM   581  C CG1 . ILE A 1 106 ? 27.907  -11.262 7.628   1.00 32.55 ? 314 ILE A CG1 1 
ATOM   582  C CG2 . ILE A 1 106 ? 29.730  -11.491 9.242   1.00 35.60 ? 314 ILE A CG2 1 
ATOM   583  C CD1 . ILE A 1 106 ? 26.511  -10.811 7.276   1.00 34.08 ? 314 ILE A CD1 1 
ATOM   584  N N   . ARG A 1 107 ? 28.167  -11.561 12.337  1.00 36.17 ? 315 ARG A N   1 
ATOM   585  C CA  . ARG A 1 107 ? 28.725  -12.060 13.602  1.00 35.58 ? 315 ARG A CA  1 
ATOM   586  C C   . ARG A 1 107 ? 27.823  -13.053 14.290  1.00 33.85 ? 315 ARG A C   1 
ATOM   587  O O   . ARG A 1 107 ? 28.304  -14.073 14.783  1.00 33.69 ? 315 ARG A O   1 
ATOM   588  C CB  . ARG A 1 107 ? 29.024  -10.918 14.570  1.00 39.20 ? 315 ARG A CB  1 
ATOM   589  C CG  . ARG A 1 107 ? 30.236  -10.100 14.182  1.00 44.27 ? 315 ARG A CG  1 
ATOM   590  C CD  . ARG A 1 107 ? 30.707  -9.198  15.318  1.00 49.55 ? 315 ARG A CD  1 
ATOM   591  N NE  . ARG A 1 107 ? 31.001  -7.879  14.767  1.00 60.34 ? 315 ARG A NE  1 
ATOM   592  C CZ  . ARG A 1 107 ? 30.143  -6.852  14.720  1.00 65.76 ? 315 ARG A CZ  1 
ATOM   593  N NH1 . ARG A 1 107 ? 28.922  -6.950  15.237  1.00 67.59 ? 315 ARG A NH1 1 
ATOM   594  N NH2 . ARG A 1 107 ? 30.516  -5.700  14.170  1.00 67.80 ? 315 ARG A NH2 1 
ATOM   595  N N   . LEU A 1 108 ? 26.519  -12.782 14.332  1.00 32.92 ? 316 LEU A N   1 
ATOM   596  C CA  . LEU A 1 108 ? 25.573  -13.710 14.945  1.00 31.61 ? 316 LEU A CA  1 
ATOM   597  C C   . LEU A 1 108 ? 25.643  -15.085 14.308  1.00 31.45 ? 316 LEU A C   1 
ATOM   598  O O   . LEU A 1 108 ? 25.388  -16.091 14.979  1.00 34.31 ? 316 LEU A O   1 
ATOM   599  C CB  . LEU A 1 108 ? 24.121  -13.223 14.827  1.00 33.47 ? 316 LEU A CB  1 
ATOM   600  C CG  . LEU A 1 108 ? 23.514  -12.292 15.875  1.00 37.41 ? 316 LEU A CG  1 
ATOM   601  C CD1 . LEU A 1 108 ? 22.097  -11.946 15.457  1.00 38.91 ? 316 LEU A CD1 1 
ATOM   602  C CD2 . LEU A 1 108 ? 23.497  -12.913 17.271  1.00 37.76 ? 316 LEU A CD2 1 
ATOM   603  N N   . ASN A 1 109 ? 25.915  -15.126 13.001  1.00 29.54 ? 317 ASN A N   1 
ATOM   604  C CA  . ASN A 1 109 ? 26.053  -16.393 12.290  1.00 30.62 ? 317 ASN A CA  1 
ATOM   605  C C   . ASN A 1 109 ? 27.498  -16.918 12.171  1.00 29.71 ? 317 ASN A C   1 
ATOM   606  O O   . ASN A 1 109 ? 27.733  -17.893 11.466  1.00 28.91 ? 317 ASN A O   1 
ATOM   607  C CB  . ASN A 1 109 ? 25.411  -16.268 10.918  1.00 29.28 ? 317 ASN A CB  1 
ATOM   608  C CG  . ASN A 1 109 ? 23.931  -16.040 11.019  1.00 28.07 ? 317 ASN A CG  1 
ATOM   609  O OD1 . ASN A 1 109 ? 23.171  -16.976 11.270  1.00 28.88 ? 317 ASN A OD1 1 
ATOM   610  N ND2 . ASN A 1 109 ? 23.512  -14.795 10.860  1.00 27.89 ? 317 ASN A ND2 1 
ATOM   611  N N   . LYS A 1 110 ? 28.443  -16.258 12.844  1.00 31.08 ? 318 LYS A N   1 
ATOM   612  C CA  . LYS A 1 110 ? 29.844  -16.704 12.936  1.00 32.08 ? 318 LYS A CA  1 
ATOM   613  C C   . LYS A 1 110 ? 30.474  -16.843 11.564  1.00 32.97 ? 318 LYS A C   1 
ATOM   614  O O   . LYS A 1 110 ? 31.177  -17.818 11.263  1.00 31.10 ? 318 LYS A O   1 
ATOM   615  C CB  . LYS A 1 110 ? 29.963  -18.000 13.737  1.00 32.18 ? 318 LYS A CB  1 
ATOM   616  C CG  . LYS A 1 110 ? 29.369  -17.861 15.144  1.00 34.07 ? 318 LYS A CG  1 
ATOM   617  C CD  . LYS A 1 110 ? 29.508  -19.142 15.946  1.00 39.09 ? 318 LYS A CD  1 
ATOM   618  C CE  . LYS A 1 110 ? 28.613  -19.149 17.183  1.00 42.62 ? 318 LYS A CE  1 
ATOM   619  N NZ  . LYS A 1 110 ? 28.943  -18.004 18.075  1.00 43.86 ? 318 LYS A NZ  1 
ATOM   620  N N   . LEU A 1 111 ? 30.223  -15.828 10.745  1.00 31.11 ? 319 LEU A N   1 
ATOM   621  C CA  . LEU A 1 111 ? 30.699  -15.817 9.369   1.00 29.73 ? 319 LEU A CA  1 
ATOM   622  C C   . LEU A 1 111 ? 31.704  -14.724 9.122   1.00 28.76 ? 319 LEU A C   1 
ATOM   623  O O   . LEU A 1 111 ? 32.072  -14.456 7.983   1.00 27.48 ? 319 LEU A O   1 
ATOM   624  C CB  . LEU A 1 111 ? 29.501  -15.674 8.432   1.00 28.37 ? 319 LEU A CB  1 
ATOM   625  C CG  . LEU A 1 111 ? 28.630  -16.933 8.318   1.00 28.79 ? 319 LEU A CG  1 
ATOM   626  C CD1 . LEU A 1 111 ? 27.302  -16.605 7.603   1.00 28.60 ? 319 LEU A CD1 1 
ATOM   627  C CD2 . LEU A 1 111 ? 29.345  -18.080 7.613   1.00 28.01 ? 319 LEU A CD2 1 
ATOM   628  N N   . GLU A 1 112 ? 32.169  -14.081 10.181  1.00 30.81 ? 320 GLU A N   1 
ATOM   629  C CA  . GLU A 1 112 ? 33.071  -12.954 9.989   1.00 34.64 ? 320 GLU A CA  1 
ATOM   630  C C   . GLU A 1 112 ? 34.436  -13.409 9.418   1.00 33.74 ? 320 GLU A C   1 
ATOM   631  O O   . GLU A 1 112 ? 35.112  -12.626 8.809   1.00 36.84 ? 320 GLU A O   1 
ATOM   632  C CB  . GLU A 1 112 ? 33.203  -12.117 11.276  1.00 39.79 ? 320 GLU A CB  1 
ATOM   633  C CG  . GLU A 1 112 ? 33.807  -12.827 12.500  1.00 41.91 ? 320 GLU A CG  1 
ATOM   634  C CD  . GLU A 1 112 ? 32.803  -13.621 13.339  1.00 43.64 ? 320 GLU A CD  1 
ATOM   635  O OE1 . GLU A 1 112 ? 31.755  -14.050 12.837  1.00 41.24 ? 320 GLU A OE1 1 
ATOM   636  O OE2 . GLU A 1 112 ? 33.077  -13.846 14.530  1.00 47.51 ? 320 GLU A OE2 1 
ATOM   637  N N   . ASP A 1 113 ? 34.802  -14.683 9.564   1.00 35.52 ? 321 ASP A N   1 
ATOM   638  C CA  . ASP A 1 113 ? 36.022  -15.210 8.932   1.00 35.35 ? 321 ASP A CA  1 
ATOM   639  C C   . ASP A 1 113 ? 35.892  -15.374 7.415   1.00 34.80 ? 321 ASP A C   1 
ATOM   640  O O   . ASP A 1 113 ? 36.895  -15.566 6.739   1.00 34.38 ? 321 ASP A O   1 
ATOM   641  C CB  . ASP A 1 113 ? 36.463  -16.532 9.583   1.00 37.59 ? 321 ASP A CB  1 
ATOM   642  C CG  . ASP A 1 113 ? 35.516  -17.743 9.264   1.00 43.19 ? 321 ASP A CG  1 
ATOM   643  O OD1 . ASP A 1 113 ? 34.478  -17.629 8.547   1.00 42.71 ? 321 ASP A OD1 1 
ATOM   644  O OD2 . ASP A 1 113 ? 35.816  -18.842 9.774   1.00 43.95 ? 321 ASP A OD2 1 
ATOM   645  N N   . THR A 1 114 ? 34.669  -15.281 6.883   1.00 33.31 ? 322 THR A N   1 
ATOM   646  C CA  . THR A 1 114 ? 34.411  -15.424 5.441   1.00 31.44 ? 322 THR A CA  1 
ATOM   647  C C   . THR A 1 114 ? 33.828  -14.166 4.782   1.00 31.82 ? 322 THR A C   1 
ATOM   648  O O   . THR A 1 114 ? 34.111  -13.892 3.611   1.00 29.93 ? 322 THR A O   1 
ATOM   649  C CB  . THR A 1 114 ? 33.418  -16.570 5.184   1.00 30.74 ? 322 THR A CB  1 
ATOM   650  O OG1 . THR A 1 114 ? 33.884  -17.739 5.825   1.00 30.47 ? 322 THR A OG1 1 
ATOM   651  C CG2 . THR A 1 114 ? 33.255  -16.880 3.720   1.00 32.01 ? 322 THR A CG2 1 
ATOM   652  N N   . ILE A 1 115 ? 32.990  -13.426 5.505   1.00 28.56 ? 323 ILE A N   1 
ATOM   653  C CA  . ILE A 1 115 ? 32.314  -12.274 4.916   1.00 31.03 ? 323 ILE A CA  1 
ATOM   654  C C   . ILE A 1 115 ? 32.814  -10.993 5.542   1.00 29.68 ? 323 ILE A C   1 
ATOM   655  O O   . ILE A 1 115 ? 32.779  -10.855 6.756   1.00 30.01 ? 323 ILE A O   1 
ATOM   656  C CB  . ILE A 1 115 ? 30.781  -12.352 5.133   1.00 31.20 ? 323 ILE A CB  1 
ATOM   657  C CG1 . ILE A 1 115 ? 30.249  -13.671 4.590   1.00 31.32 ? 323 ILE A CG1 1 
ATOM   658  C CG2 . ILE A 1 115 ? 30.083  -11.156 4.472   1.00 30.98 ? 323 ILE A CG2 1 
ATOM   659  C CD1 . ILE A 1 115 ? 28.793  -13.942 4.905   1.00 31.95 ? 323 ILE A CD1 1 
ATOM   660  N N   . THR A 1 116 ? 33.263  -10.073 4.702   1.00 30.97 ? 324 THR A N   1 
ATOM   661  C CA  . THR A 1 116 ? 33.693  -8.732  5.095   1.00 33.04 ? 324 THR A CA  1 
ATOM   662  C C   . THR A 1 116 ? 32.703  -7.732  4.539   1.00 33.51 ? 324 THR A C   1 
ATOM   663  O O   . THR A 1 116 ? 32.426  -7.742  3.346   1.00 34.78 ? 324 THR A O   1 
ATOM   664  C CB  . THR A 1 116 ? 35.061  -8.449  4.480   1.00 35.43 ? 324 THR A CB  1 
ATOM   665  O OG1 . THR A 1 116 ? 35.999  -9.368  5.046   1.00 35.18 ? 324 THR A OG1 1 
ATOM   666  C CG2 . THR A 1 116 ? 35.522  -6.984  4.716   1.00 37.25 ? 324 THR A CG2 1 
ATOM   667  N N   . LEU A 1 117 ? 32.161  -6.873  5.396   1.00 34.99 ? 325 LEU A N   1 
ATOM   668  C CA  . LEU A 1 117 ? 31.230  -5.834  4.967   1.00 35.57 ? 325 LEU A CA  1 
ATOM   669  C C   . LEU A 1 117 ? 31.914  -4.473  4.881   1.00 38.59 ? 325 LEU A C   1 
ATOM   670  O O   . LEU A 1 117 ? 32.739  -4.119  5.722   1.00 36.62 ? 325 LEU A O   1 
ATOM   671  C CB  . LEU A 1 117 ? 30.044  -5.778  5.918   1.00 37.93 ? 325 LEU A CB  1 
ATOM   672  C CG  . LEU A 1 117 ? 29.405  -7.161  5.992   1.00 40.17 ? 325 LEU A CG  1 
ATOM   673  C CD1 . LEU A 1 117 ? 28.732  -7.385  7.315   1.00 43.98 ? 325 LEU A CD1 1 
ATOM   674  C CD2 . LEU A 1 117 ? 28.481  -7.409  4.817   1.00 38.13 ? 325 LEU A CD2 1 
ATOM   675  N N   . ILE A 1 118 ? 31.572  -3.720  3.845   1.00 40.54 ? 326 ILE A N   1 
ATOM   676  C CA  . ILE A 1 118 ? 32.207  -2.442  3.577   1.00 41.20 ? 326 ILE A CA  1 
ATOM   677  C C   . ILE A 1 118 ? 31.121  -1.424  3.289   1.00 43.64 ? 326 ILE A C   1 
ATOM   678  O O   . ILE A 1 118 ? 30.259  -1.639  2.428   1.00 39.54 ? 326 ILE A O   1 
ATOM   679  C CB  . ILE A 1 118 ? 33.165  -2.522  2.388   1.00 43.67 ? 326 ILE A CB  1 
ATOM   680  C CG1 . ILE A 1 118 ? 34.185  -3.652  2.594   1.00 44.38 ? 326 ILE A CG1 1 
ATOM   681  C CG2 . ILE A 1 118 ? 33.903  -1.191  2.224   1.00 46.60 ? 326 ILE A CG2 1 
ATOM   682  C CD1 . ILE A 1 118 ? 35.106  -3.868  1.413   1.00 45.73 ? 326 ILE A CD1 1 
ATOM   683  N N   . LYS A 1 119 ? 31.164  -0.310  4.013   1.00 41.75 ? 327 LYS A N   1 
ATOM   684  C CA  . LYS A 1 119 ? 30.143  0.718   3.885   1.00 41.79 ? 327 LYS A CA  1 
ATOM   685  C C   . LYS A 1 119 ? 30.571  1.774   2.891   1.00 42.48 ? 327 LYS A C   1 
ATOM   686  O O   . LYS A 1 119 ? 31.657  2.315   3.001   1.00 46.45 ? 327 LYS A O   1 
ATOM   687  C CB  . LYS A 1 119 ? 29.862  1.381   5.229   1.00 42.98 ? 327 LYS A CB  1 
ATOM   688  C CG  . LYS A 1 119 ? 28.766  2.427   5.123   1.00 45.68 ? 327 LYS A CG  1 
ATOM   689  C CD  . LYS A 1 119 ? 27.993  2.586   6.416   1.00 45.46 ? 327 LYS A CD  1 
ATOM   690  C CE  . LYS A 1 119 ? 26.762  3.447   6.183   1.00 48.49 ? 327 LYS A CE  1 
ATOM   691  N NZ  . LYS A 1 119 ? 27.109  4.759   5.576   1.00 47.87 ? 327 LYS A NZ  1 
ATOM   692  N N   . GLY A 1 120 ? 29.700  2.067   1.935   1.00 41.13 ? 328 GLY A N   1 
ATOM   693  C CA  . GLY A 1 120 ? 29.941  3.098   0.937   1.00 41.27 ? 328 GLY A CA  1 
ATOM   694  C C   . GLY A 1 120 ? 29.399  2.680   -0.408  1.00 44.06 ? 328 GLY A C   1 
ATOM   695  O O   . GLY A 1 120 ? 28.787  1.598   -0.556  1.00 39.14 ? 328 GLY A O   1 
ATOM   696  N N   . LYS A 1 121 ? 29.642  3.535   -1.395  1.00 44.19 ? 329 LYS A N   1 
ATOM   697  C CA  . LYS A 1 121 ? 29.267  3.259   -2.767  1.00 43.74 ? 329 LYS A CA  1 
ATOM   698  C C   . LYS A 1 121 ? 30.374  2.424   -3.384  1.00 45.71 ? 329 LYS A C   1 
ATOM   699  O O   . LYS A 1 121 ? 31.562  2.606   -3.076  1.00 44.63 ? 329 LYS A O   1 
ATOM   700  C CB  . LYS A 1 121 ? 29.086  4.565   -3.558  1.00 47.69 ? 329 LYS A CB  1 
ATOM   701  C CG  . LYS A 1 121 ? 28.077  5.541   -2.959  1.00 48.50 ? 329 LYS A CG  1 
ATOM   702  C CD  . LYS A 1 121 ? 27.821  6.745   -3.863  1.00 51.85 ? 329 LYS A CD  1 
ATOM   703  N N   . ILE A 1 122 ? 29.988  1.506   -4.269  1.00 42.93 ? 330 ILE A N   1 
ATOM   704  C CA  . ILE A 1 122 ? 30.955  0.654   -4.956  1.00 43.47 ? 330 ILE A CA  1 
ATOM   705  C C   . ILE A 1 122 ? 32.002  1.461   -5.760  1.00 43.39 ? 330 ILE A C   1 
ATOM   706  O O   . ILE A 1 122 ? 33.133  1.003   -5.984  1.00 39.90 ? 330 ILE A O   1 
ATOM   707  C CB  . ILE A 1 122 ? 30.228  -0.398  -5.841  1.00 41.99 ? 330 ILE A CB  1 
ATOM   708  C CG1 . ILE A 1 122 ? 31.182  -1.517  -6.258  1.00 41.53 ? 330 ILE A CG1 1 
ATOM   709  C CG2 . ILE A 1 122 ? 29.561  0.238   -7.060  1.00 41.90 ? 330 ILE A CG2 1 
ATOM   710  C CD1 . ILE A 1 122 ? 31.835  -2.243  -5.106  1.00 45.66 ? 330 ILE A CD1 1 
ATOM   711  N N   . GLU A 1 123 ? 31.588  2.649   -6.194  1.00 46.51 ? 331 GLU A N   1 
ATOM   712  C CA  . GLU A 1 123 ? 32.411  3.571   -6.955  1.00 48.76 ? 331 GLU A CA  1 
ATOM   713  C C   . GLU A 1 123 ? 33.462  4.243   -6.072  1.00 49.94 ? 331 GLU A C   1 
ATOM   714  O O   . GLU A 1 123 ? 34.447  4.753   -6.579  1.00 58.10 ? 331 GLU A O   1 
ATOM   715  C CB  . GLU A 1 123 ? 31.535  4.659   -7.617  1.00 49.00 ? 331 GLU A CB  1 
ATOM   716  C CG  . GLU A 1 123 ? 30.513  4.154   -8.633  1.00 52.08 ? 331 GLU A CG  1 
ATOM   717  C CD  . GLU A 1 123 ? 29.186  3.731   -8.015  1.00 52.20 ? 331 GLU A CD  1 
ATOM   718  O OE1 . GLU A 1 123 ? 29.040  3.843   -6.777  1.00 50.28 ? 331 GLU A OE1 1 
ATOM   719  O OE2 . GLU A 1 123 ? 28.294  3.280   -8.769  1.00 47.69 ? 331 GLU A OE2 1 
ATOM   720  N N   . GLU A 1 124 ? 33.256  4.248   -4.760  1.00 51.84 ? 332 GLU A N   1 
ATOM   721  C CA  . GLU A 1 124 ? 34.147  4.958   -3.845  1.00 51.72 ? 332 GLU A CA  1 
ATOM   722  C C   . GLU A 1 124 ? 34.972  4.070   -2.910  1.00 52.64 ? 332 GLU A C   1 
ATOM   723  O O   . GLU A 1 124 ? 36.091  4.439   -2.551  1.00 56.72 ? 332 GLU A O   1 
ATOM   724  C CB  . GLU A 1 124 ? 33.325  5.974   -3.048  1.00 50.92 ? 332 GLU A CB  1 
ATOM   725  C CG  . GLU A 1 124 ? 32.968  7.176   -3.898  1.00 50.82 ? 332 GLU A CG  1 
ATOM   726  C CD  . GLU A 1 124 ? 31.808  7.974   -3.362  1.00 54.99 ? 332 GLU A CD  1 
ATOM   727  O OE1 . GLU A 1 124 ? 31.536  7.917   -2.153  1.00 54.72 ? 332 GLU A OE1 1 
ATOM   728  O OE2 . GLU A 1 124 ? 31.164  8.670   -4.160  1.00 59.04 ? 332 GLU A OE2 1 
ATOM   729  N N   . VAL A 1 125 ? 34.461  2.893   -2.549  1.00 48.96 ? 333 VAL A N   1 
ATOM   730  C CA  . VAL A 1 125 ? 35.119  2.081   -1.517  1.00 45.18 ? 333 VAL A CA  1 
ATOM   731  C C   . VAL A 1 125 ? 36.446  1.467   -1.946  1.00 43.33 ? 333 VAL A C   1 
ATOM   732  O O   . VAL A 1 125 ? 36.754  1.358   -3.126  1.00 43.05 ? 333 VAL A O   1 
ATOM   733  C CB  . VAL A 1 125 ? 34.198  0.974   -0.944  1.00 44.83 ? 333 VAL A CB  1 
ATOM   734  C CG1 . VAL A 1 125 ? 33.031  1.595   -0.217  1.00 47.41 ? 333 VAL A CG1 1 
ATOM   735  C CG2 . VAL A 1 125 ? 33.713  0.029   -2.028  1.00 46.33 ? 333 VAL A CG2 1 
ATOM   736  N N   . HIS A 1 126 ? 37.243  1.101   -0.956  1.00 45.71 ? 334 HIS A N   1 
ATOM   737  C CA  . HIS A 1 126 ? 38.465  0.345   -1.178  1.00 52.26 ? 334 HIS A CA  1 
ATOM   738  C C   . HIS A 1 126 ? 38.178  -1.117  -0.822  1.00 49.22 ? 334 HIS A C   1 
ATOM   739  O O   . HIS A 1 126 ? 37.823  -1.427  0.309   1.00 49.50 ? 334 HIS A O   1 
ATOM   740  C CB  . HIS A 1 126 ? 39.616  0.896   -0.321  1.00 54.36 ? 334 HIS A CB  1 
ATOM   741  C CG  . HIS A 1 126 ? 40.888  0.116   -0.461  1.00 64.98 ? 334 HIS A CG  1 
ATOM   742  N ND1 . HIS A 1 126 ? 41.647  0.130   -1.613  1.00 69.87 ? 334 HIS A ND1 1 
ATOM   743  C CD2 . HIS A 1 126 ? 41.516  -0.731  0.393   1.00 67.52 ? 334 HIS A CD2 1 
ATOM   744  C CE1 . HIS A 1 126 ? 42.691  -0.666  -1.459  1.00 70.62 ? 334 HIS A CE1 1 
ATOM   745  N NE2 . HIS A 1 126 ? 42.637  -1.197  -0.250  1.00 67.47 ? 334 HIS A NE2 1 
ATOM   746  N N   . LEU A 1 127 ? 38.295  -2.005  -1.797  1.00 46.27 ? 335 LEU A N   1 
ATOM   747  C CA  . LEU A 1 127 ? 38.155  -3.423  -1.524  1.00 48.44 ? 335 LEU A CA  1 
ATOM   748  C C   . LEU A 1 127 ? 39.537  -3.949  -1.160  1.00 48.15 ? 335 LEU A C   1 
ATOM   749  O O   . LEU A 1 127 ? 40.534  -3.441  -1.648  1.00 43.10 ? 335 LEU A O   1 
ATOM   750  C CB  . LEU A 1 127 ? 37.627  -4.177  -2.749  1.00 47.37 ? 335 LEU A CB  1 
ATOM   751  C CG  . LEU A 1 127 ? 36.254  -3.772  -3.293  1.00 49.02 ? 335 LEU A CG  1 
ATOM   752  C CD1 . LEU A 1 127 ? 35.873  -4.678  -4.458  1.00 50.27 ? 335 LEU A CD1 1 
ATOM   753  C CD2 . LEU A 1 127 ? 35.184  -3.796  -2.212  1.00 44.42 ? 335 LEU A CD2 1 
ATOM   754  N N   . PRO A 1 128 ? 39.597  -4.984  -0.320  1.00 45.80 ? 336 PRO A N   1 
ATOM   755  C CA  . PRO A 1 128 ? 40.887  -5.581  0.011   1.00 46.02 ? 336 PRO A CA  1 
ATOM   756  C C   . PRO A 1 128 ? 41.349  -6.656  -0.973  1.00 44.06 ? 336 PRO A C   1 
ATOM   757  O O   . PRO A 1 128 ? 42.169  -7.479  -0.612  1.00 48.94 ? 336 PRO A O   1 
ATOM   758  C CB  . PRO A 1 128 ? 40.638  -6.164  1.408   1.00 48.26 ? 336 PRO A CB  1 
ATOM   759  C CG  . PRO A 1 128 ? 39.174  -6.520  1.406   1.00 49.59 ? 336 PRO A CG  1 
ATOM   760  C CD  . PRO A 1 128 ? 38.487  -5.597  0.429   1.00 48.54 ? 336 PRO A CD  1 
ATOM   761  N N   . VAL A 1 129 ? 40.807  -6.670  -2.191  1.00 41.95 ? 337 VAL A N   1 
ATOM   762  C CA  . VAL A 1 129 ? 41.376  -7.424  -3.307  1.00 42.26 ? 337 VAL A CA  1 
ATOM   763  C C   . VAL A 1 129 ? 41.300  -6.581  -4.579  1.00 42.85 ? 337 VAL A C   1 
ATOM   764  O O   . VAL A 1 129 ? 40.599  -5.566  -4.618  1.00 45.68 ? 337 VAL A O   1 
ATOM   765  C CB  . VAL A 1 129 ? 40.657  -8.773  -3.566  1.00 44.49 ? 337 VAL A CB  1 
ATOM   766  C CG1 . VAL A 1 129 ? 40.797  -9.702  -2.375  1.00 46.98 ? 337 VAL A CG1 1 
ATOM   767  C CG2 . VAL A 1 129 ? 39.179  -8.562  -3.914  1.00 48.06 ? 337 VAL A CG2 1 
ATOM   768  N N   . GLU A 1 130 ? 42.012  -7.020  -5.615  1.00 42.20 ? 338 GLU A N   1 
ATOM   769  C CA  . GLU A 1 130 ? 42.001  -6.362  -6.930  1.00 44.24 ? 338 GLU A CA  1 
ATOM   770  C C   . GLU A 1 130 ? 40.831  -6.838  -7.804  1.00 43.97 ? 338 GLU A C   1 
ATOM   771  O O   . GLU A 1 130 ? 40.227  -6.056  -8.527  1.00 42.65 ? 338 GLU A O   1 
ATOM   772  C CB  . GLU A 1 130 ? 43.312  -6.662  -7.672  1.00 43.01 ? 338 GLU A CB  1 
ATOM   773  N N   . LYS A 1 131 ? 40.555  -8.140  -7.756  1.00 42.38 ? 339 LYS A N   1 
ATOM   774  C CA  . LYS A 1 131 ? 39.531  -8.765  -8.592  1.00 41.56 ? 339 LYS A CA  1 
ATOM   775  C C   . LYS A 1 131 ? 38.705  -9.771  -7.784  1.00 39.36 ? 339 LYS A C   1 
ATOM   776  O O   . LYS A 1 131 ? 39.169  -10.305 -6.767  1.00 35.41 ? 339 LYS A O   1 
ATOM   777  C CB  . LYS A 1 131 ? 40.159  -9.494  -9.781  1.00 42.25 ? 339 LYS A CB  1 
ATOM   778  C CG  . LYS A 1 131 ? 41.000  -8.613  -10.701 1.00 43.65 ? 339 LYS A CG  1 
ATOM   779  C CD  . LYS A 1 131 ? 40.182  -7.580  -11.471 1.00 43.04 ? 339 LYS A CD  1 
ATOM   780  C CE  . LYS A 1 131 ? 41.106  -6.695  -12.308 1.00 44.62 ? 339 LYS A CE  1 
ATOM   781  N NZ  . LYS A 1 131 ? 40.348  -5.778  -13.203 1.00 45.35 ? 339 LYS A NZ  1 
ATOM   782  N N   . VAL A 1 132 ? 37.482  -10.012 -8.254  1.00 34.08 ? 340 VAL A N   1 
ATOM   783  C CA  . VAL A 1 132 ? 36.623  -11.031 -7.699  1.00 33.37 ? 340 VAL A CA  1 
ATOM   784  C C   . VAL A 1 132 ? 36.238  -12.023 -8.788  1.00 32.15 ? 340 VAL A C   1 
ATOM   785  O O   . VAL A 1 132 ? 36.329  -11.725 -9.969  1.00 32.62 ? 340 VAL A O   1 
ATOM   786  C CB  . VAL A 1 132 ? 35.352  -10.430 -7.060  1.00 34.05 ? 340 VAL A CB  1 
ATOM   787  C CG1 . VAL A 1 132 ? 35.717  -9.359  -6.050  1.00 34.78 ? 340 VAL A CG1 1 
ATOM   788  C CG2 . VAL A 1 132 ? 34.405  -9.871  -8.131  1.00 35.37 ? 340 VAL A CG2 1 
ATOM   789  N N   . ASP A 1 133 ? 35.813  -13.214 -8.382  1.00 33.00 ? 341 ASP A N   1 
ATOM   790  C CA  . ASP A 1 133 ? 35.430  -14.249 -9.335  1.00 32.76 ? 341 ASP A CA  1 
ATOM   791  C C   . ASP A 1 133 ? 33.964  -14.127 -9.752  1.00 31.10 ? 341 ASP A C   1 
ATOM   792  O O   . ASP A 1 133 ? 33.603  -14.420 -10.895 1.00 32.00 ? 341 ASP A O   1 
ATOM   793  C CB  . ASP A 1 133 ? 35.705  -15.616 -8.736  1.00 33.97 ? 341 ASP A CB  1 
ATOM   794  C CG  . ASP A 1 133 ? 37.179  -15.798 -8.369  1.00 35.05 ? 341 ASP A CG  1 
ATOM   795  O OD1 . ASP A 1 133 ? 38.043  -15.577 -9.243  1.00 36.70 ? 341 ASP A OD1 1 
ATOM   796  O OD2 . ASP A 1 133 ? 37.456  -16.177 -7.214  1.00 33.16 ? 341 ASP A OD2 1 
ATOM   797  N N   . VAL A 1 134 ? 33.126  -13.700 -8.820  1.00 29.20 ? 342 VAL A N   1 
ATOM   798  C CA  . VAL A 1 134 ? 31.678  -13.704 -9.012  1.00 29.67 ? 342 VAL A CA  1 
ATOM   799  C C   . VAL A 1 134 ? 31.094  -12.431 -8.413  1.00 29.72 ? 342 VAL A C   1 
ATOM   800  O O   . VAL A 1 134 ? 31.410  -12.065 -7.269  1.00 27.09 ? 342 VAL A O   1 
ATOM   801  C CB  . VAL A 1 134 ? 31.009  -14.935 -8.354  1.00 32.02 ? 342 VAL A CB  1 
ATOM   802  C CG1 . VAL A 1 134 ? 29.486  -14.896 -8.537  1.00 31.03 ? 342 VAL A CG1 1 
ATOM   803  C CG2 . VAL A 1 134 ? 31.572  -16.257 -8.924  1.00 33.92 ? 342 VAL A CG2 1 
ATOM   804  N N   . ILE A 1 135 ? 30.235  -11.777 -9.188  1.00 30.68 ? 343 ILE A N   1 
ATOM   805  C CA  . ILE A 1 135 ? 29.406  -10.695 -8.682  1.00 29.94 ? 343 ILE A CA  1 
ATOM   806  C C   . ILE A 1 135 ? 27.957  -11.176 -8.573  1.00 29.07 ? 343 ILE A C   1 
ATOM   807  O O   . ILE A 1 135 ? 27.406  -11.781 -9.500  1.00 28.64 ? 343 ILE A O   1 
ATOM   808  C CB  . ILE A 1 135 ? 29.518  -9.425  -9.547  1.00 29.57 ? 343 ILE A CB  1 
ATOM   809  C CG1 . ILE A 1 135 ? 30.928  -8.825  -9.445  1.00 29.41 ? 343 ILE A CG1 1 
ATOM   810  C CG2 . ILE A 1 135 ? 28.508  -8.368  -9.111  1.00 28.30 ? 343 ILE A CG2 1 
ATOM   811  C CD1 . ILE A 1 135 ? 31.243  -7.822  -10.542 1.00 29.75 ? 343 ILE A CD1 1 
ATOM   812  N N   . ILE A 1 136 ? 27.368  -10.961 -7.401  1.00 28.75 ? 344 ILE A N   1 
ATOM   813  C CA  . ILE A 1 136 ? 25.944  -11.164 -7.204  1.00 27.10 ? 344 ILE A CA  1 
ATOM   814  C C   . ILE A 1 136 ? 25.340  -9.879  -6.698  1.00 27.65 ? 344 ILE A C   1 
ATOM   815  O O   . ILE A 1 136 ? 25.958  -9.162  -5.893  1.00 28.62 ? 344 ILE A O   1 
ATOM   816  C CB  . ILE A 1 136 ? 25.612  -12.304 -6.208  1.00 28.28 ? 344 ILE A CB  1 
ATOM   817  C CG1 . ILE A 1 136 ? 26.303  -12.064 -4.856  1.00 28.31 ? 344 ILE A CG1 1 
ATOM   818  C CG2 . ILE A 1 136 ? 26.030  -13.653 -6.786  1.00 30.84 ? 344 ILE A CG2 1 
ATOM   819  C CD1 . ILE A 1 136 ? 25.947  -13.096 -3.822  1.00 31.57 ? 344 ILE A CD1 1 
ATOM   820  N N   . SER A 1 137 ? 24.105  -9.623  -7.121  1.00 26.52 ? 345 SER A N   1 
ATOM   821  C CA  . SER A 1 137 ? 23.404  -8.427  -6.701  1.00 27.12 ? 345 SER A CA  1 
ATOM   822  C C   . SER A 1 137 ? 21.920  -8.610  -6.910  1.00 25.08 ? 345 SER A C   1 
ATOM   823  O O   . SER A 1 137 ? 21.500  -9.179  -7.907  1.00 26.74 ? 345 SER A O   1 
ATOM   824  C CB  . SER A 1 137 ? 23.882  -7.210  -7.511  1.00 26.31 ? 345 SER A CB  1 
ATOM   825  O OG  . SER A 1 137 ? 23.268  -6.029  -7.026  1.00 28.33 ? 345 SER A OG  1 
ATOM   826  N N   . GLU A 1 138 ? 21.133  -8.160  -5.946  1.00 27.08 ? 346 GLU A N   1 
ATOM   827  C CA  . GLU A 1 138 ? 19.722  -7.841  -6.203  1.00 27.14 ? 346 GLU A CA  1 
ATOM   828  C C   . GLU A 1 138 ? 19.575  -6.302  -6.384  1.00 28.43 ? 346 GLU A C   1 
ATOM   829  O O   . GLU A 1 138 ? 19.511  -5.548  -5.424  1.00 29.38 ? 346 GLU A O   1 
ATOM   830  C CB  . GLU A 1 138 ? 18.853  -8.389  -5.090  1.00 27.59 ? 346 GLU A CB  1 
ATOM   831  C CG  . GLU A 1 138 ? 17.408  -8.616  -5.507  1.00 27.78 ? 346 GLU A CG  1 
ATOM   832  C CD  . GLU A 1 138 ? 16.638  -7.337  -5.611  1.00 27.57 ? 346 GLU A CD  1 
ATOM   833  O OE1 . GLU A 1 138 ? 16.798  -6.650  -6.638  1.00 29.14 ? 346 GLU A OE1 1 
ATOM   834  O OE2 . GLU A 1 138 ? 15.883  -7.031  -4.663  1.00 29.54 ? 346 GLU A OE2 1 
ATOM   835  N N   . TRP A 1 139 ? 19.528  -5.870  -7.638  1.00 29.96 ? 347 TRP A N   1 
ATOM   836  C CA  . TRP A 1 139 ? 19.650  -4.454  -8.030  1.00 30.75 ? 347 TRP A CA  1 
ATOM   837  C C   . TRP A 1 139 ? 18.405  -3.891  -8.721  1.00 30.27 ? 347 TRP A C   1 
ATOM   838  O O   . TRP A 1 139 ? 18.362  -2.692  -9.044  1.00 30.16 ? 347 TRP A O   1 
ATOM   839  C CB  . TRP A 1 139 ? 20.819  -4.292  -9.011  1.00 31.02 ? 347 TRP A CB  1 
ATOM   840  C CG  . TRP A 1 139 ? 20.744  -5.256  -10.192 1.00 30.12 ? 347 TRP A CG  1 
ATOM   841  C CD1 . TRP A 1 139 ? 21.353  -6.475  -10.271 1.00 29.80 ? 347 TRP A CD1 1 
ATOM   842  C CD2 . TRP A 1 139 ? 20.035  -5.085  -11.444 1.00 29.52 ? 347 TRP A CD2 1 
ATOM   843  N NE1 . TRP A 1 139 ? 21.063  -7.073  -11.468 1.00 29.70 ? 347 TRP A NE1 1 
ATOM   844  C CE2 . TRP A 1 139 ? 20.267  -6.241  -12.213 1.00 28.41 ? 347 TRP A CE2 1 
ATOM   845  C CE3 . TRP A 1 139 ? 19.245  -4.062  -11.989 1.00 31.01 ? 347 TRP A CE3 1 
ATOM   846  C CZ2 . TRP A 1 139 ? 19.726  -6.422  -13.498 1.00 30.98 ? 347 TRP A CZ2 1 
ATOM   847  C CZ3 . TRP A 1 139 ? 18.700  -4.240  -13.271 1.00 30.10 ? 347 TRP A CZ3 1 
ATOM   848  C CH2 . TRP A 1 139 ? 18.945  -5.415  -14.011 1.00 29.38 ? 347 TRP A CH2 1 
ATOM   849  N N   . MET A 1 140 ? 17.416  -4.743  -8.942  1.00 27.76 ? 348 MET A N   1 
ATOM   850  C CA  . MET A 1 140 ? 16.353  -4.476  -9.919  1.00 29.32 ? 348 MET A CA  1 
ATOM   851  C C   . MET A 1 140 ? 15.348  -3.474  -9.372  1.00 29.21 ? 348 MET A C   1 
ATOM   852  O O   . MET A 1 140 ? 14.943  -3.572  -8.219  1.00 26.31 ? 348 MET A O   1 
ATOM   853  C CB  . MET A 1 140 ? 15.626  -5.784  -10.298 1.00 28.44 ? 348 MET A CB  1 
ATOM   854  C CG  . MET A 1 140 ? 16.463  -6.763  -11.129 1.00 30.12 ? 348 MET A CG  1 
ATOM   855  S SD  . MET A 1 140 ? 17.606  -7.811  -10.202 1.00 29.80 ? 348 MET A SD  1 
ATOM   856  C CE  . MET A 1 140 ? 16.431  -8.830  -9.330  1.00 31.56 ? 348 MET A CE  1 
ATOM   857  N N   . GLY A 1 141 ? 14.933  -2.534  -10.226 1.00 29.78 ? 349 GLY A N   1 
ATOM   858  C CA  . GLY A 1 141 ? 13.898  -1.546  -9.877  1.00 27.59 ? 349 GLY A CA  1 
ATOM   859  C C   . GLY A 1 141 ? 12.573  -1.909  -10.497 1.00 27.33 ? 349 GLY A C   1 
ATOM   860  O O   . GLY A 1 141 ? 12.457  -2.894  -11.196 1.00 27.16 ? 349 GLY A O   1 
ATOM   861  N N   . TYR A 1 142 ? 11.563  -1.090  -10.248 1.00 28.26 ? 350 TYR A N   1 
ATOM   862  C CA  . TYR A 1 142 ? 10.293  -1.225  -10.913 1.00 28.86 ? 350 TYR A CA  1 
ATOM   863  C C   . TYR A 1 142 ? 10.522  -1.142  -12.407 1.00 28.79 ? 350 TYR A C   1 
ATOM   864  O O   . TYR A 1 142 ? 11.348  -0.354  -12.841 1.00 28.13 ? 350 TYR A O   1 
ATOM   865  C CB  . TYR A 1 142 ? 9.334   -0.124  -10.447 1.00 32.12 ? 350 TYR A CB  1 
ATOM   866  C CG  . TYR A 1 142 ? 9.034   -0.215  -8.964  1.00 32.26 ? 350 TYR A CG  1 
ATOM   867  C CD1 . TYR A 1 142 ? 8.503   -1.381  -8.417  1.00 30.39 ? 350 TYR A CD1 1 
ATOM   868  C CD2 . TYR A 1 142 ? 9.276   0.863   -8.112  1.00 36.66 ? 350 TYR A CD2 1 
ATOM   869  C CE1 . TYR A 1 142 ? 8.247   -1.491  -7.049  1.00 33.27 ? 350 TYR A CE1 1 
ATOM   870  C CE2 . TYR A 1 142 ? 9.002   0.779   -6.747  1.00 35.53 ? 350 TYR A CE2 1 
ATOM   871  C CZ  . TYR A 1 142 ? 8.493   -0.402  -6.220  1.00 36.79 ? 350 TYR A CZ  1 
ATOM   872  O OH  . TYR A 1 142 ? 8.198   -0.494  -4.874  1.00 36.75 ? 350 TYR A OH  1 
ATOM   873  N N   . PHE A 1 143 ? 9.831   -1.994  -13.165 1.00 26.65 ? 351 PHE A N   1 
ATOM   874  C CA  . PHE A 1 143 ? 9.981   -2.046  -14.608 1.00 28.37 ? 351 PHE A CA  1 
ATOM   875  C C   . PHE A 1 143 ? 11.472  -2.256  -14.940 1.00 27.67 ? 351 PHE A C   1 
ATOM   876  O O   . PHE A 1 143 ? 11.997  -1.728  -15.931 1.00 28.66 ? 351 PHE A O   1 
ATOM   877  C CB  . PHE A 1 143 ? 9.421   -0.745  -15.231 1.00 27.75 ? 351 PHE A CB  1 
ATOM   878  C CG  . PHE A 1 143 ? 9.299   -0.759  -16.732 1.00 27.30 ? 351 PHE A CG  1 
ATOM   879  C CD1 . PHE A 1 143 ? 8.593   -1.748  -17.390 1.00 28.96 ? 351 PHE A CD1 1 
ATOM   880  C CD2 . PHE A 1 143 ? 9.866   0.263   -17.496 1.00 28.20 ? 351 PHE A CD2 1 
ATOM   881  C CE1 . PHE A 1 143 ? 8.462   -1.730  -18.788 1.00 28.92 ? 351 PHE A CE1 1 
ATOM   882  C CE2 . PHE A 1 143 ? 9.735   0.281   -18.874 1.00 27.40 ? 351 PHE A CE2 1 
ATOM   883  C CZ  . PHE A 1 143 ? 9.043   -0.734  -19.523 1.00 27.10 ? 351 PHE A CZ  1 
ATOM   884  N N   . LEU A 1 144 ? 12.131  -3.014  -14.060 1.00 27.98 ? 352 LEU A N   1 
ATOM   885  C CA  . LEU A 1 144 ? 13.535  -3.337  -14.100 1.00 28.02 ? 352 LEU A CA  1 
ATOM   886  C C   . LEU A 1 144 ? 14.455  -2.151  -13.829 1.00 30.28 ? 352 LEU A C   1 
ATOM   887  O O   . LEU A 1 144 ? 15.379  -2.282  -13.036 1.00 29.33 ? 352 LEU A O   1 
ATOM   888  C CB  . LEU A 1 144 ? 13.950  -3.974  -15.419 1.00 29.17 ? 352 LEU A CB  1 
ATOM   889  C CG  . LEU A 1 144 ? 15.325  -4.650  -15.357 1.00 30.47 ? 352 LEU A CG  1 
ATOM   890  C CD1 . LEU A 1 144 ? 15.235  -5.902  -14.526 1.00 30.20 ? 352 LEU A CD1 1 
ATOM   891  C CD2 . LEU A 1 144 ? 15.867  -5.034  -16.746 1.00 31.98 ? 352 LEU A CD2 1 
ATOM   892  N N   . LEU A 1 145 ? 14.219  -1.016  -14.485 1.00 29.25 ? 353 LEU A N   1 
ATOM   893  C CA  . LEU A 1 145 ? 15.220  0.046   -14.520 1.00 32.44 ? 353 LEU A CA  1 
ATOM   894  C C   . LEU A 1 145 ? 14.952  1.291   -13.656 1.00 34.19 ? 353 LEU A C   1 
ATOM   895  O O   . LEU A 1 145 ? 15.889  1.992   -13.356 1.00 39.32 ? 353 LEU A O   1 
ATOM   896  C CB  . LEU A 1 145 ? 15.472  0.436   -15.984 1.00 33.35 ? 353 LEU A CB  1 
ATOM   897  C CG  . LEU A 1 145 ? 15.991  -0.689  -16.890 1.00 33.55 ? 353 LEU A CG  1 
ATOM   898  C CD1 . LEU A 1 145 ? 15.920  -0.289  -18.361 1.00 35.70 ? 353 LEU A CD1 1 
ATOM   899  C CD2 . LEU A 1 145 ? 17.407  -1.111  -16.507 1.00 35.68 ? 353 LEU A CD2 1 
ATOM   900  N N   . PHE A 1 146 ? 13.714  1.578   -13.250 1.00 35.79 ? 354 PHE A N   1 
ATOM   901  C CA  A PHE A 1 146 ? 13.429  2.716   -12.370 0.50 35.23 ? 354 PHE A CA  1 
ATOM   902  C CA  B PHE A 1 146 ? 13.489  2.741   -12.374 0.50 36.15 ? 354 PHE A CA  1 
ATOM   903  C C   . PHE A 1 146 ? 14.163  2.552   -11.037 1.00 36.11 ? 354 PHE A C   1 
ATOM   904  O O   . PHE A 1 146 ? 13.865  1.608   -10.299 1.00 38.03 ? 354 PHE A O   1 
ATOM   905  C CB  A PHE A 1 146 ? 11.922  2.800   -12.046 0.50 33.83 ? 354 PHE A CB  1 
ATOM   906  C CB  B PHE A 1 146 ? 12.008  3.033   -12.113 0.50 36.11 ? 354 PHE A CB  1 
ATOM   907  C CG  A PHE A 1 146 ? 11.039  3.307   -13.174 0.50 33.01 ? 354 PHE A CG  1 
ATOM   908  C CG  B PHE A 1 146 ? 11.771  4.154   -11.104 0.50 36.72 ? 354 PHE A CG  1 
ATOM   909  C CD1 A PHE A 1 146 ? 11.237  4.559   -13.745 0.50 32.22 ? 354 PHE A CD1 1 
ATOM   910  C CD1 B PHE A 1 146 ? 12.168  5.469   -11.381 0.50 37.60 ? 354 PHE A CD1 1 
ATOM   911  C CD2 A PHE A 1 146 ? 9.927   2.578   -13.573 0.50 31.36 ? 354 PHE A CD2 1 
ATOM   912  C CD2 B PHE A 1 146 ? 11.147  3.899   -9.893  0.50 37.60 ? 354 PHE A CD2 1 
ATOM   913  C CE1 A PHE A 1 146 ? 10.397  5.026   -14.740 0.50 29.85 ? 354 PHE A CE1 1 
ATOM   914  C CE1 B PHE A 1 146 ? 11.946  6.491   -10.476 0.50 35.42 ? 354 PHE A CE1 1 
ATOM   915  C CE2 A PHE A 1 146 ? 9.089   3.049   -14.565 0.50 32.56 ? 354 PHE A CE2 1 
ATOM   916  C CE2 B PHE A 1 146 ? 10.919  4.919   -8.980  0.50 37.99 ? 354 PHE A CE2 1 
ATOM   917  C CZ  A PHE A 1 146 ? 9.326   4.274   -15.152 0.50 30.13 ? 354 PHE A CZ  1 
ATOM   918  C CZ  B PHE A 1 146 ? 11.320  6.218   -9.274  0.50 37.22 ? 354 PHE A CZ  1 
ATOM   919  N N   . GLU A 1 147 ? 15.053  3.489   -10.714 1.00 37.05 ? 355 GLU A N   1 
ATOM   920  C CA  . GLU A 1 147 ? 15.784  3.506   -9.443  1.00 36.20 ? 355 GLU A CA  1 
ATOM   921  C C   . GLU A 1 147 ? 16.508  2.202   -9.235  1.00 36.26 ? 355 GLU A C   1 
ATOM   922  O O   . GLU A 1 147 ? 16.542  1.682   -8.141  1.00 40.56 ? 355 GLU A O   1 
ATOM   923  C CB  . GLU A 1 147 ? 14.837  3.797   -8.248  1.00 38.79 ? 355 GLU A CB  1 
ATOM   924  N N   . SER A 1 148 ? 17.089  1.650   -10.287 1.00 39.29 ? 356 SER A N   1 
ATOM   925  C CA  . SER A 1 148 ? 17.790  0.391   -10.144 1.00 37.40 ? 356 SER A CA  1 
ATOM   926  C C   . SER A 1 148 ? 19.227  0.677   -9.742  1.00 40.99 ? 356 SER A C   1 
ATOM   927  O O   . SER A 1 148 ? 19.694  1.798   -9.870  1.00 42.95 ? 356 SER A O   1 
ATOM   928  C CB  . SER A 1 148 ? 17.734  -0.404  -11.428 1.00 36.64 ? 356 SER A CB  1 
ATOM   929  O OG  . SER A 1 148 ? 18.846  -0.145  -12.252 1.00 36.66 ? 356 SER A OG  1 
ATOM   930  N N   A MET A 1 149 ? 19.913  -0.363  -9.277  0.50 39.19 ? 357 MET A N   1 
ATOM   931  N N   B MET A 1 149 ? 19.928  -0.330  -9.235  0.50 40.26 ? 357 MET A N   1 
ATOM   932  C CA  A MET A 1 149 ? 21.313  -0.290  -8.906  0.50 38.13 ? 357 MET A CA  1 
ATOM   933  C CA  B MET A 1 149 ? 21.342  -0.181  -8.944  0.50 39.98 ? 357 MET A CA  1 
ATOM   934  C C   A MET A 1 149 ? 22.197  -0.836  -10.039 0.50 36.92 ? 357 MET A C   1 
ATOM   935  C C   B MET A 1 149 ? 22.193  -0.850  -10.035 0.50 37.94 ? 357 MET A C   1 
ATOM   936  O O   A MET A 1 149 ? 23.370  -1.132  -9.814  0.50 36.07 ? 357 MET A O   1 
ATOM   937  O O   B MET A 1 149 ? 23.335  -1.235  -9.780  0.50 37.01 ? 357 MET A O   1 
ATOM   938  C CB  A MET A 1 149 ? 21.519  -1.123  -7.635  0.50 40.34 ? 357 MET A CB  1 
ATOM   939  C CB  B MET A 1 149 ? 21.652  -0.745  -7.550  0.50 43.50 ? 357 MET A CB  1 
ATOM   940  C CG  A MET A 1 149 ? 22.382  -0.500  -6.552  0.50 41.74 ? 357 MET A CG  1 
ATOM   941  C CG  B MET A 1 149 ? 21.397  0.234   -6.405  0.50 45.65 ? 357 MET A CG  1 
ATOM   942  S SD  A MET A 1 149 ? 22.072  -1.299  -4.965  0.50 41.66 ? 357 MET A SD  1 
ATOM   943  S SD  B MET A 1 149 ? 22.782  1.380   -6.158  0.50 50.86 ? 357 MET A SD  1 
ATOM   944  C CE  A MET A 1 149 ? 22.180  -3.041  -5.393  0.50 38.03 ? 357 MET A CE  1 
ATOM   945  C CE  B MET A 1 149 ? 23.972  0.350   -5.283  0.50 49.86 ? 357 MET A CE  1 
ATOM   946  N N   . LEU A 1 150 ? 21.641  -0.984  -11.246 1.00 35.21 ? 358 LEU A N   1 
ATOM   947  C CA  . LEU A 1 150 ? 22.359  -1.634  -12.359 1.00 37.61 ? 358 LEU A CA  1 
ATOM   948  C C   . LEU A 1 150 ? 23.633  -0.915  -12.745 1.00 39.25 ? 358 LEU A C   1 
ATOM   949  O O   . LEU A 1 150 ? 24.643  -1.561  -12.993 1.00 35.79 ? 358 LEU A O   1 
ATOM   950  C CB  . LEU A 1 150 ? 21.502  -1.779  -13.617 1.00 37.33 ? 358 LEU A CB  1 
ATOM   951  C CG  . LEU A 1 150 ? 22.113  -2.616  -14.749 1.00 36.85 ? 358 LEU A CG  1 
ATOM   952  C CD1 . LEU A 1 150 ? 22.688  -3.955  -14.281 1.00 36.05 ? 358 LEU A CD1 1 
ATOM   953  C CD2 . LEU A 1 150 ? 21.085  -2.864  -15.846 1.00 35.17 ? 358 LEU A CD2 1 
ATOM   954  N N   . ASP A 1 151 ? 23.577  0.410   -12.807 1.00 38.94 ? 359 ASP A N   1 
ATOM   955  C CA  . ASP A 1 151 ? 24.780  1.197   -13.066 1.00 42.80 ? 359 ASP A CA  1 
ATOM   956  C C   . ASP A 1 151 ? 25.913  0.787   -12.166 1.00 39.62 ? 359 ASP A C   1 
ATOM   957  O O   . ASP A 1 151 ? 27.014  0.605   -12.647 1.00 38.11 ? 359 ASP A O   1 
ATOM   958  C CB  . ASP A 1 151 ? 24.520  2.691   -12.898 1.00 45.94 ? 359 ASP A CB  1 
ATOM   959  C CG  . ASP A 1 151 ? 23.816  3.288   -14.094 1.00 52.47 ? 359 ASP A CG  1 
ATOM   960  O OD1 . ASP A 1 151 ? 23.208  2.542   -14.912 1.00 53.60 ? 359 ASP A OD1 1 
ATOM   961  O OD2 . ASP A 1 151 ? 23.900  4.523   -14.229 1.00 67.77 ? 359 ASP A OD2 1 
ATOM   962  N N   . SER A 1 152 ? 25.638  0.625   -10.871 1.00 38.45 ? 360 SER A N   1 
ATOM   963  C CA  . SER A 1 152 ? 26.672  0.205   -9.917  1.00 39.86 ? 360 SER A CA  1 
ATOM   964  C C   . SER A 1 152 ? 27.205  -1.204  -10.168 1.00 37.77 ? 360 SER A C   1 
ATOM   965  O O   . SER A 1 152 ? 28.411  -1.452  -10.027 1.00 37.30 ? 360 SER A O   1 
ATOM   966  C CB  . SER A 1 152 ? 26.144  0.263   -8.487  1.00 39.15 ? 360 SER A CB  1 
ATOM   967  O OG  . SER A 1 152 ? 25.718  1.552   -8.186  1.00 43.74 ? 360 SER A OG  1 
ATOM   968  N N   . VAL A 1 153 ? 26.299  -2.131  -10.477 1.00 35.92 ? 361 VAL A N   1 
ATOM   969  C CA  . VAL A 1 153 ? 26.681  -3.505  -10.786 1.00 34.64 ? 361 VAL A CA  1 
ATOM   970  C C   . VAL A 1 153 ? 27.582  -3.545  -12.022 1.00 36.40 ? 361 VAL A C   1 
ATOM   971  O O   . VAL A 1 153 ? 28.563  -4.284  -12.044 1.00 34.44 ? 361 VAL A O   1 
ATOM   972  C CB  . VAL A 1 153 ? 25.449  -4.394  -11.025 1.00 34.43 ? 361 VAL A CB  1 
ATOM   973  C CG1 . VAL A 1 153 ? 25.863  -5.758  -11.571 1.00 36.04 ? 361 VAL A CG1 1 
ATOM   974  C CG2 . VAL A 1 153 ? 24.648  -4.556  -9.741  1.00 34.00 ? 361 VAL A CG2 1 
ATOM   975  N N   . LEU A 1 154 ? 27.236  -2.767  -13.052 1.00 34.57 ? 362 LEU A N   1 
ATOM   976  C CA  . LEU A 1 154 ? 28.066  -2.676  -14.255 1.00 37.60 ? 362 LEU A CA  1 
ATOM   977  C C   . LEU A 1 154 ? 29.431  -2.041  -13.953 1.00 36.76 ? 362 LEU A C   1 
ATOM   978  O O   . LEU A 1 154 ? 30.463  -2.485  -14.466 1.00 37.11 ? 362 LEU A O   1 
ATOM   979  C CB  . LEU A 1 154 ? 27.345  -1.915  -15.381 1.00 37.70 ? 362 LEU A CB  1 
ATOM   980  C CG  . LEU A 1 154 ? 26.076  -2.609  -15.915 1.00 38.47 ? 362 LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 154 ? 25.375  -1.802  -16.993 1.00 39.35 ? 362 LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 154 ? 26.383  -4.008  -16.437 1.00 40.60 ? 362 LEU A CD2 1 
ATOM   983  N N   . TYR A 1 155 ? 29.442  -1.019  -13.110 1.00 38.85 ? 363 TYR A N   1 
ATOM   984  C CA  . TYR A 1 155 ? 30.699  -0.425  -12.667 1.00 41.07 ? 363 TYR A CA  1 
ATOM   985  C C   . TYR A 1 155 ? 31.575  -1.514  -12.029 1.00 41.88 ? 363 TYR A C   1 
ATOM   986  O O   . TYR A 1 155 ? 32.741  -1.665  -12.369 1.00 40.04 ? 363 TYR A O   1 
ATOM   987  C CB  . TYR A 1 155 ? 30.431  0.701   -11.670 1.00 40.64 ? 363 TYR A CB  1 
ATOM   988  C CG  . TYR A 1 155 ? 31.699  1.320   -11.150 1.00 43.67 ? 363 TYR A CG  1 
ATOM   989  C CD1 . TYR A 1 155 ? 32.375  0.752   -10.080 1.00 43.50 ? 363 TYR A CD1 1 
ATOM   990  C CD2 . TYR A 1 155 ? 32.249  2.462   -11.750 1.00 44.19 ? 363 TYR A CD2 1 
ATOM   991  C CE1 . TYR A 1 155 ? 33.556  1.298   -9.603  1.00 46.39 ? 363 TYR A CE1 1 
ATOM   992  C CE2 . TYR A 1 155 ? 33.433  3.012   -11.275 1.00 44.81 ? 363 TYR A CE2 1 
ATOM   993  C CZ  . TYR A 1 155 ? 34.073  2.420   -10.202 1.00 45.13 ? 363 TYR A CZ  1 
ATOM   994  O OH  . TYR A 1 155 ? 35.226  2.930   -9.705  1.00 49.46 ? 363 TYR A OH  1 
ATOM   995  N N   . ALA A 1 156 ? 30.984  -2.280  -11.114 1.00 39.08 ? 364 ALA A N   1 
ATOM   996  C CA  . ALA A 1 156 ? 31.681  -3.351  -10.431 1.00 38.91 ? 364 ALA A CA  1 
ATOM   997  C C   . ALA A 1 156 ? 32.223  -4.387  -11.397 1.00 38.41 ? 364 ALA A C   1 
ATOM   998  O O   . ALA A 1 156 ? 33.362  -4.821  -11.241 1.00 37.32 ? 364 ALA A O   1 
ATOM   999  C CB  . ALA A 1 156 ? 30.751  -4.025  -9.416  1.00 40.16 ? 364 ALA A CB  1 
ATOM   1000 N N   . LYS A 1 157 ? 31.402  -4.802  -12.368 1.00 37.12 ? 365 LYS A N   1 
ATOM   1001 C CA  . LYS A 1 157 ? 31.817  -5.757  -13.389 1.00 39.18 ? 365 LYS A CA  1 
ATOM   1002 C C   . LYS A 1 157 ? 33.104  -5.258  -14.054 1.00 42.39 ? 365 LYS A C   1 
ATOM   1003 O O   . LYS A 1 157 ? 34.135  -5.916  -13.999 1.00 38.38 ? 365 LYS A O   1 
ATOM   1004 C CB  . LYS A 1 157 ? 30.725  -5.956  -14.445 1.00 41.75 ? 365 LYS A CB  1 
ATOM   1005 C CG  . LYS A 1 157 ? 30.966  -7.104  -15.437 1.00 44.01 ? 365 LYS A CG  1 
ATOM   1006 C CD  . LYS A 1 157 ? 30.802  -6.726  -16.904 1.00 47.43 ? 365 LYS A CD  1 
ATOM   1007 C CE  . LYS A 1 157 ? 29.766  -5.633  -17.161 1.00 50.23 ? 365 LYS A CE  1 
ATOM   1008 N N   . ASN A 1 158 ? 33.044  -4.062  -14.624 1.00 46.43 ? 366 ASN A N   1 
ATOM   1009 C CA  . ASN A 1 158 ? 34.177  -3.506  -15.386 1.00 46.76 ? 366 ASN A CA  1 
ATOM   1010 C C   . ASN A 1 158 ? 35.418  -3.252  -14.570 1.00 44.35 ? 366 ASN A C   1 
ATOM   1011 O O   . ASN A 1 158 ? 36.509  -3.514  -15.043 1.00 44.04 ? 366 ASN A O   1 
ATOM   1012 C CB  . ASN A 1 158 ? 33.750  -2.248  -16.120 1.00 44.87 ? 366 ASN A CB  1 
ATOM   1013 C CG  . ASN A 1 158 ? 32.686  -2.544  -17.152 1.00 49.74 ? 366 ASN A CG  1 
ATOM   1014 O OD1 . ASN A 1 158 ? 32.764  -3.548  -17.862 1.00 54.09 ? 366 ASN A OD1 1 
ATOM   1015 N ND2 . ASN A 1 158 ? 31.677  -1.694  -17.231 1.00 51.48 ? 366 ASN A ND2 1 
ATOM   1016 N N   . LYS A 1 159 ? 35.264  -2.774  -13.342 1.00 44.93 ? 367 LYS A N   1 
ATOM   1017 C CA  . LYS A 1 159 ? 36.428  -2.548  -12.487 1.00 45.76 ? 367 LYS A CA  1 
ATOM   1018 C C   . LYS A 1 159 ? 36.976  -3.830  -11.820 1.00 44.68 ? 367 LYS A C   1 
ATOM   1019 O O   . LYS A 1 159 ? 38.187  -4.045  -11.791 1.00 46.22 ? 367 LYS A O   1 
ATOM   1020 C CB  . LYS A 1 159 ? 36.113  -1.510  -11.406 1.00 47.28 ? 367 LYS A CB  1 
ATOM   1021 C CG  . LYS A 1 159 ? 37.354  -0.937  -10.722 1.00 50.59 ? 367 LYS A CG  1 
ATOM   1022 C CD  . LYS A 1 159 ? 36.993  0.019   -9.600  1.00 51.25 ? 367 LYS A CD  1 
ATOM   1023 N N   . TYR A 1 160 ? 36.100  -4.667  -11.268 1.00 42.66 ? 368 TYR A N   1 
ATOM   1024 C CA  . TYR A 1 160 ? 36.535  -5.710  -10.308 1.00 40.15 ? 368 TYR A CA  1 
ATOM   1025 C C   . TYR A 1 160 ? 36.422  -7.160  -10.777 1.00 37.16 ? 368 TYR A C   1 
ATOM   1026 O O   . TYR A 1 160 ? 37.078  -8.046  -10.211 1.00 36.43 ? 368 TYR A O   1 
ATOM   1027 C CB  . TYR A 1 160 ? 35.801  -5.534  -8.964  1.00 39.93 ? 368 TYR A CB  1 
ATOM   1028 C CG  . TYR A 1 160 ? 36.175  -4.270  -8.204  1.00 41.27 ? 368 TYR A CG  1 
ATOM   1029 C CD1 . TYR A 1 160 ? 37.481  -4.042  -7.781  1.00 43.48 ? 368 TYR A CD1 1 
ATOM   1030 C CD2 . TYR A 1 160 ? 35.224  -3.305  -7.901  1.00 41.67 ? 368 TYR A CD2 1 
ATOM   1031 C CE1 . TYR A 1 160 ? 37.824  -2.887  -7.078  1.00 44.78 ? 368 TYR A CE1 1 
ATOM   1032 C CE2 . TYR A 1 160 ? 35.551  -2.159  -7.196  1.00 42.14 ? 368 TYR A CE2 1 
ATOM   1033 C CZ  . TYR A 1 160 ? 36.852  -1.946  -6.787  1.00 45.82 ? 368 TYR A CZ  1 
ATOM   1034 O OH  . TYR A 1 160 ? 37.172  -0.795  -6.089  1.00 47.35 ? 368 TYR A OH  1 
ATOM   1035 N N   . LEU A 1 161 ? 35.616  -7.434  -11.796 1.00 34.99 ? 369 LEU A N   1 
ATOM   1036 C CA  . LEU A 1 161 ? 35.425  -8.815  -12.229 1.00 34.83 ? 369 LEU A CA  1 
ATOM   1037 C C   . LEU A 1 161 ? 36.673  -9.418  -12.919 1.00 37.98 ? 369 LEU A C   1 
ATOM   1038 O O   . LEU A 1 161 ? 37.178  -8.871  -13.892 1.00 34.16 ? 369 LEU A O   1 
ATOM   1039 C CB  . LEU A 1 161 ? 34.221  -8.930  -13.150 1.00 34.27 ? 369 LEU A CB  1 
ATOM   1040 C CG  . LEU A 1 161 ? 33.740  -10.367 -13.358 1.00 33.68 ? 369 LEU A CG  1 
ATOM   1041 C CD1 . LEU A 1 161 ? 33.227  -10.982 -12.069 1.00 33.47 ? 369 LEU A CD1 1 
ATOM   1042 C CD2 . LEU A 1 161 ? 32.668  -10.425 -14.439 1.00 34.48 ? 369 LEU A CD2 1 
ATOM   1043 N N   . ALA A 1 162 ? 37.138  -10.565 -12.423 1.00 37.91 ? 370 ALA A N   1 
ATOM   1044 C CA  . ALA A 1 162 ? 38.266  -11.258 -13.045 1.00 41.22 ? 370 ALA A CA  1 
ATOM   1045 C C   . ALA A 1 162 ? 37.946  -11.643 -14.481 1.00 43.38 ? 370 ALA A C   1 
ATOM   1046 O O   . ALA A 1 162 ? 36.774  -11.836 -14.854 1.00 41.76 ? 370 ALA A O   1 
ATOM   1047 C CB  . ALA A 1 162 ? 38.652  -12.488 -12.240 1.00 41.91 ? 370 ALA A CB  1 
ATOM   1048 N N   . LYS A 1 163 ? 38.984  -11.734 -15.305 1.00 44.24 ? 371 LYS A N   1 
ATOM   1049 C CA  . LYS A 1 163 ? 38.818  -12.234 -16.672 1.00 45.61 ? 371 LYS A CA  1 
ATOM   1050 C C   . LYS A 1 163 ? 38.227  -13.632 -16.501 1.00 43.10 ? 371 LYS A C   1 
ATOM   1051 O O   . LYS A 1 163 ? 38.646  -14.377 -15.620 1.00 50.15 ? 371 LYS A O   1 
ATOM   1052 C CB  . LYS A 1 163 ? 40.174  -12.262 -17.419 1.00 46.51 ? 371 LYS A CB  1 
ATOM   1053 C CG  . LYS A 1 163 ? 40.104  -12.316 -18.939 1.00 46.01 ? 371 LYS A CG  1 
ATOM   1054 N N   . GLY A 1 164 ? 37.203  -13.950 -17.278 1.00 42.93 ? 372 GLY A N   1 
ATOM   1055 C CA  . GLY A 1 164 ? 36.494  -15.213 -17.127 1.00 41.36 ? 372 GLY A CA  1 
ATOM   1056 C C   . GLY A 1 164 ? 35.572  -15.311 -15.914 1.00 42.63 ? 372 GLY A C   1 
ATOM   1057 O O   . GLY A 1 164 ? 34.993  -16.372 -15.672 1.00 41.38 ? 372 GLY A O   1 
ATOM   1058 N N   . GLY A 1 165 ? 35.409  -14.231 -15.142 1.00 40.35 ? 373 GLY A N   1 
ATOM   1059 C CA  . GLY A 1 165 ? 34.459  -14.249 -14.014 1.00 38.83 ? 373 GLY A CA  1 
ATOM   1060 C C   . GLY A 1 165 ? 33.004  -14.170 -14.472 1.00 37.39 ? 373 GLY A C   1 
ATOM   1061 O O   . GLY A 1 165 ? 32.727  -14.101 -15.669 1.00 35.43 ? 373 GLY A O   1 
ATOM   1062 N N   . SER A 1 166 ? 32.065  -14.167 -13.526 1.00 33.82 ? 374 SER A N   1 
ATOM   1063 C CA  . SER A 1 166 ? 30.648  -14.125 -13.865 1.00 32.22 ? 374 SER A CA  1 
ATOM   1064 C C   . SER A 1 166 ? 29.828  -13.202 -12.961 1.00 32.48 ? 374 SER A C   1 
ATOM   1065 O O   . SER A 1 166 ? 30.208  -12.940 -11.808 1.00 33.08 ? 374 SER A O   1 
ATOM   1066 C CB  . SER A 1 166 ? 30.068  -15.543 -13.820 1.00 34.68 ? 374 SER A CB  1 
ATOM   1067 O OG  . SER A 1 166 ? 30.742  -16.396 -14.728 1.00 33.17 ? 374 SER A OG  1 
ATOM   1068 N N   . VAL A 1 167 ? 28.715  -12.725 -13.524 1.00 30.76 ? 375 VAL A N   1 
ATOM   1069 C CA  A VAL A 1 167 ? 27.790  -11.830 -12.848 0.50 31.72 ? 375 VAL A CA  1 
ATOM   1070 C CA  B VAL A 1 167 ? 27.788  -11.826 -12.857 0.50 31.49 ? 375 VAL A CA  1 
ATOM   1071 C C   . VAL A 1 167 ? 26.368  -12.418 -12.884 1.00 31.62 ? 375 VAL A C   1 
ATOM   1072 O O   . VAL A 1 167 ? 25.872  -12.844 -13.952 1.00 30.83 ? 375 VAL A O   1 
ATOM   1073 C CB  A VAL A 1 167 ? 27.829  -10.404 -13.458 0.50 31.88 ? 375 VAL A CB  1 
ATOM   1074 C CB  B VAL A 1 167 ? 27.775  -10.442 -13.532 0.50 31.33 ? 375 VAL A CB  1 
ATOM   1075 C CG1 A VAL A 1 167 ? 27.798  -10.439 -14.981 0.50 32.42 ? 375 VAL A CG1 1 
ATOM   1076 C CG1 B VAL A 1 167 ? 26.881  -9.482  -12.759 0.50 30.99 ? 375 VAL A CG1 1 
ATOM   1077 C CG2 A VAL A 1 167 ? 26.709  -9.533  -12.899 0.50 31.56 ? 375 VAL A CG2 1 
ATOM   1078 C CG2 B VAL A 1 167 ? 29.192  -9.885  -13.629 0.50 31.62 ? 375 VAL A CG2 1 
ATOM   1079 N N   . TYR A 1 168 ? 25.714  -12.438 -11.720 1.00 28.48 ? 376 TYR A N   1 
ATOM   1080 C CA  . TYR A 1 168 ? 24.378  -13.037 -11.586 1.00 27.61 ? 376 TYR A CA  1 
ATOM   1081 C C   . TYR A 1 168 ? 23.437  -12.099 -10.822 1.00 27.73 ? 376 TYR A C   1 
ATOM   1082 O O   . TYR A 1 168 ? 23.841  -11.485 -9.830  1.00 26.36 ? 376 TYR A O   1 
ATOM   1083 C CB  . TYR A 1 168 ? 24.433  -14.387 -10.861 1.00 25.35 ? 376 TYR A CB  1 
ATOM   1084 C CG  . TYR A 1 168 ? 25.287  -15.421 -11.546 1.00 26.03 ? 376 TYR A CG  1 
ATOM   1085 C CD1 . TYR A 1 168 ? 24.776  -16.173 -12.578 1.00 24.17 ? 376 TYR A CD1 1 
ATOM   1086 C CD2 . TYR A 1 168 ? 26.640  -15.617 -11.188 1.00 26.86 ? 376 TYR A CD2 1 
ATOM   1087 C CE1 . TYR A 1 168 ? 25.539  -17.122 -13.215 1.00 25.82 ? 376 TYR A CE1 1 
ATOM   1088 C CE2 . TYR A 1 168 ? 27.429  -16.581 -11.837 1.00 25.70 ? 376 TYR A CE2 1 
ATOM   1089 C CZ  . TYR A 1 168 ? 26.865  -17.333 -12.848 1.00 25.71 ? 376 TYR A CZ  1 
ATOM   1090 O OH  . TYR A 1 168 ? 27.578  -18.294 -13.541 1.00 25.44 ? 376 TYR A OH  1 
ATOM   1091 N N   . PRO A 1 169 ? 22.171  -12.037 -11.222 1.00 27.51 ? 377 PRO A N   1 
ATOM   1092 C CA  . PRO A 1 169 ? 21.653  -12.779 -12.369 1.00 29.15 ? 377 PRO A CA  1 
ATOM   1093 C C   . PRO A 1 169 ? 22.266  -12.258 -13.660 1.00 27.41 ? 377 PRO A C   1 
ATOM   1094 O O   . PRO A 1 169 ? 22.565  -11.071 -13.787 1.00 25.62 ? 377 PRO A O   1 
ATOM   1095 C CB  . PRO A 1 169 ? 20.144  -12.498 -12.323 1.00 29.53 ? 377 PRO A CB  1 
ATOM   1096 C CG  . PRO A 1 169 ? 20.030  -11.167 -11.634 1.00 29.87 ? 377 PRO A CG  1 
ATOM   1097 C CD  . PRO A 1 169 ? 21.145  -11.179 -10.607 1.00 29.27 ? 377 PRO A CD  1 
ATOM   1098 N N   . ASP A 1 170 ? 22.466  -13.154 -14.616 1.00 27.88 ? 378 ASP A N   1 
ATOM   1099 C CA  . ASP A 1 170 ? 23.187  -12.801 -15.818 1.00 27.57 ? 378 ASP A CA  1 
ATOM   1100 C C   . ASP A 1 170 ? 22.269  -12.293 -16.945 1.00 29.36 ? 378 ASP A C   1 
ATOM   1101 O O   . ASP A 1 170 ? 22.696  -11.481 -17.766 1.00 30.70 ? 378 ASP A O   1 
ATOM   1102 C CB  . ASP A 1 170 ? 24.118  -13.944 -16.280 1.00 27.11 ? 378 ASP A CB  1 
ATOM   1103 C CG  . ASP A 1 170 ? 23.444  -15.303 -16.316 1.00 27.92 ? 378 ASP A CG  1 
ATOM   1104 O OD1 . ASP A 1 170 ? 22.603  -15.642 -15.429 1.00 26.04 ? 378 ASP A OD1 1 
ATOM   1105 O OD2 . ASP A 1 170 ? 23.800  -16.074 -17.224 1.00 28.36 ? 378 ASP A OD2 1 
ATOM   1106 N N   . ILE A 1 171 ? 21.019  -12.739 -16.983 1.00 28.41 ? 379 ILE A N   1 
ATOM   1107 C CA  . ILE A 1 171 ? 20.129  -12.386 -18.098 1.00 28.66 ? 379 ILE A CA  1 
ATOM   1108 C C   . ILE A 1 171 ? 18.814  -11.806 -17.571 1.00 30.00 ? 379 ILE A C   1 
ATOM   1109 O O   . ILE A 1 171 ? 18.230  -12.359 -16.648 1.00 28.94 ? 379 ILE A O   1 
ATOM   1110 C CB  . ILE A 1 171 ? 19.853  -13.581 -19.027 1.00 30.09 ? 379 ILE A CB  1 
ATOM   1111 C CG1 . ILE A 1 171 ? 21.170  -14.101 -19.657 1.00 33.52 ? 379 ILE A CG1 1 
ATOM   1112 C CG2 . ILE A 1 171 ? 18.894  -13.147 -20.138 1.00 32.17 ? 379 ILE A CG2 1 
ATOM   1113 C CD1 . ILE A 1 171 ? 21.045  -15.410 -20.443 1.00 35.30 ? 379 ILE A CD1 1 
ATOM   1114 N N   . CYS A 1 172 ? 18.373  -10.694 -18.160 1.00 28.09 ? 380 CYS A N   1 
ATOM   1115 C CA  . CYS A 1 172 ? 17.119  -10.012 -17.788 1.00 30.52 ? 380 CYS A CA  1 
ATOM   1116 C C   . CYS A 1 172 ? 16.402  -9.660  -19.051 1.00 30.48 ? 380 CYS A C   1 
ATOM   1117 O O   . CYS A 1 172 ? 17.058  -9.289  -20.042 1.00 29.59 ? 380 CYS A O   1 
ATOM   1118 C CB  . CYS A 1 172 ? 17.390  -8.670  -17.088 1.00 33.01 ? 380 CYS A CB  1 
ATOM   1119 S SG  . CYS A 1 172 ? 18.509  -8.854  -15.712 1.00 42.10 ? 380 CYS A SG  1 
ATOM   1120 N N   . THR A 1 173 ? 15.075  -9.723  -19.006 1.00 28.51 ? 381 THR A N   1 
ATOM   1121 C CA  . THR A 1 173 ? 14.239  -9.203  -20.065 1.00 28.68 ? 381 THR A CA  1 
ATOM   1122 C C   . THR A 1 173 ? 13.137  -8.286  -19.547 1.00 29.24 ? 381 THR A C   1 
ATOM   1123 O O   . THR A 1 173 ? 12.731  -8.369  -18.380 1.00 28.42 ? 381 THR A O   1 
ATOM   1124 C CB  . THR A 1 173 ? 13.566  -10.315 -20.859 1.00 29.86 ? 381 THR A CB  1 
ATOM   1125 O OG1 . THR A 1 173 ? 12.665  -11.015 -20.011 1.00 28.27 ? 381 THR A OG1 1 
ATOM   1126 C CG2 . THR A 1 173 ? 14.598  -11.272 -21.476 1.00 30.58 ? 381 THR A CG2 1 
ATOM   1127 N N   . ILE A 1 174 ? 12.653  -7.417  -20.435 1.00 27.58 ? 382 ILE A N   1 
ATOM   1128 C CA  . ILE A 1 174 ? 11.499  -6.550  -20.161 1.00 27.15 ? 382 ILE A CA  1 
ATOM   1129 C C   . ILE A 1 174 ? 10.465  -6.867  -21.205 1.00 26.80 ? 382 ILE A C   1 
ATOM   1130 O O   . ILE A 1 174 ? 10.827  -7.085  -22.377 1.00 26.29 ? 382 ILE A O   1 
ATOM   1131 C CB  . ILE A 1 174 ? 11.855  -5.052  -20.235 1.00 27.31 ? 382 ILE A CB  1 
ATOM   1132 C CG1 . ILE A 1 174 ? 12.980  -4.734  -19.281 1.00 27.09 ? 382 ILE A CG1 1 
ATOM   1133 C CG2 . ILE A 1 174 ? 10.648  -4.174  -19.906 1.00 27.44 ? 382 ILE A CG2 1 
ATOM   1134 C CD1 . ILE A 1 174 ? 13.533  -3.324  -19.431 1.00 27.21 ? 382 ILE A CD1 1 
ATOM   1135 N N   . SER A 1 175 ? 9.201   -6.918  -20.783 1.00 24.30 ? 383 SER A N   1 
ATOM   1136 C CA  . SER A 1 175 ? 8.081   -7.175  -21.655 1.00 25.80 ? 383 SER A CA  1 
ATOM   1137 C C   . SER A 1 175 ? 6.944   -6.175  -21.445 1.00 26.94 ? 383 SER A C   1 
ATOM   1138 O O   . SER A 1 175 ? 6.815   -5.572  -20.375 1.00 27.01 ? 383 SER A O   1 
ATOM   1139 C CB  . SER A 1 175 ? 7.529   -8.581  -21.410 1.00 25.97 ? 383 SER A CB  1 
ATOM   1140 O OG  . SER A 1 175 ? 8.545   -9.536  -21.661 1.00 27.24 ? 383 SER A OG  1 
ATOM   1141 N N   . LEU A 1 176 ? 6.137   -6.010  -22.490 1.00 25.53 ? 384 LEU A N   1 
ATOM   1142 C CA  . LEU A 1 176 ? 4.893   -5.246  -22.445 1.00 24.60 ? 384 LEU A CA  1 
ATOM   1143 C C   . LEU A 1 176 ? 3.710   -6.154  -22.696 1.00 25.02 ? 384 LEU A C   1 
ATOM   1144 O O   . LEU A 1 176 ? 3.840   -7.187  -23.349 1.00 23.78 ? 384 LEU A O   1 
ATOM   1145 C CB  . LEU A 1 176 ? 4.902   -4.149  -23.509 1.00 25.61 ? 384 LEU A CB  1 
ATOM   1146 C CG  . LEU A 1 176 ? 5.971   -3.063  -23.358 1.00 24.50 ? 384 LEU A CG  1 
ATOM   1147 C CD1 . LEU A 1 176 ? 5.780   -1.980  -24.414 1.00 26.03 ? 384 LEU A CD1 1 
ATOM   1148 C CD2 . LEU A 1 176 ? 5.986   -2.445  -21.971 1.00 24.70 ? 384 LEU A CD2 1 
ATOM   1149 N N   . VAL A 1 177 ? 2.554   -5.773  -22.167 1.00 24.68 ? 385 VAL A N   1 
ATOM   1150 C CA  . VAL A 1 177 ? 1.326   -6.516  -22.382 1.00 25.62 ? 385 VAL A CA  1 
ATOM   1151 C C   . VAL A 1 177 ? 0.163   -5.531  -22.378 1.00 25.41 ? 385 VAL A C   1 
ATOM   1152 O O   . VAL A 1 177 ? 0.219   -4.525  -21.699 1.00 25.75 ? 385 VAL A O   1 
ATOM   1153 C CB  . VAL A 1 177 ? 1.205   -7.682  -21.373 1.00 27.66 ? 385 VAL A CB  1 
ATOM   1154 C CG1 . VAL A 1 177 ? 1.143   -7.197  -19.951 1.00 29.87 ? 385 VAL A CG1 1 
ATOM   1155 C CG2 . VAL A 1 177 ? 0.024   -8.569  -21.681 1.00 28.92 ? 385 VAL A CG2 1 
ATOM   1156 N N   . ALA A 1 178 ? -0.835  -5.764  -23.229 1.00 25.27 ? 386 ALA A N   1 
ATOM   1157 C CA  . ALA A 1 178 ? -2.008  -4.894  -23.309 1.00 24.00 ? 386 ALA A CA  1 
ATOM   1158 C C   . ALA A 1 178 ? -3.009  -5.241  -22.238 1.00 24.14 ? 386 ALA A C   1 
ATOM   1159 O O   . ALA A 1 178 ? -3.154  -6.411  -21.857 1.00 23.48 ? 386 ALA A O   1 
ATOM   1160 C CB  . ALA A 1 178 ? -2.667  -4.984  -24.670 1.00 24.61 ? 386 ALA A CB  1 
ATOM   1161 N N   . VAL A 1 179 ? -3.721  -4.208  -21.776 1.00 25.14 ? 387 VAL A N   1 
ATOM   1162 C CA  . VAL A 1 179 ? -4.675  -4.318  -20.694 1.00 25.17 ? 387 VAL A CA  1 
ATOM   1163 C C   . VAL A 1 179 ? -5.992  -3.712  -21.102 1.00 25.52 ? 387 VAL A C   1 
ATOM   1164 O O   . VAL A 1 179 ? -6.022  -2.675  -21.755 1.00 25.48 ? 387 VAL A O   1 
ATOM   1165 C CB  . VAL A 1 179 ? -4.182  -3.551  -19.429 1.00 28.16 ? 387 VAL A CB  1 
ATOM   1166 C CG1 . VAL A 1 179 ? -5.044  -3.894  -18.213 1.00 27.95 ? 387 VAL A CG1 1 
ATOM   1167 C CG2 . VAL A 1 179 ? -2.715  -3.859  -19.120 1.00 29.86 ? 387 VAL A CG2 1 
ATOM   1168 N N   . SER A 1 180 ? -7.082  -4.336  -20.672 1.00 27.84 ? 388 SER A N   1 
ATOM   1169 C CA  . SER A 1 180 ? -8.421  -3.768  -20.776 1.00 27.41 ? 388 SER A CA  1 
ATOM   1170 C C   . SER A 1 180 ? -9.047  -3.715  -19.398 1.00 27.98 ? 388 SER A C   1 
ATOM   1171 O O   . SER A 1 180 ? -9.254  -4.741  -18.754 1.00 26.80 ? 388 SER A O   1 
ATOM   1172 C CB  . SER A 1 180 ? -9.315  -4.632  -21.659 1.00 29.74 ? 388 SER A CB  1 
ATOM   1173 O OG  . SER A 1 180 ? -10.633 -4.100  -21.703 1.00 29.68 ? 388 SER A OG  1 
ATOM   1174 N N   . ASP A 1 181 ? -9.309  -2.510  -18.916 1.00 28.19 ? 389 ASP A N   1 
ATOM   1175 C CA  . ASP A 1 181 ? -9.991  -2.343  -17.643 1.00 27.88 ? 389 ASP A CA  1 
ATOM   1176 C C   . ASP A 1 181 ? -10.755 -1.016  -17.675 1.00 29.46 ? 389 ASP A C   1 
ATOM   1177 O O   . ASP A 1 181 ? -10.261 0.035   -17.173 1.00 26.79 ? 389 ASP A O   1 
ATOM   1178 C CB  . ASP A 1 181 ? -8.978  -2.410  -16.481 1.00 27.73 ? 389 ASP A CB  1 
ATOM   1179 C CG  . ASP A 1 181 ? -9.638  -2.739  -15.146 1.00 29.18 ? 389 ASP A CG  1 
ATOM   1180 O OD1 . ASP A 1 181 ? -10.791 -2.283  -14.924 1.00 28.04 ? 389 ASP A OD1 1 
ATOM   1181 O OD2 . ASP A 1 181 ? -9.001  -3.472  -14.345 1.00 27.73 ? 389 ASP A OD2 1 
ATOM   1182 N N   . VAL A 1 182 ? -11.944 -1.043  -18.298 1.00 30.16 ? 390 VAL A N   1 
ATOM   1183 C CA  . VAL A 1 182 ? -12.733 0.196   -18.440 1.00 30.08 ? 390 VAL A CA  1 
ATOM   1184 C C   . VAL A 1 182 ? -13.182 0.770   -17.096 1.00 30.29 ? 390 VAL A C   1 
ATOM   1185 O O   . VAL A 1 182 ? -13.255 1.989   -16.956 1.00 28.64 ? 390 VAL A O   1 
ATOM   1186 C CB  . VAL A 1 182 ? -13.937 0.095   -19.399 1.00 30.88 ? 390 VAL A CB  1 
ATOM   1187 C CG1 . VAL A 1 182 ? -13.465 -0.261  -20.796 1.00 31.13 ? 390 VAL A CG1 1 
ATOM   1188 C CG2 . VAL A 1 182 ? -14.989 -0.883  -18.898 1.00 33.35 ? 390 VAL A CG2 1 
ATOM   1189 N N   . ASN A 1 183 ? -13.462 -0.087  -16.113 1.00 31.32 ? 391 ASN A N   1 
ATOM   1190 C CA  . ASN A 1 183 ? -13.834 0.401   -14.766 1.00 33.23 ? 391 ASN A CA  1 
ATOM   1191 C C   . ASN A 1 183 ? -12.694 1.150   -14.089 1.00 31.54 ? 391 ASN A C   1 
ATOM   1192 O O   . ASN A 1 183 ? -12.889 2.257   -13.595 1.00 30.83 ? 391 ASN A O   1 
ATOM   1193 C CB  . ASN A 1 183 ? -14.334 -0.728  -13.874 1.00 35.38 ? 391 ASN A CB  1 
ATOM   1194 C CG  . ASN A 1 183 ? -15.630 -1.337  -14.386 1.00 39.49 ? 391 ASN A CG  1 
ATOM   1195 O OD1 . ASN A 1 183 ? -16.338 -0.746  -15.182 1.00 41.12 ? 391 ASN A OD1 1 
ATOM   1196 N ND2 . ASN A 1 183 ? -15.926 -2.534  -13.943 1.00 42.81 ? 391 ASN A ND2 1 
ATOM   1197 N N   . LYS A 1 184 ? -11.494 0.573   -14.097 1.00 30.17 ? 392 LYS A N   1 
ATOM   1198 C CA  . LYS A 1 184 ? -10.353 1.290   -13.560 1.00 30.46 ? 392 LYS A CA  1 
ATOM   1199 C C   . LYS A 1 184 ? -10.024 2.556   -14.323 1.00 26.95 ? 392 LYS A C   1 
ATOM   1200 O O   . LYS A 1 184 ? -9.611  3.550   -13.716 1.00 29.76 ? 392 LYS A O   1 
ATOM   1201 C CB  . LYS A 1 184 ? -9.122  0.415   -13.431 1.00 31.65 ? 392 LYS A CB  1 
ATOM   1202 C CG  . LYS A 1 184 ? -9.288  -0.570  -12.299 1.00 38.16 ? 392 LYS A CG  1 
ATOM   1203 C CD  . LYS A 1 184 ? -8.007  -1.313  -11.980 1.00 42.82 ? 392 LYS A CD  1 
ATOM   1204 C CE  . LYS A 1 184 ? -8.267  -2.350  -10.901 1.00 48.59 ? 392 LYS A CE  1 
ATOM   1205 N NZ  . LYS A 1 184 ? -8.354  -1.719  -9.550  1.00 53.68 ? 392 LYS A NZ  1 
ATOM   1206 N N   . HIS A 1 185 ? -10.204 2.555   -15.629 1.00 25.39 ? 393 HIS A N   1 
ATOM   1207 C CA  . HIS A 1 185 ? -9.949  3.766   -16.386 1.00 25.96 ? 393 HIS A CA  1 
ATOM   1208 C C   . HIS A 1 185 ? -10.907 4.864   -15.946 1.00 27.83 ? 393 HIS A C   1 
ATOM   1209 O O   . HIS A 1 185 ? -10.513 6.017   -15.795 1.00 28.18 ? 393 HIS A O   1 
ATOM   1210 C CB  . HIS A 1 185 ? -10.088 3.520   -17.883 1.00 27.10 ? 393 HIS A CB  1 
ATOM   1211 C CG  . HIS A 1 185 ? -9.497  4.607   -18.725 1.00 26.35 ? 393 HIS A CG  1 
ATOM   1212 N ND1 . HIS A 1 185 ? -10.230 5.678   -19.177 1.00 25.76 ? 393 HIS A ND1 1 
ATOM   1213 C CD2 . HIS A 1 185 ? -8.239  4.781   -19.204 1.00 27.09 ? 393 HIS A CD2 1 
ATOM   1214 C CE1 . HIS A 1 185 ? -9.456  6.477   -19.887 1.00 27.41 ? 393 HIS A CE1 1 
ATOM   1215 N NE2 . HIS A 1 185 ? -8.234  5.960   -19.905 1.00 28.03 ? 393 HIS A NE2 1 
ATOM   1216 N N   . ALA A 1 186 ? -12.184 4.494   -15.813 1.00 29.96 ? 394 ALA A N   1 
ATOM   1217 C CA  . ALA A 1 186 ? -13.213 5.394   -15.319 1.00 32.54 ? 394 ALA A CA  1 
ATOM   1218 C C   . ALA A 1 186 ? -12.809 5.930   -13.949 1.00 32.05 ? 394 ALA A C   1 
ATOM   1219 O O   . ALA A 1 186 ? -12.916 7.151   -13.712 1.00 30.48 ? 394 ALA A O   1 
ATOM   1220 C CB  . ALA A 1 186 ? -14.576 4.685   -15.256 1.00 32.51 ? 394 ALA A CB  1 
ATOM   1221 N N   . ASP A 1 187 ? -12.295 5.036   -13.091 1.00 29.97 ? 395 ASP A N   1 
ATOM   1222 C CA  A ASP A 1 187 ? -11.890 5.400   -11.732 0.50 30.96 ? 395 ASP A CA  1 
ATOM   1223 C CA  B ASP A 1 187 ? -11.899 5.404   -11.723 0.50 28.95 ? 395 ASP A CA  1 
ATOM   1224 C C   . ASP A 1 187 ? -10.760 6.418   -11.703 1.00 29.23 ? 395 ASP A C   1 
ATOM   1225 O O   . ASP A 1 187 ? -10.694 7.236   -10.810 1.00 28.69 ? 395 ASP A O   1 
ATOM   1226 C CB  A ASP A 1 187 ? -11.454 4.164   -10.954 0.50 33.62 ? 395 ASP A CB  1 
ATOM   1227 C CB  B ASP A 1 187 ? -11.478 4.185   -10.890 0.50 28.97 ? 395 ASP A CB  1 
ATOM   1228 C CG  A ASP A 1 187 ? -11.786 4.254   -9.492  0.50 36.41 ? 395 ASP A CG  1 
ATOM   1229 C CG  B ASP A 1 187 ? -12.617 3.202   -10.638 0.50 29.06 ? 395 ASP A CG  1 
ATOM   1230 O OD1 A ASP A 1 187 ? -11.391 5.225   -8.816  0.50 36.06 ? 395 ASP A OD1 1 
ATOM   1231 O OD1 B ASP A 1 187 ? -13.794 3.590   -10.749 0.50 27.85 ? 395 ASP A OD1 1 
ATOM   1232 O OD2 A ASP A 1 187 ? -12.473 3.330   -9.015  0.50 44.48 ? 395 ASP A OD2 1 
ATOM   1233 O OD2 B ASP A 1 187 ? -12.319 2.028   -10.312 0.50 29.68 ? 395 ASP A OD2 1 
ATOM   1234 N N   . ARG A 1 188 ? -9.854  6.355   -12.684 1.00 28.58 ? 396 ARG A N   1 
ATOM   1235 C CA  . ARG A 1 188 ? -8.708  7.271   -12.730 1.00 26.40 ? 396 ARG A CA  1 
ATOM   1236 C C   . ARG A 1 188 ? -8.908  8.528   -13.562 1.00 27.57 ? 396 ARG A C   1 
ATOM   1237 O O   . ARG A 1 188 ? -8.215  9.539   -13.333 1.00 26.21 ? 396 ARG A O   1 
ATOM   1238 C CB  . ARG A 1 188 ? -7.464  6.546   -13.254 1.00 28.47 ? 396 ARG A CB  1 
ATOM   1239 C CG  . ARG A 1 188 ? -7.051  5.338   -12.425 1.00 30.37 ? 396 ARG A CG  1 
ATOM   1240 C CD  . ARG A 1 188 ? -6.816  5.673   -10.939 1.00 29.89 ? 396 ARG A CD  1 
ATOM   1241 N NE  . ARG A 1 188 ? -6.106  6.946   -10.732 1.00 28.77 ? 396 ARG A NE  1 
ATOM   1242 C CZ  . ARG A 1 188 ? -4.821  7.171   -10.965 1.00 28.05 ? 396 ARG A CZ  1 
ATOM   1243 N NH1 . ARG A 1 188 ? -4.036  6.217   -11.474 1.00 29.64 ? 396 ARG A NH1 1 
ATOM   1244 N NH2 . ARG A 1 188 ? -4.319  8.380   -10.732 1.00 25.50 ? 396 ARG A NH2 1 
ATOM   1245 N N   . ILE A 1 189 ? -9.813  8.460   -14.540 1.00 27.67 ? 397 ILE A N   1 
ATOM   1246 C CA  . ILE A 1 189 ? -9.912  9.499   -15.588 1.00 28.13 ? 397 ILE A CA  1 
ATOM   1247 C C   . ILE A 1 189 ? -11.293 10.162  -15.606 1.00 27.60 ? 397 ILE A C   1 
ATOM   1248 O O   . ILE A 1 189 ? -11.415 11.331  -15.226 1.00 28.24 ? 397 ILE A O   1 
ATOM   1249 C CB  . ILE A 1 189 ? -9.511  8.921   -16.978 1.00 30.62 ? 397 ILE A CB  1 
ATOM   1250 C CG1 . ILE A 1 189 ? -8.088  8.330   -16.919 1.00 30.49 ? 397 ILE A CG1 1 
ATOM   1251 C CG2 . ILE A 1 189 ? -9.618  9.977   -18.091 1.00 31.48 ? 397 ILE A CG2 1 
ATOM   1252 C CD1 . ILE A 1 189 ? -6.995  9.342   -16.606 1.00 31.10 ? 397 ILE A CD1 1 
ATOM   1253 N N   . ALA A 1 190 ? -12.338 9.431   -15.993 1.00 29.32 ? 398 ALA A N   1 
ATOM   1254 C CA  . ALA A 1 190 ? -13.682 10.012  -16.019 1.00 30.67 ? 398 ALA A CA  1 
ATOM   1255 C C   . ALA A 1 190 ? -14.095 10.521  -14.626 1.00 31.85 ? 398 ALA A C   1 
ATOM   1256 O O   . ALA A 1 190 ? -14.918 11.446  -14.516 1.00 32.32 ? 398 ALA A O   1 
ATOM   1257 C CB  . ALA A 1 190 ? -14.707 9.006   -16.541 1.00 31.91 ? 398 ALA A CB  1 
ATOM   1258 N N   . PHE A 1 191 ? -13.520 9.908   -13.587 1.00 30.74 ? 399 PHE A N   1 
ATOM   1259 C CA  . PHE A 1 191 ? -13.654 10.364  -12.211 1.00 31.14 ? 399 PHE A CA  1 
ATOM   1260 C C   . PHE A 1 191 ? -13.594 11.883  -12.074 1.00 31.15 ? 399 PHE A C   1 
ATOM   1261 O O   . PHE A 1 191 ? -14.320 12.442  -11.277 1.00 32.48 ? 399 PHE A O   1 
ATOM   1262 C CB  . PHE A 1 191 ? -12.533 9.763   -11.356 1.00 32.29 ? 399 PHE A CB  1 
ATOM   1263 C CG  . PHE A 1 191 ? -12.465 10.332  -9.968  1.00 32.96 ? 399 PHE A CG  1 
ATOM   1264 C CD1 . PHE A 1 191 ? -13.370 9.907   -8.982  1.00 31.96 ? 399 PHE A CD1 1 
ATOM   1265 C CD2 . PHE A 1 191 ? -11.520 11.297  -9.635  1.00 31.74 ? 399 PHE A CD2 1 
ATOM   1266 C CE1 . PHE A 1 191 ? -13.302 10.427  -7.689  1.00 32.47 ? 399 PHE A CE1 1 
ATOM   1267 C CE2 . PHE A 1 191 ? -11.462 11.834  -8.346  1.00 31.73 ? 399 PHE A CE2 1 
ATOM   1268 C CZ  . PHE A 1 191 ? -12.352 11.403  -7.373  1.00 29.83 ? 399 PHE A CZ  1 
ATOM   1269 N N   . TRP A 1 192 ? -12.721 12.538  -12.848 1.00 29.55 ? 400 TRP A N   1 
ATOM   1270 C CA  . TRP A 1 192 ? -12.437 13.957  -12.680 1.00 28.28 ? 400 TRP A CA  1 
ATOM   1271 C C   . TRP A 1 192 ? -13.450 14.909  -13.348 1.00 29.38 ? 400 TRP A C   1 
ATOM   1272 O O   . TRP A 1 192 ? -13.350 16.115  -13.200 1.00 28.10 ? 400 TRP A O   1 
ATOM   1273 C CB  . TRP A 1 192 ? -11.041 14.262  -13.220 1.00 27.35 ? 400 TRP A CB  1 
ATOM   1274 C CG  . TRP A 1 192 ? -9.950  13.573  -12.493 1.00 28.42 ? 400 TRP A CG  1 
ATOM   1275 C CD1 . TRP A 1 192 ? -9.250  12.478  -12.900 1.00 27.58 ? 400 TRP A CD1 1 
ATOM   1276 C CD2 . TRP A 1 192 ? -9.413  13.941  -11.222 1.00 30.07 ? 400 TRP A CD2 1 
ATOM   1277 N NE1 . TRP A 1 192 ? -8.315  12.131  -11.963 1.00 28.21 ? 400 TRP A NE1 1 
ATOM   1278 C CE2 . TRP A 1 192 ? -8.393  13.008  -10.915 1.00 29.25 ? 400 TRP A CE2 1 
ATOM   1279 C CE3 . TRP A 1 192 ? -9.686  14.975  -10.314 1.00 29.13 ? 400 TRP A CE3 1 
ATOM   1280 C CZ2 . TRP A 1 192 ? -7.643  13.077  -9.736  1.00 29.33 ? 400 TRP A CZ2 1 
ATOM   1281 C CZ3 . TRP A 1 192 ? -8.954  15.024  -9.109  1.00 28.73 ? 400 TRP A CZ3 1 
ATOM   1282 C CH2 . TRP A 1 192 ? -7.937  14.089  -8.848  1.00 29.16 ? 400 TRP A CH2 1 
ATOM   1283 N N   . ASP A 1 193 ? -14.384 14.386  -14.129 1.00 30.26 ? 401 ASP A N   1 
ATOM   1284 C CA  . ASP A 1 193 ? -15.387 15.250  -14.751 1.00 31.58 ? 401 ASP A CA  1 
ATOM   1285 C C   . ASP A 1 193 ? -16.359 15.836  -13.740 1.00 31.32 ? 401 ASP A C   1 
ATOM   1286 O O   . ASP A 1 193 ? -16.784 16.959  -13.909 1.00 29.40 ? 401 ASP A O   1 
ATOM   1287 C CB  . ASP A 1 193 ? -16.158 14.507  -15.818 1.00 33.74 ? 401 ASP A CB  1 
ATOM   1288 C CG  . ASP A 1 193 ? -15.267 14.092  -16.967 1.00 39.33 ? 401 ASP A CG  1 
ATOM   1289 O OD1 . ASP A 1 193 ? -14.352 14.867  -17.305 1.00 37.48 ? 401 ASP A OD1 1 
ATOM   1290 O OD2 . ASP A 1 193 ? -15.480 12.997  -17.482 1.00 42.56 ? 401 ASP A OD2 1 
ATOM   1291 N N   . ASP A 1 194 ? -16.706 15.062  -12.710 1.00 31.07 ? 402 ASP A N   1 
ATOM   1292 C CA  . ASP A 1 194 ? -17.558 15.538  -11.631 1.00 32.81 ? 402 ASP A CA  1 
ATOM   1293 C C   . ASP A 1 194 ? -17.119 15.035  -10.259 1.00 30.37 ? 402 ASP A C   1 
ATOM   1294 O O   . ASP A 1 194 ? -17.286 13.860  -9.928  1.00 29.68 ? 402 ASP A O   1 
ATOM   1295 C CB  . ASP A 1 194 ? -19.023 15.120  -11.837 1.00 35.96 ? 402 ASP A CB  1 
ATOM   1296 C CG  . ASP A 1 194 ? -19.936 15.808  -10.827 1.00 41.11 ? 402 ASP A CG  1 
ATOM   1297 O OD1 . ASP A 1 194 ? -20.453 16.889  -11.134 1.00 47.86 ? 402 ASP A OD1 1 
ATOM   1298 O OD2 . ASP A 1 194 ? -20.033 15.356  -9.679  1.00 47.20 ? 402 ASP A OD2 1 
ATOM   1299 N N   . VAL A 1 195 ? -16.627 15.950  -9.446  1.00 29.23 ? 403 VAL A N   1 
ATOM   1300 C CA  . VAL A 1 195 ? -16.059 15.634  -8.157  1.00 29.78 ? 403 VAL A CA  1 
ATOM   1301 C C   . VAL A 1 195 ? -16.884 16.445  -7.159  1.00 30.57 ? 403 VAL A C   1 
ATOM   1302 O O   . VAL A 1 195 ? -16.803 17.703  -7.132  1.00 30.17 ? 403 VAL A O   1 
ATOM   1303 C CB  . VAL A 1 195 ? -14.574 16.005  -8.134  1.00 30.39 ? 403 VAL A CB  1 
ATOM   1304 C CG1 . VAL A 1 195 ? -13.969 15.774  -6.766  1.00 32.98 ? 403 VAL A CG1 1 
ATOM   1305 C CG2 . VAL A 1 195 ? -13.820 15.198  -9.192  1.00 33.56 ? 403 VAL A CG2 1 
ATOM   1306 N N   . TYR A 1 196 ? -17.747 15.733  -6.429  1.00 29.77 ? 404 TYR A N   1 
ATOM   1307 C CA  . TYR A 1 196 ? -18.698 16.338  -5.487  1.00 31.16 ? 404 TYR A CA  1 
ATOM   1308 C C   . TYR A 1 196 ? -19.427 17.524  -6.103  1.00 32.73 ? 404 TYR A C   1 
ATOM   1309 O O   . TYR A 1 196 ? -19.533 18.588  -5.484  1.00 31.56 ? 404 TYR A O   1 
ATOM   1310 C CB  . TYR A 1 196 ? -17.962 16.717  -4.196  1.00 33.17 ? 404 TYR A CB  1 
ATOM   1311 C CG  . TYR A 1 196 ? -17.548 15.468  -3.444  1.00 35.28 ? 404 TYR A CG  1 
ATOM   1312 C CD1 . TYR A 1 196 ? -18.493 14.733  -2.722  1.00 37.57 ? 404 TYR A CD1 1 
ATOM   1313 C CD2 . TYR A 1 196 ? -16.253 14.984  -3.511  1.00 34.71 ? 404 TYR A CD2 1 
ATOM   1314 C CE1 . TYR A 1 196 ? -18.148 13.563  -2.077  1.00 38.86 ? 404 TYR A CE1 1 
ATOM   1315 C CE2 . TYR A 1 196 ? -15.897 13.804  -2.867  1.00 39.67 ? 404 TYR A CE2 1 
ATOM   1316 C CZ  . TYR A 1 196 ? -16.858 13.107  -2.150  1.00 39.15 ? 404 TYR A CZ  1 
ATOM   1317 O OH  . TYR A 1 196 ? -16.528 11.953  -1.499  1.00 49.39 ? 404 TYR A OH  1 
ATOM   1318 N N   . GLY A 1 197 ? -19.865 17.336  -7.350  1.00 31.53 ? 405 GLY A N   1 
ATOM   1319 C CA  . GLY A 1 197 ? -20.574 18.351  -8.115  1.00 33.24 ? 405 GLY A CA  1 
ATOM   1320 C C   . GLY A 1 197 ? -19.731 19.357  -8.892  1.00 32.74 ? 405 GLY A C   1 
ATOM   1321 O O   . GLY A 1 197 ? -20.284 20.258  -9.513  1.00 31.06 ? 405 GLY A O   1 
ATOM   1322 N N   . PHE A 1 198 ? -18.410 19.255  -8.853  1.00 30.94 ? 406 PHE A N   1 
ATOM   1323 C CA  . PHE A 1 198 ? -17.570 20.270  -9.511  1.00 29.89 ? 406 PHE A CA  1 
ATOM   1324 C C   . PHE A 1 198 ? -16.716 19.675  -10.628 1.00 29.87 ? 406 PHE A C   1 
ATOM   1325 O O   . PHE A 1 198 ? -16.273 18.535  -10.523 1.00 28.54 ? 406 PHE A O   1 
ATOM   1326 C CB  . PHE A 1 198 ? -16.659 20.993  -8.502  1.00 28.17 ? 406 PHE A CB  1 
ATOM   1327 C CG  . PHE A 1 198 ? -17.414 21.724  -7.423  1.00 30.14 ? 406 PHE A CG  1 
ATOM   1328 C CD1 . PHE A 1 198 ? -17.941 22.999  -7.664  1.00 30.70 ? 406 PHE A CD1 1 
ATOM   1329 C CD2 . PHE A 1 198 ? -17.604 21.148  -6.173  1.00 32.47 ? 406 PHE A CD2 1 
ATOM   1330 C CE1 . PHE A 1 198 ? -18.657 23.673  -6.680  1.00 30.93 ? 406 PHE A CE1 1 
ATOM   1331 C CE2 . PHE A 1 198 ? -18.315 21.808  -5.188  1.00 32.27 ? 406 PHE A CE2 1 
ATOM   1332 C CZ  . PHE A 1 198 ? -18.851 23.079  -5.447  1.00 32.04 ? 406 PHE A CZ  1 
ATOM   1333 N N   . LYS A 1 199 ? -16.454 20.476  -11.667 1.00 28.00 ? 407 LYS A N   1 
ATOM   1334 C CA  . LYS A 1 199 ? -15.543 20.078  -12.740 1.00 31.61 ? 407 LYS A CA  1 
ATOM   1335 C C   . LYS A 1 199 ? -14.096 20.076  -12.300 1.00 29.73 ? 407 LYS A C   1 
ATOM   1336 O O   . LYS A 1 199 ? -13.619 21.047  -11.719 1.00 29.64 ? 407 LYS A O   1 
ATOM   1337 C CB  . LYS A 1 199 ? -15.714 20.993  -13.965 1.00 32.64 ? 407 LYS A CB  1 
ATOM   1338 C CG  . LYS A 1 199 ? -17.062 20.796  -14.631 1.00 37.22 ? 407 LYS A CG  1 
ATOM   1339 C CD  . LYS A 1 199 ? -17.346 21.788  -15.746 1.00 43.84 ? 407 LYS A CD  1 
ATOM   1340 C CE  . LYS A 1 199 ? -18.778 21.580  -16.221 1.00 46.41 ? 407 LYS A CE  1 
ATOM   1341 N NZ  . LYS A 1 199 ? -19.006 22.246  -17.514 1.00 51.43 ? 407 LYS A NZ  1 
ATOM   1342 N N   . MET A 1 200 ? -13.411 18.970  -12.587 1.00 29.09 ? 408 MET A N   1 
ATOM   1343 C CA  . MET A 1 200 ? -11.989 18.859  -12.346 1.00 30.90 ? 408 MET A CA  1 
ATOM   1344 C C   . MET A 1 200 ? -11.227 18.239  -13.526 1.00 32.25 ? 408 MET A C   1 
ATOM   1345 O O   . MET A 1 200 ? -10.128 17.713  -13.336 1.00 31.80 ? 408 MET A O   1 
ATOM   1346 C CB  . MET A 1 200 ? -11.739 18.056  -11.065 1.00 30.77 ? 408 MET A CB  1 
ATOM   1347 C CG  . MET A 1 200 ? -12.095 18.808  -9.791  1.00 30.72 ? 408 MET A CG  1 
ATOM   1348 S SD  . MET A 1 200 ? -11.268 18.131  -8.331  1.00 31.64 ? 408 MET A SD  1 
ATOM   1349 C CE  . MET A 1 200 ? -12.002 19.152  -7.049  1.00 32.07 ? 408 MET A CE  1 
ATOM   1350 N N   . SER A 1 201 ? -11.784 18.349  -14.739 1.00 31.49 ? 409 SER A N   1 
ATOM   1351 C CA  . SER A 1 201 ? -11.229 17.680  -15.937 1.00 33.76 ? 409 SER A CA  1 
ATOM   1352 C C   . SER A 1 201 ? -9.745  17.894  -16.166 1.00 32.19 ? 409 SER A C   1 
ATOM   1353 O O   . SER A 1 201 ? -9.050  17.007  -16.680 1.00 33.89 ? 409 SER A O   1 
ATOM   1354 C CB  . SER A 1 201 ? -11.965 18.167  -17.196 1.00 35.51 ? 409 SER A CB  1 
ATOM   1355 O OG  . SER A 1 201 ? -13.290 17.733  -17.110 1.00 46.17 ? 409 SER A OG  1 
ATOM   1356 N N   . CYS A 1 202 ? -9.265  19.086  -15.850 1.00 31.52 ? 410 CYS A N   1 
ATOM   1357 C CA  . CYS A 1 202 ? -7.868  19.409  -16.081 1.00 32.40 ? 410 CYS A CA  1 
ATOM   1358 C C   . CYS A 1 202 ? -6.910  18.459  -15.323 1.00 33.13 ? 410 CYS A C   1 
ATOM   1359 O O   . CYS A 1 202 ? -5.735  18.326  -15.685 1.00 31.18 ? 410 CYS A O   1 
ATOM   1360 C CB  . CYS A 1 202 ? -7.620  20.856  -15.687 1.00 36.04 ? 410 CYS A CB  1 
ATOM   1361 S SG  . CYS A 1 202 ? -8.340  21.311  -14.073 1.00 37.10 ? 410 CYS A SG  1 
ATOM   1362 N N   . MET A 1 203 ? -7.403  17.786  -14.287 1.00 29.88 ? 411 MET A N   1 
ATOM   1363 C CA  . MET A 1 203 ? -6.558  16.877  -13.531 1.00 29.57 ? 411 MET A CA  1 
ATOM   1364 C C   . MET A 1 203 ? -6.186  15.617  -14.328 1.00 30.97 ? 411 MET A C   1 
ATOM   1365 O O   . MET A 1 203 ? -5.191  14.952  -13.992 1.00 26.34 ? 411 MET A O   1 
ATOM   1366 C CB  . MET A 1 203 ? -7.228  16.500  -12.200 1.00 30.10 ? 411 MET A CB  1 
ATOM   1367 C CG  . MET A 1 203 ? -7.179  17.629  -11.165 1.00 32.13 ? 411 MET A CG  1 
ATOM   1368 S SD  . MET A 1 203 ? -5.512  17.871  -10.479 1.00 31.90 ? 411 MET A SD  1 
ATOM   1369 C CE  . MET A 1 203 ? -5.343  16.389  -9.526  1.00 35.12 ? 411 MET A CE  1 
ATOM   1370 N N   . LYS A 1 204 ? -6.970  15.279  -15.361 1.00 30.45 ? 412 LYS A N   1 
ATOM   1371 C CA  . LYS A 1 204 ? -6.680  14.079  -16.159 1.00 33.18 ? 412 LYS A CA  1 
ATOM   1372 C C   . LYS A 1 204 ? -5.250  14.134  -16.713 1.00 35.16 ? 412 LYS A C   1 
ATOM   1373 O O   . LYS A 1 204 ? -4.522  13.145  -16.690 1.00 32.65 ? 412 LYS A O   1 
ATOM   1374 C CB  . LYS A 1 204 ? -7.687  13.905  -17.291 1.00 32.14 ? 412 LYS A CB  1 
ATOM   1375 C CG  . LYS A 1 204 ? -9.109  13.594  -16.852 1.00 32.05 ? 412 LYS A CG  1 
ATOM   1376 C CD  . LYS A 1 204 ? -10.079 13.921  -17.983 1.00 32.83 ? 412 LYS A CD  1 
ATOM   1377 C CE  . LYS A 1 204 ? -11.472 13.402  -17.719 1.00 32.31 ? 412 LYS A CE  1 
ATOM   1378 N NZ  . LYS A 1 204 ? -12.392 13.868  -18.793 1.00 33.72 ? 412 LYS A NZ  1 
ATOM   1379 N N   . LYS A 1 205 ? -4.843  15.310  -17.161 1.00 35.23 ? 413 LYS A N   1 
ATOM   1380 C CA  . LYS A 1 205 ? -3.518  15.474  -17.742 1.00 38.81 ? 413 LYS A CA  1 
ATOM   1381 C C   . LYS A 1 205 ? -2.381  15.397  -16.721 1.00 36.65 ? 413 LYS A C   1 
ATOM   1382 O O   . LYS A 1 205 ? -1.226  15.171  -17.081 1.00 33.38 ? 413 LYS A O   1 
ATOM   1383 C CB  . LYS A 1 205 ? -3.488  16.755  -18.598 1.00 41.27 ? 413 LYS A CB  1 
ATOM   1384 C CG  . LYS A 1 205 ? -4.255  16.494  -19.899 1.00 43.31 ? 413 LYS A CG  1 
ATOM   1385 C CD  . LYS A 1 205 ? -4.384  17.697  -20.809 1.00 45.83 ? 413 LYS A CD  1 
ATOM   1386 C CE  . LYS A 1 205 ? -5.315  17.389  -21.967 1.00 44.16 ? 413 LYS A CE  1 
ATOM   1387 N NZ  . LYS A 1 205 ? -4.858  16.198  -22.747 1.00 42.34 ? 413 LYS A NZ  1 
ATOM   1388 N N   . ALA A 1 206 ? -2.700  15.530  -15.440 1.00 34.32 ? 414 ALA A N   1 
ATOM   1389 C CA  . ALA A 1 206 ? -1.681  15.373  -14.415 1.00 33.09 ? 414 ALA A CA  1 
ATOM   1390 C C   . ALA A 1 206 ? -1.557  13.925  -13.984 1.00 30.47 ? 414 ALA A C   1 
ATOM   1391 O O   . ALA A 1 206 ? -0.486  13.504  -13.615 1.00 29.36 ? 414 ALA A O   1 
ATOM   1392 C CB  . ALA A 1 206 ? -1.986  16.256  -13.215 1.00 35.53 ? 414 ALA A CB  1 
ATOM   1393 N N   . VAL A 1 207 ? -2.641  13.153  -14.013 1.00 29.60 ? 415 VAL A N   1 
ATOM   1394 C CA  . VAL A 1 207 ? -2.539  11.770  -13.599 1.00 30.30 ? 415 VAL A CA  1 
ATOM   1395 C C   . VAL A 1 207 ? -2.047  10.836  -14.731 1.00 30.07 ? 415 VAL A C   1 
ATOM   1396 O O   . VAL A 1 207 ? -1.400  9.831   -14.457 1.00 29.96 ? 415 VAL A O   1 
ATOM   1397 C CB  . VAL A 1 207 ? -3.848  11.241  -12.950 1.00 35.08 ? 415 VAL A CB  1 
ATOM   1398 C CG1 . VAL A 1 207 ? -4.241  12.111  -11.760 1.00 34.83 ? 415 VAL A CG1 1 
ATOM   1399 C CG2 . VAL A 1 207 ? -4.992  11.116  -13.939 1.00 36.08 ? 415 VAL A CG2 1 
ATOM   1400 N N   . ILE A 1 208 ? -2.339  11.153  -15.987 1.00 28.63 ? 416 ILE A N   1 
ATOM   1401 C CA  . ILE A 1 208 ? -1.938  10.275  -17.080 1.00 30.06 ? 416 ILE A CA  1 
ATOM   1402 C C   . ILE A 1 208 ? -0.422  9.968   -17.130 1.00 28.34 ? 416 ILE A C   1 
ATOM   1403 O O   . ILE A 1 208 ? -0.042  8.811   -17.332 1.00 27.81 ? 416 ILE A O   1 
ATOM   1404 C CB  . ILE A 1 208 ? -2.429  10.774  -18.468 1.00 29.53 ? 416 ILE A CB  1 
ATOM   1405 C CG1 . ILE A 1 208 ? -3.931  10.541  -18.626 1.00 30.88 ? 416 ILE A CG1 1 
ATOM   1406 C CG2 . ILE A 1 208 ? -1.702  10.045  -19.578 1.00 29.49 ? 416 ILE A CG2 1 
ATOM   1407 C CD1 . ILE A 1 208 ? -4.294  9.073   -18.823 1.00 33.47 ? 416 ILE A CD1 1 
ATOM   1408 N N   . PRO A 1 209 ? 0.442   10.987  -16.954 1.00 27.15 ? 417 PRO A N   1 
ATOM   1409 C CA  . PRO A 1 209 ? 1.885   10.754  -17.003 1.00 26.92 ? 417 PRO A CA  1 
ATOM   1410 C C   . PRO A 1 209 ? 2.512   9.955   -15.870 1.00 27.71 ? 417 PRO A C   1 
ATOM   1411 O O   . PRO A 1 209 ? 3.674   9.608   -15.990 1.00 30.13 ? 417 PRO A O   1 
ATOM   1412 C CB  . PRO A 1 209 ? 2.471   12.179  -17.004 1.00 27.97 ? 417 PRO A CB  1 
ATOM   1413 C CG  . PRO A 1 209 ? 1.381   13.026  -17.544 1.00 27.74 ? 417 PRO A CG  1 
ATOM   1414 C CD  . PRO A 1 209 ? 0.145   12.423  -16.945 1.00 27.45 ? 417 PRO A CD  1 
ATOM   1415 N N   . GLU A 1 210 ? 1.769   9.679   -14.799 1.00 27.94 ? 418 GLU A N   1 
ATOM   1416 C CA  . GLU A 1 210 ? 2.301   8.962   -13.640 1.00 30.24 ? 418 GLU A CA  1 
ATOM   1417 C C   . GLU A 1 210 ? 2.085   7.469   -13.867 1.00 29.12 ? 418 GLU A C   1 
ATOM   1418 O O   . GLU A 1 210 ? 0.955   6.988   -13.866 1.00 29.01 ? 418 GLU A O   1 
ATOM   1419 C CB  . GLU A 1 210 ? 1.603   9.420   -12.340 1.00 32.15 ? 418 GLU A CB  1 
ATOM   1420 C CG  . GLU A 1 210 ? 1.663   10.938  -12.071 1.00 35.66 ? 418 GLU A CG  1 
ATOM   1421 C CD  . GLU A 1 210 ? 0.961   11.398  -10.760 1.00 40.61 ? 418 GLU A CD  1 
ATOM   1422 O OE1 . GLU A 1 210 ? -0.056  10.782  -10.302 1.00 42.80 ? 418 GLU A OE1 1 
ATOM   1423 O OE2 . GLU A 1 210 ? 1.421   12.411  -10.173 1.00 38.79 ? 418 GLU A OE2 1 
ATOM   1424 N N   . ALA A 1 211 ? 3.176   6.749   -14.095 1.00 26.90 ? 419 ALA A N   1 
ATOM   1425 C CA  . ALA A 1 211 ? 3.142   5.297   -14.187 1.00 26.39 ? 419 ALA A CA  1 
ATOM   1426 C C   . ALA A 1 211 ? 2.739   4.775   -12.829 1.00 28.06 ? 419 ALA A C   1 
ATOM   1427 O O   . ALA A 1 211 ? 3.125   5.333   -11.814 1.00 27.95 ? 419 ALA A O   1 
ATOM   1428 C CB  . ALA A 1 211 ? 4.503   4.757   -14.574 1.00 26.74 ? 419 ALA A CB  1 
ATOM   1429 N N   . VAL A 1 212 ? 1.923   3.737   -12.823 1.00 28.15 ? 420 VAL A N   1 
ATOM   1430 C CA  . VAL A 1 212 ? 1.404   3.155   -11.596 1.00 29.23 ? 420 VAL A CA  1 
ATOM   1431 C C   . VAL A 1 212 ? 2.096   1.810   -11.334 1.00 28.54 ? 420 VAL A C   1 
ATOM   1432 O O   . VAL A 1 212 ? 2.322   1.043   -12.259 1.00 27.63 ? 420 VAL A O   1 
ATOM   1433 C CB  . VAL A 1 212 ? -0.116  2.987   -11.719 1.00 28.94 ? 420 VAL A CB  1 
ATOM   1434 C CG1 . VAL A 1 212 ? -0.679  2.144   -10.576 1.00 32.00 ? 420 VAL A CG1 1 
ATOM   1435 C CG2 . VAL A 1 212 ? -0.778  4.348   -11.764 1.00 30.18 ? 420 VAL A CG2 1 
ATOM   1436 N N   . VAL A 1 213 ? 2.470   1.552   -10.092 1.00 27.56 ? 421 VAL A N   1 
ATOM   1437 C CA  . VAL A 1 213 ? 3.076   0.276   -9.719  1.00 27.39 ? 421 VAL A CA  1 
ATOM   1438 C C   . VAL A 1 213 ? 2.048   -0.496  -8.900  1.00 28.86 ? 421 VAL A C   1 
ATOM   1439 O O   . VAL A 1 213 ? 1.628   -0.024  -7.841  1.00 29.68 ? 421 VAL A O   1 
ATOM   1440 C CB  . VAL A 1 213 ? 4.370   0.465   -8.948  1.00 29.31 ? 421 VAL A CB  1 
ATOM   1441 C CG1 . VAL A 1 213 ? 4.868   -0.881  -8.422  1.00 31.67 ? 421 VAL A CG1 1 
ATOM   1442 C CG2 . VAL A 1 213 ? 5.429   1.079   -9.862  1.00 29.79 ? 421 VAL A CG2 1 
ATOM   1443 N N   . GLU A 1 214 ? 1.596   -1.634  -9.419  1.00 24.12 ? 422 GLU A N   1 
ATOM   1444 C CA  . GLU A 1 214 ? 0.454   -2.309  -8.865  1.00 27.00 ? 422 GLU A CA  1 
ATOM   1445 C C   . GLU A 1 214 ? 0.309   -3.667  -9.481  1.00 26.16 ? 422 GLU A C   1 
ATOM   1446 O O   . GLU A 1 214 ? 0.608   -3.838  -10.663 1.00 27.62 ? 422 GLU A O   1 
ATOM   1447 C CB  . GLU A 1 214 ? -0.820  -1.503  -9.170  1.00 29.59 ? 422 GLU A CB  1 
ATOM   1448 C CG  . GLU A 1 214 ? -2.081  -1.999  -8.490  1.00 30.94 ? 422 GLU A CG  1 
ATOM   1449 C CD  . GLU A 1 214 ? -3.261  -1.066  -8.765  1.00 31.36 ? 422 GLU A CD  1 
ATOM   1450 O OE1 . GLU A 1 214 ? -3.265  0.052   -8.209  1.00 29.99 ? 422 GLU A OE1 1 
ATOM   1451 O OE2 . GLU A 1 214 ? -4.149  -1.427  -9.575  1.00 28.09 ? 422 GLU A OE2 1 
ATOM   1452 N N   . VAL A 1 215 ? -0.209  -4.607  -8.704  1.00 25.73 ? 423 VAL A N   1 
ATOM   1453 C CA  . VAL A 1 215 ? -0.510  -5.942  -9.189  1.00 27.23 ? 423 VAL A CA  1 
ATOM   1454 C C   . VAL A 1 215 ? -1.780  -5.970  -9.996  1.00 27.11 ? 423 VAL A C   1 
ATOM   1455 O O   . VAL A 1 215 ? -2.822  -5.574  -9.525  1.00 28.01 ? 423 VAL A O   1 
ATOM   1456 C CB  . VAL A 1 215 ? -0.643  -6.981  -8.038  1.00 28.75 ? 423 VAL A CB  1 
ATOM   1457 C CG1 . VAL A 1 215 ? -0.971  -8.364  -8.617  1.00 30.29 ? 423 VAL A CG1 1 
ATOM   1458 C CG2 . VAL A 1 215 ? 0.640   -7.058  -7.229  1.00 29.21 ? 423 VAL A CG2 1 
ATOM   1459 N N   . LEU A 1 216 ? -1.698  -6.464  -11.220 1.00 27.14 ? 424 LEU A N   1 
ATOM   1460 C CA  . LEU A 1 216 ? -2.863  -6.505  -12.098 1.00 27.80 ? 424 LEU A CA  1 
ATOM   1461 C C   . LEU A 1 216 ? -3.627  -7.799  -11.995 1.00 28.51 ? 424 LEU A C   1 
ATOM   1462 O O   . LEU A 1 216 ? -3.048  -8.864  -11.865 1.00 29.94 ? 424 LEU A O   1 
ATOM   1463 C CB  . LEU A 1 216 ? -2.420  -6.375  -13.535 1.00 29.07 ? 424 LEU A CB  1 
ATOM   1464 C CG  . LEU A 1 216 ? -1.794  -5.046  -13.880 1.00 30.48 ? 424 LEU A CG  1 
ATOM   1465 C CD1 . LEU A 1 216 ? -1.205  -5.179  -15.261 1.00 31.82 ? 424 LEU A CD1 1 
ATOM   1466 C CD2 . LEU A 1 216 ? -2.846  -3.944  -13.831 1.00 32.16 ? 424 LEU A CD2 1 
ATOM   1467 N N   . ASP A 1 217 ? -4.940  -7.701  -12.084 1.00 28.60 ? 425 ASP A N   1 
ATOM   1468 C CA  . ASP A 1 217 ? -5.758  -8.886  -12.248 1.00 31.31 ? 425 ASP A CA  1 
ATOM   1469 C C   . ASP A 1 217 ? -5.441  -9.506  -13.626 1.00 29.68 ? 425 ASP A C   1 
ATOM   1470 O O   . ASP A 1 217 ? -5.676  -8.889  -14.644 1.00 31.85 ? 425 ASP A O   1 
ATOM   1471 C CB  . ASP A 1 217 ? -7.220  -8.472  -12.105 1.00 30.92 ? 425 ASP A CB  1 
ATOM   1472 C CG  . ASP A 1 217 ? -8.192  -9.585  -12.366 1.00 35.47 ? 425 ASP A CG  1 
ATOM   1473 O OD1 . ASP A 1 217 ? -7.798  -10.718 -12.738 1.00 37.15 ? 425 ASP A OD1 1 
ATOM   1474 O OD2 . ASP A 1 217 ? -9.396  -9.277  -12.236 1.00 40.94 ? 425 ASP A OD2 1 
ATOM   1475 N N   . PRO A 1 218 ? -4.895  -10.725 -13.656 1.00 31.54 ? 426 PRO A N   1 
ATOM   1476 C CA  . PRO A 1 218 ? -4.466  -11.321 -14.929 1.00 32.58 ? 426 PRO A CA  1 
ATOM   1477 C C   . PRO A 1 218 ? -5.578  -11.505 -15.957 1.00 31.75 ? 426 PRO A C   1 
ATOM   1478 O O   . PRO A 1 218 ? -5.310  -11.586 -17.143 1.00 34.36 ? 426 PRO A O   1 
ATOM   1479 C CB  . PRO A 1 218 ? -3.896  -12.683 -14.495 1.00 34.54 ? 426 PRO A CB  1 
ATOM   1480 C CG  . PRO A 1 218 ? -4.610  -13.017 -13.249 1.00 33.08 ? 426 PRO A CG  1 
ATOM   1481 C CD  . PRO A 1 218 ? -4.744  -11.681 -12.541 1.00 34.13 ? 426 PRO A CD  1 
ATOM   1482 N N   . LYS A 1 219 ? -6.821  -11.557 -15.511 1.00 32.33 ? 427 LYS A N   1 
ATOM   1483 C CA  . LYS A 1 219 ? -7.963  -11.627 -16.433 1.00 33.36 ? 427 LYS A CA  1 
ATOM   1484 C C   . LYS A 1 219 ? -8.113  -10.339 -17.251 1.00 33.47 ? 427 LYS A C   1 
ATOM   1485 O O   . LYS A 1 219 ? -8.827  -10.356 -18.255 1.00 30.77 ? 427 LYS A O   1 
ATOM   1486 C CB  . LYS A 1 219 ? -9.293  -11.870 -15.682 1.00 33.47 ? 427 LYS A CB  1 
ATOM   1487 C CG  . LYS A 1 219 ? -9.341  -13.115 -14.781 1.00 34.56 ? 427 LYS A CG  1 
ATOM   1488 N N   . THR A 1 220 ? -7.465  -9.235  -16.843 1.00 29.77 ? 428 THR A N   1 
ATOM   1489 C CA  . THR A 1 220 ? -7.577  -7.982  -17.602 1.00 29.06 ? 428 THR A CA  1 
ATOM   1490 C C   . THR A 1 220 ? -6.553  -7.893  -18.748 1.00 30.68 ? 428 THR A C   1 
ATOM   1491 O O   . THR A 1 220 ? -6.566  -6.928  -19.559 1.00 27.37 ? 428 THR A O   1 
ATOM   1492 C CB  . THR A 1 220 ? -7.517  -6.761  -16.678 1.00 30.78 ? 428 THR A CB  1 
ATOM   1493 O OG1 . THR A 1 220 ? -6.253  -6.682  -16.009 1.00 26.84 ? 428 THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 220 ? -8.644  -6.855  -15.626 1.00 32.38 ? 428 THR A CG2 1 
ATOM   1495 N N   . LEU A 1 221 ? -5.689  -8.903  -18.862 1.00 30.77 ? 429 LEU A N   1 
ATOM   1496 C CA  . LEU A 1 221 ? -4.690  -8.908  -19.938 1.00 32.51 ? 429 LEU A CA  1 
ATOM   1497 C C   . LEU A 1 221 ? -5.343  -9.287  -21.262 1.00 31.31 ? 429 LEU A C   1 
ATOM   1498 O O   . LEU A 1 221 ? -6.072  -10.237 -21.317 1.00 31.70 ? 429 LEU A O   1 
ATOM   1499 C CB  . LEU A 1 221 ? -3.533  -9.842  -19.617 1.00 35.63 ? 429 LEU A CB  1 
ATOM   1500 C CG  . LEU A 1 221 ? -2.619  -9.396  -18.461 1.00 39.75 ? 429 LEU A CG  1 
ATOM   1501 C CD1 . LEU A 1 221 ? -1.266  -10.086 -18.650 1.00 46.06 ? 429 LEU A CD1 1 
ATOM   1502 C CD2 . LEU A 1 221 ? -2.441  -7.885  -18.356 1.00 39.80 ? 429 LEU A CD2 1 
ATOM   1503 N N   . ILE A 1 222 ? -5.099  -8.517  -22.316 1.00 29.25 ? 430 ILE A N   1 
ATOM   1504 C CA  . ILE A 1 222 ? -5.773  -8.752  -23.579 1.00 28.54 ? 430 ILE A CA  1 
ATOM   1505 C C   . ILE A 1 222 ? -4.820  -8.964  -24.733 1.00 27.40 ? 430 ILE A C   1 
ATOM   1506 O O   . ILE A 1 222 ? -5.201  -8.885  -25.880 1.00 26.88 ? 430 ILE A O   1 
ATOM   1507 C CB  . ILE A 1 222 ? -6.759  -7.627  -23.894 1.00 28.67 ? 430 ILE A CB  1 
ATOM   1508 C CG1 . ILE A 1 222 ? -6.015  -6.307  -24.024 1.00 28.71 ? 430 ILE A CG1 1 
ATOM   1509 C CG2 . ILE A 1 222 ? -7.855  -7.583  -22.812 1.00 29.91 ? 430 ILE A CG2 1 
ATOM   1510 C CD1 . ILE A 1 222 ? -6.735  -5.303  -24.893 1.00 29.29 ? 430 ILE A CD1 1 
ATOM   1511 N N   . SER A 1 223 ? -3.563  -9.220  -24.445 1.00 28.85 ? 431 SER A N   1 
ATOM   1512 C CA  . SER A 1 223 ? -2.643  -9.641  -25.502 1.00 29.56 ? 431 SER A CA  1 
ATOM   1513 C C   . SER A 1 223 ? -1.664  -10.610 -24.913 1.00 30.59 ? 431 SER A C   1 
ATOM   1514 O O   . SER A 1 223 ? -1.552  -10.714 -23.686 1.00 28.67 ? 431 SER A O   1 
ATOM   1515 C CB  . SER A 1 223 ? -1.873  -8.464  -26.092 1.00 28.57 ? 431 SER A CB  1 
ATOM   1516 O OG  . SER A 1 223 ? -0.833  -8.057  -25.211 1.00 27.36 ? 431 SER A OG  1 
ATOM   1517 N N   . GLU A 1 224 ? -0.967  -11.316 -25.798 1.00 31.08 ? 432 GLU A N   1 
ATOM   1518 C CA  . GLU A 1 224 ? 0.240   -12.021 -25.416 1.00 33.09 ? 432 GLU A CA  1 
ATOM   1519 C C   . GLU A 1 224 ? 1.293   -10.957 -25.091 1.00 32.76 ? 432 GLU A C   1 
ATOM   1520 O O   . GLU A 1 224 ? 1.264   -9.849  -25.650 1.00 28.64 ? 432 GLU A O   1 
ATOM   1521 C CB  . GLU A 1 224 ? 0.791   -12.897 -26.562 1.00 34.77 ? 432 GLU A CB  1 
ATOM   1522 C CG  . GLU A 1 224 ? -0.127  -13.991 -27.105 1.00 39.34 ? 432 GLU A CG  1 
ATOM   1523 C CD  . GLU A 1 224 ? 0.471   -14.666 -28.352 1.00 44.11 ? 432 GLU A CD  1 
ATOM   1524 O OE1 . GLU A 1 224 ? 1.662   -14.434 -28.679 1.00 52.39 ? 432 GLU A OE1 1 
ATOM   1525 O OE2 . GLU A 1 224 ? -0.240  -15.419 -29.029 1.00 48.70 ? 432 GLU A OE2 1 
ATOM   1526 N N   . PRO A 1 225 ? 2.243   -11.305 -24.213 1.00 32.80 ? 433 PRO A N   1 
ATOM   1527 C CA  . PRO A 1 225 ? 3.336   -10.384 -23.944 1.00 34.97 ? 433 PRO A CA  1 
ATOM   1528 C C   . PRO A 1 225 ? 4.260   -10.243 -25.133 1.00 33.79 ? 433 PRO A C   1 
ATOM   1529 O O   . PRO A 1 225 ? 4.263   -11.114 -26.001 1.00 31.48 ? 433 PRO A O   1 
ATOM   1530 C CB  . PRO A 1 225 ? 4.078   -11.031 -22.761 1.00 34.69 ? 433 PRO A CB  1 
ATOM   1531 C CG  . PRO A 1 225 ? 3.699   -12.475 -22.785 1.00 35.22 ? 433 PRO A CG  1 
ATOM   1532 C CD  . PRO A 1 225 ? 2.330   -12.543 -23.414 1.00 36.13 ? 433 PRO A CD  1 
ATOM   1533 N N   . CYS A 1 226 ? 5.013   -9.142  -25.173 1.00 31.80 ? 434 CYS A N   1 
ATOM   1534 C CA  . CYS A 1 226 ? 6.050   -8.928  -26.181 1.00 33.35 ? 434 CYS A CA  1 
ATOM   1535 C C   . CYS A 1 226 ? 7.333   -8.447  -25.509 1.00 31.88 ? 434 CYS A C   1 
ATOM   1536 O O   . CYS A 1 226 ? 7.324   -7.422  -24.829 1.00 30.29 ? 434 CYS A O   1 
ATOM   1537 C CB  . CYS A 1 226 ? 5.603   -7.863  -27.197 1.00 35.03 ? 434 CYS A CB  1 
ATOM   1538 S SG  . CYS A 1 226 ? 6.783   -7.614  -28.545 1.00 41.56 ? 434 CYS A SG  1 
ATOM   1539 N N   . GLY A 1 227 ? 8.426   -9.181  -25.700 1.00 30.93 ? 435 GLY A N   1 
ATOM   1540 C CA  . GLY A 1 227 ? 9.743   -8.765  -25.208 1.00 32.89 ? 435 GLY A CA  1 
ATOM   1541 C C   . GLY A 1 227 ? 10.152  -7.459  -25.864 1.00 33.47 ? 435 GLY A C   1 
ATOM   1542 O O   . GLY A 1 227 ? 10.047  -7.321  -27.068 1.00 33.40 ? 435 GLY A O   1 
ATOM   1543 N N   . ILE A 1 228 ? 10.571  -6.471  -25.088 1.00 32.35 ? 436 ILE A N   1 
ATOM   1544 C CA  . ILE A 1 228 ? 11.085  -5.231  -25.678 1.00 31.26 ? 436 ILE A CA  1 
ATOM   1545 C C   . ILE A 1 228 ? 12.556  -4.990  -25.421 1.00 30.78 ? 436 ILE A C   1 
ATOM   1546 O O   . ILE A 1 228 ? 13.119  -4.004  -25.897 1.00 30.19 ? 436 ILE A O   1 
ATOM   1547 C CB  . ILE A 1 228 ? 10.280  -4.005  -25.209 1.00 31.86 ? 436 ILE A CB  1 
ATOM   1548 C CG1 . ILE A 1 228 ? 10.278  -3.893  -23.675 1.00 30.56 ? 436 ILE A CG1 1 
ATOM   1549 C CG2 . ILE A 1 228 ? 8.861   -4.101  -25.762 1.00 30.28 ? 436 ILE A CG2 1 
ATOM   1550 C CD1 . ILE A 1 228 ? 9.841   -2.534  -23.168 1.00 32.60 ? 436 ILE A CD1 1 
ATOM   1551 N N   . LYS A 1 229 ? 13.184  -5.860  -24.648 1.00 31.73 ? 437 LYS A N   1 
ATOM   1552 C CA  . LYS A 1 229 ? 14.573  -5.645  -24.228 1.00 31.03 ? 437 LYS A CA  1 
ATOM   1553 C C   . LYS A 1 229 ? 15.122  -6.935  -23.620 1.00 32.19 ? 437 LYS A C   1 
ATOM   1554 O O   . LYS A 1 229 ? 14.439  -7.594  -22.827 1.00 30.96 ? 437 LYS A O   1 
ATOM   1555 C CB  . LYS A 1 229 ? 14.649  -4.526  -23.189 1.00 32.22 ? 437 LYS A CB  1 
ATOM   1556 C CG  . LYS A 1 229 ? 16.045  -4.198  -22.673 1.00 33.95 ? 437 LYS A CG  1 
ATOM   1557 C CD  . LYS A 1 229 ? 16.990  -3.793  -23.813 1.00 34.35 ? 437 LYS A CD  1 
ATOM   1558 C CE  . LYS A 1 229 ? 18.121  -2.935  -23.288 1.00 35.63 ? 437 LYS A CE  1 
ATOM   1559 N NZ  . LYS A 1 229 ? 19.015  -2.498  -24.390 1.00 38.64 ? 437 LYS A NZ  1 
ATOM   1560 N N   . HIS A 1 230 ? 16.331  -7.300  -24.043 1.00 30.63 ? 438 HIS A N   1 
ATOM   1561 C CA  . HIS A 1 230 ? 17.062  -8.406  -23.498 1.00 31.90 ? 438 HIS A CA  1 
ATOM   1562 C C   . HIS A 1 230 ? 18.423  -7.829  -23.085 1.00 33.16 ? 438 HIS A C   1 
ATOM   1563 O O   . HIS A 1 230 ? 19.040  -7.087  -23.843 1.00 31.44 ? 438 HIS A O   1 
ATOM   1564 C CB  . HIS A 1 230 ? 17.174  -9.481  -24.573 1.00 34.47 ? 438 HIS A CB  1 
ATOM   1565 C CG  . HIS A 1 230 ? 17.954  -10.682 -24.151 1.00 35.08 ? 438 HIS A CG  1 
ATOM   1566 N ND1 . HIS A 1 230 ? 19.330  -10.670 -24.016 1.00 36.15 ? 438 HIS A ND1 1 
ATOM   1567 C CD2 . HIS A 1 230 ? 17.556  -11.944 -23.870 1.00 35.05 ? 438 HIS A CD2 1 
ATOM   1568 C CE1 . HIS A 1 230 ? 19.738  -11.866 -23.634 1.00 34.66 ? 438 HIS A CE1 1 
ATOM   1569 N NE2 . HIS A 1 230 ? 18.684  -12.659 -23.553 1.00 36.87 ? 438 HIS A NE2 1 
ATOM   1570 N N   . ILE A 1 231 ? 18.851  -8.148  -21.872 1.00 31.30 ? 439 ILE A N   1 
ATOM   1571 C CA  . ILE A 1 231 ? 20.108  -7.687  -21.289 1.00 33.42 ? 439 ILE A CA  1 
ATOM   1572 C C   . ILE A 1 231 ? 20.886  -8.938  -20.852 1.00 33.69 ? 439 ILE A C   1 
ATOM   1573 O O   . ILE A 1 231 ? 20.323  -9.803  -20.170 1.00 34.26 ? 439 ILE A O   1 
ATOM   1574 C CB  . ILE A 1 231 ? 19.806  -6.802  -20.053 1.00 35.46 ? 439 ILE A CB  1 
ATOM   1575 C CG1 . ILE A 1 231 ? 19.310  -5.426  -20.482 1.00 40.43 ? 439 ILE A CG1 1 
ATOM   1576 C CG2 . ILE A 1 231 ? 20.994  -6.605  -19.154 1.00 36.56 ? 439 ILE A CG2 1 
ATOM   1577 C CD1 . ILE A 1 231 ? 18.694  -4.643  -19.333 1.00 41.50 ? 439 ILE A CD1 1 
ATOM   1578 N N   . ASP A 1 232 ? 22.152  -9.046  -21.267 1.00 33.66 ? 440 ASP A N   1 
ATOM   1579 C CA  . ASP A 1 232 ? 23.119  -9.958  -20.639 1.00 35.54 ? 440 ASP A CA  1 
ATOM   1580 C C   . ASP A 1 232 ? 24.110  -9.096  -19.905 1.00 37.18 ? 440 ASP A C   1 
ATOM   1581 O O   . ASP A 1 232 ? 24.792  -8.258  -20.530 1.00 31.16 ? 440 ASP A O   1 
ATOM   1582 C CB  . ASP A 1 232 ? 23.857  -10.854 -21.638 1.00 40.60 ? 440 ASP A CB  1 
ATOM   1583 C CG  . ASP A 1 232 ? 24.619  -12.011 -20.934 1.00 42.85 ? 440 ASP A CG  1 
ATOM   1584 O OD1 . ASP A 1 232 ? 25.473  -11.777 -20.037 1.00 39.42 ? 440 ASP A OD1 1 
ATOM   1585 O OD2 . ASP A 1 232 ? 24.331  -13.170 -21.270 1.00 42.56 ? 440 ASP A OD2 1 
ATOM   1586 N N   . CYS A 1 233 ? 24.191  -9.288  -18.586 1.00 35.93 ? 441 CYS A N   1 
ATOM   1587 C CA  . CYS A 1 233 ? 25.004  -8.405  -17.745 1.00 40.51 ? 441 CYS A CA  1 
ATOM   1588 C C   . CYS A 1 233 ? 26.509  -8.539  -17.970 1.00 40.23 ? 441 CYS A C   1 
ATOM   1589 O O   . CYS A 1 233 ? 27.267  -7.695  -17.504 1.00 44.48 ? 441 CYS A O   1 
ATOM   1590 C CB  . CYS A 1 233 ? 24.692  -8.621  -16.266 1.00 40.54 ? 441 CYS A CB  1 
ATOM   1591 S SG  . CYS A 1 233 ? 22.986  -8.220  -15.817 1.00 42.47 ? 441 CYS A SG  1 
ATOM   1592 N N   . HIS A 1 234 ? 26.939  -9.606  -18.644 1.00 38.74 ? 442 HIS A N   1 
ATOM   1593 C CA  . HIS A 1 234 ? 28.351  -9.780  -18.988 1.00 41.32 ? 442 HIS A CA  1 
ATOM   1594 C C   . HIS A 1 234 ? 28.761  -8.803  -20.092 1.00 42.86 ? 442 HIS A C   1 
ATOM   1595 O O   . HIS A 1 234 ? 29.860  -8.258  -20.062 1.00 45.27 ? 442 HIS A O   1 
ATOM   1596 C CB  . HIS A 1 234 ? 28.642  -11.230 -19.412 1.00 40.08 ? 442 HIS A CB  1 
ATOM   1597 C CG  . HIS A 1 234 ? 28.449  -12.227 -18.309 1.00 41.05 ? 442 HIS A CG  1 
ATOM   1598 N ND1 . HIS A 1 234 ? 27.317  -13.002 -18.198 1.00 39.81 ? 442 HIS A ND1 1 
ATOM   1599 C CD2 . HIS A 1 234 ? 29.225  -12.547 -17.245 1.00 41.06 ? 442 HIS A CD2 1 
ATOM   1600 C CE1 . HIS A 1 234 ? 27.408  -13.770 -17.130 1.00 39.60 ? 442 HIS A CE1 1 
ATOM   1601 N NE2 . HIS A 1 234 ? 28.555  -13.516 -16.533 1.00 39.08 ? 442 HIS A NE2 1 
ATOM   1602 N N   . THR A 1 235 ? 27.858  -8.548  -21.029 1.00 40.64 ? 443 THR A N   1 
ATOM   1603 C CA  . THR A 1 235 ? 28.189  -7.757  -22.209 1.00 42.92 ? 443 THR A CA  1 
ATOM   1604 C C   . THR A 1 235 ? 27.482  -6.411  -22.284 1.00 46.45 ? 443 THR A C   1 
ATOM   1605 O O   . THR A 1 235 ? 27.779  -5.644  -23.176 1.00 48.78 ? 443 THR A O   1 
ATOM   1606 C CB  . THR A 1 235 ? 27.869  -8.554  -23.487 1.00 40.03 ? 443 THR A CB  1 
ATOM   1607 O OG1 . THR A 1 235 ? 26.508  -8.943  -23.457 1.00 36.55 ? 443 THR A OG1 1 
ATOM   1608 C CG2 . THR A 1 235 ? 28.715  -9.827  -23.564 1.00 40.82 ? 443 THR A CG2 1 
ATOM   1609 N N   . THR A 1 236 ? 26.577  -6.105  -21.352 1.00 48.11 ? 444 THR A N   1 
ATOM   1610 C CA  . THR A 1 236 ? 25.854  -4.828  -21.378 1.00 48.80 ? 444 THR A CA  1 
ATOM   1611 C C   . THR A 1 236 ? 26.705  -3.629  -20.860 1.00 48.92 ? 444 THR A C   1 
ATOM   1612 O O   . THR A 1 236 ? 27.512  -3.770  -19.935 1.00 50.25 ? 444 THR A O   1 
ATOM   1613 C CB  . THR A 1 236 ? 24.535  -4.943  -20.566 1.00 51.26 ? 444 THR A CB  1 
ATOM   1614 O OG1 . THR A 1 236 ? 23.748  -6.034  -21.069 1.00 55.59 ? 444 THR A OG1 1 
ATOM   1615 C CG2 . THR A 1 236 ? 23.700  -3.693  -20.681 1.00 52.17 ? 444 THR A CG2 1 
ATOM   1616 N N   . SER A 1 237 ? 26.511  -2.446  -21.449 1.00 45.47 ? 445 SER A N   1 
ATOM   1617 C CA  . SER A 1 237 ? 27.074  -1.192  -20.893 1.00 46.39 ? 445 SER A CA  1 
ATOM   1618 C C   . SER A 1 237 ? 25.934  -0.284  -20.404 1.00 47.10 ? 445 SER A C   1 
ATOM   1619 O O   . SER A 1 237 ? 24.760  -0.578  -20.666 1.00 44.75 ? 445 SER A O   1 
ATOM   1620 C CB  . SER A 1 237 ? 27.901  -0.467  -21.947 1.00 46.24 ? 445 SER A CB  1 
ATOM   1621 O OG  . SER A 1 237 ? 27.079  -0.103  -23.042 1.00 51.49 ? 445 SER A OG  1 
ATOM   1622 N N   . ILE A 1 238 ? 26.272  0.793   -19.690 1.00 46.36 ? 446 ILE A N   1 
ATOM   1623 C CA  . ILE A 1 238 ? 25.258  1.724   -19.165 1.00 50.26 ? 446 ILE A CA  1 
ATOM   1624 C C   . ILE A 1 238 ? 24.506  2.373   -20.313 1.00 47.78 ? 446 ILE A C   1 
ATOM   1625 O O   . ILE A 1 238 ? 23.329  2.649   -20.210 1.00 47.04 ? 446 ILE A O   1 
ATOM   1626 C CB  . ILE A 1 238 ? 25.840  2.838   -18.257 1.00 54.27 ? 446 ILE A CB  1 
ATOM   1627 C CG1 . ILE A 1 238 ? 26.959  3.603   -18.971 1.00 59.71 ? 446 ILE A CG1 1 
ATOM   1628 C CG2 . ILE A 1 238 ? 26.322  2.259   -16.931 1.00 58.28 ? 446 ILE A CG2 1 
ATOM   1629 N N   . SER A 1 239 ? 25.230  2.591   -21.401 1.00 50.55 ? 447 SER A N   1 
ATOM   1630 C CA  . SER A 1 239 ? 24.709  3.051   -22.677 1.00 47.89 ? 447 SER A CA  1 
ATOM   1631 C C   . SER A 1 239 ? 23.501  2.225   -23.219 1.00 46.76 ? 447 SER A C   1 
ATOM   1632 O O   . SER A 1 239 ? 22.546  2.775   -23.776 1.00 40.99 ? 447 SER A O   1 
ATOM   1633 C CB  . SER A 1 239 ? 25.895  3.036   -23.647 1.00 47.34 ? 447 SER A CB  1 
ATOM   1634 O OG  . SER A 1 239 ? 25.514  3.264   -24.965 1.00 50.78 ? 447 SER A OG  1 
ATOM   1635 N N   . ASP A 1 240 ? 23.519  0.911   -23.029 1.00 45.84 ? 448 ASP A N   1 
ATOM   1636 C CA  . ASP A 1 240 ? 22.416  0.055   -23.518 1.00 44.31 ? 448 ASP A CA  1 
ATOM   1637 C C   . ASP A 1 240 ? 21.121  0.170   -22.723 1.00 40.72 ? 448 ASP A C   1 
ATOM   1638 O O   . ASP A 1 240 ? 20.088  -0.323  -23.155 1.00 42.13 ? 448 ASP A O   1 
ATOM   1639 C CB  . ASP A 1 240 ? 22.843  -1.403  -23.517 1.00 45.90 ? 448 ASP A CB  1 
ATOM   1640 C CG  . ASP A 1 240 ? 24.042  -1.646  -24.382 1.00 47.30 ? 448 ASP A CG  1 
ATOM   1641 O OD1 . ASP A 1 240 ? 24.036  -1.173  -25.532 1.00 53.10 ? 448 ASP A OD1 1 
ATOM   1642 O OD2 . ASP A 1 240 ? 24.986  -2.306  -23.916 1.00 53.30 ? 448 ASP A OD2 1 
ATOM   1643 N N   . LEU A 1 241 ? 21.171  0.819   -21.567 1.00 40.44 ? 449 LEU A N   1 
ATOM   1644 C CA  . LEU A 1 241 ? 19.989  0.933   -20.714 1.00 43.52 ? 449 LEU A CA  1 
ATOM   1645 C C   . LEU A 1 241 ? 19.009  1.999   -21.191 1.00 43.51 ? 449 LEU A C   1 
ATOM   1646 O O   . LEU A 1 241 ? 17.890  2.068   -20.698 1.00 48.10 ? 449 LEU A O   1 
ATOM   1647 C CB  . LEU A 1 241 ? 20.401  1.206   -19.259 1.00 44.83 ? 449 LEU A CB  1 
ATOM   1648 C CG  . LEU A 1 241 ? 21.506  0.276   -18.712 1.00 47.67 ? 449 LEU A CG  1 
ATOM   1649 C CD1 . LEU A 1 241 ? 21.616  0.406   -17.199 1.00 48.66 ? 449 LEU A CD1 1 
ATOM   1650 C CD2 . LEU A 1 241 ? 21.275  -1.178  -19.121 1.00 48.02 ? 449 LEU A CD2 1 
ATOM   1651 N N   . GLU A 1 242 ? 19.436  2.844   -22.118 1.00 43.28 ? 450 GLU A N   1 
ATOM   1652 C CA  . GLU A 1 242 ? 18.540  3.747   -22.823 1.00 42.14 ? 450 GLU A CA  1 
ATOM   1653 C C   . GLU A 1 242 ? 18.334  3.120   -24.177 1.00 41.43 ? 450 GLU A C   1 
ATOM   1654 O O   . GLU A 1 242 ? 19.277  2.960   -24.915 1.00 45.70 ? 450 GLU A O   1 
ATOM   1655 C CB  . GLU A 1 242 ? 19.186  5.106   -22.992 1.00 43.35 ? 450 GLU A CB  1 
ATOM   1656 C CG  . GLU A 1 242 ? 19.361  5.875   -21.702 1.00 45.98 ? 450 GLU A CG  1 
ATOM   1657 C CD  . GLU A 1 242 ? 19.845  7.289   -21.963 1.00 51.59 ? 450 GLU A CD  1 
ATOM   1658 O OE1 . GLU A 1 242 ? 20.935  7.430   -22.559 1.00 56.78 ? 450 GLU A OE1 1 
ATOM   1659 O OE2 . GLU A 1 242 ? 19.143  8.256   -21.584 1.00 51.31 ? 450 GLU A OE2 1 
ATOM   1660 N N   . PHE A 1 243 ? 17.108  2.737   -24.498 1.00 36.24 ? 451 PHE A N   1 
ATOM   1661 C CA  . PHE A 1 243 ? 16.866  1.972   -25.692 1.00 32.90 ? 451 PHE A CA  1 
ATOM   1662 C C   . PHE A 1 243 ? 15.495  2.265   -26.262 1.00 31.68 ? 451 PHE A C   1 
ATOM   1663 O O   . PHE A 1 243 ? 14.670  2.902   -25.618 1.00 31.85 ? 451 PHE A O   1 
ATOM   1664 C CB  . PHE A 1 243 ? 16.999  0.488   -25.380 1.00 31.91 ? 451 PHE A CB  1 
ATOM   1665 C CG  . PHE A 1 243 ? 15.912  -0.030  -24.503 1.00 31.50 ? 451 PHE A CG  1 
ATOM   1666 C CD1 . PHE A 1 243 ? 16.025  0.044   -23.139 1.00 33.53 ? 451 PHE A CD1 1 
ATOM   1667 C CD2 . PHE A 1 243 ? 14.749  -0.544  -25.050 1.00 32.95 ? 451 PHE A CD2 1 
ATOM   1668 C CE1 . PHE A 1 243 ? 15.010  -0.423  -22.327 1.00 32.68 ? 451 PHE A CE1 1 
ATOM   1669 C CE2 . PHE A 1 243 ? 13.730  -0.999  -24.251 1.00 33.01 ? 451 PHE A CE2 1 
ATOM   1670 C CZ  . PHE A 1 243 ? 13.863  -0.939  -22.885 1.00 31.48 ? 451 PHE A CZ  1 
ATOM   1671 N N   . SER A 1 244 ? 15.288  1.792   -27.480 1.00 30.20 ? 452 SER A N   1 
ATOM   1672 C CA  . SER A 1 244 ? 14.066  1.990   -28.232 1.00 33.53 ? 452 SER A CA  1 
ATOM   1673 C C   . SER A 1 244 ? 13.687  0.656   -28.773 1.00 33.03 ? 452 SER A C   1 
ATOM   1674 O O   . SER A 1 244 ? 14.554  -0.133  -29.152 1.00 36.87 ? 452 SER A O   1 
ATOM   1675 C CB  . SER A 1 244 ? 14.303  2.946   -29.406 1.00 33.77 ? 452 SER A CB  1 
ATOM   1676 O OG  . SER A 1 244 ? 13.911  4.245   -29.086 1.00 34.88 ? 452 SER A OG  1 
ATOM   1677 N N   . SER A 1 245 ? 12.402  0.368   -28.823 1.00 33.26 ? 453 SER A N   1 
ATOM   1678 C CA  . SER A 1 245 ? 11.999  -0.880  -29.410 1.00 33.39 ? 453 SER A CA  1 
ATOM   1679 C C   . SER A 1 245 ? 10.631  -0.765  -30.062 1.00 32.88 ? 453 SER A C   1 
ATOM   1680 O O   . SER A 1 245 ? 9.700   -0.189  -29.488 1.00 31.95 ? 453 SER A O   1 
ATOM   1681 C CB  . SER A 1 245 ? 12.073  -1.976  -28.335 1.00 36.04 ? 453 SER A CB  1 
ATOM   1682 O OG  . SER A 1 245 ? 11.402  -3.146  -28.745 1.00 41.58 ? 453 SER A OG  1 
ATOM   1683 N N   . ASP A 1 246 ? 10.527  -1.252  -31.301 1.00 30.64 ? 454 ASP A N   1 
ATOM   1684 C CA  . ASP A 1 246 ? 9.220   -1.433  -31.936 1.00 35.52 ? 454 ASP A CA  1 
ATOM   1685 C C   . ASP A 1 246 ? 8.643   -2.689  -31.326 1.00 37.34 ? 454 ASP A C   1 
ATOM   1686 O O   . ASP A 1 246 ? 9.394   -3.577  -30.991 1.00 42.20 ? 454 ASP A O   1 
ATOM   1687 C CB  . ASP A 1 246 ? 9.380   -1.551  -33.448 1.00 38.67 ? 454 ASP A CB  1 
ATOM   1688 C CG  . ASP A 1 246 ? 9.909   -0.245  -34.065 1.00 40.85 ? 454 ASP A CG  1 
ATOM   1689 O OD1 . ASP A 1 246 ? 9.201   0.767   -34.074 1.00 45.76 ? 454 ASP A OD1 1 
ATOM   1690 O OD2 . ASP A 1 246 ? 11.060  -0.200  -34.490 1.00 48.48 ? 454 ASP A OD2 1 
ATOM   1691 N N   . PHE A 1 247 ? 7.334   -2.760  -31.121 1.00 33.40 ? 455 PHE A N   1 
ATOM   1692 C CA  . PHE A 1 247 ? 6.746   -3.967  -30.563 1.00 30.96 ? 455 PHE A CA  1 
ATOM   1693 C C   . PHE A 1 247 ? 5.418   -4.278  -31.252 1.00 30.93 ? 455 PHE A C   1 
ATOM   1694 O O   . PHE A 1 247 ? 4.798   -3.398  -31.854 1.00 28.21 ? 455 PHE A O   1 
ATOM   1695 C CB  . PHE A 1 247 ? 6.566   -3.869  -29.034 1.00 32.43 ? 455 PHE A CB  1 
ATOM   1696 C CG  . PHE A 1 247 ? 5.649   -2.745  -28.576 1.00 32.26 ? 455 PHE A CG  1 
ATOM   1697 C CD1 . PHE A 1 247 ? 4.267   -2.897  -28.577 1.00 31.18 ? 455 PHE A CD1 1 
ATOM   1698 C CD2 . PHE A 1 247 ? 6.178   -1.537  -28.139 1.00 30.76 ? 455 PHE A CD2 1 
ATOM   1699 C CE1 . PHE A 1 247 ? 3.434   -1.880  -28.147 1.00 33.50 ? 455 PHE A CE1 1 
ATOM   1700 C CE2 . PHE A 1 247 ? 5.348   -0.503  -27.722 1.00 30.38 ? 455 PHE A CE2 1 
ATOM   1701 C CZ  . PHE A 1 247 ? 3.974   -0.665  -27.732 1.00 30.94 ? 455 PHE A CZ  1 
ATOM   1702 N N   . THR A 1 248 ? 5.016   -5.541  -31.169 1.00 30.12 ? 456 THR A N   1 
ATOM   1703 C CA  . THR A 1 248 ? 3.745   -6.000  -31.697 1.00 33.45 ? 456 THR A CA  1 
ATOM   1704 C C   . THR A 1 248 ? 3.030   -6.822  -30.642 1.00 31.25 ? 456 THR A C   1 
ATOM   1705 O O   . THR A 1 248 ? 3.583   -7.796  -30.127 1.00 33.33 ? 456 THR A O   1 
ATOM   1706 C CB  . THR A 1 248 ? 3.973   -6.810  -32.967 1.00 34.89 ? 456 THR A CB  1 
ATOM   1707 O OG1 . THR A 1 248 ? 4.754   -6.005  -33.848 1.00 38.03 ? 456 THR A OG1 1 
ATOM   1708 C CG2 . THR A 1 248 ? 2.651   -7.169  -33.636 1.00 36.56 ? 456 THR A CG2 1 
ATOM   1709 N N   . LEU A 1 249 ? 1.847   -6.369  -30.241 1.00 30.50 ? 457 LEU A N   1 
ATOM   1710 C CA  . LEU A 1 249 ? 1.080   -7.087  -29.234 1.00 30.49 ? 457 LEU A CA  1 
ATOM   1711 C C   . LEU A 1 249 ? 0.031   -7.908  -29.935 1.00 31.66 ? 457 LEU A C   1 
ATOM   1712 O O   . LEU A 1 249 ? -0.780  -7.368  -30.665 1.00 32.65 ? 457 LEU A O   1 
ATOM   1713 C CB  . LEU A 1 249 ? 0.430   -6.127  -28.240 1.00 30.46 ? 457 LEU A CB  1 
ATOM   1714 C CG  . LEU A 1 249 ? 1.463   -5.218  -27.566 1.00 31.68 ? 457 LEU A CG  1 
ATOM   1715 C CD1 . LEU A 1 249 ? 0.803   -4.212  -26.665 1.00 32.97 ? 457 LEU A CD1 1 
ATOM   1716 C CD2 . LEU A 1 249 ? 2.457   -6.044  -26.766 1.00 34.25 ? 457 LEU A CD2 1 
ATOM   1717 N N   . LYS A 1 250 ? 0.053   -9.212  -29.705 1.00 30.91 ? 458 LYS A N   1 
ATOM   1718 C CA  . LYS A 1 250 ? -0.890  -10.106 -30.371 1.00 31.61 ? 458 LYS A CA  1 
ATOM   1719 C C   . LYS A 1 250 ? -2.112  -10.151 -29.502 1.00 29.08 ? 458 LYS A C   1 
ATOM   1720 O O   . LYS A 1 250 ? -2.105  -10.778 -28.456 1.00 28.87 ? 458 LYS A O   1 
ATOM   1721 C CB  . LYS A 1 250 ? -0.287  -11.499 -30.553 1.00 32.73 ? 458 LYS A CB  1 
ATOM   1722 C CG  . LYS A 1 250 ? 0.888   -11.532 -31.522 1.00 33.88 ? 458 LYS A CG  1 
ATOM   1723 N N   . ILE A 1 251 ? -3.145  -9.437  -29.932 1.00 28.68 ? 459 ILE A N   1 
ATOM   1724 C CA  . ILE A 1 251 ? -4.376  -9.281  -29.178 1.00 28.40 ? 459 ILE A CA  1 
ATOM   1725 C C   . ILE A 1 251 ? -5.152  -10.596 -29.070 1.00 31.34 ? 459 ILE A C   1 
ATOM   1726 O O   . ILE A 1 251 ? -5.333  -11.310 -30.072 1.00 30.24 ? 459 ILE A O   1 
ATOM   1727 C CB  . ILE A 1 251 ? -5.270  -8.200  -29.832 1.00 28.10 ? 459 ILE A CB  1 
ATOM   1728 C CG1 . ILE A 1 251 ? -4.536  -6.840  -29.900 1.00 28.06 ? 459 ILE A CG1 1 
ATOM   1729 C CG2 . ILE A 1 251 ? -6.594  -8.084  -29.125 1.00 29.37 ? 459 ILE A CG2 1 
ATOM   1730 C CD1 . ILE A 1 251 ? -4.044  -6.339  -28.568 1.00 26.59 ? 459 ILE A CD1 1 
ATOM   1731 N N   . THR A 1 252 ? -5.628  -10.906 -27.867 1.00 30.29 ? 460 THR A N   1 
ATOM   1732 C CA  . THR A 1 252 ? -6.284  -12.192 -27.628 1.00 30.81 ? 460 THR A CA  1 
ATOM   1733 C C   . THR A 1 252 ? -7.731  -12.048 -27.207 1.00 32.76 ? 460 THR A C   1 
ATOM   1734 O O   . THR A 1 252 ? -8.401  -13.050 -27.020 1.00 33.25 ? 460 THR A O   1 
ATOM   1735 C CB  . THR A 1 252 ? -5.571  -12.964 -26.520 1.00 31.67 ? 460 THR A CB  1 
ATOM   1736 O OG1 . THR A 1 252 ? -5.385  -12.088 -25.411 1.00 31.64 ? 460 THR A OG1 1 
ATOM   1737 C CG2 . THR A 1 252 ? -4.205  -13.511 -27.011 1.00 31.20 ? 460 THR A CG2 1 
ATOM   1738 N N   . ARG A 1 253 ? -8.213  -10.820 -27.039 1.00 31.33 ? 461 ARG A N   1 
ATOM   1739 C CA  A ARG A 1 253 ? -9.606  -10.606 -26.696 0.50 32.07 ? 461 ARG A CA  1 
ATOM   1740 C CA  B ARG A 1 253 ? -9.600  -10.590 -26.676 0.50 32.46 ? 461 ARG A CA  1 
ATOM   1741 C C   . ARG A 1 253 ? -10.093 -9.289  -27.280 1.00 33.79 ? 461 ARG A C   1 
ATOM   1742 O O   . ARG A 1 253 ? -9.459  -8.249  -27.126 1.00 32.33 ? 461 ARG A O   1 
ATOM   1743 C CB  A ARG A 1 253 ? -9.822  -10.655 -25.177 0.50 33.17 ? 461 ARG A CB  1 
ATOM   1744 C CB  B ARG A 1 253 ? -9.772  -10.559 -25.156 0.50 34.12 ? 461 ARG A CB  1 
ATOM   1745 C CG  A ARG A 1 253 ? -11.238 -11.051 -24.769 0.50 32.60 ? 461 ARG A CG  1 
ATOM   1746 C CG  B ARG A 1 253 ? -11.123 -10.021 -24.703 0.50 34.31 ? 461 ARG A CG  1 
ATOM   1747 C CD  A ARG A 1 253 ? -11.295 -11.633 -23.357 0.50 33.98 ? 461 ARG A CD  1 
ATOM   1748 C CD  B ARG A 1 253 ? -11.546 -10.598 -23.374 0.50 35.77 ? 461 ARG A CD  1 
ATOM   1749 N NE  A ARG A 1 253 ? -11.226 -10.595 -22.331 0.50 34.75 ? 461 ARG A NE  1 
ATOM   1750 N NE  B ARG A 1 253 ? -10.643 -10.251 -22.280 0.50 35.84 ? 461 ARG A NE  1 
ATOM   1751 C CZ  A ARG A 1 253 ? -10.397 -10.592 -21.292 0.50 32.59 ? 461 ARG A CZ  1 
ATOM   1752 C CZ  B ARG A 1 253 ? -10.760 -9.158  -21.527 0.50 35.48 ? 461 ARG A CZ  1 
ATOM   1753 N NH1 A ARG A 1 253 ? -10.439 -9.580  -20.429 0.50 30.45 ? 461 ARG A NH1 1 
ATOM   1754 N NH1 B ARG A 1 253 ? -9.900  -8.952  -20.543 0.50 34.35 ? 461 ARG A NH1 1 
ATOM   1755 N NH2 A ARG A 1 253 ? -9.535  -11.583 -21.108 0.50 32.64 ? 461 ARG A NH2 1 
ATOM   1756 N NH2 B ARG A 1 253 ? -11.728 -8.273  -21.750 0.50 32.98 ? 461 ARG A NH2 1 
ATOM   1757 N N   . THR A 1 254 ? -11.218 -9.371  -27.981 1.00 30.30 ? 462 THR A N   1 
ATOM   1758 C CA  . THR A 1 254 ? -11.921 -8.227  -28.483 1.00 30.82 ? 462 THR A CA  1 
ATOM   1759 C C   . THR A 1 254 ? -12.443 -7.411  -27.288 1.00 29.96 ? 462 THR A C   1 
ATOM   1760 O O   . THR A 1 254 ? -13.249 -7.887  -26.489 1.00 30.01 ? 462 THR A O   1 
ATOM   1761 C CB  . THR A 1 254 ? -13.065 -8.679  -29.427 1.00 31.33 ? 462 THR A CB  1 
ATOM   1762 O OG1 . THR A 1 254 ? -12.489 -9.310  -30.573 1.00 30.31 ? 462 THR A OG1 1 
ATOM   1763 C CG2 . THR A 1 254 ? -13.854 -7.476  -29.914 1.00 33.77 ? 462 THR A CG2 1 
ATOM   1764 N N   . SER A 1 255 ? -11.916 -6.202  -27.144 1.00 30.27 ? 463 SER A N   1 
ATOM   1765 C CA  . SER A 1 255 ? -12.109 -5.424  -25.931 1.00 30.27 ? 463 SER A CA  1 
ATOM   1766 C C   . SER A 1 255 ? -11.652 -3.984  -26.165 1.00 28.85 ? 463 SER A C   1 
ATOM   1767 O O   . SER A 1 255 ? -11.164 -3.661  -27.238 1.00 25.79 ? 463 SER A O   1 
ATOM   1768 C CB  . SER A 1 255 ? -11.289 -6.048  -24.798 1.00 31.36 ? 463 SER A CB  1 
ATOM   1769 O OG  . SER A 1 255 ? -9.923  -6.131  -25.197 1.00 32.37 ? 463 SER A OG  1 
ATOM   1770 N N   . MET A 1 256 ? -11.840 -3.137  -25.156 1.00 29.42 ? 464 MET A N   1 
ATOM   1771 C CA  . MET A 1 256 ? -11.271 -1.787  -25.114 1.00 30.03 ? 464 MET A CA  1 
ATOM   1772 C C   . MET A 1 256 ? -9.915  -1.841  -24.401 1.00 28.48 ? 464 MET A C   1 
ATOM   1773 O O   . MET A 1 256 ? -9.836  -2.252  -23.247 1.00 28.43 ? 464 MET A O   1 
ATOM   1774 C CB  . MET A 1 256 ? -12.226 -0.887  -24.326 1.00 34.97 ? 464 MET A CB  1 
ATOM   1775 C CG  . MET A 1 256 ? -11.889 0.583   -24.340 1.00 36.66 ? 464 MET A CG  1 
ATOM   1776 S SD  . MET A 1 256 ? -12.094 1.379   -25.942 1.00 38.81 ? 464 MET A SD  1 
ATOM   1777 C CE  . MET A 1 256 ? -13.503 0.548   -26.635 1.00 38.65 ? 464 MET A CE  1 
ATOM   1778 N N   . CYS A 1 257 ? -8.857  -1.442  -25.097 1.00 27.86 ? 465 CYS A N   1 
ATOM   1779 C CA  . CYS A 1 257 ? -7.526  -1.330  -24.516 1.00 28.39 ? 465 CYS A CA  1 
ATOM   1780 C C   . CYS A 1 257 ? -7.445  -0.015  -23.754 1.00 27.81 ? 465 CYS A C   1 
ATOM   1781 O O   . CYS A 1 257 ? -7.711  1.058   -24.321 1.00 25.98 ? 465 CYS A O   1 
ATOM   1782 C CB  . CYS A 1 257 ? -6.469  -1.327  -25.603 1.00 28.13 ? 465 CYS A CB  1 
ATOM   1783 S SG  . CYS A 1 257 ? -4.787  -1.305  -24.946 1.00 26.48 ? 465 CYS A SG  1 
ATOM   1784 N N   . THR A 1 258 ? -7.129  -0.098  -22.464 1.00 24.46 ? 466 THR A N   1 
ATOM   1785 C CA  . THR A 1 258 ? -7.137  1.087   -21.602 1.00 24.07 ? 466 THR A CA  1 
ATOM   1786 C C   . THR A 1 258 ? -5.772  1.430   -21.010 1.00 24.65 ? 466 THR A C   1 
ATOM   1787 O O   . THR A 1 258 ? -5.619  2.508   -20.460 1.00 24.92 ? 466 THR A O   1 
ATOM   1788 C CB  . THR A 1 258 ? -8.099  0.901   -20.428 1.00 24.09 ? 466 THR A CB  1 
ATOM   1789 O OG1 . THR A 1 258 ? -7.702  -0.245  -19.677 1.00 24.85 ? 466 THR A OG1 1 
ATOM   1790 C CG2 . THR A 1 258 ? -9.509  0.701   -20.908 1.00 24.30 ? 466 THR A CG2 1 
ATOM   1791 N N   . ALA A 1 259 ? -4.817  0.484   -21.067 1.00 25.87 ? 467 ALA A N   1 
ATOM   1792 C CA  . ALA A 1 259 ? -3.471  0.668   -20.542 1.00 25.44 ? 467 ALA A CA  1 
ATOM   1793 C C   . ALA A 1 259 ? -2.508  -0.335  -21.183 1.00 24.77 ? 467 ALA A C   1 
ATOM   1794 O O   . ALA A 1 259 ? -2.936  -1.333  -21.779 1.00 25.79 ? 467 ALA A O   1 
ATOM   1795 C CB  . ALA A 1 259 ? -3.489  0.481   -19.023 1.00 25.65 ? 467 ALA A CB  1 
ATOM   1796 N N   . ILE A 1 260 ? -1.219  -0.051  -21.041 1.00 24.13 ? 468 ILE A N   1 
ATOM   1797 C CA  . ILE A 1 260 ? -0.136  -0.970  -21.335 1.00 24.47 ? 468 ILE A CA  1 
ATOM   1798 C C   . ILE A 1 260 ? 0.630   -1.257  -20.046 1.00 26.27 ? 468 ILE A C   1 
ATOM   1799 O O   . ILE A 1 260 ? 1.021   -0.331  -19.304 1.00 24.31 ? 468 ILE A O   1 
ATOM   1800 C CB  . ILE A 1 260 ? 0.830   -0.410  -22.420 1.00 24.15 ? 468 ILE A CB  1 
ATOM   1801 C CG1 . ILE A 1 260 ? 0.096   -0.164  -23.744 1.00 25.54 ? 468 ILE A CG1 1 
ATOM   1802 C CG2 . ILE A 1 260 ? 2.004   -1.346  -22.657 1.00 25.38 ? 468 ILE A CG2 1 
ATOM   1803 C CD1 . ILE A 1 260 ? -0.617  -1.369  -24.328 1.00 24.99 ? 468 ILE A CD1 1 
ATOM   1804 N N   . ALA A 1 261 ? 0.828   -2.542  -19.757 1.00 25.06 ? 469 ALA A N   1 
ATOM   1805 C CA  . ALA A 1 261 ? 1.585   -2.928  -18.572 1.00 25.27 ? 469 ALA A CA  1 
ATOM   1806 C C   . ALA A 1 261 ? 2.971   -3.415  -18.950 1.00 25.40 ? 469 ALA A C   1 
ATOM   1807 O O   . ALA A 1 261 ? 3.189   -3.952  -20.043 1.00 25.79 ? 469 ALA A O   1 
ATOM   1808 C CB  . ALA A 1 261 ? 0.842   -3.984  -17.792 1.00 25.60 ? 469 ALA A CB  1 
ATOM   1809 N N   . GLY A 1 262 ? 3.908   -3.243  -18.030 1.00 25.19 ? 470 GLY A N   1 
ATOM   1810 C CA  . GLY A 1 262 ? 5.255   -3.739  -18.212 1.00 25.57 ? 470 GLY A CA  1 
ATOM   1811 C C   . GLY A 1 262 ? 5.744   -4.526  -17.018 1.00 25.26 ? 470 GLY A C   1 
ATOM   1812 O O   . GLY A 1 262 ? 5.280   -4.312  -15.894 1.00 24.97 ? 470 GLY A O   1 
ATOM   1813 N N   . TYR A 1 263 ? 6.689   -5.425  -17.278 1.00 23.14 ? 471 TYR A N   1 
ATOM   1814 C CA  . TYR A 1 263 ? 7.286   -6.252  -16.246 1.00 24.60 ? 471 TYR A CA  1 
ATOM   1815 C C   . TYR A 1 263 ? 8.564   -6.825  -16.773 1.00 24.76 ? 471 TYR A C   1 
ATOM   1816 O O   . TYR A 1 263 ? 8.965   -6.489  -17.895 1.00 24.26 ? 471 TYR A O   1 
ATOM   1817 C CB  . TYR A 1 263 ? 6.326   -7.367  -15.843 1.00 25.32 ? 471 TYR A CB  1 
ATOM   1818 C CG  . TYR A 1 263 ? 5.985   -8.369  -16.916 1.00 25.89 ? 471 TYR A CG  1 
ATOM   1819 C CD1 . TYR A 1 263 ? 6.745   -9.529  -17.083 1.00 27.01 ? 471 TYR A CD1 1 
ATOM   1820 C CD2 . TYR A 1 263 ? 4.881   -8.189  -17.726 1.00 25.65 ? 471 TYR A CD2 1 
ATOM   1821 C CE1 . TYR A 1 263 ? 6.415   -10.480 -18.040 1.00 28.13 ? 471 TYR A CE1 1 
ATOM   1822 C CE2 . TYR A 1 263 ? 4.538   -9.133  -18.675 1.00 27.90 ? 471 TYR A CE2 1 
ATOM   1823 C CZ  . TYR A 1 263 ? 5.316   -10.273 -18.829 1.00 28.25 ? 471 TYR A CZ  1 
ATOM   1824 O OH  . TYR A 1 263 ? 4.979   -11.193 -19.775 1.00 29.50 ? 471 TYR A OH  1 
ATOM   1825 N N   . PHE A 1 264 ? 9.243   -7.618  -15.943 1.00 23.98 ? 472 PHE A N   1 
ATOM   1826 C CA  . PHE A 1 264 ? 10.547  -8.125  -16.276 1.00 24.06 ? 472 PHE A CA  1 
ATOM   1827 C C   . PHE A 1 264 ? 10.729  -9.537  -15.765 1.00 25.59 ? 472 PHE A C   1 
ATOM   1828 O O   . PHE A 1 264 ? 10.021  -9.981  -14.836 1.00 24.53 ? 472 PHE A O   1 
ATOM   1829 C CB  . PHE A 1 264 ? 11.658  -7.178  -15.785 1.00 26.38 ? 472 PHE A CB  1 
ATOM   1830 C CG  . PHE A 1 264 ? 11.731  -7.012  -14.293 1.00 26.71 ? 472 PHE A CG  1 
ATOM   1831 C CD1 . PHE A 1 264 ? 12.495  -7.887  -13.529 1.00 27.46 ? 472 PHE A CD1 1 
ATOM   1832 C CD2 . PHE A 1 264 ? 11.044  -5.992  -13.656 1.00 25.92 ? 472 PHE A CD2 1 
ATOM   1833 C CE1 . PHE A 1 264 ? 12.588  -7.743  -12.143 1.00 28.62 ? 472 PHE A CE1 1 
ATOM   1834 C CE2 . PHE A 1 264 ? 11.125  -5.852  -12.283 1.00 26.82 ? 472 PHE A CE2 1 
ATOM   1835 C CZ  . PHE A 1 264 ? 11.897  -6.729  -11.526 1.00 26.98 ? 472 PHE A CZ  1 
ATOM   1836 N N   . ASP A 1 265 ? 11.673  -10.241 -16.375 1.00 24.85 ? 473 ASP A N   1 
ATOM   1837 C CA  . ASP A 1 265 ? 12.000  -11.606 -16.010 1.00 24.55 ? 473 ASP A CA  1 
ATOM   1838 C C   . ASP A 1 265 ? 13.485  -11.658 -15.759 1.00 25.17 ? 473 ASP A C   1 
ATOM   1839 O O   . ASP A 1 265 ? 14.251  -10.942 -16.425 1.00 22.89 ? 473 ASP A O   1 
ATOM   1840 C CB  . ASP A 1 265 ? 11.646  -12.572 -17.135 1.00 29.02 ? 473 ASP A CB  1 
ATOM   1841 C CG  . ASP A 1 265 ? 10.154  -12.630 -17.432 1.00 30.68 ? 473 ASP A CG  1 
ATOM   1842 O OD1 . ASP A 1 265 ? 9.337   -12.085 -16.712 1.00 35.48 ? 473 ASP A OD1 1 
ATOM   1843 O OD2 . ASP A 1 265 ? 9.784   -13.248 -18.407 1.00 38.77 ? 473 ASP A OD2 1 
ATOM   1844 N N   . ILE A 1 266 ? 13.884  -12.514 -14.810 1.00 24.69 ? 474 ILE A N   1 
ATOM   1845 C CA  . ILE A 1 266 ? 15.236  -12.597 -14.300 1.00 24.81 ? 474 ILE A CA  1 
ATOM   1846 C C   . ILE A 1 266 ? 15.724  -14.050 -14.431 1.00 24.07 ? 474 ILE A C   1 
ATOM   1847 O O   . ILE A 1 266 ? 15.032  -14.975 -13.995 1.00 24.37 ? 474 ILE A O   1 
ATOM   1848 C CB  . ILE A 1 266 ? 15.321  -12.203 -12.810 1.00 25.15 ? 474 ILE A CB  1 
ATOM   1849 C CG1 . ILE A 1 266 ? 14.768  -10.780 -12.587 1.00 24.88 ? 474 ILE A CG1 1 
ATOM   1850 C CG2 . ILE A 1 266 ? 16.793  -12.297 -12.322 1.00 25.49 ? 474 ILE A CG2 1 
ATOM   1851 C CD1 . ILE A 1 266 ? 15.627  -9.696  -13.239 1.00 24.29 ? 474 ILE A CD1 1 
ATOM   1852 N N   . TYR A 1 267 ? 16.902  -14.218 -15.027 1.00 22.70 ? 475 TYR A N   1 
ATOM   1853 C CA  . TYR A 1 267 ? 17.454  -15.535 -15.359 1.00 25.10 ? 475 TYR A CA  1 
ATOM   1854 C C   . TYR A 1 267 ? 18.818  -15.686 -14.742 1.00 25.83 ? 475 TYR A C   1 
ATOM   1855 O O   . TYR A 1 267 ? 19.635  -14.774 -14.797 1.00 27.13 ? 475 TYR A O   1 
ATOM   1856 C CB  . TYR A 1 267 ? 17.579  -15.736 -16.886 1.00 25.01 ? 475 TYR A CB  1 
ATOM   1857 C CG  . TYR A 1 267 ? 16.284  -15.727 -17.665 1.00 27.25 ? 475 TYR A CG  1 
ATOM   1858 C CD1 . TYR A 1 267 ? 15.678  -14.521 -18.028 1.00 28.42 ? 475 TYR A CD1 1 
ATOM   1859 C CD2 . TYR A 1 267 ? 15.667  -16.914 -18.050 1.00 29.82 ? 475 TYR A CD2 1 
ATOM   1860 C CE1 . TYR A 1 267 ? 14.516  -14.490 -18.767 1.00 30.16 ? 475 TYR A CE1 1 
ATOM   1861 C CE2 . TYR A 1 267 ? 14.484  -16.899 -18.774 1.00 31.08 ? 475 TYR A CE2 1 
ATOM   1862 C CZ  . TYR A 1 267 ? 13.918  -15.679 -19.122 1.00 31.81 ? 475 TYR A CZ  1 
ATOM   1863 O OH  . TYR A 1 267 ? 12.757  -15.655 -19.820 1.00 35.98 ? 475 TYR A OH  1 
ATOM   1864 N N   . PHE A 1 268 ? 19.050  -16.857 -14.149 1.00 26.49 ? 476 PHE A N   1 
ATOM   1865 C CA  . PHE A 1 268 ? 20.351  -17.283 -13.701 1.00 26.35 ? 476 PHE A CA  1 
ATOM   1866 C C   . PHE A 1 268 ? 20.690  -18.478 -14.637 1.00 27.57 ? 476 PHE A C   1 
ATOM   1867 O O   . PHE A 1 268 ? 20.030  -19.536 -14.582 1.00 26.56 ? 476 PHE A O   1 
ATOM   1868 C CB  . PHE A 1 268 ? 20.292  -17.742 -12.245 1.00 25.12 ? 476 PHE A CB  1 
ATOM   1869 C CG  . PHE A 1 268 ? 19.882  -16.674 -11.275 1.00 25.27 ? 476 PHE A CG  1 
ATOM   1870 C CD1 . PHE A 1 268 ? 18.549  -16.379 -11.064 1.00 27.04 ? 476 PHE A CD1 1 
ATOM   1871 C CD2 . PHE A 1 268 ? 20.832  -15.960 -10.581 1.00 26.91 ? 476 PHE A CD2 1 
ATOM   1872 C CE1 . PHE A 1 268 ? 18.171  -15.392 -10.177 1.00 27.91 ? 476 PHE A CE1 1 
ATOM   1873 C CE2 . PHE A 1 268 ? 20.470  -14.990 -9.677  1.00 26.29 ? 476 PHE A CE2 1 
ATOM   1874 C CZ  . PHE A 1 268 ? 19.139  -14.704 -9.475  1.00 26.73 ? 476 PHE A CZ  1 
ATOM   1875 N N   . GLU A 1 269 ? 21.704  -18.315 -15.471 1.00 26.95 ? 477 GLU A N   1 
ATOM   1876 C CA  . GLU A 1 269 ? 21.935  -19.236 -16.574 1.00 29.45 ? 477 GLU A CA  1 
ATOM   1877 C C   . GLU A 1 269 ? 23.364  -19.691 -16.717 1.00 28.87 ? 477 GLU A C   1 
ATOM   1878 O O   . GLU A 1 269 ? 23.617  -20.887 -16.810 1.00 29.50 ? 477 GLU A O   1 
ATOM   1879 C CB  . GLU A 1 269 ? 21.495  -18.592 -17.891 1.00 31.61 ? 477 GLU A CB  1 
ATOM   1880 C CG  . GLU A 1 269 ? 21.428  -19.570 -19.040 1.00 36.30 ? 477 GLU A CG  1 
ATOM   1881 C CD  . GLU A 1 269 ? 20.888  -18.935 -20.313 1.00 40.06 ? 477 GLU A CD  1 
ATOM   1882 O OE1 . GLU A 1 269 ? 19.656  -18.729 -20.375 1.00 41.73 ? 477 GLU A OE1 1 
ATOM   1883 O OE2 . GLU A 1 269 ? 21.700  -18.631 -21.223 1.00 42.20 ? 477 GLU A OE2 1 
ATOM   1884 N N   . LYS A 1 270 ? 24.296  -18.748 -16.795 1.00 27.25 ? 478 LYS A N   1 
ATOM   1885 C CA  . LYS A 1 270 ? 25.678  -19.082 -17.156 1.00 28.87 ? 478 LYS A CA  1 
ATOM   1886 C C   . LYS A 1 270 ? 26.273  -20.134 -16.229 1.00 29.15 ? 478 LYS A C   1 
ATOM   1887 O O   . LYS A 1 270 ? 26.267  -19.972 -15.014 1.00 28.28 ? 478 LYS A O   1 
ATOM   1888 C CB  . LYS A 1 270 ? 26.582  -17.843 -17.190 1.00 30.17 ? 478 LYS A CB  1 
ATOM   1889 C CG  . LYS A 1 270 ? 27.992  -18.120 -17.699 1.00 31.85 ? 478 LYS A CG  1 
ATOM   1890 C CD  . LYS A 1 270 ? 28.926  -16.941 -17.494 1.00 34.33 ? 478 LYS A CD  1 
ATOM   1891 C CE  . LYS A 1 270 ? 30.373  -17.317 -17.786 1.00 36.61 ? 478 LYS A CE  1 
ATOM   1892 N NZ  . LYS A 1 270 ? 31.287  -16.177 -17.483 1.00 38.56 ? 478 LYS A NZ  1 
ATOM   1893 N N   . ASN A 1 271 ? 26.775  -21.214 -16.831 1.00 27.44 ? 479 ASN A N   1 
ATOM   1894 C CA  . ASN A 1 271 ? 27.423  -22.304 -16.114 1.00 28.52 ? 479 ASN A CA  1 
ATOM   1895 C C   . ASN A 1 271 ? 26.591  -23.028 -15.059 1.00 27.07 ? 479 ASN A C   1 
ATOM   1896 O O   . ASN A 1 271 ? 27.151  -23.723 -14.237 1.00 29.80 ? 479 ASN A O   1 
ATOM   1897 C CB  . ASN A 1 271 ? 28.728  -21.804 -15.474 1.00 29.38 ? 479 ASN A CB  1 
ATOM   1898 C CG  . ASN A 1 271 ? 29.831  -21.622 -16.485 1.00 29.87 ? 479 ASN A CG  1 
ATOM   1899 O OD1 . ASN A 1 271 ? 29.856  -22.281 -17.529 1.00 32.37 ? 479 ASN A OD1 1 
ATOM   1900 N ND2 . ASN A 1 271 ? 30.732  -20.695 -16.204 1.00 30.04 ? 479 ASN A ND2 1 
ATOM   1901 N N   . CYS A 1 272 ? 25.265  -22.884 -15.091 1.00 27.81 ? 480 CYS A N   1 
ATOM   1902 C CA  . CYS A 1 272 ? 24.400  -23.505 -14.114 1.00 27.78 ? 480 CYS A CA  1 
ATOM   1903 C C   . CYS A 1 272 ? 24.012  -24.913 -14.502 1.00 27.04 ? 480 CYS A C   1 
ATOM   1904 O O   . CYS A 1 272 ? 23.592  -25.163 -15.617 1.00 29.14 ? 480 CYS A O   1 
ATOM   1905 C CB  . CYS A 1 272 ? 23.106  -22.696 -13.961 1.00 29.65 ? 480 CYS A CB  1 
ATOM   1906 S SG  . CYS A 1 272 ? 23.341  -21.111 -13.140 1.00 29.17 ? 480 CYS A SG  1 
ATOM   1907 N N   . HIS A 1 273 ? 24.072  -25.829 -13.553 1.00 26.21 ? 481 HIS A N   1 
ATOM   1908 C CA  . HIS A 1 273 ? 23.423  -27.103 -13.753 1.00 26.29 ? 481 HIS A CA  1 
ATOM   1909 C C   . HIS A 1 273 ? 21.926  -27.008 -13.443 1.00 27.73 ? 481 HIS A C   1 
ATOM   1910 O O   . HIS A 1 273 ? 21.125  -27.744 -14.014 1.00 31.55 ? 481 HIS A O   1 
ATOM   1911 C CB  . HIS A 1 273 ? 24.088  -28.183 -12.910 1.00 25.97 ? 481 HIS A CB  1 
ATOM   1912 C CG  . HIS A 1 273 ? 25.476  -28.514 -13.360 1.00 26.98 ? 481 HIS A CG  1 
ATOM   1913 N ND1 . HIS A 1 273 ? 25.730  -29.252 -14.495 1.00 27.19 ? 481 HIS A ND1 1 
ATOM   1914 C CD2 . HIS A 1 273 ? 26.686  -28.185 -12.847 1.00 26.55 ? 481 HIS A CD2 1 
ATOM   1915 C CE1 . HIS A 1 273 ? 27.038  -29.359 -14.667 1.00 27.36 ? 481 HIS A CE1 1 
ATOM   1916 N NE2 . HIS A 1 273 ? 27.639  -28.723 -13.678 1.00 28.14 ? 481 HIS A NE2 1 
ATOM   1917 N N   . ASN A 1 274 ? 21.582  -26.166 -12.478 1.00 27.66 ? 482 ASN A N   1 
ATOM   1918 C CA  . ASN A 1 274 ? 20.202  -25.893 -12.113 1.00 28.30 ? 482 ASN A CA  1 
ATOM   1919 C C   . ASN A 1 274 ? 19.926  -24.420 -12.409 1.00 31.02 ? 482 ASN A C   1 
ATOM   1920 O O   . ASN A 1 274 ? 20.212  -23.522 -11.592 1.00 26.93 ? 482 ASN A O   1 
ATOM   1921 C CB  . ASN A 1 274 ? 19.991  -26.230 -10.635 1.00 30.57 ? 482 ASN A CB  1 
ATOM   1922 C CG  . ASN A 1 274 ? 20.097  -27.731 -10.374 1.00 33.01 ? 482 ASN A CG  1 
ATOM   1923 O OD1 . ASN A 1 274 ? 19.361  -28.503 -10.950 1.00 34.08 ? 482 ASN A OD1 1 
ATOM   1924 N ND2 . ASN A 1 274 ? 21.015  -28.136 -9.529  1.00 33.49 ? 482 ASN A ND2 1 
ATOM   1925 N N   . ARG A 1 275 ? 19.407  -24.171 -13.604 1.00 29.66 ? 483 ARG A N   1 
ATOM   1926 C CA  . ARG A 1 275 ? 19.044  -22.806 -14.008 1.00 29.80 ? 483 ARG A CA  1 
ATOM   1927 C C   . ARG A 1 275 ? 17.849  -22.310 -13.240 1.00 27.47 ? 483 ARG A C   1 
ATOM   1928 O O   . ARG A 1 275 ? 17.027  -23.080 -12.834 1.00 28.43 ? 483 ARG A O   1 
ATOM   1929 C CB  . ARG A 1 275 ? 18.705  -22.778 -15.470 1.00 32.17 ? 483 ARG A CB  1 
ATOM   1930 C CG  . ARG A 1 275 ? 19.922  -23.031 -16.326 1.00 37.10 ? 483 ARG A CG  1 
ATOM   1931 C CD  . ARG A 1 275 ? 19.466  -22.964 -17.765 1.00 39.50 ? 483 ARG A CD  1 
ATOM   1932 N NE  . ARG A 1 275 ? 20.569  -23.039 -18.698 1.00 40.82 ? 483 ARG A NE  1 
ATOM   1933 C CZ  . ARG A 1 275 ? 20.400  -23.053 -20.014 1.00 39.74 ? 483 ARG A CZ  1 
ATOM   1934 N NH1 . ARG A 1 275 ? 19.177  -23.006 -20.558 1.00 40.12 ? 483 ARG A NH1 1 
ATOM   1935 N NH2 . ARG A 1 275 ? 21.448  -23.121 -20.776 1.00 40.33 ? 483 ARG A NH2 1 
ATOM   1936 N N   . VAL A 1 276 ? 17.758  -21.011 -13.016 1.00 26.69 ? 484 VAL A N   1 
ATOM   1937 C CA  . VAL A 1 276 ? 16.639  -20.471 -12.261 1.00 26.56 ? 484 VAL A CA  1 
ATOM   1938 C C   . VAL A 1 276 ? 16.093  -19.278 -13.002 1.00 27.16 ? 484 VAL A C   1 
ATOM   1939 O O   . VAL A 1 276 ? 16.847  -18.468 -13.541 1.00 24.98 ? 484 VAL A O   1 
ATOM   1940 C CB  . VAL A 1 276 ? 17.069  -20.049 -10.845 1.00 28.29 ? 484 VAL A CB  1 
ATOM   1941 C CG1 . VAL A 1 276 ? 15.928  -19.358 -10.108 1.00 27.77 ? 484 VAL A CG1 1 
ATOM   1942 C CG2 . VAL A 1 276 ? 17.581  -21.242 -10.047 1.00 27.77 ? 484 VAL A CG2 1 
ATOM   1943 N N   . VAL A 1 277 ? 14.774  -19.176 -13.040 1.00 26.58 ? 485 VAL A N   1 
ATOM   1944 C CA  . VAL A 1 277 ? 14.139  -18.030 -13.639 1.00 27.69 ? 485 VAL A CA  1 
ATOM   1945 C C   . VAL A 1 277 ? 12.978  -17.595 -12.758 1.00 29.54 ? 485 VAL A C   1 
ATOM   1946 O O   . VAL A 1 277 ? 12.294  -18.427 -12.157 1.00 27.20 ? 485 VAL A O   1 
ATOM   1947 C CB  . VAL A 1 277 ? 13.649  -18.329 -15.075 1.00 31.09 ? 485 VAL A CB  1 
ATOM   1948 C CG1 . VAL A 1 277 ? 12.871  -19.637 -15.157 1.00 32.63 ? 485 VAL A CG1 1 
ATOM   1949 C CG2 . VAL A 1 277 ? 12.801  -17.175 -15.600 1.00 31.58 ? 485 VAL A CG2 1 
ATOM   1950 N N   . PHE A 1 278 ? 12.774  -16.288 -12.653 1.00 27.44 ? 486 PHE A N   1 
ATOM   1951 C CA  . PHE A 1 278 ? 11.507  -15.823 -12.142 1.00 27.84 ? 486 PHE A CA  1 
ATOM   1952 C C   . PHE A 1 278 ? 10.995  -14.659 -12.956 1.00 28.54 ? 486 PHE A C   1 
ATOM   1953 O O   . PHE A 1 278 ? 11.787  -13.886 -13.523 1.00 26.25 ? 486 PHE A O   1 
ATOM   1954 C CB  . PHE A 1 278 ? 11.572  -15.549 -10.627 1.00 28.64 ? 486 PHE A CB  1 
ATOM   1955 C CG  . PHE A 1 278 ? 12.317  -14.289 -10.243 1.00 28.26 ? 486 PHE A CG  1 
ATOM   1956 C CD1 . PHE A 1 278 ? 11.670  -13.063 -10.225 1.00 27.71 ? 486 PHE A CD1 1 
ATOM   1957 C CD2 . PHE A 1 278 ? 13.649  -14.339 -9.862  1.00 27.11 ? 486 PHE A CD2 1 
ATOM   1958 C CE1 . PHE A 1 278 ? 12.344  -11.897 -9.853  1.00 26.91 ? 486 PHE A CE1 1 
ATOM   1959 C CE2 . PHE A 1 278 ? 14.323  -13.180 -9.488  1.00 26.57 ? 486 PHE A CE2 1 
ATOM   1960 C CZ  . PHE A 1 278 ? 13.666  -11.958 -9.491  1.00 26.65 ? 486 PHE A CZ  1 
ATOM   1961 N N   . SER A 1 279 ? 9.664   -14.578 -13.035 1.00 27.32 ? 487 SER A N   1 
ATOM   1962 C CA  . SER A 1 279 ? 8.957   -13.530 -13.737 1.00 29.49 ? 487 SER A CA  1 
ATOM   1963 C C   . SER A 1 279 ? 8.281   -12.621 -12.718 1.00 28.84 ? 487 SER A C   1 
ATOM   1964 O O   . SER A 1 279 ? 7.842   -13.087 -11.660 1.00 29.36 ? 487 SER A O   1 
ATOM   1965 C CB  . SER A 1 279 ? 7.866   -14.147 -14.628 1.00 31.30 ? 487 SER A CB  1 
ATOM   1966 O OG  . SER A 1 279 ? 7.203   -13.157 -15.406 1.00 31.70 ? 487 SER A OG  1 
ATOM   1967 N N   . THR A 1 280 ? 8.180   -11.335 -13.044 1.00 26.37 ? 488 THR A N   1 
ATOM   1968 C CA  . THR A 1 280 ? 7.377   -10.393 -12.265 1.00 24.60 ? 488 THR A CA  1 
ATOM   1969 C C   . THR A 1 280 ? 6.095   -10.011 -13.004 1.00 25.62 ? 488 THR A C   1 
ATOM   1970 O O   . THR A 1 280 ? 5.444   -9.021  -12.676 1.00 24.82 ? 488 THR A O   1 
ATOM   1971 C CB  . THR A 1 280 ? 8.193   -9.143  -11.882 1.00 25.85 ? 488 THR A CB  1 
ATOM   1972 O OG1 . THR A 1 280 ? 8.626   -8.426  -13.047 1.00 24.68 ? 488 THR A OG1 1 
ATOM   1973 C CG2 . THR A 1 280 ? 9.403   -9.532  -11.051 1.00 25.34 ? 488 THR A CG2 1 
ATOM   1974 N N   . GLY A 1 281 ? 5.706   -10.826 -13.985 1.00 25.64 ? 489 GLY A N   1 
ATOM   1975 C CA  . GLY A 1 281 ? 4.502   -10.578 -14.754 1.00 25.45 ? 489 GLY A CA  1 
ATOM   1976 C C   . GLY A 1 281 ? 3.206   -10.926 -14.041 1.00 26.09 ? 489 GLY A C   1 
ATOM   1977 O O   . GLY A 1 281 ? 3.187   -11.607 -13.027 1.00 23.48 ? 489 GLY A O   1 
ATOM   1978 N N   . PRO A 1 282 ? 2.092   -10.446 -14.582 1.00 27.97 ? 490 PRO A N   1 
ATOM   1979 C CA  . PRO A 1 282 ? 0.829   -10.632 -13.900 1.00 29.47 ? 490 PRO A CA  1 
ATOM   1980 C C   . PRO A 1 282 ? 0.320   -12.062 -13.926 1.00 30.62 ? 490 PRO A C   1 
ATOM   1981 O O   . PRO A 1 282 ? -0.522  -12.388 -13.090 1.00 26.94 ? 490 PRO A O   1 
ATOM   1982 C CB  . PRO A 1 282 ? -0.122  -9.668  -14.620 1.00 30.78 ? 490 PRO A CB  1 
ATOM   1983 C CG  . PRO A 1 282 ? 0.496   -9.441  -15.943 1.00 31.95 ? 490 PRO A CG  1 
ATOM   1984 C CD  . PRO A 1 282 ? 1.971   -9.655  -15.812 1.00 29.94 ? 490 PRO A CD  1 
ATOM   1985 N N   . GLN A 1 283 ? 0.836   -12.911 -14.824 1.00 31.51 ? 491 GLN A N   1 
ATOM   1986 C CA  . GLN A 1 283 ? 0.440   -14.329 -14.812 1.00 35.13 ? 491 GLN A CA  1 
ATOM   1987 C C   . GLN A 1 283 ? 1.225   -15.115 -13.805 1.00 32.85 ? 491 GLN A C   1 
ATOM   1988 O O   . GLN A 1 283 ? 0.946   -16.284 -13.644 1.00 34.44 ? 491 GLN A O   1 
ATOM   1989 C CB  . GLN A 1 283 ? 0.601   -15.013 -16.188 1.00 39.14 ? 491 GLN A CB  1 
ATOM   1990 C CG  . GLN A 1 283 ? -0.049  -14.264 -17.340 1.00 42.93 ? 491 GLN A CG  1 
ATOM   1991 C CD  . GLN A 1 283 ? -1.544  -14.063 -17.141 1.00 48.23 ? 491 GLN A CD  1 
ATOM   1992 O OE1 . GLN A 1 283 ? -2.095  -12.991 -17.440 1.00 59.57 ? 491 GLN A OE1 1 
ATOM   1993 N NE2 . GLN A 1 283 ? -2.208  -15.082 -16.631 1.00 44.54 ? 491 GLN A NE2 1 
ATOM   1994 N N   . SER A 1 284 ? 2.198   -14.501 -13.122 1.00 30.96 ? 492 SER A N   1 
ATOM   1995 C CA  . SER A 1 284 ? 2.958   -15.218 -12.092 1.00 31.88 ? 492 SER A CA  1 
ATOM   1996 C C   . SER A 1 284 ? 2.694   -14.637 -10.721 1.00 32.23 ? 492 SER A C   1 
ATOM   1997 O O   . SER A 1 284 ? 2.192   -13.510 -10.576 1.00 31.57 ? 492 SER A O   1 
ATOM   1998 C CB  . SER A 1 284 ? 4.458   -15.201 -12.374 1.00 32.35 ? 492 SER A CB  1 
ATOM   1999 O OG  . SER A 1 284 ? 4.696   -15.354 -13.755 1.00 36.20 ? 492 SER A OG  1 
ATOM   2000 N N   . THR A 1 285 ? 3.047   -15.428 -9.718  1.00 31.91 ? 493 THR A N   1 
ATOM   2001 C CA  . THR A 1 285 ? 2.979   -15.041 -8.317  1.00 32.29 ? 493 THR A CA  1 
ATOM   2002 C C   . THR A 1 285 ? 3.504   -13.644 -8.120  1.00 31.14 ? 493 THR A C   1 
ATOM   2003 O O   . THR A 1 285 ? 4.584   -13.297 -8.606  1.00 28.80 ? 493 THR A O   1 
ATOM   2004 C CB  . THR A 1 285 ? 3.822   -15.996 -7.469  1.00 35.16 ? 493 THR A CB  1 
ATOM   2005 O OG1 . THR A 1 285 ? 3.403   -17.330 -7.759  1.00 39.83 ? 493 THR A OG1 1 
ATOM   2006 C CG2 . THR A 1 285 ? 3.662   -15.708 -5.957  1.00 39.43 ? 493 THR A CG2 1 
ATOM   2007 N N   . LYS A 1 286 ? 2.741   -12.841 -7.399  1.00 31.61 ? 494 LYS A N   1 
ATOM   2008 C CA  . LYS A 1 286 ? 3.130   -11.451 -7.175  1.00 33.14 ? 494 LYS A CA  1 
ATOM   2009 C C   . LYS A 1 286 ? 4.444   -11.337 -6.407  1.00 30.17 ? 494 LYS A C   1 
ATOM   2010 O O   . LYS A 1 286 ? 4.788   -12.206 -5.604  1.00 28.79 ? 494 LYS A O   1 
ATOM   2011 C CB  . LYS A 1 286 ? 2.008   -10.689 -6.483  1.00 39.53 ? 494 LYS A CB  1 
ATOM   2012 C CG  . LYS A 1 286 ? 1.781   -11.028 -5.013  1.00 46.28 ? 494 LYS A CG  1 
ATOM   2013 C CD  . LYS A 1 286 ? 0.382   -10.556 -4.604  1.00 53.55 ? 494 LYS A CD  1 
ATOM   2014 C CE  . LYS A 1 286 ? 0.286   -10.062 -3.177  1.00 57.22 ? 494 LYS A CE  1 
ATOM   2015 N NZ  . LYS A 1 286 ? 0.512   -11.173 -2.232  1.00 61.16 ? 494 LYS A NZ  1 
ATOM   2016 N N   . THR A 1 287 ? 5.204   -10.296 -6.743  1.00 27.52 ? 495 THR A N   1 
ATOM   2017 C CA  . THR A 1 287 ? 6.465   -9.964  -6.112  1.00 26.28 ? 495 THR A CA  1 
ATOM   2018 C C   . THR A 1 287 ? 6.339   -8.512  -5.658  1.00 26.79 ? 495 THR A C   1 
ATOM   2019 O O   . THR A 1 287 ? 5.384   -7.830  -6.006  1.00 26.50 ? 495 THR A O   1 
ATOM   2020 C CB  . THR A 1 287 ? 7.652   -10.065 -7.081  1.00 26.23 ? 495 THR A CB  1 
ATOM   2021 O OG1 . THR A 1 287 ? 7.620   -8.982  -8.034  1.00 24.70 ? 495 THR A OG1 1 
ATOM   2022 C CG2 . THR A 1 287 ? 7.662   -11.390 -7.799  1.00 26.30 ? 495 THR A CG2 1 
ATOM   2023 N N   . HIS A 1 288 ? 7.287   -8.021  -4.885  1.00 28.24 ? 496 HIS A N   1 
ATOM   2024 C CA  . HIS A 1 288 ? 7.218   -6.629  -4.481  1.00 28.50 ? 496 HIS A CA  1 
ATOM   2025 C C   . HIS A 1 288 ? 7.409   -5.649  -5.641  1.00 29.81 ? 496 HIS A C   1 
ATOM   2026 O O   . HIS A 1 288 ? 7.173   -4.449  -5.466  1.00 28.08 ? 496 HIS A O   1 
ATOM   2027 C CB  . HIS A 1 288 ? 8.224   -6.318  -3.378  1.00 31.11 ? 496 HIS A CB  1 
ATOM   2028 C CG  . HIS A 1 288 ? 9.612   -6.097  -3.859  1.00 31.41 ? 496 HIS A CG  1 
ATOM   2029 N ND1 . HIS A 1 288 ? 10.461  -7.138  -4.168  1.00 32.86 ? 496 HIS A ND1 1 
ATOM   2030 C CD2 . HIS A 1 288 ? 10.311  -4.955  -4.068  1.00 32.32 ? 496 HIS A CD2 1 
ATOM   2031 C CE1 . HIS A 1 288 ? 11.627  -6.647  -4.555  1.00 33.33 ? 496 HIS A CE1 1 
ATOM   2032 N NE2 . HIS A 1 288 ? 11.558  -5.328  -4.516  1.00 33.86 ? 496 HIS A NE2 1 
ATOM   2033 N N   . TRP A 1 289 ? 7.869   -6.124  -6.803  1.00 27.10 ? 497 TRP A N   1 
ATOM   2034 C CA  . TRP A 1 289 ? 7.970   -5.243  -7.987  1.00 25.71 ? 497 TRP A CA  1 
ATOM   2035 C C   . TRP A 1 289 ? 6.596   -5.058  -8.647  1.00 26.03 ? 497 TRP A C   1 
ATOM   2036 O O   . TRP A 1 289 ? 6.397   -4.128  -9.422  1.00 28.83 ? 497 TRP A O   1 
ATOM   2037 C CB  . TRP A 1 289 ? 8.967   -5.783  -8.995  1.00 25.30 ? 497 TRP A CB  1 
ATOM   2038 C CG  . TRP A 1 289 ? 10.364  -5.711  -8.543  1.00 25.46 ? 497 TRP A CG  1 
ATOM   2039 C CD1 . TRP A 1 289 ? 11.149  -4.594  -8.499  1.00 25.71 ? 497 TRP A CD1 1 
ATOM   2040 C CD2 . TRP A 1 289 ? 11.182  -6.799  -8.091  1.00 23.81 ? 497 TRP A CD2 1 
ATOM   2041 N NE1 . TRP A 1 289 ? 12.404  -4.918  -8.033  1.00 26.17 ? 497 TRP A NE1 1 
ATOM   2042 C CE2 . TRP A 1 289 ? 12.454  -6.269  -7.797  1.00 25.64 ? 497 TRP A CE2 1 
ATOM   2043 C CE3 . TRP A 1 289 ? 10.967  -8.175  -7.932  1.00 25.99 ? 497 TRP A CE3 1 
ATOM   2044 C CZ2 . TRP A 1 289 ? 13.512  -7.059  -7.348  1.00 25.17 ? 497 TRP A CZ2 1 
ATOM   2045 C CZ3 . TRP A 1 289 ? 12.022  -8.963  -7.474  1.00 26.06 ? 497 TRP A CZ3 1 
ATOM   2046 C CH2 . TRP A 1 289 ? 13.270  -8.399  -7.186  1.00 25.94 ? 497 TRP A CH2 1 
ATOM   2047 N N   . LYS A 1 290 ? 5.651   -5.933  -8.318  1.00 25.48 ? 498 LYS A N   1 
ATOM   2048 C CA  . LYS A 1 290 ? 4.322   -5.870  -8.868  1.00 26.48 ? 498 LYS A CA  1 
ATOM   2049 C C   . LYS A 1 290 ? 4.415   -5.785  -10.404 1.00 25.98 ? 498 LYS A C   1 
ATOM   2050 O O   . LYS A 1 290 ? 5.269   -6.466  -10.996 1.00 25.59 ? 498 LYS A O   1 
ATOM   2051 C CB  . LYS A 1 290 ? 3.551   -4.708  -8.224  1.00 26.10 ? 498 LYS A CB  1 
ATOM   2052 C CG  . LYS A 1 290 ? 3.527   -4.834  -6.706  1.00 27.15 ? 498 LYS A CG  1 
ATOM   2053 C CD  . LYS A 1 290 ? 2.800   -3.666  -6.083  1.00 30.88 ? 498 LYS A CD  1 
ATOM   2054 C CE  . LYS A 1 290 ? 2.751   -3.824  -4.579  1.00 34.58 ? 498 LYS A CE  1 
ATOM   2055 N NZ  . LYS A 1 290 ? 2.779   -2.499  -3.949  1.00 37.66 ? 498 LYS A NZ  1 
ATOM   2056 N N   . GLN A 1 291 ? 3.551   -4.982  -11.039 1.00 25.34 ? 499 GLN A N   1 
ATOM   2057 C CA  . GLN A 1 291 ? 3.725   -4.605  -12.449 1.00 25.90 ? 499 GLN A CA  1 
ATOM   2058 C C   . GLN A 1 291 ? 3.668   -3.083  -12.583 1.00 26.15 ? 499 GLN A C   1 
ATOM   2059 O O   . GLN A 1 291 ? 3.208   -2.381  -11.680 1.00 27.40 ? 499 GLN A O   1 
ATOM   2060 C CB  . GLN A 1 291 ? 2.662   -5.266  -13.315 1.00 26.61 ? 499 GLN A CB  1 
ATOM   2061 C CG  . GLN A 1 291 ? 2.834   -6.778  -13.395 1.00 27.74 ? 499 GLN A CG  1 
ATOM   2062 C CD  . GLN A 1 291 ? 2.054   -7.551  -12.354 1.00 27.47 ? 499 GLN A CD  1 
ATOM   2063 O OE1 . GLN A 1 291 ? 0.853   -7.324  -12.157 1.00 28.78 ? 499 GLN A OE1 1 
ATOM   2064 N NE2 . GLN A 1 291 ? 2.716   -8.513  -11.714 1.00 29.94 ? 499 GLN A NE2 1 
ATOM   2065 N N   . THR A 1 292 ? 4.182   -2.566  -13.681 1.00 23.89 ? 500 THR A N   1 
ATOM   2066 C CA  . THR A 1 292 ? 4.152   -1.143  -13.933 1.00 24.62 ? 500 THR A CA  1 
ATOM   2067 C C   . THR A 1 292 ? 3.076   -0.900  -14.991 1.00 27.70 ? 500 THR A C   1 
ATOM   2068 O O   . THR A 1 292 ? 3.030   -1.621  -16.004 1.00 29.32 ? 500 THR A O   1 
ATOM   2069 C CB  . THR A 1 292 ? 5.534   -0.672  -14.414 1.00 25.09 ? 500 THR A CB  1 
ATOM   2070 O OG1 . THR A 1 292 ? 6.535   -0.990  -13.414 1.00 23.18 ? 500 THR A OG1 1 
ATOM   2071 C CG2 . THR A 1 292 ? 5.525   0.816   -14.716 1.00 26.06 ? 500 THR A CG2 1 
ATOM   2072 N N   . VAL A 1 293 ? 2.228   0.101   -14.776 1.00 25.75 ? 501 VAL A N   1 
ATOM   2073 C CA  . VAL A 1 293 ? 1.066   0.362   -15.639 1.00 26.55 ? 501 VAL A CA  1 
ATOM   2074 C C   . VAL A 1 293 ? 1.169   1.761   -16.229 1.00 25.74 ? 501 VAL A C   1 
ATOM   2075 O O   . VAL A 1 293 ? 1.396   2.748   -15.507 1.00 26.69 ? 501 VAL A O   1 
ATOM   2076 C CB  . VAL A 1 293 ? -0.284  0.189   -14.875 1.00 27.66 ? 501 VAL A CB  1 
ATOM   2077 C CG1 . VAL A 1 293 ? -1.478  0.230   -15.829 1.00 29.65 ? 501 VAL A CG1 1 
ATOM   2078 C CG2 . VAL A 1 293 ? -0.299  -1.126  -14.114 1.00 29.04 ? 501 VAL A CG2 1 
ATOM   2079 N N   . PHE A 1 294 ? 1.072   1.830   -17.552 1.00 23.87 ? 502 PHE A N   1 
ATOM   2080 C CA  . PHE A 1 294 ? 1.020   3.078   -18.299 1.00 25.04 ? 502 PHE A CA  1 
ATOM   2081 C C   . PHE A 1 294 ? -0.377  3.271   -18.820 1.00 25.96 ? 502 PHE A C   1 
ATOM   2082 O O   . PHE A 1 294 ? -0.811  2.554   -19.744 1.00 24.78 ? 502 PHE A O   1 
ATOM   2083 C CB  . PHE A 1 294 ? 2.014   3.046   -19.449 1.00 27.07 ? 502 PHE A CB  1 
ATOM   2084 C CG  . PHE A 1 294 ? 3.379   2.578   -19.047 1.00 27.27 ? 502 PHE A CG  1 
ATOM   2085 C CD1 . PHE A 1 294 ? 4.242   3.434   -18.387 1.00 28.91 ? 502 PHE A CD1 1 
ATOM   2086 C CD2 . PHE A 1 294 ? 3.799   1.291   -19.343 1.00 27.56 ? 502 PHE A CD2 1 
ATOM   2087 C CE1 . PHE A 1 294 ? 5.510   3.015   -18.022 1.00 27.99 ? 502 PHE A CE1 1 
ATOM   2088 C CE2 . PHE A 1 294 ? 5.068   0.856   -18.975 1.00 29.20 ? 502 PHE A CE2 1 
ATOM   2089 C CZ  . PHE A 1 294 ? 5.922   1.722   -18.301 1.00 28.86 ? 502 PHE A CZ  1 
ATOM   2090 N N   . LEU A 1 295 ? -1.102  4.210   -18.202 1.00 24.98 ? 503 LEU A N   1 
ATOM   2091 C CA  . LEU A 1 295 ? -2.501  4.483   -18.577 1.00 27.65 ? 503 LEU A CA  1 
ATOM   2092 C C   . LEU A 1 295 ? -2.598  5.167   -19.927 1.00 27.65 ? 503 LEU A C   1 
ATOM   2093 O O   . LEU A 1 295 ? -1.798  6.039   -20.241 1.00 26.21 ? 503 LEU A O   1 
ATOM   2094 C CB  . LEU A 1 295 ? -3.187  5.390   -17.557 1.00 30.14 ? 503 LEU A CB  1 
ATOM   2095 C CG  . LEU A 1 295 ? -3.714  4.723   -16.308 1.00 33.87 ? 503 LEU A CG  1 
ATOM   2096 C CD1 . LEU A 1 295 ? -2.583  4.153   -15.470 1.00 34.79 ? 503 LEU A CD1 1 
ATOM   2097 C CD2 . LEU A 1 295 ? -4.544  5.752   -15.538 1.00 34.73 ? 503 LEU A CD2 1 
ATOM   2098 N N   . LEU A 1 296 ? -3.603  4.778   -20.715 1.00 27.04 ? 504 LEU A N   1 
ATOM   2099 C CA  . LEU A 1 296 ? -3.842  5.428   -21.997 1.00 27.04 ? 504 LEU A CA  1 
ATOM   2100 C C   . LEU A 1 296 ? -4.853  6.524   -21.778 1.00 27.93 ? 504 LEU A C   1 
ATOM   2101 O O   . LEU A 1 296 ? -5.899  6.287   -21.182 1.00 30.24 ? 504 LEU A O   1 
ATOM   2102 C CB  . LEU A 1 296 ? -4.388  4.417   -23.012 1.00 27.71 ? 504 LEU A CB  1 
ATOM   2103 C CG  . LEU A 1 296 ? -3.412  3.295   -23.388 1.00 27.59 ? 504 LEU A CG  1 
ATOM   2104 C CD1 . LEU A 1 296 ? -4.085  2.457   -24.465 1.00 29.32 ? 504 LEU A CD1 1 
ATOM   2105 C CD2 . LEU A 1 296 ? -2.049  3.812   -23.873 1.00 27.47 ? 504 LEU A CD2 1 
ATOM   2106 N N   . GLU A 1 297 ? -4.559  7.726   -22.241 1.00 28.26 ? 505 GLU A N   1 
ATOM   2107 C CA  . GLU A 1 297 ? -5.514  8.816   -22.080 1.00 33.02 ? 505 GLU A CA  1 
ATOM   2108 C C   . GLU A 1 297 ? -6.785  8.531   -22.845 1.00 33.01 ? 505 GLU A C   1 
ATOM   2109 O O   . GLU A 1 297 ? -7.870  8.750   -22.330 1.00 35.63 ? 505 GLU A O   1 
ATOM   2110 C CB  . GLU A 1 297 ? -4.905  10.120  -22.540 1.00 33.50 ? 505 GLU A CB  1 
ATOM   2111 C CG  . GLU A 1 297 ? -5.818  11.305  -22.331 1.00 37.25 ? 505 GLU A CG  1 
ATOM   2112 C CD  . GLU A 1 297 ? -5.080  12.612  -22.470 1.00 41.05 ? 505 GLU A CD  1 
ATOM   2113 O OE1 . GLU A 1 297 ? -3.864  12.598  -22.762 1.00 44.91 ? 505 GLU A OE1 1 
ATOM   2114 O OE2 . GLU A 1 297 ? -5.711  13.652  -22.279 1.00 43.14 ? 505 GLU A OE2 1 
ATOM   2115 N N   . LYS A 1 298 ? -6.638  7.989   -24.053 1.00 33.42 ? 506 LYS A N   1 
ATOM   2116 C CA  . LYS A 1 298 ? -7.772  7.662   -24.912 1.00 34.51 ? 506 LYS A CA  1 
ATOM   2117 C C   . LYS A 1 298 ? -7.862  6.145   -25.205 1.00 30.21 ? 506 LYS A C   1 
ATOM   2118 O O   . LYS A 1 298 ? -7.248  5.649   -26.118 1.00 28.18 ? 506 LYS A O   1 
ATOM   2119 C CB  . LYS A 1 298 ? -7.658  8.439   -26.234 1.00 36.26 ? 506 LYS A CB  1 
ATOM   2120 C CG  . LYS A 1 298 ? -7.605  9.980   -26.111 1.00 43.23 ? 506 LYS A CG  1 
ATOM   2121 C CD  . LYS A 1 298 ? -8.857  10.594  -25.440 1.00 47.32 ? 506 LYS A CD  1 
ATOM   2122 C CE  . LYS A 1 298 ? -9.186  11.995  -25.935 1.00 49.82 ? 506 LYS A CE  1 
ATOM   2123 N N   . PRO A 1 299 ? -8.666  5.408   -24.444 1.00 29.69 ? 507 PRO A N   1 
ATOM   2124 C CA  . PRO A 1 299 ? -8.816  3.966   -24.703 1.00 28.74 ? 507 PRO A CA  1 
ATOM   2125 C C   . PRO A 1 299 ? -9.296  3.722   -26.131 1.00 29.08 ? 507 PRO A C   1 
ATOM   2126 O O   . PRO A 1 299 ? -10.019 4.556   -26.652 1.00 27.59 ? 507 PRO A O   1 
ATOM   2127 C CB  . PRO A 1 299 ? -9.920  3.555   -23.746 1.00 30.94 ? 507 PRO A CB  1 
ATOM   2128 C CG  . PRO A 1 299 ? -9.884  4.582   -22.651 1.00 31.47 ? 507 PRO A CG  1 
ATOM   2129 C CD  . PRO A 1 299 ? -9.517  5.867   -23.334 1.00 30.06 ? 507 PRO A CD  1 
ATOM   2130 N N   . PHE A 1 300 ? -8.873  2.632   -26.770 1.00 26.64 ? 508 PHE A N   1 
ATOM   2131 C CA  . PHE A 1 300 ? -9.319  2.360   -28.138 1.00 29.98 ? 508 PHE A CA  1 
ATOM   2132 C C   . PHE A 1 300 ? -9.659  0.885   -28.290 1.00 29.84 ? 508 PHE A C   1 
ATOM   2133 O O   . PHE A 1 300 ? -9.125  0.035   -27.572 1.00 27.73 ? 508 PHE A O   1 
ATOM   2134 C CB  . PHE A 1 300 ? -8.257  2.789   -29.179 1.00 29.37 ? 508 PHE A CB  1 
ATOM   2135 C CG  . PHE A 1 300 ? -6.928  2.082   -29.013 1.00 27.71 ? 508 PHE A CG  1 
ATOM   2136 C CD1 . PHE A 1 300 ? -5.989  2.540   -28.074 1.00 29.80 ? 508 PHE A CD1 1 
ATOM   2137 C CD2 . PHE A 1 300 ? -6.615  0.950   -29.763 1.00 27.53 ? 508 PHE A CD2 1 
ATOM   2138 C CE1 . PHE A 1 300 ? -4.770  1.867   -27.882 1.00 28.41 ? 508 PHE A CE1 1 
ATOM   2139 C CE2 . PHE A 1 300 ? -5.399  0.300   -29.598 1.00 27.20 ? 508 PHE A CE2 1 
ATOM   2140 C CZ  . PHE A 1 300 ? -4.480  0.745   -28.648 1.00 27.64 ? 508 PHE A CZ  1 
ATOM   2141 N N   . SER A 1 301 ? -10.554 0.576   -29.226 1.00 29.03 ? 509 SER A N   1 
ATOM   2142 C CA  . SER A 1 301 ? -10.987 -0.814  -29.398 1.00 32.00 ? 509 SER A CA  1 
ATOM   2143 C C   . SER A 1 301 ? -9.979  -1.670  -30.155 1.00 30.02 ? 509 SER A C   1 
ATOM   2144 O O   . SER A 1 301 ? -9.328  -1.206  -31.083 1.00 29.38 ? 509 SER A O   1 
ATOM   2145 C CB  . SER A 1 301 ? -12.374 -0.902  -30.067 1.00 34.17 ? 509 SER A CB  1 
ATOM   2146 O OG  . SER A 1 301 ? -12.295 -0.574  -31.437 1.00 33.66 ? 509 SER A OG  1 
ATOM   2147 N N   . VAL A 1 302 ? -9.855  -2.929  -29.722 1.00 30.45 ? 510 VAL A N   1 
ATOM   2148 C CA  . VAL A 1 302 ? -9.064  -3.920  -30.418 1.00 30.44 ? 510 VAL A CA  1 
ATOM   2149 C C   . VAL A 1 302 ? -9.872  -5.217  -30.603 1.00 31.20 ? 510 VAL A C   1 
ATOM   2150 O O   . VAL A 1 302 ? -10.808 -5.508  -29.839 1.00 33.28 ? 510 VAL A O   1 
ATOM   2151 C CB  . VAL A 1 302 ? -7.749  -4.278  -29.675 1.00 30.05 ? 510 VAL A CB  1 
ATOM   2152 C CG1 . VAL A 1 302 ? -6.802  -3.073  -29.581 1.00 28.79 ? 510 VAL A CG1 1 
ATOM   2153 C CG2 . VAL A 1 302 ? -8.047  -4.869  -28.296 1.00 29.15 ? 510 VAL A CG2 1 
ATOM   2154 N N   . LYS A 1 303 ? -9.475  -6.003  -31.602 1.00 32.65 ? 511 LYS A N   1 
ATOM   2155 C CA  A LYS A 1 303 ? -10.105 -7.289  -31.881 0.50 31.90 ? 511 LYS A CA  1 
ATOM   2156 C CA  B LYS A 1 303 ? -10.114 -7.284  -31.909 0.50 31.65 ? 511 LYS A CA  1 
ATOM   2157 C C   . LYS A 1 303 ? -9.137  -8.433  -31.685 1.00 30.87 ? 511 LYS A C   1 
ATOM   2158 O O   . LYS A 1 303 ? -7.963  -8.317  -32.020 1.00 31.86 ? 511 LYS A O   1 
ATOM   2159 C CB  A LYS A 1 303 ? -10.640 -7.305  -33.311 0.50 32.40 ? 511 LYS A CB  1 
ATOM   2160 C CB  B LYS A 1 303 ? -10.599 -7.317  -33.371 0.50 31.65 ? 511 LYS A CB  1 
ATOM   2161 C CG  A LYS A 1 303 ? -11.659 -6.205  -33.522 0.50 32.31 ? 511 LYS A CG  1 
ATOM   2162 C CG  B LYS A 1 303 ? -11.666 -6.280  -33.742 0.50 31.34 ? 511 LYS A CG  1 
ATOM   2163 C CD  A LYS A 1 303 ? -12.731 -6.562  -34.522 0.50 32.96 ? 511 LYS A CD  1 
ATOM   2164 C CD  B LYS A 1 303 ? -12.746 -6.112  -32.677 0.50 31.60 ? 511 LYS A CD  1 
ATOM   2165 C CE  A LYS A 1 303 ? -13.951 -5.682  -34.286 0.50 32.06 ? 511 LYS A CE  1 
ATOM   2166 C CE  B LYS A 1 303 ? -13.762 -5.010  -33.015 0.50 31.27 ? 511 LYS A CE  1 
ATOM   2167 N NZ  A LYS A 1 303 ? -13.564 -4.250  -34.270 0.50 32.05 ? 511 LYS A NZ  1 
ATOM   2168 N NZ  B LYS A 1 303 ? -14.259 -4.186  -31.847 0.50 29.75 ? 511 LYS A NZ  1 
ATOM   2169 N N   . ALA A 1 304 ? -9.648  -9.546  -31.149 1.00 32.27 ? 512 ALA A N   1 
ATOM   2170 C CA  . ALA A 1 304 ? -8.872  -10.762 -30.958 1.00 35.62 ? 512 ALA A CA  1 
ATOM   2171 C C   . ALA A 1 304 ? -8.214  -11.133 -32.266 1.00 34.81 ? 512 ALA A C   1 
ATOM   2172 O O   . ALA A 1 304 ? -8.870  -11.109 -33.286 1.00 29.97 ? 512 ALA A O   1 
ATOM   2173 C CB  . ALA A 1 304 ? -9.771  -11.914 -30.511 1.00 37.27 ? 512 ALA A CB  1 
ATOM   2174 N N   . GLY A 1 305 ? -6.928  -11.479 -32.219 1.00 35.11 ? 513 GLY A N   1 
ATOM   2175 C CA  . GLY A 1 305 ? -6.174  -11.809 -33.420 1.00 34.41 ? 513 GLY A CA  1 
ATOM   2176 C C   . GLY A 1 305 ? -5.481  -10.636 -34.094 1.00 34.57 ? 513 GLY A C   1 
ATOM   2177 O O   . GLY A 1 305 ? -4.642  -10.840 -34.942 1.00 34.38 ? 513 GLY A O   1 
ATOM   2178 N N   . GLU A 1 306 ? -5.834  -9.405  -33.747 1.00 36.63 ? 514 GLU A N   1 
ATOM   2179 C CA  . GLU A 1 306 ? -5.157  -8.207  -34.304 1.00 35.07 ? 514 GLU A CA  1 
ATOM   2180 C C   . GLU A 1 306 ? -3.677  -8.131  -33.840 1.00 35.27 ? 514 GLU A C   1 
ATOM   2181 O O   . GLU A 1 306 ? -3.356  -8.554  -32.724 1.00 32.71 ? 514 GLU A O   1 
ATOM   2182 C CB  . GLU A 1 306 ? -5.902  -6.968  -33.808 1.00 38.10 ? 514 GLU A CB  1 
ATOM   2183 C CG  . GLU A 1 306 ? -5.375  -5.605  -34.261 1.00 43.70 ? 514 GLU A CG  1 
ATOM   2184 C CD  . GLU A 1 306 ? -6.135  -4.441  -33.604 1.00 45.75 ? 514 GLU A CD  1 
ATOM   2185 O OE1 . GLU A 1 306 ? -7.358  -4.582  -33.330 1.00 41.63 ? 514 GLU A OE1 1 
ATOM   2186 O OE2 . GLU A 1 306 ? -5.510  -3.380  -33.370 1.00 45.51 ? 514 GLU A OE2 1 
ATOM   2187 N N   . ALA A 1 307 ? -2.802  -7.581  -34.684 1.00 32.13 ? 515 ALA A N   1 
ATOM   2188 C CA  . ALA A 1 307 ? -1.412  -7.365  -34.338 1.00 34.20 ? 515 ALA A CA  1 
ATOM   2189 C C   . ALA A 1 307 ? -1.252  -5.877  -34.083 1.00 34.44 ? 515 ALA A C   1 
ATOM   2190 O O   . ALA A 1 307 ? -1.161  -5.090  -35.001 1.00 35.70 ? 515 ALA A O   1 
ATOM   2191 C CB  . ALA A 1 307 ? -0.482  -7.836  -35.453 1.00 35.57 ? 515 ALA A CB  1 
ATOM   2192 N N   . LEU A 1 308 ? -1.265  -5.488  -32.811 1.00 32.67 ? 516 LEU A N   1 
ATOM   2193 C CA  . LEU A 1 308 ? -1.223  -4.079  -32.437 1.00 31.34 ? 516 LEU A CA  1 
ATOM   2194 C C   . LEU A 1 308 ? 0.217   -3.608  -32.309 1.00 31.52 ? 516 LEU A C   1 
ATOM   2195 O O   . LEU A 1 308 ? 0.969   -4.098  -31.448 1.00 32.81 ? 516 LEU A O   1 
ATOM   2196 C CB  . LEU A 1 308 ? -1.948  -3.909  -31.100 1.00 33.13 ? 516 LEU A CB  1 
ATOM   2197 C CG  . LEU A 1 308 ? -1.956  -2.509  -30.525 1.00 31.61 ? 516 LEU A CG  1 
ATOM   2198 C CD1 . LEU A 1 308 ? -2.789  -1.560  -31.387 1.00 33.69 ? 516 LEU A CD1 1 
ATOM   2199 C CD2 . LEU A 1 308 ? -2.488  -2.607  -29.110 1.00 31.78 ? 516 LEU A CD2 1 
ATOM   2200 N N   . LYS A 1 309 ? 0.604   -2.670  -33.166 1.00 32.29 ? 517 LYS A N   1 
ATOM   2201 C CA  . LYS A 1 309 ? 1.974   -2.208  -33.247 1.00 34.86 ? 517 LYS A CA  1 
ATOM   2202 C C   . LYS A 1 309 ? 2.186   -0.874  -32.513 1.00 34.63 ? 517 LYS A C   1 
ATOM   2203 O O   . LYS A 1 309 ? 1.348   0.026   -32.588 1.00 33.64 ? 517 LYS A O   1 
ATOM   2204 C CB  . LYS A 1 309 ? 2.346   -1.980  -34.713 1.00 40.46 ? 517 LYS A CB  1 
ATOM   2205 C CG  . LYS A 1 309 ? 2.498   -3.251  -35.534 1.00 45.03 ? 517 LYS A CG  1 
ATOM   2206 C CD  . LYS A 1 309 ? 3.053   -2.945  -36.921 1.00 50.05 ? 517 LYS A CD  1 
ATOM   2207 C CE  . LYS A 1 309 ? 4.053   -4.000  -37.387 1.00 55.80 ? 517 LYS A CE  1 
ATOM   2208 N NZ  . LYS A 1 309 ? 3.535   -5.397  -37.228 1.00 56.52 ? 517 LYS A NZ  1 
ATOM   2209 N N   . GLY A 1 310 ? 3.327   -0.736  -31.855 1.00 31.88 ? 518 GLY A N   1 
ATOM   2210 C CA  . GLY A 1 310 ? 3.703   0.531   -31.239 1.00 30.77 ? 518 GLY A CA  1 
ATOM   2211 C C   . GLY A 1 310 ? 5.196   0.644   -31.073 1.00 30.09 ? 518 GLY A C   1 
ATOM   2212 O O   . GLY A 1 310 ? 5.968   -0.179  -31.596 1.00 29.91 ? 518 GLY A O   1 
ATOM   2213 N N   . LYS A 1 311 ? 5.607   1.665   -30.338 1.00 28.34 ? 519 LYS A N   1 
ATOM   2214 C CA  . LYS A 1 311 ? 6.998   1.897   -30.102 1.00 26.48 ? 519 LYS A CA  1 
ATOM   2215 C C   . LYS A 1 311 ? 7.198   2.420   -28.683 1.00 26.65 ? 519 LYS A C   1 
ATOM   2216 O O   . LYS A 1 311 ? 6.372   3.190   -28.152 1.00 23.88 ? 519 LYS A O   1 
ATOM   2217 C CB  . LYS A 1 311 ? 7.543   2.869   -31.160 1.00 29.99 ? 519 LYS A CB  1 
ATOM   2218 C CG  . LYS A 1 311 ? 9.061   2.979   -31.139 1.00 35.14 ? 519 LYS A CG  1 
ATOM   2219 C CD  . LYS A 1 311 ? 9.672   3.802   -32.278 1.00 36.45 ? 519 LYS A CD  1 
ATOM   2220 C CE  . LYS A 1 311 ? 11.190  3.713   -32.144 1.00 38.64 ? 519 LYS A CE  1 
ATOM   2221 N NZ  . LYS A 1 311 ? 11.986  4.442   -33.172 1.00 38.79 ? 519 LYS A NZ  1 
ATOM   2222 N N   . VAL A 1 312 ? 8.304   1.992   -28.082 1.00 26.43 ? 520 VAL A N   1 
ATOM   2223 C CA  . VAL A 1 312 ? 8.633   2.323   -26.710 1.00 26.70 ? 520 VAL A CA  1 
ATOM   2224 C C   . VAL A 1 312 ? 10.079  2.749   -26.625 1.00 25.76 ? 520 VAL A C   1 
ATOM   2225 O O   . VAL A 1 312 ? 10.939  2.114   -27.190 1.00 27.85 ? 520 VAL A O   1 
ATOM   2226 C CB  . VAL A 1 312 ? 8.362   1.130   -25.747 1.00 27.19 ? 520 VAL A CB  1 
ATOM   2227 C CG1 . VAL A 1 312 ? 9.274   -0.079  -26.022 1.00 28.01 ? 520 VAL A CG1 1 
ATOM   2228 C CG2 . VAL A 1 312 ? 8.524   1.577   -24.315 1.00 28.23 ? 520 VAL A CG2 1 
ATOM   2229 N N   . THR A 1 313 ? 10.339  3.829   -25.903 1.00 27.11 ? 521 THR A N   1 
ATOM   2230 C CA  . THR A 1 313 ? 11.702  4.279   -25.648 1.00 27.16 ? 521 THR A CA  1 
ATOM   2231 C C   . THR A 1 313 ? 11.898  4.640   -24.181 1.00 26.10 ? 521 THR A C   1 
ATOM   2232 O O   . THR A 1 313 ? 11.096  5.364   -23.584 1.00 28.28 ? 521 THR A O   1 
ATOM   2233 C CB  . THR A 1 313 ? 12.047  5.504   -26.509 1.00 29.12 ? 521 THR A CB  1 
ATOM   2234 O OG1 . THR A 1 313 ? 11.883  5.166   -27.891 1.00 27.86 ? 521 THR A OG1 1 
ATOM   2235 C CG2 . THR A 1 313 ? 13.513  5.958   -26.248 1.00 30.32 ? 521 THR A CG2 1 
ATOM   2236 N N   . VAL A 1 314 ? 12.974  4.132   -23.606 1.00 26.08 ? 522 VAL A N   1 
ATOM   2237 C CA  . VAL A 1 314 ? 13.365  4.458   -22.234 1.00 28.48 ? 522 VAL A CA  1 
ATOM   2238 C C   . VAL A 1 314 ? 14.541  5.437   -22.236 1.00 29.67 ? 522 VAL A C   1 
ATOM   2239 O O   . VAL A 1 314 ? 15.565  5.165   -22.834 1.00 30.05 ? 522 VAL A O   1 
ATOM   2240 C CB  . VAL A 1 314 ? 13.734  3.163   -21.486 1.00 30.91 ? 522 VAL A CB  1 
ATOM   2241 C CG1 . VAL A 1 314 ? 14.343  3.462   -20.118 1.00 33.59 ? 522 VAL A CG1 1 
ATOM   2242 C CG2 . VAL A 1 314 ? 12.486  2.273   -21.383 1.00 32.01 ? 522 VAL A CG2 1 
ATOM   2243 N N   . HIS A 1 315 ? 14.380  6.577   -21.569 1.00 32.98 ? 523 HIS A N   1 
ATOM   2244 C CA  . HIS A 1 315 ? 15.446  7.572   -21.436 1.00 35.28 ? 523 HIS A CA  1 
ATOM   2245 C C   . HIS A 1 315 ? 15.831  7.803   -19.983 1.00 40.02 ? 523 HIS A C   1 
ATOM   2246 O O   . HIS A 1 315 ? 14.997  7.671   -19.090 1.00 39.47 ? 523 HIS A O   1 
ATOM   2247 C CB  . HIS A 1 315 ? 15.002  8.915   -21.985 1.00 34.86 ? 523 HIS A CB  1 
ATOM   2248 C CG  . HIS A 1 315 ? 14.882  8.967   -23.472 1.00 36.10 ? 523 HIS A CG  1 
ATOM   2249 N ND1 . HIS A 1 315 ? 13.689  9.249   -24.106 1.00 36.36 ? 523 HIS A ND1 1 
ATOM   2250 C CD2 . HIS A 1 315 ? 15.810  8.825   -24.452 1.00 36.50 ? 523 HIS A CD2 1 
ATOM   2251 C CE1 . HIS A 1 315 ? 13.883  9.256   -25.413 1.00 38.25 ? 523 HIS A CE1 1 
ATOM   2252 N NE2 . HIS A 1 315 ? 15.166  9.013   -25.648 1.00 38.14 ? 523 HIS A NE2 1 
ATOM   2253 N N   . LYS A 1 316 ? 17.087  8.223   -19.783 1.00 50.94 ? 524 LYS A N   1 
ATOM   2254 C CA  . LYS A 1 316 ? 17.642  8.626   -18.481 1.00 54.83 ? 524 LYS A CA  1 
ATOM   2255 C C   . LYS A 1 316 ? 17.113  9.991   -18.072 1.00 55.44 ? 524 LYS A C   1 
ATOM   2256 O O   . LYS A 1 316 ? 17.875  10.944  -17.972 1.00 58.25 ? 524 LYS A O   1 
ATOM   2257 C CB  . LYS A 1 316 ? 19.175  8.683   -18.549 1.00 55.30 ? 524 LYS A CB  1 
ATOM   2258 N N   . SER A 1 323 ? 16.107  8.797   -12.196 1.00 70.20 ? 531 SER A N   1 
ATOM   2259 C CA  . SER A 1 323 ? 14.736  8.569   -12.644 1.00 69.59 ? 531 SER A CA  1 
ATOM   2260 C C   . SER A 1 323 ? 14.609  8.530   -14.187 1.00 63.62 ? 531 SER A C   1 
ATOM   2261 O O   . SER A 1 323 ? 15.097  9.402   -14.912 1.00 63.90 ? 531 SER A O   1 
ATOM   2262 C CB  . SER A 1 323 ? 13.800  9.632   -12.066 1.00 68.27 ? 531 SER A CB  1 
ATOM   2263 O OG  . SER A 1 323 ? 13.947  10.837  -12.787 1.00 69.04 ? 531 SER A OG  1 
ATOM   2264 N N   . LEU A 1 324 ? 13.923  7.501   -14.660 1.00 57.57 ? 532 LEU A N   1 
ATOM   2265 C CA  . LEU A 1 324 ? 13.751  7.235   -16.080 1.00 53.51 ? 532 LEU A CA  1 
ATOM   2266 C C   . LEU A 1 324 ? 12.438  7.772   -16.577 1.00 42.89 ? 532 LEU A C   1 
ATOM   2267 O O   . LEU A 1 324 ? 11.518  7.966   -15.810 1.00 41.71 ? 532 LEU A O   1 
ATOM   2268 C CB  . LEU A 1 324 ? 13.702  5.719   -16.327 1.00 57.04 ? 532 LEU A CB  1 
ATOM   2269 C CG  . LEU A 1 324 ? 14.957  4.877   -16.198 1.00 58.83 ? 532 LEU A CG  1 
ATOM   2270 C CD1 . LEU A 1 324 ? 14.607  3.469   -16.633 1.00 62.17 ? 532 LEU A CD1 1 
ATOM   2271 C CD2 . LEU A 1 324 ? 16.112  5.428   -17.020 1.00 60.80 ? 532 LEU A CD2 1 
ATOM   2272 N N   . THR A 1 325 ? 12.332  7.934   -17.889 1.00 36.91 ? 533 THR A N   1 
ATOM   2273 C CA  . THR A 1 325 ? 11.040  8.175   -18.506 1.00 32.57 ? 533 THR A CA  1 
ATOM   2274 C C   . THR A 1 325 ? 10.796  7.134   -19.582 1.00 29.69 ? 533 THR A C   1 
ATOM   2275 O O   . THR A 1 325 ? 11.728  6.562   -20.154 1.00 27.84 ? 533 THR A O   1 
ATOM   2276 C CB  . THR A 1 325 ? 10.941  9.607   -19.068 1.00 31.39 ? 533 THR A CB  1 
ATOM   2277 O OG1 . THR A 1 325 ? 11.995  9.816   -19.986 1.00 31.43 ? 533 THR A OG1 1 
ATOM   2278 C CG2 . THR A 1 325 ? 11.061  10.622  -17.955 1.00 33.46 ? 533 THR A CG2 1 
ATOM   2279 N N   . VAL A 1 326 ? 9.525   6.874   -19.840 1.00 28.61 ? 534 VAL A N   1 
ATOM   2280 C CA  . VAL A 1 326 ? 9.139   5.881   -20.827 1.00 27.55 ? 534 VAL A CA  1 
ATOM   2281 C C   . VAL A 1 326 ? 8.233   6.583   -21.795 1.00 27.24 ? 534 VAL A C   1 
ATOM   2282 O O   . VAL A 1 326 ? 7.199   7.092   -21.387 1.00 28.37 ? 534 VAL A O   1 
ATOM   2283 C CB  . VAL A 1 326 ? 8.374   4.727   -20.188 1.00 28.35 ? 534 VAL A CB  1 
ATOM   2284 C CG1 . VAL A 1 326 ? 7.913   3.729   -21.238 1.00 29.98 ? 534 VAL A CG1 1 
ATOM   2285 C CG2 . VAL A 1 326 ? 9.222   4.054   -19.111 1.00 28.57 ? 534 VAL A CG2 1 
ATOM   2286 N N   . THR A 1 327 ? 8.628   6.616   -23.064 1.00 26.03 ? 535 THR A N   1 
ATOM   2287 C CA  . THR A 1 327 ? 7.816   7.204   -24.103 1.00 27.04 ? 535 THR A CA  1 
ATOM   2288 C C   . THR A 1 327 ? 7.174   6.086   -24.916 1.00 27.19 ? 535 THR A C   1 
ATOM   2289 O O   . THR A 1 327 ? 7.869   5.175   -25.425 1.00 25.33 ? 535 THR A O   1 
ATOM   2290 C CB  . THR A 1 327 ? 8.675   8.110   -25.003 1.00 28.93 ? 535 THR A CB  1 
ATOM   2291 O OG1 . THR A 1 327 ? 9.257   9.131   -24.190 1.00 29.02 ? 535 THR A OG1 1 
ATOM   2292 C CG2 . THR A 1 327 ? 7.847   8.742   -26.086 1.00 29.29 ? 535 THR A CG2 1 
ATOM   2293 N N   . LEU A 1 328 ? 5.857   6.188   -25.065 1.00 26.92 ? 536 LEU A N   1 
ATOM   2294 C CA  . LEU A 1 328 ? 5.049   5.157   -25.709 1.00 29.47 ? 536 LEU A CA  1 
ATOM   2295 C C   . LEU A 1 328 ? 4.270   5.732   -26.863 1.00 29.27 ? 536 LEU A C   1 
ATOM   2296 O O   . LEU A 1 328 ? 3.541   6.690   -26.675 1.00 27.71 ? 536 LEU A O   1 
ATOM   2297 C CB  . LEU A 1 328 ? 4.030   4.625   -24.713 1.00 33.30 ? 536 LEU A CB  1 
ATOM   2298 C CG  . LEU A 1 328 ? 3.749   3.138   -24.749 1.00 41.65 ? 536 LEU A CG  1 
ATOM   2299 C CD1 . LEU A 1 328 ? 5.034   2.402   -24.386 1.00 44.37 ? 536 LEU A CD1 1 
ATOM   2300 C CD2 . LEU A 1 328 ? 2.652   2.805   -23.744 1.00 43.95 ? 536 LEU A CD2 1 
ATOM   2301 N N   . THR A 1 329 ? 4.387   5.131   -28.041 1.00 28.82 ? 537 THR A N   1 
ATOM   2302 C CA  . THR A 1 329 ? 3.522   5.480   -29.165 1.00 27.72 ? 537 THR A CA  1 
ATOM   2303 C C   . THR A 1 329 ? 2.666   4.264   -29.523 1.00 27.78 ? 537 THR A C   1 
ATOM   2304 O O   . THR A 1 329 ? 3.172   3.172   -29.734 1.00 26.78 ? 537 THR A O   1 
ATOM   2305 C CB  . THR A 1 329 ? 4.326   5.912   -30.398 1.00 27.68 ? 537 THR A CB  1 
ATOM   2306 O OG1 . THR A 1 329 ? 5.046   7.118   -30.110 1.00 27.87 ? 537 THR A OG1 1 
ATOM   2307 C CG2 . THR A 1 329 ? 3.387   6.150   -31.614 1.00 28.39 ? 537 THR A CG2 1 
ATOM   2308 N N   . LEU A 1 330 ? 1.367   4.482   -29.614 1.00 27.69 ? 538 LEU A N   1 
ATOM   2309 C CA  . LEU A 1 330 ? 0.404   3.422   -29.809 1.00 29.69 ? 538 LEU A CA  1 
ATOM   2310 C C   . LEU A 1 330 ? -0.877  4.075   -30.320 1.00 29.63 ? 538 LEU A C   1 
ATOM   2311 O O   . LEU A 1 330 ? -1.296  5.089   -29.767 1.00 25.96 ? 538 LEU A O   1 
ATOM   2312 C CB  . LEU A 1 330 ? 0.150   2.774   -28.453 1.00 32.83 ? 538 LEU A CB  1 
ATOM   2313 C CG  . LEU A 1 330 ? -0.620  1.470   -28.462 1.00 35.64 ? 538 LEU A CG  1 
ATOM   2314 C CD1 . LEU A 1 330 ? 0.208   0.401   -29.132 1.00 35.13 ? 538 LEU A CD1 1 
ATOM   2315 C CD2 . LEU A 1 330 ? -1.017  1.073   -27.044 1.00 37.04 ? 538 LEU A CD2 1 
ATOM   2316 N N   . ASN A 1 331 ? -1.476  3.523   -31.373 1.00 30.11 ? 539 ASN A N   1 
ATOM   2317 C CA  . ASN A 1 331 ? -2.754  4.028   -31.925 1.00 30.81 ? 539 ASN A CA  1 
ATOM   2318 C C   . ASN A 1 331 ? -2.653  5.482   -32.301 1.00 31.98 ? 539 ASN A C   1 
ATOM   2319 O O   . ASN A 1 331 ? -3.611  6.221   -32.125 1.00 27.99 ? 539 ASN A O   1 
ATOM   2320 C CB  . ASN A 1 331 ? -3.906  3.869   -30.917 1.00 30.62 ? 539 ASN A CB  1 
ATOM   2321 C CG  . ASN A 1 331 ? -5.310  4.001   -31.566 1.00 31.75 ? 539 ASN A CG  1 
ATOM   2322 O OD1 . ASN A 1 331 ? -6.191  4.706   -31.063 1.00 34.42 ? 539 ASN A OD1 1 
ATOM   2323 N ND2 . ASN A 1 331 ? -5.519  3.298   -32.630 1.00 31.41 ? 539 ASN A ND2 1 
ATOM   2324 N N   . ASN A 1 332 ? -1.473  5.892   -32.759 1.00 35.06 ? 540 ASN A N   1 
ATOM   2325 C CA  . ASN A 1 332 ? -1.207  7.262   -33.178 1.00 37.36 ? 540 ASN A CA  1 
ATOM   2326 C C   . ASN A 1 332 ? -1.278  8.302   -32.096 1.00 37.30 ? 540 ASN A C   1 
ATOM   2327 O O   . ASN A 1 332 ? -1.519  9.468   -32.400 1.00 37.02 ? 540 ASN A O   1 
ATOM   2328 C CB  . ASN A 1 332 ? -2.163  7.671   -34.299 1.00 40.40 ? 540 ASN A CB  1 
ATOM   2329 C CG  . ASN A 1 332 ? -1.976  6.838   -35.533 1.00 41.71 ? 540 ASN A CG  1 
ATOM   2330 O OD1 . ASN A 1 332 ? -0.863  6.704   -36.031 1.00 41.71 ? 540 ASN A OD1 1 
ATOM   2331 N ND2 . ASN A 1 332 ? -3.047  6.269   -36.028 1.00 43.64 ? 540 ASN A ND2 1 
ATOM   2332 N N   . SER A 1 333 ? -1.083  7.909   -30.840 1.00 36.92 ? 541 SER A N   1 
ATOM   2333 C CA  . SER A 1 333 ? -0.811  8.886   -29.786 1.00 34.66 ? 541 SER A CA  1 
ATOM   2334 C C   . SER A 1 333 ? 0.495   8.518   -29.141 1.00 32.12 ? 541 SER A C   1 
ATOM   2335 O O   . SER A 1 333 ? 0.854   7.342   -29.069 1.00 31.04 ? 541 SER A O   1 
ATOM   2336 C CB  . SER A 1 333 ? -1.855  8.884   -28.685 1.00 37.90 ? 541 SER A CB  1 
ATOM   2337 O OG  . SER A 1 333 ? -3.121  8.590   -29.190 1.00 47.85 ? 541 SER A OG  1 
ATOM   2338 N N   . THR A 1 334 ? 1.139   9.528   -28.585 1.00 28.87 ? 542 THR A N   1 
ATOM   2339 C CA  . THR A 1 334 ? 2.432   9.410   -27.975 1.00 28.77 ? 542 THR A CA  1 
ATOM   2340 C C   . THR A 1 334 ? 2.325   10.067  -26.611 1.00 29.60 ? 542 THR A C   1 
ATOM   2341 O O   . THR A 1 334 ? 1.783   11.163  -26.484 1.00 26.96 ? 542 THR A O   1 
ATOM   2342 C CB  . THR A 1 334 ? 3.509   10.089  -28.853 1.00 27.77 ? 542 THR A CB  1 
ATOM   2343 O OG1 . THR A 1 334 ? 3.656   9.357   -30.075 1.00 25.94 ? 542 THR A OG1 1 
ATOM   2344 C CG2 . THR A 1 334 ? 4.860   10.129  -28.157 1.00 27.03 ? 542 THR A CG2 1 
ATOM   2345 N N   . GLN A 1 335 ? 2.808   9.368   -25.588 1.00 28.35 ? 543 GLN A N   1 
ATOM   2346 C CA  . GLN A 1 335 ? 2.867   9.904   -24.238 1.00 29.88 ? 543 GLN A CA  1 
ATOM   2347 C C   . GLN A 1 335 ? 4.145   9.473   -23.567 1.00 28.07 ? 543 GLN A C   1 
ATOM   2348 O O   . GLN A 1 335 ? 4.591   8.358   -23.747 1.00 28.61 ? 543 GLN A O   1 
ATOM   2349 C CB  . GLN A 1 335 ? 1.651   9.443   -23.420 1.00 29.23 ? 543 GLN A CB  1 
ATOM   2350 C CG  . GLN A 1 335 ? 1.676   9.915   -21.963 1.00 29.83 ? 543 GLN A CG  1 
ATOM   2351 C CD  . GLN A 1 335 ? 1.446   11.424  -21.808 1.00 29.24 ? 543 GLN A CD  1 
ATOM   2352 O OE1 . GLN A 1 335 ? 2.180   12.099  -21.105 1.00 32.38 ? 543 GLN A OE1 1 
ATOM   2353 N NE2 . GLN A 1 335 ? 0.433   11.936  -22.458 1.00 26.69 ? 543 GLN A NE2 1 
ATOM   2354 N N   . THR A 1 336 ? 4.725   10.375  -22.789 1.00 26.19 ? 544 THR A N   1 
ATOM   2355 C CA  . THR A 1 336 ? 5.862   10.076  -21.953 1.00 28.48 ? 544 THR A CA  1 
ATOM   2356 C C   . THR A 1 336 ? 5.415   9.931   -20.502 1.00 26.62 ? 544 THR A C   1 
ATOM   2357 O O   . THR A 1 336 ? 4.604   10.702  -20.011 1.00 27.76 ? 544 THR A O   1 
ATOM   2358 C CB  . THR A 1 336 ? 6.936   11.179  -22.099 1.00 31.26 ? 544 THR A CB  1 
ATOM   2359 O OG1 . THR A 1 336 ? 7.370   11.206  -23.466 1.00 31.86 ? 544 THR A OG1 1 
ATOM   2360 C CG2 . THR A 1 336 ? 8.143   10.918  -21.200 1.00 31.84 ? 544 THR A CG2 1 
ATOM   2361 N N   . TYR A 1 337 ? 5.922   8.906   -19.844 1.00 26.87 ? 545 TYR A N   1 
ATOM   2362 C CA  . TYR A 1 337 ? 5.506   8.557   -18.501 1.00 28.74 ? 545 TYR A CA  1 
ATOM   2363 C C   . TYR A 1 337 ? 6.723   8.546   -17.589 1.00 29.56 ? 545 TYR A C   1 
ATOM   2364 O O   . TYR A 1 337 ? 7.815   8.187   -18.016 1.00 28.09 ? 545 TYR A O   1 
ATOM   2365 C CB  . TYR A 1 337 ? 4.890   7.158   -18.465 1.00 28.15 ? 545 TYR A CB  1 
ATOM   2366 C CG  . TYR A 1 337 ? 3.683   6.957   -19.336 1.00 25.35 ? 545 TYR A CG  1 
ATOM   2367 C CD1 . TYR A 1 337 ? 3.812   6.601   -20.676 1.00 26.08 ? 545 TYR A CD1 1 
ATOM   2368 C CD2 . TYR A 1 337 ? 2.417   7.081   -18.816 1.00 24.56 ? 545 TYR A CD2 1 
ATOM   2369 C CE1 . TYR A 1 337 ? 2.691   6.393   -21.460 1.00 25.79 ? 545 TYR A CE1 1 
ATOM   2370 C CE2 . TYR A 1 337 ? 1.310   6.883   -19.582 1.00 23.05 ? 545 TYR A CE2 1 
ATOM   2371 C CZ  . TYR A 1 337 ? 1.450   6.547   -20.910 1.00 25.36 ? 545 TYR A CZ  1 
ATOM   2372 O OH  . TYR A 1 337 ? 0.311   6.338   -21.652 1.00 24.27 ? 545 TYR A OH  1 
ATOM   2373 N N   . GLY A 1 338 ? 6.517   8.917   -16.329 1.00 31.04 ? 546 GLY A N   1 
ATOM   2374 C CA  . GLY A 1 338 ? 7.564   8.800   -15.306 1.00 31.60 ? 546 GLY A CA  1 
ATOM   2375 C C   . GLY A 1 338 ? 7.066   8.066   -14.082 1.00 34.75 ? 546 GLY A C   1 
ATOM   2376 O O   . GLY A 1 338 ? 5.856   7.866   -13.900 1.00 31.02 ? 546 GLY A O   1 
ATOM   2377 N N   . LEU A 1 339 ? 7.993   7.622   -13.241 1.00 39.39 ? 547 LEU A N   1 
ATOM   2378 C CA  . LEU A 1 339 ? 7.615   7.043   -11.950 1.00 45.60 ? 547 LEU A CA  1 
ATOM   2379 C C   . LEU A 1 339 ? 8.089   7.994   -10.853 1.00 48.55 ? 547 LEU A C   1 
ATOM   2380 O O   . LEU A 1 339 ? 9.259   8.016   -10.537 1.00 51.80 ? 547 LEU A O   1 
ATOM   2381 C CB  . LEU A 1 339 ? 8.173   5.619   -11.791 1.00 41.15 ? 547 LEU A CB  1 
ATOM   2382 N N   . GLN A 1 340 ? 7.174   8.810   -10.320 1.00 61.08 ? 548 GLN A N   1 
ATOM   2383 C CA  . GLN A 1 340 ? 7.483   9.810   -9.273  1.00 65.92 ? 548 GLN A CA  1 
ATOM   2384 C C   . GLN A 1 340 ? 7.410   9.137   -7.907  1.00 68.25 ? 548 GLN A C   1 
ATOM   2385 O O   . GLN A 1 340 ? 8.269   8.320   -7.564  1.00 70.53 ? 548 GLN A O   1 
ATOM   2386 C CB  . GLN A 1 340 ? 6.514   11.018  -9.330  1.00 65.70 ? 548 GLN A CB  1 
HETATM 2387 C C4  . 3ZG B 2 .   ? -4.655  -0.492  -13.011 1.00 26.89 ? 601 3ZG A C4  1 
HETATM 2388 C C5  . 3ZG B 2 .   ? -4.995  -0.924  -14.260 1.00 27.01 ? 601 3ZG A C5  1 
HETATM 2389 C C6  . 3ZG B 2 .   ? -5.609  -0.048  -15.192 1.00 27.13 ? 601 3ZG A C6  1 
HETATM 2390 N N1  . 3ZG B 2 .   ? -4.475  1.174   -11.302 1.00 28.46 ? 601 3ZG A N1  1 
HETATM 2391 C C7  . 3ZG B 2 .   ? -6.033  -0.433  -16.492 1.00 26.47 ? 601 3ZG A C7  1 
HETATM 2392 C C8  . 3ZG B 2 .   ? -6.810  1.660   -16.982 1.00 29.54 ? 601 3ZG A C8  1 
HETATM 2393 N N2  . 3ZG B 2 .   ? -6.628  0.382   -17.358 1.00 27.46 ? 601 3ZG A N2  1 
HETATM 2394 C C9  . 3ZG B 2 .   ? -6.444  2.158   -15.765 1.00 29.22 ? 601 3ZG A C9  1 
HETATM 2395 C C10 . 3ZG B 2 .   ? -5.845  1.288   -14.814 1.00 28.22 ? 601 3ZG A C10 1 
HETATM 2396 C C11 . 3ZG B 2 .   ? -5.487  1.704   -13.507 1.00 27.88 ? 601 3ZG A C11 1 
HETATM 2397 C C12 . 3ZG B 2 .   ? -3.303  6.269   -7.600  1.00 34.95 ? 601 3ZG A C12 1 
HETATM 2398 N N3  . 3ZG B 2 .   ? -4.559  5.537   -7.650  1.00 33.25 ? 601 3ZG A N3  1 
HETATM 2399 C C13 . 3ZG B 2 .   ? -3.732  7.632   -7.141  1.00 36.20 ? 601 3ZG A C13 1 
HETATM 2400 C C14 . 3ZG B 2 .   ? -4.915  7.401   -6.341  1.00 36.42 ? 601 3ZG A C14 1 
HETATM 2401 C C15 . 3ZG B 2 .   ? -5.646  6.314   -7.048  1.00 36.12 ? 601 3ZG A C15 1 
HETATM 2402 O O1  . 3ZG B 2 .   ? -4.475  3.467   -11.364 1.00 28.07 ? 601 3ZG A O1  1 
HETATM 2403 C C2  . 3ZG B 2 .   ? -4.386  2.418   -10.740 1.00 27.36 ? 601 3ZG A C2  1 
HETATM 2404 N N   . 3ZG B 2 .   ? -4.125  2.402   -9.433  1.00 29.66 ? 601 3ZG A N   1 
HETATM 2405 C C1  . 3ZG B 2 .   ? -3.630  3.586   -8.771  1.00 28.95 ? 601 3ZG A C1  1 
HETATM 2406 C C   . 3ZG B 2 .   ? -4.805  4.334   -8.182  1.00 28.56 ? 601 3ZG A C   1 
HETATM 2407 O O   . 3ZG B 2 .   ? -5.917  3.863   -8.197  1.00 27.10 ? 601 3ZG A O   1 
HETATM 2408 C C3  . 3ZG B 2 .   ? -4.903  0.821   -12.612 1.00 28.42 ? 601 3ZG A C3  1 
HETATM 2409 X UNK . UNX C 3 .   ? 22.650  -23.114 -18.269 1.00 30.00 1 602 UNX A UNK 1 
HETATM 2410 X UNK . UNX D 3 .   ? -5.272  6.175   -27.877 1.00 30.00 1 603 UNX A UNK 1 
HETATM 2411 O O   . HOH E 4 .   ? 4.693   -11.249 -10.623 1.00 25.35 ? 701 HOH A O   1 
HETATM 2412 O O   . HOH E 4 .   ? 24.639  -28.334 -9.500  1.00 29.56 ? 702 HOH A O   1 
HETATM 2413 O O   . HOH E 4 .   ? -1.421  8.588   -10.424 1.00 27.20 ? 703 HOH A O   1 
HETATM 2414 O O   . HOH E 4 .   ? 6.546   -14.524 -9.806  1.00 29.90 ? 704 HOH A O   1 
HETATM 2415 O O   . HOH E 4 .   ? 1.495   -10.637 -10.124 1.00 26.23 ? 705 HOH A O   1 
HETATM 2416 O O   . HOH E 4 .   ? 2.893   -12.613 -16.682 1.00 30.53 ? 706 HOH A O   1 
HETATM 2417 O O   . HOH E 4 .   ? 13.235  -21.449 -11.983 1.00 29.74 ? 707 HOH A O   1 
HETATM 2418 O O   . HOH E 4 .   ? 22.872  -9.728  0.464   1.00 28.27 ? 708 HOH A O   1 
HETATM 2419 O O   . HOH E 4 .   ? 7.501   -3.406  -12.065 1.00 27.99 ? 709 HOH A O   1 
HETATM 2420 O O   . HOH E 4 .   ? 11.650  -13.294 -20.510 1.00 33.30 ? 710 HOH A O   1 
HETATM 2421 O O   . HOH E 4 .   ? -12.099 2.650   -30.326 1.00 34.19 ? 711 HOH A O   1 
HETATM 2422 O O   . HOH E 4 .   ? -12.465 7.130   -18.075 1.00 31.55 ? 712 HOH A O   1 
HETATM 2423 O O   . HOH E 4 .   ? 7.283   -5.928  -12.735 1.00 22.80 ? 713 HOH A O   1 
HETATM 2424 O O   . HOH E 4 .   ? -13.425 -4.171  -29.258 1.00 33.15 ? 714 HOH A O   1 
HETATM 2425 O O   . HOH E 4 .   ? 3.016   -7.579  -4.457  1.00 41.31 ? 715 HOH A O   1 
HETATM 2426 O O   . HOH E 4 .   ? -1.633  7.621   -12.884 1.00 25.19 ? 716 HOH A O   1 
HETATM 2427 O O   . HOH E 4 .   ? 40.441  -12.474 -5.897  1.00 49.40 ? 717 HOH A O   1 
HETATM 2428 O O   . HOH E 4 .   ? 22.630  -7.372  -3.401  1.00 27.52 ? 718 HOH A O   1 
HETATM 2429 O O   . HOH E 4 .   ? -2.087  8.273   -23.427 1.00 28.70 ? 719 HOH A O   1 
HETATM 2430 O O   . HOH E 4 .   ? 2.303   -10.075 -28.284 1.00 32.38 ? 720 HOH A O   1 
HETATM 2431 O O   . HOH E 4 .   ? -14.006 -10.165 -32.333 1.00 31.38 ? 721 HOH A O   1 
HETATM 2432 O O   . HOH E 4 .   ? -12.354 -3.567  -19.615 1.00 26.76 ? 722 HOH A O   1 
HETATM 2433 O O   . HOH E 4 .   ? 4.801   -14.282 -15.937 1.00 36.67 ? 723 HOH A O   1 
HETATM 2434 O O   . HOH E 4 .   ? -0.033  6.183   -16.393 1.00 27.66 ? 724 HOH A O   1 
HETATM 2435 O O   . HOH E 4 .   ? 32.391  -20.526 2.823   1.00 26.04 ? 725 HOH A O   1 
HETATM 2436 O O   . HOH E 4 .   ? -6.454  -4.129  -14.729 1.00 26.67 ? 726 HOH A O   1 
HETATM 2437 O O   . HOH E 4 .   ? -1.655  10.902  -23.563 1.00 33.10 ? 727 HOH A O   1 
HETATM 2438 O O   . HOH E 4 .   ? -18.326 12.779  -6.469  1.00 38.65 ? 728 HOH A O   1 
HETATM 2439 O O   . HOH E 4 .   ? 30.044  -19.251 -13.508 1.00 33.36 ? 729 HOH A O   1 
HETATM 2440 O O   . HOH E 4 .   ? 16.662  9.100   -27.909 1.00 31.71 ? 730 HOH A O   1 
HETATM 2441 O O   . HOH E 4 .   ? 1.674   9.726   -31.783 1.00 35.24 ? 731 HOH A O   1 
HETATM 2442 O O   . HOH E 4 .   ? 31.098  -22.211 -19.793 1.00 27.58 ? 732 HOH A O   1 
HETATM 2443 O O   . HOH E 4 .   ? -4.335  8.195   -25.662 1.00 30.22 ? 733 HOH A O   1 
HETATM 2444 O O   . HOH E 4 .   ? -12.567 -11.900 -27.895 1.00 33.04 ? 734 HOH A O   1 
HETATM 2445 O O   . HOH E 4 .   ? -0.887  1.365   -32.813 1.00 37.34 ? 735 HOH A O   1 
HETATM 2446 O O   . HOH E 4 .   ? -6.044  -4.964  -12.173 1.00 29.28 ? 736 HOH A O   1 
HETATM 2447 O O   . HOH E 4 .   ? 32.580  -19.433 8.580   1.00 40.48 ? 737 HOH A O   1 
HETATM 2448 O O   . HOH E 4 .   ? -13.502 -3.036  -15.902 1.00 34.79 ? 738 HOH A O   1 
HETATM 2449 O O   . HOH E 4 .   ? 25.084  0.701   -1.939  1.00 52.00 ? 739 HOH A O   1 
HETATM 2450 O O   . HOH E 4 .   ? -1.279  -10.718 -11.070 1.00 28.88 ? 740 HOH A O   1 
HETATM 2451 O O   . HOH E 4 .   ? 10.076  -9.965  -19.479 1.00 29.26 ? 741 HOH A O   1 
HETATM 2452 O O   . HOH E 4 .   ? -7.043  -1.159  -32.739 1.00 36.48 ? 742 HOH A O   1 
HETATM 2453 O O   . HOH E 4 .   ? -4.661  -3.609  -10.358 1.00 35.49 ? 743 HOH A O   1 
HETATM 2454 O O   A HOH E 4 .   ? -11.668 -11.207 -33.948 0.50 25.34 ? 744 HOH A O   1 
HETATM 2455 O O   B HOH E 4 .   ? -12.080 -9.926  -35.831 0.50 28.66 ? 744 HOH A O   1 
HETATM 2456 O O   . HOH E 4 .   ? 33.186  -6.830  8.143   1.00 36.14 ? 745 HOH A O   1 
HETATM 2457 O O   . HOH E 4 .   ? 6.724   -12.967 -3.871  1.00 31.28 ? 746 HOH A O   1 
HETATM 2458 O O   . HOH E 4 .   ? 17.146  -6.069  -26.476 1.00 35.57 ? 747 HOH A O   1 
HETATM 2459 O O   . HOH E 4 .   ? 0.819   4.498   -33.772 1.00 40.35 ? 748 HOH A O   1 
HETATM 2460 O O   . HOH E 4 .   ? -0.848  -3.933  -5.919  1.00 35.71 ? 749 HOH A O   1 
HETATM 2461 O O   . HOH E 4 .   ? 32.600  -19.300 -10.365 1.00 38.23 ? 750 HOH A O   1 
HETATM 2462 O O   . HOH E 4 .   ? 27.780  -15.472 17.396  1.00 54.41 ? 751 HOH A O   1 
HETATM 2463 O O   . HOH E 4 .   ? 11.380  8.429   -22.778 1.00 40.27 ? 752 HOH A O   1 
HETATM 2464 O O   . HOH E 4 .   ? 26.176  -9.809  16.426  1.00 36.52 ? 753 HOH A O   1 
HETATM 2465 O O   . HOH E 4 .   ? 8.345   13.711  -23.854 1.00 29.81 ? 754 HOH A O   1 
HETATM 2466 O O   . HOH E 4 .   ? 30.239  -14.502 -19.747 1.00 46.47 ? 755 HOH A O   1 
HETATM 2467 O O   . HOH E 4 .   ? 33.796  -17.096 -18.316 1.00 44.05 ? 756 HOH A O   1 
HETATM 2468 O O   . HOH E 4 .   ? 32.911  -17.586 -14.063 1.00 39.95 ? 757 HOH A O   1 
HETATM 2469 O O   . HOH E 4 .   ? 5.424   -9.047  -9.521  1.00 26.14 ? 758 HOH A O   1 
HETATM 2470 O O   . HOH E 4 .   ? -13.633 -3.968  -23.060 1.00 36.16 ? 759 HOH A O   1 
HETATM 2471 O O   . HOH E 4 .   ? 27.148  -28.051 -8.663  1.00 32.62 ? 760 HOH A O   1 
HETATM 2472 O O   . HOH E 4 .   ? -9.278  -2.881  -34.179 1.00 39.88 ? 761 HOH A O   1 
HETATM 2473 O O   . HOH E 4 .   ? 6.282   -13.838 -1.189  1.00 45.29 ? 762 HOH A O   1 
HETATM 2474 O O   . HOH E 4 .   ? -16.910 12.200  -12.902 1.00 36.44 ? 763 HOH A O   1 
HETATM 2475 O O   . HOH E 4 .   ? -14.419 3.410   -18.932 1.00 37.40 ? 764 HOH A O   1 
HETATM 2476 O O   . HOH E 4 .   ? 1.725   13.408  -28.588 1.00 52.41 ? 765 HOH A O   1 
HETATM 2477 O O   . HOH E 4 .   ? 17.495  -17.033 -21.495 1.00 54.65 ? 766 HOH A O   1 
HETATM 2478 O O   . HOH E 4 .   ? -0.372  15.394  -19.428 1.00 37.95 ? 767 HOH A O   1 
HETATM 2479 O O   . HOH E 4 .   ? 4.199   -17.857 -10.675 1.00 36.08 ? 768 HOH A O   1 
HETATM 2480 O O   . HOH E 4 .   ? 25.092  -25.381 -1.681  1.00 41.07 ? 769 HOH A O   1 
HETATM 2481 O O   . HOH E 4 .   ? -10.682 -6.976  -18.882 1.00 37.48 ? 770 HOH A O   1 
HETATM 2482 O O   . HOH E 4 .   ? 39.239  -1.068  -4.292  1.00 40.97 ? 771 HOH A O   1 
HETATM 2483 O O   . HOH E 4 .   ? 5.974   -1.644  -34.111 1.00 45.76 ? 772 HOH A O   1 
HETATM 2484 O O   . HOH E 4 .   ? 23.639  2.505   -9.742  1.00 52.33 ? 773 HOH A O   1 
HETATM 2485 O O   . HOH E 4 .   ? -8.014  -15.331 -28.314 1.00 49.74 ? 774 HOH A O   1 
HETATM 2486 O O   . HOH E 4 .   ? -11.695 -3.314  -12.722 1.00 50.66 ? 775 HOH A O   1 
HETATM 2487 O O   . HOH E 4 .   ? 7.072   -8.888  0.780   1.00 36.58 ? 776 HOH A O   1 
HETATM 2488 O O   . HOH E 4 .   ? 21.571  2.120   -11.872 1.00 45.18 ? 777 HOH A O   1 
HETATM 2489 O O   . HOH E 4 .   ? -11.686 -2.647  -32.956 1.00 36.96 ? 778 HOH A O   1 
HETATM 2490 O O   . HOH E 4 .   ? -8.558  -5.580  -35.661 1.00 51.78 ? 779 HOH A O   1 
HETATM 2491 O O   . HOH E 4 .   ? 24.989  -16.539 17.636  1.00 42.14 ? 780 HOH A O   1 
HETATM 2492 O O   . HOH E 4 .   ? -3.804  -3.145  -35.402 1.00 49.21 ? 781 HOH A O   1 
HETATM 2493 O O   . HOH E 4 .   ? 35.593  -10.409 -17.207 1.00 52.01 ? 782 HOH A O   1 
HETATM 2494 O O   . HOH E 4 .   ? 7.880   -11.840 -22.719 1.00 40.92 ? 783 HOH A O   1 
HETATM 2495 O O   . HOH E 4 .   ? 12.882  -9.215  -24.485 1.00 36.72 ? 784 HOH A O   1 
HETATM 2496 O O   . HOH E 4 .   ? -1.414  -1.425  -34.923 1.00 35.83 ? 785 HOH A O   1 
HETATM 2497 O O   . HOH E 4 .   ? -8.269  3.160   -32.906 1.00 39.03 ? 786 HOH A O   1 
HETATM 2498 O O   . HOH E 4 .   ? -15.545 7.489   -12.753 1.00 42.94 ? 787 HOH A O   1 
HETATM 2499 O O   . HOH E 4 .   ? -19.222 18.335  -13.124 1.00 47.57 ? 788 HOH A O   1 
HETATM 2500 O O   . HOH E 4 .   ? 41.670  -10.716 -14.465 1.00 49.50 ? 789 HOH A O   1 
HETATM 2501 O O   . HOH E 4 .   ? 28.159  1.976   -14.338 1.00 54.52 ? 790 HOH A O   1 
HETATM 2502 O O   . HOH E 4 .   ? 31.064  5.819   -0.650  1.00 49.20 ? 791 HOH A O   1 
HETATM 2503 O O   . HOH E 4 .   ? 1.825   14.560  -13.788 1.00 37.70 ? 792 HOH A O   1 
HETATM 2504 O O   . HOH E 4 .   ? 23.073  -8.871  -12.188 1.00 36.33 ? 793 HOH A O   1 
HETATM 2505 O O   . HOH E 4 .   ? 33.763  -16.630 11.413  1.00 42.20 ? 794 HOH A O   1 
HETATM 2506 O O   . HOH E 4 .   ? 30.671  -8.606  11.049  1.00 43.52 ? 795 HOH A O   1 
HETATM 2507 O O   . HOH E 4 .   ? -11.758 15.972  -20.414 1.00 40.26 ? 796 HOH A O   1 
HETATM 2508 O O   . HOH E 4 .   ? 6.697   -8.326  -1.654  1.00 50.22 ? 797 HOH A O   1 
HETATM 2509 O O   . HOH E 4 .   ? 25.208  -18.835 14.829  1.00 36.28 ? 798 HOH A O   1 
HETATM 2510 O O   . HOH E 4 .   ? 2.139   14.833  -20.421 1.00 32.32 ? 799 HOH A O   1 
HETATM 2511 O O   . HOH E 4 .   ? -9.705  0.896   -32.522 1.00 34.23 ? 800 HOH A O   1 
HETATM 2512 O O   . HOH E 4 .   ? 22.820  -13.634 -23.483 1.00 40.59 ? 801 HOH A O   1 
HETATM 2513 O O   . HOH E 4 .   ? 17.808  -5.467  -2.967  1.00 38.42 ? 802 HOH A O   1 
HETATM 2514 O O   . HOH E 4 .   ? 20.258  -21.282 4.557   1.00 37.34 ? 803 HOH A O   1 
HETATM 2515 O O   . HOH E 4 .   ? 0.115   -13.591 -6.623  1.00 44.81 ? 804 HOH A O   1 
HETATM 2516 O O   . HOH E 4 .   ? 20.943  -30.663 -8.123  1.00 44.29 ? 805 HOH A O   1 
HETATM 2517 O O   . HOH E 4 .   ? 35.678  1.323   -5.494  1.00 47.99 ? 806 HOH A O   1 
HETATM 2518 O O   . HOH E 4 .   ? 27.363  -3.015  13.529  1.00 43.32 ? 807 HOH A O   1 
HETATM 2519 O O   . HOH E 4 .   ? -1.032  -12.464 -21.591 1.00 36.57 ? 808 HOH A O   1 
HETATM 2520 O O   . HOH E 4 .   ? 6.469   -13.273 -20.029 1.00 56.29 ? 809 HOH A O   1 
HETATM 2521 O O   . HOH E 4 .   ? 8.266   -11.785 -27.148 1.00 45.06 ? 810 HOH A O   1 
HETATM 2522 O O   . HOH E 4 .   ? 25.094  -15.405 -19.335 1.00 36.47 ? 811 HOH A O   1 
HETATM 2523 O O   . HOH E 4 .   ? 37.285  -16.009 -11.877 1.00 49.31 ? 812 HOH A O   1 
HETATM 2524 O O   . HOH E 4 .   ? -15.622 16.995  -18.310 1.00 51.24 ? 813 HOH A O   1 
HETATM 2525 O O   . HOH E 4 .   ? -15.897 11.849  -9.214  1.00 40.50 ? 814 HOH A O   1 
HETATM 2526 O O   . HOH E 4 .   ? -11.999 5.757   -25.728 1.00 47.58 ? 815 HOH A O   1 
HETATM 2527 O O   . HOH E 4 .   ? 7.356   -5.796  -33.466 1.00 55.12 ? 816 HOH A O   1 
HETATM 2528 O O   . HOH E 4 .   ? 21.605  -0.165  11.069  1.00 53.47 ? 817 HOH A O   1 
HETATM 2529 O O   . HOH E 4 .   ? 6.208   -7.923  3.559   1.00 49.06 ? 818 HOH A O   1 
HETATM 2530 O O   . HOH E 4 .   ? -2.902  0.702   -34.344 1.00 39.81 ? 819 HOH A O   1 
HETATM 2531 O O   . HOH E 4 .   ? -5.160  0.934   -33.390 1.00 42.61 ? 820 HOH A O   1 
HETATM 2532 O O   . HOH E 4 .   ? 10.677  8.413   -13.485 1.00 47.35 ? 821 HOH A O   1 
HETATM 2533 O O   . HOH E 4 .   ? -10.718 5.173   -29.457 1.00 44.35 ? 822 HOH A O   1 
HETATM 2534 O O   . HOH E 4 .   ? 12.356  -19.123 -8.723  1.00 39.21 ? 823 HOH A O   1 
HETATM 2535 O O   . HOH E 4 .   ? 20.370  -2.402  0.285   1.00 52.32 ? 824 HOH A O   1 
HETATM 2536 O O   . HOH E 4 .   ? -14.486 -10.260 -26.627 1.00 44.49 ? 825 HOH A O   1 
HETATM 2537 O O   . HOH E 4 .   ? 11.852  -22.119 -3.559  1.00 53.64 ? 826 HOH A O   1 
HETATM 2538 O O   . HOH E 4 .   ? -1.240  -14.822 -11.934 1.00 52.12 ? 827 HOH A O   1 
HETATM 2539 O O   . HOH E 4 .   ? 2.300   -12.046 -19.245 1.00 41.43 ? 828 HOH A O   1 
HETATM 2540 O O   . HOH E 4 .   ? 39.592  -17.209 -6.339  1.00 47.16 ? 829 HOH A O   1 
HETATM 2541 O O   . HOH E 4 .   ? -14.273 -2.505  -27.439 1.00 38.21 ? 830 HOH A O   1 
HETATM 2542 O O   . HOH E 4 .   ? -15.614 -0.432  -28.971 1.00 45.75 ? 831 HOH A O   1 
HETATM 2543 O O   . HOH E 4 .   ? -14.906 5.922   -18.604 1.00 41.44 ? 832 HOH A O   1 
HETATM 2544 O O   . HOH E 4 .   ? -17.080 6.607   -17.275 1.00 44.91 ? 833 HOH A O   1 
HETATM 2545 O O   . HOH E 4 .   ? -13.121 5.213   -23.446 1.00 49.09 ? 834 HOH A O   1 
HETATM 2546 O O   . HOH E 4 .   ? -13.081 3.036   -21.657 1.00 49.03 ? 835 HOH A O   1 
HETATM 2547 O O   . HOH E 4 .   ? -15.322 -3.160  -25.161 1.00 57.10 ? 836 HOH A O   1 
HETATM 2548 O O   . HOH E 4 .   ? -14.835 2.292   -29.451 1.00 50.38 ? 837 HOH A O   1 
HETATM 2549 O O   . HOH E 4 .   ? 34.282  -20.162 11.526  1.00 44.35 ? 838 HOH A O   1 
HETATM 2550 O O   . HOH E 4 .   ? -12.328 2.446   -32.820 1.00 46.90 ? 839 HOH A O   1 
HETATM 2551 O O   . HOH E 4 .   ? -8.751  -0.130  -34.805 1.00 45.90 ? 840 HOH A O   1 
HETATM 2552 O O   . HOH E 4 .   ? 26.702  -19.869 9.719   1.00 37.21 ? 841 HOH A O   1 
HETATM 2553 O O   . HOH E 4 .   ? 23.702  -19.493 12.454  1.00 38.14 ? 842 HOH A O   1 
HETATM 2554 O O   . HOH E 4 .   ? 26.778  -20.880 7.123   1.00 35.87 ? 843 HOH A O   1 
HETATM 2555 O O   A HOH E 4 .   ? -7.839  17.001  -19.051 0.50 22.49 ? 844 HOH A O   1 
HETATM 2556 O O   B HOH E 4 .   ? -8.696  16.076  -20.720 0.50 25.44 ? 844 HOH A O   1 
HETATM 2557 O O   . HOH E 4 .   ? 17.952  -2.632  -26.903 1.00 40.47 ? 845 HOH A O   1 
HETATM 2558 O O   . HOH E 4 .   ? 21.120  -9.163  -25.215 1.00 45.17 ? 846 HOH A O   1 
HETATM 2559 O O   . HOH E 4 .   ? 18.154  -19.625 -18.915 1.00 44.74 ? 847 HOH A O   1 
HETATM 2560 O O   . HOH E 4 .   ? 17.736  -19.472 -16.487 1.00 36.62 ? 848 HOH A O   1 
HETATM 2561 O O   A HOH E 4 .   ? 31.634  -21.913 -12.984 0.50 22.49 ? 849 HOH A O   1 
HETATM 2562 O O   B HOH E 4 .   ? 32.872  -22.066 -11.229 0.50 26.26 ? 849 HOH A O   1 
HETATM 2563 O O   . HOH E 4 .   ? 17.322  -28.146 -12.541 1.00 50.94 ? 850 HOH A O   1 
HETATM 2564 O O   . HOH E 4 .   ? 33.761  -17.160 -11.605 1.00 41.08 ? 851 HOH A O   1 
HETATM 2565 O O   . HOH E 4 .   ? 36.232  -18.575 -11.491 1.00 49.74 ? 852 HOH A O   1 
HETATM 2566 O O   . HOH E 4 .   ? 30.869  -14.341 15.863  1.00 43.86 ? 853 HOH A O   1 
HETATM 2567 O O   . HOH E 4 .   ? 27.226  -11.772 17.829  1.00 53.67 ? 854 HOH A O   1 
HETATM 2568 O O   . HOH E 4 .   ? -9.067  -4.910  -11.900 1.00 62.64 ? 855 HOH A O   1 
HETATM 2569 O O   . HOH E 4 .   ? 5.620   -11.413 0.567   1.00 48.32 ? 856 HOH A O   1 
HETATM 2570 O O   . HOH E 4 .   ? 34.146  0.397   -13.639 1.00 47.34 ? 857 HOH A O   1 
HETATM 2571 O O   . HOH E 4 .   ? -7.934  13.716  -21.318 1.00 41.02 ? 858 HOH A O   1 
HETATM 2572 O O   . HOH E 4 .   ? -2.522  -11.622 -9.059  1.00 43.26 ? 859 HOH A O   1 
HETATM 2573 O O   . HOH E 4 .   ? 20.935  -30.723 -11.481 1.00 39.32 ? 860 HOH A O   1 
HETATM 2574 O O   . HOH E 4 .   ? 8.298   -21.067 -0.648  1.00 61.19 ? 861 HOH A O   1 
HETATM 2575 O O   . HOH E 4 .   ? -1.714  -11.403 -6.454  1.00 57.85 ? 862 HOH A O   1 
HETATM 2576 O O   . HOH E 4 .   ? 22.519  -4.483  14.938  1.00 46.96 ? 863 HOH A O   1 
HETATM 2577 O O   . HOH E 4 .   ? 38.953  3.859   -2.677  1.00 66.50 ? 864 HOH A O   1 
HETATM 2578 O O   . HOH E 4 .   ? 1.981   3.483   -8.151  1.00 40.45 ? 865 HOH A O   1 
HETATM 2579 O O   . HOH E 4 .   ? 10.969  2.979   -35.112 1.00 56.06 ? 866 HOH A O   1 
HETATM 2580 O O   . HOH E 4 .   ? -19.868 13.149  -8.623  1.00 51.64 ? 867 HOH A O   1 
HETATM 2581 O O   . HOH E 4 .   ? 24.664  -17.779 -20.631 1.00 53.09 ? 868 HOH A O   1 
HETATM 2582 O O   . HOH E 4 .   ? 29.245  -21.451 5.960   1.00 40.03 ? 869 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   209 ?   ?   ?   A . n 
A 1 2   GLY 2   210 ?   ?   ?   A . n 
A 1 3   SER 3   211 ?   ?   ?   A . n 
A 1 4   SER 4   212 ?   ?   ?   A . n 
A 1 5   HIS 5   213 ?   ?   ?   A . n 
A 1 6   HIS 6   214 ?   ?   ?   A . n 
A 1 7   HIS 7   215 ?   ?   ?   A . n 
A 1 8   HIS 8   216 ?   ?   ?   A . n 
A 1 9   HIS 9   217 ?   ?   ?   A . n 
A 1 10  HIS 10  218 ?   ?   ?   A . n 
A 1 11  SER 11  219 ?   ?   ?   A . n 
A 1 12  SER 12  220 ?   ?   ?   A . n 
A 1 13  GLY 13  221 ?   ?   ?   A . n 
A 1 14  LEU 14  222 ?   ?   ?   A . n 
A 1 15  VAL 15  223 ?   ?   ?   A . n 
A 1 16  PRO 16  224 ?   ?   ?   A . n 
A 1 17  ARG 17  225 ?   ?   ?   A . n 
A 1 18  GLY 18  226 ?   ?   ?   A . n 
A 1 19  SER 19  227 ?   ?   ?   A . n 
A 1 20  ASP 20  228 ?   ?   ?   A . n 
A 1 21  LEU 21  229 ?   ?   ?   A . n 
A 1 22  GLN 22  230 ?   ?   ?   A . n 
A 1 23  GLU 23  231 ?   ?   ?   A . n 
A 1 24  ASP 24  232 ?   ?   ?   A . n 
A 1 25  GLU 25  233 ?   ?   ?   A . n 
A 1 26  ASP 26  234 ?   ?   ?   A . n 
A 1 27  GLY 27  235 ?   ?   ?   A . n 
A 1 28  VAL 28  236 ?   ?   ?   A . n 
A 1 29  TYR 29  237 ?   ?   ?   A . n 
A 1 30  PHE 30  238 ?   ?   ?   A . n 
A 1 31  SER 31  239 ?   ?   ?   A . n 
A 1 32  SER 32  240 ?   ?   ?   A . n 
A 1 33  TYR 33  241 ?   ?   ?   A . n 
A 1 34  GLY 34  242 ?   ?   ?   A . n 
A 1 35  HIS 35  243 243 HIS HIS A . n 
A 1 36  TYR 36  244 244 TYR TYR A . n 
A 1 37  GLY 37  245 245 GLY GLY A . n 
A 1 38  ILE 38  246 246 ILE ILE A . n 
A 1 39  HIS 39  247 247 HIS HIS A . n 
A 1 40  GLU 40  248 248 GLU GLU A . n 
A 1 41  GLU 41  249 249 GLU GLU A . n 
A 1 42  MET 42  250 250 MET MET A . n 
A 1 43  LEU 43  251 251 LEU LEU A . n 
A 1 44  LYS 44  252 252 LYS LYS A . n 
A 1 45  ASP 45  253 253 ASP ASP A . n 
A 1 46  LYS 46  254 254 LYS LYS A . n 
A 1 47  ILE 47  255 255 ILE ILE A . n 
A 1 48  ARG 48  256 256 ARG ARG A . n 
A 1 49  THR 49  257 257 THR THR A . n 
A 1 50  GLU 50  258 258 GLU GLU A . n 
A 1 51  SER 51  259 259 SER SER A . n 
A 1 52  TYR 52  260 260 TYR TYR A . n 
A 1 53  ARG 53  261 261 ARG ARG A . n 
A 1 54  ASP 54  262 262 ASP ASP A . n 
A 1 55  PHE 55  263 263 PHE PHE A . n 
A 1 56  ILE 56  264 264 ILE ILE A . n 
A 1 57  TYR 57  265 265 TYR TYR A . n 
A 1 58  GLN 58  266 266 GLN GLN A . n 
A 1 59  ASN 59  267 267 ASN ASN A . n 
A 1 60  PRO 60  268 268 PRO PRO A . n 
A 1 61  HIS 61  269 269 HIS HIS A . n 
A 1 62  ILE 62  270 270 ILE ILE A . n 
A 1 63  PHE 63  271 271 PHE PHE A . n 
A 1 64  LYS 64  272 272 LYS LYS A . n 
A 1 65  ASP 65  273 273 ASP ASP A . n 
A 1 66  LYS 66  274 274 LYS LYS A . n 
A 1 67  VAL 67  275 275 VAL VAL A . n 
A 1 68  VAL 68  276 276 VAL VAL A . n 
A 1 69  LEU 69  277 277 LEU LEU A . n 
A 1 70  ASP 70  278 278 ASP ASP A . n 
A 1 71  VAL 71  279 279 VAL VAL A . n 
A 1 72  GLY 72  280 280 GLY GLY A . n 
A 1 73  CYS 73  281 281 CYS CYS A . n 
A 1 74  GLY 74  282 282 GLY GLY A . n 
A 1 75  THR 75  283 283 THR THR A . n 
A 1 76  GLY 76  284 284 GLY GLY A . n 
A 1 77  ILE 77  285 285 ILE ILE A . n 
A 1 78  LEU 78  286 286 LEU LEU A . n 
A 1 79  SER 79  287 287 SER SER A . n 
A 1 80  MET 80  288 288 MET MET A . n 
A 1 81  PHE 81  289 289 PHE PHE A . n 
A 1 82  ALA 82  290 290 ALA ALA A . n 
A 1 83  ALA 83  291 291 ALA ALA A . n 
A 1 84  LYS 84  292 292 LYS LYS A . n 
A 1 85  ALA 85  293 293 ALA ALA A . n 
A 1 86  GLY 86  294 294 GLY GLY A . n 
A 1 87  ALA 87  295 295 ALA ALA A . n 
A 1 88  LYS 88  296 296 LYS LYS A . n 
A 1 89  LYS 89  297 297 LYS LYS A . n 
A 1 90  VAL 90  298 298 VAL VAL A . n 
A 1 91  LEU 91  299 299 LEU LEU A . n 
A 1 92  GLY 92  300 300 GLY GLY A . n 
A 1 93  VAL 93  301 301 VAL VAL A . n 
A 1 94  ASP 94  302 302 ASP ASP A . n 
A 1 95  GLN 95  303 303 GLN GLN A . n 
A 1 96  SER 96  304 304 SER SER A . n 
A 1 97  GLU 97  305 305 GLU GLU A . n 
A 1 98  ILE 98  306 306 ILE ILE A . n 
A 1 99  LEU 99  307 307 LEU LEU A . n 
A 1 100 TYR 100 308 308 TYR TYR A . n 
A 1 101 GLN 101 309 309 GLN GLN A . n 
A 1 102 ALA 102 310 310 ALA ALA A . n 
A 1 103 MET 103 311 311 MET MET A . n 
A 1 104 ASP 104 312 312 ASP ASP A . n 
A 1 105 ILE 105 313 313 ILE ILE A . n 
A 1 106 ILE 106 314 314 ILE ILE A . n 
A 1 107 ARG 107 315 315 ARG ARG A . n 
A 1 108 LEU 108 316 316 LEU LEU A . n 
A 1 109 ASN 109 317 317 ASN ASN A . n 
A 1 110 LYS 110 318 318 LYS LYS A . n 
A 1 111 LEU 111 319 319 LEU LEU A . n 
A 1 112 GLU 112 320 320 GLU GLU A . n 
A 1 113 ASP 113 321 321 ASP ASP A . n 
A 1 114 THR 114 322 322 THR THR A . n 
A 1 115 ILE 115 323 323 ILE ILE A . n 
A 1 116 THR 116 324 324 THR THR A . n 
A 1 117 LEU 117 325 325 LEU LEU A . n 
A 1 118 ILE 118 326 326 ILE ILE A . n 
A 1 119 LYS 119 327 327 LYS LYS A . n 
A 1 120 GLY 120 328 328 GLY GLY A . n 
A 1 121 LYS 121 329 329 LYS LYS A . n 
A 1 122 ILE 122 330 330 ILE ILE A . n 
A 1 123 GLU 123 331 331 GLU GLU A . n 
A 1 124 GLU 124 332 332 GLU GLU A . n 
A 1 125 VAL 125 333 333 VAL VAL A . n 
A 1 126 HIS 126 334 334 HIS HIS A . n 
A 1 127 LEU 127 335 335 LEU LEU A . n 
A 1 128 PRO 128 336 336 PRO PRO A . n 
A 1 129 VAL 129 337 337 VAL VAL A . n 
A 1 130 GLU 130 338 338 GLU GLU A . n 
A 1 131 LYS 131 339 339 LYS LYS A . n 
A 1 132 VAL 132 340 340 VAL VAL A . n 
A 1 133 ASP 133 341 341 ASP ASP A . n 
A 1 134 VAL 134 342 342 VAL VAL A . n 
A 1 135 ILE 135 343 343 ILE ILE A . n 
A 1 136 ILE 136 344 344 ILE ILE A . n 
A 1 137 SER 137 345 345 SER SER A . n 
A 1 138 GLU 138 346 346 GLU GLU A . n 
A 1 139 TRP 139 347 347 TRP TRP A . n 
A 1 140 MET 140 348 348 MET MET A . n 
A 1 141 GLY 141 349 349 GLY GLY A . n 
A 1 142 TYR 142 350 350 TYR TYR A . n 
A 1 143 PHE 143 351 351 PHE PHE A . n 
A 1 144 LEU 144 352 352 LEU LEU A . n 
A 1 145 LEU 145 353 353 LEU LEU A . n 
A 1 146 PHE 146 354 354 PHE PHE A . n 
A 1 147 GLU 147 355 355 GLU GLU A . n 
A 1 148 SER 148 356 356 SER SER A . n 
A 1 149 MET 149 357 357 MET MET A . n 
A 1 150 LEU 150 358 358 LEU LEU A . n 
A 1 151 ASP 151 359 359 ASP ASP A . n 
A 1 152 SER 152 360 360 SER SER A . n 
A 1 153 VAL 153 361 361 VAL VAL A . n 
A 1 154 LEU 154 362 362 LEU LEU A . n 
A 1 155 TYR 155 363 363 TYR TYR A . n 
A 1 156 ALA 156 364 364 ALA ALA A . n 
A 1 157 LYS 157 365 365 LYS LYS A . n 
A 1 158 ASN 158 366 366 ASN ASN A . n 
A 1 159 LYS 159 367 367 LYS LYS A . n 
A 1 160 TYR 160 368 368 TYR TYR A . n 
A 1 161 LEU 161 369 369 LEU LEU A . n 
A 1 162 ALA 162 370 370 ALA ALA A . n 
A 1 163 LYS 163 371 371 LYS LYS A . n 
A 1 164 GLY 164 372 372 GLY GLY A . n 
A 1 165 GLY 165 373 373 GLY GLY A . n 
A 1 166 SER 166 374 374 SER SER A . n 
A 1 167 VAL 167 375 375 VAL VAL A . n 
A 1 168 TYR 168 376 376 TYR TYR A . n 
A 1 169 PRO 169 377 377 PRO PRO A . n 
A 1 170 ASP 170 378 378 ASP ASP A . n 
A 1 171 ILE 171 379 379 ILE ILE A . n 
A 1 172 CYS 172 380 380 CYS CYS A . n 
A 1 173 THR 173 381 381 THR THR A . n 
A 1 174 ILE 174 382 382 ILE ILE A . n 
A 1 175 SER 175 383 383 SER SER A . n 
A 1 176 LEU 176 384 384 LEU LEU A . n 
A 1 177 VAL 177 385 385 VAL VAL A . n 
A 1 178 ALA 178 386 386 ALA ALA A . n 
A 1 179 VAL 179 387 387 VAL VAL A . n 
A 1 180 SER 180 388 388 SER SER A . n 
A 1 181 ASP 181 389 389 ASP ASP A . n 
A 1 182 VAL 182 390 390 VAL VAL A . n 
A 1 183 ASN 183 391 391 ASN ASN A . n 
A 1 184 LYS 184 392 392 LYS LYS A . n 
A 1 185 HIS 185 393 393 HIS HIS A . n 
A 1 186 ALA 186 394 394 ALA ALA A . n 
A 1 187 ASP 187 395 395 ASP ASP A . n 
A 1 188 ARG 188 396 396 ARG ARG A . n 
A 1 189 ILE 189 397 397 ILE ILE A . n 
A 1 190 ALA 190 398 398 ALA ALA A . n 
A 1 191 PHE 191 399 399 PHE PHE A . n 
A 1 192 TRP 192 400 400 TRP TRP A . n 
A 1 193 ASP 193 401 401 ASP ASP A . n 
A 1 194 ASP 194 402 402 ASP ASP A . n 
A 1 195 VAL 195 403 403 VAL VAL A . n 
A 1 196 TYR 196 404 404 TYR TYR A . n 
A 1 197 GLY 197 405 405 GLY GLY A . n 
A 1 198 PHE 198 406 406 PHE PHE A . n 
A 1 199 LYS 199 407 407 LYS LYS A . n 
A 1 200 MET 200 408 408 MET MET A . n 
A 1 201 SER 201 409 409 SER SER A . n 
A 1 202 CYS 202 410 410 CYS CYS A . n 
A 1 203 MET 203 411 411 MET MET A . n 
A 1 204 LYS 204 412 412 LYS LYS A . n 
A 1 205 LYS 205 413 413 LYS LYS A . n 
A 1 206 ALA 206 414 414 ALA ALA A . n 
A 1 207 VAL 207 415 415 VAL VAL A . n 
A 1 208 ILE 208 416 416 ILE ILE A . n 
A 1 209 PRO 209 417 417 PRO PRO A . n 
A 1 210 GLU 210 418 418 GLU GLU A . n 
A 1 211 ALA 211 419 419 ALA ALA A . n 
A 1 212 VAL 212 420 420 VAL VAL A . n 
A 1 213 VAL 213 421 421 VAL VAL A . n 
A 1 214 GLU 214 422 422 GLU GLU A . n 
A 1 215 VAL 215 423 423 VAL VAL A . n 
A 1 216 LEU 216 424 424 LEU LEU A . n 
A 1 217 ASP 217 425 425 ASP ASP A . n 
A 1 218 PRO 218 426 426 PRO PRO A . n 
A 1 219 LYS 219 427 427 LYS LYS A . n 
A 1 220 THR 220 428 428 THR THR A . n 
A 1 221 LEU 221 429 429 LEU LEU A . n 
A 1 222 ILE 222 430 430 ILE ILE A . n 
A 1 223 SER 223 431 431 SER SER A . n 
A 1 224 GLU 224 432 432 GLU GLU A . n 
A 1 225 PRO 225 433 433 PRO PRO A . n 
A 1 226 CYS 226 434 434 CYS CYS A . n 
A 1 227 GLY 227 435 435 GLY GLY A . n 
A 1 228 ILE 228 436 436 ILE ILE A . n 
A 1 229 LYS 229 437 437 LYS LYS A . n 
A 1 230 HIS 230 438 438 HIS HIS A . n 
A 1 231 ILE 231 439 439 ILE ILE A . n 
A 1 232 ASP 232 440 440 ASP ASP A . n 
A 1 233 CYS 233 441 441 CYS CYS A . n 
A 1 234 HIS 234 442 442 HIS HIS A . n 
A 1 235 THR 235 443 443 THR THR A . n 
A 1 236 THR 236 444 444 THR THR A . n 
A 1 237 SER 237 445 445 SER SER A . n 
A 1 238 ILE 238 446 446 ILE ILE A . n 
A 1 239 SER 239 447 447 SER SER A . n 
A 1 240 ASP 240 448 448 ASP ASP A . n 
A 1 241 LEU 241 449 449 LEU LEU A . n 
A 1 242 GLU 242 450 450 GLU GLU A . n 
A 1 243 PHE 243 451 451 PHE PHE A . n 
A 1 244 SER 244 452 452 SER SER A . n 
A 1 245 SER 245 453 453 SER SER A . n 
A 1 246 ASP 246 454 454 ASP ASP A . n 
A 1 247 PHE 247 455 455 PHE PHE A . n 
A 1 248 THR 248 456 456 THR THR A . n 
A 1 249 LEU 249 457 457 LEU LEU A . n 
A 1 250 LYS 250 458 458 LYS LYS A . n 
A 1 251 ILE 251 459 459 ILE ILE A . n 
A 1 252 THR 252 460 460 THR THR A . n 
A 1 253 ARG 253 461 461 ARG ARG A . n 
A 1 254 THR 254 462 462 THR THR A . n 
A 1 255 SER 255 463 463 SER SER A . n 
A 1 256 MET 256 464 464 MET MET A . n 
A 1 257 CYS 257 465 465 CYS CYS A . n 
A 1 258 THR 258 466 466 THR THR A . n 
A 1 259 ALA 259 467 467 ALA ALA A . n 
A 1 260 ILE 260 468 468 ILE ILE A . n 
A 1 261 ALA 261 469 469 ALA ALA A . n 
A 1 262 GLY 262 470 470 GLY GLY A . n 
A 1 263 TYR 263 471 471 TYR TYR A . n 
A 1 264 PHE 264 472 472 PHE PHE A . n 
A 1 265 ASP 265 473 473 ASP ASP A . n 
A 1 266 ILE 266 474 474 ILE ILE A . n 
A 1 267 TYR 267 475 475 TYR TYR A . n 
A 1 268 PHE 268 476 476 PHE PHE A . n 
A 1 269 GLU 269 477 477 GLU GLU A . n 
A 1 270 LYS 270 478 478 LYS LYS A . n 
A 1 271 ASN 271 479 479 ASN ASN A . n 
A 1 272 CYS 272 480 480 CYS CYS A . n 
A 1 273 HIS 273 481 481 HIS HIS A . n 
A 1 274 ASN 274 482 482 ASN ASN A . n 
A 1 275 ARG 275 483 483 ARG ARG A . n 
A 1 276 VAL 276 484 484 VAL VAL A . n 
A 1 277 VAL 277 485 485 VAL VAL A . n 
A 1 278 PHE 278 486 486 PHE PHE A . n 
A 1 279 SER 279 487 487 SER SER A . n 
A 1 280 THR 280 488 488 THR THR A . n 
A 1 281 GLY 281 489 489 GLY GLY A . n 
A 1 282 PRO 282 490 490 PRO PRO A . n 
A 1 283 GLN 283 491 491 GLN GLN A . n 
A 1 284 SER 284 492 492 SER SER A . n 
A 1 285 THR 285 493 493 THR THR A . n 
A 1 286 LYS 286 494 494 LYS LYS A . n 
A 1 287 THR 287 495 495 THR THR A . n 
A 1 288 HIS 288 496 496 HIS HIS A . n 
A 1 289 TRP 289 497 497 TRP TRP A . n 
A 1 290 LYS 290 498 498 LYS LYS A . n 
A 1 291 GLN 291 499 499 GLN GLN A . n 
A 1 292 THR 292 500 500 THR THR A . n 
A 1 293 VAL 293 501 501 VAL VAL A . n 
A 1 294 PHE 294 502 502 PHE PHE A . n 
A 1 295 LEU 295 503 503 LEU LEU A . n 
A 1 296 LEU 296 504 504 LEU LEU A . n 
A 1 297 GLU 297 505 505 GLU GLU A . n 
A 1 298 LYS 298 506 506 LYS LYS A . n 
A 1 299 PRO 299 507 507 PRO PRO A . n 
A 1 300 PHE 300 508 508 PHE PHE A . n 
A 1 301 SER 301 509 509 SER SER A . n 
A 1 302 VAL 302 510 510 VAL VAL A . n 
A 1 303 LYS 303 511 511 LYS LYS A . n 
A 1 304 ALA 304 512 512 ALA ALA A . n 
A 1 305 GLY 305 513 513 GLY GLY A . n 
A 1 306 GLU 306 514 514 GLU GLU A . n 
A 1 307 ALA 307 515 515 ALA ALA A . n 
A 1 308 LEU 308 516 516 LEU LEU A . n 
A 1 309 LYS 309 517 517 LYS LYS A . n 
A 1 310 GLY 310 518 518 GLY GLY A . n 
A 1 311 LYS 311 519 519 LYS LYS A . n 
A 1 312 VAL 312 520 520 VAL VAL A . n 
A 1 313 THR 313 521 521 THR THR A . n 
A 1 314 VAL 314 522 522 VAL VAL A . n 
A 1 315 HIS 315 523 523 HIS HIS A . n 
A 1 316 LYS 316 524 524 LYS LYS A . n 
A 1 317 ASN 317 525 ?   ?   ?   A . n 
A 1 318 LYS 318 526 ?   ?   ?   A . n 
A 1 319 LYS 319 527 ?   ?   ?   A . n 
A 1 320 ASP 320 528 ?   ?   ?   A . n 
A 1 321 PRO 321 529 ?   ?   ?   A . n 
A 1 322 ARG 322 530 ?   ?   ?   A . n 
A 1 323 SER 323 531 531 SER SER A . n 
A 1 324 LEU 324 532 532 LEU LEU A . n 
A 1 325 THR 325 533 533 THR THR A . n 
A 1 326 VAL 326 534 534 VAL VAL A . n 
A 1 327 THR 327 535 535 THR THR A . n 
A 1 328 LEU 328 536 536 LEU LEU A . n 
A 1 329 THR 329 537 537 THR THR A . n 
A 1 330 LEU 330 538 538 LEU LEU A . n 
A 1 331 ASN 331 539 539 ASN ASN A . n 
A 1 332 ASN 332 540 540 ASN ASN A . n 
A 1 333 SER 333 541 541 SER SER A . n 
A 1 334 THR 334 542 542 THR THR A . n 
A 1 335 GLN 335 543 543 GLN GLN A . n 
A 1 336 THR 336 544 544 THR THR A . n 
A 1 337 TYR 337 545 545 TYR TYR A . n 
A 1 338 GLY 338 546 546 GLY GLY A . n 
A 1 339 LEU 339 547 547 LEU LEU A . n 
A 1 340 GLN 340 548 548 GLN GLN A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 3ZG 1   601 2000 3ZG XXX A . 
C 3 UNX 1   602 1000 UNX UNX A . 
D 3 UNX 1   603 1001 UNX UNX A . 
E 4 HOH 1   701 1    HOH HOH A . 
E 4 HOH 2   702 2    HOH HOH A . 
E 4 HOH 3   703 3    HOH HOH A . 
E 4 HOH 4   704 4    HOH HOH A . 
E 4 HOH 5   705 5    HOH HOH A . 
E 4 HOH 6   706 6    HOH HOH A . 
E 4 HOH 7   707 7    HOH HOH A . 
E 4 HOH 8   708 8    HOH HOH A . 
E 4 HOH 9   709 9    HOH HOH A . 
E 4 HOH 10  710 10   HOH HOH A . 
E 4 HOH 11  711 11   HOH HOH A . 
E 4 HOH 12  712 12   HOH HOH A . 
E 4 HOH 13  713 14   HOH HOH A . 
E 4 HOH 14  714 15   HOH HOH A . 
E 4 HOH 15  715 16   HOH HOH A . 
E 4 HOH 16  716 17   HOH HOH A . 
E 4 HOH 17  717 18   HOH HOH A . 
E 4 HOH 18  718 19   HOH HOH A . 
E 4 HOH 19  719 20   HOH HOH A . 
E 4 HOH 20  720 21   HOH HOH A . 
E 4 HOH 21  721 22   HOH HOH A . 
E 4 HOH 22  722 23   HOH HOH A . 
E 4 HOH 23  723 24   HOH HOH A . 
E 4 HOH 24  724 25   HOH HOH A . 
E 4 HOH 25  725 26   HOH HOH A . 
E 4 HOH 26  726 27   HOH HOH A . 
E 4 HOH 27  727 28   HOH HOH A . 
E 4 HOH 28  728 29   HOH HOH A . 
E 4 HOH 29  729 30   HOH HOH A . 
E 4 HOH 30  730 31   HOH HOH A . 
E 4 HOH 31  731 32   HOH HOH A . 
E 4 HOH 32  732 33   HOH HOH A . 
E 4 HOH 33  733 34   HOH HOH A . 
E 4 HOH 34  734 35   HOH HOH A . 
E 4 HOH 35  735 36   HOH HOH A . 
E 4 HOH 36  736 37   HOH HOH A . 
E 4 HOH 37  737 38   HOH HOH A . 
E 4 HOH 38  738 39   HOH HOH A . 
E 4 HOH 39  739 40   HOH HOH A . 
E 4 HOH 40  740 41   HOH HOH A . 
E 4 HOH 41  741 42   HOH HOH A . 
E 4 HOH 42  742 43   HOH HOH A . 
E 4 HOH 43  743 44   HOH HOH A . 
E 4 HOH 44  744 45   HOH HOH A . 
E 4 HOH 45  745 46   HOH HOH A . 
E 4 HOH 46  746 47   HOH HOH A . 
E 4 HOH 47  747 48   HOH HOH A . 
E 4 HOH 48  748 49   HOH HOH A . 
E 4 HOH 49  749 50   HOH HOH A . 
E 4 HOH 50  750 51   HOH HOH A . 
E 4 HOH 51  751 52   HOH HOH A . 
E 4 HOH 52  752 53   HOH HOH A . 
E 4 HOH 53  753 54   HOH HOH A . 
E 4 HOH 54  754 55   HOH HOH A . 
E 4 HOH 55  755 56   HOH HOH A . 
E 4 HOH 56  756 57   HOH HOH A . 
E 4 HOH 57  757 58   HOH HOH A . 
E 4 HOH 58  758 60   HOH HOH A . 
E 4 HOH 59  759 61   HOH HOH A . 
E 4 HOH 60  760 62   HOH HOH A . 
E 4 HOH 61  761 63   HOH HOH A . 
E 4 HOH 62  762 64   HOH HOH A . 
E 4 HOH 63  763 66   HOH HOH A . 
E 4 HOH 64  764 67   HOH HOH A . 
E 4 HOH 65  765 68   HOH HOH A . 
E 4 HOH 66  766 69   HOH HOH A . 
E 4 HOH 67  767 70   HOH HOH A . 
E 4 HOH 68  768 71   HOH HOH A . 
E 4 HOH 69  769 72   HOH HOH A . 
E 4 HOH 70  770 73   HOH HOH A . 
E 4 HOH 71  771 74   HOH HOH A . 
E 4 HOH 72  772 75   HOH HOH A . 
E 4 HOH 73  773 76   HOH HOH A . 
E 4 HOH 74  774 77   HOH HOH A . 
E 4 HOH 75  775 78   HOH HOH A . 
E 4 HOH 76  776 79   HOH HOH A . 
E 4 HOH 77  777 80   HOH HOH A . 
E 4 HOH 78  778 81   HOH HOH A . 
E 4 HOH 79  779 82   HOH HOH A . 
E 4 HOH 80  780 83   HOH HOH A . 
E 4 HOH 81  781 84   HOH HOH A . 
E 4 HOH 82  782 85   HOH HOH A . 
E 4 HOH 83  783 86   HOH HOH A . 
E 4 HOH 84  784 87   HOH HOH A . 
E 4 HOH 85  785 88   HOH HOH A . 
E 4 HOH 86  786 89   HOH HOH A . 
E 4 HOH 87  787 90   HOH HOH A . 
E 4 HOH 88  788 91   HOH HOH A . 
E 4 HOH 89  789 92   HOH HOH A . 
E 4 HOH 90  790 93   HOH HOH A . 
E 4 HOH 91  791 95   HOH HOH A . 
E 4 HOH 92  792 96   HOH HOH A . 
E 4 HOH 93  793 98   HOH HOH A . 
E 4 HOH 94  794 99   HOH HOH A . 
E 4 HOH 95  795 100  HOH HOH A . 
E 4 HOH 96  796 101  HOH HOH A . 
E 4 HOH 97  797 103  HOH HOH A . 
E 4 HOH 98  798 104  HOH HOH A . 
E 4 HOH 99  799 105  HOH HOH A . 
E 4 HOH 100 800 106  HOH HOH A . 
E 4 HOH 101 801 107  HOH HOH A . 
E 4 HOH 102 802 108  HOH HOH A . 
E 4 HOH 103 803 109  HOH HOH A . 
E 4 HOH 104 804 110  HOH HOH A . 
E 4 HOH 105 805 111  HOH HOH A . 
E 4 HOH 106 806 112  HOH HOH A . 
E 4 HOH 107 807 113  HOH HOH A . 
E 4 HOH 108 808 114  HOH HOH A . 
E 4 HOH 109 809 115  HOH HOH A . 
E 4 HOH 110 810 116  HOH HOH A . 
E 4 HOH 111 811 117  HOH HOH A . 
E 4 HOH 112 812 118  HOH HOH A . 
E 4 HOH 113 813 119  HOH HOH A . 
E 4 HOH 114 814 120  HOH HOH A . 
E 4 HOH 115 815 121  HOH HOH A . 
E 4 HOH 116 816 122  HOH HOH A . 
E 4 HOH 117 817 123  HOH HOH A . 
E 4 HOH 118 818 124  HOH HOH A . 
E 4 HOH 119 819 125  HOH HOH A . 
E 4 HOH 120 820 126  HOH HOH A . 
E 4 HOH 121 821 127  HOH HOH A . 
E 4 HOH 122 822 128  HOH HOH A . 
E 4 HOH 123 823 129  HOH HOH A . 
E 4 HOH 124 824 131  HOH HOH A . 
E 4 HOH 125 825 132  HOH HOH A . 
E 4 HOH 126 826 134  HOH HOH A . 
E 4 HOH 127 827 135  HOH HOH A . 
E 4 HOH 128 828 137  HOH HOH A . 
E 4 HOH 129 829 138  HOH HOH A . 
E 4 HOH 130 830 139  HOH HOH A . 
E 4 HOH 131 831 140  HOH HOH A . 
E 4 HOH 132 832 141  HOH HOH A . 
E 4 HOH 133 833 142  HOH HOH A . 
E 4 HOH 134 834 143  HOH HOH A . 
E 4 HOH 135 835 144  HOH HOH A . 
E 4 HOH 136 836 145  HOH HOH A . 
E 4 HOH 137 837 146  HOH HOH A . 
E 4 HOH 138 838 147  HOH HOH A . 
E 4 HOH 139 839 148  HOH HOH A . 
E 4 HOH 140 840 149  HOH HOH A . 
E 4 HOH 141 841 150  HOH HOH A . 
E 4 HOH 142 842 151  HOH HOH A . 
E 4 HOH 143 843 152  HOH HOH A . 
E 4 HOH 144 844 155  HOH HOH A . 
E 4 HOH 145 845 156  HOH HOH A . 
E 4 HOH 146 846 157  HOH HOH A . 
E 4 HOH 147 847 158  HOH HOH A . 
E 4 HOH 148 848 159  HOH HOH A . 
E 4 HOH 149 849 160  HOH HOH A . 
E 4 HOH 150 850 161  HOH HOH A . 
E 4 HOH 151 851 162  HOH HOH A . 
E 4 HOH 152 852 163  HOH HOH A . 
E 4 HOH 153 853 164  HOH HOH A . 
E 4 HOH 154 854 165  HOH HOH A . 
E 4 HOH 155 855 166  HOH HOH A . 
E 4 HOH 156 856 167  HOH HOH A . 
E 4 HOH 157 857 168  HOH HOH A . 
E 4 HOH 158 858 170  HOH HOH A . 
E 4 HOH 159 859 171  HOH HOH A . 
E 4 HOH 160 860 172  HOH HOH A . 
E 4 HOH 161 861 173  HOH HOH A . 
E 4 HOH 162 862 174  HOH HOH A . 
E 4 HOH 163 863 175  HOH HOH A . 
E 4 HOH 164 864 176  HOH HOH A . 
E 4 HOH 165 865 177  HOH HOH A . 
E 4 HOH 166 866 178  HOH HOH A . 
E 4 HOH 167 867 179  HOH HOH A . 
E 4 HOH 168 868 180  HOH HOH A . 
E 4 HOH 169 869 181  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3450  ? 
1 MORE         -31   ? 
1 'SSA (A^2)'  24810 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-02-25 
2 'Structure model' 1 1 2015-03-18 
3 'Structure model' 1 2 2015-05-06 
4 'Structure model' 1 3 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 2 'Structure model' 'Structure summary'      
3 3 'Structure model' 'Database references'    
4 4 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .        ?                program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 REFMAC      5.8.0073 ?                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.15     'July. 29, 2014' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 JDirector   .        ?                ?       ?                    ?                        'data collection' ? ?          ? 
5 HKL-3000    .        ?                ?       ?                    ?                        'data reduction'  ? ?          ? 
6 HKL-3000    .        ?                ?       ?                    ?                        'data scaling'    ? ?          ? 
7 PHASER      .        ?                ?       ?                    ?                        phasing           ? ?          ? 
8 Coot        0.7.1    ?                ?       ?                    ?                        'model building'  ? ?          ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NE 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    483 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   UNK 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   UNX 
_pdbx_validate_close_contact.auth_seq_id_2    602 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 352 ? ? 68.73   -47.87  
2 1 ASP A 389 ? ? -151.89 81.25   
3 1 ILE A 397 ? ? -120.60 -68.23  
4 1 GLU A 422 ? ? -170.21 148.41  
5 1 GLU A 477 ? ? -133.42 -53.45  
6 1 ASN A 479 ? ? 59.08   17.39   
7 1 LYS A 498 ? ? 51.25   -141.05 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 243 ? CG  ? A HIS 35  CG  
2  1 Y 1 A HIS 243 ? ND1 ? A HIS 35  ND1 
3  1 Y 1 A HIS 243 ? CD2 ? A HIS 35  CD2 
4  1 Y 1 A HIS 243 ? CE1 ? A HIS 35  CE1 
5  1 Y 1 A HIS 243 ? NE2 ? A HIS 35  NE2 
6  1 Y 1 A LYS 254 ? NZ  ? A LYS 46  NZ  
7  1 Y 1 A LYS 292 ? CE  ? A LYS 84  CE  
8  1 Y 1 A LYS 292 ? NZ  ? A LYS 84  NZ  
9  1 Y 1 A LYS 329 ? CE  ? A LYS 121 CE  
10 1 Y 1 A LYS 329 ? NZ  ? A LYS 121 NZ  
11 1 Y 1 A GLU 338 ? CG  ? A GLU 130 CG  
12 1 Y 1 A GLU 338 ? CD  ? A GLU 130 CD  
13 1 Y 1 A GLU 338 ? OE1 ? A GLU 130 OE1 
14 1 Y 1 A GLU 338 ? OE2 ? A GLU 130 OE2 
15 1 Y 1 A GLU 355 ? CG  ? A GLU 147 CG  
16 1 Y 1 A GLU 355 ? CD  ? A GLU 147 CD  
17 1 Y 1 A GLU 355 ? OE1 ? A GLU 147 OE1 
18 1 Y 1 A GLU 355 ? OE2 ? A GLU 147 OE2 
19 1 Y 1 A LYS 365 ? NZ  ? A LYS 157 NZ  
20 1 Y 1 A LYS 367 ? CE  ? A LYS 159 CE  
21 1 Y 1 A LYS 367 ? NZ  ? A LYS 159 NZ  
22 1 Y 1 A LYS 371 ? CD  ? A LYS 163 CD  
23 1 Y 1 A LYS 371 ? CE  ? A LYS 163 CE  
24 1 Y 1 A LYS 371 ? NZ  ? A LYS 163 NZ  
25 1 Y 1 A LYS 427 ? CD  ? A LYS 219 CD  
26 1 Y 1 A LYS 427 ? CE  ? A LYS 219 CE  
27 1 Y 1 A LYS 427 ? NZ  ? A LYS 219 NZ  
28 1 Y 1 A ILE 446 ? CD1 ? A ILE 238 CD1 
29 1 Y 1 A LYS 458 ? CD  ? A LYS 250 CD  
30 1 Y 1 A LYS 458 ? CE  ? A LYS 250 CE  
31 1 Y 1 A LYS 458 ? NZ  ? A LYS 250 NZ  
32 1 Y 1 A LYS 506 ? NZ  ? A LYS 298 NZ  
33 1 Y 1 A LYS 524 ? CG  ? A LYS 316 CG  
34 1 Y 1 A LYS 524 ? CD  ? A LYS 316 CD  
35 1 Y 1 A LYS 524 ? CE  ? A LYS 316 CE  
36 1 Y 1 A LYS 524 ? NZ  ? A LYS 316 NZ  
37 1 Y 1 A LEU 547 ? CG  ? A LEU 339 CG  
38 1 Y 1 A LEU 547 ? CD1 ? A LEU 339 CD1 
39 1 Y 1 A LEU 547 ? CD2 ? A LEU 339 CD2 
40 1 Y 1 A GLN 548 ? CG  ? A GLN 340 CG  
41 1 Y 1 A GLN 548 ? CD  ? A GLN 340 CD  
42 1 Y 1 A GLN 548 ? OE1 ? A GLN 340 OE1 
43 1 Y 1 A GLN 548 ? NE2 ? A GLN 340 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 209 ? A MET 1   
2  1 Y 1 A GLY 210 ? A GLY 2   
3  1 Y 1 A SER 211 ? A SER 3   
4  1 Y 1 A SER 212 ? A SER 4   
5  1 Y 1 A HIS 213 ? A HIS 5   
6  1 Y 1 A HIS 214 ? A HIS 6   
7  1 Y 1 A HIS 215 ? A HIS 7   
8  1 Y 1 A HIS 216 ? A HIS 8   
9  1 Y 1 A HIS 217 ? A HIS 9   
10 1 Y 1 A HIS 218 ? A HIS 10  
11 1 Y 1 A SER 219 ? A SER 11  
12 1 Y 1 A SER 220 ? A SER 12  
13 1 Y 1 A GLY 221 ? A GLY 13  
14 1 Y 1 A LEU 222 ? A LEU 14  
15 1 Y 1 A VAL 223 ? A VAL 15  
16 1 Y 1 A PRO 224 ? A PRO 16  
17 1 Y 1 A ARG 225 ? A ARG 17  
18 1 Y 1 A GLY 226 ? A GLY 18  
19 1 Y 1 A SER 227 ? A SER 19  
20 1 Y 1 A ASP 228 ? A ASP 20  
21 1 Y 1 A LEU 229 ? A LEU 21  
22 1 Y 1 A GLN 230 ? A GLN 22  
23 1 Y 1 A GLU 231 ? A GLU 23  
24 1 Y 1 A ASP 232 ? A ASP 24  
25 1 Y 1 A GLU 233 ? A GLU 25  
26 1 Y 1 A ASP 234 ? A ASP 26  
27 1 Y 1 A GLY 235 ? A GLY 27  
28 1 Y 1 A VAL 236 ? A VAL 28  
29 1 Y 1 A TYR 237 ? A TYR 29  
30 1 Y 1 A PHE 238 ? A PHE 30  
31 1 Y 1 A SER 239 ? A SER 31  
32 1 Y 1 A SER 240 ? A SER 32  
33 1 Y 1 A TYR 241 ? A TYR 33  
34 1 Y 1 A GLY 242 ? A GLY 34  
35 1 Y 1 A ASN 525 ? A ASN 317 
36 1 Y 1 A LYS 526 ? A LYS 318 
37 1 Y 1 A LYS 527 ? A LYS 319 
38 1 Y 1 A ASP 528 ? A ASP 320 
39 1 Y 1 A PRO 529 ? A PRO 321 
40 1 Y 1 A ARG 530 ? A ARG 322 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1-isoquinolin-6-yl-3-[2-oxo-2-(pyrrolidin-1-yl)ethyl]urea' 3ZG 
3 'UNKNOWN ATOM OR ION'                                       UNX 
4 water                                                       HOH 
#