data_4TVJ
# 
_entry.id   4TVJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4TVJ         
WWPDB D_1000202357 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '3KCZ contains the same protein complexed with 3-Aminobenzamide.'    3KCZ unspecified 
PDB '3KJD contains the same protein complexed with ABT-888 (Veliparib).' 3KJD unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4TVJ 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karlberg, T.'   1 
'Thorsell, A.G.' 2 
'Ekblad, T.'     3 
'Pinto, A.F.'    4 
'Schuler, H.'    5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Med. Chem.' 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           1520-4804 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            60 
_citation.language                  ? 
_citation.page_first                1262 
_citation.page_last                 1271 
_citation.title                     
'Structural Basis for Potency and Promiscuity in Poly(ADP-ribose) Polymerase (PARP) and Tankyrase Inhibitors.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.6b00990 
_citation.pdbx_database_id_PubMed   28001384 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Thorsell, A.G.' 1 
primary 'Ekblad, T.'     2 
primary 'Karlberg, T.'   3 
primary 'Low, M.'        4 
primary 'Pinto, A.F.'    5 
primary 'Tresaugues, L.' 6 
primary 'Moche, M.'      7 
primary 'Cohen, M.S.'    8 
primary 'Schuler, H.'    9 
# 
_cell.entry_id           4TVJ 
_cell.length_a           58.083 
_cell.length_b           134.123 
_cell.length_c           58.348 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.96 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4TVJ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Poly [ADP-ribose] polymerase 2'                                                             41827.922 2   
2.4.2.30 ? ? ? 
2 non-polymer syn '4-(3-{[4-(cyclopropylcarbonyl)piperazin-1-yl]carbonyl}-4-fluorobenzyl)phthalazin-1(2H)-one' 434.463   2   ? ? ? 
? 
3 non-polymer syn GLYCEROL                                                                                     92.094    3   ? ? ? 
? 
4 water       nat water                                                                                        18.015    267 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;hPARP-2,ADP-ribosyltransferase diphtheria toxin-like 2,ARTD2,NAD(+) ADP-ribosyltransferase 2,ADPRT-2,Poly[ADP-ribose] synthase 2,pADPRT-2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRA
GQHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRP
LDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEAP
ITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTL
NGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRA
GQHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRP
LDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEAP
ITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTL
NGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  ASP n 
1 25  LEU n 
1 26  ARG n 
1 27  VAL n 
1 28  GLN n 
1 29  GLU n 
1 30  LEU n 
1 31  ILE n 
1 32  LYS n 
1 33  LEU n 
1 34  ILE n 
1 35  CYS n 
1 36  ASN n 
1 37  VAL n 
1 38  GLN n 
1 39  ALA n 
1 40  MET n 
1 41  GLU n 
1 42  GLU n 
1 43  MET n 
1 44  MET n 
1 45  MET n 
1 46  GLU n 
1 47  MET n 
1 48  LYS n 
1 49  TYR n 
1 50  ASN n 
1 51  THR n 
1 52  LYS n 
1 53  LYS n 
1 54  ALA n 
1 55  PRO n 
1 56  LEU n 
1 57  GLY n 
1 58  LYS n 
1 59  LEU n 
1 60  THR n 
1 61  VAL n 
1 62  ALA n 
1 63  GLN n 
1 64  ILE n 
1 65  LYS n 
1 66  ALA n 
1 67  GLY n 
1 68  TYR n 
1 69  GLN n 
1 70  SER n 
1 71  LEU n 
1 72  LYS n 
1 73  LYS n 
1 74  ILE n 
1 75  GLU n 
1 76  ASP n 
1 77  CYS n 
1 78  ILE n 
1 79  ARG n 
1 80  ALA n 
1 81  GLY n 
1 82  GLN n 
1 83  HIS n 
1 84  GLY n 
1 85  ARG n 
1 86  ALA n 
1 87  LEU n 
1 88  MET n 
1 89  GLU n 
1 90  ALA n 
1 91  CYS n 
1 92  ASN n 
1 93  GLU n 
1 94  PHE n 
1 95  TYR n 
1 96  THR n 
1 97  ARG n 
1 98  ILE n 
1 99  PRO n 
1 100 HIS n 
1 101 ASP n 
1 102 PHE n 
1 103 GLY n 
1 104 LEU n 
1 105 ARG n 
1 106 THR n 
1 107 PRO n 
1 108 PRO n 
1 109 LEU n 
1 110 ILE n 
1 111 ARG n 
1 112 THR n 
1 113 GLN n 
1 114 LYS n 
1 115 GLU n 
1 116 LEU n 
1 117 SER n 
1 118 GLU n 
1 119 LYS n 
1 120 ILE n 
1 121 GLN n 
1 122 LEU n 
1 123 LEU n 
1 124 GLU n 
1 125 ALA n 
1 126 LEU n 
1 127 GLY n 
1 128 ASP n 
1 129 ILE n 
1 130 GLU n 
1 131 ILE n 
1 132 ALA n 
1 133 ILE n 
1 134 LYS n 
1 135 LEU n 
1 136 VAL n 
1 137 LYS n 
1 138 THR n 
1 139 GLU n 
1 140 LEU n 
1 141 GLN n 
1 142 SER n 
1 143 PRO n 
1 144 GLU n 
1 145 HIS n 
1 146 PRO n 
1 147 LEU n 
1 148 ASP n 
1 149 GLN n 
1 150 HIS n 
1 151 TYR n 
1 152 ARG n 
1 153 ASN n 
1 154 LEU n 
1 155 HIS n 
1 156 CYS n 
1 157 ALA n 
1 158 LEU n 
1 159 ARG n 
1 160 PRO n 
1 161 LEU n 
1 162 ASP n 
1 163 HIS n 
1 164 GLU n 
1 165 SER n 
1 166 TYR n 
1 167 GLU n 
1 168 PHE n 
1 169 LYS n 
1 170 VAL n 
1 171 ILE n 
1 172 SER n 
1 173 GLN n 
1 174 TYR n 
1 175 LEU n 
1 176 GLN n 
1 177 SER n 
1 178 THR n 
1 179 HIS n 
1 180 ALA n 
1 181 PRO n 
1 182 THR n 
1 183 HIS n 
1 184 SER n 
1 185 ASP n 
1 186 TYR n 
1 187 THR n 
1 188 MET n 
1 189 THR n 
1 190 LEU n 
1 191 LEU n 
1 192 ASP n 
1 193 LEU n 
1 194 PHE n 
1 195 GLU n 
1 196 VAL n 
1 197 GLU n 
1 198 LYS n 
1 199 ASP n 
1 200 GLY n 
1 201 GLU n 
1 202 LYS n 
1 203 GLU n 
1 204 ALA n 
1 205 PHE n 
1 206 ARG n 
1 207 GLU n 
1 208 ASP n 
1 209 LEU n 
1 210 HIS n 
1 211 ASN n 
1 212 ARG n 
1 213 MET n 
1 214 LEU n 
1 215 LEU n 
1 216 TRP n 
1 217 HIS n 
1 218 GLY n 
1 219 SER n 
1 220 ARG n 
1 221 MET n 
1 222 SER n 
1 223 ASN n 
1 224 TRP n 
1 225 VAL n 
1 226 GLY n 
1 227 ILE n 
1 228 LEU n 
1 229 SER n 
1 230 HIS n 
1 231 GLY n 
1 232 LEU n 
1 233 ARG n 
1 234 ILE n 
1 235 ALA n 
1 236 HIS n 
1 237 PRO n 
1 238 GLU n 
1 239 ALA n 
1 240 PRO n 
1 241 ILE n 
1 242 THR n 
1 243 GLY n 
1 244 TYR n 
1 245 MET n 
1 246 PHE n 
1 247 GLY n 
1 248 LYS n 
1 249 GLY n 
1 250 ILE n 
1 251 TYR n 
1 252 PHE n 
1 253 ALA n 
1 254 ASP n 
1 255 MET n 
1 256 SER n 
1 257 SER n 
1 258 LYS n 
1 259 SER n 
1 260 ALA n 
1 261 ASN n 
1 262 TYR n 
1 263 CYS n 
1 264 PHE n 
1 265 ALA n 
1 266 SER n 
1 267 ARG n 
1 268 LEU n 
1 269 LYS n 
1 270 ASN n 
1 271 THR n 
1 272 GLY n 
1 273 LEU n 
1 274 LEU n 
1 275 LEU n 
1 276 LEU n 
1 277 SER n 
1 278 GLU n 
1 279 VAL n 
1 280 ALA n 
1 281 LEU n 
1 282 GLY n 
1 283 GLN n 
1 284 CYS n 
1 285 ASN n 
1 286 GLU n 
1 287 LEU n 
1 288 LEU n 
1 289 GLU n 
1 290 ALA n 
1 291 ASN n 
1 292 PRO n 
1 293 LYS n 
1 294 ALA n 
1 295 GLU n 
1 296 GLY n 
1 297 LEU n 
1 298 LEU n 
1 299 GLN n 
1 300 GLY n 
1 301 LYS n 
1 302 HIS n 
1 303 SER n 
1 304 THR n 
1 305 LYS n 
1 306 GLY n 
1 307 LEU n 
1 308 GLY n 
1 309 LYS n 
1 310 MET n 
1 311 ALA n 
1 312 PRO n 
1 313 SER n 
1 314 SER n 
1 315 ALA n 
1 316 HIS n 
1 317 PHE n 
1 318 VAL n 
1 319 THR n 
1 320 LEU n 
1 321 ASN n 
1 322 GLY n 
1 323 SER n 
1 324 THR n 
1 325 VAL n 
1 326 PRO n 
1 327 LEU n 
1 328 GLY n 
1 329 PRO n 
1 330 ALA n 
1 331 SER n 
1 332 ASP n 
1 333 THR n 
1 334 GLY n 
1 335 ILE n 
1 336 LEU n 
1 337 ASN n 
1 338 PRO n 
1 339 ASP n 
1 340 GLY n 
1 341 TYR n 
1 342 THR n 
1 343 LEU n 
1 344 ASN n 
1 345 TYR n 
1 346 ASN n 
1 347 GLU n 
1 348 TYR n 
1 349 ILE n 
1 350 VAL n 
1 351 TYR n 
1 352 ASN n 
1 353 PRO n 
1 354 ASN n 
1 355 GLN n 
1 356 VAL n 
1 357 ARG n 
1 358 MET n 
1 359 ARG n 
1 360 TYR n 
1 361 LEU n 
1 362 LEU n 
1 363 LYS n 
1 364 VAL n 
1 365 GLN n 
1 366 PHE n 
1 367 ASN n 
1 368 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   368 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PARP2, ADPRT2, ADPRTL2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'R3 PRARE' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC28-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PARP2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UGN5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFG
LRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTH
SDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYC
FASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTL
NYNEYIVYNPNQVRMRYLLKVQFNF
;
_struct_ref.pdbx_align_begin           235 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4TVJ A 24 ? 368 ? Q9UGN5 235 ? 579 ? 235 579 
2 1 4TVJ B 24 ? 368 ? Q9UGN5 235 ? 579 ? 235 579 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4TVJ MET A 1   ? UNP Q9UGN5 ?   ?   'initiating methionine' 212 1  
1 4TVJ HIS A 2   ? UNP Q9UGN5 ?   ?   'expression tag'        213 2  
1 4TVJ HIS A 3   ? UNP Q9UGN5 ?   ?   'expression tag'        214 3  
1 4TVJ HIS A 4   ? UNP Q9UGN5 ?   ?   'expression tag'        215 4  
1 4TVJ HIS A 5   ? UNP Q9UGN5 ?   ?   'expression tag'        216 5  
1 4TVJ HIS A 6   ? UNP Q9UGN5 ?   ?   'expression tag'        217 6  
1 4TVJ HIS A 7   ? UNP Q9UGN5 ?   ?   'expression tag'        218 7  
1 4TVJ SER A 8   ? UNP Q9UGN5 ?   ?   'expression tag'        219 8  
1 4TVJ SER A 9   ? UNP Q9UGN5 ?   ?   'expression tag'        220 9  
1 4TVJ GLY A 10  ? UNP Q9UGN5 ?   ?   'expression tag'        221 10 
1 4TVJ VAL A 11  ? UNP Q9UGN5 ?   ?   'expression tag'        222 11 
1 4TVJ ASP A 12  ? UNP Q9UGN5 ?   ?   'expression tag'        223 12 
1 4TVJ LEU A 13  ? UNP Q9UGN5 ?   ?   'expression tag'        224 13 
1 4TVJ GLY A 14  ? UNP Q9UGN5 ?   ?   'expression tag'        225 14 
1 4TVJ THR A 15  ? UNP Q9UGN5 ?   ?   'expression tag'        226 15 
1 4TVJ GLU A 16  ? UNP Q9UGN5 ?   ?   'expression tag'        227 16 
1 4TVJ ASN A 17  ? UNP Q9UGN5 ?   ?   'expression tag'        228 17 
1 4TVJ LEU A 18  ? UNP Q9UGN5 ?   ?   'expression tag'        229 18 
1 4TVJ TYR A 19  ? UNP Q9UGN5 ?   ?   'expression tag'        230 19 
1 4TVJ PHE A 20  ? UNP Q9UGN5 ?   ?   'expression tag'        231 20 
1 4TVJ GLN A 21  ? UNP Q9UGN5 ?   ?   'expression tag'        232 21 
1 4TVJ SER A 22  ? UNP Q9UGN5 ?   ?   'expression tag'        233 22 
1 4TVJ MET A 23  ? UNP Q9UGN5 ?   ?   'expression tag'        234 23 
1 4TVJ HIS A 236 ? UNP Q9UGN5 PRO 447 conflict                447 24 
2 4TVJ MET B 1   ? UNP Q9UGN5 ?   ?   'initiating methionine' 212 25 
2 4TVJ HIS B 2   ? UNP Q9UGN5 ?   ?   'expression tag'        213 26 
2 4TVJ HIS B 3   ? UNP Q9UGN5 ?   ?   'expression tag'        214 27 
2 4TVJ HIS B 4   ? UNP Q9UGN5 ?   ?   'expression tag'        215 28 
2 4TVJ HIS B 5   ? UNP Q9UGN5 ?   ?   'expression tag'        216 29 
2 4TVJ HIS B 6   ? UNP Q9UGN5 ?   ?   'expression tag'        217 30 
2 4TVJ HIS B 7   ? UNP Q9UGN5 ?   ?   'expression tag'        218 31 
2 4TVJ SER B 8   ? UNP Q9UGN5 ?   ?   'expression tag'        219 32 
2 4TVJ SER B 9   ? UNP Q9UGN5 ?   ?   'expression tag'        220 33 
2 4TVJ GLY B 10  ? UNP Q9UGN5 ?   ?   'expression tag'        221 34 
2 4TVJ VAL B 11  ? UNP Q9UGN5 ?   ?   'expression tag'        222 35 
2 4TVJ ASP B 12  ? UNP Q9UGN5 ?   ?   'expression tag'        223 36 
2 4TVJ LEU B 13  ? UNP Q9UGN5 ?   ?   'expression tag'        224 37 
2 4TVJ GLY B 14  ? UNP Q9UGN5 ?   ?   'expression tag'        225 38 
2 4TVJ THR B 15  ? UNP Q9UGN5 ?   ?   'expression tag'        226 39 
2 4TVJ GLU B 16  ? UNP Q9UGN5 ?   ?   'expression tag'        227 40 
2 4TVJ ASN B 17  ? UNP Q9UGN5 ?   ?   'expression tag'        228 41 
2 4TVJ LEU B 18  ? UNP Q9UGN5 ?   ?   'expression tag'        229 42 
2 4TVJ TYR B 19  ? UNP Q9UGN5 ?   ?   'expression tag'        230 43 
2 4TVJ PHE B 20  ? UNP Q9UGN5 ?   ?   'expression tag'        231 44 
2 4TVJ GLN B 21  ? UNP Q9UGN5 ?   ?   'expression tag'        232 45 
2 4TVJ SER B 22  ? UNP Q9UGN5 ?   ?   'expression tag'        233 46 
2 4TVJ MET B 23  ? UNP Q9UGN5 ?   ?   'expression tag'        234 47 
2 4TVJ HIS B 236 ? UNP Q9UGN5 PRO 447 conflict                447 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
09L non-polymer         . '4-(3-{[4-(cyclopropylcarbonyl)piperazin-1-yl]carbonyl}-4-fluorobenzyl)phthalazin-1(2H)-one' Olaparib 
'C24 H23 F N4 O3' 434.463 
ALA 'L-peptide linking' y ALANINE                                                                                      ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                      ? 
'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                                                                     
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                        ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                      ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                      ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                       ? 
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                    ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                     ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                       ? 
'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4TVJ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.40 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.74 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25% PEG3350, 0.1M Tris' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-07-27 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99190 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.99190 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4TVJ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.10 
_reflns.d_resolution_low                 30.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       45851 
_reflns.number_obs                       45851 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.5 
_reflns.pdbx_Rmerge_I_obs                0.109 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.107 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.10 
_reflns_shell.d_res_low                   2.15 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.1 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.669 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4TVJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     43558 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.28 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.18984 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18763 
_refine.ls_R_factor_R_free                       0.23103 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2293 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.949 
_refine.correlation_coeff_Fo_to_Fc_free          0.924 
_refine.B_iso_mean                               27.879 
_refine.aniso_B[1][1]                            0.97 
_refine.aniso_B[2][2]                            0.37 
_refine.aniso_B[3][3]                            -0.83 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.54 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3KCZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.220 
_refine.pdbx_overall_ESU_R_Free                  0.183 
_refine.overall_SU_ML                            0.127 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             10.101 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        5609 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         82 
_refine_hist.number_atoms_solvent             267 
_refine_hist.number_atoms_total               5958 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        29.28 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.022  ? 5815 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.004  0.020  ? 3993 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.530  1.987  ? 7851 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.027  3.002  ? 9765 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.212  5.000  ? 705  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.227 24.363 ? 259  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.919 15.000 ? 1042 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.891 15.000 ? 30   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.088  0.200  ? 853  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 6371 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1125 'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.805  1.500  ? 3522 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.190  1.500  ? 1429 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.471  2.000  ? 5657 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.319  3.000  ? 2293 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.724  4.500  ? 2188 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.number_reflns_R_work             3174 
_refine_ls_shell.R_factor_R_work                  0.232 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             167 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     4TVJ 
_struct.title                        'HUMAN ARTD2 (PARP2) - CATALYTIC DOMAIN IN COMPLEX WITH OLAPARIB' 
_struct.pdbx_descriptor              TRANSFERASE 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4TVJ 
_struct_keywords.text            'Poly(ADP-Ribose) transferase, Inhibitor, ADP-Ribosylation, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 12  ? GLN A 21  ? ASP A 223 GLN A 232 1 ? 10 
HELX_P HELX_P2  AA2 ASP A 24  ? CYS A 35  ? ASP A 235 CYS A 246 1 ? 12 
HELX_P HELX_P3  AA3 ASN A 36  ? MET A 47  ? ASN A 247 MET A 258 1 ? 12 
HELX_P HELX_P4  AA4 PRO A 55  ? LEU A 59  ? PRO A 266 LEU A 270 5 ? 5  
HELX_P HELX_P5  AA5 THR A 60  ? ALA A 80  ? THR A 271 ALA A 291 1 ? 21 
HELX_P HELX_P6  AA6 GLY A 84  ? ILE A 98  ? GLY A 295 ILE A 309 1 ? 15 
HELX_P HELX_P7  AA7 THR A 112 ? VAL A 136 ? THR A 323 VAL A 347 1 ? 25 
HELX_P HELX_P8  AA8 HIS A 145 ? HIS A 155 ? HIS A 356 HIS A 366 1 ? 11 
HELX_P HELX_P9  AA9 SER A 165 ? THR A 178 ? SER A 376 THR A 389 1 ? 14 
HELX_P HELX_P10 AB1 GLY A 200 ? PHE A 205 ? GLY A 411 PHE A 416 1 ? 6  
HELX_P HELX_P11 AB2 ARG A 220 ? SER A 222 ? ARG A 431 SER A 433 5 ? 3  
HELX_P HELX_P12 AB3 ASN A 223 ? GLY A 231 ? ASN A 434 GLY A 442 1 ? 9  
HELX_P HELX_P13 AB4 PRO A 240 ? TYR A 244 ? PRO A 451 TYR A 455 5 ? 5  
HELX_P HELX_P14 AB5 MET A 255 ? ASN A 261 ? MET A 466 ASN A 472 1 ? 7  
HELX_P HELX_P15 AB6 TYR A 262 ? PHE A 264 ? TYR A 473 PHE A 475 5 ? 3  
HELX_P HELX_P16 AB7 LYS A 293 ? LEU A 298 ? LYS A 504 LEU A 509 5 ? 6  
HELX_P HELX_P17 AB8 SER A 314 ? PHE A 317 ? SER A 525 PHE A 528 5 ? 4  
HELX_P HELX_P18 AB9 ASN A 352 ? ASN A 354 ? ASN A 563 ASN A 565 5 ? 3  
HELX_P HELX_P19 AC1 GLU B 16  ? GLN B 21  ? GLU B 227 GLN B 232 1 ? 6  
HELX_P HELX_P20 AC2 ASP B 24  ? CYS B 35  ? ASP B 235 CYS B 246 1 ? 12 
HELX_P HELX_P21 AC3 ASN B 36  ? MET B 47  ? ASN B 247 MET B 258 1 ? 12 
HELX_P HELX_P22 AC4 PRO B 55  ? LEU B 59  ? PRO B 266 LEU B 270 5 ? 5  
HELX_P HELX_P23 AC5 THR B 60  ? GLY B 81  ? THR B 271 GLY B 292 1 ? 22 
HELX_P HELX_P24 AC6 GLY B 84  ? ILE B 98  ? GLY B 295 ILE B 309 1 ? 15 
HELX_P HELX_P25 AC7 THR B 112 ? VAL B 136 ? THR B 323 VAL B 347 1 ? 25 
HELX_P HELX_P26 AC8 HIS B 145 ? HIS B 155 ? HIS B 356 HIS B 366 1 ? 11 
HELX_P HELX_P27 AC9 SER B 165 ? THR B 178 ? SER B 376 THR B 389 1 ? 14 
HELX_P HELX_P28 AD1 GLY B 200 ? PHE B 205 ? GLY B 411 PHE B 416 1 ? 6  
HELX_P HELX_P29 AD2 ARG B 220 ? SER B 222 ? ARG B 431 SER B 433 5 ? 3  
HELX_P HELX_P30 AD3 ASN B 223 ? GLY B 231 ? ASN B 434 GLY B 442 1 ? 9  
HELX_P HELX_P31 AD4 PRO B 240 ? TYR B 244 ? PRO B 451 TYR B 455 5 ? 5  
HELX_P HELX_P32 AD5 MET B 255 ? TYR B 262 ? MET B 466 TYR B 473 1 ? 8  
HELX_P HELX_P33 AD6 LYS B 293 ? LEU B 298 ? LYS B 504 LEU B 509 5 ? 6  
HELX_P HELX_P34 AD7 SER B 314 ? PHE B 317 ? SER B 525 PHE B 528 5 ? 4  
HELX_P HELX_P35 AD8 ASN B 352 ? ASN B 354 ? ASN B 563 ASN B 565 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 328 A . ? GLY 539 A PRO 329 A ? PRO 540 A 1 2.48 
2 GLY 328 B . ? GLY 539 B PRO 329 B ? PRO 540 B 1 5.15 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 4 ? 
AA3 ? 3 ? 
AA4 ? 2 ? 
AA5 ? 5 ? 
AA6 ? 4 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? parallel      
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? parallel      
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 CYS A 156 ? PRO A 160 ? CYS A 367 PRO A 371 
AA1 2 THR A 187 ? LYS A 198 ? THR A 398 LYS A 409 
AA1 3 VAL A 356 ? ASN A 367 ? VAL A 567 ASN A 578 
AA1 4 THR A 271 ? ALA A 280 ? THR A 482 ALA A 491 
AA1 5 ARG A 212 ? GLY A 218 ? ARG A 423 GLY A 429 
AA2 1 ILE A 250 ? PHE A 252 ? ILE A 461 PHE A 463 
AA2 2 GLU A 347 ? VAL A 350 ? GLU A 558 VAL A 561 
AA2 3 SER A 303 ? GLY A 306 ? SER A 514 GLY A 517 
AA2 4 CYS A 284 ? LEU A 287 ? CYS A 495 LEU A 498 
AA3 1 ALA A 330 ? ASP A 332 ? ALA A 541 ASP A 543 
AA3 2 GLY A 308 ? PRO A 312 ? GLY A 519 PRO A 523 
AA3 3 LEU A 343 ? TYR A 345 ? LEU A 554 TYR A 556 
AA4 1 VAL A 318 ? LEU A 320 ? VAL A 529 LEU A 531 
AA4 2 SER A 323 ? VAL A 325 ? SER A 534 VAL A 536 
AA5 1 CYS B 156 ? PRO B 160 ? CYS B 367 PRO B 371 
AA5 2 THR B 187 ? LYS B 198 ? THR B 398 LYS B 409 
AA5 3 VAL B 356 ? ASN B 367 ? VAL B 567 ASN B 578 
AA5 4 THR B 271 ? ALA B 280 ? THR B 482 ALA B 491 
AA5 5 ARG B 212 ? GLY B 218 ? ARG B 423 GLY B 429 
AA6 1 ILE B 250 ? PHE B 252 ? ILE B 461 PHE B 463 
AA6 2 GLU B 347 ? VAL B 350 ? GLU B 558 VAL B 561 
AA6 3 SER B 303 ? GLY B 306 ? SER B 514 GLY B 517 
AA6 4 CYS B 284 ? LEU B 287 ? CYS B 495 LEU B 498 
AA7 1 ALA B 330 ? ASP B 332 ? ALA B 541 ASP B 543 
AA7 2 GLY B 308 ? PRO B 312 ? GLY B 519 PRO B 523 
AA7 3 LEU B 343 ? TYR B 345 ? LEU B 554 TYR B 556 
AA8 1 VAL B 318 ? LEU B 320 ? VAL B 529 LEU B 531 
AA8 2 SER B 323 ? VAL B 325 ? SER B 534 VAL B 536 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 159 ? N ARG A 370 O GLU A 195 ? O GLU A 406 
AA1 2 3 N THR A 187 ? N THR A 398 O ASN A 367 ? O ASN A 578 
AA1 3 4 O TYR A 360 ? O TYR A 571 N LEU A 276 ? N LEU A 487 
AA1 4 5 O LEU A 275 ? O LEU A 486 N HIS A 217 ? N HIS A 428 
AA2 1 2 N ILE A 250 ? N ILE A 461 O VAL A 350 ? O VAL A 561 
AA2 2 3 O GLU A 347 ? O GLU A 558 N GLY A 306 ? N GLY A 517 
AA2 3 4 O SER A 303 ? O SER A 514 N ASN A 285 ? N ASN A 496 
AA3 1 2 O SER A 331 ? O SER A 542 N ALA A 311 ? N ALA A 522 
AA3 2 3 N MET A 310 ? N MET A 521 O ASN A 344 ? O ASN A 555 
AA4 1 2 N VAL A 318 ? N VAL A 529 O VAL A 325 ? O VAL A 536 
AA5 1 2 N ARG B 159 ? N ARG B 370 O GLU B 195 ? O GLU B 406 
AA5 2 3 N THR B 187 ? N THR B 398 O ASN B 367 ? O ASN B 578 
AA5 3 4 O ARG B 357 ? O ARG B 568 N GLU B 278 ? N GLU B 489 
AA5 4 5 O VAL B 279 ? O VAL B 490 N MET B 213 ? N MET B 424 
AA6 1 2 N ILE B 250 ? N ILE B 461 O VAL B 350 ? O VAL B 561 
AA6 2 3 O ILE B 349 ? O ILE B 560 N THR B 304 ? N THR B 515 
AA6 3 4 O SER B 303 ? O SER B 514 N ASN B 285 ? N ASN B 496 
AA7 1 2 O SER B 331 ? O SER B 542 N ALA B 311 ? N ALA B 522 
AA7 2 3 N MET B 310 ? N MET B 521 O ASN B 344 ? O ASN B 555 
AA8 1 2 N VAL B 318 ? N VAL B 529 O VAL B 325 ? O VAL B 536 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 09L 601 ? 13 'binding site for residue 09L A 601' 
AC2 Software A GOL 602 ? 6  'binding site for residue GOL A 602' 
AC3 Software A GOL 603 ? 7  'binding site for residue GOL A 603' 
AC4 Software B 09L 601 ? 11 'binding site for residue 09L B 601' 
AC5 Software B GOL 602 ? 7  'binding site for residue GOL B 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 GLU A 124 ? GLU A 335 . ? 1_555 ? 
2  AC1 13 HIS A 217 ? HIS A 428 . ? 1_555 ? 
3  AC1 13 GLY A 218 ? GLY A 429 . ? 1_555 ? 
4  AC1 13 ARG A 233 ? ARG A 444 . ? 1_555 ? 
5  AC1 13 TYR A 244 ? TYR A 455 . ? 1_555 ? 
6  AC1 13 GLY A 249 ? GLY A 460 . ? 1_555 ? 
7  AC1 13 ILE A 250 ? ILE A 461 . ? 1_555 ? 
8  AC1 13 TYR A 251 ? TYR A 462 . ? 1_555 ? 
9  AC1 13 PHE A 252 ? PHE A 463 . ? 1_555 ? 
10 AC1 13 SER A 259 ? SER A 470 . ? 1_555 ? 
11 AC1 13 TYR A 262 ? TYR A 473 . ? 1_555 ? 
12 AC1 13 GOL E .   ? GOL A 603 . ? 1_555 ? 
13 AC1 13 HOH H .   ? HOH A 723 . ? 1_555 ? 
14 AC2 6  ASP A 185 ? ASP A 396 . ? 1_555 ? 
15 AC2 6  TYR A 186 ? TYR A 397 . ? 1_555 ? 
16 AC2 6  ALA A 260 ? ALA A 471 . ? 1_555 ? 
17 AC2 6  ASN A 261 ? ASN A 472 . ? 1_555 ? 
18 AC2 6  PHE A 264 ? PHE A 475 . ? 1_555 ? 
19 AC2 6  ALA A 265 ? ALA A 476 . ? 1_555 ? 
20 AC3 7  SER A 117 ? SER A 328 . ? 1_555 ? 
21 AC3 7  ILE A 120 ? ILE A 331 . ? 1_555 ? 
22 AC3 7  GLU A 124 ? GLU A 335 . ? 1_555 ? 
23 AC3 7  GLY A 243 ? GLY A 454 . ? 1_555 ? 
24 AC3 7  TYR A 244 ? TYR A 455 . ? 1_555 ? 
25 AC3 7  09L C .   ? 09L A 601 . ? 1_555 ? 
26 AC3 7  HOH H .   ? HOH A 854 . ? 1_555 ? 
27 AC4 11 GLU B 124 ? GLU B 335 . ? 1_555 ? 
28 AC4 11 HIS B 217 ? HIS B 428 . ? 1_555 ? 
29 AC4 11 GLY B 218 ? GLY B 429 . ? 1_555 ? 
30 AC4 11 ARG B 233 ? ARG B 444 . ? 1_555 ? 
31 AC4 11 TYR B 244 ? TYR B 455 . ? 1_555 ? 
32 AC4 11 GLY B 249 ? GLY B 460 . ? 1_555 ? 
33 AC4 11 ILE B 250 ? ILE B 461 . ? 1_555 ? 
34 AC4 11 TYR B 251 ? TYR B 462 . ? 1_555 ? 
35 AC4 11 SER B 259 ? SER B 470 . ? 1_555 ? 
36 AC4 11 TYR B 262 ? TYR B 473 . ? 1_555 ? 
37 AC4 11 HOH I .   ? HOH B 719 . ? 1_555 ? 
38 AC5 7  ASP B 185 ? ASP B 396 . ? 1_555 ? 
39 AC5 7  TYR B 186 ? TYR B 397 . ? 1_555 ? 
40 AC5 7  ALA B 260 ? ALA B 471 . ? 1_555 ? 
41 AC5 7  ASN B 261 ? ASN B 472 . ? 1_555 ? 
42 AC5 7  CYS B 263 ? CYS B 474 . ? 1_555 ? 
43 AC5 7  PHE B 264 ? PHE B 475 . ? 1_555 ? 
44 AC5 7  ALA B 265 ? ALA B 476 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4TVJ 
_atom_sites.fract_transf_matrix[1][1]   0.017217 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009140 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007456 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019404 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 12  ? -20.610 9.485   10.964  1.00 47.68 ? 223 ASP A N   1 
ATOM   2    C CA  . ASP A 1 12  ? -20.016 9.700   12.313  1.00 47.07 ? 223 ASP A CA  1 
ATOM   3    C C   . ASP A 1 12  ? -19.325 8.401   12.753  1.00 46.60 ? 223 ASP A C   1 
ATOM   4    O O   . ASP A 1 12  ? -19.962 7.479   13.299  1.00 47.41 ? 223 ASP A O   1 
ATOM   5    C CB  . ASP A 1 12  ? -21.086 10.118  13.322  1.00 47.56 ? 223 ASP A CB  1 
ATOM   6    N N   . LEU A 1 13  ? -18.013 8.367   12.520  1.00 45.36 ? 224 LEU A N   1 
ATOM   7    C CA  . LEU A 1 13  ? -17.162 7.175   12.653  1.00 44.17 ? 224 LEU A CA  1 
ATOM   8    C C   . LEU A 1 13  ? -17.221 6.530   14.052  1.00 42.58 ? 224 LEU A C   1 
ATOM   9    O O   . LEU A 1 13  ? -17.094 5.312   14.176  1.00 41.34 ? 224 LEU A O   1 
ATOM   10   C CB  . LEU A 1 13  ? -15.698 7.517   12.286  1.00 43.92 ? 224 LEU A CB  1 
ATOM   11   C CG  . LEU A 1 13  ? -15.365 8.209   10.938  1.00 45.62 ? 224 LEU A CG  1 
ATOM   12   C CD1 . LEU A 1 13  ? -13.991 8.891   10.991  1.00 46.14 ? 224 LEU A CD1 1 
ATOM   13   C CD2 . LEU A 1 13  ? -15.430 7.253   9.746   1.00 47.09 ? 224 LEU A CD2 1 
ATOM   14   N N   . GLY A 1 14  ? -17.405 7.348   15.085  1.00 41.56 ? 225 GLY A N   1 
ATOM   15   C CA  . GLY A 1 14  ? -17.586 6.848   16.451  1.00 41.04 ? 225 GLY A CA  1 
ATOM   16   C C   . GLY A 1 14  ? -18.826 5.962   16.556  1.00 41.05 ? 225 GLY A C   1 
ATOM   17   O O   . GLY A 1 14  ? -18.742 4.839   17.056  1.00 39.60 ? 225 GLY A O   1 
ATOM   18   N N   . THR A 1 15  ? -19.967 6.457   16.052  1.00 41.24 ? 226 THR A N   1 
ATOM   19   C CA  . THR A 1 15  ? -21.220 5.663   16.057  1.00 41.54 ? 226 THR A CA  1 
ATOM   20   C C   . THR A 1 15  ? -21.077 4.377   15.217  1.00 40.35 ? 226 THR A C   1 
ATOM   21   O O   . THR A 1 15  ? -21.352 3.300   15.734  1.00 40.17 ? 226 THR A O   1 
ATOM   22   C CB  . THR A 1 15  ? -22.531 6.499   15.717  1.00 42.56 ? 226 THR A CB  1 
ATOM   23   O OG1 . THR A 1 15  ? -23.648 5.608   15.508  1.00 44.25 ? 226 THR A OG1 1 
ATOM   24   C CG2 . THR A 1 15  ? -22.368 7.385   14.475  1.00 43.90 ? 226 THR A CG2 1 
ATOM   25   N N   . GLU A 1 16  ? -20.602 4.474   13.978  1.00 39.19 ? 227 GLU A N   1 
ATOM   26   C CA  . GLU A 1 16  ? -20.420 3.276   13.137  1.00 39.37 ? 227 GLU A CA  1 
ATOM   27   C C   . GLU A 1 16  ? -19.596 2.195   13.825  1.00 38.55 ? 227 GLU A C   1 
ATOM   28   O O   . GLU A 1 16  ? -19.965 1.015   13.795  1.00 38.55 ? 227 GLU A O   1 
ATOM   29   C CB  . GLU A 1 16  ? -19.724 3.578   11.785  1.00 39.26 ? 227 GLU A CB  1 
ATOM   30   C CG  . GLU A 1 16  ? -20.436 4.578   10.836  1.00 40.79 ? 227 GLU A CG  1 
ATOM   31   C CD  . GLU A 1 16  ? -21.965 4.536   10.888  1.00 39.92 ? 227 GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 16  ? -22.575 3.686   10.174  1.00 35.67 ? 227 GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 16  ? -22.536 5.381   11.624  1.00 39.17 ? 227 GLU A OE2 1 
ATOM   34   N N   . ASN A 1 17  ? -18.463 2.606   14.404  1.00 37.14 ? 228 ASN A N   1 
ATOM   35   C CA  . ASN A 1 17  ? -17.587 1.720   15.154  1.00 36.41 ? 228 ASN A CA  1 
ATOM   36   C C   . ASN A 1 17  ? -18.326 0.982   16.281  1.00 35.89 ? 228 ASN A C   1 
ATOM   37   O O   . ASN A 1 17  ? -18.080 -0.206  16.531  1.00 35.19 ? 228 ASN A O   1 
ATOM   38   C CB  . ASN A 1 17  ? -16.406 2.530   15.731  1.00 36.38 ? 228 ASN A CB  1 
ATOM   39   C CG  . ASN A 1 17  ? -15.636 1.772   16.771  1.00 36.79 ? 228 ASN A CG  1 
ATOM   40   O OD1 . ASN A 1 17  ? -15.770 2.029   17.971  1.00 36.74 ? 228 ASN A OD1 1 
ATOM   41   N ND2 . ASN A 1 17  ? -14.831 0.816   16.325  1.00 38.08 ? 228 ASN A ND2 1 
ATOM   42   N N   . LEU A 1 18  ? -19.234 1.693   16.939  1.00 35.02 ? 229 LEU A N   1 
ATOM   43   C CA  . LEU A 1 18  ? -19.977 1.176   18.089  1.00 34.90 ? 229 LEU A CA  1 
ATOM   44   C C   . LEU A 1 18  ? -21.055 0.153   17.687  1.00 34.42 ? 229 LEU A C   1 
ATOM   45   O O   . LEU A 1 18  ? -21.218 -0.868  18.334  1.00 34.45 ? 229 LEU A O   1 
ATOM   46   C CB  . LEU A 1 18  ? -20.592 2.368   18.836  1.00 35.37 ? 229 LEU A CB  1 
ATOM   47   C CG  . LEU A 1 18  ? -20.948 2.242   20.312  1.00 36.29 ? 229 LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 18  ? -19.744 1.945   21.192  1.00 34.97 ? 229 LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 18  ? -21.656 3.548   20.766  1.00 37.33 ? 229 LEU A CD2 1 
ATOM   50   N N   . TYR A 1 19  ? -21.782 0.419   16.604  1.00 33.30 ? 230 TYR A N   1 
ATOM   51   C CA  . TYR A 1 19  ? -22.721 -0.567  16.070  1.00 33.03 ? 230 TYR A CA  1 
ATOM   52   C C   . TYR A 1 19  ? -22.063 -1.795  15.394  1.00 32.84 ? 230 TYR A C   1 
ATOM   53   O O   . TYR A 1 19  ? -22.525 -2.924  15.566  1.00 32.29 ? 230 TYR A O   1 
ATOM   54   C CB  . TYR A 1 19  ? -23.680 0.100   15.091  1.00 33.29 ? 230 TYR A CB  1 
ATOM   55   C CG  . TYR A 1 19  ? -24.758 0.900   15.759  1.00 32.05 ? 230 TYR A CG  1 
ATOM   56   C CD1 . TYR A 1 19  ? -26.045 0.391   15.877  1.00 32.36 ? 230 TYR A CD1 1 
ATOM   57   C CD2 . TYR A 1 19  ? -24.508 2.173   16.258  1.00 31.91 ? 230 TYR A CD2 1 
ATOM   58   C CE1 . TYR A 1 19  ? -27.059 1.119   16.475  1.00 32.06 ? 230 TYR A CE1 1 
ATOM   59   C CE2 . TYR A 1 19  ? -25.540 2.926   16.874  1.00 32.15 ? 230 TYR A CE2 1 
ATOM   60   C CZ  . TYR A 1 19  ? -26.810 2.372   16.968  1.00 31.85 ? 230 TYR A CZ  1 
ATOM   61   O OH  . TYR A 1 19  ? -27.837 3.060   17.544  1.00 35.97 ? 230 TYR A OH  1 
ATOM   62   N N   . PHE A 1 20  ? -21.008 -1.578  14.608  1.00 32.34 ? 231 PHE A N   1 
ATOM   63   C CA  . PHE A 1 20  ? -20.305 -2.692  13.970  1.00 32.64 ? 231 PHE A CA  1 
ATOM   64   C C   . PHE A 1 20  ? -19.411 -3.444  14.969  1.00 32.98 ? 231 PHE A C   1 
ATOM   65   O O   . PHE A 1 20  ? -19.071 -4.622  14.759  1.00 33.24 ? 231 PHE A O   1 
ATOM   66   C CB  . PHE A 1 20  ? -19.551 -2.200  12.718  1.00 32.52 ? 231 PHE A CB  1 
ATOM   67   C CG  . PHE A 1 20  ? -20.474 -1.983  11.555  1.00 32.77 ? 231 PHE A CG  1 
ATOM   68   C CD1 . PHE A 1 20  ? -20.689 -2.993  10.633  1.00 31.69 ? 231 PHE A CD1 1 
ATOM   69   C CD2 . PHE A 1 20  ? -21.214 -0.818  11.441  1.00 33.08 ? 231 PHE A CD2 1 
ATOM   70   C CE1 . PHE A 1 20  ? -21.573 -2.826  9.599   1.00 31.10 ? 231 PHE A CE1 1 
ATOM   71   C CE2 . PHE A 1 20  ? -22.115 -0.652  10.401  1.00 32.95 ? 231 PHE A CE2 1 
ATOM   72   C CZ  . PHE A 1 20  ? -22.299 -1.659  9.494   1.00 31.41 ? 231 PHE A CZ  1 
ATOM   73   N N   . GLN A 1 21  ? -19.106 -2.782  16.088  1.00 33.03 ? 232 GLN A N   1 
ATOM   74   C CA  . GLN A 1 21  ? -18.150 -3.273  17.073  1.00 33.33 ? 232 GLN A CA  1 
ATOM   75   C C   . GLN A 1 21  ? -16.873 -3.704  16.385  1.00 32.50 ? 232 GLN A C   1 
ATOM   76   O O   . GLN A 1 21  ? -16.410 -4.833  16.505  1.00 32.26 ? 232 GLN A O   1 
ATOM   77   C CB  . GLN A 1 21  ? -18.767 -4.393  17.914  1.00 34.50 ? 232 GLN A CB  1 
ATOM   78   C CG  . GLN A 1 21  ? -20.037 -3.912  18.627  1.00 37.01 ? 232 GLN A CG  1 
ATOM   79   C CD  . GLN A 1 21  ? -20.540 -4.889  19.643  1.00 39.28 ? 232 GLN A CD  1 
ATOM   80   O OE1 . GLN A 1 21  ? -20.687 -6.076  19.359  1.00 40.44 ? 232 GLN A OE1 1 
ATOM   81   N NE2 . GLN A 1 21  ? -20.819 -4.400  20.836  1.00 41.70 ? 232 GLN A NE2 1 
ATOM   82   N N   . SER A 1 22  ? -16.326 -2.772  15.624  1.00 32.42 ? 233 SER A N   1 
ATOM   83   C CA  . SER A 1 22  ? -15.140 -3.003  14.840  1.00 31.59 ? 233 SER A CA  1 
ATOM   84   C C   . SER A 1 22  ? -13.988 -2.706  15.771  1.00 29.72 ? 233 SER A C   1 
ATOM   85   O O   . SER A 1 22  ? -14.193 -2.189  16.857  1.00 29.29 ? 233 SER A O   1 
ATOM   86   C CB  . SER A 1 22  ? -15.093 -2.030  13.653  1.00 32.46 ? 233 SER A CB  1 
ATOM   87   O OG  . SER A 1 22  ? -15.949 -2.454  12.607  1.00 35.19 ? 233 SER A OG  1 
ATOM   88   N N   . MET A 1 23  ? -12.777 -3.013  15.321  1.00 27.71 ? 234 MET A N   1 
ATOM   89   C CA  . MET A 1 23  ? -11.570 -2.633  16.023  1.00 26.31 ? 234 MET A CA  1 
ATOM   90   C C   . MET A 1 23  ? -11.643 -1.146  16.467  1.00 24.96 ? 234 MET A C   1 
ATOM   91   O O   . MET A 1 23  ? -12.198 -0.274  15.779  1.00 23.75 ? 234 MET A O   1 
ATOM   92   C CB  . MET A 1 23  ? -10.376 -2.906  15.086  1.00 26.05 ? 234 MET A CB  1 
ATOM   93   C CG  . MET A 1 23  ? -8.989  -2.451  15.484  1.00 25.18 ? 234 MET A CG  1 
ATOM   94   S SD  . MET A 1 23  ? -7.875  -2.582  13.993  1.00 25.43 ? 234 MET A SD  1 
ATOM   95   C CE  . MET A 1 23  ? -7.623  -4.369  13.886  1.00 23.54 ? 234 MET A CE  1 
ATOM   96   N N   . ASP A 1 24  ? -11.092 -0.896  17.633  1.00 24.12 ? 235 ASP A N   1 
ATOM   97   C CA  . ASP A 1 24  ? -11.046 0.420   18.211  1.00 24.74 ? 235 ASP A CA  1 
ATOM   98   C C   . ASP A 1 24  ? -10.463 1.348   17.168  1.00 24.11 ? 235 ASP A C   1 
ATOM   99   O O   . ASP A 1 24  ? -9.508  0.988   16.458  1.00 23.46 ? 235 ASP A O   1 
ATOM   100  C CB  . ASP A 1 24  ? -10.174 0.371   19.484  1.00 24.70 ? 235 ASP A CB  1 
ATOM   101  C CG  . ASP A 1 24  ? -10.009 1.738   20.151  1.00 26.90 ? 235 ASP A CG  1 
ATOM   102  O OD1 . ASP A 1 24  ? -9.244  2.548   19.636  1.00 30.94 ? 235 ASP A OD1 1 
ATOM   103  O OD2 . ASP A 1 24  ? -10.627 2.004   21.205  1.00 31.40 ? 235 ASP A OD2 1 
ATOM   104  N N   . LEU A 1 25  ? -11.043 2.530   17.041  1.00 23.90 ? 236 LEU A N   1 
ATOM   105  C CA  . LEU A 1 25  ? -10.605 3.453   15.987  1.00 24.59 ? 236 LEU A CA  1 
ATOM   106  C C   . LEU A 1 25  ? -9.131  3.925   16.099  1.00 22.98 ? 236 LEU A C   1 
ATOM   107  O O   . LEU A 1 25  ? -8.520  4.287   15.108  1.00 22.82 ? 236 LEU A O   1 
ATOM   108  C CB  . LEU A 1 25  ? -11.504 4.678   15.956  1.00 25.28 ? 236 LEU A CB  1 
ATOM   109  C CG  . LEU A 1 25  ? -12.930 4.501   15.438  1.00 27.65 ? 236 LEU A CG  1 
ATOM   110  C CD1 . LEU A 1 25  ? -13.739 5.796   15.774  1.00 29.99 ? 236 LEU A CD1 1 
ATOM   111  C CD2 . LEU A 1 25  ? -12.942 4.189   13.947  1.00 30.06 ? 236 LEU A CD2 1 
ATOM   112  N N   . ARG A 1 26  ? -8.604  3.960   17.313  1.00 21.97 ? 237 ARG A N   1 
ATOM   113  C CA  . ARG A 1 26  ? -7.236  4.399   17.557  1.00 22.08 ? 237 ARG A CA  1 
ATOM   114  C C   . ARG A 1 26  ? -6.290  3.306   17.096  1.00 21.70 ? 237 ARG A C   1 
ATOM   115  O O   . ARG A 1 26  ? -5.276  3.589   16.480  1.00 21.51 ? 237 ARG A O   1 
ATOM   116  C CB  . ARG A 1 26  ? -7.049  4.757   19.034  1.00 21.64 ? 237 ARG A CB  1 
ATOM   117  C CG  . ARG A 1 26  ? -7.817  6.070   19.422  1.00 23.35 ? 237 ARG A CG  1 
ATOM   118  C CD  . ARG A 1 26  ? -8.314  5.985   20.893  1.00 26.75 ? 237 ARG A CD  1 
ATOM   119  N NE  . ARG A 1 26  ? -7.209  6.145   21.831  1.00 26.21 ? 237 ARG A NE  1 
ATOM   120  C CZ  . ARG A 1 26  ? -7.291  5.979   23.151  1.00 24.39 ? 237 ARG A CZ  1 
ATOM   121  N NH1 . ARG A 1 26  ? -6.209  6.159   23.909  1.00 23.24 ? 237 ARG A NH1 1 
ATOM   122  N NH2 . ARG A 1 26  ? -8.436  5.635   23.715  1.00 23.70 ? 237 ARG A NH2 1 
ATOM   123  N N   . VAL A 1 27  ? -6.674  2.058   17.337  1.00 21.61 ? 238 VAL A N   1 
ATOM   124  C CA  . VAL A 1 27  ? -5.929  0.918   16.830  1.00 20.81 ? 238 VAL A CA  1 
ATOM   125  C C   . VAL A 1 27  ? -5.996  0.903   15.325  1.00 21.17 ? 238 VAL A C   1 
ATOM   126  O O   . VAL A 1 27  ? -4.975  0.682   14.683  1.00 20.40 ? 238 VAL A O   1 
ATOM   127  C CB  . VAL A 1 27  ? -6.417  -0.417  17.420  1.00 21.14 ? 238 VAL A CB  1 
ATOM   128  C CG1 . VAL A 1 27  ? -5.658  -1.603  16.812  1.00 18.99 ? 238 VAL A CG1 1 
ATOM   129  C CG2 . VAL A 1 27  ? -6.240  -0.399  18.931  1.00 17.98 ? 238 VAL A CG2 1 
ATOM   130  N N   . GLN A 1 28  ? -7.184  1.125   14.753  1.00 21.07 ? 239 GLN A N   1 
ATOM   131  C CA  . GLN A 1 28  ? -7.306  1.205   13.308  1.00 20.78 ? 239 GLN A CA  1 
ATOM   132  C C   . GLN A 1 28  ? -6.286  2.194   12.729  1.00 20.33 ? 239 GLN A C   1 
ATOM   133  O O   . GLN A 1 28  ? -5.628  1.863   11.746  1.00 18.53 ? 239 GLN A O   1 
ATOM   134  C CB  . GLN A 1 28  ? -8.705  1.629   12.847  1.00 21.05 ? 239 GLN A CB  1 
ATOM   135  C CG  . GLN A 1 28  ? -9.793  0.567   13.064  1.00 23.54 ? 239 GLN A CG  1 
ATOM   136  C CD  . GLN A 1 28  ? -11.178 0.969   12.510  1.00 25.61 ? 239 GLN A CD  1 
ATOM   137  O OE1 . GLN A 1 28  ? -11.291 1.447   11.404  1.00 24.01 ? 239 GLN A OE1 1 
ATOM   138  N NE2 . GLN A 1 28  ? -12.225 0.696   13.275  1.00 27.23 ? 239 GLN A NE2 1 
ATOM   139  N N   . GLU A 1 29  ? -6.189  3.403   13.307  1.00 20.51 ? 240 GLU A N   1 
ATOM   140  C CA  . GLU A 1 29  ? -5.293  4.433   12.768  1.00 21.31 ? 240 GLU A CA  1 
ATOM   141  C C   . GLU A 1 29  ? -3.844  4.010   12.910  1.00 20.51 ? 240 GLU A C   1 
ATOM   142  O O   . GLU A 1 29  ? -3.065  4.313   12.044  1.00 19.37 ? 240 GLU A O   1 
ATOM   143  C CB  . GLU A 1 29  ? -5.497  5.824   13.390  1.00 22.31 ? 240 GLU A CB  1 
ATOM   144  C CG  . GLU A 1 29  ? -6.877  6.489   13.044  1.00 26.06 ? 240 GLU A CG  1 
ATOM   145  C CD  . GLU A 1 29  ? -7.085  6.712   11.524  1.00 30.52 ? 240 GLU A CD  1 
ATOM   146  O OE1 . GLU A 1 29  ? -6.179  7.251   10.889  1.00 34.26 ? 240 GLU A OE1 1 
ATOM   147  O OE2 . GLU A 1 29  ? -8.160  6.369   10.961  1.00 33.77 ? 240 GLU A OE2 1 
ATOM   148  N N   . LEU A 1 30  ? -3.505  3.301   13.997  1.00 20.32 ? 241 LEU A N   1 
ATOM   149  C CA  . LEU A 1 30  ? -2.148  2.809   14.221  1.00 19.76 ? 241 LEU A CA  1 
ATOM   150  C C   . LEU A 1 30  ? -1.747  1.769   13.190  1.00 19.92 ? 241 LEU A C   1 
ATOM   151  O O   . LEU A 1 30  ? -0.678  1.869   12.550  1.00 20.10 ? 241 LEU A O   1 
ATOM   152  C CB  . LEU A 1 30  ? -2.016  2.241   15.623  1.00 19.70 ? 241 LEU A CB  1 
ATOM   153  C CG  . LEU A 1 30  ? -0.681  1.599   16.000  1.00 18.95 ? 241 LEU A CG  1 
ATOM   154  C CD1 . LEU A 1 30  ? 0.461   2.573   16.071  1.00 16.57 ? 241 LEU A CD1 1 
ATOM   155  C CD2 . LEU A 1 30  ? -0.852  0.890   17.343  1.00 18.91 ? 241 LEU A CD2 1 
ATOM   156  N N   . ILE A 1 31  ? -2.634  0.822   12.969  1.00 20.02 ? 242 ILE A N   1 
ATOM   157  C CA  . ILE A 1 31  ? -2.402  -0.259  12.029  1.00 20.56 ? 242 ILE A CA  1 
ATOM   158  C C   . ILE A 1 31  ? -2.267  0.324   10.640  1.00 20.74 ? 242 ILE A C   1 
ATOM   159  O O   . ILE A 1 31  ? -1.416  -0.116  9.882   1.00 20.00 ? 242 ILE A O   1 
ATOM   160  C CB  . ILE A 1 31  ? -3.570  -1.283  11.991  1.00 20.74 ? 242 ILE A CB  1 
ATOM   161  C CG1 . ILE A 1 31  ? -3.671  -2.078  13.298  1.00 22.19 ? 242 ILE A CG1 1 
ATOM   162  C CG2 . ILE A 1 31  ? -3.410  -2.256  10.851  1.00 19.64 ? 242 ILE A CG2 1 
ATOM   163  C CD1 . ILE A 1 31  ? -2.500  -2.917  13.584  1.00 22.95 ? 242 ILE A CD1 1 
ATOM   164  N N   . LYS A 1 32  ? -3.135  1.262   10.290  1.00 21.03 ? 243 LYS A N   1 
ATOM   165  C CA  . LYS A 1 32  ? -3.070  1.870   8.944   1.00 22.74 ? 243 LYS A CA  1 
ATOM   166  C C   . LYS A 1 32  ? -1.718  2.568   8.730   1.00 21.95 ? 243 LYS A C   1 
ATOM   167  O O   . LYS A 1 32  ? -1.142  2.536   7.630   1.00 21.48 ? 243 LYS A O   1 
ATOM   168  C CB  . LYS A 1 32  ? -4.151  2.938   8.728   1.00 23.04 ? 243 LYS A CB  1 
ATOM   169  C CG  . LYS A 1 32  ? -5.576  2.484   8.495   1.00 27.75 ? 243 LYS A CG  1 
ATOM   170  C CD  . LYS A 1 32  ? -6.492  3.757   8.553   1.00 30.75 ? 243 LYS A CD  1 
ATOM   171  C CE  . LYS A 1 32  ? -7.907  3.555   8.092   1.00 35.44 ? 243 LYS A CE  1 
ATOM   172  N NZ  . LYS A 1 32  ? -8.781  4.701   8.547   1.00 35.96 ? 243 LYS A NZ  1 
ATOM   173  N N   . LEU A 1 33  ? -1.249  3.232   9.780   1.00 21.12 ? 244 LEU A N   1 
ATOM   174  C CA  . LEU A 1 33  ? 0.012   3.947   9.732   1.00 20.69 ? 244 LEU A CA  1 
ATOM   175  C C   . LEU A 1 33  ? 1.185   2.980   9.541   1.00 20.10 ? 244 LEU A C   1 
ATOM   176  O O   . LEU A 1 33  ? 1.980   3.180   8.649   1.00 19.63 ? 244 LEU A O   1 
ATOM   177  C CB  . LEU A 1 33  ? 0.224   4.788   10.994  1.00 20.53 ? 244 LEU A CB  1 
ATOM   178  C CG  . LEU A 1 33  ? 1.455   5.684   11.104  1.00 22.67 ? 244 LEU A CG  1 
ATOM   179  C CD1 . LEU A 1 33  ? 1.664   6.657   9.912   1.00 23.11 ? 244 LEU A CD1 1 
ATOM   180  C CD2 . LEU A 1 33  ? 1.360   6.477   12.413  1.00 21.67 ? 244 LEU A CD2 1 
ATOM   181  N N   . ILE A 1 34  ? 1.277   1.924   10.337  1.00 18.97 ? 245 ILE A N   1 
ATOM   182  C CA  . ILE A 1 34  ? 2.481   1.115   10.275  1.00 18.73 ? 245 ILE A CA  1 
ATOM   183  C C   . ILE A 1 34  ? 2.472   0.176   9.060   1.00 19.46 ? 245 ILE A C   1 
ATOM   184  O O   . ILE A 1 34  ? 3.534   -0.227  8.588   1.00 18.51 ? 245 ILE A O   1 
ATOM   185  C CB  . ILE A 1 34  ? 2.800   0.349   11.593  1.00 17.95 ? 245 ILE A CB  1 
ATOM   186  C CG1 . ILE A 1 34  ? 1.777   -0.768  11.884  1.00 17.29 ? 245 ILE A CG1 1 
ATOM   187  C CG2 . ILE A 1 34  ? 2.946   1.353   12.792  1.00 17.32 ? 245 ILE A CG2 1 
ATOM   188  C CD1 . ILE A 1 34  ? 2.190   -1.665  13.072  1.00 14.72 ? 245 ILE A CD1 1 
ATOM   189  N N   . CYS A 1 35  ? 1.273   -0.174  8.580   1.00 19.58 ? 246 CYS A N   1 
ATOM   190  C CA  . CYS A 1 35  ? 1.147   -1.040  7.431   1.00 20.62 ? 246 CYS A CA  1 
ATOM   191  C C   . CYS A 1 35  ? 1.138   -0.285  6.093   1.00 21.44 ? 246 CYS A C   1 
ATOM   192  O O   . CYS A 1 35  ? 0.850   -0.884  5.075   1.00 21.10 ? 246 CYS A O   1 
ATOM   193  C CB  . CYS A 1 35  ? -0.144  -1.878  7.542   1.00 20.73 ? 246 CYS A CB  1 
ATOM   194  S SG  . CYS A 1 35  ? -0.201  -3.006  8.918   1.00 22.60 ? 246 CYS A SG  1 
ATOM   195  N N   . ASN A 1 36  ? 1.420   1.013   6.093   1.00 22.58 ? 247 ASN A N   1 
ATOM   196  C CA  . ASN A 1 36  ? 1.334   1.838   4.873   1.00 24.29 ? 247 ASN A CA  1 
ATOM   197  C C   . ASN A 1 36  ? 2.506   1.546   3.945   1.00 24.09 ? 247 ASN A C   1 
ATOM   198  O O   . ASN A 1 36  ? 3.637   1.912   4.253   1.00 22.23 ? 247 ASN A O   1 
ATOM   199  C CB  . ASN A 1 36  ? 1.381   3.312   5.279   1.00 24.88 ? 247 ASN A CB  1 
ATOM   200  C CG  . ASN A 1 36  ? 1.076   4.256   4.139   1.00 28.12 ? 247 ASN A CG  1 
ATOM   201  O OD1 . ASN A 1 36  ? 1.497   4.062   2.997   1.00 31.81 ? 247 ASN A OD1 1 
ATOM   202  N ND2 . ASN A 1 36  ? 0.360   5.324   4.462   1.00 33.60 ? 247 ASN A ND2 1 
ATOM   203  N N   . VAL A 1 37  ? 2.241   0.853   2.845   1.00 24.51 ? 248 VAL A N   1 
ATOM   204  C CA  . VAL A 1 37  ? 3.317   0.380   1.962   1.00 25.54 ? 248 VAL A CA  1 
ATOM   205  C C   . VAL A 1 37  ? 3.936   1.508   1.136   1.00 25.28 ? 248 VAL A C   1 
ATOM   206  O O   . VAL A 1 37  ? 5.097   1.497   0.862   1.00 23.71 ? 248 VAL A O   1 
ATOM   207  C CB  . VAL A 1 37  ? 2.855   -0.732  1.019   1.00 26.40 ? 248 VAL A CB  1 
ATOM   208  C CG1 . VAL A 1 37  ? 4.029   -1.093  -0.004  1.00 27.79 ? 248 VAL A CG1 1 
ATOM   209  C CG2 . VAL A 1 37  ? 2.467   -1.953  1.831   1.00 26.83 ? 248 VAL A CG2 1 
ATOM   210  N N   . GLN A 1 38  ? 3.127   2.484   0.768   1.00 26.84 ? 249 GLN A N   1 
ATOM   211  C CA  . GLN A 1 38  ? 3.594   3.681   0.119   1.00 27.66 ? 249 GLN A CA  1 
ATOM   212  C C   . GLN A 1 38  ? 4.599   4.393   1.015   1.00 26.72 ? 249 GLN A C   1 
ATOM   213  O O   . GLN A 1 38  ? 5.630   4.889   0.525   1.00 26.38 ? 249 GLN A O   1 
ATOM   214  C CB  . GLN A 1 38  ? 2.395   4.578   -0.183  1.00 29.92 ? 249 GLN A CB  1 
ATOM   215  C CG  . GLN A 1 38  ? 2.702   5.850   -0.951  1.00 34.23 ? 249 GLN A CG  1 
ATOM   216  C CD  . GLN A 1 38  ? 3.015   5.536   -2.375  1.00 40.94 ? 249 GLN A CD  1 
ATOM   217  O OE1 . GLN A 1 38  ? 4.139   5.123   -2.686  1.00 43.45 ? 249 GLN A OE1 1 
ATOM   218  N NE2 . GLN A 1 38  ? 2.014   5.710   -3.274  1.00 45.53 ? 249 GLN A NE2 1 
ATOM   219  N N   . ALA A 1 39  ? 4.353   4.408   2.333   1.00 24.33 ? 250 ALA A N   1 
ATOM   220  C CA  . ALA A 1 39  ? 5.265   5.093   3.238   1.00 23.19 ? 250 ALA A CA  1 
ATOM   221  C C   . ALA A 1 39  ? 6.607   4.384   3.264   1.00 22.17 ? 250 ALA A C   1 
ATOM   222  O O   . ALA A 1 39  ? 7.660   5.033   3.260   1.00 20.27 ? 250 ALA A O   1 
ATOM   223  C CB  . ALA A 1 39  ? 4.677   5.260   4.686   1.00 22.68 ? 250 ALA A CB  1 
ATOM   224  N N   . MET A 1 40  ? 6.573   3.056   3.258   1.00 21.44 ? 251 MET A N   1 
ATOM   225  C CA  . MET A 1 40  ? 7.788   2.273   3.170   1.00 21.61 ? 251 MET A CA  1 
ATOM   226  C C   . MET A 1 40  ? 8.603   2.571   1.881   1.00 22.52 ? 251 MET A C   1 
ATOM   227  O O   . MET A 1 40  ? 9.839   2.674   1.942   1.00 20.29 ? 251 MET A O   1 
ATOM   228  C CB  . MET A 1 40  ? 7.460   0.784   3.228   1.00 22.24 ? 251 MET A CB  1 
ATOM   229  C CG  . MET A 1 40  ? 6.895   0.314   4.571   1.00 22.00 ? 251 MET A CG  1 
ATOM   230  S SD  . MET A 1 40  ? 6.116   -1.302  4.494   1.00 24.44 ? 251 MET A SD  1 
ATOM   231  C CE  . MET A 1 40  ? 5.538   -1.364  6.206   1.00 28.54 ? 251 MET A CE  1 
ATOM   232  N N   . GLU A 1 41  ? 7.908   2.676   0.741   1.00 23.92 ? 252 GLU A N   1 
ATOM   233  C CA  . GLU A 1 41  ? 8.518   3.014   -0.564  1.00 25.52 ? 252 GLU A CA  1 
ATOM   234  C C   . GLU A 1 41  ? 9.231   4.373   -0.475  1.00 25.23 ? 252 GLU A C   1 
ATOM   235  O O   . GLU A 1 41  ? 10.396  4.495   -0.857  1.00 24.39 ? 252 GLU A O   1 
ATOM   236  C CB  . GLU A 1 41  ? 7.477   2.974   -1.733  1.00 26.95 ? 252 GLU A CB  1 
ATOM   237  C CG  . GLU A 1 41  ? 7.557   1.715   -2.691  1.00 33.12 ? 252 GLU A CG  1 
ATOM   238  C CD  . GLU A 1 41  ? 6.194   1.275   -3.341  1.00 39.87 ? 252 GLU A CD  1 
ATOM   239  O OE1 . GLU A 1 41  ? 5.412   2.161   -3.786  1.00 44.15 ? 252 GLU A OE1 1 
ATOM   240  O OE2 . GLU A 1 41  ? 5.904   0.040   -3.408  1.00 40.80 ? 252 GLU A OE2 1 
ATOM   241  N N   . GLU A 1 42  ? 8.553   5.374   0.075   1.00 25.62 ? 253 GLU A N   1 
ATOM   242  C CA  . GLU A 1 42  ? 9.146   6.704   0.295   1.00 25.80 ? 253 GLU A CA  1 
ATOM   243  C C   . GLU A 1 42  ? 10.334  6.622   1.220   1.00 24.86 ? 253 GLU A C   1 
ATOM   244  O O   . GLU A 1 42  ? 11.351  7.248   0.968   1.00 23.61 ? 253 GLU A O   1 
ATOM   245  C CB  . GLU A 1 42  ? 8.124   7.697   0.867   1.00 26.54 ? 253 GLU A CB  1 
ATOM   246  C CG  . GLU A 1 42  ? 6.997   7.988   -0.116  1.00 29.48 ? 253 GLU A CG  1 
ATOM   247  C CD  . GLU A 1 42  ? 5.810   8.739   0.474   1.00 35.63 ? 253 GLU A CD  1 
ATOM   248  O OE1 . GLU A 1 42  ? 5.583   8.741   1.726   1.00 40.90 ? 253 GLU A OE1 1 
ATOM   249  O OE2 . GLU A 1 42  ? 5.064   9.298   -0.349  1.00 39.01 ? 253 GLU A OE2 1 
ATOM   250  N N   . MET A 1 43  ? 10.226  5.836   2.286   1.00 23.26 ? 254 MET A N   1 
ATOM   251  C CA  . MET A 1 43  ? 11.345  5.748   3.220   1.00 22.62 ? 254 MET A CA  1 
ATOM   252  C C   . MET A 1 43  ? 12.590  5.135   2.564   1.00 22.02 ? 254 MET A C   1 
ATOM   253  O O   . MET A 1 43  ? 13.695  5.546   2.850   1.00 20.16 ? 254 MET A O   1 
ATOM   254  C CB  . MET A 1 43  ? 11.001  4.940   4.497   1.00 22.26 ? 254 MET A CB  1 
ATOM   255  C CG  . MET A 1 43  ? 10.158  5.727   5.538   1.00 22.25 ? 254 MET A CG  1 
ATOM   256  S SD  . MET A 1 43  ? 9.769   4.739   7.013   1.00 20.85 ? 254 MET A SD  1 
ATOM   257  C CE  . MET A 1 43  ? 8.011   4.421   6.726   1.00 21.90 ? 254 MET A CE  1 
ATOM   258  N N   . MET A 1 44  ? 12.395  4.117   1.751   1.00 21.66 ? 255 MET A N   1 
ATOM   259  C CA  . MET A 1 44  ? 13.518  3.440   1.159   1.00 22.35 ? 255 MET A CA  1 
ATOM   260  C C   . MET A 1 44  ? 14.106  4.326   0.088   1.00 23.53 ? 255 MET A C   1 
ATOM   261  O O   . MET A 1 44  ? 15.323  4.334   -0.078  1.00 23.47 ? 255 MET A O   1 
ATOM   262  C CB  . MET A 1 44  ? 13.122  2.071   0.587   1.00 21.86 ? 255 MET A CB  1 
ATOM   263  C CG  . MET A 1 44  ? 12.725  1.031   1.630   1.00 21.89 ? 255 MET A CG  1 
ATOM   264  S SD  . MET A 1 44  ? 13.968  0.750   2.909   1.00 24.47 ? 255 MET A SD  1 
ATOM   265  C CE  . MET A 1 44  ? 13.710  2.196   3.864   1.00 25.52 ? 255 MET A CE  1 
ATOM   266  N N   . MET A 1 45  ? 13.266  5.079   -0.622  1.00 24.91 ? 256 MET A N   1 
ATOM   267  C CA  . MET A 1 45  ? 13.795  6.024   -1.628  1.00 27.00 ? 256 MET A CA  1 
ATOM   268  C C   . MET A 1 45  ? 14.682  7.071   -0.947  1.00 26.84 ? 256 MET A C   1 
ATOM   269  O O   . MET A 1 45  ? 15.747  7.394   -1.454  1.00 26.70 ? 256 MET A O   1 
ATOM   270  C CB  . MET A 1 45  ? 12.682  6.682   -2.448  1.00 27.98 ? 256 MET A CB  1 
ATOM   271  C CG  . MET A 1 45  ? 12.144  5.787   -3.574  1.00 31.05 ? 256 MET A CG  1 
ATOM   272  S SD  . MET A 1 45  ? 10.696  6.527   -4.389  1.00 38.65 ? 256 MET A SD  1 
ATOM   273  C CE  . MET A 1 45  ? 11.449  8.087   -4.946  1.00 38.13 ? 256 MET A CE  1 
ATOM   274  N N   . GLU A 1 46  ? 14.284  7.522   0.243   1.00 26.90 ? 257 GLU A N   1 
ATOM   275  C CA  . GLU A 1 46  ? 15.068  8.494   1.005   1.00 27.20 ? 257 GLU A CA  1 
ATOM   276  C C   . GLU A 1 46  ? 16.372  7.847   1.513   1.00 26.49 ? 257 GLU A C   1 
ATOM   277  O O   . GLU A 1 46  ? 17.359  8.526   1.749   1.00 25.10 ? 257 GLU A O   1 
ATOM   278  C CB  . GLU A 1 46  ? 14.211  9.080   2.154   1.00 27.76 ? 257 GLU A CB  1 
ATOM   279  C CG  . GLU A 1 46  ? 14.956  9.937   3.196   1.00 31.55 ? 257 GLU A CG  1 
ATOM   280  C CD  . GLU A 1 46  ? 15.338  11.344  2.690   1.00 36.94 ? 257 GLU A CD  1 
ATOM   281  O OE1 . GLU A 1 46  ? 16.290  11.931  3.270   1.00 40.67 ? 257 GLU A OE1 1 
ATOM   282  O OE2 . GLU A 1 46  ? 14.665  11.858  1.748   1.00 38.94 ? 257 GLU A OE2 1 
ATOM   283  N N   . MET A 1 47  ? 16.373  6.526   1.678   1.00 25.73 ? 258 MET A N   1 
ATOM   284  C CA  . MET A 1 47  ? 17.603  5.812   2.028   1.00 25.56 ? 258 MET A CA  1 
ATOM   285  C C   . MET A 1 47  ? 18.453  5.475   0.777   1.00 24.99 ? 258 MET A C   1 
ATOM   286  O O   . MET A 1 47  ? 19.441  4.788   0.881   1.00 23.95 ? 258 MET A O   1 
ATOM   287  C CB  . MET A 1 47  ? 17.270  4.528   2.825   1.00 25.38 ? 258 MET A CB  1 
ATOM   288  C CG  . MET A 1 47  ? 16.586  4.814   4.162   1.00 24.92 ? 258 MET A CG  1 
ATOM   289  S SD  . MET A 1 47  ? 16.390  3.362   5.209   1.00 25.01 ? 258 MET A SD  1 
ATOM   290  C CE  . MET A 1 47  ? 18.027  3.226   5.924   1.00 21.12 ? 258 MET A CE  1 
ATOM   291  N N   . LYS A 1 48  ? 18.037  5.968   -0.387  1.00 24.81 ? 259 LYS A N   1 
ATOM   292  C CA  . LYS A 1 48  ? 18.750  5.787   -1.679  1.00 25.17 ? 259 LYS A CA  1 
ATOM   293  C C   . LYS A 1 48  ? 18.622  4.413   -2.307  1.00 24.23 ? 259 LYS A C   1 
ATOM   294  O O   . LYS A 1 48  ? 19.351  4.099   -3.256  1.00 22.88 ? 259 LYS A O   1 
ATOM   295  C CB  . LYS A 1 48  ? 20.237  6.136   -1.615  1.00 25.13 ? 259 LYS A CB  1 
ATOM   296  C CG  . LYS A 1 48  ? 20.625  7.410   -0.924  1.00 29.12 ? 259 LYS A CG  1 
ATOM   297  C CD  . LYS A 1 48  ? 20.356  8.671   -1.701  1.00 34.67 ? 259 LYS A CD  1 
ATOM   298  C CE  . LYS A 1 48  ? 21.398  9.781   -1.398  1.00 37.01 ? 259 LYS A CE  1 
ATOM   299  N NZ  . LYS A 1 48  ? 22.354  9.471   -0.258  1.00 38.95 ? 259 LYS A NZ  1 
ATOM   300  N N   . TYR A 1 49  ? 17.660  3.614   -1.834  1.00 23.33 ? 260 TYR A N   1 
ATOM   301  C CA  . TYR A 1 49  ? 17.402  2.328   -2.422  1.00 23.10 ? 260 TYR A CA  1 
ATOM   302  C C   . TYR A 1 49  ? 16.594  2.544   -3.691  1.00 23.84 ? 260 TYR A C   1 
ATOM   303  O O   . TYR A 1 49  ? 15.709  3.379   -3.742  1.00 24.39 ? 260 TYR A O   1 
ATOM   304  C CB  . TYR A 1 49  ? 16.635  1.436   -1.454  1.00 23.67 ? 260 TYR A CB  1 
ATOM   305  C CG  . TYR A 1 49  ? 16.327  0.038   -1.976  1.00 22.13 ? 260 TYR A CG  1 
ATOM   306  C CD1 . TYR A 1 49  ? 17.275  -0.975  -1.900  1.00 20.47 ? 260 TYR A CD1 1 
ATOM   307  C CD2 . TYR A 1 49  ? 15.080  -0.259  -2.516  1.00 20.70 ? 260 TYR A CD2 1 
ATOM   308  C CE1 . TYR A 1 49  ? 16.972  -2.246  -2.345  1.00 23.61 ? 260 TYR A CE1 1 
ATOM   309  C CE2 . TYR A 1 49  ? 14.760  -1.530  -2.954  1.00 19.11 ? 260 TYR A CE2 1 
ATOM   310  C CZ  . TYR A 1 49  ? 15.699  -2.508  -2.871  1.00 22.96 ? 260 TYR A CZ  1 
ATOM   311  O OH  . TYR A 1 49  ? 15.387  -3.743  -3.335  1.00 28.23 ? 260 TYR A OH  1 
ATOM   312  N N   . ASN A 1 50  ? 16.888  1.761   -4.709  1.00 24.89 ? 261 ASN A N   1 
ATOM   313  C CA  . ASN A 1 50  ? 16.302  1.981   -6.022  1.00 26.01 ? 261 ASN A CA  1 
ATOM   314  C C   . ASN A 1 50  ? 15.027  1.163   -6.178  1.00 26.72 ? 261 ASN A C   1 
ATOM   315  O O   . ASN A 1 50  ? 15.051  0.081   -6.715  1.00 26.40 ? 261 ASN A O   1 
ATOM   316  C CB  . ASN A 1 50  ? 17.335  1.665   -7.114  1.00 25.83 ? 261 ASN A CB  1 
ATOM   317  C CG  . ASN A 1 50  ? 16.910  2.170   -8.480  1.00 27.64 ? 261 ASN A CG  1 
ATOM   318  O OD1 . ASN A 1 50  ? 15.720  2.377   -8.745  1.00 26.89 ? 261 ASN A OD1 1 
ATOM   319  N ND2 . ASN A 1 50  ? 17.882  2.400   -9.337  1.00 25.00 ? 261 ASN A ND2 1 
ATOM   320  N N   . THR A 1 51  ? 13.910  1.699   -5.677  1.00 28.20 ? 262 THR A N   1 
ATOM   321  C CA  . THR A 1 51  ? 12.622  1.006   -5.707  1.00 29.00 ? 262 THR A CA  1 
ATOM   322  C C   . THR A 1 51  ? 12.086  0.780   -7.140  1.00 31.34 ? 262 THR A C   1 
ATOM   323  O O   . THR A 1 51  ? 11.225  -0.070  -7.336  1.00 30.00 ? 262 THR A O   1 
ATOM   324  C CB  . THR A 1 51  ? 11.554  1.807   -4.944  1.00 28.31 ? 262 THR A CB  1 
ATOM   325  O OG1 . THR A 1 51  ? 11.666  3.179   -5.318  1.00 29.53 ? 262 THR A OG1 1 
ATOM   326  C CG2 . THR A 1 51  ? 11.743  1.719   -3.419  1.00 26.39 ? 262 THR A CG2 1 
ATOM   327  N N   . LYS A 1 52  ? 12.553  1.572   -8.117  1.00 33.53 ? 263 LYS A N   1 
ATOM   328  C CA  . LYS A 1 52  ? 12.229  1.309   -9.540  1.00 36.30 ? 263 LYS A CA  1 
ATOM   329  C C   . LYS A 1 52  ? 12.850  0.020   -10.077 1.00 36.90 ? 263 LYS A C   1 
ATOM   330  O O   . LYS A 1 52  ? 12.169  -0.784  -10.678 1.00 37.82 ? 263 LYS A O   1 
ATOM   331  C CB  . LYS A 1 52  ? 12.644  2.483   -10.445 1.00 37.36 ? 263 LYS A CB  1 
ATOM   332  C CG  . LYS A 1 52  ? 11.897  3.828   -10.157 1.00 40.54 ? 263 LYS A CG  1 
ATOM   333  C CD  . LYS A 1 52  ? 10.410  3.609   -9.727  1.00 43.88 ? 263 LYS A CD  1 
ATOM   334  C CE  . LYS A 1 52  ? 9.583   4.893   -9.745  1.00 46.28 ? 263 LYS A CE  1 
ATOM   335  N NZ  . LYS A 1 52  ? 9.670   5.655   -8.453  1.00 46.94 ? 263 LYS A NZ  1 
ATOM   336  N N   . LYS A 1 53  ? 14.140  -0.168  -9.834  1.00 37.66 ? 264 LYS A N   1 
ATOM   337  C CA  . LYS A 1 53  ? 14.909  -1.295  -10.376 1.00 38.53 ? 264 LYS A CA  1 
ATOM   338  C C   . LYS A 1 53  ? 14.695  -2.615  -9.604  1.00 37.95 ? 264 LYS A C   1 
ATOM   339  O O   . LYS A 1 53  ? 14.819  -3.692  -10.170 1.00 38.20 ? 264 LYS A O   1 
ATOM   340  C CB  . LYS A 1 53  ? 16.400  -0.918  -10.355 1.00 38.92 ? 264 LYS A CB  1 
ATOM   341  C CG  . LYS A 1 53  ? 17.348  -1.776  -11.221 1.00 42.32 ? 264 LYS A CG  1 
ATOM   342  C CD  . LYS A 1 53  ? 18.785  -1.175  -11.168 1.00 43.33 ? 264 LYS A CD  1 
ATOM   343  C CE  . LYS A 1 53  ? 19.894  -2.162  -11.581 1.00 44.39 ? 264 LYS A CE  1 
ATOM   344  N NZ  . LYS A 1 53  ? 21.225  -1.728  -11.001 1.00 44.10 ? 264 LYS A NZ  1 
ATOM   345  N N   . ALA A 1 54  ? 14.424  -2.534  -8.303  1.00 36.42 ? 265 ALA A N   1 
ATOM   346  C CA  . ALA A 1 54  ? 14.153  -3.731  -7.483  1.00 35.18 ? 265 ALA A CA  1 
ATOM   347  C C   . ALA A 1 54  ? 12.924  -3.423  -6.641  1.00 33.83 ? 265 ALA A C   1 
ATOM   348  O O   . ALA A 1 54  ? 13.059  -2.958  -5.536  1.00 32.44 ? 265 ALA A O   1 
ATOM   349  C CB  . ALA A 1 54  ? 15.345  -4.053  -6.593  1.00 34.33 ? 265 ALA A CB  1 
ATOM   350  N N   . PRO A 1 55  ? 11.717  -3.631  -7.192  1.00 34.17 ? 266 PRO A N   1 
ATOM   351  C CA  . PRO A 1 55  ? 10.542  -3.268  -6.399  1.00 33.66 ? 266 PRO A CA  1 
ATOM   352  C C   . PRO A 1 55  ? 10.432  -4.045  -5.073  1.00 33.04 ? 266 PRO A C   1 
ATOM   353  O O   . PRO A 1 55  ? 10.830  -5.220  -4.957  1.00 31.31 ? 266 PRO A O   1 
ATOM   354  C CB  . PRO A 1 55  ? 9.363   -3.533  -7.344  1.00 34.88 ? 266 PRO A CB  1 
ATOM   355  C CG  . PRO A 1 55  ? 10.023  -3.554  -8.779  1.00 35.14 ? 266 PRO A CG  1 
ATOM   356  C CD  . PRO A 1 55  ? 11.362  -4.163  -8.524  1.00 34.48 ? 266 PRO A CD  1 
ATOM   357  N N   . LEU A 1 56  ? 9.941   -3.337  -4.062  1.00 32.35 ? 267 LEU A N   1 
ATOM   358  C CA  . LEU A 1 56  ? 9.855   -3.887  -2.707  1.00 32.05 ? 267 LEU A CA  1 
ATOM   359  C C   . LEU A 1 56  ? 9.016   -5.184  -2.718  1.00 32.39 ? 267 LEU A C   1 
ATOM   360  O O   . LEU A 1 56  ? 9.363   -6.150  -2.089  1.00 32.38 ? 267 LEU A O   1 
ATOM   361  C CB  . LEU A 1 56  ? 9.286   -2.831  -1.758  1.00 31.25 ? 267 LEU A CB  1 
ATOM   362  C CG  . LEU A 1 56  ? 10.172  -1.593  -1.535  1.00 29.93 ? 267 LEU A CG  1 
ATOM   363  C CD1 . LEU A 1 56  ? 9.480   -0.561  -0.701  1.00 31.48 ? 267 LEU A CD1 1 
ATOM   364  C CD2 . LEU A 1 56  ? 11.453  -1.983  -0.842  1.00 28.40 ? 267 LEU A CD2 1 
ATOM   365  N N   . GLY A 1 57  ? 7.954   -5.207  -3.509  1.00 33.74 ? 268 GLY A N   1 
ATOM   366  C CA  . GLY A 1 57  ? 7.121   -6.379  -3.644  1.00 34.71 ? 268 GLY A CA  1 
ATOM   367  C C   . GLY A 1 57  ? 7.816   -7.633  -4.122  1.00 35.43 ? 268 GLY A C   1 
ATOM   368  O O   . GLY A 1 57  ? 7.291   -8.721  -3.897  1.00 36.29 ? 268 GLY A O   1 
ATOM   369  N N   . LYS A 1 58  ? 8.967   -7.492  -4.793  1.00 35.52 ? 269 LYS A N   1 
ATOM   370  C CA  . LYS A 1 58  ? 9.739   -8.628  -5.315  1.00 36.09 ? 269 LYS A CA  1 
ATOM   371  C C   . LYS A 1 58  ? 10.989  -8.959  -4.480  1.00 34.78 ? 269 LYS A C   1 
ATOM   372  O O   . LYS A 1 58  ? 11.727  -9.874  -4.777  1.00 34.42 ? 269 LYS A O   1 
ATOM   373  C CB  . LYS A 1 58  ? 10.129  -8.357  -6.784  1.00 37.23 ? 269 LYS A CB  1 
ATOM   374  C CG  . LYS A 1 58  ? 8.903   -8.374  -7.752  1.00 40.67 ? 269 LYS A CG  1 
ATOM   375  C CD  . LYS A 1 58  ? 9.263   -7.811  -9.155  1.00 44.70 ? 269 LYS A CD  1 
ATOM   376  C CE  . LYS A 1 58  ? 8.008   -7.417  -9.987  1.00 46.00 ? 269 LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 58  ? 7.311   -6.179  -9.453  1.00 46.92 ? 269 LYS A NZ  1 
ATOM   378  N N   . LEU A 1 59  ? 11.216  -8.195  -3.432  1.00 33.55 ? 270 LEU A N   1 
ATOM   379  C CA  . LEU A 1 59  ? 12.298  -8.453  -2.486  1.00 33.02 ? 270 LEU A CA  1 
ATOM   380  C C   . LEU A 1 59  ? 12.126  -9.789  -1.747  1.00 32.47 ? 270 LEU A C   1 
ATOM   381  O O   . LEU A 1 59  ? 11.022  -10.099 -1.254  1.00 33.19 ? 270 LEU A O   1 
ATOM   382  C CB  . LEU A 1 59  ? 12.263  -7.320  -1.474  1.00 33.69 ? 270 LEU A CB  1 
ATOM   383  C CG  . LEU A 1 59  ? 13.358  -7.042  -0.474  1.00 34.33 ? 270 LEU A CG  1 
ATOM   384  C CD1 . LEU A 1 59  ? 14.613  -6.657  -1.198  1.00 34.21 ? 270 LEU A CD1 1 
ATOM   385  C CD2 . LEU A 1 59  ? 12.821  -5.906  0.429   1.00 36.12 ? 270 LEU A CD2 1 
ATOM   386  N N   . THR A 1 60  ? 13.201  -10.565 -1.645  1.00 31.34 ? 271 THR A N   1 
ATOM   387  C CA  . THR A 1 60  ? 13.172  -11.860 -0.948  1.00 30.62 ? 271 THR A CA  1 
ATOM   388  C C   . THR A 1 60  ? 14.205  -11.873 0.121   1.00 29.85 ? 271 THR A C   1 
ATOM   389  O O   . THR A 1 60  ? 15.146  -11.083 0.054   1.00 30.23 ? 271 THR A O   1 
ATOM   390  C CB  . THR A 1 60  ? 13.545  -13.007 -1.906  1.00 31.10 ? 271 THR A CB  1 
ATOM   391  O OG1 . THR A 1 60  ? 14.920  -12.879 -2.268  1.00 29.41 ? 271 THR A OG1 1 
ATOM   392  C CG2 . THR A 1 60  ? 12.711  -12.949 -3.161  1.00 31.45 ? 271 THR A CG2 1 
ATOM   393  N N   . VAL A 1 61  ? 14.120  -12.804 1.067   1.00 29.56 ? 272 VAL A N   1 
ATOM   394  C CA  . VAL A 1 61  ? 15.122  -12.814 2.128   1.00 29.67 ? 272 VAL A CA  1 
ATOM   395  C C   . VAL A 1 61  ? 16.486  -13.322 1.649   1.00 29.45 ? 272 VAL A C   1 
ATOM   396  O O   . VAL A 1 61  ? 17.525  -12.853 2.146   1.00 28.90 ? 272 VAL A O   1 
ATOM   397  C CB  . VAL A 1 61  ? 14.677  -13.432 3.536   1.00 30.03 ? 272 VAL A CB  1 
ATOM   398  C CG1 . VAL A 1 61  ? 13.109  -13.331 3.792   1.00 29.94 ? 272 VAL A CG1 1 
ATOM   399  C CG2 . VAL A 1 61  ? 15.233  -14.793 3.771   1.00 30.19 ? 272 VAL A CG2 1 
ATOM   400  N N   . ALA A 1 62  ? 16.502  -14.237 0.673   1.00 28.36 ? 273 ALA A N   1 
ATOM   401  C CA  . ALA A 1 62  ? 17.771  -14.602 0.025   1.00 28.16 ? 273 ALA A CA  1 
ATOM   402  C C   . ALA A 1 62  ? 18.471  -13.362 -0.590  1.00 26.39 ? 273 ALA A C   1 
ATOM   403  O O   . ALA A 1 62  ? 19.662  -13.224 -0.460  1.00 26.84 ? 273 ALA A O   1 
ATOM   404  C CB  . ALA A 1 62  ? 17.572  -15.736 -1.049  1.00 27.16 ? 273 ALA A CB  1 
ATOM   405  N N   . GLN A 1 63  ? 17.725  -12.476 -1.241  1.00 26.33 ? 274 GLN A N   1 
ATOM   406  C CA  . GLN A 1 63  ? 18.286  -11.209 -1.775  1.00 26.39 ? 274 GLN A CA  1 
ATOM   407  C C   . GLN A 1 63  ? 18.954  -10.362 -0.674  1.00 24.85 ? 274 GLN A C   1 
ATOM   408  O O   . GLN A 1 63  ? 20.092  -9.894  -0.815  1.00 24.65 ? 274 GLN A O   1 
ATOM   409  C CB  . GLN A 1 63  ? 17.198  -10.376 -2.493  1.00 27.13 ? 274 GLN A CB  1 
ATOM   410  C CG  . GLN A 1 63  ? 17.306  -10.300 -4.011  1.00 31.16 ? 274 GLN A CG  1 
ATOM   411  C CD  . GLN A 1 63  ? 15.961  -10.404 -4.777  1.00 33.71 ? 274 GLN A CD  1 
ATOM   412  O OE1 . GLN A 1 63  ? 14.954  -9.778  -4.421  1.00 36.42 ? 274 GLN A OE1 1 
ATOM   413  N NE2 . GLN A 1 63  ? 15.967  -11.187 -5.855  1.00 36.77 ? 274 GLN A NE2 1 
ATOM   414  N N   . ILE A 1 64  ? 18.244  -10.196 0.440   1.00 23.58 ? 275 ILE A N   1 
ATOM   415  C CA  . ILE A 1 64  ? 18.723  -9.432  1.556   1.00 22.35 ? 275 ILE A CA  1 
ATOM   416  C C   . ILE A 1 64  ? 19.975  -10.082 2.162   1.00 22.48 ? 275 ILE A C   1 
ATOM   417  O O   . ILE A 1 64  ? 20.930  -9.404  2.473   1.00 21.68 ? 275 ILE A O   1 
ATOM   418  C CB  . ILE A 1 64  ? 17.582  -9.211  2.617   1.00 22.17 ? 275 ILE A CB  1 
ATOM   419  C CG1 . ILE A 1 64  ? 16.462  -8.354  2.024   1.00 20.90 ? 275 ILE A CG1 1 
ATOM   420  C CG2 . ILE A 1 64  ? 18.152  -8.577  3.874   1.00 21.02 ? 275 ILE A CG2 1 
ATOM   421  C CD1 . ILE A 1 64  ? 15.095  -8.436  2.798   1.00 21.80 ? 275 ILE A CD1 1 
ATOM   422  N N   . LYS A 1 65  ? 19.986  -11.397 2.301   1.00 23.40 ? 276 LYS A N   1 
ATOM   423  C CA  . LYS A 1 65  ? 21.133  -12.083 2.888   1.00 24.04 ? 276 LYS A CA  1 
ATOM   424  C C   . LYS A 1 65  ? 22.395  -11.938 2.023   1.00 24.01 ? 276 LYS A C   1 
ATOM   425  O O   . LYS A 1 65  ? 23.489  -11.796 2.535   1.00 22.78 ? 276 LYS A O   1 
ATOM   426  C CB  . LYS A 1 65  ? 20.828  -13.567 3.062   1.00 25.02 ? 276 LYS A CB  1 
ATOM   427  C CG  . LYS A 1 65  ? 21.997  -14.393 3.592   1.00 26.73 ? 276 LYS A CG  1 
ATOM   428  C CD  . LYS A 1 65  ? 21.746  -15.897 3.408   1.00 31.95 ? 276 LYS A CD  1 
ATOM   429  C CE  . LYS A 1 65  ? 22.955  -16.713 3.893   1.00 35.03 ? 276 LYS A CE  1 
ATOM   430  N NZ  . LYS A 1 65  ? 22.551  -17.954 4.578   1.00 38.18 ? 276 LYS A NZ  1 
ATOM   431  N N   . ALA A 1 66  ? 22.220  -12.016 0.714   1.00 24.43 ? 277 ALA A N   1 
ATOM   432  C CA  . ALA A 1 66  ? 23.324  -11.791 -0.222  1.00 24.94 ? 277 ALA A CA  1 
ATOM   433  C C   . ALA A 1 66  ? 23.869  -10.358 -0.068  1.00 24.13 ? 277 ALA A C   1 
ATOM   434  O O   . ALA A 1 66  ? 25.070  -10.125 -0.152  1.00 24.85 ? 277 ALA A O   1 
ATOM   435  C CB  . ALA A 1 66  ? 22.863  -12.120 -1.717  1.00 24.23 ? 277 ALA A CB  1 
ATOM   436  N N   . GLY A 1 67  ? 23.003  -9.397  0.215   1.00 23.24 ? 278 GLY A N   1 
ATOM   437  C CA  . GLY A 1 67  ? 23.487  -8.080  0.586   1.00 22.03 ? 278 GLY A CA  1 
ATOM   438  C C   . GLY A 1 67  ? 24.366  -8.069  1.815   1.00 22.12 ? 278 GLY A C   1 
ATOM   439  O O   . GLY A 1 67  ? 25.443  -7.420  1.840   1.00 20.75 ? 278 GLY A O   1 
ATOM   440  N N   . TYR A 1 68  ? 23.936  -8.772  2.862   1.00 21.72 ? 279 TYR A N   1 
ATOM   441  C CA  . TYR A 1 68  ? 24.714  -8.744  4.114   1.00 20.95 ? 279 TYR A CA  1 
ATOM   442  C C   . TYR A 1 68  ? 26.094  -9.311  3.838   1.00 21.91 ? 279 TYR A C   1 
ATOM   443  O O   . TYR A 1 68  ? 27.101  -8.841  4.390   1.00 21.24 ? 279 TYR A O   1 
ATOM   444  C CB  . TYR A 1 68  ? 24.075  -9.579  5.207   1.00 20.69 ? 279 TYR A CB  1 
ATOM   445  C CG  . TYR A 1 68  ? 22.953  -8.925  5.985   1.00 19.80 ? 279 TYR A CG  1 
ATOM   446  C CD1 . TYR A 1 68  ? 23.190  -7.828  6.827   1.00 19.96 ? 279 TYR A CD1 1 
ATOM   447  C CD2 . TYR A 1 68  ? 21.660  -9.440  5.925   1.00 19.88 ? 279 TYR A CD2 1 
ATOM   448  C CE1 . TYR A 1 68  ? 22.136  -7.259  7.586   1.00 20.53 ? 279 TYR A CE1 1 
ATOM   449  C CE2 . TYR A 1 68  ? 20.608  -8.889  6.676   1.00 20.86 ? 279 TYR A CE2 1 
ATOM   450  C CZ  . TYR A 1 68  ? 20.849  -7.803  7.495   1.00 20.89 ? 279 TYR A CZ  1 
ATOM   451  O OH  . TYR A 1 68  ? 19.808  -7.276  8.212   1.00 20.33 ? 279 TYR A OH  1 
ATOM   452  N N   . GLN A 1 69  ? 26.092  -10.363 3.017   1.00 22.05 ? 280 GLN A N   1 
ATOM   453  C CA  . GLN A 1 69  ? 27.301  -11.062 2.622   1.00 23.37 ? 280 GLN A CA  1 
ATOM   454  C C   . GLN A 1 69  ? 28.255  -10.155 1.901   1.00 22.43 ? 280 GLN A C   1 
ATOM   455  O O   . GLN A 1 69  ? 29.441  -10.200 2.167   1.00 22.59 ? 280 GLN A O   1 
ATOM   456  C CB  . GLN A 1 69  ? 26.977  -12.305 1.762   1.00 23.95 ? 280 GLN A CB  1 
ATOM   457  C CG  . GLN A 1 69  ? 26.516  -13.459 2.641   1.00 26.38 ? 280 GLN A CG  1 
ATOM   458  C CD  . GLN A 1 69  ? 25.964  -14.639 1.879   1.00 31.24 ? 280 GLN A CD  1 
ATOM   459  O OE1 . GLN A 1 69  ? 25.525  -14.516 0.730   1.00 34.23 ? 280 GLN A OE1 1 
ATOM   460  N NE2 . GLN A 1 69  ? 25.955  -15.807 2.537   1.00 32.00 ? 280 GLN A NE2 1 
ATOM   461  N N   . SER A 1 70  ? 27.746  -9.339  0.988   1.00 22.20 ? 281 SER A N   1 
ATOM   462  C CA  . SER A 1 70  ? 28.628  -8.386  0.305   1.00 21.92 ? 281 SER A CA  1 
ATOM   463  C C   . SER A 1 70  ? 29.113  -7.343  1.272   1.00 21.28 ? 281 SER A C   1 
ATOM   464  O O   . SER A 1 70  ? 30.268  -6.915  1.190   1.00 21.08 ? 281 SER A O   1 
ATOM   465  C CB  . SER A 1 70  ? 27.934  -7.728  -0.873  1.00 21.39 ? 281 SER A CB  1 
ATOM   466  O OG  . SER A 1 70  ? 27.519  -8.744  -1.727  1.00 24.50 ? 281 SER A OG  1 
ATOM   467  N N   . LEU A 1 71  ? 28.254  -6.946  2.216   1.00 20.53 ? 282 LEU A N   1 
ATOM   468  C CA  . LEU A 1 71  ? 28.672  -5.973  3.216   1.00 20.39 ? 282 LEU A CA  1 
ATOM   469  C C   . LEU A 1 71  ? 29.801  -6.520  4.052   1.00 19.97 ? 282 LEU A C   1 
ATOM   470  O O   . LEU A 1 71  ? 30.673  -5.774  4.492   1.00 19.07 ? 282 LEU A O   1 
ATOM   471  C CB  . LEU A 1 71  ? 27.526  -5.537  4.137   1.00 20.08 ? 282 LEU A CB  1 
ATOM   472  C CG  . LEU A 1 71  ? 26.751  -4.280  3.789   1.00 20.47 ? 282 LEU A CG  1 
ATOM   473  C CD1 . LEU A 1 71  ? 25.661  -4.028  4.904   1.00 18.92 ? 282 LEU A CD1 1 
ATOM   474  C CD2 . LEU A 1 71  ? 27.678  -3.071  3.629   1.00 16.41 ? 282 LEU A CD2 1 
ATOM   475  N N   . LYS A 1 72  ? 29.747  -7.810  4.331   1.00 21.05 ? 283 LYS A N   1 
ATOM   476  C CA  . LYS A 1 72  ? 30.789  -8.451  5.152   1.00 22.27 ? 283 LYS A CA  1 
ATOM   477  C C   . LYS A 1 72  ? 32.144  -8.444  4.374   1.00 23.23 ? 283 LYS A C   1 
ATOM   478  O O   . LYS A 1 72  ? 33.224  -8.188  4.944   1.00 21.74 ? 283 LYS A O   1 
ATOM   479  C CB  . LYS A 1 72  ? 30.337  -9.855  5.572   1.00 23.00 ? 283 LYS A CB  1 
ATOM   480  C CG  . LYS A 1 72  ? 31.426  -10.806 6.163   1.00 25.34 ? 283 LYS A CG  1 
ATOM   481  C CD  . LYS A 1 72  ? 32.000  -10.294 7.458   1.00 28.93 ? 283 LYS A CD  1 
ATOM   482  C CE  . LYS A 1 72  ? 32.656  -11.428 8.290   1.00 30.17 ? 283 LYS A CE  1 
ATOM   483  N NZ  . LYS A 1 72  ? 33.949  -11.943 7.720   1.00 31.81 ? 283 LYS A NZ  1 
ATOM   484  N N   . LYS A 1 73  ? 32.075  -8.669  3.063   1.00 24.30 ? 284 LYS A N   1 
ATOM   485  C CA  . LYS A 1 73  ? 33.289  -8.638  2.230   1.00 24.94 ? 284 LYS A CA  1 
ATOM   486  C C   . LYS A 1 73  ? 33.885  -7.248  2.248   1.00 24.34 ? 284 LYS A C   1 
ATOM   487  O O   . LYS A 1 73  ? 35.114  -7.093  2.336   1.00 23.91 ? 284 LYS A O   1 
ATOM   488  C CB  . LYS A 1 73  ? 32.982  -9.038  0.807   1.00 25.98 ? 284 LYS A CB  1 
ATOM   489  C CG  . LYS A 1 73  ? 32.772  -10.534 0.616   1.00 29.50 ? 284 LYS A CG  1 
ATOM   490  C CD  . LYS A 1 73  ? 32.862  -10.859 -0.900  1.00 33.38 ? 284 LYS A CD  1 
ATOM   491  C CE  . LYS A 1 73  ? 32.313  -12.213 -1.240  1.00 35.30 ? 284 LYS A CE  1 
ATOM   492  N NZ  . LYS A 1 73  ? 31.228  -12.117 -2.261  1.00 35.15 ? 284 LYS A NZ  1 
ATOM   493  N N   . ILE A 1 74  ? 33.008  -6.245  2.191   1.00 22.81 ? 285 ILE A N   1 
ATOM   494  C CA  . ILE A 1 74  ? 33.416  -4.854  2.355   1.00 22.53 ? 285 ILE A CA  1 
ATOM   495  C C   . ILE A 1 74  ? 34.093  -4.636  3.700   1.00 22.09 ? 285 ILE A C   1 
ATOM   496  O O   . ILE A 1 74  ? 35.184  -4.047  3.761   1.00 21.40 ? 285 ILE A O   1 
ATOM   497  C CB  . ILE A 1 74  ? 32.246  -3.865  2.179   1.00 22.04 ? 285 ILE A CB  1 
ATOM   498  C CG1 . ILE A 1 74  ? 31.721  -3.922  0.737   1.00 23.04 ? 285 ILE A CG1 1 
ATOM   499  C CG2 . ILE A 1 74  ? 32.698  -2.464  2.547   1.00 20.57 ? 285 ILE A CG2 1 
ATOM   500  C CD1 . ILE A 1 74  ? 30.456  -3.092  0.462   1.00 22.16 ? 285 ILE A CD1 1 
ATOM   501  N N   . GLU A 1 75  ? 33.490  -5.158  4.774   1.00 22.09 ? 286 GLU A N   1 
ATOM   502  C CA  . GLU A 1 75  ? 34.128  -5.075  6.098   1.00 21.42 ? 286 GLU A CA  1 
ATOM   503  C C   . GLU A 1 75  ? 35.534  -5.685  6.043   1.00 22.17 ? 286 GLU A C   1 
ATOM   504  O O   . GLU A 1 75  ? 36.503  -5.081  6.563   1.00 20.85 ? 286 GLU A O   1 
ATOM   505  C CB  . GLU A 1 75  ? 33.326  -5.738  7.199   1.00 21.28 ? 286 GLU A CB  1 
ATOM   506  C CG  . GLU A 1 75  ? 33.896  -5.443  8.610   1.00 22.63 ? 286 GLU A CG  1 
ATOM   507  C CD  . GLU A 1 75  ? 33.135  -6.188  9.757   1.00 24.48 ? 286 GLU A CD  1 
ATOM   508  O OE1 . GLU A 1 75  ? 33.253  -7.421  9.846   1.00 25.61 ? 286 GLU A OE1 1 
ATOM   509  O OE2 . GLU A 1 75  ? 32.461  -5.519  10.573  1.00 24.46 ? 286 GLU A OE2 1 
ATOM   510  N N   . ASP A 1 76  ? 35.643  -6.858  5.412   1.00 22.66 ? 287 ASP A N   1 
ATOM   511  C CA  . ASP A 1 76  ? 36.917  -7.562  5.302   1.00 24.48 ? 287 ASP A CA  1 
ATOM   512  C C   . ASP A 1 76  ? 37.991  -6.712  4.618   1.00 24.97 ? 287 ASP A C   1 
ATOM   513  O O   . ASP A 1 76  ? 39.118  -6.686  5.067   1.00 23.70 ? 287 ASP A O   1 
ATOM   514  C CB  . ASP A 1 76  ? 36.770  -8.882  4.535   1.00 25.25 ? 287 ASP A CB  1 
ATOM   515  C CG  . ASP A 1 76  ? 35.882  -9.879  5.242   1.00 26.36 ? 287 ASP A CG  1 
ATOM   516  O OD1 . ASP A 1 76  ? 35.714  -9.800  6.478   1.00 28.30 ? 287 ASP A OD1 1 
ATOM   517  O OD2 . ASP A 1 76  ? 35.356  -10.772 4.545   1.00 29.40 ? 287 ASP A OD2 1 
ATOM   518  N N   . CYS A 1 77  ? 37.611  -6.018  3.549   1.00 25.95 ? 288 CYS A N   1 
ATOM   519  C CA  . CYS A 1 77  ? 38.519  -5.139  2.826   1.00 27.49 ? 288 CYS A CA  1 
ATOM   520  C C   . CYS A 1 77  ? 39.018  -4.029  3.706   1.00 27.25 ? 288 CYS A C   1 
ATOM   521  O O   . CYS A 1 77  ? 40.249  -3.817  3.805   1.00 28.44 ? 288 CYS A O   1 
ATOM   522  C CB  . CYS A 1 77  ? 37.861  -4.503  1.603   1.00 27.43 ? 288 CYS A CB  1 
ATOM   523  S SG  . CYS A 1 77  ? 37.604  -5.631  0.285   1.00 32.56 ? 288 CYS A SG  1 
ATOM   524  N N   . ILE A 1 78  ? 38.088  -3.301  4.314   1.00 26.53 ? 289 ILE A N   1 
ATOM   525  C CA  . ILE A 1 78  ? 38.471  -2.251  5.243   1.00 26.74 ? 289 ILE A CA  1 
ATOM   526  C C   . ILE A 1 78  ? 39.430  -2.815  6.287   1.00 27.47 ? 289 ILE A C   1 
ATOM   527  O O   . ILE A 1 78  ? 40.462  -2.221  6.545   1.00 28.36 ? 289 ILE A O   1 
ATOM   528  C CB  . ILE A 1 78  ? 37.269  -1.574  5.914   1.00 26.15 ? 289 ILE A CB  1 
ATOM   529  C CG1 . ILE A 1 78  ? 36.430  -0.841  4.871   1.00 26.50 ? 289 ILE A CG1 1 
ATOM   530  C CG2 . ILE A 1 78  ? 37.730  -0.598  7.002   1.00 27.01 ? 289 ILE A CG2 1 
ATOM   531  C CD1 . ILE A 1 78  ? 34.977  -0.559  5.315   1.00 24.63 ? 289 ILE A CD1 1 
ATOM   532  N N   . ARG A 1 79  ? 39.113  -3.975  6.848   1.00 27.92 ? 290 ARG A N   1 
ATOM   533  C CA  . ARG A 1 79  ? 39.942  -4.566  7.896   1.00 29.75 ? 290 ARG A CA  1 
ATOM   534  C C   . ARG A 1 79  ? 41.380  -4.860  7.367   1.00 31.35 ? 290 ARG A C   1 
ATOM   535  O O   . ARG A 1 79  ? 42.343  -4.609  8.059   1.00 31.23 ? 290 ARG A O   1 
ATOM   536  C CB  . ARG A 1 79  ? 39.275  -5.837  8.425   1.00 29.37 ? 290 ARG A CB  1 
ATOM   537  C CG  . ARG A 1 79  ? 39.693  -6.322  9.798   1.00 31.21 ? 290 ARG A CG  1 
ATOM   538  C CD  . ARG A 1 79  ? 38.979  -7.654  10.168  1.00 32.57 ? 290 ARG A CD  1 
ATOM   539  N NE  . ARG A 1 79  ? 37.549  -7.498  10.474  1.00 33.81 ? 290 ARG A NE  1 
ATOM   540  C CZ  . ARG A 1 79  ? 37.063  -6.970  11.606  1.00 35.34 ? 290 ARG A CZ  1 
ATOM   541  N NH1 . ARG A 1 79  ? 37.882  -6.499  12.554  1.00 34.34 ? 290 ARG A NH1 1 
ATOM   542  N NH2 . ARG A 1 79  ? 35.746  -6.899  11.804  1.00 34.77 ? 290 ARG A NH2 1 
ATOM   543  N N   . ALA A 1 80  ? 41.508  -5.364  6.139   1.00 33.16 ? 291 ALA A N   1 
ATOM   544  C CA  . ALA A 1 80  ? 42.832  -5.684  5.558   1.00 35.00 ? 291 ALA A CA  1 
ATOM   545  C C   . ALA A 1 80  ? 43.526  -4.479  4.931   1.00 36.28 ? 291 ALA A C   1 
ATOM   546  O O   . ALA A 1 80  ? 44.568  -4.631  4.331   1.00 37.76 ? 291 ALA A O   1 
ATOM   547  C CB  . ALA A 1 80  ? 42.721  -6.807  4.539   1.00 34.91 ? 291 ALA A CB  1 
ATOM   548  N N   . GLY A 1 81  ? 42.954  -3.290  5.062   1.00 38.22 ? 292 GLY A N   1 
ATOM   549  C CA  . GLY A 1 81  ? 43.533  -2.071  4.490   1.00 40.43 ? 292 GLY A CA  1 
ATOM   550  C C   . GLY A 1 81  ? 43.505  -2.059  2.973   1.00 42.62 ? 292 GLY A C   1 
ATOM   551  O O   . GLY A 1 81  ? 44.148  -1.216  2.350   1.00 42.67 ? 292 GLY A O   1 
ATOM   552  N N   . GLN A 1 82  ? 42.761  -3.004  2.393   1.00 44.95 ? 293 GLN A N   1 
ATOM   553  C CA  . GLN A 1 82  ? 42.650  -3.162  0.952   1.00 46.98 ? 293 GLN A CA  1 
ATOM   554  C C   . GLN A 1 82  ? 41.667  -2.198  0.439   1.00 47.96 ? 293 GLN A C   1 
ATOM   555  O O   . GLN A 1 82  ? 40.508  -2.216  0.825   1.00 49.22 ? 293 GLN A O   1 
ATOM   556  C CB  . GLN A 1 82  ? 42.072  -4.505  0.555   1.00 47.13 ? 293 GLN A CB  1 
ATOM   557  C CG  . GLN A 1 82  ? 42.982  -5.683  0.667   1.00 49.19 ? 293 GLN A CG  1 
ATOM   558  C CD  . GLN A 1 82  ? 42.179  -6.964  0.678   1.00 51.75 ? 293 GLN A CD  1 
ATOM   559  O OE1 . GLN A 1 82  ? 40.946  -6.942  0.541   1.00 54.15 ? 293 GLN A OE1 1 
ATOM   560  N NE2 . GLN A 1 82  ? 42.857  -8.090  0.852   1.00 53.88 ? 293 GLN A NE2 1 
ATOM   561  N N   . HIS A 1 83  ? 42.108  -1.370  -0.475  1.00 49.71 ? 294 HIS A N   1 
ATOM   562  C CA  . HIS A 1 83  ? 41.186  -0.629  -1.285  1.00 50.05 ? 294 HIS A CA  1 
ATOM   563  C C   . HIS A 1 83  ? 41.542  -1.081  -2.705  1.00 50.17 ? 294 HIS A C   1 
ATOM   564  O O   . HIS A 1 83  ? 42.445  -1.916  -2.868  1.00 49.08 ? 294 HIS A O   1 
ATOM   565  C CB  . HIS A 1 83  ? 41.328  0.852   -0.937  1.00 50.46 ? 294 HIS A CB  1 
ATOM   566  C CG  . HIS A 1 83  ? 41.258  1.101   0.548   1.00 52.16 ? 294 HIS A CG  1 
ATOM   567  N ND1 . HIS A 1 83  ? 41.331  0.077   1.474   1.00 54.14 ? 294 HIS A ND1 1 
ATOM   568  C CD2 . HIS A 1 83  ? 41.140  2.243   1.271   1.00 55.28 ? 294 HIS A CD2 1 
ATOM   569  C CE1 . HIS A 1 83  ? 41.248  0.570   2.698   1.00 54.99 ? 294 HIS A CE1 1 
ATOM   570  N NE2 . HIS A 1 83  ? 41.137  1.884   2.606   1.00 56.19 ? 294 HIS A NE2 1 
ATOM   571  N N   . GLY A 1 84  ? 40.797  -0.632  -3.714  1.00 50.13 ? 295 GLY A N   1 
ATOM   572  C CA  . GLY A 1 84  ? 40.969  -1.204  -5.055  1.00 50.09 ? 295 GLY A CA  1 
ATOM   573  C C   . GLY A 1 84  ? 40.454  -2.642  -5.142  1.00 49.32 ? 295 GLY A C   1 
ATOM   574  O O   . GLY A 1 84  ? 39.515  -3.006  -4.443  1.00 48.36 ? 295 GLY A O   1 
ATOM   575  N N   . ARG A 1 85  ? 41.101  -3.475  -5.968  1.00 49.22 ? 296 ARG A N   1 
ATOM   576  C CA  . ARG A 1 85  ? 40.390  -4.621  -6.587  1.00 48.79 ? 296 ARG A CA  1 
ATOM   577  C C   . ARG A 1 85  ? 39.432  -5.398  -5.655  1.00 47.63 ? 296 ARG A C   1 
ATOM   578  O O   . ARG A 1 85  ? 38.273  -5.608  -6.013  1.00 46.52 ? 296 ARG A O   1 
ATOM   579  C CB  . ARG A 1 85  ? 41.305  -5.603  -7.327  1.00 49.16 ? 296 ARG A CB  1 
ATOM   580  C CG  . ARG A 1 85  ? 40.492  -6.429  -8.360  1.00 50.71 ? 296 ARG A CG  1 
ATOM   581  C CD  . ARG A 1 85  ? 41.280  -7.518  -9.095  1.00 53.13 ? 296 ARG A CD  1 
ATOM   582  N NE  . ARG A 1 85  ? 40.403  -8.434  -9.847  1.00 54.01 ? 296 ARG A NE  1 
ATOM   583  C CZ  . ARG A 1 85  ? 40.836  -9.400  -10.664 1.00 55.80 ? 296 ARG A CZ  1 
ATOM   584  N NH1 . ARG A 1 85  ? 42.132  -9.593  -10.843 1.00 56.87 ? 296 ARG A NH1 1 
ATOM   585  N NH2 . ARG A 1 85  ? 39.977  -10.187 -11.310 1.00 56.81 ? 296 ARG A NH2 1 
ATOM   586  N N   . ALA A 1 86  ? 39.903  -5.840  -4.492  1.00 46.74 ? 297 ALA A N   1 
ATOM   587  C CA  . ALA A 1 86  ? 39.055  -6.689  -3.643  1.00 45.96 ? 297 ALA A CA  1 
ATOM   588  C C   . ALA A 1 86  ? 37.820  -5.870  -3.211  1.00 44.55 ? 297 ALA A C   1 
ATOM   589  O O   . ALA A 1 86  ? 36.701  -6.336  -3.349  1.00 42.38 ? 297 ALA A O   1 
ATOM   590  C CB  . ALA A 1 86  ? 39.839  -7.263  -2.440  1.00 45.73 ? 297 ALA A CB  1 
ATOM   591  N N   . LEU A 1 87  ? 38.067  -4.622  -2.805  1.00 44.56 ? 298 LEU A N   1 
ATOM   592  C CA  . LEU A 1 87  ? 37.044  -3.675  -2.393  1.00 44.12 ? 298 LEU A CA  1 
ATOM   593  C C   . LEU A 1 87  ? 36.036  -3.372  -3.486  1.00 44.17 ? 298 LEU A C   1 
ATOM   594  O O   . LEU A 1 87  ? 34.816  -3.549  -3.289  1.00 43.46 ? 298 LEU A O   1 
ATOM   595  C CB  . LEU A 1 87  ? 37.703  -2.366  -1.909  1.00 44.16 ? 298 LEU A CB  1 
ATOM   596  C CG  . LEU A 1 87  ? 36.764  -1.303  -1.317  1.00 43.86 ? 298 LEU A CG  1 
ATOM   597  C CD1 . LEU A 1 87  ? 35.710  -1.950  -0.397  1.00 43.01 ? 298 LEU A CD1 1 
ATOM   598  C CD2 . LEU A 1 87  ? 37.541  -0.226  -0.561  1.00 42.03 ? 298 LEU A CD2 1 
ATOM   599  N N   . MET A 1 88  ? 36.544  -2.871  -4.614  1.00 44.25 ? 299 MET A N   1 
ATOM   600  C CA  . MET A 1 88  ? 35.747  -2.609  -5.816  1.00 44.08 ? 299 MET A CA  1 
ATOM   601  C C   . MET A 1 88  ? 34.833  -3.818  -6.056  1.00 43.78 ? 299 MET A C   1 
ATOM   602  O O   . MET A 1 88  ? 33.600  -3.707  -5.976  1.00 41.75 ? 299 MET A O   1 
ATOM   603  C CB  . MET A 1 88  ? 36.711  -2.386  -6.998  1.00 45.39 ? 299 MET A CB  1 
ATOM   604  C CG  . MET A 1 88  ? 36.075  -2.355  -8.369  1.00 47.17 ? 299 MET A CG  1 
ATOM   605  S SD  . MET A 1 88  ? 37.214  -2.854  -9.686  1.00 52.54 ? 299 MET A SD  1 
ATOM   606  C CE  . MET A 1 88  ? 37.511  -4.601  -9.298  1.00 48.65 ? 299 MET A CE  1 
ATOM   607  N N   . GLU A 1 89  ? 35.444  -4.988  -6.281  1.00 44.10 ? 300 GLU A N   1 
ATOM   608  C CA  . GLU A 1 89  ? 34.670  -6.255  -6.422  1.00 45.39 ? 300 GLU A CA  1 
ATOM   609  C C   . GLU A 1 89  ? 33.549  -6.367  -5.351  1.00 44.56 ? 300 GLU A C   1 
ATOM   610  O O   . GLU A 1 89  ? 32.418  -6.720  -5.679  1.00 44.29 ? 300 GLU A O   1 
ATOM   611  C CB  . GLU A 1 89  ? 35.591  -7.501  -6.417  1.00 46.27 ? 300 GLU A CB  1 
ATOM   612  C CG  . GLU A 1 89  ? 36.231  -7.804  -7.795  1.00 48.80 ? 300 GLU A CG  1 
ATOM   613  C CD  . GLU A 1 89  ? 37.076  -9.093  -7.825  1.00 51.96 ? 300 GLU A CD  1 
ATOM   614  O OE1 . GLU A 1 89  ? 37.072  -9.857  -6.822  1.00 52.54 ? 300 GLU A OE1 1 
ATOM   615  O OE2 . GLU A 1 89  ? 37.762  -9.329  -8.855  1.00 53.67 ? 300 GLU A OE2 1 
ATOM   616  N N   . ALA A 1 90  ? 33.885  -5.992  -4.108  1.00 43.61 ? 301 ALA A N   1 
ATOM   617  C CA  . ALA A 1 90  ? 32.962  -5.892  -2.974  1.00 42.40 ? 301 ALA A CA  1 
ATOM   618  C C   . ALA A 1 90  ? 31.891  -4.760  -3.046  1.00 40.87 ? 301 ALA A C   1 
ATOM   619  O O   . ALA A 1 90  ? 30.712  -5.060  -3.034  1.00 41.12 ? 301 ALA A O   1 
ATOM   620  C CB  . ALA A 1 90  ? 33.789  -5.741  -1.673  1.00 42.34 ? 301 ALA A CB  1 
ATOM   621  N N   . CYS A 1 91  ? 32.300  -3.493  -3.087  1.00 39.61 ? 302 CYS A N   1 
ATOM   622  C CA  . CYS A 1 91  ? 31.369  -2.352  -3.063  1.00 39.04 ? 302 CYS A CA  1 
ATOM   623  C C   . CYS A 1 91  ? 30.392  -2.324  -4.248  1.00 39.55 ? 302 CYS A C   1 
ATOM   624  O O   . CYS A 1 91  ? 29.163  -2.259  -4.084  1.00 38.82 ? 302 CYS A O   1 
ATOM   625  C CB  . CYS A 1 91  ? 32.113  -1.022  -3.012  1.00 39.22 ? 302 CYS A CB  1 
ATOM   626  S SG  . CYS A 1 91  ? 32.495  -0.273  -1.348  1.00 38.05 ? 302 CYS A SG  1 
ATOM   627  N N   . ASN A 1 92  ? 30.939  -2.347  -5.455  1.00 39.91 ? 303 ASN A N   1 
ATOM   628  C CA  . ASN A 1 92  ? 30.109  -2.373  -6.659  1.00 39.73 ? 303 ASN A CA  1 
ATOM   629  C C   . ASN A 1 92  ? 29.240  -3.643  -6.662  1.00 38.13 ? 303 ASN A C   1 
ATOM   630  O O   . ASN A 1 92  ? 28.107  -3.610  -7.136  1.00 38.58 ? 303 ASN A O   1 
ATOM   631  C CB  . ASN A 1 92  ? 30.971  -2.252  -7.930  1.00 40.30 ? 303 ASN A CB  1 
ATOM   632  C CG  . ASN A 1 92  ? 32.027  -1.164  -7.812  1.00 43.59 ? 303 ASN A CG  1 
ATOM   633  O OD1 . ASN A 1 92  ? 32.703  -1.008  -6.758  1.00 48.22 ? 303 ASN A OD1 1 
ATOM   634  N ND2 . ASN A 1 92  ? 32.184  -0.386  -8.885  1.00 49.33 ? 303 ASN A ND2 1 
ATOM   635  N N   . GLU A 1 93  ? 29.729  -4.746  -6.100  1.00 35.91 ? 304 GLU A N   1 
ATOM   636  C CA  . GLU A 1 93  ? 28.871  -5.947  -5.976  1.00 34.57 ? 304 GLU A CA  1 
ATOM   637  C C   . GLU A 1 93  ? 27.722  -5.802  -4.950  1.00 31.61 ? 304 GLU A C   1 
ATOM   638  O O   . GLU A 1 93  ? 26.628  -6.294  -5.179  1.00 30.97 ? 304 GLU A O   1 
ATOM   639  C CB  . GLU A 1 93  ? 29.675  -7.163  -5.573  1.00 35.89 ? 304 GLU A CB  1 
ATOM   640  C CG  . GLU A 1 93  ? 28.818  -8.372  -5.146  1.00 38.62 ? 304 GLU A CG  1 
ATOM   641  C CD  . GLU A 1 93  ? 29.633  -9.365  -4.387  1.00 44.34 ? 304 GLU A CD  1 
ATOM   642  O OE1 . GLU A 1 93  ? 30.680  -9.781  -4.926  1.00 48.99 ? 304 GLU A OE1 1 
ATOM   643  O OE2 . GLU A 1 93  ? 29.251  -9.738  -3.253  1.00 47.11 ? 304 GLU A OE2 1 
ATOM   644  N N   . PHE A 1 94  ? 27.975  -5.152  -3.818  1.00 28.81 ? 305 PHE A N   1 
ATOM   645  C CA  . PHE A 1 94  ? 26.880  -4.832  -2.895  1.00 26.60 ? 305 PHE A CA  1 
ATOM   646  C C   . PHE A 1 94  ? 25.782  -4.121  -3.662  1.00 25.24 ? 305 PHE A C   1 
ATOM   647  O O   . PHE A 1 94  ? 24.619  -4.512  -3.608  1.00 23.41 ? 305 PHE A O   1 
ATOM   648  C CB  . PHE A 1 94  ? 27.352  -3.945  -1.761  1.00 25.84 ? 305 PHE A CB  1 
ATOM   649  C CG  . PHE A 1 94  ? 26.248  -3.491  -0.854  1.00 24.18 ? 305 PHE A CG  1 
ATOM   650  C CD1 . PHE A 1 94  ? 25.616  -4.385  -0.025  1.00 20.78 ? 305 PHE A CD1 1 
ATOM   651  C CD2 . PHE A 1 94  ? 25.866  -2.158  -0.808  1.00 23.25 ? 305 PHE A CD2 1 
ATOM   652  C CE1 . PHE A 1 94  ? 24.607  -3.970  0.825   1.00 20.45 ? 305 PHE A CE1 1 
ATOM   653  C CE2 . PHE A 1 94  ? 24.867  -1.737  0.042   1.00 21.90 ? 305 PHE A CE2 1 
ATOM   654  C CZ  . PHE A 1 94  ? 24.230  -2.659  0.868   1.00 20.37 ? 305 PHE A CZ  1 
ATOM   655  N N   . TYR A 1 95  ? 26.190  -3.099  -4.408  1.00 24.57 ? 306 TYR A N   1 
ATOM   656  C CA  . TYR A 1 95  ? 25.258  -2.218  -5.093  1.00 25.18 ? 306 TYR A CA  1 
ATOM   657  C C   . TYR A 1 95  ? 24.442  -2.936  -6.167  1.00 25.90 ? 306 TYR A C   1 
ATOM   658  O O   . TYR A 1 95  ? 23.271  -2.595  -6.385  1.00 25.69 ? 306 TYR A O   1 
ATOM   659  C CB  . TYR A 1 95  ? 25.983  -1.004  -5.683  1.00 25.20 ? 306 TYR A CB  1 
ATOM   660  C CG  . TYR A 1 95  ? 26.485  -0.019  -4.665  1.00 23.63 ? 306 TYR A CG  1 
ATOM   661  C CD1 . TYR A 1 95  ? 25.664  0.426   -3.628  1.00 22.57 ? 306 TYR A CD1 1 
ATOM   662  C CD2 . TYR A 1 95  ? 27.781  0.506   -4.744  1.00 24.94 ? 306 TYR A CD2 1 
ATOM   663  C CE1 . TYR A 1 95  ? 26.110  1.307   -2.689  1.00 21.89 ? 306 TYR A CE1 1 
ATOM   664  C CE2 . TYR A 1 95  ? 28.222  1.445   -3.815  1.00 21.83 ? 306 TYR A CE2 1 
ATOM   665  C CZ  . TYR A 1 95  ? 27.388  1.827   -2.790  1.00 22.61 ? 306 TYR A CZ  1 
ATOM   666  O OH  . TYR A 1 95  ? 27.774  2.744   -1.846  1.00 20.43 ? 306 TYR A OH  1 
ATOM   667  N N   . THR A 1 96  ? 25.051  -3.941  -6.794  1.00 26.42 ? 307 THR A N   1 
ATOM   668  C CA  . THR A 1 96  ? 24.379  -4.792  -7.765  1.00 27.22 ? 307 THR A CA  1 
ATOM   669  C C   . THR A 1 96  ? 23.277  -5.601  -7.065  1.00 27.40 ? 307 THR A C   1 
ATOM   670  O O   . THR A 1 96  ? 22.178  -5.750  -7.596  1.00 27.40 ? 307 THR A O   1 
ATOM   671  C CB  . THR A 1 96  ? 25.397  -5.731  -8.472  1.00 27.96 ? 307 THR A CB  1 
ATOM   672  O OG1 . THR A 1 96  ? 26.312  -4.935  -9.243  1.00 29.95 ? 307 THR A OG1 1 
ATOM   673  C CG2 . THR A 1 96  ? 24.715  -6.719  -9.375  1.00 26.15 ? 307 THR A CG2 1 
ATOM   674  N N   . ARG A 1 97  ? 23.570  -6.107  -5.869  1.00 27.40 ? 308 ARG A N   1 
ATOM   675  C CA  . ARG A 1 97  ? 22.588  -6.908  -5.099  1.00 27.31 ? 308 ARG A CA  1 
ATOM   676  C C   . ARG A 1 97  ? 21.505  -6.088  -4.396  1.00 25.01 ? 308 ARG A C   1 
ATOM   677  O O   . ARG A 1 97  ? 20.390  -6.526  -4.206  1.00 25.09 ? 308 ARG A O   1 
ATOM   678  C CB  . ARG A 1 97  ? 23.334  -7.773  -4.094  1.00 27.93 ? 308 ARG A CB  1 
ATOM   679  C CG  . ARG A 1 97  ? 24.021  -8.970  -4.783  1.00 30.75 ? 308 ARG A CG  1 
ATOM   680  C CD  . ARG A 1 97  ? 25.062  -9.554  -3.880  1.00 34.07 ? 308 ARG A CD  1 
ATOM   681  N NE  . ARG A 1 97  ? 25.716  -10.677 -4.517  1.00 36.48 ? 308 ARG A NE  1 
ATOM   682  C CZ  . ARG A 1 97  ? 26.440  -11.585 -3.877  1.00 38.51 ? 308 ARG A CZ  1 
ATOM   683  N NH1 . ARG A 1 97  ? 26.600  -11.523 -2.553  1.00 40.12 ? 308 ARG A NH1 1 
ATOM   684  N NH2 . ARG A 1 97  ? 27.003  -12.571 -4.563  1.00 38.19 ? 308 ARG A NH2 1 
ATOM   685  N N   . ILE A 1 98  ? 21.855  -4.889  -3.996  1.00 23.10 ? 309 ILE A N   1 
ATOM   686  C CA  . ILE A 1 98  ? 20.954  -4.036  -3.313  1.00 21.90 ? 309 ILE A CA  1 
ATOM   687  C C   . ILE A 1 98  ? 21.021  -2.729  -4.092  1.00 21.33 ? 309 ILE A C   1 
ATOM   688  O O   . ILE A 1 98  ? 21.759  -1.837  -3.729  1.00 19.92 ? 309 ILE A O   1 
ATOM   689  C CB  . ILE A 1 98  ? 21.379  -3.874  -1.846  1.00 20.83 ? 309 ILE A CB  1 
ATOM   690  C CG1 . ILE A 1 98  ? 21.466  -5.234  -1.122  1.00 22.24 ? 309 ILE A CG1 1 
ATOM   691  C CG2 . ILE A 1 98  ? 20.457  -2.872  -1.095  1.00 22.19 ? 309 ILE A CG2 1 
ATOM   692  C CD1 . ILE A 1 98  ? 20.320  -6.155  -1.194  1.00 17.91 ? 309 ILE A CD1 1 
ATOM   693  N N   . PRO A 1 99  ? 20.254  -2.636  -5.186  1.00 21.99 ? 310 PRO A N   1 
ATOM   694  C CA  . PRO A 1 99  ? 20.327  -1.484  -6.083  1.00 21.84 ? 310 PRO A CA  1 
ATOM   695  C C   . PRO A 1 99  ? 20.075  -0.161  -5.388  1.00 21.45 ? 310 PRO A C   1 
ATOM   696  O O   . PRO A 1 99  ? 19.098  -0.027  -4.619  1.00 20.01 ? 310 PRO A O   1 
ATOM   697  C CB  . PRO A 1 99  ? 19.226  -1.773  -7.096  1.00 23.44 ? 310 PRO A CB  1 
ATOM   698  C CG  . PRO A 1 99  ? 19.099  -3.305  -7.094  1.00 24.26 ? 310 PRO A CG  1 
ATOM   699  C CD  . PRO A 1 99  ? 19.227  -3.604  -5.629  1.00 22.09 ? 310 PRO A CD  1 
ATOM   700  N N   . HIS A 1 100 ? 20.966  0.797   -5.635  1.00 20.32 ? 311 HIS A N   1 
ATOM   701  C CA  . HIS A 1 100 ? 20.830  2.158   -5.139  1.00 20.12 ? 311 HIS A CA  1 
ATOM   702  C C   . HIS A 1 100 ? 20.597  3.098   -6.321  1.00 21.73 ? 311 HIS A C   1 
ATOM   703  O O   . HIS A 1 100 ? 20.926  2.769   -7.485  1.00 22.14 ? 311 HIS A O   1 
ATOM   704  C CB  . HIS A 1 100 ? 22.081  2.637   -4.382  1.00 19.56 ? 311 HIS A CB  1 
ATOM   705  C CG  . HIS A 1 100 ? 22.264  2.036   -3.015  1.00 19.78 ? 311 HIS A CG  1 
ATOM   706  N ND1 . HIS A 1 100 ? 22.174  0.676   -2.770  1.00 19.10 ? 311 HIS A ND1 1 
ATOM   707  C CD2 . HIS A 1 100 ? 22.557  2.613   -1.817  1.00 20.41 ? 311 HIS A CD2 1 
ATOM   708  C CE1 . HIS A 1 100 ? 22.430  0.446   -1.488  1.00 19.72 ? 311 HIS A CE1 1 
ATOM   709  N NE2 . HIS A 1 100 ? 22.660  1.602   -0.885  1.00 17.27 ? 311 HIS A NE2 1 
ATOM   710  N N   . ASP A 1 101 ? 20.061  4.277   -6.012  1.00 21.81 ? 312 ASP A N   1 
ATOM   711  C CA  . ASP A 1 101 ? 19.818  5.300   -7.022  1.00 22.62 ? 312 ASP A CA  1 
ATOM   712  C C   . ASP A 1 101 ? 20.707  6.467   -6.689  1.00 22.46 ? 312 ASP A C   1 
ATOM   713  O O   . ASP A 1 101 ? 20.316  7.307   -5.891  1.00 21.82 ? 312 ASP A O   1 
ATOM   714  C CB  . ASP A 1 101 ? 18.352  5.745   -7.034  1.00 23.06 ? 312 ASP A CB  1 
ATOM   715  C CG  . ASP A 1 101 ? 18.052  6.726   -8.198  1.00 26.96 ? 312 ASP A CG  1 
ATOM   716  O OD1 . ASP A 1 101 ? 19.003  7.309   -8.769  1.00 28.20 ? 312 ASP A OD1 1 
ATOM   717  O OD2 . ASP A 1 101 ? 16.875  6.919   -8.544  1.00 29.71 ? 312 ASP A OD2 1 
ATOM   718  N N   . PHE A 1 102 ? 21.903  6.507   -7.279  1.00 21.63 ? 313 PHE A N   1 
ATOM   719  C CA  . PHE A 1 102 ? 22.820  7.655   -7.106  1.00 22.02 ? 313 PHE A CA  1 
ATOM   720  C C   . PHE A 1 102 ? 22.732  8.674   -8.255  1.00 22.55 ? 313 PHE A C   1 
ATOM   721  O O   . PHE A 1 102 ? 23.562  9.558   -8.362  1.00 21.97 ? 313 PHE A O   1 
ATOM   722  C CB  . PHE A 1 102 ? 24.256  7.173   -6.925  1.00 22.10 ? 313 PHE A CB  1 
ATOM   723  C CG  . PHE A 1 102 ? 24.462  6.347   -5.664  1.00 22.13 ? 313 PHE A CG  1 
ATOM   724  C CD1 . PHE A 1 102 ? 24.319  6.932   -4.411  1.00 22.23 ? 313 PHE A CD1 1 
ATOM   725  C CD2 . PHE A 1 102 ? 24.786  5.006   -5.744  1.00 21.99 ? 313 PHE A CD2 1 
ATOM   726  C CE1 . PHE A 1 102 ? 24.496  6.197   -3.246  1.00 24.11 ? 313 PHE A CE1 1 
ATOM   727  C CE2 . PHE A 1 102 ? 24.986  4.237   -4.579  1.00 23.41 ? 313 PHE A CE2 1 
ATOM   728  C CZ  . PHE A 1 102 ? 24.830  4.836   -3.325  1.00 23.45 ? 313 PHE A CZ  1 
ATOM   729  N N   . GLY A 1 103 ? 21.693  8.566   -9.086  1.00 23.06 ? 314 GLY A N   1 
ATOM   730  C CA  . GLY A 1 103 ? 21.578  9.414   -10.262 1.00 24.16 ? 314 GLY A CA  1 
ATOM   731  C C   . GLY A 1 103 ? 22.846  9.303   -11.093 1.00 24.97 ? 314 GLY A C   1 
ATOM   732  O O   . GLY A 1 103 ? 23.331  8.209   -11.331 1.00 26.12 ? 314 GLY A O   1 
ATOM   733  N N   . LEU A 1 104 ? 23.422  10.438  -11.468 1.00 24.28 ? 315 LEU A N   1 
ATOM   734  C CA  . LEU A 1 104 ? 24.590  10.488  -12.332 1.00 24.49 ? 315 LEU A CA  1 
ATOM   735  C C   . LEU A 1 104 ? 25.924  10.485  -11.605 1.00 23.85 ? 315 LEU A C   1 
ATOM   736  O O   . LEU A 1 104 ? 26.966  10.544  -12.219 1.00 22.96 ? 315 LEU A O   1 
ATOM   737  C CB  . LEU A 1 104 ? 24.488  11.745  -13.191 1.00 25.03 ? 315 LEU A CB  1 
ATOM   738  C CG  . LEU A 1 104 ? 23.249  11.621  -14.055 1.00 26.07 ? 315 LEU A CG  1 
ATOM   739  C CD1 . LEU A 1 104 ? 22.733  12.973  -14.542 1.00 28.27 ? 315 LEU A CD1 1 
ATOM   740  C CD2 . LEU A 1 104 ? 23.632  10.675  -15.214 1.00 29.56 ? 315 LEU A CD2 1 
ATOM   741  N N   . ARG A 1 105 ? 25.876  10.410  -10.289 1.00 23.03 ? 316 ARG A N   1 
ATOM   742  C CA  . ARG A 1 105 ? 27.055  10.510  -9.439  1.00 23.20 ? 316 ARG A CA  1 
ATOM   743  C C   . ARG A 1 105 ? 27.799  9.152   -9.352  1.00 22.99 ? 316 ARG A C   1 
ATOM   744  O O   . ARG A 1 105 ? 27.152  8.080   -9.366  1.00 22.28 ? 316 ARG A O   1 
ATOM   745  C CB  . ARG A 1 105 ? 26.519  10.884  -8.067  1.00 23.30 ? 316 ARG A CB  1 
ATOM   746  C CG  . ARG A 1 105 ? 27.466  11.208  -7.007  1.00 25.64 ? 316 ARG A CG  1 
ATOM   747  C CD  . ARG A 1 105 ? 26.680  11.377  -5.696  1.00 28.10 ? 316 ARG A CD  1 
ATOM   748  N NE  . ARG A 1 105 ? 27.567  11.015  -4.617  1.00 32.13 ? 316 ARG A NE  1 
ATOM   749  C CZ  . ARG A 1 105 ? 27.203  10.434  -3.494  1.00 29.87 ? 316 ARG A CZ  1 
ATOM   750  N NH1 . ARG A 1 105 ? 25.930  10.162  -3.259  1.00 28.26 ? 316 ARG A NH1 1 
ATOM   751  N NH2 . ARG A 1 105 ? 28.141  10.166  -2.600  1.00 31.91 ? 316 ARG A NH2 1 
ATOM   752  N N   . THR A 1 106 ? 29.130  9.190   -9.259  1.00 22.81 ? 317 THR A N   1 
ATOM   753  C CA  . THR A 1 106 ? 29.918  7.970   -8.982  1.00 22.88 ? 317 THR A CA  1 
ATOM   754  C C   . THR A 1 106 ? 29.350  7.229   -7.731  1.00 23.10 ? 317 THR A C   1 
ATOM   755  O O   . THR A 1 106 ? 29.301  7.804   -6.637  1.00 22.13 ? 317 THR A O   1 
ATOM   756  C CB  . THR A 1 106 ? 31.387  8.279   -8.681  1.00 22.69 ? 317 THR A CB  1 
ATOM   757  O OG1 . THR A 1 106 ? 31.895  9.235   -9.622  1.00 22.59 ? 317 THR A OG1 1 
ATOM   758  C CG2 . THR A 1 106 ? 32.273  6.953   -8.672  1.00 21.20 ? 317 THR A CG2 1 
ATOM   759  N N   . PRO A 1 107 ? 28.946  5.950   -7.872  1.00 23.36 ? 318 PRO A N   1 
ATOM   760  C CA  . PRO A 1 107 ? 28.497  5.309   -6.624  1.00 24.31 ? 318 PRO A CA  1 
ATOM   761  C C   . PRO A 1 107 ? 29.599  5.343   -5.552  1.00 25.55 ? 318 PRO A C   1 
ATOM   762  O O   . PRO A 1 107 ? 30.739  4.955   -5.845  1.00 26.49 ? 318 PRO A O   1 
ATOM   763  C CB  . PRO A 1 107 ? 28.169  3.894   -7.065  1.00 24.79 ? 318 PRO A CB  1 
ATOM   764  C CG  . PRO A 1 107 ? 27.754  4.053   -8.560  1.00 23.28 ? 318 PRO A CG  1 
ATOM   765  C CD  . PRO A 1 107 ? 28.666  5.135   -9.064  1.00 23.44 ? 318 PRO A CD  1 
ATOM   766  N N   . PRO A 1 108 ? 29.293  5.861   -4.347  1.00 26.69 ? 319 PRO A N   1 
ATOM   767  C CA  . PRO A 1 108 ? 30.379  6.127   -3.407  1.00 28.45 ? 319 PRO A CA  1 
ATOM   768  C C   . PRO A 1 108 ? 30.874  4.869   -2.743  1.00 29.79 ? 319 PRO A C   1 
ATOM   769  O O   . PRO A 1 108 ? 30.145  3.885   -2.649  1.00 30.25 ? 319 PRO A O   1 
ATOM   770  C CB  . PRO A 1 108 ? 29.725  7.053   -2.372  1.00 28.58 ? 319 PRO A CB  1 
ATOM   771  C CG  . PRO A 1 108 ? 28.296  6.696   -2.405  1.00 26.64 ? 319 PRO A CG  1 
ATOM   772  C CD  . PRO A 1 108 ? 27.997  6.319   -3.815  1.00 26.66 ? 319 PRO A CD  1 
ATOM   773  N N   . LEU A 1 109 ? 32.127  4.889   -2.321  1.00 31.79 ? 320 LEU A N   1 
ATOM   774  C CA  . LEU A 1 109 ? 32.714  3.756   -1.607  1.00 32.72 ? 320 LEU A CA  1 
ATOM   775  C C   . LEU A 1 109 ? 32.102  3.706   -0.229  1.00 32.38 ? 320 LEU A C   1 
ATOM   776  O O   . LEU A 1 109 ? 31.634  4.733   0.309   1.00 33.34 ? 320 LEU A O   1 
ATOM   777  C CB  . LEU A 1 109 ? 34.251  3.882   -1.474  1.00 33.72 ? 320 LEU A CB  1 
ATOM   778  C CG  . LEU A 1 109 ? 35.157  3.443   -2.645  1.00 35.27 ? 320 LEU A CG  1 
ATOM   779  C CD1 . LEU A 1 109 ? 36.585  3.358   -2.117  1.00 39.04 ? 320 LEU A CD1 1 
ATOM   780  C CD2 . LEU A 1 109 ? 34.795  2.119   -3.276  1.00 35.54 ? 320 LEU A CD2 1 
ATOM   781  N N   . ILE A 1 110 ? 32.080  2.500   0.327   1.00 32.02 ? 321 ILE A N   1 
ATOM   782  C CA  . ILE A 1 110 ? 31.728  2.280   1.724   1.00 31.36 ? 321 ILE A CA  1 
ATOM   783  C C   . ILE A 1 110 ? 33.047  1.977   2.431   1.00 32.39 ? 321 ILE A C   1 
ATOM   784  O O   . ILE A 1 110 ? 33.709  0.973   2.146   1.00 31.60 ? 321 ILE A O   1 
ATOM   785  C CB  . ILE A 1 110 ? 30.729  1.129   1.848   1.00 30.45 ? 321 ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 110 ? 29.386  1.533   1.243   1.00 29.39 ? 321 ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 110 ? 30.581  0.729   3.293   1.00 30.75 ? 321 ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 110 ? 28.731  0.461   0.426   1.00 25.83 ? 321 ILE A CD1 1 
ATOM   789  N N   . ARG A 1 111 ? 33.482  2.882   3.294   1.00 34.32 ? 322 ARG A N   1 
ATOM   790  C CA  . ARG A 1 111 ? 34.795  2.711   3.890   1.00 36.56 ? 322 ARG A CA  1 
ATOM   791  C C   . ARG A 1 111 ? 34.905  3.006   5.376   1.00 36.24 ? 322 ARG A C   1 
ATOM   792  O O   . ARG A 1 111 ? 35.940  2.719   5.941   1.00 36.35 ? 322 ARG A O   1 
ATOM   793  C CB  . ARG A 1 111 ? 35.871  3.502   3.115   1.00 38.35 ? 322 ARG A CB  1 
ATOM   794  C CG  . ARG A 1 111 ? 35.646  5.000   3.070   1.00 42.84 ? 322 ARG A CG  1 
ATOM   795  C CD  . ARG A 1 111 ? 36.842  5.807   2.469   1.00 49.75 ? 322 ARG A CD  1 
ATOM   796  N NE  . ARG A 1 111 ? 37.441  5.252   1.226   1.00 54.79 ? 322 ARG A NE  1 
ATOM   797  C CZ  . ARG A 1 111 ? 38.201  5.948   0.355   1.00 58.84 ? 322 ARG A CZ  1 
ATOM   798  N NH1 . ARG A 1 111 ? 38.452  7.252   0.539   1.00 60.29 ? 322 ARG A NH1 1 
ATOM   799  N NH2 . ARG A 1 111 ? 38.708  5.349   -0.727  1.00 59.04 ? 322 ARG A NH2 1 
ATOM   800  N N   . THR A 1 112 ? 33.883  3.572   6.001   1.00 36.06 ? 323 THR A N   1 
ATOM   801  C CA  . THR A 1 112 ? 33.916  3.761   7.430   1.00 36.37 ? 323 THR A CA  1 
ATOM   802  C C   . THR A 1 112 ? 32.828  2.957   8.117   1.00 35.80 ? 323 THR A C   1 
ATOM   803  O O   . THR A 1 112 ? 31.840  2.533   7.500   1.00 35.64 ? 323 THR A O   1 
ATOM   804  C CB  . THR A 1 112 ? 33.744  5.238   7.873   1.00 36.49 ? 323 THR A CB  1 
ATOM   805  O OG1 . THR A 1 112 ? 32.407  5.674   7.623   1.00 37.85 ? 323 THR A OG1 1 
ATOM   806  C CG2 . THR A 1 112 ? 34.722  6.151   7.158   1.00 37.47 ? 323 THR A CG2 1 
ATOM   807  N N   . GLN A 1 113 ? 33.031  2.786   9.416   1.00 34.88 ? 324 GLN A N   1 
ATOM   808  C CA  . GLN A 1 113 ? 32.095  2.117   10.299  1.00 33.76 ? 324 GLN A CA  1 
ATOM   809  C C   . GLN A 1 113 ? 30.702  2.678   10.108  1.00 33.18 ? 324 GLN A C   1 
ATOM   810  O O   . GLN A 1 113 ? 29.726  1.936   9.983   1.00 32.83 ? 324 GLN A O   1 
ATOM   811  C CB  . GLN A 1 113 ? 32.546  2.325   11.746  1.00 33.87 ? 324 GLN A CB  1 
ATOM   812  C CG  . GLN A 1 113 ? 31.731  1.562   12.767  1.00 34.02 ? 324 GLN A CG  1 
ATOM   813  C CD  . GLN A 1 113 ? 30.413  2.228   13.061  1.00 32.90 ? 324 GLN A CD  1 
ATOM   814  O OE1 . GLN A 1 113 ? 30.281  3.430   12.852  1.00 35.55 ? 324 GLN A OE1 1 
ATOM   815  N NE2 . GLN A 1 113 ? 29.429  1.467   13.537  1.00 30.24 ? 324 GLN A NE2 1 
ATOM   816  N N   . LYS A 1 114 ? 30.603  3.996   10.059  1.00 32.55 ? 325 LYS A N   1 
ATOM   817  C CA  . LYS A 1 114 ? 29.317  4.612   9.937   1.00 32.34 ? 325 LYS A CA  1 
ATOM   818  C C   . LYS A 1 114 ? 28.674  4.396   8.552   1.00 30.42 ? 325 LYS A C   1 
ATOM   819  O O   . LYS A 1 114 ? 27.468  4.270   8.467   1.00 29.14 ? 325 LYS A O   1 
ATOM   820  C CB  . LYS A 1 114 ? 29.367  6.085   10.357  1.00 33.49 ? 325 LYS A CB  1 
ATOM   821  C CG  . LYS A 1 114 ? 29.408  7.089   9.242   1.00 37.02 ? 325 LYS A CG  1 
ATOM   822  C CD  . LYS A 1 114 ? 29.088  8.507   9.738   1.00 40.47 ? 325 LYS A CD  1 
ATOM   823  C CE  . LYS A 1 114 ? 28.581  9.373   8.578   1.00 42.54 ? 325 LYS A CE  1 
ATOM   824  N NZ  . LYS A 1 114 ? 29.161  8.933   7.246   1.00 42.59 ? 325 LYS A NZ  1 
ATOM   825  N N   . GLU A 1 115 ? 29.461  4.338   7.484   1.00 29.32 ? 326 GLU A N   1 
ATOM   826  C CA  . GLU A 1 115 ? 28.900  3.958   6.181   1.00 28.37 ? 326 GLU A CA  1 
ATOM   827  C C   . GLU A 1 115 ? 28.424  2.507   6.202   1.00 26.75 ? 326 GLU A C   1 
ATOM   828  O O   . GLU A 1 115 ? 27.327  2.211   5.686   1.00 25.50 ? 326 GLU A O   1 
ATOM   829  C CB  . GLU A 1 115 ? 29.890  4.213   5.047   1.00 29.21 ? 326 GLU A CB  1 
ATOM   830  C CG  . GLU A 1 115 ? 30.104  5.707   4.786   1.00 31.91 ? 326 GLU A CG  1 
ATOM   831  C CD  . GLU A 1 115 ? 31.368  6.028   3.992   1.00 35.03 ? 326 GLU A CD  1 
ATOM   832  O OE1 . GLU A 1 115 ? 32.117  5.110   3.576   1.00 36.57 ? 326 GLU A OE1 1 
ATOM   833  O OE2 . GLU A 1 115 ? 31.603  7.231   3.779   1.00 36.71 ? 326 GLU A OE2 1 
ATOM   834  N N   . LEU A 1 116 ? 29.210  1.614   6.814   1.00 24.51 ? 327 LEU A N   1 
ATOM   835  C CA  . LEU A 1 116 ? 28.752  0.243   7.011   1.00 24.01 ? 327 LEU A CA  1 
ATOM   836  C C   . LEU A 1 116 ? 27.432  0.204   7.826   1.00 22.92 ? 327 LEU A C   1 
ATOM   837  O O   . LEU A 1 116 ? 26.491  -0.477  7.445   1.00 22.85 ? 327 LEU A O   1 
ATOM   838  C CB  . LEU A 1 116 ? 29.800  -0.627  7.700   1.00 24.00 ? 327 LEU A CB  1 
ATOM   839  C CG  . LEU A 1 116 ? 30.933  -1.238  6.884   1.00 23.42 ? 327 LEU A CG  1 
ATOM   840  C CD1 . LEU A 1 116 ? 31.825  -2.020  7.832   1.00 24.53 ? 327 LEU A CD1 1 
ATOM   841  C CD2 . LEU A 1 116 ? 30.418  -2.131  5.773   1.00 23.45 ? 327 LEU A CD2 1 
ATOM   842  N N   . SER A 1 117 ? 27.383  0.925   8.941   1.00 21.12 ? 328 SER A N   1 
ATOM   843  C CA  . SER A 1 117 ? 26.169  1.068   9.727   1.00 20.23 ? 328 SER A CA  1 
ATOM   844  C C   . SER A 1 117 ? 24.950  1.520   8.905   1.00 19.35 ? 328 SER A C   1 
ATOM   845  O O   . SER A 1 117 ? 23.894  0.967   9.048   1.00 18.40 ? 328 SER A O   1 
ATOM   846  C CB  . SER A 1 117 ? 26.383  2.056   10.849  1.00 21.18 ? 328 SER A CB  1 
ATOM   847  O OG  . SER A 1 117 ? 25.158  2.289   11.522  1.00 20.81 ? 328 SER A OG  1 
ATOM   848  N N   . GLU A 1 118 ? 25.108  2.503   8.035   1.00 18.90 ? 329 GLU A N   1 
ATOM   849  C CA  . GLU A 1 118 ? 23.984  3.010   7.266   1.00 19.16 ? 329 GLU A CA  1 
ATOM   850  C C   . GLU A 1 118 ? 23.428  1.929   6.354   1.00 18.50 ? 329 GLU A C   1 
ATOM   851  O O   . GLU A 1 118 ? 22.197  1.795   6.246   1.00 16.37 ? 329 GLU A O   1 
ATOM   852  C CB  . GLU A 1 118 ? 24.381  4.230   6.465   1.00 20.05 ? 329 GLU A CB  1 
ATOM   853  C CG  . GLU A 1 118 ? 24.560  5.398   7.404   1.00 25.36 ? 329 GLU A CG  1 
ATOM   854  C CD  . GLU A 1 118 ? 25.436  6.500   6.876   1.00 30.37 ? 329 GLU A CD  1 
ATOM   855  O OE1 . GLU A 1 118 ? 26.024  6.393   5.752   1.00 33.98 ? 329 GLU A OE1 1 
ATOM   856  O OE2 . GLU A 1 118 ? 25.498  7.501   7.619   1.00 36.03 ? 329 GLU A OE2 1 
ATOM   857  N N   . LYS A 1 119 ? 24.322  1.115   5.782   1.00 16.91 ? 330 LYS A N   1 
ATOM   858  C CA  . LYS A 1 119 ? 23.904  0.015   4.916   1.00 17.64 ? 330 LYS A CA  1 
ATOM   859  C C   . LYS A 1 119 ? 23.187  -1.110  5.643   1.00 17.13 ? 330 LYS A C   1 
ATOM   860  O O   . LYS A 1 119 ? 22.262  -1.716  5.088   1.00 18.35 ? 330 LYS A O   1 
ATOM   861  C CB  . LYS A 1 119 ? 25.100  -0.536  4.122   1.00 17.96 ? 330 LYS A CB  1 
ATOM   862  C CG  . LYS A 1 119 ? 25.753  0.485   3.234   1.00 20.16 ? 330 LYS A CG  1 
ATOM   863  C CD  . LYS A 1 119 ? 24.845  1.053   2.159   1.00 22.54 ? 330 LYS A CD  1 
ATOM   864  C CE  . LYS A 1 119 ? 24.327  2.425   2.486   1.00 23.24 ? 330 LYS A CE  1 
ATOM   865  N NZ  . LYS A 1 119 ? 23.518  3.026   1.381   1.00 25.02 ? 330 LYS A NZ  1 
ATOM   866  N N   . ILE A 1 120 ? 23.621  -1.401  6.859   1.00 16.61 ? 331 ILE A N   1 
ATOM   867  C CA  . ILE A 1 120 ? 22.951  -2.323  7.741   1.00 16.92 ? 331 ILE A CA  1 
ATOM   868  C C   . ILE A 1 120 ? 21.534  -1.858  8.093   1.00 16.69 ? 331 ILE A C   1 
ATOM   869  O O   . ILE A 1 120 ? 20.599  -2.626  8.061   1.00 16.11 ? 331 ILE A O   1 
ATOM   870  C CB  . ILE A 1 120 ? 23.779  -2.547  9.036   1.00 16.94 ? 331 ILE A CB  1 
ATOM   871  C CG1 . ILE A 1 120 ? 24.949  -3.458  8.724   1.00 19.10 ? 331 ILE A CG1 1 
ATOM   872  C CG2 . ILE A 1 120 ? 22.957  -3.232  10.116  1.00 16.57 ? 331 ILE A CG2 1 
ATOM   873  C CD1 . ILE A 1 120 ? 26.001  -3.533  9.796   1.00 20.53 ? 331 ILE A CD1 1 
ATOM   874  N N   . GLN A 1 121 ? 21.381  -0.594  8.419   1.00 17.05 ? 332 GLN A N   1 
ATOM   875  C CA  . GLN A 1 121 ? 20.073  -0.040  8.727   1.00 16.41 ? 332 GLN A CA  1 
ATOM   876  C C   . GLN A 1 121 ? 19.171  -0.161  7.513   1.00 16.13 ? 332 GLN A C   1 
ATOM   877  O O   . GLN A 1 121 ? 17.975  -0.435  7.645   1.00 15.81 ? 332 GLN A O   1 
ATOM   878  C CB  . GLN A 1 121 ? 20.179  1.416   9.086   1.00 16.46 ? 332 GLN A CB  1 
ATOM   879  C CG  . GLN A 1 121 ? 20.878  1.723   10.392  1.00 20.36 ? 332 GLN A CG  1 
ATOM   880  C CD  . GLN A 1 121 ? 21.267  3.194   10.458  1.00 23.85 ? 332 GLN A CD  1 
ATOM   881  O OE1 . GLN A 1 121 ? 20.514  4.068   10.006  1.00 24.92 ? 332 GLN A OE1 1 
ATOM   882  N NE2 . GLN A 1 121 ? 22.487  3.465   10.934  1.00 29.53 ? 332 GLN A NE2 1 
ATOM   883  N N   . LEU A 1 122 ? 19.737  0.056   6.328   1.00 15.10 ? 333 LEU A N   1 
ATOM   884  C CA  . LEU A 1 122 ? 18.981  -0.143  5.090   1.00 15.10 ? 333 LEU A CA  1 
ATOM   885  C C   . LEU A 1 122 ? 18.547  -1.622  4.958   1.00 14.45 ? 333 LEU A C   1 
ATOM   886  O O   . LEU A 1 122 ? 17.402  -1.907  4.572   1.00 13.19 ? 333 LEU A O   1 
ATOM   887  C CB  . LEU A 1 122 ? 19.832  0.252   3.873   1.00 16.02 ? 333 LEU A CB  1 
ATOM   888  C CG  . LEU A 1 122 ? 19.318  -0.115  2.473   1.00 17.46 ? 333 LEU A CG  1 
ATOM   889  C CD1 . LEU A 1 122 ? 17.933  0.387   2.327   1.00 20.79 ? 333 LEU A CD1 1 
ATOM   890  C CD2 . LEU A 1 122 ? 20.218  0.601   1.492   1.00 25.10 ? 333 LEU A CD2 1 
ATOM   891  N N   . LEU A 1 123 ? 19.465  -2.554  5.225   1.00 13.71 ? 334 LEU A N   1 
ATOM   892  C CA  . LEU A 1 123 ? 19.124  -3.976  5.036   1.00 15.40 ? 334 LEU A CA  1 
ATOM   893  C C   . LEU A 1 123 ? 18.135  -4.454  6.119   1.00 15.37 ? 334 LEU A C   1 
ATOM   894  O O   . LEU A 1 123 ? 17.270  -5.267  5.824   1.00 16.15 ? 334 LEU A O   1 
ATOM   895  C CB  . LEU A 1 123 ? 20.345  -4.876  5.038   1.00 14.88 ? 334 LEU A CB  1 
ATOM   896  C CG  . LEU A 1 123 ? 21.375  -4.791  3.903   1.00 17.95 ? 334 LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 123 ? 22.447  -5.858  4.128   1.00 19.70 ? 334 LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 123 ? 20.782  -5.008  2.588   1.00 20.51 ? 334 LEU A CD2 1 
ATOM   899  N N   . GLU A 1 124 ? 18.280  -3.981  7.358   1.00 14.90 ? 335 GLU A N   1 
ATOM   900  C CA  . GLU A 1 124 ? 17.298  -4.329  8.399   1.00 15.60 ? 335 GLU A CA  1 
ATOM   901  C C   . GLU A 1 124 ? 15.915  -3.810  8.040   1.00 15.83 ? 335 GLU A C   1 
ATOM   902  O O   . GLU A 1 124 ? 14.932  -4.537  8.164   1.00 16.85 ? 335 GLU A O   1 
ATOM   903  C CB  . GLU A 1 124 ? 17.786  -3.852  9.767   1.00 15.27 ? 335 GLU A CB  1 
ATOM   904  C CG  . GLU A 1 124 ? 18.996  -4.688  10.159  1.00 15.30 ? 335 GLU A CG  1 
ATOM   905  C CD  . GLU A 1 124 ? 19.663  -4.312  11.446  1.00 17.83 ? 335 GLU A CD  1 
ATOM   906  O OE1 . GLU A 1 124 ? 19.395  -3.198  11.981  1.00 19.06 ? 335 GLU A OE1 1 
ATOM   907  O OE2 . GLU A 1 124 ? 20.438  -5.186  11.928  1.00 15.69 ? 335 GLU A OE2 1 
ATOM   908  N N   . ALA A 1 125 ? 15.847  -2.602  7.488   1.00 15.37 ? 336 ALA A N   1 
ATOM   909  C CA  . ALA A 1 125 ? 14.590  -2.039  7.056   1.00 14.48 ? 336 ALA A CA  1 
ATOM   910  C C   . ALA A 1 125 ? 13.942  -2.835  5.930   1.00 15.55 ? 336 ALA A C   1 
ATOM   911  O O   . ALA A 1 125 ? 12.712  -3.106  5.949   1.00 14.77 ? 336 ALA A O   1 
ATOM   912  C CB  . ALA A 1 125 ? 14.791  -0.598  6.635   1.00 15.07 ? 336 ALA A CB  1 
ATOM   913  N N   . LEU A 1 126 ? 14.753  -3.209  4.937   1.00 15.06 ? 337 LEU A N   1 
ATOM   914  C CA  . LEU A 1 126 ? 14.283  -4.028  3.857   1.00 15.26 ? 337 LEU A CA  1 
ATOM   915  C C   . LEU A 1 126 ? 13.710  -5.349  4.394   1.00 15.60 ? 337 LEU A C   1 
ATOM   916  O O   . LEU A 1 126 ? 12.703  -5.828  3.890   1.00 15.23 ? 337 LEU A O   1 
ATOM   917  C CB  . LEU A 1 126 ? 15.399  -4.308  2.835   1.00 15.15 ? 337 LEU A CB  1 
ATOM   918  C CG  . LEU A 1 126 ? 15.883  -3.126  1.963   1.00 16.60 ? 337 LEU A CG  1 
ATOM   919  C CD1 . LEU A 1 126 ? 17.052  -3.583  1.089   1.00 15.03 ? 337 LEU A CD1 1 
ATOM   920  C CD2 . LEU A 1 126 ? 14.733  -2.632  1.071   1.00 16.98 ? 337 LEU A CD2 1 
ATOM   921  N N   . GLY A 1 127 ? 14.392  -5.927  5.370   1.00 15.45 ? 338 GLY A N   1 
ATOM   922  C CA  . GLY A 1 127 ? 13.995  -7.169  5.977   1.00 16.98 ? 338 GLY A CA  1 
ATOM   923  C C   . GLY A 1 127 ? 12.608  -7.019  6.598   1.00 17.68 ? 338 GLY A C   1 
ATOM   924  O O   . GLY A 1 127 ? 11.756  -7.880  6.436   1.00 18.19 ? 338 GLY A O   1 
ATOM   925  N N   . ASP A 1 128 ? 12.385  -5.911  7.270   1.00 17.08 ? 339 ASP A N   1 
ATOM   926  C CA  . ASP A 1 128 ? 11.097  -5.653  7.910   1.00 17.56 ? 339 ASP A CA  1 
ATOM   927  C C   . ASP A 1 128 ? 9.995   -5.302  6.921   1.00 17.37 ? 339 ASP A C   1 
ATOM   928  O O   . ASP A 1 128 ? 8.818   -5.607  7.145   1.00 17.28 ? 339 ASP A O   1 
ATOM   929  C CB  . ASP A 1 128 ? 11.268  -4.539  8.941   1.00 16.96 ? 339 ASP A CB  1 
ATOM   930  C CG  . ASP A 1 128 ? 11.920  -5.031  10.222  1.00 20.81 ? 339 ASP A CG  1 
ATOM   931  O OD1 . ASP A 1 128 ? 11.889  -6.250  10.510  1.00 22.53 ? 339 ASP A OD1 1 
ATOM   932  O OD2 . ASP A 1 128 ? 12.472  -4.198  10.959  1.00 24.61 ? 339 ASP A OD2 1 
ATOM   933  N N   . ILE A 1 129 ? 10.355  -4.639  5.831   1.00 17.03 ? 340 ILE A N   1 
ATOM   934  C CA  . ILE A 1 129 ? 9.395   -4.387  4.771   1.00 16.84 ? 340 ILE A CA  1 
ATOM   935  C C   . ILE A 1 129 ? 8.972   -5.712  4.082   1.00 18.37 ? 340 ILE A C   1 
ATOM   936  O O   . ILE A 1 129 ? 7.796   -5.902  3.732   1.00 17.06 ? 340 ILE A O   1 
ATOM   937  C CB  . ILE A 1 129 ? 9.934   -3.380  3.766   1.00 16.30 ? 340 ILE A CB  1 
ATOM   938  C CG1 . ILE A 1 129 ? 10.020  -1.996  4.414   1.00 16.40 ? 340 ILE A CG1 1 
ATOM   939  C CG2 . ILE A 1 129 ? 9.009   -3.285  2.553   1.00 18.35 ? 340 ILE A CG2 1 
ATOM   940  C CD1 . ILE A 1 129 ? 10.891  -0.959  3.615   1.00 13.19 ? 340 ILE A CD1 1 
ATOM   941  N N   . GLU A 1 130 ? 9.928   -6.618  3.911   1.00 18.73 ? 341 GLU A N   1 
ATOM   942  C CA  . GLU A 1 130 ? 9.666   -7.916  3.311   1.00 20.70 ? 341 GLU A CA  1 
ATOM   943  C C   . GLU A 1 130 ? 8.649   -8.684  4.173   1.00 21.28 ? 341 GLU A C   1 
ATOM   944  O O   . GLU A 1 130 ? 7.720   -9.310  3.654   1.00 21.36 ? 341 GLU A O   1 
ATOM   945  C CB  . GLU A 1 130 ? 10.972  -8.709  3.157   1.00 20.51 ? 341 GLU A CB  1 
ATOM   946  C CG  . GLU A 1 130 ? 10.805  -10.080 2.391   1.00 24.98 ? 341 GLU A CG  1 
ATOM   947  C CD  . GLU A 1 130 ? 10.257  -11.230 3.233   1.00 26.47 ? 341 GLU A CD  1 
ATOM   948  O OE1 . GLU A 1 130 ? 10.373  -11.181 4.470   1.00 27.20 ? 341 GLU A OE1 1 
ATOM   949  O OE2 . GLU A 1 130 ? 9.732   -12.199 2.641   1.00 27.84 ? 341 GLU A OE2 1 
ATOM   950  N N   . ILE A 1 131 ? 8.833   -8.616  5.486   1.00 21.45 ? 342 ILE A N   1 
ATOM   951  C CA  . ILE A 1 131 ? 7.841   -9.116  6.446   1.00 21.66 ? 342 ILE A CA  1 
ATOM   952  C C   . ILE A 1 131 ? 6.506   -8.378  6.316   1.00 21.11 ? 342 ILE A C   1 
ATOM   953  O O   . ILE A 1 131 ? 5.450   -9.014  6.220   1.00 21.42 ? 342 ILE A O   1 
ATOM   954  C CB  . ILE A 1 131 ? 8.368   -9.030  7.915   1.00 21.10 ? 342 ILE A CB  1 
ATOM   955  C CG1 . ILE A 1 131 ? 9.506   -10.055 8.126   1.00 20.52 ? 342 ILE A CG1 1 
ATOM   956  C CG2 . ILE A 1 131 ? 7.238   -9.338  8.945   1.00 21.68 ? 342 ILE A CG2 1 
ATOM   957  C CD1 . ILE A 1 131 ? 10.409  -9.767  9.412   1.00 17.27 ? 342 ILE A CD1 1 
ATOM   958  N N   . ALA A 1 132 ? 6.558   -7.050  6.294   1.00 20.70 ? 343 ALA A N   1 
ATOM   959  C CA  . ALA A 1 132 ? 5.363   -6.233  6.180   1.00 20.84 ? 343 ALA A CA  1 
ATOM   960  C C   . ALA A 1 132 ? 4.505   -6.548  4.939   1.00 22.25 ? 343 ALA A C   1 
ATOM   961  O O   . ALA A 1 132 ? 3.289   -6.721  5.060   1.00 21.47 ? 343 ALA A O   1 
ATOM   962  C CB  . ALA A 1 132 ? 5.690   -4.750  6.233   1.00 19.17 ? 343 ALA A CB  1 
ATOM   963  N N   . ILE A 1 133 ? 5.128   -6.632  3.763   1.00 22.58 ? 344 ILE A N   1 
ATOM   964  C CA  . ILE A 1 133 ? 4.382   -6.779  2.526   1.00 23.73 ? 344 ILE A CA  1 
ATOM   965  C C   . ILE A 1 133 ? 3.644   -8.125  2.480   1.00 24.65 ? 344 ILE A C   1 
ATOM   966  O O   . ILE A 1 133 ? 2.534   -8.209  1.935   1.00 24.70 ? 344 ILE A O   1 
ATOM   967  C CB  . ILE A 1 133 ? 5.304   -6.568  1.273   1.00 24.92 ? 344 ILE A CB  1 
ATOM   968  C CG1 . ILE A 1 133 ? 5.640   -5.086  1.142   1.00 24.45 ? 344 ILE A CG1 1 
ATOM   969  C CG2 . ILE A 1 133 ? 4.597   -7.063  -0.018  1.00 25.85 ? 344 ILE A CG2 1 
ATOM   970  C CD1 . ILE A 1 133 ? 6.580   -4.745  0.017   1.00 26.89 ? 344 ILE A CD1 1 
ATOM   971  N N   . LYS A 1 134 ? 4.268   -9.156  3.059   1.00 24.80 ? 345 LYS A N   1 
ATOM   972  C CA  . LYS A 1 134 ? 3.665   -10.470 3.236   1.00 25.89 ? 345 LYS A CA  1 
ATOM   973  C C   . LYS A 1 134 ? 2.514   -10.405 4.234   1.00 25.57 ? 345 LYS A C   1 
ATOM   974  O O   . LYS A 1 134 ? 1.508   -11.045 4.047   1.00 25.44 ? 345 LYS A O   1 
ATOM   975  C CB  . LYS A 1 134 ? 4.680   -11.461 3.821   1.00 26.47 ? 345 LYS A CB  1 
ATOM   976  C CG  . LYS A 1 134 ? 5.240   -12.491 2.871   1.00 31.43 ? 345 LYS A CG  1 
ATOM   977  C CD  . LYS A 1 134 ? 6.292   -13.353 3.575   1.00 33.98 ? 345 LYS A CD  1 
ATOM   978  C CE  . LYS A 1 134 ? 6.916   -14.357 2.636   1.00 36.61 ? 345 LYS A CE  1 
ATOM   979  N NZ  . LYS A 1 134 ? 8.393   -14.105 2.443   1.00 39.52 ? 345 LYS A NZ  1 
ATOM   980  N N   . LEU A 1 135 ? 2.721   -9.675  5.330   1.00 25.31 ? 346 LEU A N   1 
ATOM   981  C CA  . LEU A 1 135 ? 1.766   -9.627  6.435   1.00 25.46 ? 346 LEU A CA  1 
ATOM   982  C C   . LEU A 1 135 ? 0.482   -8.971  6.005   1.00 25.36 ? 346 LEU A C   1 
ATOM   983  O O   . LEU A 1 135 ? -0.571  -9.419  6.386   1.00 26.04 ? 346 LEU A O   1 
ATOM   984  C CB  . LEU A 1 135 ? 2.350   -8.869  7.615   1.00 25.28 ? 346 LEU A CB  1 
ATOM   985  C CG  . LEU A 1 135 ? 1.587   -8.875  8.940   1.00 25.91 ? 346 LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 135 ? 2.648   -9.082  10.047  1.00 24.62 ? 346 LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 135 ? 0.781   -7.580  9.136   1.00 24.23 ? 346 LEU A CD2 1 
ATOM   988  N N   . VAL A 1 136 ? 0.571   -7.919  5.204   1.00 25.94 ? 347 VAL A N   1 
ATOM   989  C CA  . VAL A 1 136 ? -0.620  -7.146  4.787   1.00 26.54 ? 347 VAL A CA  1 
ATOM   990  C C   . VAL A 1 136 ? -1.380  -7.737  3.591   1.00 27.82 ? 347 VAL A C   1 
ATOM   991  O O   . VAL A 1 136 ? -2.397  -7.182  3.174   1.00 28.04 ? 347 VAL A O   1 
ATOM   992  C CB  . VAL A 1 136 ? -0.264  -5.682  4.503   1.00 26.75 ? 347 VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 136 ? 0.338   -5.064  5.759   1.00 23.98 ? 347 VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 136 ? 0.691   -5.558  3.302   1.00 26.74 ? 347 VAL A CG2 1 
ATOM   995  N N   . LYS A 1 137 ? -0.898  -8.855  3.052   1.00 28.72 ? 348 LYS A N   1 
ATOM   996  C CA  . LYS A 1 137 ? -1.663  -9.614  2.060   1.00 31.13 ? 348 LYS A CA  1 
ATOM   997  C C   . LYS A 1 137 ? -3.024  -10.008 2.636   1.00 31.04 ? 348 LYS A C   1 
ATOM   998  O O   . LYS A 1 137 ? -3.103  -10.563 3.710   1.00 29.78 ? 348 LYS A O   1 
ATOM   999  C CB  . LYS A 1 137 ? -0.923  -10.880 1.657   1.00 31.91 ? 348 LYS A CB  1 
ATOM   1000 C CG  . LYS A 1 137 ? 0.315   -10.590 0.815   1.00 36.86 ? 348 LYS A CG  1 
ATOM   1001 C CD  . LYS A 1 137 ? 0.909   -11.897 0.247   1.00 42.86 ? 348 LYS A CD  1 
ATOM   1002 C CE  . LYS A 1 137 ? 2.205   -11.647 -0.529  1.00 45.73 ? 348 LYS A CE  1 
ATOM   1003 N NZ  . LYS A 1 137 ? 2.767   -12.968 -0.945  1.00 48.01 ? 348 LYS A NZ  1 
ATOM   1004 N N   . THR A 1 138 ? -4.076  -9.691  1.910   1.00 31.98 ? 349 THR A N   1 
ATOM   1005 C CA  . THR A 1 138 ? -5.412  -9.957  2.357   1.00 33.30 ? 349 THR A CA  1 
ATOM   1006 C C   . THR A 1 138 ? -6.076  -10.992 1.461   1.00 34.52 ? 349 THR A C   1 
ATOM   1007 O O   . THR A 1 138 ? -5.719  -11.158 0.297   1.00 34.17 ? 349 THR A O   1 
ATOM   1008 C CB  . THR A 1 138 ? -6.231  -8.678  2.314   1.00 33.24 ? 349 THR A CB  1 
ATOM   1009 O OG1 . THR A 1 138 ? -6.342  -8.257  0.957   1.00 34.50 ? 349 THR A OG1 1 
ATOM   1010 C CG2 . THR A 1 138 ? -5.540  -7.566  3.111   1.00 32.66 ? 349 THR A CG2 1 
ATOM   1011 N N   . GLU A 1 139 ? -7.056  -11.687 2.013   1.00 35.88 ? 350 GLU A N   1 
ATOM   1012 C CA  . GLU A 1 139 ? -7.915  -12.523 1.205   1.00 37.57 ? 350 GLU A CA  1 
ATOM   1013 C C   . GLU A 1 139 ? -9.010  -11.618 0.632   1.00 38.23 ? 350 GLU A C   1 
ATOM   1014 O O   . GLU A 1 139 ? -9.832  -11.108 1.373   1.00 38.79 ? 350 GLU A O   1 
ATOM   1015 C CB  . GLU A 1 139 ? -8.574  -13.580 2.075   1.00 38.33 ? 350 GLU A CB  1 
ATOM   1016 C CG  . GLU A 1 139 ? -7.927  -14.922 2.132   1.00 38.93 ? 350 GLU A CG  1 
ATOM   1017 C CD  . GLU A 1 139 ? -8.538  -15.773 3.264   1.00 39.58 ? 350 GLU A CD  1 
ATOM   1018 O OE1 . GLU A 1 139 ? -9.752  -15.673 3.535   1.00 39.83 ? 350 GLU A OE1 1 
ATOM   1019 O OE2 . GLU A 1 139 ? -7.792  -16.532 3.890   1.00 41.19 ? 350 GLU A OE2 1 
ATOM   1020 N N   . LEU A 1 140 ? -9.029  -11.414 -0.668  1.00 38.74 ? 351 LEU A N   1 
ATOM   1021 C CA  . LEU A 1 140 ? -10.083 -10.595 -1.302  1.00 39.85 ? 351 LEU A CA  1 
ATOM   1022 C C   . LEU A 1 140 ? -11.487 -10.907 -0.750  1.00 38.83 ? 351 LEU A C   1 
ATOM   1023 O O   . LEU A 1 140 ? -12.234 -10.010 -0.366  1.00 38.74 ? 351 LEU A O   1 
ATOM   1024 C CB  . LEU A 1 140 ? -10.070 -10.838 -2.825  1.00 40.88 ? 351 LEU A CB  1 
ATOM   1025 C CG  . LEU A 1 140 ? -10.425 -9.730  -3.844  1.00 44.17 ? 351 LEU A CG  1 
ATOM   1026 C CD1 . LEU A 1 140 ? -9.762  -10.042 -5.210  1.00 46.38 ? 351 LEU A CD1 1 
ATOM   1027 C CD2 . LEU A 1 140 ? -11.924 -9.538  -4.053  1.00 47.04 ? 351 LEU A CD2 1 
ATOM   1028 N N   . GLN A 1 141 ? -11.843 -12.189 -0.721  1.00 37.84 ? 352 GLN A N   1 
ATOM   1029 C CA  . GLN A 1 141 ? -13.210 -12.586 -0.377  1.00 37.38 ? 352 GLN A CA  1 
ATOM   1030 C C   . GLN A 1 141 ? -13.486 -12.785 1.101   1.00 35.10 ? 352 GLN A C   1 
ATOM   1031 O O   . GLN A 1 141 ? -14.579 -13.167 1.447   1.00 34.11 ? 352 GLN A O   1 
ATOM   1032 C CB  . GLN A 1 141 ? -13.622 -13.846 -1.156  1.00 38.68 ? 352 GLN A CB  1 
ATOM   1033 C CG  . GLN A 1 141 ? -13.632 -13.649 -2.654  1.00 41.25 ? 352 GLN A CG  1 
ATOM   1034 C CD  . GLN A 1 141 ? -14.612 -12.560 -3.105  1.00 45.17 ? 352 GLN A CD  1 
ATOM   1035 O OE1 . GLN A 1 141 ? -14.210 -11.408 -3.356  1.00 47.94 ? 352 GLN A OE1 1 
ATOM   1036 N NE2 . GLN A 1 141 ? -15.903 -12.917 -3.207  1.00 45.00 ? 352 GLN A NE2 1 
ATOM   1037 N N   . SER A 1 142 ? -12.535 -12.498 1.983   1.00 32.95 ? 353 SER A N   1 
ATOM   1038 C CA  . SER A 1 142 ? -12.780 -12.734 3.394   1.00 31.95 ? 353 SER A CA  1 
ATOM   1039 C C   . SER A 1 142 ? -13.827 -11.770 3.963   1.00 31.27 ? 353 SER A C   1 
ATOM   1040 O O   . SER A 1 142 ? -13.881 -10.604 3.597   1.00 30.24 ? 353 SER A O   1 
ATOM   1041 C CB  . SER A 1 142 ? -11.511 -12.599 4.216   1.00 31.54 ? 353 SER A CB  1 
ATOM   1042 O OG  . SER A 1 142 ? -11.845 -12.632 5.580   1.00 31.29 ? 353 SER A OG  1 
ATOM   1043 N N   . PRO A 1 143 ? -14.632 -12.246 4.907   1.00 31.32 ? 354 PRO A N   1 
ATOM   1044 C CA  . PRO A 1 143 ? -15.542 -11.271 5.516   1.00 31.41 ? 354 PRO A CA  1 
ATOM   1045 C C   . PRO A 1 143 ? -14.835 -10.358 6.545   1.00 30.48 ? 354 PRO A C   1 
ATOM   1046 O O   . PRO A 1 143 ? -15.409 -9.373  6.993   1.00 30.03 ? 354 PRO A O   1 
ATOM   1047 C CB  . PRO A 1 143 ? -16.627 -12.143 6.155   1.00 32.04 ? 354 PRO A CB  1 
ATOM   1048 C CG  . PRO A 1 143 ? -15.957 -13.518 6.398   1.00 32.49 ? 354 PRO A CG  1 
ATOM   1049 C CD  . PRO A 1 143 ? -14.835 -13.625 5.378   1.00 32.10 ? 354 PRO A CD  1 
ATOM   1050 N N   . GLU A 1 144 ? -13.605 -10.686 6.923   1.00 30.32 ? 355 GLU A N   1 
ATOM   1051 C CA  . GLU A 1 144 ? -12.846 -9.859  7.866   1.00 30.10 ? 355 GLU A CA  1 
ATOM   1052 C C   . GLU A 1 144 ? -12.374 -8.552  7.248   1.00 28.46 ? 355 GLU A C   1 
ATOM   1053 O O   . GLU A 1 144 ? -11.749 -8.562  6.183   1.00 28.17 ? 355 GLU A O   1 
ATOM   1054 C CB  . GLU A 1 144 ? -11.579 -10.592 8.311   1.00 31.03 ? 355 GLU A CB  1 
ATOM   1055 C CG  . GLU A 1 144 ? -11.713 -11.598 9.421   1.00 36.13 ? 355 GLU A CG  1 
ATOM   1056 C CD  . GLU A 1 144 ? -10.329 -11.973 9.955   1.00 40.90 ? 355 GLU A CD  1 
ATOM   1057 O OE1 . GLU A 1 144 ? -10.033 -11.673 11.120  1.00 46.12 ? 355 GLU A OE1 1 
ATOM   1058 O OE2 . GLU A 1 144 ? -9.501  -12.527 9.198   1.00 43.44 ? 355 GLU A OE2 1 
ATOM   1059 N N   . HIS A 1 145 ? -12.581 -7.437  7.941   1.00 26.69 ? 356 HIS A N   1 
ATOM   1060 C CA  . HIS A 1 145 ? -11.953 -6.175  7.547   1.00 25.79 ? 356 HIS A CA  1 
ATOM   1061 C C   . HIS A 1 145 ? -10.416 -6.360  7.367   1.00 24.87 ? 356 HIS A C   1 
ATOM   1062 O O   . HIS A 1 145 ? -9.777  -7.057  8.172   1.00 24.04 ? 356 HIS A O   1 
ATOM   1063 C CB  . HIS A 1 145 ? -12.247 -5.070  8.579   1.00 25.18 ? 356 HIS A CB  1 
ATOM   1064 C CG  . HIS A 1 145 ? -11.951 -3.699  8.070   1.00 24.52 ? 356 HIS A CG  1 
ATOM   1065 N ND1 . HIS A 1 145 ? -10.663 -3.261  7.828   1.00 22.07 ? 356 HIS A ND1 1 
ATOM   1066 C CD2 . HIS A 1 145 ? -12.773 -2.677  7.720   1.00 21.92 ? 356 HIS A CD2 1 
ATOM   1067 C CE1 . HIS A 1 145 ? -10.705 -2.028  7.346   1.00 22.66 ? 356 HIS A CE1 1 
ATOM   1068 N NE2 . HIS A 1 145 ? -11.972 -1.646  7.285   1.00 24.45 ? 356 HIS A NE2 1 
ATOM   1069 N N   . PRO A 1 146 ? -9.830  -5.781  6.306   1.00 24.37 ? 357 PRO A N   1 
ATOM   1070 C CA  . PRO A 1 146 ? -8.378  -5.849  6.119   1.00 24.83 ? 357 PRO A CA  1 
ATOM   1071 C C   . PRO A 1 146 ? -7.550  -5.531  7.363   1.00 24.28 ? 357 PRO A C   1 
ATOM   1072 O O   . PRO A 1 146 ? -6.617  -6.261  7.709   1.00 24.60 ? 357 PRO A O   1 
ATOM   1073 C CB  . PRO A 1 146 ? -8.127  -4.801  5.025   1.00 24.52 ? 357 PRO A CB  1 
ATOM   1074 C CG  . PRO A 1 146 ? -9.347  -4.974  4.138   1.00 24.76 ? 357 PRO A CG  1 
ATOM   1075 C CD  . PRO A 1 146 ? -10.487 -5.223  5.113   1.00 25.59 ? 357 PRO A CD  1 
ATOM   1076 N N   . LEU A 1 147 ? -7.901  -4.471  8.059   1.00 24.27 ? 358 LEU A N   1 
ATOM   1077 C CA  . LEU A 1 147 ? -7.164  -4.128  9.257   1.00 24.35 ? 358 LEU A CA  1 
ATOM   1078 C C   . LEU A 1 147 ? -7.186  -5.246  10.299  1.00 24.45 ? 358 LEU A C   1 
ATOM   1079 O O   . LEU A 1 147 ? -6.184  -5.444  10.985  1.00 24.30 ? 358 LEU A O   1 
ATOM   1080 C CB  . LEU A 1 147 ? -7.620  -2.785  9.827   1.00 24.21 ? 358 LEU A CB  1 
ATOM   1081 C CG  . LEU A 1 147 ? -7.568  -1.584  8.855   1.00 25.10 ? 358 LEU A CG  1 
ATOM   1082 C CD1 . LEU A 1 147 ? -8.113  -0.295  9.513   1.00 26.86 ? 358 LEU A CD1 1 
ATOM   1083 C CD2 . LEU A 1 147 ? -6.166  -1.355  8.310   1.00 25.33 ? 358 LEU A CD2 1 
ATOM   1084 N N   . ASP A 1 148 ? -8.285  -6.007  10.393  1.00 25.12 ? 359 ASP A N   1 
ATOM   1085 C CA  . ASP A 1 148 ? -8.385  -7.081  11.400  1.00 24.94 ? 359 ASP A CA  1 
ATOM   1086 C C   . ASP A 1 148 ? -7.458  -8.216  10.986  1.00 24.25 ? 359 ASP A C   1 
ATOM   1087 O O   . ASP A 1 148 ? -6.817  -8.861  11.816  1.00 23.67 ? 359 ASP A O   1 
ATOM   1088 C CB  . ASP A 1 148 ? -9.825  -7.617  11.534  1.00 25.71 ? 359 ASP A CB  1 
ATOM   1089 C CG  . ASP A 1 148 ? -10.774 -6.661  12.301  1.00 28.37 ? 359 ASP A CG  1 
ATOM   1090 O OD1 . ASP A 1 148 ? -10.356 -5.880  13.167  1.00 33.94 ? 359 ASP A OD1 1 
ATOM   1091 O OD2 . ASP A 1 148 ? -11.975 -6.694  12.047  1.00 33.57 ? 359 ASP A OD2 1 
ATOM   1092 N N   . GLN A 1 149 ? -7.435  -8.491  9.687   1.00 24.05 ? 360 GLN A N   1 
ATOM   1093 C CA  . GLN A 1 149 ? -6.496  -9.455  9.127   1.00 24.18 ? 360 GLN A CA  1 
ATOM   1094 C C   . GLN A 1 149 ? -5.024  -9.051  9.438   1.00 23.04 ? 360 GLN A C   1 
ATOM   1095 O O   . GLN A 1 149 ? -4.233  -9.875  9.874   1.00 23.81 ? 360 GLN A O   1 
ATOM   1096 C CB  . GLN A 1 149 ? -6.719  -9.604  7.611   1.00 24.62 ? 360 GLN A CB  1 
ATOM   1097 C CG  . GLN A 1 149 ? -8.080  -10.137 7.190   1.00 25.22 ? 360 GLN A CG  1 
ATOM   1098 C CD  . GLN A 1 149 ? -8.242  -10.195 5.672   1.00 26.54 ? 360 GLN A CD  1 
ATOM   1099 O OE1 . GLN A 1 149 ? -7.448  -10.833 4.989   1.00 26.32 ? 360 GLN A OE1 1 
ATOM   1100 N NE2 . GLN A 1 149 ? -9.262  -9.513  5.143   1.00 23.22 ? 360 GLN A NE2 1 
ATOM   1101 N N   . HIS A 1 150 ? -4.654  -7.799  9.227   1.00 22.79 ? 361 HIS A N   1 
ATOM   1102 C CA  . HIS A 1 150 ? -3.274  -7.343  9.568   1.00 22.06 ? 361 HIS A CA  1 
ATOM   1103 C C   . HIS A 1 150 ? -2.937  -7.519  11.056  1.00 21.96 ? 361 HIS A C   1 
ATOM   1104 O O   . HIS A 1 150 ? -1.857  -8.047  11.422  1.00 21.17 ? 361 HIS A O   1 
ATOM   1105 C CB  . HIS A 1 150 ? -3.040  -5.846  9.232   1.00 20.98 ? 361 HIS A CB  1 
ATOM   1106 C CG  . HIS A 1 150 ? -3.385  -5.463  7.827   1.00 20.32 ? 361 HIS A CG  1 
ATOM   1107 N ND1 . HIS A 1 150 ? -3.586  -6.381  6.823   1.00 21.12 ? 361 HIS A ND1 1 
ATOM   1108 C CD2 . HIS A 1 150 ? -3.546  -4.244  7.257   1.00 20.95 ? 361 HIS A CD2 1 
ATOM   1109 C CE1 . HIS A 1 150 ? -3.884  -5.747  5.703   1.00 20.29 ? 361 HIS A CE1 1 
ATOM   1110 N NE2 . HIS A 1 150 ? -3.887  -4.451  5.946   1.00 20.26 ? 361 HIS A NE2 1 
ATOM   1111 N N   . TYR A 1 151 ? -3.829  -6.982  11.883  1.00 21.44 ? 362 TYR A N   1 
ATOM   1112 C CA  . TYR A 1 151 ? -3.717  -7.047  13.331  1.00 22.27 ? 362 TYR A CA  1 
ATOM   1113 C C   . TYR A 1 151 ? -3.542  -8.468  13.851  1.00 22.28 ? 362 TYR A C   1 
ATOM   1114 O O   . TYR A 1 151 ? -2.658  -8.703  14.652  1.00 20.35 ? 362 TYR A O   1 
ATOM   1115 C CB  . TYR A 1 151 ? -4.953  -6.401  13.973  1.00 23.21 ? 362 TYR A CB  1 
ATOM   1116 C CG  . TYR A 1 151 ? -4.909  -6.343  15.486  1.00 23.67 ? 362 TYR A CG  1 
ATOM   1117 C CD1 . TYR A 1 151 ? -3.927  -5.628  16.134  1.00 24.69 ? 362 TYR A CD1 1 
ATOM   1118 C CD2 . TYR A 1 151 ? -5.867  -6.995  16.264  1.00 24.76 ? 362 TYR A CD2 1 
ATOM   1119 C CE1 . TYR A 1 151 ? -3.876  -5.558  17.538  1.00 24.25 ? 362 TYR A CE1 1 
ATOM   1120 C CE2 . TYR A 1 151 ? -5.822  -6.936  17.659  1.00 25.08 ? 362 TYR A CE2 1 
ATOM   1121 C CZ  . TYR A 1 151 ? -4.831  -6.218  18.281  1.00 21.41 ? 362 TYR A CZ  1 
ATOM   1122 O OH  . TYR A 1 151 ? -4.747  -6.148  19.625  1.00 19.37 ? 362 TYR A OH  1 
ATOM   1123 N N   . ARG A 1 152 ? -4.388  -9.407  13.407  1.00 23.57 ? 363 ARG A N   1 
ATOM   1124 C CA  . ARG A 1 152 ? -4.250  -10.835 13.797  1.00 24.10 ? 363 ARG A CA  1 
ATOM   1125 C C   . ARG A 1 152 ? -2.876  -11.381 13.390  1.00 23.34 ? 363 ARG A C   1 
ATOM   1126 O O   . ARG A 1 152 ? -2.283  -12.160 14.122  1.00 21.93 ? 363 ARG A O   1 
ATOM   1127 C CB  . ARG A 1 152 ? -5.334  -11.703 13.139  1.00 25.63 ? 363 ARG A CB  1 
ATOM   1128 C CG  . ARG A 1 152 ? -5.254  -13.202 13.484  1.00 30.36 ? 363 ARG A CG  1 
ATOM   1129 C CD  . ARG A 1 152 ? -6.514  -13.994 13.071  1.00 34.80 ? 363 ARG A CD  1 
ATOM   1130 N NE  . ARG A 1 152 ? -7.129  -13.553 11.808  1.00 39.73 ? 363 ARG A NE  1 
ATOM   1131 C CZ  . ARG A 1 152 ? -6.611  -13.751 10.593  1.00 40.72 ? 363 ARG A CZ  1 
ATOM   1132 N NH1 . ARG A 1 152 ? -7.246  -13.300 9.513   1.00 41.76 ? 363 ARG A NH1 1 
ATOM   1133 N NH2 . ARG A 1 152 ? -5.443  -14.376 10.447  1.00 42.18 ? 363 ARG A NH2 1 
ATOM   1134 N N   . ASN A 1 153 ? -2.372  -10.947 12.234  1.00 22.55 ? 364 ASN A N   1 
ATOM   1135 C CA  . ASN A 1 153 ? -1.089  -11.444 11.725  1.00 22.61 ? 364 ASN A CA  1 
ATOM   1136 C C   . ASN A 1 153 ? 0.099   -10.919 12.494  1.00 21.62 ? 364 ASN A C   1 
ATOM   1137 O O   . ASN A 1 153 ? 1.168   -11.483 12.420  1.00 22.06 ? 364 ASN A O   1 
ATOM   1138 C CB  . ASN A 1 153 ? -0.919  -11.136 10.231  1.00 22.51 ? 364 ASN A CB  1 
ATOM   1139 C CG  . ASN A 1 153 ? -1.797  -12.013 9.354   1.00 26.09 ? 364 ASN A CG  1 
ATOM   1140 O OD1 . ASN A 1 153 ? -2.054  -13.157 9.686   1.00 28.63 ? 364 ASN A OD1 1 
ATOM   1141 N ND2 . ASN A 1 153 ? -2.233  -11.482 8.210   1.00 30.70 ? 364 ASN A ND2 1 
ATOM   1142 N N   . LEU A 1 154 ? -0.080  -9.831  13.233  1.00 20.43 ? 365 LEU A N   1 
ATOM   1143 C CA  . LEU A 1 154 ? 0.959   -9.356  14.125  1.00 19.30 ? 365 LEU A CA  1 
ATOM   1144 C C   . LEU A 1 154 ? 1.231   -10.320 15.297  1.00 20.04 ? 365 LEU A C   1 
ATOM   1145 O O   . LEU A 1 154 ? 2.351   -10.363 15.815  1.00 19.14 ? 365 LEU A O   1 
ATOM   1146 C CB  . LEU A 1 154 ? 0.591   -7.966  14.688  1.00 19.14 ? 365 LEU A CB  1 
ATOM   1147 C CG  . LEU A 1 154 ? 0.530   -6.737  13.789  1.00 17.02 ? 365 LEU A CG  1 
ATOM   1148 C CD1 . LEU A 1 154 ? 0.351   -5.478  14.661  1.00 15.18 ? 365 LEU A CD1 1 
ATOM   1149 C CD2 . LEU A 1 154 ? 1.845   -6.636  12.976  1.00 19.11 ? 365 LEU A CD2 1 
ATOM   1150 N N   . HIS A 1 155 ? 0.200   -11.055 15.736  1.00 20.87 ? 366 HIS A N   1 
ATOM   1151 C CA  . HIS A 1 155 ? 0.284   -11.890 16.951  1.00 20.70 ? 366 HIS A CA  1 
ATOM   1152 C C   . HIS A 1 155 ? 0.808   -11.038 18.107  1.00 20.20 ? 366 HIS A C   1 
ATOM   1153 O O   . HIS A 1 155 ? 1.762   -11.384 18.790  1.00 18.42 ? 366 HIS A O   1 
ATOM   1154 C CB  . HIS A 1 155 ? 1.167   -13.125 16.711  1.00 21.81 ? 366 HIS A CB  1 
ATOM   1155 C CG  . HIS A 1 155 ? 0.583   -14.112 15.746  1.00 24.64 ? 366 HIS A CG  1 
ATOM   1156 N ND1 . HIS A 1 155 ? 1.098   -14.315 14.481  1.00 29.43 ? 366 HIS A ND1 1 
ATOM   1157 C CD2 . HIS A 1 155 ? -0.472  -14.950 15.862  1.00 27.19 ? 366 HIS A CD2 1 
ATOM   1158 C CE1 . HIS A 1 155 ? 0.378   -15.231 13.856  1.00 31.07 ? 366 HIS A CE1 1 
ATOM   1159 N NE2 . HIS A 1 155 ? -0.584  -15.629 14.670  1.00 30.64 ? 366 HIS A NE2 1 
ATOM   1160 N N   . CYS A 1 156 ? 0.171   -9.893  18.309  1.00 20.08 ? 367 CYS A N   1 
ATOM   1161 C CA  . CYS A 1 156 ? 0.638   -8.924  19.293  1.00 20.17 ? 367 CYS A CA  1 
ATOM   1162 C C   . CYS A 1 156 ? -0.536  -8.044  19.629  1.00 20.69 ? 367 CYS A C   1 
ATOM   1163 O O   . CYS A 1 156 ? -1.055  -7.354  18.738  1.00 21.76 ? 367 CYS A O   1 
ATOM   1164 C CB  . CYS A 1 156 ? 1.761   -8.037  18.692  1.00 20.31 ? 367 CYS A CB  1 
ATOM   1165 S SG  . CYS A 1 156 ? 2.559   -6.913  19.893  1.00 19.14 ? 367 CYS A SG  1 
ATOM   1166 N N   . ALA A 1 157 ? -0.996  -8.081  20.873  1.00 20.44 ? 368 ALA A N   1 
ATOM   1167 C CA  . ALA A 1 157 ? -2.142  -7.261  21.265  1.00 20.23 ? 368 ALA A CA  1 
ATOM   1168 C C   . ALA A 1 157 ? -1.691  -5.813  21.400  1.00 19.32 ? 368 ALA A C   1 
ATOM   1169 O O   . ALA A 1 157 ? -0.646  -5.572  21.948  1.00 18.78 ? 368 ALA A O   1 
ATOM   1170 C CB  . ALA A 1 157 ? -2.730  -7.737  22.598  1.00 20.24 ? 368 ALA A CB  1 
ATOM   1171 N N   . LEU A 1 158 ? -2.503  -4.888  20.893  1.00 18.98 ? 369 LEU A N   1 
ATOM   1172 C CA  . LEU A 1 158 ? -2.334  -3.440  21.049  1.00 18.70 ? 369 LEU A CA  1 
ATOM   1173 C C   . LEU A 1 158 ? -3.634  -2.834  21.633  1.00 19.63 ? 369 LEU A C   1 
ATOM   1174 O O   . LEU A 1 158 ? -4.642  -2.809  20.938  1.00 19.11 ? 369 LEU A O   1 
ATOM   1175 C CB  . LEU A 1 158 ? -2.025  -2.808  19.679  1.00 17.85 ? 369 LEU A CB  1 
ATOM   1176 C CG  . LEU A 1 158 ? -0.766  -3.327  18.963  1.00 16.74 ? 369 LEU A CG  1 
ATOM   1177 C CD1 . LEU A 1 158 ? -0.677  -2.855  17.492  1.00 18.67 ? 369 LEU A CD1 1 
ATOM   1178 C CD2 . LEU A 1 158 ? 0.467   -2.909  19.736  1.00 14.77 ? 369 LEU A CD2 1 
ATOM   1179 N N   . ARG A 1 159 ? -3.589  -2.349  22.885  1.00 20.47 ? 370 ARG A N   1 
ATOM   1180 C CA  . ARG A 1 159 ? -4.760  -1.806  23.583  1.00 22.48 ? 370 ARG A CA  1 
ATOM   1181 C C   . ARG A 1 159 ? -4.544  -0.345  23.928  1.00 21.70 ? 370 ARG A C   1 
ATOM   1182 O O   . ARG A 1 159 ? -3.618  -0.018  24.659  1.00 21.72 ? 370 ARG A O   1 
ATOM   1183 C CB  . ARG A 1 159 ? -5.016  -2.593  24.896  1.00 23.01 ? 370 ARG A CB  1 
ATOM   1184 C CG  . ARG A 1 159 ? -5.071  -4.099  24.655  1.00 26.86 ? 370 ARG A CG  1 
ATOM   1185 C CD  . ARG A 1 159 ? -5.516  -4.904  25.846  1.00 30.66 ? 370 ARG A CD  1 
ATOM   1186 N NE  . ARG A 1 159 ? -5.316  -6.330  25.553  1.00 34.09 ? 370 ARG A NE  1 
ATOM   1187 C CZ  . ARG A 1 159 ? -4.227  -7.035  25.861  1.00 32.31 ? 370 ARG A CZ  1 
ATOM   1188 N NH1 . ARG A 1 159 ? -3.220  -6.504  26.529  1.00 32.03 ? 370 ARG A NH1 1 
ATOM   1189 N NH2 . ARG A 1 159 ? -4.171  -8.312  25.537  1.00 35.58 ? 370 ARG A NH2 1 
ATOM   1190 N N   . PRO A 1 160 ? -5.418  0.533   23.453  1.00 21.52 ? 371 PRO A N   1 
ATOM   1191 C CA  . PRO A 1 160 ? -5.181  1.945   23.734  1.00 21.85 ? 371 PRO A CA  1 
ATOM   1192 C C   . PRO A 1 160 ? -5.481  2.303   25.183  1.00 22.18 ? 371 PRO A C   1 
ATOM   1193 O O   . PRO A 1 160 ? -6.425  1.758   25.756  1.00 21.38 ? 371 PRO A O   1 
ATOM   1194 C CB  . PRO A 1 160 ? -6.123  2.667   22.778  1.00 22.02 ? 371 PRO A CB  1 
ATOM   1195 C CG  . PRO A 1 160 ? -7.060  1.680   22.304  1.00 23.33 ? 371 PRO A CG  1 
ATOM   1196 C CD  . PRO A 1 160 ? -6.585  0.312   22.598  1.00 21.96 ? 371 PRO A CD  1 
ATOM   1197 N N   . LEU A 1 161 ? -4.674  3.185   25.763  1.00 22.89 ? 372 LEU A N   1 
ATOM   1198 C CA  . LEU A 1 161 ? -4.812  3.553   27.178  1.00 24.00 ? 372 LEU A CA  1 
ATOM   1199 C C   . LEU A 1 161 ? -5.479  4.887   27.365  1.00 24.62 ? 372 LEU A C   1 
ATOM   1200 O O   . LEU A 1 161 ? -5.309  5.795   26.569  1.00 24.08 ? 372 LEU A O   1 
ATOM   1201 C CB  . LEU A 1 161 ? -3.450  3.563   27.894  1.00 23.56 ? 372 LEU A CB  1 
ATOM   1202 C CG  . LEU A 1 161 ? -2.839  2.181   28.003  1.00 23.90 ? 372 LEU A CG  1 
ATOM   1203 C CD1 . LEU A 1 161 ? -1.564  2.269   28.824  1.00 23.82 ? 372 LEU A CD1 1 
ATOM   1204 C CD2 . LEU A 1 161 ? -3.887  1.139   28.603  1.00 24.74 ? 372 LEU A CD2 1 
ATOM   1205 N N   . ASP A 1 162 ? -6.200  5.000   28.473  1.00 25.93 ? 373 ASP A N   1 
ATOM   1206 C CA  . ASP A 1 162 ? -6.899  6.219   28.831  1.00 27.17 ? 373 ASP A CA  1 
ATOM   1207 C C   . ASP A 1 162 ? -5.866  7.315   29.130  1.00 26.55 ? 373 ASP A C   1 
ATOM   1208 O O   . ASP A 1 162 ? -4.965  7.118   29.921  1.00 26.42 ? 373 ASP A O   1 
ATOM   1209 C CB  . ASP A 1 162 ? -7.745  5.909   30.061  1.00 28.80 ? 373 ASP A CB  1 
ATOM   1210 C CG  . ASP A 1 162 ? -8.770  6.976   30.374  1.00 30.99 ? 373 ASP A CG  1 
ATOM   1211 O OD1 . ASP A 1 162 ? -8.552  8.191   30.120  1.00 31.32 ? 373 ASP A OD1 1 
ATOM   1212 O OD2 . ASP A 1 162 ? -9.816  6.557   30.908  1.00 38.38 ? 373 ASP A OD2 1 
ATOM   1213 N N   . HIS A 1 163 ? -5.992  8.460   28.484  1.00 27.20 ? 374 HIS A N   1 
ATOM   1214 C CA  . HIS A 1 163 ? -5.071  9.565   28.691  1.00 28.15 ? 374 HIS A CA  1 
ATOM   1215 C C   . HIS A 1 163 ? -5.155  10.179  30.104  1.00 30.04 ? 374 HIS A C   1 
ATOM   1216 O O   . HIS A 1 163 ? -4.200  10.803  30.559  1.00 30.98 ? 374 HIS A O   1 
ATOM   1217 C CB  . HIS A 1 163 ? -5.315  10.660  27.659  1.00 28.98 ? 374 HIS A CB  1 
ATOM   1218 C CG  . HIS A 1 163 ? -4.879  10.302  26.264  1.00 29.17 ? 374 HIS A CG  1 
ATOM   1219 N ND1 . HIS A 1 163 ? -4.450  11.249  25.364  1.00 29.36 ? 374 HIS A ND1 1 
ATOM   1220 C CD2 . HIS A 1 163 ? -4.800  9.109   25.621  1.00 29.83 ? 374 HIS A CD2 1 
ATOM   1221 C CE1 . HIS A 1 163 ? -4.146  10.665  24.216  1.00 30.81 ? 374 HIS A CE1 1 
ATOM   1222 N NE2 . HIS A 1 163 ? -4.345  9.365   24.343  1.00 31.13 ? 374 HIS A NE2 1 
ATOM   1223 N N   . GLU A 1 164 ? -6.269  9.969   30.802  1.00 30.42 ? 375 GLU A N   1 
ATOM   1224 C CA  . GLU A 1 164 ? -6.411  10.408  32.192  1.00 31.37 ? 375 GLU A CA  1 
ATOM   1225 C C   . GLU A 1 164 ? -5.910  9.339   33.176  1.00 30.69 ? 375 GLU A C   1 
ATOM   1226 O O   . GLU A 1 164 ? -6.126  9.466   34.372  1.00 30.84 ? 375 GLU A O   1 
ATOM   1227 C CB  . GLU A 1 164 ? -7.891  10.781  32.479  1.00 32.43 ? 375 GLU A CB  1 
ATOM   1228 C CG  . GLU A 1 164 ? -8.375  12.016  31.681  1.00 34.83 ? 375 GLU A CG  1 
ATOM   1229 C CD  . GLU A 1 164 ? -9.815  12.463  32.038  1.00 42.24 ? 375 GLU A CD  1 
ATOM   1230 O OE1 . GLU A 1 164 ? -10.778 11.667  31.845  1.00 42.58 ? 375 GLU A OE1 1 
ATOM   1231 O OE2 . GLU A 1 164 ? -9.988  13.626  32.514  1.00 47.07 ? 375 GLU A OE2 1 
ATOM   1232 N N   . SER A 1 165 ? -5.233  8.293   32.697  1.00 29.09 ? 376 SER A N   1 
ATOM   1233 C CA  . SER A 1 165 ? -4.772  7.219   33.590  1.00 28.00 ? 376 SER A CA  1 
ATOM   1234 C C   . SER A 1 165 ? -3.451  7.576   34.230  1.00 27.69 ? 376 SER A C   1 
ATOM   1235 O O   . SER A 1 165 ? -2.749  8.488   33.785  1.00 28.26 ? 376 SER A O   1 
ATOM   1236 C CB  . SER A 1 165 ? -4.600  5.898   32.828  1.00 28.84 ? 376 SER A CB  1 
ATOM   1237 O OG  . SER A 1 165 ? -3.557  5.965   31.846  1.00 25.72 ? 376 SER A OG  1 
ATOM   1238 N N   . TYR A 1 166 ? -3.118  6.864   35.294  1.00 27.17 ? 377 TYR A N   1 
ATOM   1239 C CA  . TYR A 1 166 ? -1.812  6.979   35.916  1.00 26.60 ? 377 TYR A CA  1 
ATOM   1240 C C   . TYR A 1 166 ? -0.670  6.462   35.004  1.00 26.77 ? 377 TYR A C   1 
ATOM   1241 O O   . TYR A 1 166 ? 0.408   7.052   34.965  1.00 26.27 ? 377 TYR A O   1 
ATOM   1242 C CB  . TYR A 1 166 ? -1.788  6.258   37.259  1.00 26.35 ? 377 TYR A CB  1 
ATOM   1243 C CG  . TYR A 1 166 ? -0.392  6.214   37.865  1.00 25.40 ? 377 TYR A CG  1 
ATOM   1244 C CD1 . TYR A 1 166 ? 0.155   7.330   38.473  1.00 22.86 ? 377 TYR A CD1 1 
ATOM   1245 C CD2 . TYR A 1 166 ? 0.378   5.066   37.796  1.00 23.13 ? 377 TYR A CD2 1 
ATOM   1246 C CE1 . TYR A 1 166 ? 1.432   7.302   39.021  1.00 25.11 ? 377 TYR A CE1 1 
ATOM   1247 C CE2 . TYR A 1 166 ? 1.661   5.026   38.321  1.00 22.87 ? 377 TYR A CE2 1 
ATOM   1248 C CZ  . TYR A 1 166 ? 2.189   6.147   38.930  1.00 24.07 ? 377 TYR A CZ  1 
ATOM   1249 O OH  . TYR A 1 166 ? 3.461   6.120   39.463  1.00 23.91 ? 377 TYR A OH  1 
ATOM   1250 N N   . GLU A 1 167 ? -0.929  5.370   34.291  1.00 27.06 ? 378 GLU A N   1 
ATOM   1251 C CA  . GLU A 1 167 ? 0.009   4.807   33.308  1.00 27.37 ? 378 GLU A CA  1 
ATOM   1252 C C   . GLU A 1 167 ? 0.393   5.895   32.307  1.00 25.94 ? 378 GLU A C   1 
ATOM   1253 O O   . GLU A 1 167 ? 1.563   6.148   32.102  1.00 26.06 ? 378 GLU A O   1 
ATOM   1254 C CB  . GLU A 1 167 ? -0.584  3.586   32.561  1.00 27.20 ? 378 GLU A CB  1 
ATOM   1255 C CG  . GLU A 1 167 ? -0.654  2.272   33.343  1.00 31.45 ? 378 GLU A CG  1 
ATOM   1256 C CD  . GLU A 1 167 ? -1.642  2.314   34.544  1.00 39.17 ? 378 GLU A CD  1 
ATOM   1257 O OE1 . GLU A 1 167 ? -2.670  3.052   34.465  1.00 40.50 ? 378 GLU A OE1 1 
ATOM   1258 O OE2 . GLU A 1 167 ? -1.382  1.627   35.583  1.00 40.94 ? 378 GLU A OE2 1 
ATOM   1259 N N   . PHE A 1 168 ? -0.595  6.553   31.710  1.00 25.34 ? 379 PHE A N   1 
ATOM   1260 C CA  . PHE A 1 168 ? -0.337  7.664   30.779  1.00 24.57 ? 379 PHE A CA  1 
ATOM   1261 C C   . PHE A 1 168 ? 0.425   8.810   31.414  1.00 24.56 ? 379 PHE A C   1 
ATOM   1262 O O   . PHE A 1 168 ? 1.365   9.314   30.825  1.00 22.72 ? 379 PHE A O   1 
ATOM   1263 C CB  . PHE A 1 168 ? -1.629  8.185   30.171  1.00 24.84 ? 379 PHE A CB  1 
ATOM   1264 C CG  . PHE A 1 168 ? -1.435  9.134   29.033  1.00 23.75 ? 379 PHE A CG  1 
ATOM   1265 C CD1 . PHE A 1 168 ? -1.511  8.681   27.715  1.00 25.59 ? 379 PHE A CD1 1 
ATOM   1266 C CD2 . PHE A 1 168 ? -1.232  10.497  29.264  1.00 24.59 ? 379 PHE A CD2 1 
ATOM   1267 C CE1 . PHE A 1 168 ? -1.349  9.571   26.643  1.00 24.82 ? 379 PHE A CE1 1 
ATOM   1268 C CE2 . PHE A 1 168 ? -1.040  11.387  28.224  1.00 22.75 ? 379 PHE A CE2 1 
ATOM   1269 C CZ  . PHE A 1 168 ? -1.092  10.928  26.903  1.00 25.14 ? 379 PHE A CZ  1 
ATOM   1270 N N   . LYS A 1 169 ? 0.025   9.248   32.611  1.00 24.65 ? 380 LYS A N   1 
ATOM   1271 C CA  . LYS A 1 169 ? 0.759   10.327  33.241  1.00 25.19 ? 380 LYS A CA  1 
ATOM   1272 C C   . LYS A 1 169 ? 2.243   10.002  33.453  1.00 23.54 ? 380 LYS A C   1 
ATOM   1273 O O   . LYS A 1 169 ? 3.073   10.815  33.179  1.00 24.38 ? 380 LYS A O   1 
ATOM   1274 C CB  . LYS A 1 169 ? 0.142   10.728  34.607  1.00 26.72 ? 380 LYS A CB  1 
ATOM   1275 C CG  . LYS A 1 169 ? 0.821   11.954  35.209  1.00 29.30 ? 380 LYS A CG  1 
ATOM   1276 C CD  . LYS A 1 169 ? 0.906   11.906  36.787  1.00 33.83 ? 380 LYS A CD  1 
ATOM   1277 C CE  . LYS A 1 169 ? 2.039   10.992  37.274  1.00 35.61 ? 380 LYS A CE  1 
ATOM   1278 N NZ  . LYS A 1 169 ? 2.327   11.261  38.695  1.00 32.34 ? 380 LYS A NZ  1 
ATOM   1279 N N   . VAL A 1 170 ? 2.579   8.845   33.984  1.00 22.73 ? 381 VAL A N   1 
ATOM   1280 C CA  . VAL A 1 170 ? 3.975   8.518   34.249  1.00 22.88 ? 381 VAL A CA  1 
ATOM   1281 C C   . VAL A 1 170 ? 4.806   8.379   32.939  1.00 21.67 ? 381 VAL A C   1 
ATOM   1282 O O   . VAL A 1 170 ? 5.958   8.828   32.843  1.00 19.29 ? 381 VAL A O   1 
ATOM   1283 C CB  . VAL A 1 170 ? 4.085   7.177   35.003  1.00 23.98 ? 381 VAL A CB  1 
ATOM   1284 C CG1 . VAL A 1 170 ? 5.487   6.988   35.545  1.00 26.28 ? 381 VAL A CG1 1 
ATOM   1285 C CG2 . VAL A 1 170 ? 3.101   7.156   36.157  1.00 26.44 ? 381 VAL A CG2 1 
ATOM   1286 N N   . ILE A 1 171 ? 4.216   7.736   31.949  1.00 20.50 ? 382 ILE A N   1 
ATOM   1287 C CA  . ILE A 1 171 ? 4.904   7.566   30.665  1.00 20.89 ? 382 ILE A CA  1 
ATOM   1288 C C   . ILE A 1 171 ? 5.128   8.952   30.036  1.00 20.93 ? 382 ILE A C   1 
ATOM   1289 O O   . ILE A 1 171 ? 6.216   9.235   29.519  1.00 21.02 ? 382 ILE A O   1 
ATOM   1290 C CB  . ILE A 1 171 ? 4.169   6.558   29.763  1.00 20.01 ? 382 ILE A CB  1 
ATOM   1291 C CG1 . ILE A 1 171 ? 4.341   5.176   30.371  1.00 20.53 ? 382 ILE A CG1 1 
ATOM   1292 C CG2 . ILE A 1 171 ? 4.733   6.574   28.327  1.00 20.26 ? 382 ILE A CG2 1 
ATOM   1293 C CD1 . ILE A 1 171 ? 3.533   4.148   29.753  1.00 23.54 ? 382 ILE A CD1 1 
ATOM   1294 N N   . SER A 1 172 ? 4.156   9.855   30.171  1.00 22.53 ? 383 SER A N   1 
ATOM   1295 C CA  . SER A 1 172 ? 4.379   11.251  29.737  1.00 22.99 ? 383 SER A CA  1 
ATOM   1296 C C   . SER A 1 172 ? 5.503   11.916  30.455  1.00 21.83 ? 383 SER A C   1 
ATOM   1297 O O   . SER A 1 172 ? 6.265   12.605  29.814  1.00 20.21 ? 383 SER A O   1 
ATOM   1298 C CB  . SER A 1 172 ? 3.140   12.127  29.845  1.00 23.65 ? 383 SER A CB  1 
ATOM   1299 O OG  . SER A 1 172 ? 2.195   11.623  28.940  1.00 27.75 ? 383 SER A OG  1 
ATOM   1300 N N   . GLN A 1 173 ? 5.612   11.729  31.768  1.00 22.07 ? 384 GLN A N   1 
ATOM   1301 C CA  . GLN A 1 173 ? 6.737   12.329  32.500  1.00 23.25 ? 384 GLN A CA  1 
ATOM   1302 C C   . GLN A 1 173 ? 8.082   11.704  32.154  1.00 21.59 ? 384 GLN A C   1 
ATOM   1303 O O   . GLN A 1 173 ? 9.105   12.393  32.095  1.00 21.73 ? 384 GLN A O   1 
ATOM   1304 C CB  . GLN A 1 173 ? 6.525   12.277  34.012  1.00 24.68 ? 384 GLN A CB  1 
ATOM   1305 C CG  . GLN A 1 173 ? 5.538   13.292  34.481  1.00 27.71 ? 384 GLN A CG  1 
ATOM   1306 C CD  . GLN A 1 173 ? 5.332   13.287  35.990  1.00 30.58 ? 384 GLN A CD  1 
ATOM   1307 O OE1 . GLN A 1 173 ? 6.054   12.639  36.746  1.00 33.14 ? 384 GLN A OE1 1 
ATOM   1308 N NE2 . GLN A 1 173 ? 4.348   14.036  36.423  1.00 31.69 ? 384 GLN A NE2 1 
ATOM   1309 N N   . TYR A 1 174 ? 8.090   10.390  31.966  1.00 21.20 ? 385 TYR A N   1 
ATOM   1310 C CA  . TYR A 1 174 ? 9.280   9.687   31.504  1.00 19.71 ? 385 TYR A CA  1 
ATOM   1311 C C   . TYR A 1 174 ? 9.752   10.304  30.172  1.00 19.28 ? 385 TYR A C   1 
ATOM   1312 O O   . TYR A 1 174 ? 10.886  10.686  30.067  1.00 20.38 ? 385 TYR A O   1 
ATOM   1313 C CB  . TYR A 1 174 ? 8.971   8.216   31.280  1.00 19.52 ? 385 TYR A CB  1 
ATOM   1314 C CG  . TYR A 1 174 ? 10.171  7.290   31.124  1.00 17.63 ? 385 TYR A CG  1 
ATOM   1315 C CD1 . TYR A 1 174 ? 11.462  7.687   31.459  1.00 16.82 ? 385 TYR A CD1 1 
ATOM   1316 C CD2 . TYR A 1 174 ? 9.977   5.948   30.766  1.00 16.11 ? 385 TYR A CD2 1 
ATOM   1317 C CE1 . TYR A 1 174 ? 12.545  6.806   31.326  1.00 16.37 ? 385 TYR A CE1 1 
ATOM   1318 C CE2 . TYR A 1 174 ? 11.053  5.065   30.664  1.00 14.92 ? 385 TYR A CE2 1 
ATOM   1319 C CZ  . TYR A 1 174 ? 12.332  5.513   30.905  1.00 15.29 ? 385 TYR A CZ  1 
ATOM   1320 O OH  . TYR A 1 174 ? 13.371  4.622   30.791  1.00 14.27 ? 385 TYR A OH  1 
ATOM   1321 N N   . LEU A 1 175 ? 8.846   10.392  29.204  1.00 17.70 ? 386 LEU A N   1 
ATOM   1322 C CA  . LEU A 1 175 ? 9.107   10.960  27.884  1.00 17.19 ? 386 LEU A CA  1 
ATOM   1323 C C   . LEU A 1 175 ? 9.708   12.361  27.950  1.00 17.46 ? 386 LEU A C   1 
ATOM   1324 O O   . LEU A 1 175 ? 10.773  12.634  27.373  1.00 15.82 ? 386 LEU A O   1 
ATOM   1325 C CB  . LEU A 1 175 ? 7.781   11.017  27.097  1.00 17.12 ? 386 LEU A CB  1 
ATOM   1326 C CG  . LEU A 1 175 ? 7.834   11.581  25.679  1.00 16.47 ? 386 LEU A CG  1 
ATOM   1327 C CD1 . LEU A 1 175 ? 8.808   10.683  24.770  1.00 12.84 ? 386 LEU A CD1 1 
ATOM   1328 C CD2 . LEU A 1 175 ? 6.423   11.713  25.163  1.00 12.67 ? 386 LEU A CD2 1 
ATOM   1329 N N   . GLN A 1 176 ? 9.037   13.247  28.687  1.00 17.82 ? 387 GLN A N   1 
ATOM   1330 C CA  . GLN A 1 176 ? 9.519   14.609  28.794  1.00 19.15 ? 387 GLN A CA  1 
ATOM   1331 C C   . GLN A 1 176 ? 10.744  14.775  29.635  1.00 19.11 ? 387 GLN A C   1 
ATOM   1332 O O   . GLN A 1 176 ? 11.635  15.483  29.225  1.00 20.03 ? 387 GLN A O   1 
ATOM   1333 C CB  . GLN A 1 176 ? 8.420   15.536  29.362  1.00 20.01 ? 387 GLN A CB  1 
ATOM   1334 C CG  . GLN A 1 176 ? 7.175   15.596  28.478  1.00 22.31 ? 387 GLN A CG  1 
ATOM   1335 C CD  . GLN A 1 176 ? 7.472   15.880  27.003  1.00 23.84 ? 387 GLN A CD  1 
ATOM   1336 O OE1 . GLN A 1 176 ? 8.421   16.594  26.669  1.00 25.68 ? 387 GLN A OE1 1 
ATOM   1337 N NE2 . GLN A 1 176 ? 6.625   15.359  26.120  1.00 24.52 ? 387 GLN A NE2 1 
ATOM   1338 N N   . SER A 1 177 ? 10.770  14.169  30.829  1.00 19.84 ? 388 SER A N   1 
ATOM   1339 C CA  . SER A 1 177 ? 11.838  14.397  31.819  1.00 19.99 ? 388 SER A CA  1 
ATOM   1340 C C   . SER A 1 177 ? 13.190  13.826  31.407  1.00 19.55 ? 388 SER A C   1 
ATOM   1341 O O   . SER A 1 177 ? 14.234  14.287  31.879  1.00 19.52 ? 388 SER A O   1 
ATOM   1342 C CB  . SER A 1 177 ? 11.447  13.798  33.179  1.00 20.66 ? 388 SER A CB  1 
ATOM   1343 O OG  . SER A 1 177 ? 11.543  12.357  33.206  1.00 17.75 ? 388 SER A OG  1 
ATOM   1344 N N   . THR A 1 178 ? 13.173  12.815  30.528  1.00 19.48 ? 389 THR A N   1 
ATOM   1345 C CA  . THR A 1 178 ? 14.421  12.257  30.017  1.00 18.87 ? 389 THR A CA  1 
ATOM   1346 C C   . THR A 1 178 ? 14.696  12.638  28.542  1.00 19.70 ? 389 THR A C   1 
ATOM   1347 O O   . THR A 1 178 ? 15.436  11.932  27.830  1.00 20.50 ? 389 THR A O   1 
ATOM   1348 C CB  . THR A 1 178 ? 14.465  10.724  30.205  1.00 18.44 ? 389 THR A CB  1 
ATOM   1349 O OG1 . THR A 1 178 ? 13.491  10.098  29.348  1.00 14.98 ? 389 THR A OG1 1 
ATOM   1350 C CG2 . THR A 1 178 ? 14.237  10.357  31.683  1.00 15.44 ? 389 THR A CG2 1 
ATOM   1351 N N   . HIS A 1 179 ? 14.128  13.735  28.083  1.00 19.98 ? 390 HIS A N   1 
ATOM   1352 C CA  . HIS A 1 179 ? 14.529  14.277  26.784  1.00 20.84 ? 390 HIS A CA  1 
ATOM   1353 C C   . HIS A 1 179 ? 15.900  14.975  26.950  1.00 21.65 ? 390 HIS A C   1 
ATOM   1354 O O   . HIS A 1 179 ? 16.047  15.898  27.741  1.00 21.80 ? 390 HIS A O   1 
ATOM   1355 C CB  . HIS A 1 179 ? 13.452  15.213  26.266  1.00 21.19 ? 390 HIS A CB  1 
ATOM   1356 C CG  . HIS A 1 179 ? 13.661  15.653  24.846  1.00 21.54 ? 390 HIS A CG  1 
ATOM   1357 N ND1 . HIS A 1 179 ? 12.623  15.768  23.948  1.00 19.87 ? 390 HIS A ND1 1 
ATOM   1358 C CD2 . HIS A 1 179 ? 14.782  15.999  24.174  1.00 18.63 ? 390 HIS A CD2 1 
ATOM   1359 C CE1 . HIS A 1 179 ? 13.095  16.172  22.783  1.00 19.90 ? 390 HIS A CE1 1 
ATOM   1360 N NE2 . HIS A 1 179 ? 14.407  16.314  22.890  1.00 19.73 ? 390 HIS A NE2 1 
ATOM   1361 N N   . ALA A 1 180 ? 16.926  14.526  26.230  1.00 22.31 ? 391 ALA A N   1 
ATOM   1362 C CA  . ALA A 1 180 ? 18.302  14.972  26.562  1.00 23.04 ? 391 ALA A CA  1 
ATOM   1363 C C   . ALA A 1 180 ? 18.538  16.404  26.157  1.00 23.77 ? 391 ALA A C   1 
ATOM   1364 O O   . ALA A 1 180 ? 17.925  16.880  25.216  1.00 23.99 ? 391 ALA A O   1 
ATOM   1365 C CB  . ALA A 1 180 ? 19.359  14.086  25.939  1.00 21.60 ? 391 ALA A CB  1 
ATOM   1366 N N   . PRO A 1 181 ? 19.447  17.085  26.859  1.00 26.17 ? 392 PRO A N   1 
ATOM   1367 C CA  . PRO A 1 181 ? 19.714  18.489  26.556  1.00 27.49 ? 392 PRO A CA  1 
ATOM   1368 C C   . PRO A 1 181 ? 20.403  18.611  25.224  1.00 28.04 ? 392 PRO A C   1 
ATOM   1369 O O   . PRO A 1 181 ? 20.244  19.615  24.568  1.00 28.81 ? 392 PRO A O   1 
ATOM   1370 C CB  . PRO A 1 181 ? 20.630  18.938  27.711  1.00 28.14 ? 392 PRO A CB  1 
ATOM   1371 C CG  . PRO A 1 181 ? 21.304  17.685  28.167  1.00 27.23 ? 392 PRO A CG  1 
ATOM   1372 C CD  . PRO A 1 181 ? 20.170  16.655  28.078  1.00 26.67 ? 392 PRO A CD  1 
ATOM   1373 N N   . THR A 1 182 ? 21.122  17.582  24.775  1.00 28.63 ? 393 THR A N   1 
ATOM   1374 C CA  . THR A 1 182 ? 21.823  17.719  23.494  1.00 28.09 ? 393 THR A CA  1 
ATOM   1375 C C   . THR A 1 182 ? 20.938  17.435  22.291  1.00 26.84 ? 393 THR A C   1 
ATOM   1376 O O   . THR A 1 182 ? 21.361  17.673  21.161  1.00 27.99 ? 393 THR A O   1 
ATOM   1377 C CB  . THR A 1 182 ? 23.153  16.957  23.460  1.00 28.30 ? 393 THR A CB  1 
ATOM   1378 O OG1 . THR A 1 182 ? 22.941  15.589  23.760  1.00 28.89 ? 393 THR A OG1 1 
ATOM   1379 C CG2 . THR A 1 182 ? 24.110  17.549  24.511  1.00 30.37 ? 393 THR A CG2 1 
ATOM   1380 N N   . HIS A 1 183 ? 19.693  16.985  22.511  1.00 25.29 ? 394 HIS A N   1 
ATOM   1381 C CA  . HIS A 1 183 ? 18.794  16.659  21.389  1.00 22.88 ? 394 HIS A CA  1 
ATOM   1382 C C   . HIS A 1 183 ? 17.715  17.723  21.295  1.00 22.34 ? 394 HIS A C   1 
ATOM   1383 O O   . HIS A 1 183 ? 16.545  17.402  21.238  1.00 21.99 ? 394 HIS A O   1 
ATOM   1384 C CB  . HIS A 1 183 ? 18.163  15.257  21.563  1.00 21.83 ? 394 HIS A CB  1 
ATOM   1385 C CG  . HIS A 1 183 ? 19.170  14.155  21.758  1.00 20.13 ? 394 HIS A CG  1 
ATOM   1386 N ND1 . HIS A 1 183 ? 18.938  13.057  22.564  1.00 14.75 ? 394 HIS A ND1 1 
ATOM   1387 C CD2 . HIS A 1 183 ? 20.421  14.000  21.262  1.00 19.22 ? 394 HIS A CD2 1 
ATOM   1388 C CE1 . HIS A 1 183 ? 20.018  12.298  22.581  1.00 17.83 ? 394 HIS A CE1 1 
ATOM   1389 N NE2 . HIS A 1 183 ? 20.924  12.838  21.784  1.00 18.34 ? 394 HIS A NE2 1 
ATOM   1390 N N   . SER A 1 184 ? 18.121  18.992  21.279  1.00 22.03 ? 395 SER A N   1 
ATOM   1391 C CA  . SER A 1 184 ? 17.192  20.149  21.314  1.00 21.78 ? 395 SER A CA  1 
ATOM   1392 C C   . SER A 1 184 ? 16.672  20.629  19.947  1.00 21.78 ? 395 SER A C   1 
ATOM   1393 O O   . SER A 1 184 ? 16.066  21.713  19.857  1.00 21.09 ? 395 SER A O   1 
ATOM   1394 C CB  . SER A 1 184 ? 17.903  21.342  21.965  1.00 22.51 ? 395 SER A CB  1 
ATOM   1395 O OG  . SER A 1 184 ? 19.024  21.700  21.165  1.00 22.26 ? 395 SER A OG  1 
ATOM   1396 N N   . ASP A 1 185 ? 16.934  19.866  18.883  1.00 20.99 ? 396 ASP A N   1 
ATOM   1397 C CA  . ASP A 1 185 ? 16.385  20.181  17.564  1.00 20.25 ? 396 ASP A CA  1 
ATOM   1398 C C   . ASP A 1 185 ? 14.881  19.951  17.454  1.00 19.61 ? 396 ASP A C   1 
ATOM   1399 O O   . ASP A 1 185 ? 14.245  20.429  16.524  1.00 20.33 ? 396 ASP A O   1 
ATOM   1400 C CB  . ASP A 1 185 ? 17.152  19.459  16.410  1.00 20.46 ? 396 ASP A CB  1 
ATOM   1401 C CG  . ASP A 1 185 ? 17.324  17.953  16.635  1.00 20.80 ? 396 ASP A CG  1 
ATOM   1402 O OD1 . ASP A 1 185 ? 17.867  17.544  17.694  1.00 21.12 ? 396 ASP A OD1 1 
ATOM   1403 O OD2 . ASP A 1 185 ? 16.900  17.180  15.746  1.00 21.27 ? 396 ASP A OD2 1 
ATOM   1404 N N   . TYR A 1 186 ? 14.304  19.198  18.381  1.00 18.28 ? 397 TYR A N   1 
ATOM   1405 C CA  . TYR A 1 186 ? 12.874  18.983  18.415  1.00 16.88 ? 397 TYR A CA  1 
ATOM   1406 C C   . TYR A 1 186 ? 12.414  18.802  19.844  1.00 16.72 ? 397 TYR A C   1 
ATOM   1407 O O   . TYR A 1 186 ? 13.199  18.566  20.726  1.00 16.10 ? 397 TYR A O   1 
ATOM   1408 C CB  . TYR A 1 186 ? 12.477  17.718  17.620  1.00 17.60 ? 397 TYR A CB  1 
ATOM   1409 C CG  . TYR A 1 186 ? 13.102  16.437  18.150  1.00 14.89 ? 397 TYR A CG  1 
ATOM   1410 C CD1 . TYR A 1 186 ? 12.435  15.635  19.046  1.00 16.58 ? 397 TYR A CD1 1 
ATOM   1411 C CD2 . TYR A 1 186 ? 14.363  16.056  17.768  1.00 16.32 ? 397 TYR A CD2 1 
ATOM   1412 C CE1 . TYR A 1 186 ? 13.018  14.469  19.548  1.00 15.37 ? 397 TYR A CE1 1 
ATOM   1413 C CE2 . TYR A 1 186 ? 14.975  14.905  18.262  1.00 15.68 ? 397 TYR A CE2 1 
ATOM   1414 C CZ  . TYR A 1 186 ? 14.287  14.113  19.170  1.00 17.28 ? 397 TYR A CZ  1 
ATOM   1415 O OH  . TYR A 1 186 ? 14.871  12.969  19.689  1.00 14.89 ? 397 TYR A OH  1 
ATOM   1416 N N   . THR A 1 187 ? 11.123  18.950  20.047  1.00 17.70 ? 398 THR A N   1 
ATOM   1417 C CA  . THR A 1 187 ? 10.450  18.444  21.233  1.00 17.63 ? 398 THR A CA  1 
ATOM   1418 C C   . THR A 1 187 ? 9.444   17.387  20.743  1.00 18.19 ? 398 THR A C   1 
ATOM   1419 O O   . THR A 1 187 ? 9.196   17.238  19.538  1.00 17.91 ? 398 THR A O   1 
ATOM   1420 C CB  . THR A 1 187 ? 9.670   19.550  22.005  1.00 18.20 ? 398 THR A CB  1 
ATOM   1421 O OG1 . THR A 1 187 ? 8.622   20.031  21.158  1.00 18.74 ? 398 THR A OG1 1 
ATOM   1422 C CG2 . THR A 1 187 ? 10.607  20.729  22.525  1.00 17.00 ? 398 THR A CG2 1 
ATOM   1423 N N   . MET A 1 188 ? 8.849   16.690  21.694  1.00 18.49 ? 399 MET A N   1 
ATOM   1424 C CA  . MET A 1 188 ? 7.976   15.585  21.405  1.00 19.05 ? 399 MET A CA  1 
ATOM   1425 C C   . MET A 1 188 ? 6.643   15.779  22.142  1.00 19.86 ? 399 MET A C   1 
ATOM   1426 O O   . MET A 1 188 ? 6.628   16.143  23.319  1.00 18.44 ? 399 MET A O   1 
ATOM   1427 C CB  . MET A 1 188 ? 8.652   14.330  21.891  1.00 19.20 ? 399 MET A CB  1 
ATOM   1428 C CG  . MET A 1 188 ? 9.748   13.835  20.959  1.00 20.89 ? 399 MET A CG  1 
ATOM   1429 S SD  . MET A 1 188 ? 10.380  12.209  21.466  1.00 20.39 ? 399 MET A SD  1 
ATOM   1430 C CE  . MET A 1 188 ? 11.303  12.638  22.939  1.00 18.91 ? 399 MET A CE  1 
ATOM   1431 N N   . THR A 1 189 ? 5.547   15.507  21.437  1.00 20.47 ? 400 THR A N   1 
ATOM   1432 C CA  . THR A 1 189 ? 4.195   15.589  21.987  1.00 20.86 ? 400 THR A CA  1 
ATOM   1433 C C   . THR A 1 189 ? 3.652   14.185  21.843  1.00 20.84 ? 400 THR A C   1 
ATOM   1434 O O   . THR A 1 189 ? 3.758   13.595  20.761  1.00 19.11 ? 400 THR A O   1 
ATOM   1435 C CB  . THR A 1 189 ? 3.329   16.591  21.196  1.00 21.51 ? 400 THR A CB  1 
ATOM   1436 O OG1 . THR A 1 189 ? 3.917   17.899  21.310  1.00 22.21 ? 400 THR A OG1 1 
ATOM   1437 C CG2 . THR A 1 189 ? 1.819   16.614  21.675  1.00 21.75 ? 400 THR A CG2 1 
ATOM   1438 N N   . LEU A 1 190 ? 3.155   13.639  22.961  1.00 20.57 ? 401 LEU A N   1 
ATOM   1439 C CA  . LEU A 1 190 ? 2.607   12.329  23.002  1.00 20.57 ? 401 LEU A CA  1 
ATOM   1440 C C   . LEU A 1 190 ? 1.209   12.416  22.456  1.00 21.25 ? 401 LEU A C   1 
ATOM   1441 O O   . LEU A 1 190 ? 0.334   12.981  23.091  1.00 21.65 ? 401 LEU A O   1 
ATOM   1442 C CB  . LEU A 1 190 ? 2.585   11.801  24.434  1.00 20.92 ? 401 LEU A CB  1 
ATOM   1443 C CG  . LEU A 1 190 ? 2.143   10.349  24.624  1.00 20.68 ? 401 LEU A CG  1 
ATOM   1444 C CD1 . LEU A 1 190 ? 2.959   9.361   23.787  1.00 19.80 ? 401 LEU A CD1 1 
ATOM   1445 C CD2 . LEU A 1 190 ? 2.227   9.991   26.104  1.00 19.77 ? 401 LEU A CD2 1 
ATOM   1446 N N   . LEU A 1 191 ? 0.983   11.813  21.298  1.00 21.31 ? 402 LEU A N   1 
ATOM   1447 C CA  . LEU A 1 191 ? -0.345  11.813  20.690  1.00 21.42 ? 402 LEU A CA  1 
ATOM   1448 C C   . LEU A 1 191 ? -1.254  10.687  21.222  1.00 21.55 ? 402 LEU A C   1 
ATOM   1449 O O   . LEU A 1 191 ? -2.460  10.906  21.405  1.00 22.39 ? 402 LEU A O   1 
ATOM   1450 C CB  . LEU A 1 191 ? -0.218  11.721  19.187  1.00 21.25 ? 402 LEU A CB  1 
ATOM   1451 C CG  . LEU A 1 191 ? 0.428   12.901  18.455  1.00 22.02 ? 402 LEU A CG  1 
ATOM   1452 C CD1 . LEU A 1 191 ? 0.390   12.618  16.922  1.00 22.72 ? 402 LEU A CD1 1 
ATOM   1453 C CD2 . LEU A 1 191 ? -0.267  14.290  18.752  1.00 21.74 ? 402 LEU A CD2 1 
ATOM   1454 N N   . ASP A 1 192 ? -0.701  9.495   21.480  1.00 20.16 ? 403 ASP A N   1 
ATOM   1455 C CA  . ASP A 1 192 ? -1.508  8.376   21.976  1.00 19.40 ? 403 ASP A CA  1 
ATOM   1456 C C   . ASP A 1 192 ? -0.618  7.284   22.503  1.00 18.63 ? 403 ASP A C   1 
ATOM   1457 O O   . ASP A 1 192 ? 0.575   7.267   22.245  1.00 18.92 ? 403 ASP A O   1 
ATOM   1458 C CB  . ASP A 1 192 ? -2.421  7.844   20.882  1.00 20.27 ? 403 ASP A CB  1 
ATOM   1459 C CG  . ASP A 1 192 ? -3.755  7.330   21.400  1.00 21.05 ? 403 ASP A CG  1 
ATOM   1460 O OD1 . ASP A 1 192 ? -3.906  7.127   22.598  1.00 25.85 ? 403 ASP A OD1 1 
ATOM   1461 O OD2 . ASP A 1 192 ? -4.677  7.075   20.578  1.00 25.37 ? 403 ASP A OD2 1 
ATOM   1462 N N   . LEU A 1 193 ? -1.196  6.379   23.280  1.00 18.53 ? 404 LEU A N   1 
ATOM   1463 C CA  . LEU A 1 193 ? -0.423  5.407   24.000  1.00 17.35 ? 404 LEU A CA  1 
ATOM   1464 C C   . LEU A 1 193 ? -1.154  4.084   23.987  1.00 18.75 ? 404 LEU A C   1 
ATOM   1465 O O   . LEU A 1 193 ? -2.391  4.024   24.226  1.00 18.36 ? 404 LEU A O   1 
ATOM   1466 C CB  . LEU A 1 193 ? -0.199  5.889   25.422  1.00 17.86 ? 404 LEU A CB  1 
ATOM   1467 C CG  . LEU A 1 193 ? 0.495   4.916   26.348  1.00 13.91 ? 404 LEU A CG  1 
ATOM   1468 C CD1 . LEU A 1 193 ? 1.902   4.804   25.948  1.00 14.86 ? 404 LEU A CD1 1 
ATOM   1469 C CD2 . LEU A 1 193 ? 0.359   5.406   27.771  1.00 15.87 ? 404 LEU A CD2 1 
ATOM   1470 N N   . PHE A 1 194 ? -0.411  3.027   23.663  1.00 17.95 ? 405 PHE A N   1 
ATOM   1471 C CA  . PHE A 1 194 ? -0.976  1.673   23.619  1.00 18.58 ? 405 PHE A CA  1 
ATOM   1472 C C   . PHE A 1 194 ? -0.222  0.710   24.513  1.00 18.65 ? 405 PHE A C   1 
ATOM   1473 O O   . PHE A 1 194 ? 0.983   0.717   24.599  1.00 17.89 ? 405 PHE A O   1 
ATOM   1474 C CB  . PHE A 1 194 ? -0.947  1.125   22.189  1.00 18.60 ? 405 PHE A CB  1 
ATOM   1475 C CG  . PHE A 1 194 ? -1.633  2.020   21.202  1.00 18.11 ? 405 PHE A CG  1 
ATOM   1476 C CD1 . PHE A 1 194 ? -2.941  1.781   20.825  1.00 20.09 ? 405 PHE A CD1 1 
ATOM   1477 C CD2 . PHE A 1 194 ? -1.001  3.129   20.713  1.00 18.41 ? 405 PHE A CD2 1 
ATOM   1478 C CE1 . PHE A 1 194 ? -3.567  2.641   19.929  1.00 22.26 ? 405 PHE A CE1 1 
ATOM   1479 C CE2 . PHE A 1 194 ? -1.629  3.993   19.820  1.00 18.70 ? 405 PHE A CE2 1 
ATOM   1480 C CZ  . PHE A 1 194 ? -2.881  3.743   19.424  1.00 20.66 ? 405 PHE A CZ  1 
ATOM   1481 N N   . GLU A 1 195 ? -0.966  -0.134  25.188  1.00 19.39 ? 406 GLU A N   1 
ATOM   1482 C CA  . GLU A 1 195 ? -0.377  -1.255  25.840  1.00 20.39 ? 406 GLU A CA  1 
ATOM   1483 C C   . GLU A 1 195 ? -0.016  -2.311  24.761  1.00 18.72 ? 406 GLU A C   1 
ATOM   1484 O O   . GLU A 1 195 ? -0.743  -2.489  23.782  1.00 17.80 ? 406 GLU A O   1 
ATOM   1485 C CB  . GLU A 1 195 ? -1.388  -1.811  26.828  1.00 21.55 ? 406 GLU A CB  1 
ATOM   1486 C CG  . GLU A 1 195 ? -1.001  -3.095  27.516  1.00 27.06 ? 406 GLU A CG  1 
ATOM   1487 C CD  . GLU A 1 195 ? -2.113  -3.549  28.519  1.00 34.46 ? 406 GLU A CD  1 
ATOM   1488 O OE1 . GLU A 1 195 ? -2.415  -4.775  28.508  1.00 37.37 ? 406 GLU A OE1 1 
ATOM   1489 O OE2 . GLU A 1 195 ? -2.684  -2.674  29.272  1.00 34.66 ? 406 GLU A OE2 1 
ATOM   1490 N N   . VAL A 1 196 ? 1.109   -2.986  24.961  1.00 17.74 ? 407 VAL A N   1 
ATOM   1491 C CA  . VAL A 1 196 ? 1.606   -3.991  24.033  1.00 16.77 ? 407 VAL A CA  1 
ATOM   1492 C C   . VAL A 1 196 ? 1.715   -5.320  24.742  1.00 16.76 ? 407 VAL A C   1 
ATOM   1493 O O   . VAL A 1 196 ? 2.345   -5.414  25.794  1.00 16.37 ? 407 VAL A O   1 
ATOM   1494 C CB  . VAL A 1 196 ? 3.045   -3.644  23.554  1.00 15.95 ? 407 VAL A CB  1 
ATOM   1495 C CG1 . VAL A 1 196 ? 3.548   -4.683  22.518  1.00 15.01 ? 407 VAL A CG1 1 
ATOM   1496 C CG2 . VAL A 1 196 ? 3.077   -2.306  22.917  1.00 18.02 ? 407 VAL A CG2 1 
ATOM   1497 N N   . GLU A 1 197 ? 1.178   -6.361  24.133  1.00 17.19 ? 408 GLU A N   1 
ATOM   1498 C CA  . GLU A 1 197 ? 1.329   -7.713  24.650  1.00 18.17 ? 408 GLU A CA  1 
ATOM   1499 C C   . GLU A 1 197 ? 1.614   -8.652  23.513  1.00 18.94 ? 408 GLU A C   1 
ATOM   1500 O O   . GLU A 1 197 ? 0.723   -9.125  22.835  1.00 18.69 ? 408 GLU A O   1 
ATOM   1501 C CB  . GLU A 1 197 ? 0.074   -8.179  25.419  1.00 19.45 ? 408 GLU A CB  1 
ATOM   1502 C CG  . GLU A 1 197 ? 0.283   -9.490  26.176  1.00 22.20 ? 408 GLU A CG  1 
ATOM   1503 C CD  . GLU A 1 197 ? -0.907  -9.850  27.092  1.00 28.58 ? 408 GLU A CD  1 
ATOM   1504 O OE1 . GLU A 1 197 ? -0.923  -10.984 27.598  1.00 29.90 ? 408 GLU A OE1 1 
ATOM   1505 O OE2 . GLU A 1 197 ? -1.811  -8.996  27.312  1.00 33.50 ? 408 GLU A OE2 1 
ATOM   1506 N N   . LYS A 1 198 ? 2.890   -8.916  23.313  1.00 19.46 ? 409 LYS A N   1 
ATOM   1507 C CA  . LYS A 1 198 ? 3.317   -9.748  22.225  1.00 20.23 ? 409 LYS A CA  1 
ATOM   1508 C C   . LYS A 1 198 ? 3.200   -11.229 22.612  1.00 19.96 ? 409 LYS A C   1 
ATOM   1509 O O   . LYS A 1 198 ? 3.738   -11.639 23.628  1.00 19.67 ? 409 LYS A O   1 
ATOM   1510 C CB  . LYS A 1 198 ? 4.772   -9.398  21.911  1.00 20.14 ? 409 LYS A CB  1 
ATOM   1511 C CG  . LYS A 1 198 ? 5.475   -10.363 20.992  1.00 22.47 ? 409 LYS A CG  1 
ATOM   1512 C CD  . LYS A 1 198 ? 4.955   -10.198 19.646  1.00 27.47 ? 409 LYS A CD  1 
ATOM   1513 C CE  . LYS A 1 198 ? 5.416   -11.318 18.731  1.00 30.46 ? 409 LYS A CE  1 
ATOM   1514 N NZ  . LYS A 1 198 ? 4.434   -11.421 17.629  1.00 32.10 ? 409 LYS A NZ  1 
ATOM   1515 N N   . ASP A 1 199 ? 2.533   -12.028 21.788  1.00 21.87 ? 410 ASP A N   1 
ATOM   1516 C CA  . ASP A 1 199 ? 2.359   -13.467 22.077  1.00 23.77 ? 410 ASP A CA  1 
ATOM   1517 C C   . ASP A 1 199 ? 3.688   -14.102 22.461  1.00 22.88 ? 410 ASP A C   1 
ATOM   1518 O O   . ASP A 1 199 ? 4.646   -13.897 21.784  1.00 22.99 ? 410 ASP A O   1 
ATOM   1519 C CB  . ASP A 1 199 ? 1.839   -14.197 20.849  1.00 25.01 ? 410 ASP A CB  1 
ATOM   1520 C CG  . ASP A 1 199 ? 0.375   -13.877 20.540  1.00 29.61 ? 410 ASP A CG  1 
ATOM   1521 O OD1 . ASP A 1 199 ? -0.258  -13.072 21.273  1.00 33.32 ? 410 ASP A OD1 1 
ATOM   1522 O OD2 . ASP A 1 199 ? -0.133  -14.428 19.530  1.00 33.50 ? 410 ASP A OD2 1 
ATOM   1523 N N   . GLY A 1 200 ? 3.746   -14.821 23.576  1.00 23.47 ? 411 GLY A N   1 
ATOM   1524 C CA  . GLY A 1 200 ? 4.932   -15.592 23.940  1.00 23.35 ? 411 GLY A CA  1 
ATOM   1525 C C   . GLY A 1 200 ? 5.904   -14.848 24.839  1.00 23.70 ? 411 GLY A C   1 
ATOM   1526 O O   . GLY A 1 200 ? 6.690   -15.482 25.564  1.00 22.40 ? 411 GLY A O   1 
ATOM   1527 N N   . GLU A 1 201 ? 5.877   -13.506 24.821  1.00 23.39 ? 412 GLU A N   1 
ATOM   1528 C CA  . GLU A 1 201 ? 6.907   -12.775 25.542  1.00 23.90 ? 412 GLU A CA  1 
ATOM   1529 C C   . GLU A 1 201 ? 6.778   -12.913 27.054  1.00 24.65 ? 412 GLU A C   1 
ATOM   1530 O O   . GLU A 1 201 ? 7.784   -13.048 27.741  1.00 24.75 ? 412 GLU A O   1 
ATOM   1531 C CB  . GLU A 1 201 ? 6.951   -11.282 25.156  1.00 23.83 ? 412 GLU A CB  1 
ATOM   1532 C CG  . GLU A 1 201 ? 7.721   -11.011 23.870  1.00 22.96 ? 412 GLU A CG  1 
ATOM   1533 C CD  . GLU A 1 201 ? 8.101   -9.530  23.680  1.00 19.47 ? 412 GLU A CD  1 
ATOM   1534 O OE1 . GLU A 1 201 ? 7.424   -8.640  24.221  1.00 17.71 ? 412 GLU A OE1 1 
ATOM   1535 O OE2 . GLU A 1 201 ? 9.086   -9.271  22.977  1.00 22.87 ? 412 GLU A OE2 1 
ATOM   1536 N N   . LYS A 1 202 ? 5.557   -12.871 27.578  1.00 25.48 ? 413 LYS A N   1 
ATOM   1537 C CA  . LYS A 1 202 ? 5.355   -12.994 29.019  1.00 27.20 ? 413 LYS A CA  1 
ATOM   1538 C C   . LYS A 1 202 ? 5.902   -14.331 29.534  1.00 27.73 ? 413 LYS A C   1 
ATOM   1539 O O   . LYS A 1 202 ? 6.594   -14.361 30.543  1.00 28.33 ? 413 LYS A O   1 
ATOM   1540 C CB  . LYS A 1 202 ? 3.867   -12.840 29.368  1.00 28.05 ? 413 LYS A CB  1 
ATOM   1541 C CG  . LYS A 1 202 ? 3.486   -12.885 30.832  1.00 32.65 ? 413 LYS A CG  1 
ATOM   1542 C CD  . LYS A 1 202 ? 1.923   -12.886 30.958  1.00 37.68 ? 413 LYS A CD  1 
ATOM   1543 C CE  . LYS A 1 202 ? 1.430   -12.834 32.429  1.00 40.77 ? 413 LYS A CE  1 
ATOM   1544 N NZ  . LYS A 1 202 ? 1.678   -11.465 33.013  1.00 42.54 ? 413 LYS A NZ  1 
ATOM   1545 N N   . GLU A 1 203 ? 5.645   -15.429 28.835  1.00 28.52 ? 414 GLU A N   1 
ATOM   1546 C CA  . GLU A 1 203 ? 6.109   -16.736 29.346  1.00 29.88 ? 414 GLU A CA  1 
ATOM   1547 C C   . GLU A 1 203 ? 7.608   -16.952 29.101  1.00 28.72 ? 414 GLU A C   1 
ATOM   1548 O O   . GLU A 1 203 ? 8.255   -17.644 29.872  1.00 29.51 ? 414 GLU A O   1 
ATOM   1549 C CB  . GLU A 1 203 ? 5.270   -17.929 28.831  1.00 31.39 ? 414 GLU A CB  1 
ATOM   1550 C CG  . GLU A 1 203 ? 4.452   -17.702 27.547  1.00 35.64 ? 414 GLU A CG  1 
ATOM   1551 C CD  . GLU A 1 203 ? 3.346   -16.671 27.727  1.00 39.02 ? 414 GLU A CD  1 
ATOM   1552 O OE1 . GLU A 1 203 ? 3.498   -15.556 27.185  1.00 35.50 ? 414 GLU A OE1 1 
ATOM   1553 O OE2 . GLU A 1 203 ? 2.353   -16.970 28.444  1.00 41.50 ? 414 GLU A OE2 1 
ATOM   1554 N N   . ALA A 1 204 ? 8.182   -16.318 28.077  1.00 26.68 ? 415 ALA A N   1 
ATOM   1555 C CA  . ALA A 1 204 ? 9.608   -16.456 27.825  1.00 25.32 ? 415 ALA A CA  1 
ATOM   1556 C C   . ALA A 1 204 ? 10.473  -15.589 28.749  1.00 24.16 ? 415 ALA A C   1 
ATOM   1557 O O   . ALA A 1 204 ? 11.654  -15.861 28.960  1.00 22.90 ? 415 ALA A O   1 
ATOM   1558 C CB  . ALA A 1 204 ? 9.905   -16.163 26.338  1.00 24.50 ? 415 ALA A CB  1 
ATOM   1559 N N   . PHE A 1 205 ? 9.882   -14.565 29.352  1.00 23.63 ? 416 PHE A N   1 
ATOM   1560 C CA  . PHE A 1 205 ? 10.665  -13.505 29.960  1.00 23.20 ? 416 PHE A CA  1 
ATOM   1561 C C   . PHE A 1 205 ? 11.437  -13.921 31.196  1.00 24.05 ? 416 PHE A C   1 
ATOM   1562 O O   . PHE A 1 205 ? 10.946  -14.677 32.020  1.00 23.96 ? 416 PHE A O   1 
ATOM   1563 C CB  . PHE A 1 205 ? 9.742   -12.332 30.252  1.00 23.12 ? 416 PHE A CB  1 
ATOM   1564 C CG  . PHE A 1 205 ? 10.430  -11.115 30.796  1.00 23.17 ? 416 PHE A CG  1 
ATOM   1565 C CD1 . PHE A 1 205 ? 11.222  -10.320 29.982  1.00 21.26 ? 416 PHE A CD1 1 
ATOM   1566 C CD2 . PHE A 1 205 ? 10.206  -10.711 32.104  1.00 24.74 ? 416 PHE A CD2 1 
ATOM   1567 C CE1 . PHE A 1 205 ? 11.826  -9.173  30.477  1.00 22.27 ? 416 PHE A CE1 1 
ATOM   1568 C CE2 . PHE A 1 205 ? 10.808  -9.569  32.612  1.00 22.96 ? 416 PHE A CE2 1 
ATOM   1569 C CZ  . PHE A 1 205 ? 11.620  -8.791  31.810  1.00 23.21 ? 416 PHE A CZ  1 
ATOM   1570 N N   . ARG A 1 206 ? 12.660  -13.409 31.322  1.00 24.27 ? 417 ARG A N   1 
ATOM   1571 C CA  . ARG A 1 206 ? 13.517  -13.686 32.476  1.00 25.22 ? 417 ARG A CA  1 
ATOM   1572 C C   . ARG A 1 206 ? 13.078  -12.843 33.695  1.00 25.64 ? 417 ARG A C   1 
ATOM   1573 O O   . ARG A 1 206 ? 13.782  -11.932 34.130  1.00 23.36 ? 417 ARG A O   1 
ATOM   1574 C CB  . ARG A 1 206 ? 14.987  -13.401 32.154  1.00 25.21 ? 417 ARG A CB  1 
ATOM   1575 C CG  . ARG A 1 206 ? 15.618  -14.299 31.048  1.00 27.35 ? 417 ARG A CG  1 
ATOM   1576 C CD  . ARG A 1 206 ? 15.802  -15.711 31.512  1.00 28.37 ? 417 ARG A CD  1 
ATOM   1577 N NE  . ARG A 1 206 ? 16.602  -15.794 32.734  1.00 29.87 ? 417 ARG A NE  1 
ATOM   1578 C CZ  . ARG A 1 206 ? 17.930  -15.912 32.798  1.00 32.80 ? 417 ARG A CZ  1 
ATOM   1579 N NH1 . ARG A 1 206 ? 18.688  -15.959 31.706  1.00 32.29 ? 417 ARG A NH1 1 
ATOM   1580 N NH2 . ARG A 1 206 ? 18.509  -15.990 33.992  1.00 35.59 ? 417 ARG A NH2 1 
ATOM   1581 N N   . GLU A 1 207 ? 11.920  -13.211 34.239  1.00 27.25 ? 418 GLU A N   1 
ATOM   1582 C CA  . GLU A 1 207 ? 11.372  -12.641 35.484  1.00 29.14 ? 418 GLU A CA  1 
ATOM   1583 C C   . GLU A 1 207 ? 12.346  -12.712 36.638  1.00 29.77 ? 418 GLU A C   1 
ATOM   1584 O O   . GLU A 1 207 ? 12.376  -11.802 37.450  1.00 29.60 ? 418 GLU A O   1 
ATOM   1585 C CB  . GLU A 1 207 ? 10.101  -13.387 35.910  1.00 29.94 ? 418 GLU A CB  1 
ATOM   1586 C CG  . GLU A 1 207 ? 8.886   -13.110 35.041  1.00 34.40 ? 418 GLU A CG  1 
ATOM   1587 C CD  . GLU A 1 207 ? 7.583   -13.776 35.560  1.00 41.44 ? 418 GLU A CD  1 
ATOM   1588 O OE1 . GLU A 1 207 ? 7.553   -14.223 36.734  1.00 45.03 ? 418 GLU A OE1 1 
ATOM   1589 O OE2 . GLU A 1 207 ? 6.589   -13.847 34.784  1.00 45.07 ? 418 GLU A OE2 1 
ATOM   1590 N N   . ASP A 1 208 ? 13.122  -13.798 36.697  1.00 30.06 ? 419 ASP A N   1 
ATOM   1591 C CA  . ASP A 1 208 ? 14.073  -14.043 37.784  1.00 31.09 ? 419 ASP A CA  1 
ATOM   1592 C C   . ASP A 1 208 ? 15.151  -12.974 37.884  1.00 31.14 ? 419 ASP A C   1 
ATOM   1593 O O   . ASP A 1 208 ? 15.594  -12.613 38.993  1.00 32.81 ? 419 ASP A O   1 
ATOM   1594 C CB  . ASP A 1 208 ? 14.720  -15.434 37.621  1.00 31.85 ? 419 ASP A CB  1 
ATOM   1595 C CG  . ASP A 1 208 ? 15.565  -15.565 36.321  1.00 32.23 ? 419 ASP A CG  1 
ATOM   1596 O OD1 . ASP A 1 208 ? 15.014  -15.419 35.188  1.00 31.71 ? 419 ASP A OD1 1 
ATOM   1597 O OD2 . ASP A 1 208 ? 16.779  -15.820 36.440  1.00 33.44 ? 419 ASP A OD2 1 
ATOM   1598 N N   . LEU A 1 209 ? 15.575  -12.421 36.759  1.00 29.30 ? 420 LEU A N   1 
ATOM   1599 C CA  . LEU A 1 209 ? 16.737  -11.528 36.813  1.00 28.51 ? 420 LEU A CA  1 
ATOM   1600 C C   . LEU A 1 209 ? 16.449  -10.233 37.561  1.00 28.04 ? 420 LEU A C   1 
ATOM   1601 O O   . LEU A 1 209 ? 15.366  -9.688  37.452  1.00 27.55 ? 420 LEU A O   1 
ATOM   1602 C CB  . LEU A 1 209 ? 17.253  -11.207 35.403  1.00 27.32 ? 420 LEU A CB  1 
ATOM   1603 C CG  . LEU A 1 209 ? 18.005  -12.339 34.711  1.00 25.68 ? 420 LEU A CG  1 
ATOM   1604 C CD1 . LEU A 1 209 ? 18.389  -11.922 33.264  1.00 24.54 ? 420 LEU A CD1 1 
ATOM   1605 C CD2 . LEU A 1 209 ? 19.234  -12.705 35.538  1.00 23.93 ? 420 LEU A CD2 1 
ATOM   1606 N N   . HIS A 1 210 ? 17.438  -9.741  38.290  1.00 28.00 ? 421 HIS A N   1 
ATOM   1607 C CA  . HIS A 1 210 ? 17.326  -8.440  38.961  1.00 29.33 ? 421 HIS A CA  1 
ATOM   1608 C C   . HIS A 1 210 ? 17.519  -7.283  37.967  1.00 28.41 ? 421 HIS A C   1 
ATOM   1609 O O   . HIS A 1 210 ? 17.841  -7.503  36.789  1.00 27.42 ? 421 HIS A O   1 
ATOM   1610 C CB  . HIS A 1 210 ? 18.349  -8.343  40.097  1.00 30.30 ? 421 HIS A CB  1 
ATOM   1611 C CG  . HIS A 1 210 ? 19.743  -8.763  39.705  1.00 33.99 ? 421 HIS A CG  1 
ATOM   1612 N ND1 . HIS A 1 210 ? 20.038  -10.003 39.156  1.00 37.49 ? 421 HIS A ND1 1 
ATOM   1613 C CD2 . HIS A 1 210 ? 20.931  -8.123  39.830  1.00 36.57 ? 421 HIS A CD2 1 
ATOM   1614 C CE1 . HIS A 1 210 ? 21.334  -10.095 38.940  1.00 35.93 ? 421 HIS A CE1 1 
ATOM   1615 N NE2 . HIS A 1 210 ? 21.904  -8.973  39.357  1.00 37.60 ? 421 HIS A NE2 1 
ATOM   1616 N N   . ASN A 1 211 ? 17.328  -6.060  38.451  1.00 27.96 ? 422 ASN A N   1 
ATOM   1617 C CA  . ASN A 1 211 ? 17.583  -4.867  37.679  1.00 28.38 ? 422 ASN A CA  1 
ATOM   1618 C C   . ASN A 1 211 ? 16.685  -4.801  36.421  1.00 26.69 ? 422 ASN A C   1 
ATOM   1619 O O   . ASN A 1 211 ? 17.175  -4.644  35.298  1.00 26.04 ? 422 ASN A O   1 
ATOM   1620 C CB  . ASN A 1 211 ? 19.061  -4.907  37.286  1.00 29.52 ? 422 ASN A CB  1 
ATOM   1621 C CG  . ASN A 1 211 ? 19.582  -3.598  36.821  1.00 33.12 ? 422 ASN A CG  1 
ATOM   1622 O OD1 . ASN A 1 211 ? 19.022  -2.536  37.107  1.00 39.28 ? 422 ASN A OD1 1 
ATOM   1623 N ND2 . ASN A 1 211 ? 20.709  -3.653  36.101  1.00 38.32 ? 422 ASN A ND2 1 
ATOM   1624 N N   . ARG A 1 212 ? 15.383  -4.999  36.619  1.00 23.92 ? 423 ARG A N   1 
ATOM   1625 C CA  . ARG A 1 212 ? 14.423  -4.919  35.549  1.00 22.05 ? 423 ARG A CA  1 
ATOM   1626 C C   . ARG A 1 212 ? 14.016  -3.459  35.429  1.00 21.48 ? 423 ARG A C   1 
ATOM   1627 O O   . ARG A 1 212 ? 13.503  -2.857  36.390  1.00 21.59 ? 423 ARG A O   1 
ATOM   1628 C CB  . ARG A 1 212 ? 13.220  -5.799  35.847  1.00 22.18 ? 423 ARG A CB  1 
ATOM   1629 C CG  . ARG A 1 212 ? 12.227  -5.912  34.694  1.00 22.14 ? 423 ARG A CG  1 
ATOM   1630 C CD  . ARG A 1 212 ? 10.925  -6.606  35.107  1.00 20.65 ? 423 ARG A CD  1 
ATOM   1631 N NE  . ARG A 1 212 ? 11.140  -7.866  35.811  1.00 20.62 ? 423 ARG A NE  1 
ATOM   1632 C CZ  . ARG A 1 212 ? 10.242  -8.439  36.620  1.00 23.85 ? 423 ARG A CZ  1 
ATOM   1633 N NH1 . ARG A 1 212 ? 9.057   -7.872  36.835  1.00 21.80 ? 423 ARG A NH1 1 
ATOM   1634 N NH2 . ARG A 1 212 ? 10.521  -9.578  37.202  1.00 23.92 ? 423 ARG A NH2 1 
ATOM   1635 N N   . MET A 1 213 ? 14.247  -2.884  34.253  1.00 19.78 ? 424 MET A N   1 
ATOM   1636 C CA  . MET A 1 213 ? 13.994  -1.479  33.999  1.00 18.32 ? 424 MET A CA  1 
ATOM   1637 C C   . MET A 1 213 ? 13.117  -1.332  32.768  1.00 17.29 ? 424 MET A C   1 
ATOM   1638 O O   . MET A 1 213 ? 13.182  -2.146  31.823  1.00 16.36 ? 424 MET A O   1 
ATOM   1639 C CB  . MET A 1 213 ? 15.319  -0.760  33.737  1.00 19.06 ? 424 MET A CB  1 
ATOM   1640 C CG  . MET A 1 213 ? 16.302  -0.775  34.880  1.00 21.98 ? 424 MET A CG  1 
ATOM   1641 S SD  . MET A 1 213 ? 17.695  0.309   34.490  1.00 27.65 ? 424 MET A SD  1 
ATOM   1642 C CE  . MET A 1 213 ? 17.047  1.901   34.925  1.00 24.30 ? 424 MET A CE  1 
ATOM   1643 N N   . LEU A 1 214 ? 12.316  -0.266  32.764  1.00 16.19 ? 425 LEU A N   1 
ATOM   1644 C CA  . LEU A 1 214 ? 11.469  0.073   31.642  1.00 15.41 ? 425 LEU A CA  1 
ATOM   1645 C C   . LEU A 1 214 ? 12.236  1.074   30.785  1.00 15.39 ? 425 LEU A C   1 
ATOM   1646 O O   . LEU A 1 214 ? 12.471  2.226   31.197  1.00 14.37 ? 425 LEU A O   1 
ATOM   1647 C CB  . LEU A 1 214 ? 10.140  0.663   32.099  1.00 15.01 ? 425 LEU A CB  1 
ATOM   1648 C CG  . LEU A 1 214 ? 9.000   0.849   31.104  1.00 15.09 ? 425 LEU A CG  1 
ATOM   1649 C CD1 . LEU A 1 214 ? 8.379   -0.487  30.759  1.00 15.21 ? 425 LEU A CD1 1 
ATOM   1650 C CD2 . LEU A 1 214 ? 7.936   1.856   31.680  1.00 13.45 ? 425 LEU A CD2 1 
ATOM   1651 N N   . LEU A 1 215 ? 12.636  0.620   29.593  1.00 14.45 ? 426 LEU A N   1 
ATOM   1652 C CA  . LEU A 1 215 ? 13.586  1.374   28.773  1.00 14.84 ? 426 LEU A CA  1 
ATOM   1653 C C   . LEU A 1 215 ? 13.076  1.566   27.371  1.00 13.88 ? 426 LEU A C   1 
ATOM   1654 O O   . LEU A 1 215 ? 12.227  0.812   26.866  1.00 12.48 ? 426 LEU A O   1 
ATOM   1655 C CB  . LEU A 1 215 ? 14.931  0.677   28.713  1.00 14.68 ? 426 LEU A CB  1 
ATOM   1656 C CG  . LEU A 1 215 ? 15.615  0.422   30.026  1.00 15.87 ? 426 LEU A CG  1 
ATOM   1657 C CD1 . LEU A 1 215 ? 16.900  -0.373  29.775  1.00 13.41 ? 426 LEU A CD1 1 
ATOM   1658 C CD2 . LEU A 1 215 ? 15.920  1.749   30.652  1.00 13.13 ? 426 LEU A CD2 1 
ATOM   1659 N N   . TRP A 1 216 ? 13.637  2.603   26.760  1.00 14.00 ? 427 TRP A N   1 
ATOM   1660 C CA  . TRP A 1 216 ? 13.228  3.104   25.453  1.00 13.23 ? 427 TRP A CA  1 
ATOM   1661 C C   . TRP A 1 216 ? 13.834  2.342   24.283  1.00 12.66 ? 427 TRP A C   1 
ATOM   1662 O O   . TRP A 1 216 ? 15.012  1.990   24.301  1.00 12.99 ? 427 TRP A O   1 
ATOM   1663 C CB  . TRP A 1 216 ? 13.660  4.556   25.299  1.00 12.81 ? 427 TRP A CB  1 
ATOM   1664 C CG  . TRP A 1 216 ? 13.050  5.506   26.260  1.00 13.60 ? 427 TRP A CG  1 
ATOM   1665 C CD1 . TRP A 1 216 ? 13.662  6.079   27.329  1.00 13.22 ? 427 TRP A CD1 1 
ATOM   1666 C CD2 . TRP A 1 216 ? 11.694  5.957   26.272  1.00 13.20 ? 427 TRP A CD2 1 
ATOM   1667 N NE1 . TRP A 1 216 ? 12.778  6.885   27.995  1.00 16.28 ? 427 TRP A NE1 1 
ATOM   1668 C CE2 . TRP A 1 216 ? 11.553  6.812   27.379  1.00 14.60 ? 427 TRP A CE2 1 
ATOM   1669 C CE3 . TRP A 1 216 ? 10.590  5.737   25.447  1.00 14.11 ? 427 TRP A CE3 1 
ATOM   1670 C CZ2 . TRP A 1 216 ? 10.351  7.450   27.685  1.00 16.46 ? 427 TRP A CZ2 1 
ATOM   1671 C CZ3 . TRP A 1 216 ? 9.369   6.354   25.775  1.00 17.44 ? 427 TRP A CZ3 1 
ATOM   1672 C CH2 . TRP A 1 216 ? 9.273   7.217   26.873  1.00 17.53 ? 427 TRP A CH2 1 
ATOM   1673 N N   . HIS A 1 217 ? 13.056  2.221   23.208  1.00 12.62 ? 428 HIS A N   1 
ATOM   1674 C CA  . HIS A 1 217 ? 13.613  1.790   21.931  1.00 11.28 ? 428 HIS A CA  1 
ATOM   1675 C C   . HIS A 1 217 ? 12.933  2.521   20.821  1.00 11.46 ? 428 HIS A C   1 
ATOM   1676 O O   . HIS A 1 217 ? 11.678  2.520   20.764  1.00 11.51 ? 428 HIS A O   1 
ATOM   1677 C CB  . HIS A 1 217 ? 13.463  0.270   21.710  1.00 11.15 ? 428 HIS A CB  1 
ATOM   1678 C CG  . HIS A 1 217 ? 14.131  -0.196  20.444  1.00 10.93 ? 428 HIS A CG  1 
ATOM   1679 N ND1 . HIS A 1 217 ? 15.439  -0.646  20.411  1.00 11.66 ? 428 HIS A ND1 1 
ATOM   1680 C CD2 . HIS A 1 217 ? 13.703  -0.192  19.154  1.00 11.68 ? 428 HIS A CD2 1 
ATOM   1681 C CE1 . HIS A 1 217 ? 15.772  -0.924  19.159  1.00 11.97 ? 428 HIS A CE1 1 
ATOM   1682 N NE2 . HIS A 1 217 ? 14.734  -0.681  18.378  1.00 9.04  ? 428 HIS A NE2 1 
ATOM   1683 N N   . GLY A 1 218 ? 13.733  3.174   19.961  1.00 11.42 ? 429 GLY A N   1 
ATOM   1684 C CA  . GLY A 1 218 ? 13.220  3.896   18.809  1.00 11.51 ? 429 GLY A CA  1 
ATOM   1685 C C   . GLY A 1 218 ? 13.599  3.165   17.512  1.00 12.30 ? 429 GLY A C   1 
ATOM   1686 O O   . GLY A 1 218 ? 14.672  2.601   17.405  1.00 12.76 ? 429 GLY A O   1 
ATOM   1687 N N   . SER A 1 219 ? 12.765  3.243   16.489  1.00 13.05 ? 430 SER A N   1 
ATOM   1688 C CA  . SER A 1 219 ? 13.094  2.629   15.188  1.00 13.21 ? 430 SER A CA  1 
ATOM   1689 C C   . SER A 1 219 ? 12.393  3.335   14.060  1.00 13.64 ? 430 SER A C   1 
ATOM   1690 O O   . SER A 1 219 ? 11.532  4.132   14.280  1.00 14.20 ? 430 SER A O   1 
ATOM   1691 C CB  . SER A 1 219 ? 12.734  1.130   15.155  1.00 13.68 ? 430 SER A CB  1 
ATOM   1692 O OG  . SER A 1 219 ? 13.413  0.426   14.076  1.00 13.24 ? 430 SER A OG  1 
ATOM   1693 N N   . ARG A 1 220 ? 12.775  3.022   12.832  1.00 14.59 ? 431 ARG A N   1 
ATOM   1694 C CA  . ARG A 1 220 ? 12.184  3.659   11.675  1.00 14.39 ? 431 ARG A CA  1 
ATOM   1695 C C   . ARG A 1 220 ? 10.733  3.224   11.501  1.00 14.86 ? 431 ARG A C   1 
ATOM   1696 O O   . ARG A 1 220 ? 10.343  2.124   11.920  1.00 14.08 ? 431 ARG A O   1 
ATOM   1697 C CB  . ARG A 1 220 ? 12.998  3.313   10.434  1.00 14.49 ? 431 ARG A CB  1 
ATOM   1698 C CG  . ARG A 1 220 ? 14.370  3.937   10.455  1.00 15.39 ? 431 ARG A CG  1 
ATOM   1699 C CD  . ARG A 1 220 ? 15.211  3.492   9.279   1.00 15.96 ? 431 ARG A CD  1 
ATOM   1700 N NE  . ARG A 1 220 ? 16.575  4.055   9.372   1.00 17.63 ? 431 ARG A NE  1 
ATOM   1701 C CZ  . ARG A 1 220 ? 16.952  5.189   8.786   1.00 18.05 ? 431 ARG A CZ  1 
ATOM   1702 N NH1 . ARG A 1 220 ? 16.074  5.890   8.082   1.00 20.19 ? 431 ARG A NH1 1 
ATOM   1703 N NH2 . ARG A 1 220 ? 18.200  5.633   8.922   1.00 18.16 ? 431 ARG A NH2 1 
ATOM   1704 N N   . MET A 1 221 ? 9.934   4.073   10.873  1.00 15.53 ? 432 MET A N   1 
ATOM   1705 C CA  . MET A 1 221 ? 8.506   3.754   10.681  1.00 16.59 ? 432 MET A CA  1 
ATOM   1706 C C   . MET A 1 221 ? 8.275   2.531   9.882   1.00 16.62 ? 432 MET A C   1 
ATOM   1707 O O   . MET A 1 221 ? 7.240   1.885   10.040  1.00 18.01 ? 432 MET A O   1 
ATOM   1708 C CB  . MET A 1 221 ? 7.723   4.935   10.069  1.00 17.57 ? 432 MET A CB  1 
ATOM   1709 C CG  . MET A 1 221 ? 7.416   6.008   11.079  1.00 18.88 ? 432 MET A CG  1 
ATOM   1710 S SD  . MET A 1 221 ? 6.412   5.451   12.505  1.00 19.84 ? 432 MET A SD  1 
ATOM   1711 C CE  . MET A 1 221 ? 4.918   4.925   11.604  1.00 11.77 ? 432 MET A CE  1 
ATOM   1712 N N   . SER A 1 222 ? 9.259   2.168   9.063   1.00 16.74 ? 433 SER A N   1 
ATOM   1713 C CA  . SER A 1 222 ? 9.178   1.007   8.199   1.00 17.29 ? 433 SER A CA  1 
ATOM   1714 C C   . SER A 1 222 ? 9.280   -0.291  8.975   1.00 17.09 ? 433 SER A C   1 
ATOM   1715 O O   . SER A 1 222 ? 8.892   -1.339  8.459   1.00 18.43 ? 433 SER A O   1 
ATOM   1716 C CB  . SER A 1 222 ? 10.323  1.050   7.157   1.00 18.06 ? 433 SER A CB  1 
ATOM   1717 O OG  . SER A 1 222 ? 11.579  1.225   7.785   1.00 17.39 ? 433 SER A OG  1 
ATOM   1718 N N   . ASN A 1 223 ? 9.803   -0.221  10.199  1.00 15.57 ? 434 ASN A N   1 
ATOM   1719 C CA  . ASN A 1 223 ? 10.209  -1.392  10.923  1.00 14.44 ? 434 ASN A CA  1 
ATOM   1720 C C   . ASN A 1 223 ? 9.181   -1.967  11.917  1.00 15.01 ? 434 ASN A C   1 
ATOM   1721 O O   . ASN A 1 223 ? 9.348   -3.118  12.345  1.00 14.29 ? 434 ASN A O   1 
ATOM   1722 C CB  . ASN A 1 223 ? 11.547  -1.122  11.633  1.00 14.12 ? 434 ASN A CB  1 
ATOM   1723 C CG  . ASN A 1 223 ? 12.697  -0.799  10.637  1.00 14.96 ? 434 ASN A CG  1 
ATOM   1724 O OD1 . ASN A 1 223 ? 12.498  -0.710  9.408   1.00 13.20 ? 434 ASN A OD1 1 
ATOM   1725 N ND2 . ASN A 1 223 ? 13.878  -0.572  11.175  1.00 14.21 ? 434 ASN A ND2 1 
ATOM   1726 N N   . TRP A 1 224 ? 8.131   -1.215  12.248  1.00 13.14 ? 435 TRP A N   1 
ATOM   1727 C CA  . TRP A 1 224 ? 7.256   -1.592  13.363  1.00 14.06 ? 435 TRP A CA  1 
ATOM   1728 C C   . TRP A 1 224 ? 6.481   -2.864  13.103  1.00 14.70 ? 435 TRP A C   1 
ATOM   1729 O O   . TRP A 1 224 ? 6.274   -3.659  13.996  1.00 15.54 ? 435 TRP A O   1 
ATOM   1730 C CB  . TRP A 1 224 ? 6.312   -0.415  13.726  1.00 13.01 ? 435 TRP A CB  1 
ATOM   1731 C CG  . TRP A 1 224 ? 7.102   0.752   14.266  1.00 11.15 ? 435 TRP A CG  1 
ATOM   1732 C CD1 . TRP A 1 224 ? 7.253   1.978   13.697  1.00 10.42 ? 435 TRP A CD1 1 
ATOM   1733 C CD2 . TRP A 1 224 ? 7.899   0.753   15.443  1.00 9.45  ? 435 TRP A CD2 1 
ATOM   1734 N NE1 . TRP A 1 224 ? 8.088   2.747   14.462  1.00 13.24 ? 435 TRP A NE1 1 
ATOM   1735 C CE2 . TRP A 1 224 ? 8.484   2.021   15.550  1.00 10.92 ? 435 TRP A CE2 1 
ATOM   1736 C CE3 . TRP A 1 224 ? 8.134   -0.184  16.448  1.00 11.53 ? 435 TRP A CE3 1 
ATOM   1737 C CZ2 . TRP A 1 224 ? 9.298   2.379   16.612  1.00 13.57 ? 435 TRP A CZ2 1 
ATOM   1738 C CZ3 . TRP A 1 224 ? 8.952   0.175   17.518  1.00 11.39 ? 435 TRP A CZ3 1 
ATOM   1739 C CH2 . TRP A 1 224 ? 9.518   1.435   17.590  1.00 12.37 ? 435 TRP A CH2 1 
ATOM   1740 N N   . VAL A 1 225 ? 6.070   -3.072  11.874  1.00 14.97 ? 436 VAL A N   1 
ATOM   1741 C CA  . VAL A 1 225 ? 5.349   -4.291  11.580  1.00 17.13 ? 436 VAL A CA  1 
ATOM   1742 C C   . VAL A 1 225 ? 6.227   -5.522  11.861  1.00 17.34 ? 436 VAL A C   1 
ATOM   1743 O O   . VAL A 1 225 ? 5.778   -6.508  12.471  1.00 16.90 ? 436 VAL A O   1 
ATOM   1744 C CB  . VAL A 1 225 ? 4.765   -4.276  10.148  1.00 16.54 ? 436 VAL A CB  1 
ATOM   1745 C CG1 . VAL A 1 225 ? 4.306   -5.704  9.760   1.00 18.19 ? 436 VAL A CG1 1 
ATOM   1746 C CG2 . VAL A 1 225 ? 3.588   -3.301  10.105  1.00 17.39 ? 436 VAL A CG2 1 
ATOM   1747 N N   . GLY A 1 226 ? 7.483   -5.437  11.450  1.00 17.31 ? 437 GLY A N   1 
ATOM   1748 C CA  . GLY A 1 226 ? 8.489   -6.444  11.808  1.00 17.28 ? 437 GLY A CA  1 
ATOM   1749 C C   . GLY A 1 226 ? 8.699   -6.600  13.295  1.00 17.41 ? 437 GLY A C   1 
ATOM   1750 O O   . GLY A 1 226 ? 8.697   -7.726  13.840  1.00 15.78 ? 437 GLY A O   1 
ATOM   1751 N N   . ILE A 1 227 ? 8.857   -5.463  13.974  1.00 17.14 ? 438 ILE A N   1 
ATOM   1752 C CA  . ILE A 1 227 ? 9.189   -5.495  15.398  1.00 15.86 ? 438 ILE A CA  1 
ATOM   1753 C C   . ILE A 1 227 ? 8.008   -6.076  16.184  1.00 16.08 ? 438 ILE A C   1 
ATOM   1754 O O   . ILE A 1 227 ? 8.207   -6.807  17.112  1.00 14.89 ? 438 ILE A O   1 
ATOM   1755 C CB  . ILE A 1 227 ? 9.622   -4.110  15.925  1.00 15.71 ? 438 ILE A CB  1 
ATOM   1756 C CG1 . ILE A 1 227 ? 10.959  -3.722  15.286  1.00 13.76 ? 438 ILE A CG1 1 
ATOM   1757 C CG2 . ILE A 1 227 ? 9.727   -4.087  17.514  1.00 13.10 ? 438 ILE A CG2 1 
ATOM   1758 C CD1 . ILE A 1 227 ? 11.350  -2.204  15.421  1.00 11.22 ? 438 ILE A CD1 1 
ATOM   1759 N N   . LEU A 1 228 ? 6.787   -5.774  15.775  1.00 16.10 ? 439 LEU A N   1 
ATOM   1760 C CA  . LEU A 1 228 ? 5.640   -6.177  16.546  1.00 16.62 ? 439 LEU A CA  1 
ATOM   1761 C C   . LEU A 1 228 ? 5.286   -7.639  16.254  1.00 17.75 ? 439 LEU A C   1 
ATOM   1762 O O   . LEU A 1 228 ? 4.918   -8.376  17.161  1.00 17.80 ? 439 LEU A O   1 
ATOM   1763 C CB  . LEU A 1 228 ? 4.453   -5.243  16.262  1.00 16.40 ? 439 LEU A CB  1 
ATOM   1764 C CG  . LEU A 1 228 ? 4.669   -3.817  16.785  1.00 15.84 ? 439 LEU A CG  1 
ATOM   1765 C CD1 . LEU A 1 228 ? 3.458   -2.985  16.561  1.00 14.45 ? 439 LEU A CD1 1 
ATOM   1766 C CD2 . LEU A 1 228 ? 5.025   -3.793  18.250  1.00 11.56 ? 439 LEU A CD2 1 
ATOM   1767 N N   . SER A 1 229 ? 5.432   -8.045  15.001  1.00 18.25 ? 440 SER A N   1 
ATOM   1768 C CA  . SER A 1 229 ? 5.124   -9.383  14.591  1.00 19.10 ? 440 SER A CA  1 
ATOM   1769 C C   . SER A 1 229 ? 6.189   -10.375 14.983  1.00 19.24 ? 440 SER A C   1 
ATOM   1770 O O   . SER A 1 229 ? 5.858   -11.523 15.338  1.00 19.23 ? 440 SER A O   1 
ATOM   1771 C CB  . SER A 1 229 ? 4.863   -9.451  13.085  1.00 19.84 ? 440 SER A CB  1 
ATOM   1772 O OG  . SER A 1 229 ? 5.971   -8.983  12.329  1.00 20.02 ? 440 SER A OG  1 
ATOM   1773 N N   . HIS A 1 230 ? 7.446   -9.952  14.973  1.00 18.78 ? 441 HIS A N   1 
ATOM   1774 C CA  . HIS A 1 230 ? 8.546   -10.849 15.308  1.00 19.17 ? 441 HIS A CA  1 
ATOM   1775 C C   . HIS A 1 230 ? 9.332   -10.525 16.550  1.00 19.02 ? 441 HIS A C   1 
ATOM   1776 O O   . HIS A 1 230 ? 10.254  -11.266 16.897  1.00 19.05 ? 441 HIS A O   1 
ATOM   1777 C CB  . HIS A 1 230 ? 9.535   -10.910 14.163  1.00 19.71 ? 441 HIS A CB  1 
ATOM   1778 C CG  . HIS A 1 230 ? 9.070   -11.708 12.997  1.00 21.10 ? 441 HIS A CG  1 
ATOM   1779 N ND1 . HIS A 1 230 ? 7.937   -11.387 12.287  1.00 24.18 ? 441 HIS A ND1 1 
ATOM   1780 C CD2 . HIS A 1 230 ? 9.629   -12.767 12.363  1.00 22.81 ? 441 HIS A CD2 1 
ATOM   1781 C CE1 . HIS A 1 230 ? 7.796   -12.240 11.283  1.00 27.15 ? 441 HIS A CE1 1 
ATOM   1782 N NE2 . HIS A 1 230 ? 8.819   -13.077 11.302  1.00 25.84 ? 441 HIS A NE2 1 
ATOM   1783 N N   . GLY A 1 231 ? 9.035   -9.419  17.227  1.00 17.62 ? 442 GLY A N   1 
ATOM   1784 C CA  . GLY A 1 231 ? 9.924   -9.021  18.303  1.00 16.88 ? 442 GLY A CA  1 
ATOM   1785 C C   . GLY A 1 231 ? 11.183  -8.270  17.859  1.00 16.31 ? 442 GLY A C   1 
ATOM   1786 O O   . GLY A 1 231 ? 11.556  -8.209  16.669  1.00 14.99 ? 442 GLY A O   1 
ATOM   1787 N N   . LEU A 1 232 ? 11.810  -7.627  18.835  1.00 16.04 ? 443 LEU A N   1 
ATOM   1788 C CA  . LEU A 1 232 ? 13.126  -7.072  18.654  1.00 16.28 ? 443 LEU A CA  1 
ATOM   1789 C C   . LEU A 1 232 ? 14.038  -8.298  18.523  1.00 16.24 ? 443 LEU A C   1 
ATOM   1790 O O   . LEU A 1 232 ? 13.931  -9.221  19.317  1.00 16.12 ? 443 LEU A O   1 
ATOM   1791 C CB  . LEU A 1 232 ? 13.528  -6.202  19.841  1.00 15.08 ? 443 LEU A CB  1 
ATOM   1792 C CG  . LEU A 1 232 ? 12.759  -4.885  19.902  1.00 14.80 ? 443 LEU A CG  1 
ATOM   1793 C CD1 . LEU A 1 232 ? 12.976  -4.241  21.254  1.00 13.05 ? 443 LEU A CD1 1 
ATOM   1794 C CD2 . LEU A 1 232 ? 13.141  -3.897  18.720  1.00 12.41 ? 443 LEU A CD2 1 
ATOM   1795 N N   . ARG A 1 233 ? 14.876  -8.329  17.494  1.00 15.75 ? 444 ARG A N   1 
ATOM   1796 C CA  . ARG A 1 233 ? 15.667  -9.549  17.176  1.00 17.52 ? 444 ARG A CA  1 
ATOM   1797 C C   . ARG A 1 233 ? 17.156  -9.235  17.177  1.00 17.92 ? 444 ARG A C   1 
ATOM   1798 O O   . ARG A 1 233 ? 17.571  -8.075  17.002  1.00 18.31 ? 444 ARG A O   1 
ATOM   1799 C CB  . ARG A 1 233 ? 15.281  -10.137 15.819  1.00 17.69 ? 444 ARG A CB  1 
ATOM   1800 C CG  . ARG A 1 233 ? 13.872  -10.758 15.648  1.00 19.68 ? 444 ARG A CG  1 
ATOM   1801 C CD  . ARG A 1 233 ? 13.288  -10.407 14.202  1.00 21.72 ? 444 ARG A CD  1 
ATOM   1802 N NE  . ARG A 1 233 ? 12.750  -9.024  14.185  1.00 24.11 ? 444 ARG A NE  1 
ATOM   1803 C CZ  . ARG A 1 233 ? 12.506  -8.257  13.109  1.00 25.93 ? 444 ARG A CZ  1 
ATOM   1804 N NH1 . ARG A 1 233 ? 12.722  -8.688  11.888  1.00 27.31 ? 444 ARG A NH1 1 
ATOM   1805 N NH2 . ARG A 1 233 ? 12.068  -7.010  13.262  1.00 26.94 ? 444 ARG A NH2 1 
ATOM   1806 N N   . ILE A 1 234 ? 17.931  -10.286 17.407  1.00 17.85 ? 445 ILE A N   1 
ATOM   1807 C CA  . ILE A 1 234 ? 19.385  -10.320 17.279  1.00 18.42 ? 445 ILE A CA  1 
ATOM   1808 C C   . ILE A 1 234 ? 19.763  -10.188 15.793  1.00 18.25 ? 445 ILE A C   1 
ATOM   1809 O O   . ILE A 1 234 ? 19.176  -10.827 14.967  1.00 17.75 ? 445 ILE A O   1 
ATOM   1810 C CB  . ILE A 1 234 ? 19.885  -11.684 17.798  1.00 18.76 ? 445 ILE A CB  1 
ATOM   1811 C CG1 . ILE A 1 234 ? 19.501  -11.877 19.285  1.00 18.53 ? 445 ILE A CG1 1 
ATOM   1812 C CG2 . ILE A 1 234 ? 21.411  -11.879 17.623  1.00 19.93 ? 445 ILE A CG2 1 
ATOM   1813 C CD1 . ILE A 1 234 ? 19.937  -10.663 20.190  1.00 15.08 ? 445 ILE A CD1 1 
ATOM   1814 N N   . ALA A 1 235 ? 20.732  -9.334  15.482  1.00 18.44 ? 446 ALA A N   1 
ATOM   1815 C CA  . ALA A 1 235 ? 21.034  -8.934  14.084  1.00 17.86 ? 446 ALA A CA  1 
ATOM   1816 C C   . ALA A 1 235 ? 21.468  -10.173 13.296  1.00 18.07 ? 446 ALA A C   1 
ATOM   1817 O O   . ALA A 1 235 ? 21.942  -11.149 13.857  1.00 17.58 ? 446 ALA A O   1 
ATOM   1818 C CB  . ALA A 1 235 ? 22.161  -7.830  14.060  1.00 16.31 ? 446 ALA A CB  1 
ATOM   1819 N N   . HIS A 1 236 ? 21.258  -10.129 11.992  1.00 19.82 ? 447 HIS A N   1 
ATOM   1820 C CA  . HIS A 1 236 ? 21.688  -11.206 11.099  1.00 21.11 ? 447 HIS A CA  1 
ATOM   1821 C C   . HIS A 1 236 ? 23.128  -11.656 11.368  1.00 20.99 ? 447 HIS A C   1 
ATOM   1822 O O   . HIS A 1 236 ? 24.015  -10.826 11.599  1.00 20.37 ? 447 HIS A O   1 
ATOM   1823 C CB  . HIS A 1 236 ? 21.566  -10.760 9.630   1.00 21.35 ? 447 HIS A CB  1 
ATOM   1824 C CG  . HIS A 1 236 ? 21.542  -11.898 8.673   1.00 21.91 ? 447 HIS A CG  1 
ATOM   1825 N ND1 . HIS A 1 236 ? 22.673  -12.603 8.331   1.00 24.57 ? 447 HIS A ND1 1 
ATOM   1826 C CD2 . HIS A 1 236 ? 20.519  -12.482 8.013   1.00 24.67 ? 447 HIS A CD2 1 
ATOM   1827 C CE1 . HIS A 1 236 ? 22.347  -13.585 7.508   1.00 23.53 ? 447 HIS A CE1 1 
ATOM   1828 N NE2 . HIS A 1 236 ? 21.046  -13.526 7.289   1.00 23.45 ? 447 HIS A NE2 1 
ATOM   1829 N N   . PRO A 1 237 ? 23.375  -12.982 11.333  1.00 22.00 ? 448 PRO A N   1 
ATOM   1830 C CA  . PRO A 1 237 ? 24.729  -13.523 11.540  1.00 21.79 ? 448 PRO A CA  1 
ATOM   1831 C C   . PRO A 1 237 ? 25.765  -13.028 10.538  1.00 20.61 ? 448 PRO A C   1 
ATOM   1832 O O   . PRO A 1 237 ? 26.929  -12.868 10.880  1.00 19.34 ? 448 PRO A O   1 
ATOM   1833 C CB  . PRO A 1 237 ? 24.543  -15.030 11.370  1.00 23.27 ? 448 PRO A CB  1 
ATOM   1834 C CG  . PRO A 1 237 ? 23.132  -15.291 11.481  1.00 24.10 ? 448 PRO A CG  1 
ATOM   1835 C CD  . PRO A 1 237 ? 22.351  -14.038 11.284  1.00 22.39 ? 448 PRO A CD  1 
ATOM   1836 N N   . GLU A 1 238 ? 25.346  -12.770 9.310   1.00 21.51 ? 449 GLU A N   1 
ATOM   1837 C CA  . GLU A 1 238 ? 26.288  -12.275 8.287   1.00 22.44 ? 449 GLU A CA  1 
ATOM   1838 C C   . GLU A 1 238 ? 26.475  -10.751 8.306   1.00 21.50 ? 449 GLU A C   1 
ATOM   1839 O O   . GLU A 1 238 ? 27.341  -10.221 7.581   1.00 21.55 ? 449 GLU A O   1 
ATOM   1840 C CB  . GLU A 1 238 ? 25.827  -12.713 6.914   1.00 23.96 ? 449 GLU A CB  1 
ATOM   1841 C CG  . GLU A 1 238 ? 25.691  -14.253 6.758   1.00 28.92 ? 449 GLU A CG  1 
ATOM   1842 C CD  . GLU A 1 238 ? 27.001  -14.919 6.401   1.00 36.22 ? 449 GLU A CD  1 
ATOM   1843 O OE1 . GLU A 1 238 ? 28.089  -14.382 6.755   1.00 40.17 ? 449 GLU A OE1 1 
ATOM   1844 O OE2 . GLU A 1 238 ? 26.942  -15.982 5.735   1.00 41.33 ? 449 GLU A OE2 1 
ATOM   1845 N N   . ALA A 1 239 ? 25.679  -10.027 9.107   1.00 19.66 ? 450 ALA A N   1 
ATOM   1846 C CA  . ALA A 1 239 ? 25.896  -8.551  9.227   1.00 18.51 ? 450 ALA A CA  1 
ATOM   1847 C C   . ALA A 1 239 ? 27.269  -8.270  9.790   1.00 18.11 ? 450 ALA A C   1 
ATOM   1848 O O   . ALA A 1 239 ? 27.719  -8.967  10.661  1.00 16.56 ? 450 ALA A O   1 
ATOM   1849 C CB  . ALA A 1 239 ? 24.844  -7.878  10.087  1.00 16.32 ? 450 ALA A CB  1 
ATOM   1850 N N   . PRO A 1 240 ? 27.927  -7.208  9.298   1.00 19.20 ? 451 PRO A N   1 
ATOM   1851 C CA  . PRO A 1 240 ? 29.240  -6.869  9.796   1.00 19.73 ? 451 PRO A CA  1 
ATOM   1852 C C   . PRO A 1 240 ? 29.206  -6.555  11.269  1.00 20.43 ? 451 PRO A C   1 
ATOM   1853 O O   . PRO A 1 240 ? 28.363  -5.777  11.705  1.00 20.37 ? 451 PRO A O   1 
ATOM   1854 C CB  . PRO A 1 240 ? 29.590  -5.596  9.010   1.00 19.31 ? 451 PRO A CB  1 
ATOM   1855 C CG  . PRO A 1 240 ? 28.877  -5.669  7.814   1.00 19.23 ? 451 PRO A CG  1 
ATOM   1856 C CD  . PRO A 1 240 ? 27.596  -6.429  8.092   1.00 19.12 ? 451 PRO A CD  1 
ATOM   1857 N N   . ILE A 1 241 ? 30.138  -7.107  12.025  1.00 21.12 ? 452 ILE A N   1 
ATOM   1858 C CA  . ILE A 1 241 ? 30.150  -6.865  13.452  1.00 21.73 ? 452 ILE A CA  1 
ATOM   1859 C C   . ILE A 1 241 ? 30.450  -5.414  13.780  1.00 21.34 ? 452 ILE A C   1 
ATOM   1860 O O   . ILE A 1 241 ? 29.929  -4.879  14.771  1.00 20.38 ? 452 ILE A O   1 
ATOM   1861 C CB  . ILE A 1 241 ? 31.075  -7.829  14.230  1.00 21.82 ? 452 ILE A CB  1 
ATOM   1862 C CG1 . ILE A 1 241 ? 30.798  -7.737  15.746  1.00 23.28 ? 452 ILE A CG1 1 
ATOM   1863 C CG2 . ILE A 1 241 ? 32.546  -7.559  13.976  1.00 21.78 ? 452 ILE A CG2 1 
ATOM   1864 C CD1 . ILE A 1 241 ? 29.411  -8.161  16.147  1.00 24.15 ? 452 ILE A CD1 1 
ATOM   1865 N N   . THR A 1 242 ? 31.255  -4.760  12.946  1.00 21.74 ? 453 THR A N   1 
ATOM   1866 C CA  . THR A 1 242 ? 31.551  -3.342  13.170  1.00 21.17 ? 453 THR A CA  1 
ATOM   1867 C C   . THR A 1 242 ? 30.356  -2.436  13.086  1.00 20.53 ? 453 THR A C   1 
ATOM   1868 O O   . THR A 1 242 ? 30.473  -1.270  13.415  1.00 20.07 ? 453 THR A O   1 
ATOM   1869 C CB  . THR A 1 242 ? 32.594  -2.785  12.181  1.00 22.36 ? 453 THR A CB  1 
ATOM   1870 O OG1 . THR A 1 242 ? 32.132  -2.981  10.857  1.00 20.75 ? 453 THR A OG1 1 
ATOM   1871 C CG2 . THR A 1 242 ? 33.945  -3.453  12.377  1.00 22.22 ? 453 THR A CG2 1 
ATOM   1872 N N   . GLY A 1 243 ? 29.215  -2.926  12.615  1.00 19.74 ? 454 GLY A N   1 
ATOM   1873 C CA  . GLY A 1 243 ? 28.013  -2.118  12.643  1.00 20.18 ? 454 GLY A CA  1 
ATOM   1874 C C   . GLY A 1 243 ? 27.408  -1.959  14.053  1.00 19.86 ? 454 GLY A C   1 
ATOM   1875 O O   . GLY A 1 243 ? 26.462  -1.210  14.247  1.00 21.59 ? 454 GLY A O   1 
ATOM   1876 N N   . TYR A 1 244 ? 27.947  -2.666  15.027  1.00 18.90 ? 455 TYR A N   1 
ATOM   1877 C CA  . TYR A 1 244 ? 27.316  -2.807  16.336  1.00 18.39 ? 455 TYR A CA  1 
ATOM   1878 C C   . TYR A 1 244 ? 28.262  -2.394  17.434  1.00 18.33 ? 455 TYR A C   1 
ATOM   1879 O O   . TYR A 1 244 ? 29.177  -3.147  17.779  1.00 19.06 ? 455 TYR A O   1 
ATOM   1880 C CB  . TYR A 1 244 ? 26.850  -4.252  16.540  1.00 16.95 ? 455 TYR A CB  1 
ATOM   1881 C CG  . TYR A 1 244 ? 25.891  -4.614  15.473  1.00 16.89 ? 455 TYR A CG  1 
ATOM   1882 C CD1 . TYR A 1 244 ? 24.505  -4.463  15.649  1.00 15.16 ? 455 TYR A CD1 1 
ATOM   1883 C CD2 . TYR A 1 244 ? 26.357  -5.090  14.225  1.00 14.05 ? 455 TYR A CD2 1 
ATOM   1884 C CE1 . TYR A 1 244 ? 23.619  -4.781  14.612  1.00 15.18 ? 455 TYR A CE1 1 
ATOM   1885 C CE2 . TYR A 1 244 ? 25.470  -5.415  13.223  1.00 13.45 ? 455 TYR A CE2 1 
ATOM   1886 C CZ  . TYR A 1 244 ? 24.119  -5.255  13.395  1.00 14.26 ? 455 TYR A CZ  1 
ATOM   1887 O OH  . TYR A 1 244 ? 23.281  -5.585  12.331  1.00 14.32 ? 455 TYR A OH  1 
ATOM   1888 N N   . MET A 1 245 ? 28.024  -1.203  17.993  1.00 18.43 ? 456 MET A N   1 
ATOM   1889 C CA  . MET A 1 245 ? 28.902  -0.617  19.008  1.00 18.66 ? 456 MET A CA  1 
ATOM   1890 C C   . MET A 1 245 ? 29.207  -1.531  20.204  1.00 19.02 ? 456 MET A C   1 
ATOM   1891 O O   . MET A 1 245 ? 30.325  -1.488  20.765  1.00 18.94 ? 456 MET A O   1 
ATOM   1892 C CB  . MET A 1 245 ? 28.317  0.709   19.497  1.00 19.93 ? 456 MET A CB  1 
ATOM   1893 C CG  . MET A 1 245 ? 29.208  1.399   20.553  1.00 23.79 ? 456 MET A CG  1 
ATOM   1894 S SD  . MET A 1 245 ? 28.618  3.020   21.126  1.00 28.93 ? 456 MET A SD  1 
ATOM   1895 C CE  . MET A 1 245 ? 28.377  3.888   19.564  1.00 33.00 ? 456 MET A CE  1 
ATOM   1896 N N   . PHE A 1 246 ? 28.248  -2.373  20.595  1.00 18.05 ? 457 PHE A N   1 
ATOM   1897 C CA  . PHE A 1 246 ? 28.484  -3.306  21.695  1.00 18.19 ? 457 PHE A CA  1 
ATOM   1898 C C   . PHE A 1 246 ? 28.023  -4.701  21.324  1.00 18.16 ? 457 PHE A C   1 
ATOM   1899 O O   . PHE A 1 246 ? 27.595  -5.467  22.175  1.00 18.36 ? 457 PHE A O   1 
ATOM   1900 C CB  . PHE A 1 246 ? 27.775  -2.832  22.954  1.00 18.24 ? 457 PHE A CB  1 
ATOM   1901 C CG  . PHE A 1 246 ? 28.298  -1.536  23.492  1.00 18.21 ? 457 PHE A CG  1 
ATOM   1902 C CD1 . PHE A 1 246 ? 29.518  -1.485  24.123  1.00 18.69 ? 457 PHE A CD1 1 
ATOM   1903 C CD2 . PHE A 1 246 ? 27.588  -0.367  23.347  1.00 20.66 ? 457 PHE A CD2 1 
ATOM   1904 C CE1 . PHE A 1 246 ? 30.020  -0.310  24.618  1.00 20.27 ? 457 PHE A CE1 1 
ATOM   1905 C CE2 . PHE A 1 246 ? 28.093  0.824   23.844  1.00 20.15 ? 457 PHE A CE2 1 
ATOM   1906 C CZ  . PHE A 1 246 ? 29.317  0.846   24.464  1.00 21.57 ? 457 PHE A CZ  1 
ATOM   1907 N N   . GLY A 1 247 ? 28.086  -5.026  20.039  1.00 17.65 ? 458 GLY A N   1 
ATOM   1908 C CA  . GLY A 1 247 ? 27.690  -6.355  19.572  1.00 17.08 ? 458 GLY A CA  1 
ATOM   1909 C C   . GLY A 1 247 ? 26.248  -6.463  19.153  1.00 16.11 ? 458 GLY A C   1 
ATOM   1910 O O   . GLY A 1 247 ? 25.448  -5.500  19.211  1.00 15.39 ? 458 GLY A O   1 
ATOM   1911 N N   . LYS A 1 248 ? 25.928  -7.661  18.720  1.00 15.36 ? 459 LYS A N   1 
ATOM   1912 C CA  . LYS A 1 248 ? 24.651  -7.938  18.141  1.00 16.04 ? 459 LYS A CA  1 
ATOM   1913 C C   . LYS A 1 248 ? 23.673  -8.269  19.259  1.00 15.92 ? 459 LYS A C   1 
ATOM   1914 O O   . LYS A 1 248 ? 23.357  -9.446  19.508  1.00 16.12 ? 459 LYS A O   1 
ATOM   1915 C CB  . LYS A 1 248 ? 24.786  -9.067  17.132  1.00 16.76 ? 459 LYS A CB  1 
ATOM   1916 C CG  . LYS A 1 248 ? 25.508  -8.575  15.844  1.00 20.43 ? 459 LYS A CG  1 
ATOM   1917 C CD  . LYS A 1 248 ? 25.696  -9.701  14.885  1.00 20.11 ? 459 LYS A CD  1 
ATOM   1918 C CE  . LYS A 1 248 ? 26.478  -9.259  13.662  1.00 21.60 ? 459 LYS A CE  1 
ATOM   1919 N NZ  . LYS A 1 248 ? 26.611  -10.381 12.663  1.00 19.03 ? 459 LYS A NZ  1 
ATOM   1920 N N   . GLY A 1 249 ? 23.219  -7.207  19.942  1.00 15.34 ? 460 GLY A N   1 
ATOM   1921 C CA  . GLY A 1 249 ? 22.170  -7.327  20.960  1.00 15.31 ? 460 GLY A CA  1 
ATOM   1922 C C   . GLY A 1 249 ? 20.978  -6.442  20.633  1.00 15.35 ? 460 GLY A C   1 
ATOM   1923 O O   . GLY A 1 249 ? 20.843  -5.917  19.511  1.00 13.97 ? 460 GLY A O   1 
ATOM   1924 N N   . ILE A 1 250 ? 20.123  -6.267  21.643  1.00 14.70 ? 461 ILE A N   1 
ATOM   1925 C CA  . ILE A 1 250 ? 18.964  -5.422  21.558  1.00 13.44 ? 461 ILE A CA  1 
ATOM   1926 C C   . ILE A 1 250 ? 19.294  -4.219  22.436  1.00 13.94 ? 461 ILE A C   1 
ATOM   1927 O O   . ILE A 1 250 ? 19.624  -4.364  23.607  1.00 12.77 ? 461 ILE A O   1 
ATOM   1928 C CB  . ILE A 1 250 ? 17.700  -6.159  22.026  1.00 13.57 ? 461 ILE A CB  1 
ATOM   1929 C CG1 . ILE A 1 250 ? 17.526  -7.455  21.200  1.00 12.50 ? 461 ILE A CG1 1 
ATOM   1930 C CG2 . ILE A 1 250 ? 16.506  -5.293  21.881  1.00 12.68 ? 461 ILE A CG2 1 
ATOM   1931 C CD1 . ILE A 1 250 ? 16.497  -8.398  21.728  1.00 13.86 ? 461 ILE A CD1 1 
ATOM   1932 N N   . TYR A 1 251 ? 19.231  -3.041  21.820  1.00 13.57 ? 462 TYR A N   1 
ATOM   1933 C CA  . TYR A 1 251 ? 19.706  -1.808  22.404  1.00 13.23 ? 462 TYR A CA  1 
ATOM   1934 C C   . TYR A 1 251 ? 18.578  -0.950  22.961  1.00 13.54 ? 462 TYR A C   1 
ATOM   1935 O O   . TYR A 1 251 ? 17.503  -0.848  22.363  1.00 13.78 ? 462 TYR A O   1 
ATOM   1936 C CB  . TYR A 1 251 ? 20.461  -1.008  21.367  1.00 13.82 ? 462 TYR A CB  1 
ATOM   1937 C CG  . TYR A 1 251 ? 21.827  -1.536  21.034  1.00 12.33 ? 462 TYR A CG  1 
ATOM   1938 C CD1 . TYR A 1 251 ? 21.995  -2.822  20.507  1.00 14.41 ? 462 TYR A CD1 1 
ATOM   1939 C CD2 . TYR A 1 251 ? 22.941  -0.758  21.205  1.00 13.03 ? 462 TYR A CD2 1 
ATOM   1940 C CE1 . TYR A 1 251 ? 23.236  -3.300  20.195  1.00 11.17 ? 462 TYR A CE1 1 
ATOM   1941 C CE2 . TYR A 1 251 ? 24.192  -1.225  20.881  1.00 14.16 ? 462 TYR A CE2 1 
ATOM   1942 C CZ  . TYR A 1 251 ? 24.348  -2.488  20.358  1.00 13.55 ? 462 TYR A CZ  1 
ATOM   1943 O OH  . TYR A 1 251 ? 25.626  -2.940  20.015  1.00 13.96 ? 462 TYR A OH  1 
ATOM   1944 N N   . PHE A 1 252 ? 18.833  -0.372  24.130  1.00 13.17 ? 463 PHE A N   1 
ATOM   1945 C CA  . PHE A 1 252 ? 17.848  0.452   24.847  1.00 14.10 ? 463 PHE A CA  1 
ATOM   1946 C C   . PHE A 1 252 ? 18.506  1.717   25.416  1.00 14.67 ? 463 PHE A C   1 
ATOM   1947 O O   . PHE A 1 252 ? 19.699  1.751   25.678  1.00 14.23 ? 463 PHE A O   1 
ATOM   1948 C CB  . PHE A 1 252 ? 17.192  -0.370  25.973  1.00 13.80 ? 463 PHE A CB  1 
ATOM   1949 C CG  . PHE A 1 252 ? 16.431  -1.563  25.485  1.00 13.57 ? 463 PHE A CG  1 
ATOM   1950 C CD1 . PHE A 1 252 ? 15.134  -1.435  25.016  1.00 12.20 ? 463 PHE A CD1 1 
ATOM   1951 C CD2 . PHE A 1 252 ? 17.000  -2.807  25.473  1.00 11.20 ? 463 PHE A CD2 1 
ATOM   1952 C CE1 . PHE A 1 252 ? 14.412  -2.528  24.595  1.00 9.63  ? 463 PHE A CE1 1 
ATOM   1953 C CE2 . PHE A 1 252 ? 16.287  -3.893  25.018  1.00 9.79  ? 463 PHE A CE2 1 
ATOM   1954 C CZ  . PHE A 1 252 ? 14.997  -3.753  24.583  1.00 8.66  ? 463 PHE A CZ  1 
ATOM   1955 N N   . ALA A 1 253 ? 17.715  2.760   25.566  1.00 16.26 ? 464 ALA A N   1 
ATOM   1956 C CA  . ALA A 1 253 ? 18.139  3.974   26.268  1.00 16.76 ? 464 ALA A CA  1 
ATOM   1957 C C   . ALA A 1 253 ? 17.251  4.245   27.502  1.00 17.72 ? 464 ALA A C   1 
ATOM   1958 O O   . ALA A 1 253 ? 16.092  3.825   27.567  1.00 17.43 ? 464 ALA A O   1 
ATOM   1959 C CB  . ALA A 1 253 ? 18.112  5.157   25.327  1.00 16.50 ? 464 ALA A CB  1 
ATOM   1960 N N   . ASP A 1 254 ? 17.826  4.939   28.485  1.00 18.34 ? 465 ASP A N   1 
ATOM   1961 C CA  . ASP A 1 254 ? 17.038  5.518   29.569  1.00 17.68 ? 465 ASP A CA  1 
ATOM   1962 C C   . ASP A 1 254 ? 16.727  6.996   29.288  1.00 18.71 ? 465 ASP A C   1 
ATOM   1963 O O   . ASP A 1 254 ? 16.082  7.675   30.127  1.00 19.75 ? 465 ASP A O   1 
ATOM   1964 C CB  . ASP A 1 254 ? 17.730  5.299   30.918  1.00 17.42 ? 465 ASP A CB  1 
ATOM   1965 C CG  . ASP A 1 254 ? 19.093  5.954   31.025  1.00 18.43 ? 465 ASP A CG  1 
ATOM   1966 O OD1 . ASP A 1 254 ? 19.404  6.893   30.256  1.00 17.99 ? 465 ASP A OD1 1 
ATOM   1967 O OD2 . ASP A 1 254 ? 19.867  5.545   31.930  1.00 17.08 ? 465 ASP A OD2 1 
ATOM   1968 N N   . MET A 1 255 ? 17.158  7.499   28.115  1.00 16.48 ? 466 MET A N   1 
ATOM   1969 C CA  . MET A 1 255 ? 16.779  8.844   27.677  1.00 16.29 ? 466 MET A CA  1 
ATOM   1970 C C   . MET A 1 255 ? 15.932  8.773   26.431  1.00 16.48 ? 466 MET A C   1 
ATOM   1971 O O   . MET A 1 255 ? 16.420  8.305   25.367  1.00 16.24 ? 466 MET A O   1 
ATOM   1972 C CB  . MET A 1 255 ? 18.010  9.703   27.366  1.00 15.77 ? 466 MET A CB  1 
ATOM   1973 C CG  . MET A 1 255 ? 18.995  9.872   28.528  1.00 16.25 ? 466 MET A CG  1 
ATOM   1974 S SD  . MET A 1 255 ? 18.307  10.827  29.935  1.00 18.87 ? 466 MET A SD  1 
ATOM   1975 C CE  . MET A 1 255 ? 18.178  12.486  29.226  1.00 12.84 ? 466 MET A CE  1 
ATOM   1976 N N   . SER A 1 256 ? 14.707  9.299   26.535  1.00 16.04 ? 467 SER A N   1 
ATOM   1977 C CA  . SER A 1 256 ? 13.706  9.153   25.501  1.00 16.48 ? 467 SER A CA  1 
ATOM   1978 C C   . SER A 1 256 ? 14.201  9.619   24.128  1.00 16.49 ? 467 SER A C   1 
ATOM   1979 O O   . SER A 1 256 ? 13.951  8.970   23.119  1.00 16.10 ? 467 SER A O   1 
ATOM   1980 C CB  . SER A 1 256 ? 12.431  9.901   25.913  1.00 17.10 ? 467 SER A CB  1 
ATOM   1981 O OG  . SER A 1 256 ? 12.648  11.297  25.929  1.00 16.69 ? 467 SER A OG  1 
ATOM   1982 N N   . SER A 1 257 ? 14.940  10.729  24.095  1.00 17.02 ? 468 SER A N   1 
ATOM   1983 C CA  . SER A 1 257 ? 15.330  11.334  22.838  1.00 15.94 ? 468 SER A CA  1 
ATOM   1984 C C   . SER A 1 257 ? 16.503  10.576  22.211  1.00 15.48 ? 468 SER A C   1 
ATOM   1985 O O   . SER A 1 257 ? 16.629  10.577  21.018  1.00 14.93 ? 468 SER A O   1 
ATOM   1986 C CB  . SER A 1 257 ? 15.684  12.809  23.027  1.00 16.06 ? 468 SER A CB  1 
ATOM   1987 O OG  . SER A 1 257 ? 16.748  12.947  23.952  1.00 18.05 ? 468 SER A OG  1 
ATOM   1988 N N   . LYS A 1 258 ? 17.332  9.908   22.998  1.00 15.84 ? 469 LYS A N   1 
ATOM   1989 C CA  . LYS A 1 258 ? 18.413  9.118   22.417  1.00 15.72 ? 469 LYS A CA  1 
ATOM   1990 C C   . LYS A 1 258 ? 17.786  8.026   21.538  1.00 15.97 ? 469 LYS A C   1 
ATOM   1991 O O   . LYS A 1 258 ? 18.250  7.773   20.402  1.00 13.36 ? 469 LYS A O   1 
ATOM   1992 C CB  . LYS A 1 258 ? 19.302  8.512   23.501  1.00 16.27 ? 469 LYS A CB  1 
ATOM   1993 C CG  . LYS A 1 258 ? 20.391  7.598   22.951  1.00 18.18 ? 469 LYS A CG  1 
ATOM   1994 C CD  . LYS A 1 258 ? 21.476  7.258   23.958  1.00 18.12 ? 469 LYS A CD  1 
ATOM   1995 C CE  . LYS A 1 258 ? 22.426  6.217   23.396  1.00 17.50 ? 469 LYS A CE  1 
ATOM   1996 N NZ  . LYS A 1 258 ? 23.570  5.918   24.304  1.00 17.74 ? 469 LYS A NZ  1 
ATOM   1997 N N   . SER A 1 259 ? 16.698  7.428   22.035  1.00 14.17 ? 470 SER A N   1 
ATOM   1998 C CA  . SER A 1 259 ? 15.969  6.424   21.251  1.00 13.68 ? 470 SER A CA  1 
ATOM   1999 C C   . SER A 1 259 ? 15.148  7.074   20.153  1.00 13.76 ? 470 SER A C   1 
ATOM   2000 O O   . SER A 1 259 ? 15.097  6.579   19.015  1.00 12.72 ? 470 SER A O   1 
ATOM   2001 C CB  . SER A 1 259 ? 15.070  5.549   22.158  1.00 14.32 ? 470 SER A CB  1 
ATOM   2002 O OG  . SER A 1 259 ? 15.802  4.636   22.974  1.00 12.55 ? 470 SER A OG  1 
ATOM   2003 N N   . ALA A 1 260 ? 14.502  8.205   20.449  1.00 13.58 ? 471 ALA A N   1 
ATOM   2004 C CA  . ALA A 1 260 ? 13.699  8.870   19.429  1.00 13.06 ? 471 ALA A CA  1 
ATOM   2005 C C   . ALA A 1 260 ? 14.502  9.392   18.232  1.00 13.84 ? 471 ALA A C   1 
ATOM   2006 O O   . ALA A 1 260 ? 13.935  9.526   17.164  1.00 14.90 ? 471 ALA A O   1 
ATOM   2007 C CB  . ALA A 1 260 ? 12.839  9.982   20.019  1.00 11.89 ? 471 ALA A CB  1 
ATOM   2008 N N   . ASN A 1 261 ? 15.781  9.717   18.403  1.00 14.00 ? 472 ASN A N   1 
ATOM   2009 C CA  . ASN A 1 261 ? 16.627  9.992   17.240  1.00 15.26 ? 472 ASN A CA  1 
ATOM   2010 C C   . ASN A 1 261 ? 16.621  8.852   16.250  1.00 16.21 ? 472 ASN A C   1 
ATOM   2011 O O   . ASN A 1 261 ? 16.754  9.083   15.067  1.00 18.34 ? 472 ASN A O   1 
ATOM   2012 C CB  . ASN A 1 261 ? 18.061  10.291  17.628  1.00 14.73 ? 472 ASN A CB  1 
ATOM   2013 C CG  . ASN A 1 261 ? 18.199  11.558  18.410  1.00 15.91 ? 472 ASN A CG  1 
ATOM   2014 O OD1 . ASN A 1 261 ? 17.353  12.459  18.332  1.00 14.86 ? 472 ASN A OD1 1 
ATOM   2015 N ND2 . ASN A 1 261 ? 19.300  11.657  19.151  1.00 15.11 ? 472 ASN A ND2 1 
ATOM   2016 N N   . TYR A 1 262 ? 16.494  7.613   16.715  1.00 16.17 ? 473 TYR A N   1 
ATOM   2017 C CA  . TYR A 1 262 ? 16.429  6.455   15.772  1.00 16.28 ? 473 TYR A CA  1 
ATOM   2018 C C   . TYR A 1 262 ? 15.093  6.243   15.111  1.00 15.92 ? 473 TYR A C   1 
ATOM   2019 O O   . TYR A 1 262 ? 14.937  5.295   14.339  1.00 15.64 ? 473 TYR A O   1 
ATOM   2020 C CB  . TYR A 1 262 ? 16.877  5.166   16.478  1.00 15.73 ? 473 TYR A CB  1 
ATOM   2021 C CG  . TYR A 1 262 ? 18.335  5.243   16.846  1.00 16.80 ? 473 TYR A CG  1 
ATOM   2022 C CD1 . TYR A 1 262 ? 19.328  4.943   15.911  1.00 16.59 ? 473 TYR A CD1 1 
ATOM   2023 C CD2 . TYR A 1 262 ? 18.725  5.667   18.098  1.00 18.17 ? 473 TYR A CD2 1 
ATOM   2024 C CE1 . TYR A 1 262 ? 20.653  5.031   16.230  1.00 16.88 ? 473 TYR A CE1 1 
ATOM   2025 C CE2 . TYR A 1 262 ? 20.051  5.754   18.434  1.00 16.90 ? 473 TYR A CE2 1 
ATOM   2026 C CZ  . TYR A 1 262 ? 21.005  5.434   17.485  1.00 19.69 ? 473 TYR A CZ  1 
ATOM   2027 O OH  . TYR A 1 262 ? 22.310  5.504   17.830  1.00 22.96 ? 473 TYR A OH  1 
ATOM   2028 N N   . CYS A 1 263 ? 14.112  7.107   15.396  1.00 15.97 ? 474 CYS A N   1 
ATOM   2029 C CA  . CYS A 1 263 ? 12.905  7.151   14.586  1.00 15.77 ? 474 CYS A CA  1 
ATOM   2030 C C   . CYS A 1 263 ? 13.170  7.743   13.190  1.00 16.53 ? 474 CYS A C   1 
ATOM   2031 O O   . CYS A 1 263 ? 12.403  7.508   12.236  1.00 15.49 ? 474 CYS A O   1 
ATOM   2032 C CB  . CYS A 1 263 ? 11.826  7.983   15.281  1.00 17.24 ? 474 CYS A CB  1 
ATOM   2033 S SG  . CYS A 1 263 ? 11.310  7.239   16.855  1.00 15.83 ? 474 CYS A SG  1 
ATOM   2034 N N   . PHE A 1 264 ? 14.234  8.532   13.093  1.00 16.47 ? 475 PHE A N   1 
ATOM   2035 C CA  . PHE A 1 264 ? 14.536  9.283   11.883  1.00 17.66 ? 475 PHE A CA  1 
ATOM   2036 C C   . PHE A 1 264 ? 13.311  10.055  11.377  1.00 18.20 ? 475 PHE A C   1 
ATOM   2037 O O   . PHE A 1 264 ? 13.015  10.092  10.187  1.00 18.04 ? 475 PHE A O   1 
ATOM   2038 C CB  . PHE A 1 264 ? 15.179  8.343   10.845  1.00 16.77 ? 475 PHE A CB  1 
ATOM   2039 C CG  . PHE A 1 264 ? 16.544  7.867   11.240  1.00 17.82 ? 475 PHE A CG  1 
ATOM   2040 C CD1 . PHE A 1 264 ? 17.670  8.665   11.004  1.00 20.57 ? 475 PHE A CD1 1 
ATOM   2041 C CD2 . PHE A 1 264 ? 16.717  6.641   11.874  1.00 17.51 ? 475 PHE A CD2 1 
ATOM   2042 C CE1 . PHE A 1 264 ? 18.930  8.239   11.392  1.00 20.71 ? 475 PHE A CE1 1 
ATOM   2043 C CE2 . PHE A 1 264 ? 17.950  6.215   12.249  1.00 19.24 ? 475 PHE A CE2 1 
ATOM   2044 C CZ  . PHE A 1 264 ? 19.081  7.020   12.010  1.00 22.50 ? 475 PHE A CZ  1 
ATOM   2045 N N   . ALA A 1 265 ? 12.565  10.660  12.310  1.00 19.19 ? 476 ALA A N   1 
ATOM   2046 C CA  . ALA A 1 265 ? 11.488  11.554  11.924  1.00 19.49 ? 476 ALA A CA  1 
ATOM   2047 C C   . ALA A 1 265 ? 12.085  12.840  11.346  1.00 20.06 ? 476 ALA A C   1 
ATOM   2048 O O   . ALA A 1 265 ? 13.279  13.105  11.444  1.00 20.72 ? 476 ALA A O   1 
ATOM   2049 C CB  . ALA A 1 265 ? 10.575  11.887  13.089  1.00 19.49 ? 476 ALA A CB  1 
ATOM   2050 N N   . SER A 1 266 ? 11.236  13.629  10.741  1.00 20.71 ? 477 SER A N   1 
ATOM   2051 C CA  . SER A 1 266 ? 11.665  14.895  10.178  1.00 23.07 ? 477 SER A CA  1 
ATOM   2052 C C   . SER A 1 266 ? 10.473  15.846  10.145  1.00 23.85 ? 477 SER A C   1 
ATOM   2053 O O   . SER A 1 266 ? 9.323   15.456  10.388  1.00 22.36 ? 477 SER A O   1 
ATOM   2054 C CB  . SER A 1 266 ? 12.195  14.677  8.743   1.00 22.48 ? 477 SER A CB  1 
ATOM   2055 O OG  . SER A 1 266 ? 11.146  14.236  7.894   1.00 23.67 ? 477 SER A OG  1 
ATOM   2056 N N   . ARG A 1 267 ? 10.767  17.084  9.759   1.00 26.42 ? 478 ARG A N   1 
ATOM   2057 C CA  . ARG A 1 267 ? 9.738   18.119  9.595   1.00 28.12 ? 478 ARG A CA  1 
ATOM   2058 C C   . ARG A 1 267 ? 8.718   17.638  8.596   1.00 27.78 ? 478 ARG A C   1 
ATOM   2059 O O   . ARG A 1 267 ? 7.529   17.834  8.771   1.00 28.24 ? 478 ARG A O   1 
ATOM   2060 C CB  . ARG A 1 267 ? 10.348  19.478  9.197   1.00 29.65 ? 478 ARG A CB  1 
ATOM   2061 C CG  . ARG A 1 267 ? 11.754  19.370  8.633   1.00 34.25 ? 478 ARG A CG  1 
ATOM   2062 C CD  . ARG A 1 267 ? 12.399  20.703  8.298   1.00 39.92 ? 478 ARG A CD  1 
ATOM   2063 N NE  . ARG A 1 267 ? 13.258  20.552  7.119   1.00 42.06 ? 478 ARG A NE  1 
ATOM   2064 C CZ  . ARG A 1 267 ? 12.822  20.560  5.856   1.00 44.71 ? 478 ARG A CZ  1 
ATOM   2065 N NH1 . ARG A 1 267 ? 11.521  20.727  5.559   1.00 44.59 ? 478 ARG A NH1 1 
ATOM   2066 N NH2 . ARG A 1 267 ? 13.700  20.414  4.874   1.00 46.77 ? 478 ARG A NH2 1 
ATOM   2067 N N   . LEU A 1 268 ? 9.182   16.914  7.594   1.00 28.18 ? 479 LEU A N   1 
ATOM   2068 C CA  . LEU A 1 268 ? 8.310   16.391  6.559   1.00 29.24 ? 479 LEU A CA  1 
ATOM   2069 C C   . LEU A 1 268 ? 7.420   15.241  7.083   1.00 28.39 ? 479 LEU A C   1 
ATOM   2070 O O   . LEU A 1 268 ? 6.258   15.130  6.736   1.00 28.85 ? 479 LEU A O   1 
ATOM   2071 C CB  . LEU A 1 268 ? 9.179   15.879  5.390   1.00 30.28 ? 479 LEU A CB  1 
ATOM   2072 C CG  . LEU A 1 268 ? 10.425  16.639  4.835   1.00 34.05 ? 479 LEU A CG  1 
ATOM   2073 C CD1 . LEU A 1 268 ? 11.421  17.271  5.877   1.00 35.91 ? 479 LEU A CD1 1 
ATOM   2074 C CD2 . LEU A 1 268 ? 11.219  15.715  3.895   1.00 33.62 ? 479 LEU A CD2 1 
ATOM   2075 N N   . LYS A 1 269 ? 7.995   14.388  7.919   1.00 27.68 ? 480 LYS A N   1 
ATOM   2076 C CA  . LYS A 1 269 ? 7.335   13.173  8.446   1.00 27.31 ? 480 LYS A CA  1 
ATOM   2077 C C   . LYS A 1 269 ? 7.482   13.165  9.921   1.00 25.94 ? 480 LYS A C   1 
ATOM   2078 O O   . LYS A 1 269 ? 8.352   12.476  10.467  1.00 24.55 ? 480 LYS A O   1 
ATOM   2079 C CB  . LYS A 1 269 ? 8.083   11.931  7.941   1.00 28.00 ? 480 LYS A CB  1 
ATOM   2080 C CG  . LYS A 1 269 ? 7.316   11.110  6.975   1.00 32.06 ? 480 LYS A CG  1 
ATOM   2081 C CD  . LYS A 1 269 ? 7.388   11.681  5.606   1.00 35.25 ? 480 LYS A CD  1 
ATOM   2082 C CE  . LYS A 1 269 ? 6.345   11.047  4.711   1.00 36.55 ? 480 LYS A CE  1 
ATOM   2083 N NZ  . LYS A 1 269 ? 5.082   11.822  4.746   1.00 37.30 ? 480 LYS A NZ  1 
ATOM   2084 N N   . ASN A 1 270 ? 6.652   13.940  10.577  1.00 25.61 ? 481 ASN A N   1 
ATOM   2085 C CA  . ASN A 1 270 ? 6.894   14.286  11.958  1.00 25.31 ? 481 ASN A CA  1 
ATOM   2086 C C   . ASN A 1 270 ? 6.224   13.334  12.957  1.00 24.45 ? 481 ASN A C   1 
ATOM   2087 O O   . ASN A 1 270 ? 6.243   13.592  14.144  1.00 25.67 ? 481 ASN A O   1 
ATOM   2088 C CB  . ASN A 1 270 ? 6.538   15.778  12.205  1.00 25.73 ? 481 ASN A CB  1 
ATOM   2089 C CG  . ASN A 1 270 ? 5.028   16.065  12.287  1.00 27.59 ? 481 ASN A CG  1 
ATOM   2090 O OD1 . ASN A 1 270 ? 4.172   15.287  11.860  1.00 31.92 ? 481 ASN A OD1 1 
ATOM   2091 N ND2 . ASN A 1 270 ? 4.708   17.203  12.876  1.00 29.72 ? 481 ASN A ND2 1 
ATOM   2092 N N   . THR A 1 271 ? 5.658   12.228  12.489  1.00 23.18 ? 482 THR A N   1 
ATOM   2093 C CA  . THR A 1 271 ? 4.987   11.290  13.376  1.00 22.82 ? 482 THR A CA  1 
ATOM   2094 C C   . THR A 1 271 ? 5.813   10.042  13.448  1.00 20.79 ? 482 THR A C   1 
ATOM   2095 O O   . THR A 1 271 ? 6.058   9.409   12.433  1.00 21.77 ? 482 THR A O   1 
ATOM   2096 C CB  . THR A 1 271 ? 3.573   10.928  12.919  1.00 22.54 ? 482 THR A CB  1 
ATOM   2097 O OG1 . THR A 1 271 ? 2.733   12.050  13.108  1.00 26.30 ? 482 THR A OG1 1 
ATOM   2098 C CG2 . THR A 1 271 ? 3.004   9.806   13.770  1.00 24.14 ? 482 THR A CG2 1 
ATOM   2099 N N   . GLY A 1 272 ? 6.243   9.697   14.649  1.00 19.35 ? 483 GLY A N   1 
ATOM   2100 C CA  . GLY A 1 272 ? 7.030   8.469   14.879  1.00 18.30 ? 483 GLY A CA  1 
ATOM   2101 C C   . GLY A 1 272 ? 6.490   7.707   16.089  1.00 17.94 ? 483 GLY A C   1 
ATOM   2102 O O   . GLY A 1 272 ? 5.587   8.209   16.806  1.00 16.90 ? 483 GLY A O   1 
ATOM   2103 N N   . LEU A 1 273 ? 7.034   6.505   16.312  1.00 15.85 ? 484 LEU A N   1 
ATOM   2104 C CA  . LEU A 1 273 ? 6.653   5.678   17.450  1.00 14.75 ? 484 LEU A CA  1 
ATOM   2105 C C   . LEU A 1 273 ? 7.843   5.417   18.297  1.00 14.34 ? 484 LEU A C   1 
ATOM   2106 O O   . LEU A 1 273 ? 8.976   5.333   17.795  1.00 15.25 ? 484 LEU A O   1 
ATOM   2107 C CB  . LEU A 1 273 ? 6.082   4.333   17.007  1.00 14.41 ? 484 LEU A CB  1 
ATOM   2108 C CG  . LEU A 1 273 ? 4.935   4.386   15.995  1.00 15.02 ? 484 LEU A CG  1 
ATOM   2109 C CD1 . LEU A 1 273 ? 4.471   2.960   15.677  1.00 10.59 ? 484 LEU A CD1 1 
ATOM   2110 C CD2 . LEU A 1 273 ? 3.773   5.242   16.545  1.00 17.63 ? 484 LEU A CD2 1 
ATOM   2111 N N   . LEU A 1 274 ? 7.580   5.244   19.584  1.00 13.92 ? 485 LEU A N   1 
ATOM   2112 C CA  . LEU A 1 274 ? 8.570   4.830   20.558  1.00 14.73 ? 485 LEU A CA  1 
ATOM   2113 C C   . LEU A 1 274 ? 8.043   3.659   21.342  1.00 14.94 ? 485 LEU A C   1 
ATOM   2114 O O   . LEU A 1 274 ? 6.867   3.625   21.716  1.00 16.19 ? 485 LEU A O   1 
ATOM   2115 C CB  . LEU A 1 274 ? 8.837   5.946   21.579  1.00 15.15 ? 485 LEU A CB  1 
ATOM   2116 C CG  . LEU A 1 274 ? 9.857   6.980   21.203  1.00 16.60 ? 485 LEU A CG  1 
ATOM   2117 C CD1 . LEU A 1 274 ? 9.797   8.184   22.219  1.00 12.69 ? 485 LEU A CD1 1 
ATOM   2118 C CD2 . LEU A 1 274 ? 11.230  6.281   21.143  1.00 15.04 ? 485 LEU A CD2 1 
ATOM   2119 N N   . LEU A 1 275 ? 8.924   2.725   21.631  1.00 13.91 ? 486 LEU A N   1 
ATOM   2120 C CA  . LEU A 1 275 ? 8.564   1.545   22.332  1.00 13.92 ? 486 LEU A CA  1 
ATOM   2121 C C   . LEU A 1 275 ? 9.111   1.617   23.752  1.00 13.75 ? 486 LEU A C   1 
ATOM   2122 O O   . LEU A 1 275 ? 10.241  2.010   23.963  1.00 13.82 ? 486 LEU A O   1 
ATOM   2123 C CB  . LEU A 1 275 ? 9.158   0.353   21.624  1.00 13.71 ? 486 LEU A CB  1 
ATOM   2124 C CG  . LEU A 1 275 ? 8.960   -1.042  22.185  1.00 17.33 ? 486 LEU A CG  1 
ATOM   2125 C CD1 . LEU A 1 275 ? 7.444   -1.448  22.100  1.00 15.79 ? 486 LEU A CD1 1 
ATOM   2126 C CD2 . LEU A 1 275 ? 9.883   -2.024  21.429  1.00 15.67 ? 486 LEU A CD2 1 
ATOM   2127 N N   . LEU A 1 276 ? 8.303   1.185   24.715  1.00 13.90 ? 487 LEU A N   1 
ATOM   2128 C CA  . LEU A 1 276 ? 8.810   0.876   26.060  1.00 13.86 ? 487 LEU A CA  1 
ATOM   2129 C C   . LEU A 1 276 ? 8.642   -0.587  26.367  1.00 13.37 ? 487 LEU A C   1 
ATOM   2130 O O   . LEU A 1 276 ? 7.571   -1.213  26.145  1.00 13.52 ? 487 LEU A O   1 
ATOM   2131 C CB  . LEU A 1 276 ? 8.140   1.719   27.138  1.00 13.01 ? 487 LEU A CB  1 
ATOM   2132 C CG  . LEU A 1 276 ? 8.455   3.220   27.192  1.00 13.52 ? 487 LEU A CG  1 
ATOM   2133 C CD1 . LEU A 1 276 ? 7.398   3.940   28.071  1.00 11.89 ? 487 LEU A CD1 1 
ATOM   2134 C CD2 . LEU A 1 276 ? 9.832   3.464   27.781  1.00 13.12 ? 487 LEU A CD2 1 
ATOM   2135 N N   . SER A 1 277 ? 9.706   -1.118  26.938  1.00 13.87 ? 488 SER A N   1 
ATOM   2136 C CA  . SER A 1 277 ? 9.822   -2.523  27.192  1.00 14.48 ? 488 SER A CA  1 
ATOM   2137 C C   . SER A 1 277 ? 10.424  -2.748  28.541  1.00 15.32 ? 488 SER A C   1 
ATOM   2138 O O   . SER A 1 277 ? 11.326  -2.020  28.961  1.00 15.04 ? 488 SER A O   1 
ATOM   2139 C CB  . SER A 1 277 ? 10.783  -3.155  26.165  1.00 15.14 ? 488 SER A CB  1 
ATOM   2140 O OG  . SER A 1 277 ? 10.344  -2.946  24.814  1.00 15.55 ? 488 SER A OG  1 
ATOM   2141 N N   . GLU A 1 278 ? 10.020  -3.837  29.186  1.00 15.35 ? 489 GLU A N   1 
ATOM   2142 C CA  . GLU A 1 278 ? 10.741  -4.265  30.364  1.00 16.26 ? 489 GLU A CA  1 
ATOM   2143 C C   . GLU A 1 278 ? 11.948  -5.035  29.909  1.00 15.16 ? 489 GLU A C   1 
ATOM   2144 O O   . GLU A 1 278 ? 11.825  -5.933  29.086  1.00 16.69 ? 489 GLU A O   1 
ATOM   2145 C CB  . GLU A 1 278 ? 9.867   -5.123  31.276  1.00 16.59 ? 489 GLU A CB  1 
ATOM   2146 C CG  . GLU A 1 278 ? 8.574   -4.422  31.584  1.00 20.47 ? 489 GLU A CG  1 
ATOM   2147 C CD  . GLU A 1 278 ? 7.554   -5.250  32.309  1.00 24.60 ? 489 GLU A CD  1 
ATOM   2148 O OE1 . GLU A 1 278 ? 7.690   -6.488  32.377  1.00 27.26 ? 489 GLU A OE1 1 
ATOM   2149 O OE2 . GLU A 1 278 ? 6.573   -4.619  32.787  1.00 29.85 ? 489 GLU A OE2 1 
ATOM   2150 N N   . VAL A 1 279 ? 13.090  -4.718  30.503  1.00 14.98 ? 490 VAL A N   1 
ATOM   2151 C CA  . VAL A 1 279 ? 14.377  -5.240  30.113  1.00 13.77 ? 490 VAL A CA  1 
ATOM   2152 C C   . VAL A 1 279 ? 15.036  -5.824  31.359  1.00 15.28 ? 490 VAL A C   1 
ATOM   2153 O O   . VAL A 1 279 ? 15.291  -5.117  32.347  1.00 15.89 ? 490 VAL A O   1 
ATOM   2154 C CB  . VAL A 1 279 ? 15.262  -4.172  29.532  1.00 12.46 ? 490 VAL A CB  1 
ATOM   2155 C CG1 . VAL A 1 279 ? 16.606  -4.791  29.070  1.00 12.90 ? 490 VAL A CG1 1 
ATOM   2156 C CG2 . VAL A 1 279 ? 14.561  -3.452  28.369  1.00 10.70 ? 490 VAL A CG2 1 
ATOM   2157 N N   . ALA A 1 280 ? 15.268  -7.129  31.323  1.00 15.16 ? 491 ALA A N   1 
ATOM   2158 C CA  . ALA A 1 280 ? 15.888  -7.830  32.425  1.00 16.50 ? 491 ALA A CA  1 
ATOM   2159 C C   . ALA A 1 280 ? 17.409  -7.743  32.327  1.00 17.76 ? 491 ALA A C   1 
ATOM   2160 O O   . ALA A 1 280 ? 18.056  -8.610  31.728  1.00 18.82 ? 491 ALA A O   1 
ATOM   2161 C CB  . ALA A 1 280 ? 15.443  -9.272  32.404  1.00 15.88 ? 491 ALA A CB  1 
ATOM   2162 N N   . LEU A 1 281 ? 17.977  -6.707  32.929  1.00 18.73 ? 492 LEU A N   1 
ATOM   2163 C CA  . LEU A 1 281 ? 19.384  -6.418  32.773  1.00 19.25 ? 492 LEU A CA  1 
ATOM   2164 C C   . LEU A 1 281 ? 20.253  -7.378  33.540  1.00 21.09 ? 492 LEU A C   1 
ATOM   2165 O O   . LEU A 1 281 ? 21.408  -7.634  33.148  1.00 20.39 ? 492 LEU A O   1 
ATOM   2166 C CB  . LEU A 1 281 ? 19.696  -5.006  33.192  1.00 19.03 ? 492 LEU A CB  1 
ATOM   2167 C CG  . LEU A 1 281 ? 19.024  -3.961  32.328  1.00 18.84 ? 492 LEU A CG  1 
ATOM   2168 C CD1 . LEU A 1 281 ? 19.194  -2.589  32.971  1.00 16.31 ? 492 LEU A CD1 1 
ATOM   2169 C CD2 . LEU A 1 281 ? 19.584  -4.028  30.883  1.00 16.25 ? 492 LEU A CD2 1 
ATOM   2170 N N   . GLY A 1 282 ? 19.721  -7.924  34.628  1.00 21.98 ? 493 GLY A N   1 
ATOM   2171 C CA  . GLY A 1 282 ? 20.563  -8.735  35.504  1.00 23.14 ? 493 GLY A CA  1 
ATOM   2172 C C   . GLY A 1 282 ? 21.774  -7.928  35.916  1.00 23.99 ? 493 GLY A C   1 
ATOM   2173 O O   . GLY A 1 282 ? 21.686  -6.728  36.127  1.00 24.12 ? 493 GLY A O   1 
ATOM   2174 N N   . GLN A 1 283 ? 22.907  -8.589  36.051  1.00 26.01 ? 494 GLN A N   1 
ATOM   2175 C CA  . GLN A 1 283 ? 24.165  -7.898  36.307  1.00 27.68 ? 494 GLN A CA  1 
ATOM   2176 C C   . GLN A 1 283 ? 24.729  -7.293  35.015  1.00 26.86 ? 494 GLN A C   1 
ATOM   2177 O O   . GLN A 1 283 ? 24.971  -8.023  34.056  1.00 28.13 ? 494 GLN A O   1 
ATOM   2178 C CB  . GLN A 1 283 ? 25.186  -8.891  36.914  1.00 28.82 ? 494 GLN A CB  1 
ATOM   2179 C CG  . GLN A 1 283 ? 24.900  -9.269  38.347  1.00 32.30 ? 494 GLN A CG  1 
ATOM   2180 C CD  . GLN A 1 283 ? 25.213  -8.117  39.309  1.00 37.70 ? 494 GLN A CD  1 
ATOM   2181 O OE1 . GLN A 1 283 ? 24.325  -7.336  39.678  1.00 38.09 ? 494 GLN A OE1 1 
ATOM   2182 N NE2 . GLN A 1 283 ? 26.501  -7.988  39.689  1.00 42.48 ? 494 GLN A NE2 1 
ATOM   2183 N N   . CYS A 1 284 ? 24.971  -5.985  35.015  1.00 26.61 ? 495 CYS A N   1 
ATOM   2184 C CA  . CYS A 1 284 ? 25.572  -5.283  33.873  1.00 27.31 ? 495 CYS A CA  1 
ATOM   2185 C C   . CYS A 1 284 ? 27.091  -5.363  33.842  1.00 27.30 ? 495 CYS A C   1 
ATOM   2186 O O   . CYS A 1 284 ? 27.747  -5.039  34.832  1.00 27.05 ? 495 CYS A O   1 
ATOM   2187 C CB  . CYS A 1 284 ? 25.229  -3.794  33.897  1.00 26.65 ? 495 CYS A CB  1 
ATOM   2188 S SG  . CYS A 1 284 ? 23.465  -3.429  33.649  1.00 26.99 ? 495 CYS A SG  1 
ATOM   2189 N N   . ASN A 1 285 ? 27.630  -5.753  32.693  1.00 26.94 ? 496 ASN A N   1 
ATOM   2190 C CA  . ASN A 1 285 ? 29.014  -5.460  32.372  1.00 27.36 ? 496 ASN A CA  1 
ATOM   2191 C C   . ASN A 1 285 ? 29.142  -4.026  31.810  1.00 27.66 ? 496 ASN A C   1 
ATOM   2192 O O   . ASN A 1 285 ? 28.758  -3.747  30.664  1.00 26.64 ? 496 ASN A O   1 
ATOM   2193 C CB  . ASN A 1 285 ? 29.586  -6.470  31.390  1.00 27.45 ? 496 ASN A CB  1 
ATOM   2194 C CG  . ASN A 1 285 ? 31.105  -6.291  31.185  1.00 29.51 ? 496 ASN A CG  1 
ATOM   2195 O OD1 . ASN A 1 285 ? 31.830  -6.040  32.139  1.00 29.02 ? 496 ASN A OD1 1 
ATOM   2196 N ND2 . ASN A 1 285 ? 31.567  -6.388  29.937  1.00 25.91 ? 496 ASN A ND2 1 
ATOM   2197 N N   . GLU A 1 286 ? 29.714  -3.134  32.619  1.00 27.93 ? 497 GLU A N   1 
ATOM   2198 C CA  . GLU A 1 286 ? 29.794  -1.726  32.284  1.00 28.13 ? 497 GLU A CA  1 
ATOM   2199 C C   . GLU A 1 286 ? 31.032  -1.401  31.457  1.00 28.26 ? 497 GLU A C   1 
ATOM   2200 O O   . GLU A 1 286 ? 32.132  -1.688  31.884  1.00 29.24 ? 497 GLU A O   1 
ATOM   2201 C CB  . GLU A 1 286 ? 29.822  -0.891  33.567  1.00 27.94 ? 497 GLU A CB  1 
ATOM   2202 C CG  . GLU A 1 286 ? 28.694  -1.158  34.468  1.00 28.47 ? 497 GLU A CG  1 
ATOM   2203 C CD  . GLU A 1 286 ? 28.729  -0.292  35.693  1.00 31.24 ? 497 GLU A CD  1 
ATOM   2204 O OE1 . GLU A 1 286 ? 29.820  0.177   36.071  1.00 34.19 ? 497 GLU A OE1 1 
ATOM   2205 O OE2 . GLU A 1 286 ? 27.660  -0.087  36.285  1.00 31.66 ? 497 GLU A OE2 1 
ATOM   2206 N N   . LEU A 1 287 ? 30.844  -0.776  30.297  1.00 28.72 ? 498 LEU A N   1 
ATOM   2207 C CA  . LEU A 1 287 ? 31.948  -0.376  29.410  1.00 28.79 ? 498 LEU A CA  1 
ATOM   2208 C C   . LEU A 1 287 ? 31.955  1.120   29.137  1.00 29.72 ? 498 LEU A C   1 
ATOM   2209 O O   . LEU A 1 287 ? 30.894  1.771   29.057  1.00 30.08 ? 498 LEU A O   1 
ATOM   2210 C CB  . LEU A 1 287 ? 31.892  -1.149  28.089  1.00 28.16 ? 498 LEU A CB  1 
ATOM   2211 C CG  . LEU A 1 287 ? 32.001  -2.674  28.149  1.00 27.57 ? 498 LEU A CG  1 
ATOM   2212 C CD1 . LEU A 1 287 ? 31.714  -3.322  26.785  1.00 28.21 ? 498 LEU A CD1 1 
ATOM   2213 C CD2 . LEU A 1 287 ? 33.370  -3.091  28.633  1.00 26.59 ? 498 LEU A CD2 1 
ATOM   2214 N N   . LEU A 1 288 ? 33.153  1.674   28.965  1.00 30.56 ? 499 LEU A N   1 
ATOM   2215 C CA  . LEU A 1 288 ? 33.324  3.128   28.845  1.00 31.06 ? 499 LEU A CA  1 
ATOM   2216 C C   . LEU A 1 288 ? 33.413  3.590   27.391  1.00 30.04 ? 499 LEU A C   1 
ATOM   2217 O O   . LEU A 1 288 ? 33.272  4.775   27.113  1.00 30.56 ? 499 LEU A O   1 
ATOM   2218 C CB  . LEU A 1 288 ? 34.574  3.565   29.633  1.00 32.48 ? 499 LEU A CB  1 
ATOM   2219 C CG  . LEU A 1 288 ? 34.370  3.796   31.135  1.00 34.63 ? 499 LEU A CG  1 
ATOM   2220 C CD1 . LEU A 1 288 ? 35.716  3.811   31.920  1.00 36.74 ? 499 LEU A CD1 1 
ATOM   2221 C CD2 . LEU A 1 288 ? 33.605  5.121   31.344  1.00 36.58 ? 499 LEU A CD2 1 
ATOM   2222 N N   . GLU A 1 289 ? 33.674  2.670   26.472  1.00 28.55 ? 500 GLU A N   1 
ATOM   2223 C CA  . GLU A 1 289 ? 33.736  3.007   25.057  1.00 28.49 ? 500 GLU A CA  1 
ATOM   2224 C C   . GLU A 1 289 ? 33.433  1.788   24.181  1.00 26.52 ? 500 GLU A C   1 
ATOM   2225 O O   . GLU A 1 289 ? 33.361  0.664   24.664  1.00 24.71 ? 500 GLU A O   1 
ATOM   2226 C CB  . GLU A 1 289 ? 35.129  3.545   24.713  1.00 29.35 ? 500 GLU A CB  1 
ATOM   2227 C CG  . GLU A 1 289 ? 36.232  2.513   24.954  1.00 32.21 ? 500 GLU A CG  1 
ATOM   2228 C CD  . GLU A 1 289 ? 37.636  3.022   24.608  1.00 36.24 ? 500 GLU A CD  1 
ATOM   2229 O OE1 . GLU A 1 289 ? 37.793  4.218   24.258  1.00 39.56 ? 500 GLU A OE1 1 
ATOM   2230 O OE2 . GLU A 1 289 ? 38.585  2.211   24.699  1.00 39.20 ? 500 GLU A OE2 1 
ATOM   2231 N N   . ALA A 1 290 ? 33.280  2.043   22.891  1.00 25.71 ? 501 ALA A N   1 
ATOM   2232 C CA  . ALA A 1 290 ? 32.870  1.044   21.911  1.00 25.66 ? 501 ALA A CA  1 
ATOM   2233 C C   . ALA A 1 290 ? 33.713  -0.241  21.960  1.00 25.70 ? 501 ALA A C   1 
ATOM   2234 O O   . ALA A 1 290 ? 34.942  -0.224  22.178  1.00 27.14 ? 501 ALA A O   1 
ATOM   2235 C CB  . ALA A 1 290 ? 32.859  1.649   20.476  1.00 24.74 ? 501 ALA A CB  1 
ATOM   2236 N N   . ASN A 1 291 ? 33.014  -1.351  21.832  1.00 25.53 ? 502 ASN A N   1 
ATOM   2237 C CA  . ASN A 1 291 ? 33.638  -2.653  21.573  1.00 25.62 ? 502 ASN A CA  1 
ATOM   2238 C C   . ASN A 1 291 ? 32.624  -3.587  20.942  1.00 24.53 ? 502 ASN A C   1 
ATOM   2239 O O   . ASN A 1 291 ? 31.779  -4.184  21.641  1.00 24.79 ? 502 ASN A O   1 
ATOM   2240 C CB  . ASN A 1 291 ? 34.158  -3.292  22.838  1.00 26.34 ? 502 ASN A CB  1 
ATOM   2241 C CG  . ASN A 1 291 ? 34.803  -4.639  22.569  1.00 27.18 ? 502 ASN A CG  1 
ATOM   2242 O OD1 . ASN A 1 291 ? 34.740  -5.160  21.449  1.00 29.65 ? 502 ASN A OD1 1 
ATOM   2243 N ND2 . ASN A 1 291 ? 35.472  -5.182  23.576  1.00 27.87 ? 502 ASN A ND2 1 
ATOM   2244 N N   . PRO A 1 292 ? 32.690  -3.723  19.617  1.00 23.86 ? 503 PRO A N   1 
ATOM   2245 C CA  . PRO A 1 292 ? 31.783  -4.644  18.963  1.00 22.99 ? 503 PRO A CA  1 
ATOM   2246 C C   . PRO A 1 292 ? 31.833  -6.091  19.458  1.00 22.39 ? 503 PRO A C   1 
ATOM   2247 O O   . PRO A 1 292 ? 30.884  -6.819  19.209  1.00 20.90 ? 503 PRO A O   1 
ATOM   2248 C CB  . PRO A 1 292 ? 32.181  -4.515  17.489  1.00 23.00 ? 503 PRO A CB  1 
ATOM   2249 C CG  . PRO A 1 292 ? 32.628  -3.055  17.391  1.00 21.87 ? 503 PRO A CG  1 
ATOM   2250 C CD  . PRO A 1 292 ? 33.465  -2.941  18.629  1.00 23.75 ? 503 PRO A CD  1 
ATOM   2251 N N   . LYS A 1 293 ? 32.881  -6.481  20.180  1.00 22.99 ? 504 LYS A N   1 
ATOM   2252 C CA  . LYS A 1 293 ? 32.998  -7.848  20.706  1.00 24.97 ? 504 LYS A CA  1 
ATOM   2253 C C   . LYS A 1 293 ? 32.508  -7.971  22.140  1.00 24.95 ? 504 LYS A C   1 
ATOM   2254 O O   . LYS A 1 293 ? 32.787  -8.963  22.834  1.00 25.21 ? 504 LYS A O   1 
ATOM   2255 C CB  . LYS A 1 293 ? 34.459  -8.355  20.612  1.00 26.24 ? 504 LYS A CB  1 
ATOM   2256 C CG  . LYS A 1 293 ? 34.959  -8.505  19.171  1.00 30.20 ? 504 LYS A CG  1 
ATOM   2257 C CD  . LYS A 1 293 ? 36.284  -9.353  19.108  1.00 36.19 ? 504 LYS A CD  1 
ATOM   2258 C CE  . LYS A 1 293 ? 37.053  -9.188  17.751  1.00 39.47 ? 504 LYS A CE  1 
ATOM   2259 N NZ  . LYS A 1 293 ? 37.676  -7.808  17.534  1.00 38.46 ? 504 LYS A NZ  1 
ATOM   2260 N N   . ALA A 1 294 ? 31.774  -6.964  22.591  1.00 24.49 ? 505 ALA A N   1 
ATOM   2261 C CA  . ALA A 1 294 ? 31.330  -6.897  23.983  1.00 23.98 ? 505 ALA A CA  1 
ATOM   2262 C C   . ALA A 1 294 ? 30.600  -8.135  24.423  1.00 23.16 ? 505 ALA A C   1 
ATOM   2263 O O   . ALA A 1 294 ? 30.648  -8.451  25.579  1.00 23.05 ? 505 ALA A O   1 
ATOM   2264 C CB  . ALA A 1 294 ? 30.436  -5.658  24.225  1.00 23.44 ? 505 ALA A CB  1 
ATOM   2265 N N   . GLU A 1 295 ? 29.911  -8.827  23.526  1.00 24.01 ? 506 GLU A N   1 
ATOM   2266 C CA  . GLU A 1 295 ? 29.107  -9.971  23.939  1.00 24.58 ? 506 GLU A CA  1 
ATOM   2267 C C   . GLU A 1 295 ? 29.998  -11.028 24.592  1.00 26.50 ? 506 GLU A C   1 
ATOM   2268 O O   . GLU A 1 295 ? 29.591  -11.672 25.560  1.00 26.38 ? 506 GLU A O   1 
ATOM   2269 C CB  . GLU A 1 295 ? 28.268  -10.569 22.793  1.00 24.16 ? 506 GLU A CB  1 
ATOM   2270 C CG  . GLU A 1 295 ? 27.255  -11.639 23.299  1.00 23.53 ? 506 GLU A CG  1 
ATOM   2271 C CD  . GLU A 1 295 ? 26.308  -12.199 22.223  1.00 23.58 ? 506 GLU A CD  1 
ATOM   2272 O OE1 . GLU A 1 295 ? 26.383  -11.774 21.047  1.00 22.51 ? 506 GLU A OE1 1 
ATOM   2273 O OE2 . GLU A 1 295 ? 25.484  -13.109 22.550  1.00 24.81 ? 506 GLU A OE2 1 
ATOM   2274 N N   . GLY A 1 296 ? 31.224  -11.184 24.082  1.00 27.69 ? 507 GLY A N   1 
ATOM   2275 C CA  . GLY A 1 296 ? 32.134  -12.235 24.568  1.00 28.52 ? 507 GLY A CA  1 
ATOM   2276 C C   . GLY A 1 296 ? 32.768  -11.877 25.908  1.00 29.05 ? 507 GLY A C   1 
ATOM   2277 O O   . GLY A 1 296 ? 33.414  -12.717 26.519  1.00 27.59 ? 507 GLY A O   1 
ATOM   2278 N N   . LEU A 1 297 ? 32.588  -10.627 26.348  1.00 29.19 ? 508 LEU A N   1 
ATOM   2279 C CA  . LEU A 1 297 ? 33.128  -10.135 27.625  1.00 30.44 ? 508 LEU A CA  1 
ATOM   2280 C C   . LEU A 1 297 ? 32.156  -10.352 28.793  1.00 30.61 ? 508 LEU A C   1 
ATOM   2281 O O   . LEU A 1 297 ? 32.512  -10.055 29.924  1.00 30.69 ? 508 LEU A O   1 
ATOM   2282 C CB  . LEU A 1 297 ? 33.425  -8.617  27.560  1.00 30.76 ? 508 LEU A CB  1 
ATOM   2283 C CG  . LEU A 1 297 ? 34.512  -8.018  26.663  1.00 33.00 ? 508 LEU A CG  1 
ATOM   2284 C CD1 . LEU A 1 297 ? 34.187  -8.170  25.214  1.00 36.03 ? 508 LEU A CD1 1 
ATOM   2285 C CD2 . LEU A 1 297 ? 34.683  -6.537  26.973  1.00 36.04 ? 508 LEU A CD2 1 
ATOM   2286 N N   . LEU A 1 298 ? 30.932  -10.815 28.535  1.00 30.86 ? 509 LEU A N   1 
ATOM   2287 C CA  . LEU A 1 298 ? 29.916  -10.909 29.615  1.00 31.58 ? 509 LEU A CA  1 
ATOM   2288 C C   . LEU A 1 298 ? 30.382  -11.823 30.746  1.00 33.29 ? 509 LEU A C   1 
ATOM   2289 O O   . LEU A 1 298 ? 30.289  -11.444 31.911  1.00 32.58 ? 509 LEU A O   1 
ATOM   2290 C CB  . LEU A 1 298 ? 28.559  -11.397 29.103  1.00 30.92 ? 509 LEU A CB  1 
ATOM   2291 C CG  . LEU A 1 298 ? 27.722  -10.434 28.268  1.00 29.26 ? 509 LEU A CG  1 
ATOM   2292 C CD1 . LEU A 1 298 ? 26.536  -11.169 27.713  1.00 29.02 ? 509 LEU A CD1 1 
ATOM   2293 C CD2 . LEU A 1 298 ? 27.267  -9.237  29.075  1.00 27.84 ? 509 LEU A CD2 1 
ATOM   2294 N N   . GLN A 1 299 ? 30.881  -13.012 30.384  1.00 35.32 ? 510 GLN A N   1 
ATOM   2295 C CA  . GLN A 1 299 ? 31.422  -13.987 31.356  1.00 36.84 ? 510 GLN A CA  1 
ATOM   2296 C C   . GLN A 1 299 ? 30.463  -14.171 32.556  1.00 37.74 ? 510 GLN A C   1 
ATOM   2297 O O   . GLN A 1 299 ? 30.829  -13.922 33.715  1.00 38.53 ? 510 GLN A O   1 
ATOM   2298 C CB  . GLN A 1 299 ? 32.813  -13.532 31.844  1.00 37.56 ? 510 GLN A CB  1 
ATOM   2299 C CG  . GLN A 1 299 ? 33.885  -13.377 30.750  1.00 36.44 ? 510 GLN A CG  1 
ATOM   2300 N N   . GLY A 1 300 ? 29.211  -14.520 32.266  1.00 37.99 ? 511 GLY A N   1 
ATOM   2301 C CA  . GLY A 1 300 ? 28.221  -14.753 33.325  1.00 38.14 ? 511 GLY A CA  1 
ATOM   2302 C C   . GLY A 1 300 ? 27.226  -13.629 33.537  1.00 37.22 ? 511 GLY A C   1 
ATOM   2303 O O   . GLY A 1 300 ? 26.064  -13.893 33.839  1.00 37.70 ? 511 GLY A O   1 
ATOM   2304 N N   . LYS A 1 301 ? 27.694  -12.383 33.410  1.00 36.00 ? 512 LYS A N   1 
ATOM   2305 C CA  . LYS A 1 301 ? 26.844  -11.196 33.511  1.00 34.25 ? 512 LYS A CA  1 
ATOM   2306 C C   . LYS A 1 301 ? 25.819  -11.248 32.391  1.00 31.57 ? 512 LYS A C   1 
ATOM   2307 O O   . LYS A 1 301 ? 25.995  -12.007 31.444  1.00 31.03 ? 512 LYS A O   1 
ATOM   2308 C CB  . LYS A 1 301 ? 27.689  -9.918  33.425  1.00 34.70 ? 512 LYS A CB  1 
ATOM   2309 C CG  . LYS A 1 301 ? 28.607  -9.763  34.602  1.00 36.85 ? 512 LYS A CG  1 
ATOM   2310 C CD  . LYS A 1 301 ? 29.209  -8.379  34.681  1.00 39.10 ? 512 LYS A CD  1 
ATOM   2311 C CE  . LYS A 1 301 ? 29.900  -8.174  36.059  1.00 40.85 ? 512 LYS A CE  1 
ATOM   2312 N NZ  . LYS A 1 301 ? 30.365  -6.770  36.257  1.00 42.60 ? 512 LYS A NZ  1 
ATOM   2313 N N   . HIS A 1 302 ? 24.769  -10.437 32.493  1.00 28.76 ? 513 HIS A N   1 
ATOM   2314 C CA  . HIS A 1 302 ? 23.561  -10.626 31.669  1.00 27.06 ? 513 HIS A CA  1 
ATOM   2315 C C   . HIS A 1 302 ? 23.306  -9.535  30.613  1.00 24.95 ? 513 HIS A C   1 
ATOM   2316 O O   . HIS A 1 302 ? 22.517  -9.721  29.694  1.00 24.38 ? 513 HIS A O   1 
ATOM   2317 C CB  . HIS A 1 302 ? 22.341  -10.759 32.589  1.00 27.48 ? 513 HIS A CB  1 
ATOM   2318 C CG  . HIS A 1 302 ? 22.524  -11.763 33.688  1.00 27.59 ? 513 HIS A CG  1 
ATOM   2319 N ND1 . HIS A 1 302 ? 22.964  -11.411 34.939  1.00 28.49 ? 513 HIS A ND1 1 
ATOM   2320 C CD2 . HIS A 1 302 ? 22.357  -13.110 33.713  1.00 30.61 ? 513 HIS A CD2 1 
ATOM   2321 C CE1 . HIS A 1 302 ? 23.050  -12.490 35.701  1.00 30.33 ? 513 HIS A CE1 1 
ATOM   2322 N NE2 . HIS A 1 302 ? 22.700  -13.539 34.979  1.00 29.80 ? 513 HIS A NE2 1 
ATOM   2323 N N   . SER A 1 303 ? 23.973  -8.399  30.755  1.00 23.35 ? 514 SER A N   1 
ATOM   2324 C CA  . SER A 1 303 ? 23.812  -7.332  29.807  1.00 22.09 ? 514 SER A CA  1 
ATOM   2325 C C   . SER A 1 303 ? 25.062  -6.483  29.756  1.00 21.41 ? 514 SER A C   1 
ATOM   2326 O O   . SER A 1 303 ? 25.953  -6.614  30.606  1.00 21.75 ? 514 SER A O   1 
ATOM   2327 C CB  . SER A 1 303 ? 22.590  -6.497  30.213  1.00 21.39 ? 514 SER A CB  1 
ATOM   2328 O OG  . SER A 1 303 ? 22.762  -6.002  31.523  1.00 20.80 ? 514 SER A OG  1 
ATOM   2329 N N   . THR A 1 304 ? 25.129  -5.621  28.753  1.00 20.91 ? 515 THR A N   1 
ATOM   2330 C CA  . THR A 1 304 ? 26.169  -4.593  28.678  1.00 20.82 ? 515 THR A CA  1 
ATOM   2331 C C   . THR A 1 304 ? 25.569  -3.238  28.942  1.00 21.23 ? 515 THR A C   1 
ATOM   2332 O O   . THR A 1 304 ? 24.475  -2.905  28.442  1.00 21.38 ? 515 THR A O   1 
ATOM   2333 C CB  . THR A 1 304 ? 26.835  -4.543  27.293  1.00 21.01 ? 515 THR A CB  1 
ATOM   2334 O OG1 . THR A 1 304 ? 27.401  -5.822  26.999  1.00 22.04 ? 515 THR A OG1 1 
ATOM   2335 C CG2 . THR A 1 304 ? 27.957  -3.478  27.225  1.00 19.16 ? 515 THR A CG2 1 
ATOM   2336 N N   . LYS A 1 305 ? 26.266  -2.450  29.741  1.00 21.70 ? 516 LYS A N   1 
ATOM   2337 C CA  . LYS A 1 305 ? 25.895  -1.061  29.939  1.00 22.56 ? 516 LYS A CA  1 
ATOM   2338 C C   . LYS A 1 305 ? 26.980  -0.141  29.413  1.00 22.36 ? 516 LYS A C   1 
ATOM   2339 O O   . LYS A 1 305 ? 28.089  -0.081  29.956  1.00 22.37 ? 516 LYS A O   1 
ATOM   2340 C CB  . LYS A 1 305 ? 25.605  -0.748  31.396  1.00 22.76 ? 516 LYS A CB  1 
ATOM   2341 C CG  . LYS A 1 305 ? 25.076  0.683   31.578  1.00 24.36 ? 516 LYS A CG  1 
ATOM   2342 C CD  . LYS A 1 305 ? 24.751  0.932   33.023  1.00 22.59 ? 516 LYS A CD  1 
ATOM   2343 C CE  . LYS A 1 305 ? 24.364  2.385   33.279  1.00 24.91 ? 516 LYS A CE  1 
ATOM   2344 N NZ  . LYS A 1 305 ? 24.038  2.532   34.721  1.00 23.02 ? 516 LYS A NZ  1 
ATOM   2345 N N   . GLY A 1 306 ? 26.648  0.562   28.331  1.00 21.48 ? 517 GLY A N   1 
ATOM   2346 C CA  . GLY A 1 306 ? 27.510  1.585   27.797  1.00 21.89 ? 517 GLY A CA  1 
ATOM   2347 C C   . GLY A 1 306 ? 27.276  2.812   28.641  1.00 23.00 ? 517 GLY A C   1 
ATOM   2348 O O   . GLY A 1 306 ? 26.154  3.320   28.688  1.00 23.24 ? 517 GLY A O   1 
ATOM   2349 N N   . LEU A 1 307 ? 28.321  3.286   29.321  1.00 24.23 ? 518 LEU A N   1 
ATOM   2350 C CA  . LEU A 1 307 ? 28.175  4.280   30.381  1.00 25.16 ? 518 LEU A CA  1 
ATOM   2351 C C   . LEU A 1 307 ? 28.193  5.699   29.822  1.00 26.07 ? 518 LEU A C   1 
ATOM   2352 O O   . LEU A 1 307 ? 29.170  6.123   29.215  1.00 26.84 ? 518 LEU A O   1 
ATOM   2353 C CB  . LEU A 1 307 ? 29.284  4.116   31.434  1.00 25.13 ? 518 LEU A CB  1 
ATOM   2354 C CG  . LEU A 1 307 ? 29.407  2.833   32.256  1.00 24.40 ? 518 LEU A CG  1 
ATOM   2355 C CD1 . LEU A 1 307 ? 30.657  2.878   33.219  1.00 27.58 ? 518 LEU A CD1 1 
ATOM   2356 C CD2 . LEU A 1 307 ? 28.153  2.589   33.036  1.00 25.16 ? 518 LEU A CD2 1 
ATOM   2357 N N   . GLY A 1 308 ? 27.113  6.437   30.038  1.00 26.89 ? 519 GLY A N   1 
ATOM   2358 C CA  . GLY A 1 308 ? 27.043  7.833   29.602  1.00 27.44 ? 519 GLY A CA  1 
ATOM   2359 C C   . GLY A 1 308 ? 27.513  8.859   30.629  1.00 28.42 ? 519 GLY A C   1 
ATOM   2360 O O   . GLY A 1 308 ? 27.597  8.566   31.821  1.00 28.67 ? 519 GLY A O   1 
ATOM   2361 N N   . LYS A 1 309 ? 27.807  10.061  30.144  1.00 29.48 ? 520 LYS A N   1 
ATOM   2362 C CA  . LYS A 1 309 ? 28.171  11.206  30.985  1.00 31.29 ? 520 LYS A CA  1 
ATOM   2363 C C   . LYS A 1 309 ? 26.995  11.721  31.817  1.00 31.14 ? 520 LYS A C   1 
ATOM   2364 O O   . LYS A 1 309 ? 27.197  12.287  32.886  1.00 31.71 ? 520 LYS A O   1 
ATOM   2365 C CB  . LYS A 1 309 ? 28.671  12.359  30.103  1.00 32.25 ? 520 LYS A CB  1 
ATOM   2366 C CG  . LYS A 1 309 ? 30.211  12.402  29.943  1.00 36.57 ? 520 LYS A CG  1 
ATOM   2367 C CD  . LYS A 1 309 ? 30.666  12.630  28.505  1.00 38.53 ? 520 LYS A CD  1 
ATOM   2368 C CE  . LYS A 1 309 ? 30.495  14.075  28.070  1.00 40.28 ? 520 LYS A CE  1 
ATOM   2369 N NZ  . LYS A 1 309 ? 30.652  14.157  26.593  1.00 40.04 ? 520 LYS A NZ  1 
ATOM   2370 N N   . MET A 1 310 ? 25.781  11.583  31.286  1.00 30.62 ? 521 MET A N   1 
ATOM   2371 C CA  . MET A 1 310 ? 24.564  12.087  31.943  1.00 30.93 ? 521 MET A CA  1 
ATOM   2372 C C   . MET A 1 310 ? 23.534  10.985  31.979  1.00 29.66 ? 521 MET A C   1 
ATOM   2373 O O   . MET A 1 310 ? 23.313  10.295  30.981  1.00 28.45 ? 521 MET A O   1 
ATOM   2374 C CB  . MET A 1 310 ? 24.002  13.305  31.217  1.00 31.48 ? 521 MET A CB  1 
ATOM   2375 C CG  . MET A 1 310 ? 24.931  14.530  31.208  1.00 35.07 ? 521 MET A CG  1 
ATOM   2376 S SD  . MET A 1 310 ? 24.850  15.501  32.743  1.00 43.79 ? 521 MET A SD  1 
ATOM   2377 C CE  . MET A 1 310 ? 23.484  16.634  32.407  1.00 36.33 ? 521 MET A CE  1 
ATOM   2378 N N   . ALA A 1 311 ? 22.912  10.815  33.137  1.00 29.27 ? 522 ALA A N   1 
ATOM   2379 C CA  . ALA A 1 311 ? 21.864  9.819   33.282  1.00 28.85 ? 522 ALA A CA  1 
ATOM   2380 C C   . ALA A 1 311 ? 20.858  10.265  34.324  1.00 28.75 ? 522 ALA A C   1 
ATOM   2381 O O   . ALA A 1 311 ? 21.200  11.031  35.217  1.00 28.28 ? 522 ALA A O   1 
ATOM   2382 C CB  . ALA A 1 311 ? 22.470  8.493   33.698  1.00 27.22 ? 522 ALA A CB  1 
ATOM   2383 N N   . PRO A 1 312 ? 19.609  9.779   34.216  1.00 28.64 ? 523 PRO A N   1 
ATOM   2384 C CA  . PRO A 1 312 ? 18.668  9.884   35.331  1.00 29.52 ? 523 PRO A CA  1 
ATOM   2385 C C   . PRO A 1 312 ? 19.292  9.364   36.646  1.00 31.09 ? 523 PRO A C   1 
ATOM   2386 O O   . PRO A 1 312 ? 20.117  8.441   36.624  1.00 30.80 ? 523 PRO A O   1 
ATOM   2387 C CB  . PRO A 1 312 ? 17.517  9.001   34.884  1.00 28.60 ? 523 PRO A CB  1 
ATOM   2388 C CG  . PRO A 1 312 ? 17.507  9.129   33.404  1.00 27.56 ? 523 PRO A CG  1 
ATOM   2389 C CD  . PRO A 1 312 ? 18.952  9.312   32.990  1.00 28.06 ? 523 PRO A CD  1 
ATOM   2390 N N   . SER A 1 313 ? 18.928  9.964   37.773  1.00 32.56 ? 524 SER A N   1 
ATOM   2391 C CA  . SER A 1 313 ? 19.495  9.553   39.054  1.00 33.82 ? 524 SER A CA  1 
ATOM   2392 C C   . SER A 1 313 ? 18.465  8.795   39.886  1.00 33.49 ? 524 SER A C   1 
ATOM   2393 O O   . SER A 1 313 ? 17.277  9.032   39.785  1.00 32.59 ? 524 SER A O   1 
ATOM   2394 C CB  . SER A 1 313 ? 19.988  10.777  39.817  1.00 34.91 ? 524 SER A CB  1 
ATOM   2395 O OG  . SER A 1 313 ? 18.877  11.440  40.394  1.00 37.35 ? 524 SER A OG  1 
ATOM   2396 N N   . SER A 1 314 ? 18.940  7.886   40.725  1.00 34.42 ? 525 SER A N   1 
ATOM   2397 C CA  . SER A 1 314 ? 18.058  6.968   41.440  1.00 35.17 ? 525 SER A CA  1 
ATOM   2398 C C   . SER A 1 314 ? 17.103  7.658   42.390  1.00 35.78 ? 525 SER A C   1 
ATOM   2399 O O   . SER A 1 314 ? 16.044  7.103   42.708  1.00 36.04 ? 525 SER A O   1 
ATOM   2400 C CB  . SER A 1 314 ? 18.887  5.961   42.233  1.00 35.88 ? 525 SER A CB  1 
ATOM   2401 O OG  . SER A 1 314 ? 19.699  6.642   43.169  1.00 36.23 ? 525 SER A OG  1 
ATOM   2402 N N   . ALA A 1 315 ? 17.465  8.856   42.847  1.00 36.80 ? 526 ALA A N   1 
ATOM   2403 C CA  . ALA A 1 315 ? 16.621  9.602   43.797  1.00 38.08 ? 526 ALA A CA  1 
ATOM   2404 C C   . ALA A 1 315 ? 15.226  9.835   43.230  1.00 38.03 ? 526 ALA A C   1 
ATOM   2405 O O   . ALA A 1 315 ? 14.285  9.945   43.985  1.00 38.48 ? 526 ALA A O   1 
ATOM   2406 C CB  . ALA A 1 315 ? 17.280  10.949  44.208  1.00 38.25 ? 526 ALA A CB  1 
ATOM   2407 N N   . HIS A 1 316 ? 15.099  9.887   41.898  1.00 37.86 ? 527 HIS A N   1 
ATOM   2408 C CA  . HIS A 1 316 ? 13.825  10.190  41.250  1.00 37.68 ? 527 HIS A CA  1 
ATOM   2409 C C   . HIS A 1 316 ? 13.124  8.985   40.638  1.00 37.17 ? 527 HIS A C   1 
ATOM   2410 O O   . HIS A 1 316 ? 12.092  9.152   40.018  1.00 37.27 ? 527 HIS A O   1 
ATOM   2411 C CB  . HIS A 1 316 ? 14.021  11.248  40.165  1.00 37.73 ? 527 HIS A CB  1 
ATOM   2412 C CG  . HIS A 1 316 ? 14.834  12.421  40.615  1.00 40.02 ? 527 HIS A CG  1 
ATOM   2413 N ND1 . HIS A 1 316 ? 14.362  13.353  41.517  1.00 41.94 ? 527 HIS A ND1 1 
ATOM   2414 C CD2 . HIS A 1 316 ? 16.104  12.794  40.318  1.00 40.27 ? 527 HIS A CD2 1 
ATOM   2415 C CE1 . HIS A 1 316 ? 15.303  14.254  41.744  1.00 42.24 ? 527 HIS A CE1 1 
ATOM   2416 N NE2 . HIS A 1 316 ? 16.372  13.933  41.033  1.00 42.13 ? 527 HIS A NE2 1 
ATOM   2417 N N   . PHE A 1 317 ? 13.633  7.772   40.823  1.00 36.57 ? 528 PHE A N   1 
ATOM   2418 C CA  . PHE A 1 317 ? 12.994  6.634   40.167  1.00 35.88 ? 528 PHE A CA  1 
ATOM   2419 C C   . PHE A 1 317 ? 11.611  6.351   40.752  1.00 35.96 ? 528 PHE A C   1 
ATOM   2420 O O   . PHE A 1 317 ? 11.308  6.689   41.882  1.00 36.20 ? 528 PHE A O   1 
ATOM   2421 C CB  . PHE A 1 317 ? 13.860  5.367   40.196  1.00 35.40 ? 528 PHE A CB  1 
ATOM   2422 C CG  . PHE A 1 317 ? 15.195  5.480   39.437  1.00 36.02 ? 528 PHE A CG  1 
ATOM   2423 C CD1 . PHE A 1 317 ? 15.521  6.596   38.653  1.00 35.04 ? 528 PHE A CD1 1 
ATOM   2424 C CD2 . PHE A 1 317 ? 16.120  4.436   39.508  1.00 35.70 ? 528 PHE A CD2 1 
ATOM   2425 C CE1 . PHE A 1 317 ? 16.741  6.655   37.971  1.00 35.50 ? 528 PHE A CE1 1 
ATOM   2426 C CE2 . PHE A 1 317 ? 17.338  4.497   38.824  1.00 34.02 ? 528 PHE A CE2 1 
ATOM   2427 C CZ  . PHE A 1 317 ? 17.648  5.605   38.071  1.00 33.95 ? 528 PHE A CZ  1 
ATOM   2428 N N   . VAL A 1 318 ? 10.782  5.725   39.933  1.00 35.04 ? 529 VAL A N   1 
ATOM   2429 C CA  . VAL A 1 318 ? 9.464   5.270   40.302  1.00 34.98 ? 529 VAL A CA  1 
ATOM   2430 C C   . VAL A 1 318 ? 9.414   3.820   39.762  1.00 35.25 ? 529 VAL A C   1 
ATOM   2431 O O   . VAL A 1 318 ? 10.282  3.434   38.959  1.00 34.54 ? 529 VAL A O   1 
ATOM   2432 C CB  . VAL A 1 318 ? 8.440   6.256   39.662  1.00 35.30 ? 529 VAL A CB  1 
ATOM   2433 C CG1 . VAL A 1 318 ? 7.185   5.600   39.230  1.00 34.54 ? 529 VAL A CG1 1 
ATOM   2434 C CG2 . VAL A 1 318 ? 8.158   7.432   40.625  1.00 33.41 ? 529 VAL A CG2 1 
ATOM   2435 N N   . THR A 1 319 ? 8.476   2.995   40.220  1.00 34.86 ? 530 THR A N   1 
ATOM   2436 C CA  . THR A 1 319 ? 8.358   1.654   39.643  1.00 34.40 ? 530 THR A CA  1 
ATOM   2437 C C   . THR A 1 319 ? 6.965   1.509   39.058  1.00 33.26 ? 530 THR A C   1 
ATOM   2438 O O   . THR A 1 319 ? 6.008   2.056   39.590  1.00 33.32 ? 530 THR A O   1 
ATOM   2439 C CB  . THR A 1 319 ? 8.664   0.498   40.639  1.00 35.07 ? 530 THR A CB  1 
ATOM   2440 O OG1 . THR A 1 319 ? 7.655   0.427   41.638  1.00 36.70 ? 530 THR A OG1 1 
ATOM   2441 C CG2 . THR A 1 319 ? 10.047  0.651   41.311  1.00 35.54 ? 530 THR A CG2 1 
ATOM   2442 N N   . LEU A 1 320 ? 6.874   0.811   37.931  1.00 31.05 ? 531 LEU A N   1 
ATOM   2443 C CA  . LEU A 1 320 ? 5.610   0.577   37.258  1.00 29.57 ? 531 LEU A CA  1 
ATOM   2444 C C   . LEU A 1 320 ? 5.521   -0.924  37.038  1.00 28.80 ? 531 LEU A C   1 
ATOM   2445 O O   . LEU A 1 320 ? 6.287   -1.476  36.227  1.00 26.54 ? 531 LEU A O   1 
ATOM   2446 C CB  . LEU A 1 320 ? 5.595   1.353   35.945  1.00 29.33 ? 531 LEU A CB  1 
ATOM   2447 C CG  . LEU A 1 320 ? 4.316   1.532   35.116  1.00 30.61 ? 531 LEU A CG  1 
ATOM   2448 C CD1 . LEU A 1 320 ? 3.178   2.024   35.985  1.00 30.63 ? 531 LEU A CD1 1 
ATOM   2449 C CD2 . LEU A 1 320 ? 4.540   2.505   33.933  1.00 28.27 ? 531 LEU A CD2 1 
ATOM   2450 N N   . ASN A 1 321 ? 4.616   -1.569  37.800  1.00 28.91 ? 532 ASN A N   1 
ATOM   2451 C CA  . ASN A 1 321 ? 4.307   -3.008  37.728  1.00 28.07 ? 532 ASN A CA  1 
ATOM   2452 C C   . ASN A 1 321 ? 5.558   -3.841  37.734  1.00 27.22 ? 532 ASN A C   1 
ATOM   2453 O O   . ASN A 1 321 ? 5.718   -4.776  36.933  1.00 25.66 ? 532 ASN A O   1 
ATOM   2454 C CB  . ASN A 1 321 ? 3.465   -3.328  36.484  1.00 28.76 ? 532 ASN A CB  1 
ATOM   2455 C CG  . ASN A 1 321 ? 2.092   -2.616  36.492  1.00 31.55 ? 532 ASN A CG  1 
ATOM   2456 O OD1 . ASN A 1 321 ? 1.290   -2.805  37.421  1.00 32.33 ? 532 ASN A OD1 1 
ATOM   2457 N ND2 . ASN A 1 321 ? 1.810   -1.839  35.433  1.00 27.57 ? 532 ASN A ND2 1 
ATOM   2458 N N   . GLY A 1 322 ? 6.480   -3.475  38.613  1.00 26.67 ? 533 GLY A N   1 
ATOM   2459 C CA  . GLY A 1 322 ? 7.634   -4.291  38.848  1.00 26.82 ? 533 GLY A CA  1 
ATOM   2460 C C   . GLY A 1 322 ? 8.883   -3.893  38.082  1.00 27.21 ? 533 GLY A C   1 
ATOM   2461 O O   . GLY A 1 322 ? 9.927   -4.521  38.284  1.00 27.56 ? 533 GLY A O   1 
ATOM   2462 N N   . SER A 1 323 ? 8.807   -2.858  37.232  1.00 26.21 ? 534 SER A N   1 
ATOM   2463 C CA  . SER A 1 323 ? 9.968   -2.382  36.497  1.00 25.82 ? 534 SER A CA  1 
ATOM   2464 C C   . SER A 1 323 ? 10.337  -0.986  36.933  1.00 26.19 ? 534 SER A C   1 
ATOM   2465 O O   . SER A 1 323 ? 9.470   -0.129  37.061  1.00 26.49 ? 534 SER A O   1 
ATOM   2466 C CB  . SER A 1 323 ? 9.681   -2.352  34.983  1.00 25.76 ? 534 SER A CB  1 
ATOM   2467 O OG  . SER A 1 323 ? 9.609   -3.675  34.463  1.00 25.66 ? 534 SER A OG  1 
ATOM   2468 N N   . THR A 1 324 ? 11.631  -0.730  37.110  1.00 25.75 ? 535 THR A N   1 
ATOM   2469 C CA  . THR A 1 324 ? 12.077  0.604   37.507  1.00 26.11 ? 535 THR A CA  1 
ATOM   2470 C C   . THR A 1 324 ? 11.998  1.564   36.353  1.00 25.13 ? 535 THR A C   1 
ATOM   2471 O O   . THR A 1 324 ? 12.530  1.275   35.267  1.00 25.16 ? 535 THR A O   1 
ATOM   2472 C CB  . THR A 1 324 ? 13.515  0.576   37.958  1.00 26.27 ? 535 THR A CB  1 
ATOM   2473 O OG1 . THR A 1 324 ? 13.602  -0.269  39.093  1.00 28.46 ? 535 THR A OG1 1 
ATOM   2474 C CG2 . THR A 1 324 ? 14.015  1.969   38.325  1.00 27.09 ? 535 THR A CG2 1 
ATOM   2475 N N   . VAL A 1 325 ? 11.333  2.693   36.577  1.00 24.13 ? 536 VAL A N   1 
ATOM   2476 C CA  . VAL A 1 325 ? 11.225  3.738   35.589  1.00 22.34 ? 536 VAL A CA  1 
ATOM   2477 C C   . VAL A 1 325 ? 12.177  4.841   36.003  1.00 22.78 ? 536 VAL A C   1 
ATOM   2478 O O   . VAL A 1 325 ? 11.952  5.474   37.036  1.00 23.55 ? 536 VAL A O   1 
ATOM   2479 C CB  . VAL A 1 325 ? 9.813   4.307   35.478  1.00 22.65 ? 536 VAL A CB  1 
ATOM   2480 C CG1 . VAL A 1 325 ? 9.734   5.283   34.306  1.00 20.58 ? 536 VAL A CG1 1 
ATOM   2481 C CG2 . VAL A 1 325 ? 8.799   3.229   35.312  1.00 19.64 ? 536 VAL A CG2 1 
ATOM   2482 N N   . PRO A 1 326 ? 13.240  5.093   35.198  1.00 21.97 ? 537 PRO A N   1 
ATOM   2483 C CA  . PRO A 1 326 ? 14.256  6.057   35.552  1.00 22.09 ? 537 PRO A CA  1 
ATOM   2484 C C   . PRO A 1 326 ? 13.949  7.467   35.084  1.00 22.10 ? 537 PRO A C   1 
ATOM   2485 O O   . PRO A 1 326 ? 14.618  7.970   34.185  1.00 20.83 ? 537 PRO A O   1 
ATOM   2486 C CB  . PRO A 1 326 ? 15.505  5.535   34.848  1.00 21.76 ? 537 PRO A CB  1 
ATOM   2487 C CG  . PRO A 1 326 ? 14.996  4.857   33.656  1.00 21.88 ? 537 PRO A CG  1 
ATOM   2488 C CD  . PRO A 1 326 ? 13.661  4.271   34.046  1.00 21.75 ? 537 PRO A CD  1 
ATOM   2489 N N   . LEU A 1 327 ? 12.981  8.091   35.748  1.00 21.96 ? 538 LEU A N   1 
ATOM   2490 C CA  . LEU A 1 327 ? 12.582  9.459   35.460  1.00 22.58 ? 538 LEU A CA  1 
ATOM   2491 C C   . LEU A 1 327 ? 13.734  10.411  35.580  1.00 22.28 ? 538 LEU A C   1 
ATOM   2492 O O   . LEU A 1 327 ? 14.634  10.234  36.395  1.00 20.51 ? 538 LEU A O   1 
ATOM   2493 C CB  . LEU A 1 327 ? 11.497  9.947   36.423  1.00 23.23 ? 538 LEU A CB  1 
ATOM   2494 C CG  . LEU A 1 327 ? 10.194  9.177   36.360  1.00 24.80 ? 538 LEU A CG  1 
ATOM   2495 C CD1 . LEU A 1 327 ? 9.248   9.730   37.426  1.00 27.40 ? 538 LEU A CD1 1 
ATOM   2496 C CD2 . LEU A 1 327 ? 9.601   9.278   34.938  1.00 22.59 ? 538 LEU A CD2 1 
ATOM   2497 N N   . GLY A 1 328 ? 13.668  11.451  34.767  1.00 22.16 ? 539 GLY A N   1 
ATOM   2498 C CA  . GLY A 1 328 ? 14.689  12.437  34.761  1.00 23.96 ? 539 GLY A CA  1 
ATOM   2499 C C   . GLY A 1 328 ? 14.421  13.471  35.859  1.00 25.61 ? 539 GLY A C   1 
ATOM   2500 O O   . GLY A 1 328 ? 13.578  13.271  36.736  1.00 23.96 ? 539 GLY A O   1 
ATOM   2501 N N   . PRO A 1 329 ? 15.141  14.588  35.807  1.00 28.10 ? 540 PRO A N   1 
ATOM   2502 C CA  . PRO A 1 329 ? 16.107  14.937  34.794  1.00 29.45 ? 540 PRO A CA  1 
ATOM   2503 C C   . PRO A 1 329 ? 17.389  14.170  34.962  1.00 29.67 ? 540 PRO A C   1 
ATOM   2504 O O   . PRO A 1 329 ? 17.617  13.546  36.017  1.00 30.86 ? 540 PRO A O   1 
ATOM   2505 C CB  . PRO A 1 329 ? 16.326  16.449  35.041  1.00 30.14 ? 540 PRO A CB  1 
ATOM   2506 C CG  . PRO A 1 329 ? 16.129  16.576  36.477  1.00 30.06 ? 540 PRO A CG  1 
ATOM   2507 C CD  . PRO A 1 329 ? 14.965  15.691  36.768  1.00 29.55 ? 540 PRO A CD  1 
ATOM   2508 N N   . ALA A 1 330 ? 18.218  14.232  33.930  1.00 29.79 ? 541 ALA A N   1 
ATOM   2509 C CA  . ALA A 1 330 ? 19.517  13.571  33.916  1.00 29.88 ? 541 ALA A CA  1 
ATOM   2510 C C   . ALA A 1 330 ? 20.540  14.466  34.571  1.00 31.39 ? 541 ALA A C   1 
ATOM   2511 O O   . ALA A 1 330 ? 20.499  15.680  34.385  1.00 30.50 ? 541 ALA A O   1 
ATOM   2512 C CB  . ALA A 1 330 ? 19.957  13.309  32.487  1.00 29.19 ? 541 ALA A CB  1 
ATOM   2513 N N   . SER A 1 331 ? 21.487  13.863  35.276  1.00 32.42 ? 542 SER A N   1 
ATOM   2514 C CA  . SER A 1 331 ? 22.551  14.631  35.923  1.00 35.04 ? 542 SER A CA  1 
ATOM   2515 C C   . SER A 1 331 ? 23.879  13.927  35.699  1.00 35.84 ? 542 SER A C   1 
ATOM   2516 O O   . SER A 1 331 ? 23.918  12.794  35.200  1.00 34.40 ? 542 SER A O   1 
ATOM   2517 C CB  . SER A 1 331 ? 22.256  14.812  37.422  1.00 35.25 ? 542 SER A CB  1 
ATOM   2518 O OG  . SER A 1 331 ? 22.128  13.557  38.082  1.00 35.71 ? 542 SER A OG  1 
ATOM   2519 N N   . ASP A 1 332 ? 24.969  14.607  36.040  1.00 37.58 ? 543 ASP A N   1 
ATOM   2520 C CA  . ASP A 1 332 ? 26.291  14.076  35.746  1.00 38.86 ? 543 ASP A CA  1 
ATOM   2521 C C   . ASP A 1 332 ? 26.581  12.786  36.519  1.00 39.32 ? 543 ASP A C   1 
ATOM   2522 O O   . ASP A 1 332 ? 26.218  12.659  37.684  1.00 39.54 ? 543 ASP A O   1 
ATOM   2523 C CB  . ASP A 1 332 ? 27.380  15.102  36.011  1.00 40.10 ? 543 ASP A CB  1 
ATOM   2524 C CG  . ASP A 1 332 ? 28.733  14.609  35.557  1.00 42.71 ? 543 ASP A CG  1 
ATOM   2525 O OD1 . ASP A 1 332 ? 29.080  14.844  34.379  1.00 45.97 ? 543 ASP A OD1 1 
ATOM   2526 O OD2 . ASP A 1 332 ? 29.422  13.926  36.352  1.00 44.22 ? 543 ASP A OD2 1 
ATOM   2527 N N   . THR A 1 333 ? 27.224  11.825  35.850  1.00 39.74 ? 544 THR A N   1 
ATOM   2528 C CA  . THR A 1 333 ? 27.493  10.512  36.437  1.00 40.01 ? 544 THR A CA  1 
ATOM   2529 C C   . THR A 1 333 ? 28.920  10.385  37.000  1.00 42.08 ? 544 THR A C   1 
ATOM   2530 O O   . THR A 1 333 ? 29.291  9.329   37.506  1.00 41.55 ? 544 THR A O   1 
ATOM   2531 C CB  . THR A 1 333 ? 27.297  9.384   35.391  1.00 39.36 ? 544 THR A CB  1 
ATOM   2532 O OG1 . THR A 1 333 ? 28.073  9.667   34.224  1.00 38.14 ? 544 THR A OG1 1 
ATOM   2533 C CG2 . THR A 1 333 ? 25.812  9.218   35.003  1.00 37.53 ? 544 THR A CG2 1 
ATOM   2534 N N   . GLY A 1 334 ? 29.726  11.439  36.882  1.00 44.07 ? 545 GLY A N   1 
ATOM   2535 C CA  . GLY A 1 334 ? 31.126  11.380  37.288  1.00 46.62 ? 545 GLY A CA  1 
ATOM   2536 C C   . GLY A 1 334 ? 31.938  10.449  36.405  1.00 48.20 ? 545 GLY A C   1 
ATOM   2537 O O   . GLY A 1 334 ? 33.038  10.080  36.754  1.00 48.36 ? 545 GLY A O   1 
ATOM   2538 N N   . ILE A 1 335 ? 31.382  10.073  35.254  1.00 49.95 ? 546 ILE A N   1 
ATOM   2539 C CA  . ILE A 1 335 ? 32.032  9.145   34.353  1.00 51.47 ? 546 ILE A CA  1 
ATOM   2540 C C   . ILE A 1 335 ? 32.669  9.902   33.202  1.00 53.65 ? 546 ILE A C   1 
ATOM   2541 O O   . ILE A 1 335 ? 32.026  10.724  32.548  1.00 53.82 ? 546 ILE A O   1 
ATOM   2542 C CB  . ILE A 1 335 ? 31.046  8.066   33.841  1.00 50.77 ? 546 ILE A CB  1 
ATOM   2543 C CG1 . ILE A 1 335 ? 31.060  6.863   34.800  1.00 50.94 ? 546 ILE A CG1 1 
ATOM   2544 C CG2 . ILE A 1 335 ? 31.375  7.659   32.409  1.00 48.70 ? 546 ILE A CG2 1 
ATOM   2545 C CD1 . ILE A 1 335 ? 29.719  6.180   34.944  1.00 50.36 ? 546 ILE A CD1 1 
ATOM   2546 N N   . LEU A 1 336 ? 33.950  9.612   33.000  1.00 56.55 ? 547 LEU A N   1 
ATOM   2547 C CA  . LEU A 1 336 ? 34.778  10.202  31.956  1.00 58.83 ? 547 LEU A CA  1 
ATOM   2548 C C   . LEU A 1 336 ? 35.886  9.209   31.590  1.00 60.49 ? 547 LEU A C   1 
ATOM   2549 O O   . LEU A 1 336 ? 36.839  8.998   32.361  1.00 61.29 ? 547 LEU A O   1 
ATOM   2550 C CB  . LEU A 1 336 ? 35.403  11.542  32.405  1.00 59.92 ? 547 LEU A CB  1 
ATOM   2551 C CG  . LEU A 1 336 ? 36.817  11.872  31.860  1.00 60.60 ? 547 LEU A CG  1 
ATOM   2552 C CD1 . LEU A 1 336 ? 36.871  13.249  31.229  1.00 61.47 ? 547 LEU A CD1 1 
ATOM   2553 C CD2 . LEU A 1 336 ? 37.908  11.701  32.947  1.00 61.15 ? 547 LEU A CD2 1 
ATOM   2554 N N   . ASN A 1 337 ? 35.735  8.589   30.420  1.00 61.75 ? 548 ASN A N   1 
ATOM   2555 C CA  . ASN A 1 337 ? 36.800  7.819   29.785  1.00 62.65 ? 548 ASN A CA  1 
ATOM   2556 C C   . ASN A 1 337 ? 38.055  8.719   29.653  1.00 63.70 ? 548 ASN A C   1 
ATOM   2557 O O   . ASN A 1 337 ? 37.988  9.804   29.060  1.00 63.88 ? 548 ASN A O   1 
ATOM   2558 C CB  . ASN A 1 337 ? 36.292  7.306   28.411  1.00 62.41 ? 548 ASN A CB  1 
ATOM   2559 C CG  . ASN A 1 337 ? 37.317  6.461   27.663  1.00 62.92 ? 548 ASN A CG  1 
ATOM   2560 O OD1 . ASN A 1 337 ? 38.076  5.683   28.263  1.00 63.79 ? 548 ASN A OD1 1 
ATOM   2561 N ND2 . ASN A 1 337 ? 37.334  6.605   26.335  1.00 61.96 ? 548 ASN A ND2 1 
ATOM   2562 N N   . PRO A 1 338 ? 39.185  8.311   30.264  1.00 64.82 ? 549 PRO A N   1 
ATOM   2563 C CA  . PRO A 1 338 ? 40.434  9.051   29.976  1.00 65.42 ? 549 PRO A CA  1 
ATOM   2564 C C   . PRO A 1 338 ? 41.051  8.671   28.613  1.00 65.17 ? 549 PRO A C   1 
ATOM   2565 O O   . PRO A 1 338 ? 41.807  9.463   28.036  1.00 65.77 ? 549 PRO A O   1 
ATOM   2566 C CB  . PRO A 1 338 ? 41.359  8.657   31.142  1.00 65.89 ? 549 PRO A CB  1 
ATOM   2567 C CG  . PRO A 1 338 ? 40.864  7.321   31.597  1.00 65.55 ? 549 PRO A CG  1 
ATOM   2568 C CD  . PRO A 1 338 ? 39.367  7.307   31.337  1.00 65.17 ? 549 PRO A CD  1 
ATOM   2569 N N   . ASP A 1 339 ? 40.706  7.478   28.113  1.00 64.39 ? 550 ASP A N   1 
ATOM   2570 C CA  . ASP A 1 339 ? 41.261  6.934   26.862  1.00 63.71 ? 550 ASP A CA  1 
ATOM   2571 C C   . ASP A 1 339 ? 40.662  7.542   25.585  1.00 62.14 ? 550 ASP A C   1 
ATOM   2572 O O   . ASP A 1 339 ? 41.197  7.302   24.492  1.00 62.11 ? 550 ASP A O   1 
ATOM   2573 C CB  . ASP A 1 339 ? 41.089  5.399   26.812  1.00 63.72 ? 550 ASP A CB  1 
ATOM   2574 C CG  . ASP A 1 339 ? 42.059  4.660   27.731  1.00 64.99 ? 550 ASP A CG  1 
ATOM   2575 O OD1 . ASP A 1 339 ? 42.451  3.533   27.369  1.00 66.51 ? 550 ASP A OD1 1 
ATOM   2576 O OD2 . ASP A 1 339 ? 42.436  5.192   28.804  1.00 66.87 ? 550 ASP A OD2 1 
ATOM   2577 N N   . GLY A 1 340 ? 39.570  8.305   25.709  1.00 60.31 ? 551 GLY A N   1 
ATOM   2578 C CA  . GLY A 1 340 ? 38.910  8.881   24.532  1.00 58.48 ? 551 GLY A CA  1 
ATOM   2579 C C   . GLY A 1 340 ? 37.536  9.521   24.706  1.00 56.79 ? 551 GLY A C   1 
ATOM   2580 O O   . GLY A 1 340 ? 37.285  10.246  25.677  1.00 57.11 ? 551 GLY A O   1 
ATOM   2581 N N   . TYR A 1 341 ? 36.668  9.261   23.721  1.00 54.38 ? 552 TYR A N   1 
ATOM   2582 C CA  . TYR A 1 341 ? 35.361  9.917   23.570  1.00 52.40 ? 552 TYR A CA  1 
ATOM   2583 C C   . TYR A 1 341 ? 34.264  9.096   24.253  1.00 50.21 ? 552 TYR A C   1 
ATOM   2584 O O   . TYR A 1 341 ? 33.746  8.095   23.700  1.00 50.45 ? 552 TYR A O   1 
ATOM   2585 C CB  . TYR A 1 341 ? 35.008  10.130  22.081  1.00 51.76 ? 552 TYR A CB  1 
ATOM   2586 N N   . THR A 1 342 ? 33.924  9.541   25.457  1.00 47.25 ? 553 THR A N   1 
ATOM   2587 C CA  . THR A 1 342 ? 32.861  8.980   26.257  1.00 44.84 ? 553 THR A CA  1 
ATOM   2588 C C   . THR A 1 342 ? 31.466  9.215   25.634  1.00 41.60 ? 553 THR A C   1 
ATOM   2589 O O   . THR A 1 342 ? 31.245  10.195  24.910  1.00 41.25 ? 553 THR A O   1 
ATOM   2590 C CB  . THR A 1 342 ? 32.924  9.632   27.638  1.00 45.41 ? 553 THR A CB  1 
ATOM   2591 O OG1 . THR A 1 342 ? 34.291  9.682   28.052  1.00 48.19 ? 553 THR A OG1 1 
ATOM   2592 C CG2 . THR A 1 342 ? 32.134  8.850   28.661  1.00 46.29 ? 553 THR A CG2 1 
ATOM   2593 N N   . LEU A 1 343 ? 30.529  8.316   25.922  1.00 37.65 ? 554 LEU A N   1 
ATOM   2594 C CA  . LEU A 1 343 ? 29.144  8.488   25.471  1.00 34.73 ? 554 LEU A CA  1 
ATOM   2595 C C   . LEU A 1 343 ? 28.500  9.659   26.218  1.00 32.84 ? 554 LEU A C   1 
ATOM   2596 O O   . LEU A 1 343 ? 28.822  9.913   27.352  1.00 32.28 ? 554 LEU A O   1 
ATOM   2597 C CB  . LEU A 1 343 ? 28.338  7.217   25.732  1.00 33.72 ? 554 LEU A CB  1 
ATOM   2598 C CG  . LEU A 1 343 ? 28.656  5.992   24.862  1.00 32.60 ? 554 LEU A CG  1 
ATOM   2599 C CD1 . LEU A 1 343 ? 28.172  4.743   25.542  1.00 30.38 ? 554 LEU A CD1 1 
ATOM   2600 C CD2 . LEU A 1 343 ? 28.011  6.148   23.462  1.00 30.13 ? 554 LEU A CD2 1 
ATOM   2601 N N   . ASN A 1 344 ? 27.575  10.353  25.584  1.00 30.92 ? 555 ASN A N   1 
ATOM   2602 C CA  . ASN A 1 344 ? 26.800  11.385  26.281  1.00 29.96 ? 555 ASN A CA  1 
ATOM   2603 C C   . ASN A 1 344 ? 25.783  10.779  27.243  1.00 28.09 ? 555 ASN A C   1 
ATOM   2604 O O   . ASN A 1 344 ? 25.595  11.271  28.361  1.00 27.88 ? 555 ASN A O   1 
ATOM   2605 C CB  . ASN A 1 344 ? 26.078  12.267  25.266  1.00 30.02 ? 555 ASN A CB  1 
ATOM   2606 C CG  . ASN A 1 344 ? 27.046  13.000  24.349  1.00 32.28 ? 555 ASN A CG  1 
ATOM   2607 O OD1 . ASN A 1 344 ? 28.085  13.498  24.782  1.00 32.44 ? 555 ASN A OD1 1 
ATOM   2608 N ND2 . ASN A 1 344 ? 26.718  13.043  23.078  1.00 35.30 ? 555 ASN A ND2 1 
ATOM   2609 N N   . TYR A 1 345 ? 25.092  9.744   26.771  1.00 25.42 ? 556 TYR A N   1 
ATOM   2610 C CA  . TYR A 1 345 ? 24.063  9.038   27.569  1.00 23.62 ? 556 TYR A CA  1 
ATOM   2611 C C   . TYR A 1 345 ? 24.258  7.517   27.556  1.00 21.96 ? 556 TYR A C   1 
ATOM   2612 O O   . TYR A 1 345 ? 24.929  6.961   26.683  1.00 20.13 ? 556 TYR A O   1 
ATOM   2613 C CB  . TYR A 1 345 ? 22.671  9.413   27.061  1.00 22.94 ? 556 TYR A CB  1 
ATOM   2614 C CG  . TYR A 1 345 ? 22.565  10.895  26.856  1.00 24.13 ? 556 TYR A CG  1 
ATOM   2615 C CD1 . TYR A 1 345 ? 22.528  11.761  27.938  1.00 25.88 ? 556 TYR A CD1 1 
ATOM   2616 C CD2 . TYR A 1 345 ? 22.572  11.448  25.575  1.00 25.61 ? 556 TYR A CD2 1 
ATOM   2617 C CE1 . TYR A 1 345 ? 22.454  13.160  27.759  1.00 27.20 ? 556 TYR A CE1 1 
ATOM   2618 C CE2 . TYR A 1 345 ? 22.521  12.847  25.387  1.00 26.05 ? 556 TYR A CE2 1 
ATOM   2619 C CZ  . TYR A 1 345 ? 22.467  13.680  26.492  1.00 26.38 ? 556 TYR A CZ  1 
ATOM   2620 O OH  . TYR A 1 345 ? 22.390  15.022  26.322  1.00 29.54 ? 556 TYR A OH  1 
ATOM   2621 N N   . ASN A 1 346 ? 23.677  6.863   28.556  1.00 21.16 ? 557 ASN A N   1 
ATOM   2622 C CA  . ASN A 1 346 ? 23.777  5.430   28.727  1.00 19.77 ? 557 ASN A CA  1 
ATOM   2623 C C   . ASN A 1 346 ? 23.211  4.711   27.520  1.00 18.74 ? 557 ASN A C   1 
ATOM   2624 O O   . ASN A 1 346 ? 22.427  5.275   26.759  1.00 18.61 ? 557 ASN A O   1 
ATOM   2625 C CB  . ASN A 1 346 ? 22.939  4.989   29.930  1.00 19.56 ? 557 ASN A CB  1 
ATOM   2626 C CG  . ASN A 1 346 ? 23.553  5.359   31.261  1.00 20.87 ? 557 ASN A CG  1 
ATOM   2627 O OD1 . ASN A 1 346 ? 24.771  5.464   31.399  1.00 21.40 ? 557 ASN A OD1 1 
ATOM   2628 N ND2 . ASN A 1 346 ? 22.699  5.514   32.272  1.00 19.82 ? 557 ASN A ND2 1 
ATOM   2629 N N   . GLU A 1 347 ? 23.616  3.459   27.344  1.00 18.25 ? 558 GLU A N   1 
ATOM   2630 C CA  . GLU A 1 347 ? 22.810  2.524   26.565  1.00 17.45 ? 558 GLU A CA  1 
ATOM   2631 C C   . GLU A 1 347 ? 22.968  1.152   27.169  1.00 17.46 ? 558 GLU A C   1 
ATOM   2632 O O   . GLU A 1 347 ? 24.001  0.839   27.766  1.00 18.20 ? 558 GLU A O   1 
ATOM   2633 C CB  . GLU A 1 347 ? 23.160  2.524   25.070  1.00 17.41 ? 558 GLU A CB  1 
ATOM   2634 C CG  . GLU A 1 347 ? 24.617  2.257   24.675  1.00 17.40 ? 558 GLU A CG  1 
ATOM   2635 C CD  . GLU A 1 347 ? 24.874  2.759   23.239  1.00 18.66 ? 558 GLU A CD  1 
ATOM   2636 O OE1 . GLU A 1 347 ? 24.989  1.960   22.278  1.00 18.63 ? 558 GLU A OE1 1 
ATOM   2637 O OE2 . GLU A 1 347 ? 24.861  3.981   23.061  1.00 18.30 ? 558 GLU A OE2 1 
ATOM   2638 N N   . TYR A 1 348 ? 21.919  0.360   27.041  1.00 16.97 ? 559 TYR A N   1 
ATOM   2639 C CA  . TYR A 1 348 ? 21.839  -0.958  27.655  1.00 16.93 ? 559 TYR A CA  1 
ATOM   2640 C C   . TYR A 1 348 ? 21.608  -1.964  26.528  1.00 15.21 ? 559 TYR A C   1 
ATOM   2641 O O   . TYR A 1 348 ? 20.745  -1.756  25.675  1.00 14.38 ? 559 TYR A O   1 
ATOM   2642 C CB  . TYR A 1 348 ? 20.651  -1.019  28.610  1.00 17.67 ? 559 TYR A CB  1 
ATOM   2643 C CG  . TYR A 1 348 ? 20.684  -0.050  29.768  1.00 19.90 ? 559 TYR A CG  1 
ATOM   2644 C CD1 . TYR A 1 348 ? 21.286  -0.389  30.980  1.00 21.37 ? 559 TYR A CD1 1 
ATOM   2645 C CD2 . TYR A 1 348 ? 20.096  1.189   29.659  1.00 20.86 ? 559 TYR A CD2 1 
ATOM   2646 C CE1 . TYR A 1 348 ? 21.313  0.534   32.055  1.00 24.20 ? 559 TYR A CE1 1 
ATOM   2647 C CE2 . TYR A 1 348 ? 20.109  2.090   30.715  1.00 23.73 ? 559 TYR A CE2 1 
ATOM   2648 C CZ  . TYR A 1 348 ? 20.716  1.755   31.909  1.00 25.32 ? 559 TYR A CZ  1 
ATOM   2649 O OH  . TYR A 1 348 ? 20.716  2.679   32.950  1.00 31.21 ? 559 TYR A OH  1 
ATOM   2650 N N   . ILE A 1 349 ? 22.342  -3.058  26.553  1.00 14.04 ? 560 ILE A N   1 
ATOM   2651 C CA  . ILE A 1 349 ? 22.217  -4.064  25.542  1.00 13.54 ? 560 ILE A CA  1 
ATOM   2652 C C   . ILE A 1 349 ? 22.013  -5.437  26.163  1.00 13.91 ? 560 ILE A C   1 
ATOM   2653 O O   . ILE A 1 349 ? 22.750  -5.826  27.035  1.00 14.91 ? 560 ILE A O   1 
ATOM   2654 C CB  . ILE A 1 349 ? 23.494  -4.076  24.645  1.00 13.59 ? 560 ILE A CB  1 
ATOM   2655 C CG1 . ILE A 1 349 ? 23.784  -2.687  24.072  1.00 11.18 ? 560 ILE A CG1 1 
ATOM   2656 C CG2 . ILE A 1 349 ? 23.359  -5.083  23.530  1.00 11.19 ? 560 ILE A CG2 1 
ATOM   2657 C CD1 . ILE A 1 349 ? 24.761  -1.805  24.906  1.00 9.73  ? 560 ILE A CD1 1 
ATOM   2658 N N   . VAL A 1 350 ? 20.998  -6.147  25.727  1.00 14.19 ? 561 VAL A N   1 
ATOM   2659 C CA  . VAL A 1 350 ? 20.825  -7.557  26.094  1.00 15.21 ? 561 VAL A CA  1 
ATOM   2660 C C   . VAL A 1 350 ? 20.984  -8.383  24.854  1.00 14.95 ? 561 VAL A C   1 
ATOM   2661 O O   . VAL A 1 350 ? 20.711  -7.892  23.754  1.00 15.26 ? 561 VAL A O   1 
ATOM   2662 C CB  . VAL A 1 350 ? 19.472  -7.876  26.760  1.00 15.09 ? 561 VAL A CB  1 
ATOM   2663 C CG1 . VAL A 1 350 ? 19.399  -7.223  28.120  1.00 13.44 ? 561 VAL A CG1 1 
ATOM   2664 C CG2 . VAL A 1 350 ? 18.274  -7.483  25.881  1.00 16.29 ? 561 VAL A CG2 1 
ATOM   2665 N N   . TYR A 1 351 ? 21.394  -9.631  25.014  1.00 16.16 ? 562 TYR A N   1 
ATOM   2666 C CA  . TYR A 1 351 ? 21.743  -10.493 23.858  1.00 16.36 ? 562 TYR A CA  1 
ATOM   2667 C C   . TYR A 1 351 ? 20.838  -11.707 23.655  1.00 17.19 ? 562 TYR A C   1 
ATOM   2668 O O   . TYR A 1 351 ? 21.165  -12.619 22.866  1.00 17.88 ? 562 TYR A O   1 
ATOM   2669 C CB  . TYR A 1 351 ? 23.193  -10.916 23.941  1.00 17.14 ? 562 TYR A CB  1 
ATOM   2670 C CG  . TYR A 1 351 ? 24.137  -9.745  24.062  1.00 16.69 ? 562 TYR A CG  1 
ATOM   2671 C CD1 . TYR A 1 351 ? 24.681  -9.147  22.944  1.00 17.00 ? 562 TYR A CD1 1 
ATOM   2672 C CD2 . TYR A 1 351 ? 24.459  -9.231  25.297  1.00 16.83 ? 562 TYR A CD2 1 
ATOM   2673 C CE1 . TYR A 1 351 ? 25.539  -8.049  23.064  1.00 16.94 ? 562 TYR A CE1 1 
ATOM   2674 C CE2 . TYR A 1 351 ? 25.319  -8.144  25.430  1.00 18.17 ? 562 TYR A CE2 1 
ATOM   2675 C CZ  . TYR A 1 351 ? 25.860  -7.566  24.303  1.00 15.80 ? 562 TYR A CZ  1 
ATOM   2676 O OH  . TYR A 1 351 ? 26.689  -6.464  24.457  1.00 17.90 ? 562 TYR A OH  1 
ATOM   2677 N N   . ASN A 1 352 ? 19.662  -11.661 24.270  1.00 17.65 ? 563 ASN A N   1 
ATOM   2678 C CA  . ASN A 1 352 ? 18.620  -12.685 24.088  1.00 17.55 ? 563 ASN A CA  1 
ATOM   2679 C C   . ASN A 1 352 ? 17.287  -11.981 24.189  1.00 17.59 ? 563 ASN A C   1 
ATOM   2680 O O   . ASN A 1 352 ? 17.082  -11.199 25.113  1.00 16.55 ? 563 ASN A O   1 
ATOM   2681 C CB  . ASN A 1 352 ? 18.738  -13.732 25.184  1.00 18.32 ? 563 ASN A CB  1 
ATOM   2682 C CG  . ASN A 1 352 ? 17.985  -15.022 24.885  1.00 19.97 ? 563 ASN A CG  1 
ATOM   2683 O OD1 . ASN A 1 352 ? 16.759  -15.038 24.627  1.00 19.05 ? 563 ASN A OD1 1 
ATOM   2684 N ND2 . ASN A 1 352 ? 18.712  -16.141 24.990  1.00 24.61 ? 563 ASN A ND2 1 
ATOM   2685 N N   . PRO A 1 353 ? 16.374  -12.238 23.237  1.00 17.42 ? 564 PRO A N   1 
ATOM   2686 C CA  . PRO A 1 353 ? 15.023  -11.677 23.239  1.00 17.31 ? 564 PRO A CA  1 
ATOM   2687 C C   . PRO A 1 353 ? 14.235  -12.015 24.527  1.00 17.48 ? 564 PRO A C   1 
ATOM   2688 O O   . PRO A 1 353 ? 13.319  -11.260 24.919  1.00 16.87 ? 564 PRO A O   1 
ATOM   2689 C CB  . PRO A 1 353 ? 14.353  -12.360 22.034  1.00 17.80 ? 564 PRO A CB  1 
ATOM   2690 C CG  . PRO A 1 353 ? 15.482  -12.772 21.158  1.00 18.20 ? 564 PRO A CG  1 
ATOM   2691 C CD  . PRO A 1 353 ? 16.638  -13.054 22.043  1.00 17.24 ? 564 PRO A CD  1 
ATOM   2692 N N   . ASN A 1 354 ? 14.605  -13.106 25.189  1.00 17.83 ? 565 ASN A N   1 
ATOM   2693 C CA  . ASN A 1 354 ? 13.941  -13.506 26.432  1.00 18.29 ? 565 ASN A CA  1 
ATOM   2694 C C   . ASN A 1 354 ? 14.237  -12.555 27.621  1.00 17.87 ? 565 ASN A C   1 
ATOM   2695 O O   . ASN A 1 354 ? 13.700  -12.719 28.717  1.00 17.55 ? 565 ASN A O   1 
ATOM   2696 C CB  . ASN A 1 354 ? 14.189  -15.011 26.770  1.00 18.58 ? 565 ASN A CB  1 
ATOM   2697 C CG  . ASN A 1 354 ? 15.556  -15.316 27.417  1.00 20.76 ? 565 ASN A CG  1 
ATOM   2698 O OD1 . ASN A 1 354 ? 16.388  -14.443 27.655  1.00 20.59 ? 565 ASN A OD1 1 
ATOM   2699 N ND2 . ASN A 1 354 ? 15.776  -16.619 27.727  1.00 24.99 ? 565 ASN A ND2 1 
ATOM   2700 N N   . GLN A 1 355 ? 15.083  -11.563 27.383  1.00 16.80 ? 566 GLN A N   1 
ATOM   2701 C CA  . GLN A 1 355 ? 15.309  -10.505 28.336  1.00 16.39 ? 566 GLN A CA  1 
ATOM   2702 C C   . GLN A 1 355 ? 14.480  -9.239  28.040  1.00 16.13 ? 566 GLN A C   1 
ATOM   2703 O O   . GLN A 1 355 ? 14.711  -8.191  28.637  1.00 15.25 ? 566 GLN A O   1 
ATOM   2704 C CB  . GLN A 1 355 ? 16.781  -10.192 28.415  1.00 15.71 ? 566 GLN A CB  1 
ATOM   2705 C CG  . GLN A 1 355 ? 17.488  -11.068 29.422  1.00 17.17 ? 566 GLN A CG  1 
ATOM   2706 C CD  . GLN A 1 355 ? 18.975  -11.063 29.242  1.00 20.09 ? 566 GLN A CD  1 
ATOM   2707 O OE1 . GLN A 1 355 ? 19.487  -11.743 28.338  1.00 21.59 ? 566 GLN A OE1 1 
ATOM   2708 N NE2 . GLN A 1 355 ? 19.696  -10.277 30.073  1.00 18.02 ? 566 GLN A NE2 1 
ATOM   2709 N N   . VAL A 1 356 ? 13.514  -9.365  27.134  1.00 15.73 ? 567 VAL A N   1 
ATOM   2710 C CA  . VAL A 1 356 ? 12.721  -8.253  26.701  1.00 15.50 ? 567 VAL A CA  1 
ATOM   2711 C C   . VAL A 1 356 ? 11.258  -8.605  26.722  1.00 16.05 ? 567 VAL A C   1 
ATOM   2712 O O   . VAL A 1 356 ? 10.841  -9.661  26.218  1.00 16.88 ? 567 VAL A O   1 
ATOM   2713 C CB  . VAL A 1 356 ? 13.104  -7.806  25.260  1.00 15.06 ? 567 VAL A CB  1 
ATOM   2714 C CG1 . VAL A 1 356 ? 12.208  -6.679  24.827  1.00 14.88 ? 567 VAL A CG1 1 
ATOM   2715 C CG2 . VAL A 1 356 ? 14.562  -7.416  25.203  1.00 13.56 ? 567 VAL A CG2 1 
ATOM   2716 N N   . ARG A 1 357 ? 10.473  -7.695  27.291  1.00 15.68 ? 568 ARG A N   1 
ATOM   2717 C CA  . ARG A 1 357 ? 9.051   -7.786  27.211  1.00 16.25 ? 568 ARG A CA  1 
ATOM   2718 C C   . ARG A 1 357 ? 8.507   -6.414  26.842  1.00 15.73 ? 568 ARG A C   1 
ATOM   2719 O O   . ARG A 1 357 ? 8.484   -5.486  27.651  1.00 15.08 ? 568 ARG A O   1 
ATOM   2720 C CB  . ARG A 1 357 ? 8.476   -8.264  28.565  1.00 17.64 ? 568 ARG A CB  1 
ATOM   2721 C CG  . ARG A 1 357 ? 6.984   -8.417  28.516  1.00 20.79 ? 568 ARG A CG  1 
ATOM   2722 C CD  . ARG A 1 357 ? 6.343   -8.922  29.820  1.00 25.40 ? 568 ARG A CD  1 
ATOM   2723 N NE  . ARG A 1 357 ? 4.904   -8.877  29.608  1.00 30.97 ? 568 ARG A NE  1 
ATOM   2724 C CZ  . ARG A 1 357 ? 3.970   -8.736  30.544  1.00 34.80 ? 568 ARG A CZ  1 
ATOM   2725 N NH1 . ARG A 1 357 ? 4.286   -8.623  31.831  1.00 36.65 ? 568 ARG A NH1 1 
ATOM   2726 N NH2 . ARG A 1 357 ? 2.694   -8.725  30.174  1.00 35.38 ? 568 ARG A NH2 1 
ATOM   2727 N N   . MET A 1 358 ? 8.049   -6.297  25.614  1.00 16.19 ? 569 MET A N   1 
ATOM   2728 C CA  . MET A 1 358 ? 7.469   -5.069  25.141  1.00 16.46 ? 569 MET A CA  1 
ATOM   2729 C C   . MET A 1 358 ? 6.196   -4.805  25.914  1.00 16.87 ? 569 MET A C   1 
ATOM   2730 O O   . MET A 1 358 ? 5.446   -5.728  26.201  1.00 16.76 ? 569 MET A O   1 
ATOM   2731 C CB  . MET A 1 358 ? 7.192   -5.172  23.640  1.00 16.17 ? 569 MET A CB  1 
ATOM   2732 C CG  . MET A 1 358 ? 8.458   -5.435  22.820  1.00 15.96 ? 569 MET A CG  1 
ATOM   2733 S SD  . MET A 1 358 ? 8.196   -5.342  21.060  1.00 18.08 ? 569 MET A SD  1 
ATOM   2734 C CE  . MET A 1 358 ? 7.075   -6.729  20.801  1.00 14.93 ? 569 MET A CE  1 
ATOM   2735 N N   . ARG A 1 359 ? 5.951   -3.535  26.207  1.00 17.66 ? 570 ARG A N   1 
ATOM   2736 C CA  . ARG A 1 359 ? 4.925   -3.124  27.162  1.00 17.77 ? 570 ARG A CA  1 
ATOM   2737 C C   . ARG A 1 359 ? 4.110   -1.913  26.717  1.00 17.16 ? 570 ARG A C   1 
ATOM   2738 O O   . ARG A 1 359 ? 2.880   -1.944  26.820  1.00 17.81 ? 570 ARG A O   1 
ATOM   2739 C CB  . ARG A 1 359 ? 5.591   -2.822  28.490  1.00 19.79 ? 570 ARG A CB  1 
ATOM   2740 C CG  . ARG A 1 359 ? 5.914   -3.994  29.379  1.00 25.30 ? 570 ARG A CG  1 
ATOM   2741 C CD  . ARG A 1 359 ? 4.715   -4.962  29.602  1.00 31.21 ? 570 ARG A CD  1 
ATOM   2742 N NE  . ARG A 1 359 ? 3.444   -4.257  29.510  1.00 39.56 ? 570 ARG A NE  1 
ATOM   2743 C CZ  . ARG A 1 359 ? 2.730   -3.770  30.531  1.00 43.23 ? 570 ARG A CZ  1 
ATOM   2744 N NH1 . ARG A 1 359 ? 3.118   -3.944  31.797  1.00 45.18 ? 570 ARG A NH1 1 
ATOM   2745 N NH2 . ARG A 1 359 ? 1.593   -3.114  30.264  1.00 42.88 ? 570 ARG A NH2 1 
ATOM   2746 N N   . TYR A 1 360 ? 4.752   -0.864  26.175  1.00 15.78 ? 571 TYR A N   1 
ATOM   2747 C CA  . TYR A 1 360 ? 4.016   0.293   25.651  1.00 15.50 ? 571 TYR A CA  1 
ATOM   2748 C C   . TYR A 1 360 ? 4.554   0.812   24.309  1.00 14.81 ? 571 TYR A C   1 
ATOM   2749 O O   . TYR A 1 360 ? 5.749   0.753   24.023  1.00 13.39 ? 571 TYR A O   1 
ATOM   2750 C CB  . TYR A 1 360 ? 3.961   1.476   26.636  1.00 15.95 ? 571 TYR A CB  1 
ATOM   2751 C CG  . TYR A 1 360 ? 3.478   1.128   28.028  1.00 17.01 ? 571 TYR A CG  1 
ATOM   2752 C CD1 . TYR A 1 360 ? 2.121   1.136   28.348  1.00 17.77 ? 571 TYR A CD1 1 
ATOM   2753 C CD2 . TYR A 1 360 ? 4.387   0.779   29.026  1.00 18.60 ? 571 TYR A CD2 1 
ATOM   2754 C CE1 . TYR A 1 360 ? 1.688   0.825   29.644  1.00 20.04 ? 571 TYR A CE1 1 
ATOM   2755 C CE2 . TYR A 1 360 ? 3.962   0.437   30.303  1.00 17.97 ? 571 TYR A CE2 1 
ATOM   2756 C CZ  . TYR A 1 360 ? 2.625   0.454   30.606  1.00 20.45 ? 571 TYR A CZ  1 
ATOM   2757 O OH  . TYR A 1 360 ? 2.240   0.133   31.895  1.00 26.55 ? 571 TYR A OH  1 
ATOM   2758 N N   . LEU A 1 361 ? 3.620   1.289   23.506  1.00 14.26 ? 572 LEU A N   1 
ATOM   2759 C CA  . LEU A 1 361 ? 3.911   1.869   22.230  1.00 16.04 ? 572 LEU A CA  1 
ATOM   2760 C C   . LEU A 1 361 ? 3.317   3.275   22.225  1.00 16.41 ? 572 LEU A C   1 
ATOM   2761 O O   . LEU A 1 361 ? 2.125   3.442   22.381  1.00 17.23 ? 572 LEU A O   1 
ATOM   2762 C CB  . LEU A 1 361 ? 3.308   1.023   21.103  1.00 15.07 ? 572 LEU A CB  1 
ATOM   2763 C CG  . LEU A 1 361 ? 3.826   1.371   19.688  1.00 15.89 ? 572 LEU A CG  1 
ATOM   2764 C CD1 . LEU A 1 361 ? 5.336   1.153   19.498  1.00 8.96  ? 572 LEU A CD1 1 
ATOM   2765 C CD2 . LEU A 1 361 ? 3.038   0.521   18.630  1.00 12.93 ? 572 LEU A CD2 1 
ATOM   2766 N N   . LEU A 1 362 ? 4.177   4.271   22.066  1.00 17.20 ? 573 LEU A N   1 
ATOM   2767 C CA  . LEU A 1 362 ? 3.796   5.680   22.093  1.00 16.77 ? 573 LEU A CA  1 
ATOM   2768 C C   . LEU A 1 362 ? 3.751   6.214   20.677  1.00 17.25 ? 573 LEU A C   1 
ATOM   2769 O O   . LEU A 1 362 ? 4.653   5.939   19.908  1.00 18.12 ? 573 LEU A O   1 
ATOM   2770 C CB  . LEU A 1 362 ? 4.847   6.453   22.864  1.00 15.89 ? 573 LEU A CB  1 
ATOM   2771 C CG  . LEU A 1 362 ? 4.972   6.311   24.387  1.00 15.95 ? 573 LEU A CG  1 
ATOM   2772 C CD1 . LEU A 1 362 ? 5.585   4.953   24.832  1.00 17.88 ? 573 LEU A CD1 1 
ATOM   2773 C CD2 . LEU A 1 362 ? 5.821   7.449   24.832  1.00 16.83 ? 573 LEU A CD2 1 
ATOM   2774 N N   . LYS A 1 363 ? 2.702   6.938   20.322  1.00 17.72 ? 574 LYS A N   1 
ATOM   2775 C CA  . LYS A 1 363 ? 2.614   7.629   19.047  1.00 18.37 ? 574 LYS A CA  1 
ATOM   2776 C C   . LYS A 1 363 ? 2.978   9.082   19.357  1.00 19.17 ? 574 LYS A C   1 
ATOM   2777 O O   . LYS A 1 363 ? 2.297   9.771   20.152  1.00 18.28 ? 574 LYS A O   1 
ATOM   2778 C CB  . LYS A 1 363 ? 1.226   7.514   18.449  1.00 19.21 ? 574 LYS A CB  1 
ATOM   2779 C CG  . LYS A 1 363 ? 1.106   8.038   17.025  1.00 21.52 ? 574 LYS A CG  1 
ATOM   2780 C CD  . LYS A 1 363 ? -0.394  8.148   16.630  1.00 23.91 ? 574 LYS A CD  1 
ATOM   2781 C CE  . LYS A 1 363 ? -0.623  8.744   15.235  1.00 25.19 ? 574 LYS A CE  1 
ATOM   2782 N NZ  . LYS A 1 363 ? -2.040  8.544   14.827  1.00 25.28 ? 574 LYS A NZ  1 
ATOM   2783 N N   . VAL A 1 364 ? 4.116   9.495   18.794  1.00 17.82 ? 575 VAL A N   1 
ATOM   2784 C CA  . VAL A 1 364 ? 4.745   10.742  19.122  1.00 18.40 ? 575 VAL A CA  1 
ATOM   2785 C C   . VAL A 1 364 ? 4.722   11.698  17.914  1.00 18.68 ? 575 VAL A C   1 
ATOM   2786 O O   . VAL A 1 364 ? 5.017   11.297  16.769  1.00 17.90 ? 575 VAL A O   1 
ATOM   2787 C CB  . VAL A 1 364 ? 6.180   10.479  19.582  1.00 18.27 ? 575 VAL A CB  1 
ATOM   2788 C CG1 . VAL A 1 364 ? 6.829   11.761  19.964  1.00 19.84 ? 575 VAL A CG1 1 
ATOM   2789 C CG2 . VAL A 1 364 ? 6.192   9.474   20.749  1.00 18.19 ? 575 VAL A CG2 1 
ATOM   2790 N N   . GLN A 1 365 ? 4.362   12.954  18.181  1.00 18.87 ? 576 GLN A N   1 
ATOM   2791 C CA  . GLN A 1 365 ? 4.557   14.047  17.214  1.00 19.96 ? 576 GLN A CA  1 
ATOM   2792 C C   . GLN A 1 365 ? 5.845   14.780  17.538  1.00 18.83 ? 576 GLN A C   1 
ATOM   2793 O O   . GLN A 1 365 ? 6.076   15.166  18.684  1.00 19.21 ? 576 GLN A O   1 
ATOM   2794 C CB  . GLN A 1 365 ? 3.370   14.999  17.260  1.00 21.35 ? 576 GLN A CB  1 
ATOM   2795 C CG  . GLN A 1 365 ? 3.468   16.276  16.414  1.00 22.25 ? 576 GLN A CG  1 
ATOM   2796 C CD  . GLN A 1 365 ? 2.299   17.166  16.752  1.00 26.59 ? 576 GLN A CD  1 
ATOM   2797 O OE1 . GLN A 1 365 ? 1.191   16.907  16.304  1.00 29.10 ? 576 GLN A OE1 1 
ATOM   2798 N NE2 . GLN A 1 365 ? 2.523   18.171  17.625  1.00 25.06 ? 576 GLN A NE2 1 
ATOM   2799 N N   . PHE A 1 366 ? 6.703   14.926  16.528  1.00 17.80 ? 577 PHE A N   1 
ATOM   2800 C CA  . PHE A 1 366 ? 7.993   15.563  16.698  1.00 18.18 ? 577 PHE A CA  1 
ATOM   2801 C C   . PHE A 1 366 ? 7.790   17.043  16.291  1.00 18.97 ? 577 PHE A C   1 
ATOM   2802 O O   . PHE A 1 366 ? 7.242   17.311  15.229  1.00 19.66 ? 577 PHE A O   1 
ATOM   2803 C CB  . PHE A 1 366 ? 9.084   14.924  15.832  1.00 17.33 ? 577 PHE A CB  1 
ATOM   2804 C CG  . PHE A 1 366 ? 9.594   13.560  16.349  1.00 17.34 ? 577 PHE A CG  1 
ATOM   2805 C CD1 . PHE A 1 366 ? 10.856  13.437  16.883  1.00 15.01 ? 577 PHE A CD1 1 
ATOM   2806 C CD2 . PHE A 1 366 ? 8.800   12.435  16.295  1.00 18.36 ? 577 PHE A CD2 1 
ATOM   2807 C CE1 . PHE A 1 366 ? 11.340  12.215  17.335  1.00 18.86 ? 577 PHE A CE1 1 
ATOM   2808 C CE2 . PHE A 1 366 ? 9.284   11.198  16.768  1.00 18.63 ? 577 PHE A CE2 1 
ATOM   2809 C CZ  . PHE A 1 366 ? 10.555  11.109  17.288  1.00 16.28 ? 577 PHE A CZ  1 
ATOM   2810 N N   . ASN A 1 367 ? 8.202   17.968  17.145  1.00 18.97 ? 578 ASN A N   1 
ATOM   2811 C CA  . ASN A 1 367 ? 7.967   19.411  16.904  1.00 20.43 ? 578 ASN A CA  1 
ATOM   2812 C C   . ASN A 1 367 ? 9.276   20.049  16.537  1.00 20.36 ? 578 ASN A C   1 
ATOM   2813 O O   . ASN A 1 367 ? 10.122  20.287  17.392  1.00 21.36 ? 578 ASN A O   1 
ATOM   2814 C CB  . ASN A 1 367 ? 7.399   20.076  18.147  1.00 20.79 ? 578 ASN A CB  1 
ATOM   2815 C CG  . ASN A 1 367 ? 6.138   19.387  18.639  1.00 23.51 ? 578 ASN A CG  1 
ATOM   2816 O OD1 . ASN A 1 367 ? 5.182   19.222  17.889  1.00 24.99 ? 578 ASN A OD1 1 
ATOM   2817 N ND2 . ASN A 1 367 ? 6.148   18.960  19.905  1.00 23.10 ? 578 ASN A ND2 1 
ATOM   2818 N N   . PHE A 1 368 ? 9.479   20.245  15.253  1.00 20.38 ? 579 PHE A N   1 
ATOM   2819 C CA  . PHE A 1 368 ? 10.729  20.811  14.780  1.00 22.31 ? 579 PHE A CA  1 
ATOM   2820 C C   . PHE A 1 368 ? 10.698  22.384  14.779  1.00 22.49 ? 579 PHE A C   1 
ATOM   2821 O O   . PHE A 1 368 ? 11.794  22.959  14.760  1.00 23.82 ? 579 PHE A O   1 
ATOM   2822 C CB  . PHE A 1 368 ? 11.085  20.242  13.400  1.00 21.58 ? 579 PHE A CB  1 
ATOM   2823 C CG  . PHE A 1 368 ? 11.496  18.786  13.452  1.00 21.75 ? 579 PHE A CG  1 
ATOM   2824 C CD1 . PHE A 1 368 ? 12.787  18.433  13.820  1.00 21.95 ? 579 PHE A CD1 1 
ATOM   2825 C CD2 . PHE A 1 368 ? 10.579  17.785  13.244  1.00 18.75 ? 579 PHE A CD2 1 
ATOM   2826 C CE1 . PHE A 1 368 ? 13.142  17.086  13.935  1.00 22.28 ? 579 PHE A CE1 1 
ATOM   2827 C CE2 . PHE A 1 368 ? 10.938  16.437  13.366  1.00 17.63 ? 579 PHE A CE2 1 
ATOM   2828 C CZ  . PHE A 1 368 ? 12.195  16.087  13.701  1.00 16.55 ? 579 PHE A CZ  1 
ATOM   2829 N N   . THR B 1 15  ? 12.783  -39.523 -22.546 1.00 61.34 ? 226 THR B N   1 
ATOM   2830 C CA  . THR B 1 15  ? 13.182  -38.275 -23.278 1.00 61.65 ? 226 THR B CA  1 
ATOM   2831 C C   . THR B 1 15  ? 12.060  -37.207 -23.291 1.00 61.32 ? 226 THR B C   1 
ATOM   2832 O O   . THR B 1 15  ? 11.933  -36.412 -24.242 1.00 62.32 ? 226 THR B O   1 
ATOM   2833 C CB  . THR B 1 15  ? 13.646  -38.578 -24.741 1.00 62.73 ? 226 THR B CB  1 
ATOM   2834 O OG1 . THR B 1 15  ? 12.503  -38.789 -25.584 1.00 64.63 ? 226 THR B OG1 1 
ATOM   2835 C CG2 . THR B 1 15  ? 14.607  -39.793 -24.788 1.00 62.48 ? 226 THR B CG2 1 
ATOM   2836 N N   . GLU B 1 16  ? 11.275  -37.191 -22.212 1.00 59.73 ? 227 GLU B N   1 
ATOM   2837 C CA  . GLU B 1 16  ? 10.342  -36.100 -21.904 1.00 58.73 ? 227 GLU B CA  1 
ATOM   2838 C C   . GLU B 1 16  ? 11.133  -34.804 -21.602 1.00 57.54 ? 227 GLU B C   1 
ATOM   2839 O O   . GLU B 1 16  ? 10.608  -33.700 -21.798 1.00 57.40 ? 227 GLU B O   1 
ATOM   2840 C CB  . GLU B 1 16  ? 9.455   -36.504 -20.704 1.00 58.22 ? 227 GLU B CB  1 
ATOM   2841 C CG  . GLU B 1 16  ? 8.180   -35.689 -20.490 1.00 58.32 ? 227 GLU B CG  1 
ATOM   2842 C CD  . GLU B 1 16  ? 6.945   -36.193 -21.289 1.00 59.03 ? 227 GLU B CD  1 
ATOM   2843 O OE1 . GLU B 1 16  ? 5.859   -35.612 -21.083 1.00 58.32 ? 227 GLU B OE1 1 
ATOM   2844 O OE2 . GLU B 1 16  ? 7.050   -37.136 -22.111 1.00 55.96 ? 227 GLU B OE2 1 
ATOM   2845 N N   . ASN B 1 17  ? 12.389  -34.951 -21.139 1.00 55.32 ? 228 ASN B N   1 
ATOM   2846 C CA  . ASN B 1 17  ? 13.265  -33.810 -20.769 1.00 54.04 ? 228 ASN B CA  1 
ATOM   2847 C C   . ASN B 1 17  ? 13.667  -32.884 -21.923 1.00 53.57 ? 228 ASN B C   1 
ATOM   2848 O O   . ASN B 1 17  ? 13.973  -31.713 -21.691 1.00 54.01 ? 228 ASN B O   1 
ATOM   2849 C CB  . ASN B 1 17  ? 14.530  -34.313 -20.047 1.00 52.83 ? 228 ASN B CB  1 
ATOM   2850 N N   . LEU B 1 18  ? 13.680  -33.406 -23.152 1.00 53.43 ? 229 LEU B N   1 
ATOM   2851 C CA  . LEU B 1 18  ? 13.894  -32.590 -24.376 1.00 53.51 ? 229 LEU B CA  1 
ATOM   2852 C C   . LEU B 1 18  ? 12.846  -31.486 -24.534 1.00 53.22 ? 229 LEU B C   1 
ATOM   2853 O O   . LEU B 1 18  ? 13.105  -30.444 -25.155 1.00 52.92 ? 229 LEU B O   1 
ATOM   2854 C CB  . LEU B 1 18  ? 13.838  -33.466 -25.644 1.00 54.30 ? 229 LEU B CB  1 
ATOM   2855 C CG  . LEU B 1 18  ? 15.057  -34.317 -25.989 1.00 54.37 ? 229 LEU B CG  1 
ATOM   2856 C CD1 . LEU B 1 18  ? 14.741  -35.241 -27.148 1.00 54.48 ? 229 LEU B CD1 1 
ATOM   2857 C CD2 . LEU B 1 18  ? 16.267  -33.413 -26.280 1.00 55.96 ? 229 LEU B CD2 1 
ATOM   2858 N N   . TYR B 1 19  ? 11.654  -31.761 -24.004 1.00 51.99 ? 230 TYR B N   1 
ATOM   2859 C CA  . TYR B 1 19  ? 10.497  -30.895 -24.143 1.00 52.06 ? 230 TYR B CA  1 
ATOM   2860 C C   . TYR B 1 19  ? 10.302  -29.969 -22.947 1.00 51.50 ? 230 TYR B C   1 
ATOM   2861 O O   . TYR B 1 19  ? 10.049  -28.779 -23.130 1.00 51.17 ? 230 TYR B O   1 
ATOM   2862 C CB  . TYR B 1 19  ? 9.239   -31.748 -24.344 1.00 51.89 ? 230 TYR B CB  1 
ATOM   2863 C CG  . TYR B 1 19  ? 9.248   -32.514 -25.637 1.00 52.06 ? 230 TYR B CG  1 
ATOM   2864 C CD1 . TYR B 1 19  ? 8.936   -31.886 -26.837 1.00 51.30 ? 230 TYR B CD1 1 
ATOM   2865 C CD2 . TYR B 1 19  ? 9.560   -33.871 -25.664 1.00 51.43 ? 230 TYR B CD2 1 
ATOM   2866 C CE1 . TYR B 1 19  ? 8.939   -32.585 -28.028 1.00 53.07 ? 230 TYR B CE1 1 
ATOM   2867 C CE2 . TYR B 1 19  ? 9.561   -34.579 -26.850 1.00 52.04 ? 230 TYR B CE2 1 
ATOM   2868 C CZ  . TYR B 1 19  ? 9.250   -33.931 -28.027 1.00 52.43 ? 230 TYR B CZ  1 
ATOM   2869 O OH  . TYR B 1 19  ? 9.260   -34.621 -29.203 1.00 53.25 ? 230 TYR B OH  1 
ATOM   2870 N N   . PHE B 1 20  ? 10.414  -30.514 -21.736 1.00 50.84 ? 231 PHE B N   1 
ATOM   2871 C CA  . PHE B 1 20  ? 9.969   -29.806 -20.531 1.00 51.55 ? 231 PHE B CA  1 
ATOM   2872 C C   . PHE B 1 20  ? 11.079  -29.368 -19.593 1.00 51.40 ? 231 PHE B C   1 
ATOM   2873 O O   . PHE B 1 20  ? 10.916  -28.371 -18.904 1.00 52.38 ? 231 PHE B O   1 
ATOM   2874 C CB  . PHE B 1 20  ? 8.928   -30.641 -19.774 1.00 51.37 ? 231 PHE B CB  1 
ATOM   2875 C CG  . PHE B 1 20  ? 7.652   -30.828 -20.546 1.00 52.99 ? 231 PHE B CG  1 
ATOM   2876 C CD1 . PHE B 1 20  ? 6.828   -29.730 -20.828 1.00 55.23 ? 231 PHE B CD1 1 
ATOM   2877 C CD2 . PHE B 1 20  ? 7.288   -32.080 -21.033 1.00 53.71 ? 231 PHE B CD2 1 
ATOM   2878 C CE1 . PHE B 1 20  ? 5.644   -29.885 -21.580 1.00 56.64 ? 231 PHE B CE1 1 
ATOM   2879 C CE2 . PHE B 1 20  ? 6.110   -32.253 -21.776 1.00 55.36 ? 231 PHE B CE2 1 
ATOM   2880 C CZ  . PHE B 1 20  ? 5.285   -31.152 -22.051 1.00 56.48 ? 231 PHE B CZ  1 
ATOM   2881 N N   . GLN B 1 21  ? 12.198  -30.087 -19.553 1.00 51.55 ? 232 GLN B N   1 
ATOM   2882 C CA  . GLN B 1 21  ? 13.344  -29.689 -18.704 1.00 51.30 ? 232 GLN B CA  1 
ATOM   2883 C C   . GLN B 1 21  ? 12.983  -29.742 -17.216 1.00 50.66 ? 232 GLN B C   1 
ATOM   2884 O O   . GLN B 1 21  ? 12.679  -28.714 -16.601 1.00 51.68 ? 232 GLN B O   1 
ATOM   2885 C CB  . GLN B 1 21  ? 13.864  -28.288 -19.075 1.00 51.57 ? 232 GLN B CB  1 
ATOM   2886 N N   . SER B 1 22  ? 12.988  -30.949 -16.655 1.00 49.89 ? 233 SER B N   1 
ATOM   2887 C CA  . SER B 1 22  ? 12.697  -31.151 -15.227 1.00 48.89 ? 233 SER B CA  1 
ATOM   2888 C C   . SER B 1 22  ? 13.979  -31.376 -14.461 1.00 47.55 ? 233 SER B C   1 
ATOM   2889 O O   . SER B 1 22  ? 15.001  -31.797 -15.032 1.00 47.33 ? 233 SER B O   1 
ATOM   2890 C CB  . SER B 1 22  ? 11.791  -32.372 -15.022 1.00 48.85 ? 233 SER B CB  1 
ATOM   2891 O OG  . SER B 1 22  ? 10.577  -32.232 -15.759 1.00 50.32 ? 233 SER B OG  1 
ATOM   2892 N N   . MET B 1 23  ? 13.922  -31.095 -13.164 1.00 45.90 ? 234 MET B N   1 
ATOM   2893 C CA  . MET B 1 23  ? 14.937  -31.549 -12.237 1.00 44.55 ? 234 MET B CA  1 
ATOM   2894 C C   . MET B 1 23  ? 15.247  -33.012 -12.533 1.00 43.45 ? 234 MET B C   1 
ATOM   2895 O O   . MET B 1 23  ? 14.356  -33.863 -12.528 1.00 43.65 ? 234 MET B O   1 
ATOM   2896 C CB  . MET B 1 23  ? 14.438  -31.394 -10.779 1.00 43.96 ? 234 MET B CB  1 
ATOM   2897 C CG  . MET B 1 23  ? 15.441  -31.832 -9.705  1.00 44.89 ? 234 MET B CG  1 
ATOM   2898 S SD  . MET B 1 23  ? 14.916  -31.458 -7.991  1.00 44.60 ? 234 MET B SD  1 
ATOM   2899 C CE  . MET B 1 23  ? 14.937  -29.666 -8.059  1.00 45.05 ? 234 MET B CE  1 
ATOM   2900 N N   . ASP B 1 24  ? 16.512  -33.304 -12.787 1.00 42.48 ? 235 ASP B N   1 
ATOM   2901 C CA  . ASP B 1 24  ? 16.929  -34.664 -12.997 1.00 42.17 ? 235 ASP B CA  1 
ATOM   2902 C C   . ASP B 1 24  ? 16.328  -35.498 -11.868 1.00 41.45 ? 235 ASP B C   1 
ATOM   2903 O O   . ASP B 1 24  ? 16.283  -35.052 -10.705 1.00 40.79 ? 235 ASP B O   1 
ATOM   2904 C CB  . ASP B 1 24  ? 18.458  -34.763 -13.010 1.00 41.99 ? 235 ASP B CB  1 
ATOM   2905 C CG  . ASP B 1 24  ? 18.961  -36.165 -13.339 1.00 43.86 ? 235 ASP B CG  1 
ATOM   2906 O OD1 . ASP B 1 24  ? 18.471  -37.146 -12.743 1.00 46.89 ? 235 ASP B OD1 1 
ATOM   2907 O OD2 . ASP B 1 24  ? 19.862  -36.296 -14.191 1.00 46.11 ? 235 ASP B OD2 1 
ATOM   2908 N N   . LEU B 1 25  ? 15.891  -36.710 -12.197 1.00 40.58 ? 236 LEU B N   1 
ATOM   2909 C CA  . LEU B 1 25  ? 15.258  -37.590 -11.206 1.00 40.26 ? 236 LEU B CA  1 
ATOM   2910 C C   . LEU B 1 25  ? 16.184  -37.811 -10.010 1.00 38.29 ? 236 LEU B C   1 
ATOM   2911 O O   . LEU B 1 25  ? 15.745  -37.865 -8.875  1.00 37.80 ? 236 LEU B O   1 
ATOM   2912 C CB  . LEU B 1 25  ? 14.876  -38.950 -11.842 1.00 41.22 ? 236 LEU B CB  1 
ATOM   2913 C CG  . LEU B 1 25  ? 13.807  -39.845 -11.188 1.00 42.08 ? 236 LEU B CG  1 
ATOM   2914 C CD1 . LEU B 1 25  ? 13.510  -39.451 -9.745  1.00 43.58 ? 236 LEU B CD1 1 
ATOM   2915 C CD2 . LEU B 1 25  ? 12.486  -39.879 -12.007 1.00 44.63 ? 236 LEU B CD2 1 
ATOM   2916 N N   . ARG B 1 26  ? 17.472  -37.934 -10.284 1.00 36.90 ? 237 ARG B N   1 
ATOM   2917 C CA  . ARG B 1 26  ? 18.426  -38.264 -9.272  1.00 35.09 ? 237 ARG B CA  1 
ATOM   2918 C C   . ARG B 1 26  ? 18.634  -37.113 -8.279  1.00 33.82 ? 237 ARG B C   1 
ATOM   2919 O O   . ARG B 1 26  ? 18.846  -37.343 -7.102  1.00 31.71 ? 237 ARG B O   1 
ATOM   2920 C CB  . ARG B 1 26  ? 19.716  -38.673 -9.942  1.00 35.16 ? 237 ARG B CB  1 
ATOM   2921 C CG  . ARG B 1 26  ? 19.562  -39.934 -10.784 1.00 35.69 ? 237 ARG B CG  1 
ATOM   2922 C CD  . ARG B 1 26  ? 20.393  -39.821 -12.042 1.00 36.79 ? 237 ARG B CD  1 
ATOM   2923 N NE  . ARG B 1 26  ? 21.813  -39.871 -11.720 1.00 34.44 ? 237 ARG B NE  1 
ATOM   2924 C CZ  . ARG B 1 26  ? 22.793  -39.608 -12.571 1.00 33.22 ? 237 ARG B CZ  1 
ATOM   2925 N NH1 . ARG B 1 26  ? 24.053  -39.695 -12.160 1.00 34.93 ? 237 ARG B NH1 1 
ATOM   2926 N NH2 . ARG B 1 26  ? 22.527  -39.209 -13.799 1.00 31.92 ? 237 ARG B NH2 1 
ATOM   2927 N N   . VAL B 1 27  ? 18.548  -35.888 -8.765  1.00 33.14 ? 238 VAL B N   1 
ATOM   2928 C CA  . VAL B 1 27  ? 18.563  -34.729 -7.875  1.00 32.85 ? 238 VAL B CA  1 
ATOM   2929 C C   . VAL B 1 27  ? 17.252  -34.681 -7.065  1.00 32.91 ? 238 VAL B C   1 
ATOM   2930 O O   . VAL B 1 27  ? 17.276  -34.420 -5.858  1.00 31.29 ? 238 VAL B O   1 
ATOM   2931 C CB  . VAL B 1 27  ? 18.775  -33.423 -8.650  1.00 32.92 ? 238 VAL B CB  1 
ATOM   2932 C CG1 . VAL B 1 27  ? 18.769  -32.257 -7.714  1.00 31.87 ? 238 VAL B CG1 1 
ATOM   2933 C CG2 . VAL B 1 27  ? 20.100  -33.478 -9.437  1.00 32.21 ? 238 VAL B CG2 1 
ATOM   2934 N N   . GLN B 1 28  ? 16.125  -34.931 -7.729  1.00 33.01 ? 239 GLN B N   1 
ATOM   2935 C CA  . GLN B 1 28  ? 14.842  -35.052 -7.043  1.00 34.02 ? 239 GLN B CA  1 
ATOM   2936 C C   . GLN B 1 28  ? 14.947  -35.953 -5.828  1.00 33.34 ? 239 GLN B C   1 
ATOM   2937 O O   . GLN B 1 28  ? 14.562  -35.571 -4.736  1.00 32.50 ? 239 GLN B O   1 
ATOM   2938 C CB  . GLN B 1 28  ? 13.760  -35.636 -7.950  1.00 35.09 ? 239 GLN B CB  1 
ATOM   2939 C CG  . GLN B 1 28  ? 13.067  -34.651 -8.831  1.00 35.70 ? 239 GLN B CG  1 
ATOM   2940 C CD  . GLN B 1 28  ? 11.979  -35.310 -9.657  1.00 36.26 ? 239 GLN B CD  1 
ATOM   2941 O OE1 . GLN B 1 28  ? 11.004  -35.827 -9.123  1.00 38.29 ? 239 GLN B OE1 1 
ATOM   2942 N NE2 . GLN B 1 28  ? 12.144  -35.287 -10.971 1.00 34.15 ? 239 GLN B NE2 1 
ATOM   2943 N N   . GLU B 1 29  ? 15.479  -37.150 -6.028  1.00 33.45 ? 240 GLU B N   1 
ATOM   2944 C CA  . GLU B 1 29  ? 15.587  -38.109 -4.941  1.00 33.27 ? 240 GLU B CA  1 
ATOM   2945 C C   . GLU B 1 29  ? 16.547  -37.630 -3.831  1.00 32.02 ? 240 GLU B C   1 
ATOM   2946 O O   . GLU B 1 29  ? 16.293  -37.869 -2.651  1.00 31.38 ? 240 GLU B O   1 
ATOM   2947 C CB  . GLU B 1 29  ? 15.999  -39.485 -5.481  1.00 34.21 ? 240 GLU B CB  1 
ATOM   2948 C CG  . GLU B 1 29  ? 14.923  -40.172 -6.378  1.00 35.83 ? 240 GLU B CG  1 
ATOM   2949 C CD  . GLU B 1 29  ? 13.628  -40.455 -5.637  1.00 39.71 ? 240 GLU B CD  1 
ATOM   2950 O OE1 . GLU B 1 29  ? 13.706  -40.876 -4.456  1.00 39.87 ? 240 GLU B OE1 1 
ATOM   2951 O OE2 . GLU B 1 29  ? 12.531  -40.249 -6.224  1.00 42.04 ? 240 GLU B OE2 1 
ATOM   2952 N N   . LEU B 1 30  ? 17.619  -36.935 -4.214  1.00 30.31 ? 241 LEU B N   1 
ATOM   2953 C CA  . LEU B 1 30  ? 18.568  -36.399 -3.249  1.00 28.99 ? 241 LEU B CA  1 
ATOM   2954 C C   . LEU B 1 30  ? 17.901  -35.350 -2.409  1.00 28.88 ? 241 LEU B C   1 
ATOM   2955 O O   . LEU B 1 30  ? 18.027  -35.364 -1.179  1.00 28.99 ? 241 LEU B O   1 
ATOM   2956 C CB  . LEU B 1 30  ? 19.770  -35.789 -3.945  1.00 28.37 ? 241 LEU B CB  1 
ATOM   2957 C CG  . LEU B 1 30  ? 20.822  -35.133 -3.072  1.00 27.63 ? 241 LEU B CG  1 
ATOM   2958 C CD1 . LEU B 1 30  ? 21.523  -36.150 -2.188  1.00 25.24 ? 241 LEU B CD1 1 
ATOM   2959 C CD2 . LEU B 1 30  ? 21.797  -34.425 -3.960  1.00 27.16 ? 241 LEU B CD2 1 
ATOM   2960 N N   . ILE B 1 31  ? 17.237  -34.410 -3.069  1.00 28.94 ? 242 ILE B N   1 
ATOM   2961 C CA  . ILE B 1 31  ? 16.508  -33.368 -2.379  1.00 29.16 ? 242 ILE B CA  1 
ATOM   2962 C C   . ILE B 1 31  ? 15.445  -33.927 -1.417  1.00 29.34 ? 242 ILE B C   1 
ATOM   2963 O O   . ILE B 1 31  ? 15.344  -33.445 -0.272  1.00 28.62 ? 242 ILE B O   1 
ATOM   2964 C CB  . ILE B 1 31  ? 15.840  -32.376 -3.358  1.00 29.39 ? 242 ILE B CB  1 
ATOM   2965 C CG1 . ILE B 1 31  ? 16.895  -31.580 -4.162  1.00 30.61 ? 242 ILE B CG1 1 
ATOM   2966 C CG2 . ILE B 1 31  ? 14.910  -31.424 -2.606  1.00 29.40 ? 242 ILE B CG2 1 
ATOM   2967 C CD1 . ILE B 1 31  ? 17.990  -30.897 -3.353  1.00 31.44 ? 242 ILE B CD1 1 
ATOM   2968 N N   . LYS B 1 32  ? 14.660  -34.910 -1.864  1.00 29.02 ? 243 LYS B N   1 
ATOM   2969 C CA  . LYS B 1 32  ? 13.638  -35.532 -0.992  1.00 30.18 ? 243 LYS B CA  1 
ATOM   2970 C C   . LYS B 1 32  ? 14.268  -36.177 0.213   1.00 28.52 ? 243 LYS B C   1 
ATOM   2971 O O   . LYS B 1 32  ? 13.704  -36.176 1.300   1.00 28.58 ? 243 LYS B O   1 
ATOM   2972 C CB  . LYS B 1 32  ? 12.826  -36.626 -1.687  1.00 30.84 ? 243 LYS B CB  1 
ATOM   2973 C CG  . LYS B 1 32  ? 11.819  -36.136 -2.684  1.00 35.51 ? 243 LYS B CG  1 
ATOM   2974 C CD  . LYS B 1 32  ? 11.158  -37.312 -3.460  1.00 39.23 ? 243 LYS B CD  1 
ATOM   2975 C CE  . LYS B 1 32  ? 10.455  -38.309 -2.533  1.00 40.88 ? 243 LYS B CE  1 
ATOM   2976 N NZ  . LYS B 1 32  ? 9.477   -37.671 -1.581  1.00 43.19 ? 243 LYS B NZ  1 
ATOM   2977 N N   . LEU B 1 33  ? 15.416  -36.780 -0.004  1.00 27.87 ? 244 LEU B N   1 
ATOM   2978 C CA  . LEU B 1 33  ? 16.126  -37.432 1.067   1.00 27.25 ? 244 LEU B CA  1 
ATOM   2979 C C   . LEU B 1 33  ? 16.550  -36.403 2.138   1.00 26.17 ? 244 LEU B C   1 
ATOM   2980 O O   . LEU B 1 33  ? 16.226  -36.551 3.317   1.00 25.87 ? 244 LEU B O   1 
ATOM   2981 C CB  . LEU B 1 33  ? 17.340  -38.155 0.501   1.00 26.64 ? 244 LEU B CB  1 
ATOM   2982 C CG  . LEU B 1 33  ? 18.124  -38.996 1.507   1.00 27.35 ? 244 LEU B CG  1 
ATOM   2983 C CD1 . LEU B 1 33  ? 17.223  -39.995 2.290   1.00 27.94 ? 244 LEU B CD1 1 
ATOM   2984 C CD2 . LEU B 1 33  ? 19.240  -39.718 0.777   1.00 29.51 ? 244 LEU B CD2 1 
ATOM   2985 N N   . ILE B 1 34  ? 17.268  -35.358 1.734   1.00 25.36 ? 245 ILE B N   1 
ATOM   2986 C CA  . ILE B 1 34  ? 17.863  -34.463 2.726   1.00 24.07 ? 245 ILE B CA  1 
ATOM   2987 C C   . ILE B 1 34  ? 16.832  -33.567 3.380   1.00 24.15 ? 245 ILE B C   1 
ATOM   2988 O O   . ILE B 1 34  ? 17.032  -33.195 4.510   1.00 23.48 ? 245 ILE B O   1 
ATOM   2989 C CB  . ILE B 1 34  ? 19.038  -33.623 2.191   1.00 23.94 ? 245 ILE B CB  1 
ATOM   2990 C CG1 . ILE B 1 34  ? 18.605  -32.639 1.096   1.00 23.52 ? 245 ILE B CG1 1 
ATOM   2991 C CG2 . ILE B 1 34  ? 20.137  -34.535 1.733   1.00 25.09 ? 245 ILE B CG2 1 
ATOM   2992 C CD1 . ILE B 1 34  ? 19.745  -31.738 0.590   1.00 22.23 ? 245 ILE B CD1 1 
ATOM   2993 N N   . CYS B 1 35  ? 15.734  -33.237 2.687   1.00 24.00 ? 246 CYS B N   1 
ATOM   2994 C CA  . CYS B 1 35  ? 14.703  -32.335 3.236   1.00 25.05 ? 246 CYS B CA  1 
ATOM   2995 C C   . CYS B 1 35  ? 13.597  -33.014 4.059   1.00 25.28 ? 246 CYS B C   1 
ATOM   2996 O O   . CYS B 1 35  ? 12.681  -32.339 4.500   1.00 26.17 ? 246 CYS B O   1 
ATOM   2997 C CB  . CYS B 1 35  ? 14.041  -31.499 2.123   1.00 25.26 ? 246 CYS B CB  1 
ATOM   2998 S SG  . CYS B 1 35  ? 15.154  -30.436 1.219   1.00 26.95 ? 246 CYS B SG  1 
ATOM   2999 N N   . ASN B 1 36  ? 13.686  -34.323 4.261   1.00 25.93 ? 247 ASN B N   1 
ATOM   3000 C CA  . ASN B 1 36  ? 12.681  -35.115 4.986   1.00 26.87 ? 247 ASN B CA  1 
ATOM   3001 C C   . ASN B 1 36  ? 12.690  -34.714 6.471   1.00 26.46 ? 247 ASN B C   1 
ATOM   3002 O O   . ASN B 1 36  ? 13.638  -35.030 7.191   1.00 25.37 ? 247 ASN B O   1 
ATOM   3003 C CB  . ASN B 1 36  ? 13.037  -36.605 4.824   1.00 27.26 ? 247 ASN B CB  1 
ATOM   3004 C CG  . ASN B 1 36  ? 11.981  -37.563 5.397   1.00 29.06 ? 247 ASN B CG  1 
ATOM   3005 O OD1 . ASN B 1 36  ? 11.372  -37.324 6.437   1.00 29.33 ? 247 ASN B OD1 1 
ATOM   3006 N ND2 . ASN B 1 36  ? 11.812  -38.695 4.721   1.00 32.11 ? 247 ASN B ND2 1 
ATOM   3007 N N   . VAL B 1 37  ? 11.665  -33.978 6.893   1.00 26.80 ? 248 VAL B N   1 
ATOM   3008 C CA  . VAL B 1 37  ? 11.600  -33.417 8.238   1.00 26.33 ? 248 VAL B CA  1 
ATOM   3009 C C   . VAL B 1 37  ? 11.348  -34.542 9.249   1.00 26.21 ? 248 VAL B C   1 
ATOM   3010 O O   . VAL B 1 37  ? 11.913  -34.545 10.346  1.00 24.08 ? 248 VAL B O   1 
ATOM   3011 C CB  . VAL B 1 37  ? 10.517  -32.328 8.320   1.00 27.99 ? 248 VAL B CB  1 
ATOM   3012 C CG1 . VAL B 1 37  ? 10.147  -32.017 9.790   1.00 29.08 ? 248 VAL B CG1 1 
ATOM   3013 C CG2 . VAL B 1 37  ? 10.985  -31.054 7.616   1.00 27.57 ? 248 VAL B CG2 1 
ATOM   3014 N N   . GLN B 1 38  ? 10.539  -35.526 8.837   1.00 26.37 ? 249 GLN B N   1 
ATOM   3015 C CA  . GLN B 1 38  ? 10.308  -36.746 9.596   1.00 26.15 ? 249 GLN B CA  1 
ATOM   3016 C C   . GLN B 1 38  ? 11.610  -37.486 9.925   1.00 24.36 ? 249 GLN B C   1 
ATOM   3017 O O   . GLN B 1 38  ? 11.785  -37.891 11.081  1.00 22.79 ? 249 GLN B O   1 
ATOM   3018 C CB  . GLN B 1 38  ? 9.347   -37.672 8.856   1.00 27.92 ? 249 GLN B CB  1 
ATOM   3019 C CG  . GLN B 1 38  ? 9.257   -39.113 9.381   1.00 32.00 ? 249 GLN B CG  1 
ATOM   3020 C CD  . GLN B 1 38  ? 8.060   -39.303 10.268  1.00 40.44 ? 249 GLN B CD  1 
ATOM   3021 O OE1 . GLN B 1 38  ? 7.973   -38.698 11.353  1.00 43.33 ? 249 GLN B OE1 1 
ATOM   3022 N NE2 . GLN B 1 38  ? 7.098   -40.123 9.805   1.00 43.44 ? 249 GLN B NE2 1 
ATOM   3023 N N   . ALA B 1 39  ? 12.539  -37.633 8.971   1.00 22.90 ? 250 ALA B N   1 
ATOM   3024 C CA  . ALA B 1 39  ? 13.800  -38.268 9.335   1.00 22.56 ? 250 ALA B CA  1 
ATOM   3025 C C   . ALA B 1 39  ? 14.560  -37.388 10.346  1.00 21.51 ? 250 ALA B C   1 
ATOM   3026 O O   . ALA B 1 39  ? 15.155  -37.883 11.266  1.00 21.95 ? 250 ALA B O   1 
ATOM   3027 C CB  . ALA B 1 39  ? 14.686  -38.660 8.093   1.00 22.12 ? 250 ALA B CB  1 
ATOM   3028 N N   . MET B 1 40  ? 14.474  -36.078 10.235  1.00 21.66 ? 251 MET B N   1 
ATOM   3029 C CA  . MET B 1 40  ? 15.132  -35.227 11.240  1.00 20.91 ? 251 MET B CA  1 
ATOM   3030 C C   . MET B 1 40  ? 14.573  -35.486 12.648  1.00 21.24 ? 251 MET B C   1 
ATOM   3031 O O   . MET B 1 40  ? 15.323  -35.604 13.612  1.00 20.15 ? 251 MET B O   1 
ATOM   3032 C CB  . MET B 1 40  ? 14.994  -33.758 10.865  1.00 20.93 ? 251 MET B CB  1 
ATOM   3033 C CG  . MET B 1 40  ? 15.628  -33.409 9.509   1.00 20.26 ? 251 MET B CG  1 
ATOM   3034 S SD  . MET B 1 40  ? 15.241  -31.728 8.988   1.00 23.48 ? 251 MET B SD  1 
ATOM   3035 C CE  . MET B 1 40  ? 16.130  -31.596 7.440   1.00 26.12 ? 251 MET B CE  1 
ATOM   3036 N N   . GLU B 1 41  ? 13.250  -35.569 12.737  1.00 22.19 ? 252 GLU B N   1 
ATOM   3037 C CA  . GLU B 1 41  ? 12.518  -35.849 13.993  1.00 23.82 ? 252 GLU B CA  1 
ATOM   3038 C C   . GLU B 1 41  ? 13.024  -37.116 14.676  1.00 22.58 ? 252 GLU B C   1 
ATOM   3039 O O   . GLU B 1 41  ? 13.387  -37.116 15.854  1.00 21.36 ? 252 GLU B O   1 
ATOM   3040 C CB  . GLU B 1 41  ? 10.990  -35.972 13.720  1.00 24.92 ? 252 GLU B CB  1 
ATOM   3041 C CG  . GLU B 1 41  ? 10.165  -34.681 14.010  1.00 30.20 ? 252 GLU B CG  1 
ATOM   3042 C CD  . GLU B 1 41  ? 8.896   -34.539 13.133  1.00 36.42 ? 252 GLU B CD  1 
ATOM   3043 O OE1 . GLU B 1 41  ? 8.384   -35.577 12.626  1.00 39.49 ? 252 GLU B OE1 1 
ATOM   3044 O OE2 . GLU B 1 41  ? 8.429   -33.385 12.940  1.00 38.27 ? 252 GLU B OE2 1 
ATOM   3045 N N   . GLU B 1 42  ? 13.080  -38.179 13.894  1.00 21.62 ? 253 GLU B N   1 
ATOM   3046 C CA  . GLU B 1 42  ? 13.576  -39.469 14.341  1.00 21.95 ? 253 GLU B CA  1 
ATOM   3047 C C   . GLU B 1 42  ? 15.035  -39.403 14.728  1.00 21.63 ? 253 GLU B C   1 
ATOM   3048 O O   . GLU B 1 42  ? 15.423  -40.049 15.698  1.00 20.63 ? 253 GLU B O   1 
ATOM   3049 C CB  . GLU B 1 42  ? 13.394  -40.537 13.234  1.00 22.58 ? 253 GLU B CB  1 
ATOM   3050 C CG  . GLU B 1 42  ? 11.919  -40.811 12.951  1.00 26.31 ? 253 GLU B CG  1 
ATOM   3051 C CD  . GLU B 1 42  ? 11.658  -41.664 11.721  1.00 30.24 ? 253 GLU B CD  1 
ATOM   3052 O OE1 . GLU B 1 42  ? 12.470  -41.670 10.762  1.00 34.35 ? 253 GLU B OE1 1 
ATOM   3053 O OE2 . GLU B 1 42  ? 10.592  -42.309 11.717  1.00 36.82 ? 253 GLU B OE2 1 
ATOM   3054 N N   . MET B 1 43  ? 15.844  -38.665 13.955  1.00 21.30 ? 254 MET B N   1 
ATOM   3055 C CA  . MET B 1 43  ? 17.263  -38.530 14.281  1.00 22.13 ? 254 MET B CA  1 
ATOM   3056 C C   . MET B 1 43  ? 17.399  -37.842 15.629  1.00 21.30 ? 254 MET B C   1 
ATOM   3057 O O   . MET B 1 43  ? 18.185  -38.258 16.454  1.00 20.40 ? 254 MET B O   1 
ATOM   3058 C CB  . MET B 1 43  ? 18.039  -37.748 13.204  1.00 22.56 ? 254 MET B CB  1 
ATOM   3059 C CG  . MET B 1 43  ? 18.512  -38.591 11.974  1.00 25.17 ? 254 MET B CG  1 
ATOM   3060 S SD  . MET B 1 43  ? 19.418  -37.626 10.702  1.00 24.20 ? 254 MET B SD  1 
ATOM   3061 C CE  . MET B 1 43  ? 18.081  -37.293 9.526   1.00 24.35 ? 254 MET B CE  1 
ATOM   3062 N N   . MET B 1 44  ? 16.604  -36.810 15.873  1.00 21.25 ? 255 MET B N   1 
ATOM   3063 C CA  . MET B 1 44  ? 16.767  -36.088 17.130  1.00 21.83 ? 255 MET B CA  1 
ATOM   3064 C C   . MET B 1 44  ? 16.277  -36.930 18.310  1.00 23.23 ? 255 MET B C   1 
ATOM   3065 O O   . MET B 1 44  ? 16.894  -36.917 19.384  1.00 22.92 ? 255 MET B O   1 
ATOM   3066 C CB  . MET B 1 44  ? 16.065  -34.734 17.094  1.00 20.86 ? 255 MET B CB  1 
ATOM   3067 C CG  . MET B 1 44  ? 16.651  -33.732 16.123  1.00 20.04 ? 255 MET B CG  1 
ATOM   3068 S SD  . MET B 1 44  ? 18.371  -33.351 16.517  1.00 22.48 ? 255 MET B SD  1 
ATOM   3069 C CE  . MET B 1 44  ? 19.211  -34.430 15.441  1.00 15.30 ? 255 MET B CE  1 
ATOM   3070 N N   . MET B 1 45  ? 15.194  -37.684 18.109  1.00 24.55 ? 256 MET B N   1 
ATOM   3071 C CA  . MET B 1 45  ? 14.743  -38.651 19.144  1.00 25.81 ? 256 MET B CA  1 
ATOM   3072 C C   . MET B 1 45  ? 15.827  -39.641 19.496  1.00 25.20 ? 256 MET B C   1 
ATOM   3073 O O   . MET B 1 45  ? 16.005  -39.969 20.665  1.00 24.18 ? 256 MET B O   1 
ATOM   3074 C CB  . MET B 1 45  ? 13.471  -39.398 18.706  1.00 27.19 ? 256 MET B CB  1 
ATOM   3075 C CG  . MET B 1 45  ? 12.300  -38.454 18.470  1.00 31.93 ? 256 MET B CG  1 
ATOM   3076 S SD  . MET B 1 45  ? 10.710  -39.277 18.200  1.00 44.32 ? 256 MET B SD  1 
ATOM   3077 C CE  . MET B 1 45  ? 10.385  -39.766 19.906  1.00 43.49 ? 256 MET B CE  1 
ATOM   3078 N N   . GLU B 1 46  ? 16.578  -40.080 18.483  1.00 25.46 ? 257 GLU B N   1 
ATOM   3079 C CA  . GLU B 1 46  ? 17.654  -41.063 18.640  1.00 26.37 ? 257 GLU B CA  1 
ATOM   3080 C C   . GLU B 1 46  ? 18.764  -40.457 19.493  1.00 25.69 ? 257 GLU B C   1 
ATOM   3081 O O   . GLU B 1 46  ? 19.378  -41.133 20.297  1.00 25.04 ? 257 GLU B O   1 
ATOM   3082 C CB  . GLU B 1 46  ? 18.163  -41.484 17.238  1.00 28.12 ? 257 GLU B CB  1 
ATOM   3083 C CG  . GLU B 1 46  ? 19.197  -42.644 17.115  1.00 33.61 ? 257 GLU B CG  1 
ATOM   3084 C CD  . GLU B 1 46  ? 20.663  -42.266 17.481  1.00 41.23 ? 257 GLU B CD  1 
ATOM   3085 O OE1 . GLU B 1 46  ? 21.413  -41.672 16.626  1.00 46.50 ? 257 GLU B OE1 1 
ATOM   3086 O OE2 . GLU B 1 46  ? 21.083  -42.595 18.628  1.00 44.31 ? 257 GLU B OE2 1 
ATOM   3087 N N   . MET B 1 47  ? 18.978  -39.152 19.350  1.00 24.55 ? 258 MET B N   1 
ATOM   3088 C CA  . MET B 1 47  ? 19.965  -38.437 20.152  1.00 23.77 ? 258 MET B CA  1 
ATOM   3089 C C   . MET B 1 47  ? 19.344  -38.004 21.493  1.00 23.02 ? 258 MET B C   1 
ATOM   3090 O O   . MET B 1 47  ? 19.919  -37.199 22.214  1.00 22.02 ? 258 MET B O   1 
ATOM   3091 C CB  . MET B 1 47  ? 20.467  -37.206 19.365  1.00 24.04 ? 258 MET B CB  1 
ATOM   3092 C CG  . MET B 1 47  ? 21.057  -37.501 17.977  1.00 23.80 ? 258 MET B CG  1 
ATOM   3093 S SD  . MET B 1 47  ? 21.737  -36.019 17.111  1.00 24.14 ? 258 MET B SD  1 
ATOM   3094 C CE  . MET B 1 47  ? 23.223  -35.867 18.078  1.00 16.14 ? 258 MET B CE  1 
ATOM   3095 N N   . LYS B 1 48  ? 18.149  -38.516 21.807  1.00 22.61 ? 259 LYS B N   1 
ATOM   3096 C CA  . LYS B 1 48  ? 17.486  -38.316 23.111  1.00 22.66 ? 259 LYS B CA  1 
ATOM   3097 C C   . LYS B 1 48  ? 16.841  -36.954 23.312  1.00 22.47 ? 259 LYS B C   1 
ATOM   3098 O O   . LYS B 1 48  ? 16.390  -36.646 24.412  1.00 20.36 ? 259 LYS B O   1 
ATOM   3099 C CB  . LYS B 1 48  ? 18.447  -38.633 24.292  1.00 23.34 ? 259 LYS B CB  1 
ATOM   3100 C CG  . LYS B 1 48  ? 19.174  -39.964 24.183  1.00 25.01 ? 259 LYS B CG  1 
ATOM   3101 C CD  . LYS B 1 48  ? 18.216  -41.122 24.056  1.00 26.74 ? 259 LYS B CD  1 
ATOM   3102 C CE  . LYS B 1 48  ? 17.634  -41.542 25.456  1.00 31.09 ? 259 LYS B CE  1 
ATOM   3103 N NZ  . LYS B 1 48  ? 16.396  -42.395 25.353  1.00 29.89 ? 259 LYS B NZ  1 
ATOM   3104 N N   . TYR B 1 49  ? 16.773  -36.143 22.244  1.00 21.90 ? 260 TYR B N   1 
ATOM   3105 C CA  . TYR B 1 49  ? 16.088  -34.861 22.291  1.00 21.59 ? 260 TYR B CA  1 
ATOM   3106 C C   . TYR B 1 49  ? 14.583  -35.097 22.378  1.00 22.29 ? 260 TYR B C   1 
ATOM   3107 O O   . TYR B 1 49  ? 14.056  -35.990 21.716  1.00 22.35 ? 260 TYR B O   1 
ATOM   3108 C CB  . TYR B 1 49  ? 16.405  -34.049 21.038  1.00 21.40 ? 260 TYR B CB  1 
ATOM   3109 C CG  . TYR B 1 49  ? 15.729  -32.695 20.997  1.00 22.72 ? 260 TYR B CG  1 
ATOM   3110 C CD1 . TYR B 1 49  ? 16.258  -31.617 21.665  1.00 23.07 ? 260 TYR B CD1 1 
ATOM   3111 C CD2 . TYR B 1 49  ? 14.566  -32.512 20.308  1.00 23.98 ? 260 TYR B CD2 1 
ATOM   3112 C CE1 . TYR B 1 49  ? 15.655  -30.390 21.607  1.00 24.81 ? 260 TYR B CE1 1 
ATOM   3113 C CE2 . TYR B 1 49  ? 13.947  -31.308 20.270  1.00 24.11 ? 260 TYR B CE2 1 
ATOM   3114 C CZ  . TYR B 1 49  ? 14.495  -30.246 20.916  1.00 24.21 ? 260 TYR B CZ  1 
ATOM   3115 O OH  . TYR B 1 49  ? 13.865  -29.034 20.881  1.00 24.88 ? 260 TYR B OH  1 
ATOM   3116 N N   . ASN B 1 50  ? 13.901  -34.287 23.183  1.00 23.17 ? 261 ASN B N   1 
ATOM   3117 C CA  . ASN B 1 50  ? 12.462  -34.440 23.426  1.00 24.26 ? 261 ASN B CA  1 
ATOM   3118 C C   . ASN B 1 50  ? 11.636  -33.603 22.456  1.00 25.51 ? 261 ASN B C   1 
ATOM   3119 O O   . ASN B 1 50  ? 11.202  -32.487 22.799  1.00 24.49 ? 261 ASN B O   1 
ATOM   3120 C CB  . ASN B 1 50  ? 12.115  -34.040 24.864  1.00 24.49 ? 261 ASN B CB  1 
ATOM   3121 C CG  . ASN B 1 50  ? 10.735  -34.550 25.315  1.00 25.55 ? 261 ASN B CG  1 
ATOM   3122 O OD1 . ASN B 1 50  ? 9.828   -34.756 24.497  1.00 24.26 ? 261 ASN B OD1 1 
ATOM   3123 N ND2 . ASN B 1 50  ? 10.577  -34.735 26.635  1.00 24.85 ? 261 ASN B ND2 1 
ATOM   3124 N N   . THR B 1 51  ? 11.415  -34.152 21.252  1.00 27.53 ? 262 THR B N   1 
ATOM   3125 C CA  . THR B 1 51  ? 10.581  -33.503 20.222  1.00 29.57 ? 262 THR B CA  1 
ATOM   3126 C C   . THR B 1 51  ? 9.128   -33.259 20.655  1.00 31.69 ? 262 THR B C   1 
ATOM   3127 O O   . THR B 1 51  ? 8.506   -32.325 20.150  1.00 32.02 ? 262 THR B O   1 
ATOM   3128 C CB  . THR B 1 51  ? 10.545  -34.316 18.915  1.00 29.44 ? 262 THR B CB  1 
ATOM   3129 O OG1 . THR B 1 51  ? 10.183  -35.654 19.218  1.00 30.55 ? 262 THR B OG1 1 
ATOM   3130 C CG2 . THR B 1 51  ? 11.941  -34.327 18.239  1.00 30.44 ? 262 THR B CG2 1 
ATOM   3131 N N   . LYS B 1 52  ? 8.585   -34.088 21.557  1.00 33.60 ? 263 LYS B N   1 
ATOM   3132 C CA  . LYS B 1 52  ? 7.194   -33.912 21.995  1.00 35.44 ? 263 LYS B CA  1 
ATOM   3133 C C   . LYS B 1 52  ? 7.055   -32.664 22.846  1.00 34.69 ? 263 LYS B C   1 
ATOM   3134 O O   . LYS B 1 52  ? 6.167   -31.877 22.627  1.00 35.21 ? 263 LYS B O   1 
ATOM   3135 C CB  . LYS B 1 52  ? 6.643   -35.128 22.766  1.00 36.42 ? 263 LYS B CB  1 
ATOM   3136 C CG  . LYS B 1 52  ? 6.526   -36.454 21.949  1.00 40.83 ? 263 LYS B CG  1 
ATOM   3137 C CD  . LYS B 1 52  ? 5.835   -36.298 20.544  1.00 44.18 ? 263 LYS B CD  1 
ATOM   3138 C CE  . LYS B 1 52  ? 5.710   -37.633 19.755  1.00 45.99 ? 263 LYS B CE  1 
ATOM   3139 N NZ  . LYS B 1 52  ? 6.811   -38.631 20.027  1.00 47.27 ? 263 LYS B NZ  1 
ATOM   3140 N N   . LYS B 1 53  ? 7.959   -32.478 23.791  1.00 34.20 ? 264 LYS B N   1 
ATOM   3141 C CA  . LYS B 1 53  ? 7.912   -31.326 24.686  1.00 33.86 ? 264 LYS B CA  1 
ATOM   3142 C C   . LYS B 1 53  ? 8.479   -30.050 24.059  1.00 32.56 ? 264 LYS B C   1 
ATOM   3143 O O   . LYS B 1 53  ? 8.145   -28.934 24.489  1.00 31.69 ? 264 LYS B O   1 
ATOM   3144 C CB  . LYS B 1 53  ? 8.682   -31.671 25.967  1.00 34.80 ? 264 LYS B CB  1 
ATOM   3145 C CG  . LYS B 1 53  ? 8.568   -30.676 27.092  1.00 36.62 ? 264 LYS B CG  1 
ATOM   3146 C CD  . LYS B 1 53  ? 9.062   -31.292 28.420  1.00 39.77 ? 264 LYS B CD  1 
ATOM   3147 C CE  . LYS B 1 53  ? 9.060   -30.245 29.562  1.00 40.96 ? 264 LYS B CE  1 
ATOM   3148 N NZ  . LYS B 1 53  ? 9.291   -30.876 30.903  1.00 42.05 ? 264 LYS B NZ  1 
ATOM   3149 N N   . ALA B 1 54  ? 9.354   -30.196 23.058  1.00 31.18 ? 265 ALA B N   1 
ATOM   3150 C CA  . ALA B 1 54  ? 9.952   -29.020 22.389  1.00 29.99 ? 265 ALA B CA  1 
ATOM   3151 C C   . ALA B 1 54  ? 10.029  -29.238 20.872  1.00 29.19 ? 265 ALA B C   1 
ATOM   3152 O O   . ALA B 1 54  ? 11.103  -29.554 20.345  1.00 28.22 ? 265 ALA B O   1 
ATOM   3153 C CB  . ALA B 1 54  ? 11.317  -28.703 22.975  1.00 29.63 ? 265 ALA B CB  1 
ATOM   3154 N N   . PRO B 1 55  ? 8.877   -29.075 20.175  1.00 29.21 ? 266 PRO B N   1 
ATOM   3155 C CA  . PRO B 1 55  ? 8.779   -29.385 18.744  1.00 28.84 ? 266 PRO B CA  1 
ATOM   3156 C C   . PRO B 1 55  ? 9.823   -28.636 17.932  1.00 27.90 ? 266 PRO B C   1 
ATOM   3157 O O   . PRO B 1 55  ? 10.078  -27.465 18.211  1.00 26.70 ? 266 PRO B O   1 
ATOM   3158 C CB  . PRO B 1 55  ? 7.376   -28.915 18.358  1.00 30.04 ? 266 PRO B CB  1 
ATOM   3159 C CG  . PRO B 1 55  ? 6.599   -28.823 19.672  1.00 30.70 ? 266 PRO B CG  1 
ATOM   3160 C CD  . PRO B 1 55  ? 7.631   -28.463 20.701  1.00 29.79 ? 266 PRO B CD  1 
ATOM   3161 N N   . LEU B 1 56  ? 10.405  -29.325 16.945  1.00 27.33 ? 267 LEU B N   1 
ATOM   3162 C CA  . LEU B 1 56  ? 11.520  -28.796 16.157  1.00 27.26 ? 267 LEU B CA  1 
ATOM   3163 C C   . LEU B 1 56  ? 11.145  -27.512 15.434  1.00 27.56 ? 267 LEU B C   1 
ATOM   3164 O O   . LEU B 1 56  ? 11.967  -26.629 15.273  1.00 28.19 ? 267 LEU B O   1 
ATOM   3165 C CB  . LEU B 1 56  ? 12.021  -29.841 15.146  1.00 27.11 ? 267 LEU B CB  1 
ATOM   3166 C CG  . LEU B 1 56  ? 12.561  -31.095 15.841  1.00 25.83 ? 267 LEU B CG  1 
ATOM   3167 C CD1 . LEU B 1 56  ? 12.867  -32.162 14.859  1.00 26.29 ? 267 LEU B CD1 1 
ATOM   3168 C CD2 . LEU B 1 56  ? 13.772  -30.771 16.690  1.00 24.96 ? 267 LEU B CD2 1 
ATOM   3169 N N   . GLY B 1 57  ? 9.899   -27.413 15.018  1.00 28.42 ? 268 GLY B N   1 
ATOM   3170 C CA  . GLY B 1 57  ? 9.416   -26.227 14.361  1.00 30.21 ? 268 GLY B CA  1 
ATOM   3171 C C   . GLY B 1 57  ? 9.329   -24.981 15.245  1.00 30.73 ? 268 GLY B C   1 
ATOM   3172 O O   . GLY B 1 57  ? 9.099   -23.911 14.720  1.00 30.87 ? 268 GLY B O   1 
ATOM   3173 N N   . LYS B 1 58  ? 9.470   -25.126 16.572  1.00 30.86 ? 269 LYS B N   1 
ATOM   3174 C CA  . LYS B 1 58  ? 9.411   -23.977 17.503  1.00 31.15 ? 269 LYS B CA  1 
ATOM   3175 C C   . LYS B 1 58  ? 10.781  -23.649 18.095  1.00 30.20 ? 269 LYS B C   1 
ATOM   3176 O O   . LYS B 1 58  ? 10.950  -22.665 18.820  1.00 30.56 ? 269 LYS B O   1 
ATOM   3177 C CB  . LYS B 1 58  ? 8.398   -24.241 18.623  1.00 31.80 ? 269 LYS B CB  1 
ATOM   3178 C CG  . LYS B 1 58  ? 6.950   -24.236 18.133  1.00 34.63 ? 269 LYS B CG  1 
ATOM   3179 C CD  . LYS B 1 58  ? 5.980   -24.575 19.299  1.00 40.19 ? 269 LYS B CD  1 
ATOM   3180 C CE  . LYS B 1 58  ? 4.491   -24.615 18.843  1.00 42.88 ? 269 LYS B CE  1 
ATOM   3181 N NZ  . LYS B 1 58  ? 3.971   -26.025 18.648  1.00 44.68 ? 269 LYS B NZ  1 
ATOM   3182 N N   . LEU B 1 59  ? 11.780  -24.436 17.746  1.00 29.16 ? 270 LEU B N   1 
ATOM   3183 C CA  . LEU B 1 59  ? 13.106  -24.186 18.262  1.00 28.60 ? 270 LEU B CA  1 
ATOM   3184 C C   . LEU B 1 59  ? 13.657  -22.918 17.611  1.00 27.54 ? 270 LEU B C   1 
ATOM   3185 O O   . LEU B 1 59  ? 13.489  -22.709 16.413  1.00 27.08 ? 270 LEU B O   1 
ATOM   3186 C CB  . LEU B 1 59  ? 14.031  -25.393 18.020  1.00 28.43 ? 270 LEU B CB  1 
ATOM   3187 C CG  . LEU B 1 59  ? 15.187  -25.512 19.034  1.00 29.51 ? 270 LEU B CG  1 
ATOM   3188 C CD1 . LEU B 1 59  ? 14.691  -25.317 20.505  1.00 31.47 ? 270 LEU B CD1 1 
ATOM   3189 C CD2 . LEU B 1 59  ? 15.920  -26.838 18.862  1.00 29.22 ? 270 LEU B CD2 1 
ATOM   3190 N N   . THR B 1 60  ? 14.261  -22.049 18.419  1.00 26.47 ? 271 THR B N   1 
ATOM   3191 C CA  . THR B 1 60  ? 14.811  -20.791 17.903  1.00 26.09 ? 271 THR B CA  1 
ATOM   3192 C C   . THR B 1 60  ? 16.325  -20.776 18.046  1.00 24.81 ? 271 THR B C   1 
ATOM   3193 O O   . THR B 1 60  ? 16.908  -21.481 18.884  1.00 23.42 ? 271 THR B O   1 
ATOM   3194 C CB  . THR B 1 60  ? 14.248  -19.527 18.652  1.00 26.72 ? 271 THR B CB  1 
ATOM   3195 O OG1 . THR B 1 60  ? 14.800  -19.479 19.971  1.00 25.71 ? 271 THR B OG1 1 
ATOM   3196 C CG2 . THR B 1 60  ? 12.698  -19.522 18.725  1.00 27.19 ? 271 THR B CG2 1 
ATOM   3197 N N   . VAL B 1 61  ? 16.962  -19.939 17.237  1.00 24.67 ? 272 VAL B N   1 
ATOM   3198 C CA  . VAL B 1 61  ? 18.404  -19.769 17.309  1.00 24.52 ? 272 VAL B CA  1 
ATOM   3199 C C   . VAL B 1 61  ? 18.794  -19.314 18.705  1.00 24.14 ? 272 VAL B C   1 
ATOM   3200 O O   . VAL B 1 61  ? 19.765  -19.820 19.277  1.00 23.51 ? 272 VAL B O   1 
ATOM   3201 C CB  . VAL B 1 61  ? 18.885  -18.771 16.239  1.00 25.56 ? 272 VAL B CB  1 
ATOM   3202 C CG1 . VAL B 1 61  ? 20.341  -18.272 16.548  1.00 24.81 ? 272 VAL B CG1 1 
ATOM   3203 C CG2 . VAL B 1 61  ? 18.753  -19.418 14.856  1.00 25.30 ? 272 VAL B CG2 1 
ATOM   3204 N N   . ALA B 1 62  ? 18.020  -18.382 19.271  1.00 24.23 ? 273 ALA B N   1 
ATOM   3205 C CA  . ALA B 1 62  ? 18.303  -17.846 20.625  1.00 23.55 ? 273 ALA B CA  1 
ATOM   3206 C C   . ALA B 1 62  ? 18.284  -18.949 21.693  1.00 22.82 ? 273 ALA B C   1 
ATOM   3207 O O   . ALA B 1 62  ? 19.123  -19.013 22.587  1.00 21.38 ? 273 ALA B O   1 
ATOM   3208 C CB  . ALA B 1 62  ? 17.260  -16.767 20.976  1.00 25.45 ? 273 ALA B CB  1 
ATOM   3209 N N   . GLN B 1 63  ? 17.311  -19.833 21.593  1.00 23.02 ? 274 GLN B N   1 
ATOM   3210 C CA  . GLN B 1 63  ? 17.250  -20.977 22.511  1.00 23.11 ? 274 GLN B CA  1 
ATOM   3211 C C   . GLN B 1 63  ? 18.426  -21.936 22.382  1.00 22.00 ? 274 GLN B C   1 
ATOM   3212 O O   . GLN B 1 63  ? 18.908  -22.462 23.374  1.00 22.06 ? 274 GLN B O   1 
ATOM   3213 C CB  . GLN B 1 63  ? 15.959  -21.706 22.290  1.00 23.48 ? 274 GLN B CB  1 
ATOM   3214 C CG  . GLN B 1 63  ? 14.777  -20.850 22.793  1.00 27.30 ? 274 GLN B CG  1 
ATOM   3215 C CD  . GLN B 1 63  ? 13.455  -21.334 22.228  1.00 30.09 ? 274 GLN B CD  1 
ATOM   3216 O OE1 . GLN B 1 63  ? 13.404  -22.323 21.480  1.00 29.42 ? 274 GLN B OE1 1 
ATOM   3217 N NE2 . GLN B 1 63  ? 12.371  -20.658 22.614  1.00 30.22 ? 274 GLN B NE2 1 
ATOM   3218 N N   . ILE B 1 64  ? 18.875  -22.179 21.158  1.00 21.68 ? 275 ILE B N   1 
ATOM   3219 C CA  . ILE B 1 64  ? 20.025  -23.059 20.941  1.00 21.00 ? 275 ILE B CA  1 
ATOM   3220 C C   . ILE B 1 64  ? 21.252  -22.392 21.569  1.00 20.41 ? 275 ILE B C   1 
ATOM   3221 O O   . ILE B 1 64  ? 22.077  -23.045 22.243  1.00 17.90 ? 275 ILE B O   1 
ATOM   3222 C CB  . ILE B 1 64  ? 20.241  -23.362 19.427  1.00 20.78 ? 275 ILE B CB  1 
ATOM   3223 C CG1 . ILE B 1 64  ? 19.057  -24.199 18.906  1.00 22.74 ? 275 ILE B CG1 1 
ATOM   3224 C CG2 . ILE B 1 64  ? 21.532  -24.082 19.219  1.00 19.20 ? 275 ILE B CG2 1 
ATOM   3225 C CD1 . ILE B 1 64  ? 18.974  -24.416 17.395  1.00 24.28 ? 275 ILE B CD1 1 
ATOM   3226 N N   . LYS B 1 65  ? 21.336  -21.081 21.389  1.00 20.25 ? 276 LYS B N   1 
ATOM   3227 C CA  . LYS B 1 65  ? 22.470  -20.327 21.925  1.00 21.19 ? 276 LYS B CA  1 
ATOM   3228 C C   . LYS B 1 65  ? 22.499  -20.420 23.455  1.00 20.56 ? 276 LYS B C   1 
ATOM   3229 O O   . LYS B 1 65  ? 23.567  -20.670 24.049  1.00 20.80 ? 276 LYS B O   1 
ATOM   3230 C CB  . LYS B 1 65  ? 22.398  -18.876 21.458  1.00 22.07 ? 276 LYS B CB  1 
ATOM   3231 C CG  . LYS B 1 65  ? 23.267  -17.862 22.239  1.00 24.44 ? 276 LYS B CG  1 
ATOM   3232 C CD  . LYS B 1 65  ? 23.399  -16.592 21.390  1.00 24.62 ? 276 LYS B CD  1 
ATOM   3233 C CE  . LYS B 1 65  ? 23.444  -15.320 22.165  1.00 26.33 ? 276 LYS B CE  1 
ATOM   3234 N NZ  . LYS B 1 65  ? 23.062  -14.137 21.289  1.00 24.40 ? 276 LYS B NZ  1 
ATOM   3235 N N   . ALA B 1 66  ? 21.338  -20.250 24.087  1.00 19.99 ? 277 ALA B N   1 
ATOM   3236 C CA  . ALA B 1 66  ? 21.219  -20.396 25.528  1.00 20.24 ? 277 ALA B CA  1 
ATOM   3237 C C   . ALA B 1 66  ? 21.642  -21.806 25.909  1.00 19.78 ? 277 ALA B C   1 
ATOM   3238 O O   . ALA B 1 66  ? 22.245  -22.016 26.941  1.00 21.83 ? 277 ALA B O   1 
ATOM   3239 C CB  . ALA B 1 66  ? 19.771  -20.122 26.006  1.00 20.38 ? 277 ALA B CB  1 
ATOM   3240 N N   . GLY B 1 67  ? 21.332  -22.769 25.057  1.00 19.56 ? 278 GLY B N   1 
ATOM   3241 C CA  . GLY B 1 67  ? 21.864  -24.115 25.220  1.00 18.62 ? 278 GLY B CA  1 
ATOM   3242 C C   . GLY B 1 67  ? 23.375  -24.175 25.284  1.00 17.76 ? 278 GLY B C   1 
ATOM   3243 O O   . GLY B 1 67  ? 23.934  -24.835 26.166  1.00 17.23 ? 278 GLY B O   1 
ATOM   3244 N N   . TYR B 1 68  ? 24.049  -23.542 24.324  1.00 17.57 ? 279 TYR B N   1 
ATOM   3245 C CA  . TYR B 1 68  ? 25.526  -23.483 24.312  1.00 17.91 ? 279 TYR B CA  1 
ATOM   3246 C C   . TYR B 1 68  ? 26.073  -22.883 25.621  1.00 18.15 ? 279 TYR B C   1 
ATOM   3247 O O   . TYR B 1 68  ? 27.051  -23.377 26.211  1.00 17.38 ? 279 TYR B O   1 
ATOM   3248 C CB  . TYR B 1 68  ? 26.018  -22.654 23.122  1.00 18.56 ? 279 TYR B CB  1 
ATOM   3249 C CG  . TYR B 1 68  ? 25.962  -23.359 21.755  1.00 20.54 ? 279 TYR B CG  1 
ATOM   3250 C CD1 . TYR B 1 68  ? 26.673  -24.543 21.531  1.00 21.75 ? 279 TYR B CD1 1 
ATOM   3251 C CD2 . TYR B 1 68  ? 25.257  -22.816 20.691  1.00 20.02 ? 279 TYR B CD2 1 
ATOM   3252 C CE1 . TYR B 1 68  ? 26.661  -25.160 20.297  1.00 22.50 ? 279 TYR B CE1 1 
ATOM   3253 C CE2 . TYR B 1 68  ? 25.235  -23.429 19.440  1.00 20.64 ? 279 TYR B CE2 1 
ATOM   3254 C CZ  . TYR B 1 68  ? 25.936  -24.606 19.255  1.00 21.76 ? 279 TYR B CZ  1 
ATOM   3255 O OH  . TYR B 1 68  ? 25.931  -25.259 18.053  1.00 19.99 ? 279 TYR B OH  1 
ATOM   3256 N N   . GLN B 1 69  ? 25.401  -21.834 26.079  1.00 18.35 ? 280 GLN B N   1 
ATOM   3257 C CA  . GLN B 1 69  ? 25.768  -21.150 27.330  1.00 19.51 ? 280 GLN B CA  1 
ATOM   3258 C C   . GLN B 1 69  ? 25.670  -22.071 28.540  1.00 18.75 ? 280 GLN B C   1 
ATOM   3259 O O   . GLN B 1 69  ? 26.589  -22.114 29.330  1.00 19.05 ? 280 GLN B O   1 
ATOM   3260 C CB  . GLN B 1 69  ? 24.942  -19.860 27.508  1.00 19.85 ? 280 GLN B CB  1 
ATOM   3261 C CG  . GLN B 1 69  ? 25.472  -18.822 26.506  1.00 22.01 ? 280 GLN B CG  1 
ATOM   3262 C CD  . GLN B 1 69  ? 24.617  -17.603 26.357  1.00 25.55 ? 280 GLN B CD  1 
ATOM   3263 O OE1 . GLN B 1 69  ? 23.482  -17.557 26.832  1.00 27.35 ? 280 GLN B OE1 1 
ATOM   3264 N NE2 . GLN B 1 69  ? 25.164  -16.587 25.676  1.00 28.07 ? 280 GLN B NE2 1 
ATOM   3265 N N   . SER B 1 70  ? 24.629  -22.893 28.615  1.00 17.99 ? 281 SER B N   1 
ATOM   3266 C CA  . SER B 1 70  ? 24.531  -23.835 29.745  1.00 18.07 ? 281 SER B CA  1 
ATOM   3267 C C   . SER B 1 70  ? 25.631  -24.872 29.640  1.00 18.19 ? 281 SER B C   1 
ATOM   3268 O O   . SER B 1 70  ? 26.264  -25.228 30.640  1.00 18.01 ? 281 SER B O   1 
ATOM   3269 C CB  . SER B 1 70  ? 23.141  -24.487 29.793  1.00 18.15 ? 281 SER B CB  1 
ATOM   3270 O OG  . SER B 1 70  ? 22.153  -23.481 30.041  1.00 18.35 ? 281 SER B OG  1 
ATOM   3271 N N   . LEU B 1 71  ? 25.926  -25.321 28.415  1.00 17.81 ? 282 LEU B N   1 
ATOM   3272 C CA  . LEU B 1 71  ? 27.011  -26.285 28.222  1.00 17.79 ? 282 LEU B CA  1 
ATOM   3273 C C   . LEU B 1 71  ? 28.359  -25.695 28.655  1.00 19.51 ? 282 LEU B C   1 
ATOM   3274 O O   . LEU B 1 71  ? 29.265  -26.414 29.113  1.00 18.91 ? 282 LEU B O   1 
ATOM   3275 C CB  . LEU B 1 71  ? 27.112  -26.733 26.747  1.00 17.11 ? 282 LEU B CB  1 
ATOM   3276 C CG  . LEU B 1 71  ? 26.162  -27.785 26.213  1.00 18.26 ? 282 LEU B CG  1 
ATOM   3277 C CD1 . LEU B 1 71  ? 26.549  -28.096 24.749  1.00 19.54 ? 282 LEU B CD1 1 
ATOM   3278 C CD2 . LEU B 1 71  ? 26.122  -29.115 27.084  1.00 16.58 ? 282 LEU B CD2 1 
ATOM   3279 N N   . LYS B 1 72  ? 28.526  -24.396 28.442  1.00 21.08 ? 283 LYS B N   1 
ATOM   3280 C CA  . LYS B 1 72  ? 29.755  -23.725 28.883  1.00 23.37 ? 283 LYS B CA  1 
ATOM   3281 C C   . LYS B 1 72  ? 29.929  -23.795 30.404  1.00 22.86 ? 283 LYS B C   1 
ATOM   3282 O O   . LYS B 1 72  ? 31.038  -24.021 30.929  1.00 23.25 ? 283 LYS B O   1 
ATOM   3283 C CB  . LYS B 1 72  ? 29.792  -22.260 28.375  1.00 23.62 ? 283 LYS B CB  1 
ATOM   3284 C CG  . LYS B 1 72  ? 30.933  -21.425 28.946  1.00 28.74 ? 283 LYS B CG  1 
ATOM   3285 C CD  . LYS B 1 72  ? 32.257  -21.786 28.339  1.00 32.74 ? 283 LYS B CD  1 
ATOM   3286 C CE  . LYS B 1 72  ? 33.482  -21.379 29.222  1.00 34.79 ? 283 LYS B CE  1 
ATOM   3287 N NZ  . LYS B 1 72  ? 33.410  -20.069 29.944  1.00 35.65 ? 283 LYS B NZ  1 
ATOM   3288 N N   . LYS B 1 73  ? 28.823  -23.624 31.112  1.00 23.68 ? 284 LYS B N   1 
ATOM   3289 C CA  . LYS B 1 73  ? 28.831  -23.718 32.551  1.00 24.62 ? 284 LYS B CA  1 
ATOM   3290 C C   . LYS B 1 73  ? 29.135  -25.157 32.975  1.00 24.53 ? 284 LYS B C   1 
ATOM   3291 O O   . LYS B 1 73  ? 29.821  -25.383 34.001  1.00 25.08 ? 284 LYS B O   1 
ATOM   3292 C CB  . LYS B 1 73  ? 27.500  -23.239 33.100  1.00 25.70 ? 284 LYS B CB  1 
ATOM   3293 C CG  . LYS B 1 73  ? 27.256  -21.732 32.890  1.00 30.40 ? 284 LYS B CG  1 
ATOM   3294 C CD  . LYS B 1 73  ? 25.751  -21.463 32.658  1.00 36.11 ? 284 LYS B CD  1 
ATOM   3295 C CE  . LYS B 1 73  ? 25.255  -20.123 33.199  1.00 39.98 ? 284 LYS B CE  1 
ATOM   3296 N NZ  . LYS B 1 73  ? 24.066  -20.388 34.084  1.00 42.71 ? 284 LYS B NZ  1 
ATOM   3297 N N   . ILE B 1 74  ? 28.653  -26.127 32.193  1.00 22.66 ? 285 ILE B N   1 
ATOM   3298 C CA  . ILE B 1 74  ? 28.989  -27.520 32.454  1.00 22.69 ? 285 ILE B CA  1 
ATOM   3299 C C   . ILE B 1 74  ? 30.493  -27.686 32.237  1.00 22.91 ? 285 ILE B C   1 
ATOM   3300 O O   . ILE B 1 74  ? 31.205  -28.295 33.071  1.00 23.59 ? 285 ILE B O   1 
ATOM   3301 C CB  . ILE B 1 74  ? 28.168  -28.479 31.579  1.00 22.27 ? 285 ILE B CB  1 
ATOM   3302 C CG1 . ILE B 1 74  ? 26.693  -28.400 31.963  1.00 21.93 ? 285 ILE B CG1 1 
ATOM   3303 C CG2 . ILE B 1 74  ? 28.691  -29.886 31.682  1.00 19.76 ? 285 ILE B CG2 1 
ATOM   3304 C CD1 . ILE B 1 74  ? 25.704  -29.238 31.006  1.00 22.38 ? 285 ILE B CD1 1 
ATOM   3305 N N   . GLU B 1 75  ? 31.002  -27.122 31.139  1.00 22.91 ? 286 GLU B N   1 
ATOM   3306 C CA  . GLU B 1 75  ? 32.427  -27.171 30.878  1.00 23.08 ? 286 GLU B CA  1 
ATOM   3307 C C   . GLU B 1 75  ? 33.261  -26.641 32.062  1.00 24.05 ? 286 GLU B C   1 
ATOM   3308 O O   . GLU B 1 75  ? 34.250  -27.264 32.440  1.00 23.29 ? 286 GLU B O   1 
ATOM   3309 C CB  . GLU B 1 75  ? 32.806  -26.421 29.612  1.00 22.80 ? 286 GLU B CB  1 
ATOM   3310 C CG  . GLU B 1 75  ? 34.308  -26.460 29.363  1.00 23.84 ? 286 GLU B CG  1 
ATOM   3311 C CD  . GLU B 1 75  ? 34.758  -25.697 28.116  1.00 26.12 ? 286 GLU B CD  1 
ATOM   3312 O OE1 . GLU B 1 75  ? 34.523  -24.479 28.027  1.00 26.43 ? 286 GLU B OE1 1 
ATOM   3313 O OE2 . GLU B 1 75  ? 35.320  -26.354 27.217  1.00 28.11 ? 286 GLU B OE2 1 
ATOM   3314 N N   . ASP B 1 76  ? 32.850  -25.519 32.638  1.00 25.26 ? 287 ASP B N   1 
ATOM   3315 C CA  . ASP B 1 76  ? 33.573  -24.934 33.793  1.00 27.06 ? 287 ASP B CA  1 
ATOM   3316 C C   . ASP B 1 76  ? 33.582  -25.873 35.004  1.00 27.94 ? 287 ASP B C   1 
ATOM   3317 O O   . ASP B 1 76  ? 34.552  -25.931 35.728  1.00 29.04 ? 287 ASP B O   1 
ATOM   3318 C CB  . ASP B 1 76  ? 32.949  -23.620 34.258  1.00 27.35 ? 287 ASP B CB  1 
ATOM   3319 C CG  . ASP B 1 76  ? 32.977  -22.534 33.211  1.00 27.20 ? 287 ASP B CG  1 
ATOM   3320 O OD1 . ASP B 1 76  ? 33.950  -22.451 32.449  1.00 29.24 ? 287 ASP B OD1 1 
ATOM   3321 O OD2 . ASP B 1 76  ? 32.016  -21.736 33.180  1.00 28.71 ? 287 ASP B OD2 1 
ATOM   3322 N N   . CYS B 1 77  ? 32.480  -26.564 35.246  1.00 28.77 ? 288 CYS B N   1 
ATOM   3323 C CA  . CYS B 1 77  ? 32.423  -27.506 36.352  1.00 29.73 ? 288 CYS B CA  1 
ATOM   3324 C C   . CYS B 1 77  ? 33.386  -28.648 36.109  1.00 30.71 ? 288 CYS B C   1 
ATOM   3325 O O   . CYS B 1 77  ? 34.119  -29.050 37.020  1.00 31.97 ? 288 CYS B O   1 
ATOM   3326 C CB  . CYS B 1 77  ? 31.011  -28.042 36.542  1.00 29.07 ? 288 CYS B CB  1 
ATOM   3327 S SG  . CYS B 1 77  ? 29.843  -26.782 37.048  1.00 31.62 ? 288 CYS B SG  1 
ATOM   3328 N N   . ILE B 1 78  ? 33.408  -29.161 34.884  1.00 30.87 ? 289 ILE B N   1 
ATOM   3329 C CA  . ILE B 1 78  ? 34.296  -30.255 34.546  1.00 31.96 ? 289 ILE B CA  1 
ATOM   3330 C C   . ILE B 1 78  ? 35.744  -29.804 34.664  1.00 34.35 ? 289 ILE B C   1 
ATOM   3331 O O   . ILE B 1 78  ? 36.587  -30.540 35.169  1.00 35.77 ? 289 ILE B O   1 
ATOM   3332 C CB  . ILE B 1 78  ? 34.048  -30.814 33.136  1.00 30.84 ? 289 ILE B CB  1 
ATOM   3333 C CG1 . ILE B 1 78  ? 32.615  -31.364 33.009  1.00 29.92 ? 289 ILE B CG1 1 
ATOM   3334 C CG2 . ILE B 1 78  ? 35.086  -31.908 32.824  1.00 31.62 ? 289 ILE B CG2 1 
ATOM   3335 C CD1 . ILE B 1 78  ? 32.104  -31.482 31.560  1.00 28.67 ? 289 ILE B CD1 1 
ATOM   3336 N N   . ARG B 1 79  ? 36.039  -28.592 34.210  1.00 36.15 ? 290 ARG B N   1 
ATOM   3337 C CA  . ARG B 1 79  ? 37.370  -28.034 34.389  1.00 38.22 ? 290 ARG B CA  1 
ATOM   3338 C C   . ARG B 1 79  ? 37.775  -27.982 35.837  1.00 38.79 ? 290 ARG B C   1 
ATOM   3339 O O   . ARG B 1 79  ? 38.877  -28.375 36.184  1.00 38.80 ? 290 ARG B O   1 
ATOM   3340 C CB  . ARG B 1 79  ? 37.451  -26.597 33.896  1.00 38.93 ? 290 ARG B CB  1 
ATOM   3341 C CG  . ARG B 1 79  ? 38.076  -26.490 32.606  1.00 41.39 ? 290 ARG B CG  1 
ATOM   3342 C CD  . ARG B 1 79  ? 38.766  -25.164 32.414  1.00 46.77 ? 290 ARG B CD  1 
ATOM   3343 N NE  . ARG B 1 79  ? 39.789  -25.387 31.403  1.00 51.62 ? 290 ARG B NE  1 
ATOM   3344 C CZ  . ARG B 1 79  ? 39.516  -25.694 30.139  1.00 53.99 ? 290 ARG B CZ  1 
ATOM   3345 N NH1 . ARG B 1 79  ? 40.506  -25.900 29.276  1.00 55.38 ? 290 ARG B NH1 1 
ATOM   3346 N NH2 . ARG B 1 79  ? 38.250  -25.784 29.728  1.00 55.44 ? 290 ARG B NH2 1 
ATOM   3347 N N   . ALA B 1 80  ? 36.897  -27.426 36.660  1.00 39.44 ? 291 ALA B N   1 
ATOM   3348 C CA  . ALA B 1 80  ? 37.213  -27.223 38.072  1.00 40.76 ? 291 ALA B CA  1 
ATOM   3349 C C   . ALA B 1 80  ? 37.195  -28.545 38.872  1.00 42.11 ? 291 ALA B C   1 
ATOM   3350 O O   . ALA B 1 80  ? 37.641  -28.569 40.002  1.00 43.58 ? 291 ALA B O   1 
ATOM   3351 C CB  . ALA B 1 80  ? 36.262  -26.186 38.683  1.00 39.76 ? 291 ALA B CB  1 
ATOM   3352 N N   . GLY B 1 81  ? 36.682  -29.625 38.285  1.00 43.62 ? 292 GLY B N   1 
ATOM   3353 C CA  . GLY B 1 81  ? 36.630  -30.943 38.920  1.00 45.35 ? 292 GLY B CA  1 
ATOM   3354 C C   . GLY B 1 81  ? 35.454  -31.164 39.861  1.00 46.89 ? 292 GLY B C   1 
ATOM   3355 O O   . GLY B 1 81  ? 35.497  -32.081 40.676  1.00 48.12 ? 292 GLY B O   1 
ATOM   3356 N N   . GLN B 1 82  ? 34.401  -30.350 39.750  1.00 47.87 ? 293 GLN B N   1 
ATOM   3357 C CA  . GLN B 1 82  ? 33.259  -30.382 40.700  1.00 49.69 ? 293 GLN B CA  1 
ATOM   3358 C C   . GLN B 1 82  ? 32.114  -31.295 40.251  1.00 50.07 ? 293 GLN B C   1 
ATOM   3359 O O   . GLN B 1 82  ? 32.093  -31.705 39.097  1.00 50.39 ? 293 GLN B O   1 
ATOM   3360 C CB  . GLN B 1 82  ? 32.713  -28.968 40.918  1.00 49.77 ? 293 GLN B CB  1 
ATOM   3361 C CG  . GLN B 1 82  ? 33.719  -27.993 41.534  1.00 51.52 ? 293 GLN B CG  1 
ATOM   3362 C CD  . GLN B 1 82  ? 33.880  -28.130 43.051  1.00 53.38 ? 293 GLN B CD  1 
ATOM   3363 O OE1 . GLN B 1 82  ? 33.766  -29.220 43.618  1.00 53.95 ? 293 GLN B OE1 1 
ATOM   3364 N NE2 . GLN B 1 82  ? 34.161  -27.009 43.706  1.00 54.13 ? 293 GLN B NE2 1 
ATOM   3365 N N   . HIS B 1 83  ? 31.183  -31.621 41.165  1.00 51.36 ? 294 HIS B N   1 
ATOM   3366 C CA  . HIS B 1 83  ? 29.981  -32.461 40.841  1.00 51.41 ? 294 HIS B CA  1 
ATOM   3367 C C   . HIS B 1 83  ? 28.647  -32.120 41.531  1.00 50.88 ? 294 HIS B C   1 
ATOM   3368 O O   . HIS B 1 83  ? 27.557  -32.383 40.957  1.00 49.33 ? 294 HIS B O   1 
ATOM   3369 C CB  . HIS B 1 83  ? 30.255  -33.932 41.109  1.00 52.40 ? 294 HIS B CB  1 
ATOM   3370 C CG  . HIS B 1 83  ? 30.948  -34.621 39.983  1.00 55.22 ? 294 HIS B CG  1 
ATOM   3371 N ND1 . HIS B 1 83  ? 32.001  -34.054 39.297  1.00 58.76 ? 294 HIS B ND1 1 
ATOM   3372 C CD2 . HIS B 1 83  ? 30.756  -35.841 39.433  1.00 58.73 ? 294 HIS B CD2 1 
ATOM   3373 C CE1 . HIS B 1 83  ? 32.418  -34.887 38.358  1.00 60.30 ? 294 HIS B CE1 1 
ATOM   3374 N NE2 . HIS B 1 83  ? 31.685  -35.984 38.426  1.00 60.79 ? 294 HIS B NE2 1 
ATOM   3375 N N   . GLY B 1 84  ? 28.714  -31.578 42.750  1.00 50.34 ? 295 GLY B N   1 
ATOM   3376 C CA  . GLY B 1 84  ? 27.499  -31.228 43.499  1.00 49.83 ? 295 GLY B CA  1 
ATOM   3377 C C   . GLY B 1 84  ? 26.730  -30.038 42.944  1.00 49.05 ? 295 GLY B C   1 
ATOM   3378 O O   . GLY B 1 84  ? 26.479  -29.946 41.730  1.00 46.62 ? 295 GLY B O   1 
ATOM   3379 N N   . ARG B 1 85  ? 26.367  -29.101 43.828  1.00 49.30 ? 296 ARG B N   1 
ATOM   3380 C CA  . ARG B 1 85  ? 25.467  -28.003 43.434  1.00 49.06 ? 296 ARG B CA  1 
ATOM   3381 C C   . ARG B 1 85  ? 25.834  -27.428 42.045  1.00 47.91 ? 296 ARG B C   1 
ATOM   3382 O O   . ARG B 1 85  ? 24.937  -27.002 41.290  1.00 46.91 ? 296 ARG B O   1 
ATOM   3383 C CB  . ARG B 1 85  ? 25.393  -26.877 44.489  1.00 49.82 ? 296 ARG B CB  1 
ATOM   3384 C CG  . ARG B 1 85  ? 24.083  -26.067 44.381  1.00 51.47 ? 296 ARG B CG  1 
ATOM   3385 C CD  . ARG B 1 85  ? 23.957  -24.880 45.367  1.00 53.94 ? 296 ARG B CD  1 
ATOM   3386 N NE  . ARG B 1 85  ? 22.664  -24.189 45.181  1.00 56.46 ? 296 ARG B NE  1 
ATOM   3387 C CZ  . ARG B 1 85  ? 22.194  -23.189 45.936  1.00 58.35 ? 296 ARG B CZ  1 
ATOM   3388 N NH1 . ARG B 1 85  ? 22.899  -22.725 46.969  1.00 59.99 ? 296 ARG B NH1 1 
ATOM   3389 N NH2 . ARG B 1 85  ? 21.000  -22.656 45.667  1.00 58.06 ? 296 ARG B NH2 1 
ATOM   3390 N N   . ALA B 1 86  ? 27.138  -27.444 41.723  1.00 46.77 ? 297 ALA B N   1 
ATOM   3391 C CA  . ALA B 1 86  ? 27.669  -26.824 40.503  1.00 45.67 ? 297 ALA B CA  1 
ATOM   3392 C C   . ALA B 1 86  ? 27.183  -27.545 39.243  1.00 43.85 ? 297 ALA B C   1 
ATOM   3393 O O   . ALA B 1 86  ? 26.378  -27.000 38.504  1.00 42.47 ? 297 ALA B O   1 
ATOM   3394 C CB  . ALA B 1 86  ? 29.222  -26.765 40.560  1.00 45.83 ? 297 ALA B CB  1 
ATOM   3395 N N   . LEU B 1 87  ? 27.666  -28.773 39.057  1.00 43.56 ? 298 LEU B N   1 
ATOM   3396 C CA  . LEU B 1 87  ? 27.354  -29.624 37.914  1.00 43.10 ? 298 LEU B CA  1 
ATOM   3397 C C   . LEU B 1 87  ? 25.854  -29.989 37.830  1.00 42.95 ? 298 LEU B C   1 
ATOM   3398 O O   . LEU B 1 87  ? 25.293  -30.054 36.710  1.00 40.82 ? 298 LEU B O   1 
ATOM   3399 C CB  . LEU B 1 87  ? 28.225  -30.888 37.943  1.00 42.90 ? 298 LEU B CB  1 
ATOM   3400 C CG  . LEU B 1 87  ? 28.360  -31.691 36.647  1.00 43.19 ? 298 LEU B CG  1 
ATOM   3401 C CD1 . LEU B 1 87  ? 28.926  -30.856 35.512  1.00 41.95 ? 298 LEU B CD1 1 
ATOM   3402 C CD2 . LEU B 1 87  ? 29.214  -32.917 36.830  1.00 43.62 ? 298 LEU B CD2 1 
ATOM   3403 N N   . MET B 1 88  ? 25.225  -30.189 39.005  1.00 42.60 ? 299 MET B N   1 
ATOM   3404 C CA  . MET B 1 88  ? 23.781  -30.466 39.121  1.00 42.16 ? 299 MET B CA  1 
ATOM   3405 C C   . MET B 1 88  ? 22.995  -29.322 38.560  1.00 40.96 ? 299 MET B C   1 
ATOM   3406 O O   . MET B 1 88  ? 22.226  -29.519 37.624  1.00 40.42 ? 299 MET B O   1 
ATOM   3407 C CB  . MET B 1 88  ? 23.344  -30.680 40.590  1.00 43.83 ? 299 MET B CB  1 
ATOM   3408 C CG  . MET B 1 88  ? 21.775  -30.611 40.852  1.00 46.06 ? 299 MET B CG  1 
ATOM   3409 S SD  . MET B 1 88  ? 21.247  -30.300 42.594  1.00 51.84 ? 299 MET B SD  1 
ATOM   3410 C CE  . MET B 1 88  ? 20.796  -28.557 42.623  1.00 50.26 ? 299 MET B CE  1 
ATOM   3411 N N   . GLU B 1 89  ? 23.172  -28.124 39.130  1.00 39.91 ? 300 GLU B N   1 
ATOM   3412 C CA  . GLU B 1 89  ? 22.460  -26.942 38.638  1.00 39.88 ? 300 GLU B CA  1 
ATOM   3413 C C   . GLU B 1 89  ? 22.802  -26.673 37.155  1.00 37.40 ? 300 GLU B C   1 
ATOM   3414 O O   . GLU B 1 89  ? 21.991  -26.092 36.441  1.00 36.84 ? 300 GLU B O   1 
ATOM   3415 C CB  . GLU B 1 89  ? 22.686  -25.669 39.507  1.00 40.76 ? 300 GLU B CB  1 
ATOM   3416 C CG  . GLU B 1 89  ? 21.914  -25.691 40.867  1.00 45.23 ? 300 GLU B CG  1 
ATOM   3417 C CD  . GLU B 1 89  ? 21.860  -24.346 41.622  1.00 49.86 ? 300 GLU B CD  1 
ATOM   3418 O OE1 . GLU B 1 89  ? 22.434  -23.341 41.149  1.00 53.71 ? 300 GLU B OE1 1 
ATOM   3419 O OE2 . GLU B 1 89  ? 21.223  -24.298 42.707  1.00 53.03 ? 300 GLU B OE2 1 
ATOM   3420 N N   . ALA B 1 90  ? 23.968  -27.115 36.693  1.00 34.92 ? 301 ALA B N   1 
ATOM   3421 C CA  . ALA B 1 90  ? 24.384  -26.815 35.300  1.00 33.07 ? 301 ALA B CA  1 
ATOM   3422 C C   . ALA B 1 90  ? 23.700  -27.785 34.319  1.00 30.79 ? 301 ALA B C   1 
ATOM   3423 O O   . ALA B 1 90  ? 23.136  -27.372 33.317  1.00 28.64 ? 301 ALA B O   1 
ATOM   3424 C CB  . ALA B 1 90  ? 25.912  -26.868 35.169  1.00 32.42 ? 301 ALA B CB  1 
ATOM   3425 N N   . CYS B 1 91  ? 23.752  -29.075 34.638  1.00 29.85 ? 302 CYS B N   1 
ATOM   3426 C CA  . CYS B 1 91  ? 23.133  -30.084 33.816  1.00 29.12 ? 302 CYS B CA  1 
ATOM   3427 C C   . CYS B 1 91  ? 21.600  -29.899 33.780  1.00 28.59 ? 302 CYS B C   1 
ATOM   3428 O O   . CYS B 1 91  ? 21.013  -29.919 32.699  1.00 27.59 ? 302 CYS B O   1 
ATOM   3429 C CB  . CYS B 1 91  ? 23.588  -31.471 34.248  1.00 29.77 ? 302 CYS B CB  1 
ATOM   3430 S SG  . CYS B 1 91  ? 25.340  -31.812 33.813  1.00 29.17 ? 302 CYS B SG  1 
ATOM   3431 N N   . ASN B 1 92  ? 20.982  -29.616 34.931  1.00 28.11 ? 303 ASN B N   1 
ATOM   3432 C CA  . ASN B 1 92  ? 19.534  -29.304 34.997  1.00 28.38 ? 303 ASN B CA  1 
ATOM   3433 C C   . ASN B 1 92  ? 19.151  -28.100 34.178  1.00 26.89 ? 303 ASN B C   1 
ATOM   3434 O O   . ASN B 1 92  ? 18.170  -28.131 33.451  1.00 26.53 ? 303 ASN B O   1 
ATOM   3435 C CB  . ASN B 1 92  ? 19.079  -29.065 36.436  1.00 29.31 ? 303 ASN B CB  1 
ATOM   3436 C CG  . ASN B 1 92  ? 18.955  -30.341 37.221  1.00 31.96 ? 303 ASN B CG  1 
ATOM   3437 O OD1 . ASN B 1 92  ? 18.936  -31.424 36.649  1.00 33.17 ? 303 ASN B OD1 1 
ATOM   3438 N ND2 . ASN B 1 92  ? 18.834  -30.217 38.551  1.00 34.36 ? 303 ASN B ND2 1 
ATOM   3439 N N   . GLU B 1 93  ? 19.934  -27.032 34.290  1.00 26.53 ? 304 GLU B N   1 
ATOM   3440 C CA  . GLU B 1 93  ? 19.724  -25.873 33.458  1.00 26.40 ? 304 GLU B CA  1 
ATOM   3441 C C   . GLU B 1 93  ? 19.812  -26.253 31.958  1.00 24.60 ? 304 GLU B C   1 
ATOM   3442 O O   . GLU B 1 93  ? 18.939  -25.884 31.185  1.00 23.98 ? 304 GLU B O   1 
ATOM   3443 C CB  . GLU B 1 93  ? 20.714  -24.773 33.794  1.00 26.94 ? 304 GLU B CB  1 
ATOM   3444 C CG  . GLU B 1 93  ? 20.475  -23.458 33.050  1.00 28.13 ? 304 GLU B CG  1 
ATOM   3445 C CD  . GLU B 1 93  ? 21.639  -22.485 33.257  1.00 31.29 ? 304 GLU B CD  1 
ATOM   3446 O OE1 . GLU B 1 93  ? 21.714  -21.868 34.342  1.00 33.63 ? 304 GLU B OE1 1 
ATOM   3447 O OE2 . GLU B 1 93  ? 22.464  -22.329 32.330  1.00 30.56 ? 304 GLU B OE2 1 
ATOM   3448 N N   . PHE B 1 94  ? 20.806  -27.037 31.564  1.00 23.32 ? 305 PHE B N   1 
ATOM   3449 C CA  . PHE B 1 94  ? 20.876  -27.453 30.132  1.00 22.31 ? 305 PHE B CA  1 
ATOM   3450 C C   . PHE B 1 94  ? 19.678  -28.300 29.684  1.00 21.11 ? 305 PHE B C   1 
ATOM   3451 O O   . PHE B 1 94  ? 19.080  -28.054 28.635  1.00 20.42 ? 305 PHE B O   1 
ATOM   3452 C CB  . PHE B 1 94  ? 22.177  -28.190 29.818  1.00 22.31 ? 305 PHE B CB  1 
ATOM   3453 C CG  . PHE B 1 94  ? 22.224  -28.743 28.419  1.00 20.33 ? 305 PHE B CG  1 
ATOM   3454 C CD1 . PHE B 1 94  ? 22.371  -27.894 27.334  1.00 20.79 ? 305 PHE B CD1 1 
ATOM   3455 C CD2 . PHE B 1 94  ? 22.093  -30.105 28.192  1.00 20.49 ? 305 PHE B CD2 1 
ATOM   3456 C CE1 . PHE B 1 94  ? 22.399  -28.413 26.011  1.00 21.29 ? 305 PHE B CE1 1 
ATOM   3457 C CE2 . PHE B 1 94  ? 22.146  -30.633 26.899  1.00 20.89 ? 305 PHE B CE2 1 
ATOM   3458 C CZ  . PHE B 1 94  ? 22.283  -29.773 25.806  1.00 20.49 ? 305 PHE B CZ  1 
ATOM   3459 N N   . TYR B 1 95  ? 19.293  -29.272 30.501  1.00 21.51 ? 306 TYR B N   1 
ATOM   3460 C CA  . TYR B 1 95  ? 18.169  -30.131 30.158  1.00 21.31 ? 306 TYR B CA  1 
ATOM   3461 C C   . TYR B 1 95  ? 16.822  -29.368 30.188  1.00 21.33 ? 306 TYR B C   1 
ATOM   3462 O O   . TYR B 1 95  ? 15.869  -29.768 29.517  1.00 19.02 ? 306 TYR B O   1 
ATOM   3463 C CB  . TYR B 1 95  ? 18.092  -31.357 31.079  1.00 22.15 ? 306 TYR B CB  1 
ATOM   3464 C CG  . TYR B 1 95  ? 19.206  -32.363 30.922  1.00 22.24 ? 306 TYR B CG  1 
ATOM   3465 C CD1 . TYR B 1 95  ? 19.612  -32.801 29.670  1.00 22.60 ? 306 TYR B CD1 1 
ATOM   3466 C CD2 . TYR B 1 95  ? 19.823  -32.911 32.029  1.00 22.18 ? 306 TYR B CD2 1 
ATOM   3467 C CE1 . TYR B 1 95  ? 20.617  -33.695 29.528  1.00 21.05 ? 306 TYR B CE1 1 
ATOM   3468 C CE2 . TYR B 1 95  ? 20.822  -33.842 31.898  1.00 21.88 ? 306 TYR B CE2 1 
ATOM   3469 C CZ  . TYR B 1 95  ? 21.208  -34.239 30.642  1.00 21.24 ? 306 TYR B CZ  1 
ATOM   3470 O OH  . TYR B 1 95  ? 22.196  -35.167 30.488  1.00 19.74 ? 306 TYR B OH  1 
ATOM   3471 N N   . THR B 1 96  ? 16.740  -28.281 30.949  1.00 21.56 ? 307 THR B N   1 
ATOM   3472 C CA  . THR B 1 96  ? 15.529  -27.472 30.935  1.00 22.43 ? 307 THR B CA  1 
ATOM   3473 C C   . THR B 1 96  ? 15.436  -26.672 29.649  1.00 21.99 ? 307 THR B C   1 
ATOM   3474 O O   . THR B 1 96  ? 14.378  -26.588 29.041  1.00 22.25 ? 307 THR B O   1 
ATOM   3475 C CB  . THR B 1 96  ? 15.477  -26.467 32.068  1.00 23.30 ? 307 THR B CB  1 
ATOM   3476 O OG1 . THR B 1 96  ? 15.806  -27.124 33.301  1.00 25.10 ? 307 THR B OG1 1 
ATOM   3477 C CG2 . THR B 1 96  ? 14.048  -25.851 32.123  1.00 26.38 ? 307 THR B CG2 1 
ATOM   3478 N N   . ARG B 1 97  ? 16.561  -26.113 29.221  1.00 21.43 ? 308 ARG B N   1 
ATOM   3479 C CA  . ARG B 1 97  ? 16.601  -25.316 27.975  1.00 20.77 ? 308 ARG B CA  1 
ATOM   3480 C C   . ARG B 1 97  ? 16.510  -26.142 26.717  1.00 19.94 ? 308 ARG B C   1 
ATOM   3481 O O   . ARG B 1 97  ? 15.970  -25.671 25.735  1.00 18.46 ? 308 ARG B O   1 
ATOM   3482 C CB  . ARG B 1 97  ? 17.880  -24.473 27.938  1.00 20.74 ? 308 ARG B CB  1 
ATOM   3483 C CG  . ARG B 1 97  ? 17.850  -23.396 29.014  1.00 22.57 ? 308 ARG B CG  1 
ATOM   3484 C CD  . ARG B 1 97  ? 19.178  -22.706 29.214  1.00 22.97 ? 308 ARG B CD  1 
ATOM   3485 N NE  . ARG B 1 97  ? 19.094  -21.625 30.210  1.00 23.82 ? 308 ARG B NE  1 
ATOM   3486 C CZ  . ARG B 1 97  ? 20.033  -20.697 30.411  1.00 25.93 ? 308 ARG B CZ  1 
ATOM   3487 N NH1 . ARG B 1 97  ? 21.135  -20.686 29.663  1.00 26.79 ? 308 ARG B NH1 1 
ATOM   3488 N NH2 . ARG B 1 97  ? 19.875  -19.768 31.352  1.00 25.15 ? 308 ARG B NH2 1 
ATOM   3489 N N   . ILE B 1 98  ? 17.059  -27.365 26.751  1.00 18.67 ? 309 ILE B N   1 
ATOM   3490 C CA  . ILE B 1 98  ? 17.148  -28.215 25.582  1.00 18.03 ? 309 ILE B CA  1 
ATOM   3491 C C   . ILE B 1 98  ? 16.562  -29.556 26.003  1.00 18.56 ? 309 ILE B C   1 
ATOM   3492 O O   . ILE B 1 98  ? 17.301  -30.432 26.469  1.00 18.65 ? 309 ILE B O   1 
ATOM   3493 C CB  . ILE B 1 98  ? 18.597  -28.400 25.168  1.00 17.51 ? 309 ILE B CB  1 
ATOM   3494 C CG1 . ILE B 1 98  ? 19.245  -27.040 24.855  1.00 19.30 ? 309 ILE B CG1 1 
ATOM   3495 C CG2 . ILE B 1 98  ? 18.721  -29.326 23.957  1.00 17.46 ? 309 ILE B CG2 1 
ATOM   3496 C CD1 . ILE B 1 98  ? 18.742  -26.397 23.570  1.00 17.24 ? 309 ILE B CD1 1 
ATOM   3497 N N   . PRO B 1 99  ? 15.223  -29.713 25.893  1.00 18.40 ? 310 PRO B N   1 
ATOM   3498 C CA  . PRO B 1 99  ? 14.650  -30.840 26.586  1.00 18.97 ? 310 PRO B CA  1 
ATOM   3499 C C   . PRO B 1 99  ? 15.049  -32.199 26.023  1.00 18.77 ? 310 PRO B C   1 
ATOM   3500 O O   . PRO B 1 99  ? 15.120  -32.397 24.785  1.00 17.08 ? 310 PRO B O   1 
ATOM   3501 C CB  . PRO B 1 99  ? 13.137  -30.596 26.461  1.00 19.56 ? 310 PRO B CB  1 
ATOM   3502 C CG  . PRO B 1 99  ? 13.000  -29.160 26.302  1.00 20.42 ? 310 PRO B CG  1 
ATOM   3503 C CD  . PRO B 1 99  ? 14.188  -28.738 25.515  1.00 19.55 ? 310 PRO B CD  1 
ATOM   3504 N N   . HIS B 1 100 ? 15.282  -33.127 26.954  1.00 19.58 ? 311 HIS B N   1 
ATOM   3505 C CA  . HIS B 1 100 ? 15.682  -34.494 26.642  1.00 19.10 ? 311 HIS B CA  1 
ATOM   3506 C C   . HIS B 1 100 ? 14.643  -35.465 27.207  1.00 20.81 ? 311 HIS B C   1 
ATOM   3507 O O   . HIS B 1 100 ? 13.940  -35.149 28.163  1.00 20.55 ? 311 HIS B O   1 
ATOM   3508 C CB  . HIS B 1 100 ? 17.026  -34.827 27.295  1.00 19.96 ? 311 HIS B CB  1 
ATOM   3509 C CG  . HIS B 1 100 ? 18.230  -34.291 26.580  1.00 17.17 ? 311 HIS B CG  1 
ATOM   3510 N ND1 . HIS B 1 100 ? 18.368  -32.960 26.259  1.00 17.45 ? 311 HIS B ND1 1 
ATOM   3511 C CD2 . HIS B 1 100 ? 19.362  -34.907 26.160  1.00 16.78 ? 311 HIS B CD2 1 
ATOM   3512 C CE1 . HIS B 1 100 ? 19.530  -32.785 25.648  1.00 19.49 ? 311 HIS B CE1 1 
ATOM   3513 N NE2 . HIS B 1 100 ? 20.147  -33.951 25.567  1.00 19.31 ? 311 HIS B NE2 1 
ATOM   3514 N N   . ASP B 1 101 ? 14.601  -36.672 26.654  1.00 22.05 ? 312 ASP B N   1 
ATOM   3515 C CA  . ASP B 1 101 ? 13.643  -37.688 27.101  1.00 22.64 ? 312 ASP B CA  1 
ATOM   3516 C C   . ASP B 1 101 ? 14.434  -38.918 27.551  1.00 22.45 ? 312 ASP B C   1 
ATOM   3517 O O   . ASP B 1 101 ? 14.850  -39.759 26.729  1.00 22.27 ? 312 ASP B O   1 
ATOM   3518 C CB  . ASP B 1 101 ? 12.698  -38.042 25.958  1.00 23.89 ? 312 ASP B CB  1 
ATOM   3519 C CG  . ASP B 1 101 ? 11.620  -39.084 26.364  1.00 25.60 ? 312 ASP B CG  1 
ATOM   3520 O OD1 . ASP B 1 101 ? 11.654  -39.576 27.507  1.00 25.26 ? 312 ASP B OD1 1 
ATOM   3521 O OD2 . ASP B 1 101 ? 10.745  -39.384 25.527  1.00 28.45 ? 312 ASP B OD2 1 
ATOM   3522 N N   . PHE B 1 102 ? 14.657  -39.023 28.850  1.00 20.76 ? 313 PHE B N   1 
ATOM   3523 C CA  . PHE B 1 102 ? 15.348  -40.166 29.391  1.00 20.17 ? 313 PHE B CA  1 
ATOM   3524 C C   . PHE B 1 102 ? 14.356  -41.173 29.996  1.00 20.96 ? 313 PHE B C   1 
ATOM   3525 O O   . PHE B 1 102 ? 14.740  -42.056 30.774  1.00 20.70 ? 313 PHE B O   1 
ATOM   3526 C CB  . PHE B 1 102 ? 16.378  -39.702 30.413  1.00 19.86 ? 313 PHE B CB  1 
ATOM   3527 C CG  . PHE B 1 102 ? 17.506  -38.871 29.821  1.00 20.79 ? 313 PHE B CG  1 
ATOM   3528 C CD1 . PHE B 1 102 ? 18.442  -39.446 28.982  1.00 18.97 ? 313 PHE B CD1 1 
ATOM   3529 C CD2 . PHE B 1 102 ? 17.648  -37.520 30.161  1.00 22.18 ? 313 PHE B CD2 1 
ATOM   3530 C CE1 . PHE B 1 102 ? 19.475  -38.700 28.440  1.00 21.14 ? 313 PHE B CE1 1 
ATOM   3531 C CE2 . PHE B 1 102 ? 18.679  -36.756 29.640  1.00 21.21 ? 313 PHE B CE2 1 
ATOM   3532 C CZ  . PHE B 1 102 ? 19.605  -37.334 28.777  1.00 22.14 ? 313 PHE B CZ  1 
ATOM   3533 N N   . GLY B 1 103 ? 13.084  -41.042 29.626  1.00 21.17 ? 314 GLY B N   1 
ATOM   3534 C CA  . GLY B 1 103 ? 12.021  -41.858 30.176  1.00 22.09 ? 314 GLY B CA  1 
ATOM   3535 C C   . GLY B 1 103 ? 11.991  -41.837 31.695  1.00 22.88 ? 314 GLY B C   1 
ATOM   3536 O O   . GLY B 1 103 ? 11.915  -40.778 32.288  1.00 23.14 ? 314 GLY B O   1 
ATOM   3537 N N   . LEU B 1 104 ? 12.111  -43.020 32.301  1.00 22.93 ? 315 LEU B N   1 
ATOM   3538 C CA  . LEU B 1 104 ? 12.049  -43.200 33.746  1.00 23.85 ? 315 LEU B CA  1 
ATOM   3539 C C   . LEU B 1 104 ? 13.417  -43.177 34.414  1.00 22.92 ? 315 LEU B C   1 
ATOM   3540 O O   . LEU B 1 104 ? 13.526  -43.232 35.622  1.00 23.20 ? 315 LEU B O   1 
ATOM   3541 C CB  . LEU B 1 104 ? 11.358  -44.531 34.068  1.00 25.32 ? 315 LEU B CB  1 
ATOM   3542 C CG  . LEU B 1 104 ? 9.929   -44.733 33.566  1.00 27.72 ? 315 LEU B CG  1 
ATOM   3543 C CD1 . LEU B 1 104 ? 9.461   -46.165 33.923  1.00 30.11 ? 315 LEU B CD1 1 
ATOM   3544 C CD2 . LEU B 1 104 ? 8.970   -43.690 34.129  1.00 30.95 ? 315 LEU B CD2 1 
ATOM   3545 N N   . ARG B 1 105 ? 14.464  -43.053 33.623  1.00 22.36 ? 316 ARG B N   1 
ATOM   3546 C CA  . ARG B 1 105 ? 15.826  -43.084 34.109  1.00 22.16 ? 316 ARG B CA  1 
ATOM   3547 C C   . ARG B 1 105 ? 16.302  -41.702 34.622  1.00 21.86 ? 316 ARG B C   1 
ATOM   3548 O O   . ARG B 1 105 ? 15.938  -40.660 34.059  1.00 22.08 ? 316 ARG B O   1 
ATOM   3549 C CB  . ARG B 1 105 ? 16.675  -43.563 32.939  1.00 22.30 ? 316 ARG B CB  1 
ATOM   3550 C CG  . ARG B 1 105 ? 18.134  -43.729 33.178  1.00 24.88 ? 316 ARG B CG  1 
ATOM   3551 C CD  . ARG B 1 105 ? 18.805  -44.167 31.871  1.00 28.11 ? 316 ARG B CD  1 
ATOM   3552 N NE  . ARG B 1 105 ? 20.198  -43.779 31.942  1.00 32.10 ? 316 ARG B NE  1 
ATOM   3553 C CZ  . ARG B 1 105 ? 20.860  -43.067 31.044  1.00 29.55 ? 316 ARG B CZ  1 
ATOM   3554 N NH1 . ARG B 1 105 ? 20.318  -42.704 29.884  1.00 29.69 ? 316 ARG B NH1 1 
ATOM   3555 N NH2 . ARG B 1 105 ? 22.114  -42.786 31.311  1.00 32.08 ? 316 ARG B NH2 1 
ATOM   3556 N N   . THR B 1 106 ? 17.099  -41.701 35.683  1.00 22.23 ? 317 THR B N   1 
ATOM   3557 C CA  . THR B 1 106 ? 17.778  -40.504 36.182  1.00 22.96 ? 317 THR B CA  1 
ATOM   3558 C C   . THR B 1 106 ? 18.503  -39.743 35.025  1.00 22.52 ? 317 THR B C   1 
ATOM   3559 O O   . THR B 1 106 ? 19.362  -40.297 34.368  1.00 21.86 ? 317 THR B O   1 
ATOM   3560 C CB  . THR B 1 106 ? 18.842  -40.854 37.264  1.00 23.45 ? 317 THR B CB  1 
ATOM   3561 O OG1 . THR B 1 106 ? 18.306  -41.804 38.199  1.00 23.20 ? 317 THR B OG1 1 
ATOM   3562 C CG2 . THR B 1 106 ? 19.270  -39.577 38.060  1.00 22.35 ? 317 THR B CG2 1 
ATOM   3563 N N   . PRO B 1 107 ? 18.135  -38.480 34.753  1.00 23.49 ? 318 PRO B N   1 
ATOM   3564 C CA  . PRO B 1 107 ? 18.926  -37.787 33.726  1.00 23.77 ? 318 PRO B CA  1 
ATOM   3565 C C   . PRO B 1 107 ? 20.412  -37.831 34.077  1.00 24.50 ? 318 PRO B C   1 
ATOM   3566 O O   . PRO B 1 107 ? 20.791  -37.560 35.209  1.00 24.96 ? 318 PRO B O   1 
ATOM   3567 C CB  . PRO B 1 107 ? 18.361  -36.356 33.749  1.00 23.77 ? 318 PRO B CB  1 
ATOM   3568 C CG  . PRO B 1 107 ? 16.905  -36.544 34.162  1.00 23.21 ? 318 PRO B CG  1 
ATOM   3569 C CD  . PRO B 1 107 ? 17.013  -37.645 35.232  1.00 24.08 ? 318 PRO B CD  1 
ATOM   3570 N N   . PRO B 1 108 ? 21.258  -38.233 33.133  1.00 25.43 ? 319 PRO B N   1 
ATOM   3571 C CA  . PRO B 1 108 ? 22.626  -38.444 33.558  1.00 26.44 ? 319 PRO B CA  1 
ATOM   3572 C C   . PRO B 1 108 ? 23.462  -37.172 33.532  1.00 27.44 ? 319 PRO B C   1 
ATOM   3573 O O   . PRO B 1 108 ? 23.155  -36.236 32.787  1.00 25.64 ? 319 PRO B O   1 
ATOM   3574 C CB  . PRO B 1 108 ? 23.156  -39.390 32.496  1.00 27.35 ? 319 PRO B CB  1 
ATOM   3575 C CG  . PRO B 1 108 ? 22.422  -38.965 31.245  1.00 26.42 ? 319 PRO B CG  1 
ATOM   3576 C CD  . PRO B 1 108 ? 21.032  -38.683 31.745  1.00 25.11 ? 319 PRO B CD  1 
ATOM   3577 N N   . LEU B 1 109 ? 24.526  -37.167 34.329  1.00 28.40 ? 320 LEU B N   1 
ATOM   3578 C CA  . LEU B 1 109 ? 25.461  -36.075 34.322  1.00 29.39 ? 320 LEU B CA  1 
ATOM   3579 C C   . LEU B 1 109 ? 26.260  -36.085 33.005  1.00 29.11 ? 320 LEU B C   1 
ATOM   3580 O O   . LEU B 1 109 ? 26.448  -37.118 32.346  1.00 29.44 ? 320 LEU B O   1 
ATOM   3581 C CB  . LEU B 1 109 ? 26.355  -36.083 35.578  1.00 30.30 ? 320 LEU B CB  1 
ATOM   3582 C CG  . LEU B 1 109 ? 25.663  -35.674 36.920  1.00 31.21 ? 320 LEU B CG  1 
ATOM   3583 C CD1 . LEU B 1 109 ? 26.644  -35.513 38.051  1.00 31.13 ? 320 LEU B CD1 1 
ATOM   3584 C CD2 . LEU B 1 109 ? 24.857  -34.395 36.864  1.00 30.93 ? 320 LEU B CD2 1 
ATOM   3585 N N   . ILE B 1 110 ? 26.620  -34.886 32.577  1.00 29.62 ? 321 ILE B N   1 
ATOM   3586 C CA  . ILE B 1 110 ? 27.523  -34.656 31.445  1.00 29.22 ? 321 ILE B CA  1 
ATOM   3587 C C   . ILE B 1 110 ? 28.838  -34.294 32.122  1.00 31.12 ? 321 ILE B C   1 
ATOM   3588 O O   . ILE B 1 110 ? 28.946  -33.280 32.794  1.00 30.32 ? 321 ILE B O   1 
ATOM   3589 C CB  . ILE B 1 110 ? 27.018  -33.499 30.569  1.00 27.97 ? 321 ILE B CB  1 
ATOM   3590 C CG1 . ILE B 1 110 ? 25.677  -33.863 29.927  1.00 26.48 ? 321 ILE B CG1 1 
ATOM   3591 C CG2 . ILE B 1 110 ? 28.015  -33.161 29.503  1.00 27.04 ? 321 ILE B CG2 1 
ATOM   3592 C CD1 . ILE B 1 110 ? 24.744  -32.677 29.723  1.00 26.98 ? 321 ILE B CD1 1 
ATOM   3593 N N   . ARG B 1 111 ? 29.823  -35.161 31.993  1.00 33.60 ? 322 ARG B N   1 
ATOM   3594 C CA  . ARG B 1 111 ? 31.023  -35.037 32.833  1.00 36.15 ? 322 ARG B CA  1 
ATOM   3595 C C   . ARG B 1 111 ? 32.333  -35.349 32.117  1.00 36.12 ? 322 ARG B C   1 
ATOM   3596 O O   . ARG B 1 111 ? 33.390  -35.152 32.682  1.00 37.57 ? 322 ARG B O   1 
ATOM   3597 C CB  . ARG B 1 111 ? 30.875  -35.881 34.108  1.00 37.21 ? 322 ARG B CB  1 
ATOM   3598 C CG  . ARG B 1 111 ? 30.213  -37.216 33.900  1.00 41.47 ? 322 ARG B CG  1 
ATOM   3599 C CD  . ARG B 1 111 ? 30.344  -38.103 35.131  1.00 47.37 ? 322 ARG B CD  1 
ATOM   3600 N NE  . ARG B 1 111 ? 29.452  -37.709 36.221  1.00 50.71 ? 322 ARG B NE  1 
ATOM   3601 C CZ  . ARG B 1 111 ? 29.392  -38.326 37.411  1.00 56.75 ? 322 ARG B CZ  1 
ATOM   3602 N NH1 . ARG B 1 111 ? 30.179  -39.368 37.699  1.00 58.90 ? 322 ARG B NH1 1 
ATOM   3603 N NH2 . ARG B 1 111 ? 28.541  -37.901 38.335  1.00 57.94 ? 322 ARG B NH2 1 
ATOM   3604 N N   . THR B 1 112 ? 32.272  -35.793 30.870  1.00 35.89 ? 323 THR B N   1 
ATOM   3605 C CA  . THR B 1 112 ? 33.475  -36.048 30.102  1.00 35.63 ? 323 THR B CA  1 
ATOM   3606 C C   . THR B 1 112 ? 33.473  -35.223 28.832  1.00 35.01 ? 323 THR B C   1 
ATOM   3607 O O   . THR B 1 112 ? 32.435  -34.666 28.444  1.00 32.73 ? 323 THR B O   1 
ATOM   3608 C CB  . THR B 1 112 ? 33.572  -37.516 29.715  1.00 35.94 ? 323 THR B CB  1 
ATOM   3609 O OG1 . THR B 1 112 ? 34.861  -37.777 29.167  1.00 40.41 ? 323 THR B OG1 1 
ATOM   3610 C CG2 . THR B 1 112 ? 32.573  -37.849 28.693  1.00 33.61 ? 323 THR B CG2 1 
ATOM   3611 N N   . GLN B 1 113 ? 34.637  -35.192 28.178  1.00 35.11 ? 324 GLN B N   1 
ATOM   3612 C CA  . GLN B 1 113 ? 34.814  -34.449 26.952  1.00 34.85 ? 324 GLN B CA  1 
ATOM   3613 C C   . GLN B 1 113 ? 33.896  -34.992 25.881  1.00 34.67 ? 324 GLN B C   1 
ATOM   3614 O O   . GLN B 1 113 ? 33.217  -34.222 25.207  1.00 33.30 ? 324 GLN B O   1 
ATOM   3615 C CB  . GLN B 1 113 ? 36.263  -34.510 26.471  1.00 35.74 ? 324 GLN B CB  1 
ATOM   3616 C CG  . GLN B 1 113 ? 36.579  -33.547 25.291  1.00 36.09 ? 324 GLN B CG  1 
ATOM   3617 C CD  . GLN B 1 113 ? 36.169  -34.078 23.903  1.00 37.22 ? 324 GLN B CD  1 
ATOM   3618 O OE1 . GLN B 1 113 ? 36.042  -35.292 23.687  1.00 35.42 ? 324 GLN B OE1 1 
ATOM   3619 N NE2 . GLN B 1 113 ? 35.962  -33.155 22.957  1.00 35.31 ? 324 GLN B NE2 1 
ATOM   3620 N N   . LYS B 1 114 ? 33.889  -36.316 25.701  1.00 34.41 ? 325 LYS B N   1 
ATOM   3621 C CA  . LYS B 1 114 ? 33.010  -36.926 24.702  1.00 34.46 ? 325 LYS B CA  1 
ATOM   3622 C C   . LYS B 1 114 ? 31.517  -36.628 24.978  1.00 32.87 ? 325 LYS B C   1 
ATOM   3623 O O   . LYS B 1 114 ? 30.747  -36.462 24.046  1.00 32.50 ? 325 LYS B O   1 
ATOM   3624 C CB  . LYS B 1 114 ? 33.233  -38.456 24.600  1.00 35.35 ? 325 LYS B CB  1 
ATOM   3625 C CG  . LYS B 1 114 ? 33.066  -39.151 25.940  1.00 39.35 ? 325 LYS B CG  1 
ATOM   3626 C CD  . LYS B 1 114 ? 32.820  -40.651 25.907  1.00 42.60 ? 325 LYS B CD  1 
ATOM   3627 C CE  . LYS B 1 114 ? 32.014  -41.068 27.159  1.00 43.16 ? 325 LYS B CE  1 
ATOM   3628 N NZ  . LYS B 1 114 ? 32.492  -40.403 28.421  1.00 42.58 ? 325 LYS B NZ  1 
ATOM   3629 N N   . GLU B 1 115 ? 31.127  -36.569 26.248  1.00 31.90 ? 326 GLU B N   1 
ATOM   3630 C CA  . GLU B 1 115 ? 29.733  -36.311 26.620  1.00 31.56 ? 326 GLU B CA  1 
ATOM   3631 C C   . GLU B 1 115 ? 29.370  -34.851 26.330  1.00 30.47 ? 326 GLU B C   1 
ATOM   3632 O O   . GLU B 1 115 ? 28.295  -34.572 25.814  1.00 30.49 ? 326 GLU B O   1 
ATOM   3633 C CB  . GLU B 1 115 ? 29.444  -36.706 28.091  1.00 31.87 ? 326 GLU B CB  1 
ATOM   3634 C CG  . GLU B 1 115 ? 29.288  -38.242 28.319  1.00 33.02 ? 326 GLU B CG  1 
ATOM   3635 C CD  . GLU B 1 115 ? 29.250  -38.672 29.816  1.00 35.69 ? 326 GLU B CD  1 
ATOM   3636 O OE1 . GLU B 1 115 ? 29.567  -37.866 30.714  1.00 33.08 ? 326 GLU B OE1 1 
ATOM   3637 O OE2 . GLU B 1 115 ? 28.887  -39.842 30.103  1.00 39.55 ? 326 GLU B OE2 1 
ATOM   3638 N N   . LEU B 1 116 ? 30.282  -33.924 26.628  1.00 29.75 ? 327 LEU B N   1 
ATOM   3639 C CA  . LEU B 1 116 ? 30.144  -32.517 26.210  1.00 28.59 ? 327 LEU B CA  1 
ATOM   3640 C C   . LEU B 1 116 ? 30.054  -32.416 24.674  1.00 27.52 ? 327 LEU B C   1 
ATOM   3641 O O   . LEU B 1 116 ? 29.207  -31.712 24.126  1.00 26.09 ? 327 LEU B O   1 
ATOM   3642 C CB  . LEU B 1 116 ? 31.333  -31.719 26.704  1.00 28.91 ? 327 LEU B CB  1 
ATOM   3643 C CG  . LEU B 1 116 ? 31.257  -30.242 27.065  1.00 29.70 ? 327 LEU B CG  1 
ATOM   3644 C CD1 . LEU B 1 116 ? 30.156  -29.930 28.050  1.00 27.87 ? 327 LEU B CD1 1 
ATOM   3645 C CD2 . LEU B 1 116 ? 32.605  -29.858 27.662  1.00 24.46 ? 327 LEU B CD2 1 
ATOM   3646 N N   . SER B 1 117 ? 30.933  -33.143 24.001  1.00 26.21 ? 328 SER B N   1 
ATOM   3647 C CA  . SER B 1 117 ? 30.991  -33.151 22.548  1.00 26.25 ? 328 SER B CA  1 
ATOM   3648 C C   . SER B 1 117 ? 29.669  -33.621 21.925  1.00 25.04 ? 328 SER B C   1 
ATOM   3649 O O   . SER B 1 117 ? 29.209  -33.034 20.945  1.00 24.26 ? 328 SER B O   1 
ATOM   3650 C CB  . SER B 1 117 ? 32.153  -34.049 22.073  1.00 25.90 ? 328 SER B CB  1 
ATOM   3651 O OG  . SER B 1 117 ? 32.110  -34.233 20.666  1.00 28.47 ? 328 SER B OG  1 
ATOM   3652 N N   . GLU B 1 118 ? 29.084  -34.679 22.496  1.00 24.16 ? 329 GLU B N   1 
ATOM   3653 C CA  . GLU B 1 118 ? 27.823  -35.223 22.015  1.00 24.72 ? 329 GLU B CA  1 
ATOM   3654 C C   . GLU B 1 118 ? 26.728  -34.192 22.127  1.00 22.98 ? 329 GLU B C   1 
ATOM   3655 O O   . GLU B 1 118 ? 25.892  -34.109 21.258  1.00 22.79 ? 329 GLU B O   1 
ATOM   3656 C CB  . GLU B 1 118 ? 27.415  -36.513 22.774  1.00 25.81 ? 329 GLU B CB  1 
ATOM   3657 C CG  . GLU B 1 118 ? 28.021  -37.777 22.144  1.00 30.38 ? 329 GLU B CG  1 
ATOM   3658 C CD  . GLU B 1 118 ? 28.323  -38.908 23.141  1.00 37.43 ? 329 GLU B CD  1 
ATOM   3659 O OE1 . GLU B 1 118 ? 27.999  -38.794 24.357  1.00 38.86 ? 329 GLU B OE1 1 
ATOM   3660 O OE2 . GLU B 1 118 ? 28.892  -39.928 22.673  1.00 43.32 ? 329 GLU B OE2 1 
ATOM   3661 N N   . LYS B 1 119 ? 26.757  -33.390 23.183  1.00 21.58 ? 330 LYS B N   1 
ATOM   3662 C CA  . LYS B 1 119 ? 25.774  -32.307 23.348  1.00 20.28 ? 330 LYS B CA  1 
ATOM   3663 C C   . LYS B 1 119 ? 26.019  -31.157 22.371  1.00 19.60 ? 330 LYS B C   1 
ATOM   3664 O O   . LYS B 1 119 ? 25.075  -30.545 21.876  1.00 16.98 ? 330 LYS B O   1 
ATOM   3665 C CB  . LYS B 1 119 ? 25.777  -31.780 24.783  1.00 20.33 ? 330 LYS B CB  1 
ATOM   3666 C CG  . LYS B 1 119 ? 25.402  -32.814 25.850  1.00 22.37 ? 330 LYS B CG  1 
ATOM   3667 C CD  . LYS B 1 119 ? 23.942  -33.360 25.705  1.00 25.52 ? 330 LYS B CD  1 
ATOM   3668 C CE  . LYS B 1 119 ? 23.892  -34.716 24.967  1.00 26.46 ? 330 LYS B CE  1 
ATOM   3669 N NZ  . LYS B 1 119 ? 22.613  -35.455 25.074  1.00 22.37 ? 330 LYS B NZ  1 
ATOM   3670 N N   . ILE B 1 120 ? 27.285  -30.861 22.090  1.00 19.66 ? 331 ILE B N   1 
ATOM   3671 C CA  . ILE B 1 120 ? 27.604  -29.929 21.004  1.00 20.49 ? 331 ILE B CA  1 
ATOM   3672 C C   . ILE B 1 120 ? 27.073  -30.460 19.667  1.00 19.14 ? 331 ILE B C   1 
ATOM   3673 O O   . ILE B 1 120 ? 26.418  -29.739 18.946  1.00 18.70 ? 331 ILE B O   1 
ATOM   3674 C CB  . ILE B 1 120 ? 29.114  -29.566 20.921  1.00 21.05 ? 331 ILE B CB  1 
ATOM   3675 C CG1 . ILE B 1 120 ? 29.507  -28.649 22.091  1.00 24.19 ? 331 ILE B CG1 1 
ATOM   3676 C CG2 . ILE B 1 120 ? 29.416  -28.802 19.619  1.00 23.31 ? 331 ILE B CG2 1 
ATOM   3677 C CD1 . ILE B 1 120 ? 30.958  -28.808 22.592  1.00 23.33 ? 331 ILE B CD1 1 
ATOM   3678 N N   . GLN B 1 121 ? 27.330  -31.721 19.351  1.00 19.42 ? 332 GLN B N   1 
ATOM   3679 C CA  . GLN B 1 121 ? 26.754  -32.321 18.133  1.00 20.12 ? 332 GLN B CA  1 
ATOM   3680 C C   . GLN B 1 121 ? 25.241  -32.180 18.074  1.00 19.98 ? 332 GLN B C   1 
ATOM   3681 O O   . GLN B 1 121 ? 24.695  -31.924 17.012  1.00 19.98 ? 332 GLN B O   1 
ATOM   3682 C CB  . GLN B 1 121 ? 27.101  -33.810 18.003  1.00 20.94 ? 332 GLN B CB  1 
ATOM   3683 C CG  . GLN B 1 121 ? 28.581  -34.029 17.618  1.00 25.47 ? 332 GLN B CG  1 
ATOM   3684 C CD  . GLN B 1 121 ? 28.965  -35.493 17.440  1.00 29.64 ? 332 GLN B CD  1 
ATOM   3685 O OE1 . GLN B 1 121 ? 28.235  -36.416 17.846  1.00 30.79 ? 332 GLN B OE1 1 
ATOM   3686 N NE2 . GLN B 1 121 ? 30.126  -35.712 16.804  1.00 35.87 ? 332 GLN B NE2 1 
ATOM   3687 N N   . LEU B 1 122 ? 24.566  -32.384 19.207  1.00 19.55 ? 333 LEU B N   1 
ATOM   3688 C CA  . LEU B 1 122 ? 23.110  -32.252 19.242  1.00 19.49 ? 333 LEU B CA  1 
ATOM   3689 C C   . LEU B 1 122 ? 22.722  -30.808 18.958  1.00 17.94 ? 333 LEU B C   1 
ATOM   3690 O O   . LEU B 1 122 ? 21.829  -30.546 18.174  1.00 17.51 ? 333 LEU B O   1 
ATOM   3691 C CB  . LEU B 1 122 ? 22.573  -32.716 20.603  1.00 20.10 ? 333 LEU B CB  1 
ATOM   3692 C CG  . LEU B 1 122 ? 21.113  -32.467 20.967  1.00 21.56 ? 333 LEU B CG  1 
ATOM   3693 C CD1 . LEU B 1 122 ? 20.219  -32.988 19.903  1.00 25.09 ? 333 LEU B CD1 1 
ATOM   3694 C CD2 . LEU B 1 122 ? 20.869  -33.203 22.343  1.00 23.63 ? 333 LEU B CD2 1 
ATOM   3695 N N   . LEU B 1 123 ? 23.378  -29.854 19.596  1.00 16.90 ? 334 LEU B N   1 
ATOM   3696 C CA  . LEU B 1 123 ? 23.018  -28.465 19.334  1.00 16.02 ? 334 LEU B CA  1 
ATOM   3697 C C   . LEU B 1 123 ? 23.332  -28.033 17.864  1.00 16.14 ? 334 LEU B C   1 
ATOM   3698 O O   . LEU B 1 123 ? 22.564  -27.306 17.270  1.00 15.06 ? 334 LEU B O   1 
ATOM   3699 C CB  . LEU B 1 123 ? 23.661  -27.532 20.352  1.00 16.85 ? 334 LEU B CB  1 
ATOM   3700 C CG  . LEU B 1 123 ? 23.121  -27.495 21.801  1.00 16.69 ? 334 LEU B CG  1 
ATOM   3701 C CD1 . LEU B 1 123 ? 23.819  -26.387 22.648  1.00 18.35 ? 334 LEU B CD1 1 
ATOM   3702 C CD2 . LEU B 1 123 ? 21.672  -27.216 21.769  1.00 18.92 ? 334 LEU B CD2 1 
ATOM   3703 N N   . GLU B 1 124 ? 24.435  -28.508 17.286  1.00 16.62 ? 335 GLU B N   1 
ATOM   3704 C CA  . GLU B 1 124 ? 24.756  -28.173 15.872  1.00 17.62 ? 335 GLU B CA  1 
ATOM   3705 C C   . GLU B 1 124 ? 23.716  -28.788 14.950  1.00 17.46 ? 335 GLU B C   1 
ATOM   3706 O O   . GLU B 1 124 ? 23.244  -28.134 14.018  1.00 17.46 ? 335 GLU B O   1 
ATOM   3707 C CB  . GLU B 1 124 ? 26.170  -28.629 15.544  1.00 17.56 ? 335 GLU B CB  1 
ATOM   3708 C CG  . GLU B 1 124 ? 27.173  -27.789 16.317  1.00 17.79 ? 335 GLU B CG  1 
ATOM   3709 C CD  . GLU B 1 124 ? 28.588  -28.095 16.055  1.00 19.37 ? 335 GLU B CD  1 
ATOM   3710 O OE1 . GLU B 1 124 ? 28.884  -29.249 15.703  1.00 16.79 ? 335 GLU B OE1 1 
ATOM   3711 O OE2 . GLU B 1 124 ? 29.430  -27.176 16.250  1.00 22.73 ? 335 GLU B OE2 1 
ATOM   3712 N N   . ALA B 1 125 ? 23.263  -30.005 15.262  1.00 17.30 ? 336 ALA B N   1 
ATOM   3713 C CA  . ALA B 1 125 ? 22.198  -30.622 14.434  1.00 16.85 ? 336 ALA B CA  1 
ATOM   3714 C C   . ALA B 1 125 ? 20.885  -29.848 14.580  1.00 16.67 ? 336 ALA B C   1 
ATOM   3715 O O   . ALA B 1 125 ? 20.161  -29.585 13.585  1.00 16.46 ? 336 ALA B O   1 
ATOM   3716 C CB  . ALA B 1 125 ? 22.021  -32.108 14.754  1.00 16.18 ? 336 ALA B CB  1 
ATOM   3717 N N   . LEU B 1 126 ? 20.570  -29.436 15.798  1.00 15.96 ? 337 LEU B N   1 
ATOM   3718 C CA  . LEU B 1 126 ? 19.365  -28.648 15.991  1.00 16.28 ? 337 LEU B CA  1 
ATOM   3719 C C   . LEU B 1 126 ? 19.427  -27.345 15.197  1.00 16.62 ? 337 LEU B C   1 
ATOM   3720 O O   . LEU B 1 126 ? 18.427  -26.917 14.640  1.00 15.42 ? 337 LEU B O   1 
ATOM   3721 C CB  . LEU B 1 126 ? 19.142  -28.343 17.469  1.00 16.77 ? 337 LEU B CB  1 
ATOM   3722 C CG  . LEU B 1 126 ? 18.714  -29.545 18.298  1.00 16.27 ? 337 LEU B CG  1 
ATOM   3723 C CD1 . LEU B 1 126 ? 18.879  -29.264 19.769  1.00 15.83 ? 337 LEU B CD1 1 
ATOM   3724 C CD2 . LEU B 1 126 ? 17.266  -29.925 17.924  1.00 17.08 ? 337 LEU B CD2 1 
ATOM   3725 N N   . GLY B 1 127 ? 20.624  -26.756 15.141  1.00 16.90 ? 338 GLY B N   1 
ATOM   3726 C CA  . GLY B 1 127 ? 20.883  -25.552 14.367  1.00 18.10 ? 338 GLY B CA  1 
ATOM   3727 C C   . GLY B 1 127 ? 20.550  -25.751 12.906  1.00 18.84 ? 338 GLY B C   1 
ATOM   3728 O O   . GLY B 1 127 ? 19.861  -24.931 12.289  1.00 18.64 ? 338 GLY B O   1 
ATOM   3729 N N   . ASP B 1 128 ? 21.042  -26.851 12.356  1.00 19.89 ? 339 ASP B N   1 
ATOM   3730 C CA  . ASP B 1 128 ? 20.784  -27.150 10.946  1.00 20.62 ? 339 ASP B CA  1 
ATOM   3731 C C   . ASP B 1 128 ? 19.329  -27.540 10.648  1.00 20.73 ? 339 ASP B C   1 
ATOM   3732 O O   . ASP B 1 128 ? 18.831  -27.284 9.555   1.00 20.71 ? 339 ASP B O   1 
ATOM   3733 C CB  . ASP B 1 128 ? 21.789  -28.184 10.449  1.00 20.45 ? 339 ASP B CB  1 
ATOM   3734 C CG  . ASP B 1 128 ? 23.170  -27.576 10.252  1.00 23.67 ? 339 ASP B CG  1 
ATOM   3735 O OD1 . ASP B 1 128 ? 23.281  -26.350 10.373  1.00 27.92 ? 339 ASP B OD1 1 
ATOM   3736 O OD2 . ASP B 1 128 ? 24.141  -28.295 9.975   1.00 28.10 ? 339 ASP B OD2 1 
ATOM   3737 N N   . ILE B 1 129 ? 18.640  -28.123 11.625  1.00 20.08 ? 340 ILE B N   1 
ATOM   3738 C CA  . ILE B 1 129 ? 17.244  -28.446 11.481  1.00 19.81 ? 340 ILE B CA  1 
ATOM   3739 C C   . ILE B 1 129 ? 16.424  -27.161 11.518  1.00 20.90 ? 340 ILE B C   1 
ATOM   3740 O O   . ILE B 1 129 ? 15.468  -27.003 10.761  1.00 21.75 ? 340 ILE B O   1 
ATOM   3741 C CB  . ILE B 1 129 ? 16.772  -29.484 12.557  1.00 19.65 ? 340 ILE B CB  1 
ATOM   3742 C CG1 . ILE B 1 129 ? 17.368  -30.847 12.240  1.00 18.96 ? 340 ILE B CG1 1 
ATOM   3743 C CG2 . ILE B 1 129 ? 15.228  -29.524 12.660  1.00 17.54 ? 340 ILE B CG2 1 
ATOM   3744 C CD1 . ILE B 1 129 ? 17.320  -31.910 13.403  1.00 19.90 ? 340 ILE B CD1 1 
ATOM   3745 N N   . GLU B 1 130 ? 16.811  -26.217 12.358  1.00 21.18 ? 341 GLU B N   1 
ATOM   3746 C CA  . GLU B 1 130 ? 16.085  -24.933 12.418  1.00 22.17 ? 341 GLU B CA  1 
ATOM   3747 C C   . GLU B 1 130 ? 16.147  -24.294 11.020  1.00 22.14 ? 341 GLU B C   1 
ATOM   3748 O O   . GLU B 1 130 ? 15.147  -23.747 10.518  1.00 21.73 ? 341 GLU B O   1 
ATOM   3749 C CB  . GLU B 1 130 ? 16.704  -24.016 13.500  1.00 21.97 ? 341 GLU B CB  1 
ATOM   3750 C CG  . GLU B 1 130 ? 15.983  -22.674 13.744  1.00 24.06 ? 341 GLU B CG  1 
ATOM   3751 C CD  . GLU B 1 130 ? 16.332  -21.573 12.739  1.00 28.11 ? 341 GLU B CD  1 
ATOM   3752 O OE1 . GLU B 1 130 ? 17.419  -21.589 12.104  1.00 26.59 ? 341 GLU B OE1 1 
ATOM   3753 O OE2 . GLU B 1 130 ? 15.489  -20.665 12.609  1.00 30.47 ? 341 GLU B OE2 1 
ATOM   3754 N N   . ILE B 1 131 ? 17.335  -24.384 10.404  1.00 22.04 ? 342 ILE B N   1 
ATOM   3755 C CA  . ILE B 1 131 ? 17.540  -23.930 9.022   1.00 22.34 ? 342 ILE B CA  1 
ATOM   3756 C C   . ILE B 1 131 ? 16.674  -24.664 8.027   1.00 22.02 ? 342 ILE B C   1 
ATOM   3757 O O   . ILE B 1 131 ? 15.962  -24.053 7.228   1.00 23.19 ? 342 ILE B O   1 
ATOM   3758 C CB  . ILE B 1 131 ? 19.047  -24.005 8.572   1.00 22.03 ? 342 ILE B CB  1 
ATOM   3759 C CG1 . ILE B 1 131 ? 19.852  -22.890 9.279   1.00 21.47 ? 342 ILE B CG1 1 
ATOM   3760 C CG2 . ILE B 1 131 ? 19.146  -23.798 7.080   1.00 22.04 ? 342 ILE B CG2 1 
ATOM   3761 C CD1 . ILE B 1 131 ? 21.315  -23.148 9.400   1.00 20.06 ? 342 ILE B CD1 1 
ATOM   3762 N N   . ALA B 1 132 ? 16.730  -25.976 8.074   1.00 21.93 ? 343 ALA B N   1 
ATOM   3763 C CA  . ALA B 1 132 ? 15.988  -26.810 7.135   1.00 22.13 ? 343 ALA B CA  1 
ATOM   3764 C C   . ALA B 1 132 ? 14.473  -26.549 7.169   1.00 23.42 ? 343 ALA B C   1 
ATOM   3765 O O   . ALA B 1 132 ? 13.825  -26.412 6.113   1.00 23.68 ? 343 ALA B O   1 
ATOM   3766 C CB  . ALA B 1 132 ? 16.296  -28.273 7.422   1.00 22.33 ? 343 ALA B CB  1 
ATOM   3767 N N   . ILE B 1 133 ? 13.899  -26.460 8.362   1.00 23.54 ? 344 ILE B N   1 
ATOM   3768 C CA  . ILE B 1 133 ? 12.447  -26.301 8.464   1.00 25.57 ? 344 ILE B CA  1 
ATOM   3769 C C   . ILE B 1 133 ? 12.001  -24.991 7.825   1.00 26.74 ? 344 ILE B C   1 
ATOM   3770 O O   . ILE B 1 133 ? 10.962  -24.932 7.174   1.00 28.32 ? 344 ILE B O   1 
ATOM   3771 C CB  . ILE B 1 133 ? 11.966  -26.389 9.949   1.00 25.11 ? 344 ILE B CB  1 
ATOM   3772 C CG1 . ILE B 1 133 ? 12.179  -27.816 10.465  1.00 26.12 ? 344 ILE B CG1 1 
ATOM   3773 C CG2 . ILE B 1 133 ? 10.495  -25.962 10.063  1.00 26.20 ? 344 ILE B CG2 1 
ATOM   3774 C CD1 . ILE B 1 133 ? 11.921  -28.032 11.947  1.00 25.81 ? 344 ILE B CD1 1 
ATOM   3775 N N   . LYS B 1 134 ? 12.801  -23.947 7.986   1.00 27.95 ? 345 LYS B N   1 
ATOM   3776 C CA  . LYS B 1 134 ? 12.505  -22.671 7.347   1.00 29.96 ? 345 LYS B CA  1 
ATOM   3777 C C   . LYS B 1 134 ? 12.696  -22.763 5.822   1.00 30.87 ? 345 LYS B C   1 
ATOM   3778 O O   . LYS B 1 134 ? 11.907  -22.222 5.067   1.00 31.60 ? 345 LYS B O   1 
ATOM   3779 C CB  . LYS B 1 134 ? 13.390  -21.546 7.889   1.00 30.18 ? 345 LYS B CB  1 
ATOM   3780 C CG  . LYS B 1 134 ? 12.887  -20.870 9.159   1.00 32.29 ? 345 LYS B CG  1 
ATOM   3781 C CD  . LYS B 1 134 ? 13.960  -19.947 9.746   1.00 34.29 ? 345 LYS B CD  1 
ATOM   3782 C CE  . LYS B 1 134 ? 13.466  -19.323 11.047  1.00 37.48 ? 345 LYS B CE  1 
ATOM   3783 N NZ  . LYS B 1 134 ? 13.093  -20.359 12.072  1.00 37.84 ? 345 LYS B NZ  1 
ATOM   3784 N N   . LEU B 1 135 ? 13.763  -23.424 5.397   1.00 31.09 ? 346 LEU B N   1 
ATOM   3785 C CA  . LEU B 1 135 ? 14.063  -23.569 3.984   1.00 32.07 ? 346 LEU B CA  1 
ATOM   3786 C C   . LEU B 1 135 ? 12.981  -24.360 3.224   1.00 33.04 ? 346 LEU B C   1 
ATOM   3787 O O   . LEU B 1 135 ? 12.666  -24.000 2.101   1.00 33.89 ? 346 LEU B O   1 
ATOM   3788 C CB  . LEU B 1 135 ? 15.436  -24.222 3.801   1.00 31.02 ? 346 LEU B CB  1 
ATOM   3789 C CG  . LEU B 1 135 ? 15.916  -24.316 2.343   1.00 31.48 ? 346 LEU B CG  1 
ATOM   3790 C CD1 . LEU B 1 135 ? 17.422  -24.122 2.282   1.00 31.44 ? 346 LEU B CD1 1 
ATOM   3791 C CD2 . LEU B 1 135 ? 15.485  -25.626 1.655   1.00 27.80 ? 346 LEU B CD2 1 
ATOM   3792 N N   . VAL B 1 136 ? 12.402  -25.404 3.823   1.00 33.36 ? 347 VAL B N   1 
ATOM   3793 C CA  . VAL B 1 136 ? 11.406  -26.221 3.090   1.00 34.93 ? 347 VAL B CA  1 
ATOM   3794 C C   . VAL B 1 136 ? 9.971   -25.723 3.231   1.00 37.43 ? 347 VAL B C   1 
ATOM   3795 O O   . VAL B 1 136 ? 9.035   -26.365 2.731   1.00 38.21 ? 347 VAL B O   1 
ATOM   3796 C CB  . VAL B 1 136 ? 11.400  -27.706 3.495   1.00 34.31 ? 347 VAL B CB  1 
ATOM   3797 C CG1 . VAL B 1 136 ? 12.819  -28.270 3.492   1.00 31.66 ? 347 VAL B CG1 1 
ATOM   3798 C CG2 . VAL B 1 136 ? 10.709  -27.888 4.834   1.00 32.43 ? 347 VAL B CG2 1 
ATOM   3799 N N   . LYS B 1 137 ? 9.769   -24.599 3.904   1.00 38.94 ? 348 LYS B N   1 
ATOM   3800 C CA  . LYS B 1 137 ? 8.436   -24.018 3.896   1.00 41.70 ? 348 LYS B CA  1 
ATOM   3801 C C   . LYS B 1 137 ? 8.113   -23.509 2.452   1.00 43.10 ? 348 LYS B C   1 
ATOM   3802 O O   . LYS B 1 137 ? 8.992   -22.995 1.745   1.00 43.00 ? 348 LYS B O   1 
ATOM   3803 C CB  . LYS B 1 137 ? 8.302   -22.951 4.981   1.00 41.83 ? 348 LYS B CB  1 
ATOM   3804 C CG  . LYS B 1 137 ? 6.901   -22.356 5.047   1.00 45.58 ? 348 LYS B CG  1 
ATOM   3805 C CD  . LYS B 1 137 ? 6.484   -21.881 6.461   1.00 46.96 ? 348 LYS B CD  1 
ATOM   3806 C CE  . LYS B 1 137 ? 4.971   -21.601 6.497   1.00 48.19 ? 348 LYS B CE  1 
ATOM   3807 N NZ  . LYS B 1 137 ? 4.517   -20.766 5.322   1.00 49.00 ? 348 LYS B NZ  1 
ATOM   3808 N N   . THR B 1 138 ? 6.861   -23.690 2.026   1.00 45.40 ? 349 THR B N   1 
ATOM   3809 C CA  . THR B 1 138 ? 6.436   -23.478 0.626   1.00 46.92 ? 349 THR B CA  1 
ATOM   3810 C C   . THR B 1 138 ? 5.414   -22.337 0.411   1.00 48.43 ? 349 THR B C   1 
ATOM   3811 O O   . THR B 1 138 ? 4.741   -21.896 1.353   1.00 49.15 ? 349 THR B O   1 
ATOM   3812 C CB  . THR B 1 138 ? 5.828   -24.775 0.057   1.00 47.35 ? 349 THR B CB  1 
ATOM   3813 O OG1 . THR B 1 138 ? 4.784   -25.226 0.928   1.00 49.31 ? 349 THR B OG1 1 
ATOM   3814 C CG2 . THR B 1 138 ? 6.893   -25.885 -0.071  1.00 45.79 ? 349 THR B CG2 1 
ATOM   3815 N N   . SER B 1 142 ? 2.001   -21.820 -4.745  1.00 60.89 ? 353 SER B N   1 
ATOM   3816 C CA  . SER B 1 142 ? 2.810   -21.260 -5.832  1.00 61.02 ? 353 SER B CA  1 
ATOM   3817 C C   . SER B 1 142 ? 2.930   -22.259 -6.989  1.00 60.82 ? 353 SER B C   1 
ATOM   3818 O O   . SER B 1 142 ? 2.731   -23.466 -6.789  1.00 60.47 ? 353 SER B O   1 
ATOM   3819 C CB  . SER B 1 142 ? 4.206   -20.860 -5.327  1.00 60.31 ? 353 SER B CB  1 
ATOM   3820 O OG  . SER B 1 142 ? 5.167   -21.879 -5.574  1.00 59.85 ? 353 SER B OG  1 
ATOM   3821 N N   . PRO B 1 143 ? 3.281   -21.764 -8.199  1.00 60.85 ? 354 PRO B N   1 
ATOM   3822 C CA  . PRO B 1 143 ? 3.271   -22.635 -9.382  1.00 60.52 ? 354 PRO B CA  1 
ATOM   3823 C C   . PRO B 1 143 ? 4.476   -23.587 -9.443  1.00 58.53 ? 354 PRO B C   1 
ATOM   3824 O O   . PRO B 1 143 ? 4.513   -24.472 -10.295 1.00 58.93 ? 354 PRO B O   1 
ATOM   3825 C CB  . PRO B 1 143 ? 3.295   -21.642 -10.559 1.00 61.74 ? 354 PRO B CB  1 
ATOM   3826 C CG  . PRO B 1 143 ? 3.947   -20.377 -10.009 1.00 62.00 ? 354 PRO B CG  1 
ATOM   3827 C CD  . PRO B 1 143 ? 3.926   -20.462 -8.481  1.00 61.23 ? 354 PRO B CD  1 
ATOM   3828 N N   . GLU B 1 144 ? 5.435   -23.390 -8.540  1.00 56.03 ? 355 GLU B N   1 
ATOM   3829 C CA  . GLU B 1 144 ? 6.661   -24.180 -8.471  1.00 53.91 ? 355 GLU B CA  1 
ATOM   3830 C C   . GLU B 1 144 ? 6.469   -25.447 -7.619  1.00 51.10 ? 355 GLU B C   1 
ATOM   3831 O O   . GLU B 1 144 ? 5.858   -25.378 -6.559  1.00 50.44 ? 355 GLU B O   1 
ATOM   3832 C CB  . GLU B 1 144 ? 7.738   -23.312 -7.837  1.00 53.84 ? 355 GLU B CB  1 
ATOM   3833 C CG  . GLU B 1 144 ? 9.125   -23.589 -8.317  1.00 55.18 ? 355 GLU B CG  1 
ATOM   3834 C CD  . GLU B 1 144 ? 10.128  -22.664 -7.690  1.00 56.02 ? 355 GLU B CD  1 
ATOM   3835 O OE1 . GLU B 1 144 ? 11.198  -22.477 -8.285  1.00 58.73 ? 355 GLU B OE1 1 
ATOM   3836 O OE2 . GLU B 1 144 ? 9.853   -22.122 -6.600  1.00 57.47 ? 355 GLU B OE2 1 
ATOM   3837 N N   . HIS B 1 145 ? 6.981   -26.590 -8.093  1.00 48.34 ? 356 HIS B N   1 
ATOM   3838 C CA  . HIS B 1 145 ? 6.938   -27.856 -7.347  1.00 46.11 ? 356 HIS B CA  1 
ATOM   3839 C C   . HIS B 1 145 ? 7.773   -27.712 -6.061  1.00 43.98 ? 356 HIS B C   1 
ATOM   3840 O O   . HIS B 1 145 ? 8.813   -27.040 -6.066  1.00 42.12 ? 356 HIS B O   1 
ATOM   3841 C CB  . HIS B 1 145 ? 7.496   -29.001 -8.209  1.00 45.72 ? 356 HIS B CB  1 
ATOM   3842 C CG  . HIS B 1 145 ? 7.283   -30.374 -7.632  1.00 46.71 ? 356 HIS B CG  1 
ATOM   3843 N ND1 . HIS B 1 145 ? 8.105   -30.922 -6.665  1.00 46.34 ? 356 HIS B ND1 1 
ATOM   3844 C CD2 . HIS B 1 145 ? 6.351   -31.318 -7.905  1.00 47.54 ? 356 HIS B CD2 1 
ATOM   3845 C CE1 . HIS B 1 145 ? 7.677   -32.134 -6.358  1.00 46.07 ? 356 HIS B CE1 1 
ATOM   3846 N NE2 . HIS B 1 145 ? 6.612   -32.398 -7.096  1.00 48.46 ? 356 HIS B NE2 1 
ATOM   3847 N N   . PRO B 1 146 ? 7.316   -28.325 -4.956  1.00 42.54 ? 357 PRO B N   1 
ATOM   3848 C CA  . PRO B 1 146 ? 8.072   -28.219 -3.718  1.00 41.25 ? 357 PRO B CA  1 
ATOM   3849 C C   . PRO B 1 146 ? 9.569   -28.490 -3.882  1.00 39.77 ? 357 PRO B C   1 
ATOM   3850 O O   . PRO B 1 146 ? 10.386  -27.704 -3.384  1.00 39.05 ? 357 PRO B O   1 
ATOM   3851 C CB  . PRO B 1 146 ? 7.409   -29.279 -2.818  1.00 41.43 ? 357 PRO B CB  1 
ATOM   3852 C CG  . PRO B 1 146 ? 6.012   -29.339 -3.260  1.00 42.11 ? 357 PRO B CG  1 
ATOM   3853 C CD  . PRO B 1 146 ? 5.977   -28.892 -4.718  1.00 43.00 ? 357 PRO B CD  1 
ATOM   3854 N N   . LEU B 1 147 ? 9.917   -29.562 -4.598  1.00 38.74 ? 358 LEU B N   1 
ATOM   3855 C CA  . LEU B 1 147 ? 11.326  -29.970 -4.782  1.00 37.62 ? 358 LEU B CA  1 
ATOM   3856 C C   . LEU B 1 147 ? 12.209  -28.955 -5.508  1.00 37.67 ? 358 LEU B C   1 
ATOM   3857 O O   . LEU B 1 147 ? 13.375  -28.760 -5.121  1.00 36.39 ? 358 LEU B O   1 
ATOM   3858 C CB  . LEU B 1 147 ? 11.418  -31.319 -5.500  1.00 37.55 ? 358 LEU B CB  1 
ATOM   3859 C CG  . LEU B 1 147 ? 10.769  -32.492 -4.740  1.00 37.15 ? 358 LEU B CG  1 
ATOM   3860 C CD1 . LEU B 1 147 ? 10.851  -33.761 -5.536  1.00 34.04 ? 358 LEU B CD1 1 
ATOM   3861 C CD2 . LEU B 1 147 ? 11.364  -32.681 -3.342  1.00 33.98 ? 358 LEU B CD2 1 
ATOM   3862 N N   . ASP B 1 148 ? 11.673  -28.344 -6.575  1.00 38.23 ? 359 ASP B N   1 
ATOM   3863 C CA  . ASP B 1 148 ? 12.359  -27.267 -7.304  1.00 38.28 ? 359 ASP B CA  1 
ATOM   3864 C C   . ASP B 1 148 ? 12.582  -26.076 -6.383  1.00 37.52 ? 359 ASP B C   1 
ATOM   3865 O O   . ASP B 1 148 ? 13.619  -25.409 -6.425  1.00 36.93 ? 359 ASP B O   1 
ATOM   3866 C CB  . ASP B 1 148 ? 11.534  -26.826 -8.531  1.00 39.97 ? 359 ASP B CB  1 
ATOM   3867 C CG  . ASP B 1 148 ? 11.689  -27.779 -9.734  1.00 42.31 ? 359 ASP B CG  1 
ATOM   3868 O OD1 . ASP B 1 148 ? 12.846  -28.062 -10.148 1.00 46.19 ? 359 ASP B OD1 1 
ATOM   3869 O OD2 . ASP B 1 148 ? 10.660  -28.227 -10.283 1.00 44.29 ? 359 ASP B OD2 1 
ATOM   3870 N N   . GLN B 1 149 ? 11.585  -25.826 -5.547  1.00 36.98 ? 360 GLN B N   1 
ATOM   3871 C CA  . GLN B 1 149 ? 11.596  -24.723 -4.601  1.00 37.23 ? 360 GLN B CA  1 
ATOM   3872 C C   . GLN B 1 149 ? 12.705  -24.930 -3.522  1.00 34.98 ? 360 GLN B C   1 
ATOM   3873 O O   . GLN B 1 149 ? 13.499  -24.020 -3.262  1.00 34.57 ? 360 GLN B O   1 
ATOM   3874 C CB  . GLN B 1 149 ? 10.159  -24.559 -4.040  1.00 37.77 ? 360 GLN B CB  1 
ATOM   3875 C CG  . GLN B 1 149 ? 9.961   -23.725 -2.769  1.00 40.96 ? 360 GLN B CG  1 
ATOM   3876 C CD  . GLN B 1 149 ? 8.701   -22.847 -2.811  1.00 44.89 ? 360 GLN B CD  1 
ATOM   3877 O OE1 . GLN B 1 149 ? 8.619   -21.850 -2.090  1.00 47.55 ? 360 GLN B OE1 1 
ATOM   3878 N NE2 . GLN B 1 149 ? 7.741   -23.190 -3.681  1.00 46.17 ? 360 GLN B NE2 1 
ATOM   3879 N N   . HIS B 1 150 ? 12.800  -26.141 -2.971  1.00 33.53 ? 361 HIS B N   1 
ATOM   3880 C CA  . HIS B 1 150 ? 13.850  -26.482 -1.988  1.00 31.54 ? 361 HIS B CA  1 
ATOM   3881 C C   . HIS B 1 150 ? 15.230  -26.396 -2.616  1.00 31.18 ? 361 HIS B C   1 
ATOM   3882 O O   . HIS B 1 150 ? 16.172  -25.802 -2.046  1.00 30.83 ? 361 HIS B O   1 
ATOM   3883 C CB  . HIS B 1 150 ? 13.693  -27.903 -1.440  1.00 31.05 ? 361 HIS B CB  1 
ATOM   3884 C CG  . HIS B 1 150 ? 12.346  -28.205 -0.871  1.00 29.62 ? 361 HIS B CG  1 
ATOM   3885 N ND1 . HIS B 1 150 ? 11.462  -27.226 -0.485  1.00 30.10 ? 361 HIS B ND1 1 
ATOM   3886 C CD2 . HIS B 1 150 ? 11.743  -29.387 -0.602  1.00 29.26 ? 361 HIS B CD2 1 
ATOM   3887 C CE1 . HIS B 1 150 ? 10.353  -27.790 -0.036  1.00 31.62 ? 361 HIS B CE1 1 
ATOM   3888 N NE2 . HIS B 1 150 ? 10.505  -29.104 -0.087  1.00 30.83 ? 361 HIS B NE2 1 
ATOM   3889 N N   . TYR B 1 151 ? 15.370  -27.022 -3.776  1.00 30.35 ? 362 TYR B N   1 
ATOM   3890 C CA  . TYR B 1 151 ? 16.614  -26.950 -4.490  1.00 30.61 ? 362 TYR B CA  1 
ATOM   3891 C C   . TYR B 1 151 ? 17.061  -25.508 -4.587  1.00 30.92 ? 362 TYR B C   1 
ATOM   3892 O O   . TYR B 1 151 ? 18.169  -25.182 -4.202  1.00 29.21 ? 362 TYR B O   1 
ATOM   3893 C CB  . TYR B 1 151 ? 16.494  -27.566 -5.900  1.00 31.41 ? 362 TYR B CB  1 
ATOM   3894 C CG  . TYR B 1 151 ? 17.795  -27.591 -6.690  1.00 31.41 ? 362 TYR B CG  1 
ATOM   3895 C CD1 . TYR B 1 151 ? 18.920  -28.187 -6.177  1.00 30.91 ? 362 TYR B CD1 1 
ATOM   3896 C CD2 . TYR B 1 151 ? 17.873  -27.052 -7.972  1.00 36.03 ? 362 TYR B CD2 1 
ATOM   3897 C CE1 . TYR B 1 151 ? 20.107  -28.236 -6.901  1.00 31.09 ? 362 TYR B CE1 1 
ATOM   3898 C CE2 . TYR B 1 151 ? 19.062  -27.113 -8.723  1.00 34.23 ? 362 TYR B CE2 1 
ATOM   3899 C CZ  . TYR B 1 151 ? 20.166  -27.688 -8.176  1.00 30.95 ? 362 TYR B CZ  1 
ATOM   3900 O OH  . TYR B 1 151 ? 21.346  -27.747 -8.865  1.00 26.72 ? 362 TYR B OH  1 
ATOM   3901 N N   . ARG B 1 152 ? 16.187  -24.648 -5.108  1.00 33.02 ? 363 ARG B N   1 
ATOM   3902 C CA  . ARG B 1 152 ? 16.541  -23.265 -5.386  1.00 34.49 ? 363 ARG B CA  1 
ATOM   3903 C C   . ARG B 1 152 ? 16.976  -22.557 -4.119  1.00 34.27 ? 363 ARG B C   1 
ATOM   3904 O O   . ARG B 1 152 ? 18.005  -21.881 -4.123  1.00 34.65 ? 363 ARG B O   1 
ATOM   3905 C CB  . ARG B 1 152 ? 15.366  -22.526 -6.025  1.00 35.88 ? 363 ARG B CB  1 
ATOM   3906 C CG  . ARG B 1 152 ? 15.617  -21.016 -6.294  1.00 38.86 ? 363 ARG B CG  1 
ATOM   3907 C CD  . ARG B 1 152 ? 14.533  -20.391 -7.193  1.00 42.78 ? 363 ARG B CD  1 
ATOM   3908 N NE  . ARG B 1 152 ? 13.165  -20.666 -6.728  1.00 45.63 ? 363 ARG B NE  1 
ATOM   3909 C CZ  . ARG B 1 152 ? 12.575  -20.075 -5.687  1.00 47.56 ? 363 ARG B CZ  1 
ATOM   3910 N NH1 . ARG B 1 152 ? 11.334  -20.402 -5.344  1.00 47.91 ? 363 ARG B NH1 1 
ATOM   3911 N NH2 . ARG B 1 152 ? 13.216  -19.159 -4.971  1.00 49.09 ? 363 ARG B NH2 1 
ATOM   3912 N N   . ASN B 1 153 ? 16.223  -22.749 -3.035  1.00 34.15 ? 364 ASN B N   1 
ATOM   3913 C CA  . ASN B 1 153 ? 16.552  -22.142 -1.740  1.00 34.15 ? 364 ASN B CA  1 
ATOM   3914 C C   . ASN B 1 153 ? 17.890  -22.583 -1.162  1.00 33.07 ? 364 ASN B C   1 
ATOM   3915 O O   . ASN B 1 153 ? 18.426  -21.898 -0.296  1.00 32.91 ? 364 ASN B O   1 
ATOM   3916 C CB  . ASN B 1 153 ? 15.456  -22.395 -0.702  1.00 34.58 ? 364 ASN B CB  1 
ATOM   3917 C CG  . ASN B 1 153 ? 14.141  -21.732 -1.069  1.00 37.89 ? 364 ASN B CG  1 
ATOM   3918 O OD1 . ASN B 1 153 ? 14.120  -20.831 -1.882  1.00 42.11 ? 364 ASN B OD1 1 
ATOM   3919 N ND2 . ASN B 1 153 ? 13.035  -22.199 -0.483  1.00 41.33 ? 364 ASN B ND2 1 
ATOM   3920 N N   . LEU B 1 154 ? 18.442  -23.703 -1.631  1.00 31.78 ? 365 LEU B N   1 
ATOM   3921 C CA  . LEU B 1 154 ? 19.769  -24.131 -1.180  1.00 30.42 ? 365 LEU B CA  1 
ATOM   3922 C C   . LEU B 1 154 ? 20.872  -23.222 -1.689  1.00 30.29 ? 365 LEU B C   1 
ATOM   3923 O O   . LEU B 1 154 ? 21.944  -23.159 -1.083  1.00 29.01 ? 365 LEU B O   1 
ATOM   3924 C CB  . LEU B 1 154 ? 20.127  -25.533 -1.681  1.00 29.88 ? 365 LEU B CB  1 
ATOM   3925 C CG  . LEU B 1 154 ? 19.473  -26.771 -1.146  1.00 29.30 ? 365 LEU B CG  1 
ATOM   3926 C CD1 . LEU B 1 154 ? 20.104  -28.002 -1.813  1.00 25.67 ? 365 LEU B CD1 1 
ATOM   3927 C CD2 . LEU B 1 154 ? 19.610  -26.812 0.384   1.00 29.81 ? 365 LEU B CD2 1 
ATOM   3928 N N   . HIS B 1 155 ? 20.632  -22.574 -2.830  1.00 30.13 ? 366 HIS B N   1 
ATOM   3929 C CA  . HIS B 1 155 ? 21.643  -21.770 -3.493  1.00 30.57 ? 366 HIS B CA  1 
ATOM   3930 C C   . HIS B 1 155 ? 22.933  -22.536 -3.604  1.00 29.75 ? 366 HIS B C   1 
ATOM   3931 O O   . HIS B 1 155 ? 24.021  -22.044 -3.280  1.00 28.76 ? 366 HIS B O   1 
ATOM   3932 C CB  . HIS B 1 155 ? 21.817  -20.427 -2.798  1.00 31.57 ? 366 HIS B CB  1 
ATOM   3933 C CG  . HIS B 1 155 ? 20.613  -19.552 -2.915  1.00 34.26 ? 366 HIS B CG  1 
ATOM   3934 N ND1 . HIS B 1 155 ? 19.568  -19.603 -2.016  1.00 38.12 ? 366 HIS B ND1 1 
ATOM   3935 C CD2 . HIS B 1 155 ? 20.277  -18.616 -3.829  1.00 37.02 ? 366 HIS B CD2 1 
ATOM   3936 C CE1 . HIS B 1 155 ? 18.638  -18.737 -2.373  1.00 37.38 ? 366 HIS B CE1 1 
ATOM   3937 N NE2 . HIS B 1 155 ? 19.049  -18.115 -3.463  1.00 39.65 ? 366 HIS B NE2 1 
ATOM   3938 N N   . CYS B 1 156 ? 22.778  -23.754 -4.125  1.00 29.26 ? 367 CYS B N   1 
ATOM   3939 C CA  . CYS B 1 156 ? 23.853  -24.688 -4.251  1.00 28.83 ? 367 CYS B CA  1 
ATOM   3940 C C   . CYS B 1 156 ? 23.503  -25.625 -5.385  1.00 29.43 ? 367 CYS B C   1 
ATOM   3941 O O   . CYS B 1 156 ? 22.538  -26.411 -5.292  1.00 29.42 ? 367 CYS B O   1 
ATOM   3942 C CB  . CYS B 1 156 ? 24.026  -25.474 -2.955  1.00 28.43 ? 367 CYS B CB  1 
ATOM   3943 S SG  . CYS B 1 156 ? 25.474  -26.477 -3.003  1.00 28.40 ? 367 CYS B SG  1 
ATOM   3944 N N   . ALA B 1 157 ? 24.261  -25.506 -6.462  1.00 29.00 ? 368 ALA B N   1 
ATOM   3945 C CA  . ALA B 1 157 ? 24.064  -26.345 -7.627  1.00 29.77 ? 368 ALA B CA  1 
ATOM   3946 C C   . ALA B 1 157 ? 24.499  -27.771 -7.290  1.00 28.61 ? 368 ALA B C   1 
ATOM   3947 O O   . ALA B 1 157 ? 25.527  -27.994 -6.636  1.00 28.49 ? 368 ALA B O   1 
ATOM   3948 C CB  . ALA B 1 157 ? 24.851  -25.782 -8.854  1.00 29.88 ? 368 ALA B CB  1 
ATOM   3949 N N   . LEU B 1 158 ? 23.683  -28.722 -7.711  1.00 28.02 ? 369 LEU B N   1 
ATOM   3950 C CA  . LEU B 1 158 ? 23.963  -30.118 -7.533  1.00 27.37 ? 369 LEU B CA  1 
ATOM   3951 C C   . LEU B 1 158 ? 23.726  -30.820 -8.880  1.00 28.54 ? 369 LEU B C   1 
ATOM   3952 O O   . LEU B 1 158 ? 22.582  -30.930 -9.317  1.00 28.47 ? 369 LEU B O   1 
ATOM   3953 C CB  . LEU B 1 158 ? 23.021  -30.687 -6.467  1.00 26.00 ? 369 LEU B CB  1 
ATOM   3954 C CG  . LEU B 1 158 ? 23.190  -30.138 -5.039  1.00 24.34 ? 369 LEU B CG  1 
ATOM   3955 C CD1 . LEU B 1 158 ? 22.108  -30.710 -4.126  1.00 22.62 ? 369 LEU B CD1 1 
ATOM   3956 C CD2 . LEU B 1 158 ? 24.597  -30.459 -4.511  1.00 21.84 ? 369 LEU B CD2 1 
ATOM   3957 N N   . ARG B 1 159 ? 24.779  -31.312 -9.523  1.00 29.03 ? 370 ARG B N   1 
ATOM   3958 C CA  . ARG B 1 159 ? 24.586  -31.959 -10.836 1.00 30.82 ? 370 ARG B CA  1 
ATOM   3959 C C   . ARG B 1 159 ? 25.101  -33.414 -10.909 1.00 30.28 ? 370 ARG B C   1 
ATOM   3960 O O   . ARG B 1 159 ? 26.258  -33.709 -10.595 1.00 30.39 ? 370 ARG B O   1 
ATOM   3961 C CB  . ARG B 1 159 ? 25.107  -31.080 -12.011 1.00 31.54 ? 370 ARG B CB  1 
ATOM   3962 C CG  . ARG B 1 159 ? 26.151  -30.040 -11.684 1.00 33.35 ? 370 ARG B CG  1 
ATOM   3963 C CD  . ARG B 1 159 ? 26.419  -29.077 -12.866 1.00 35.75 ? 370 ARG B CD  1 
ATOM   3964 N NE  . ARG B 1 159 ? 25.938  -27.712 -12.580 1.00 38.87 ? 370 ARG B NE  1 
ATOM   3965 C CZ  . ARG B 1 159 ? 26.650  -26.743 -11.985 1.00 37.12 ? 370 ARG B CZ  1 
ATOM   3966 N NH1 . ARG B 1 159 ? 27.904  -26.930 -11.597 1.00 36.79 ? 370 ARG B NH1 1 
ATOM   3967 N NH2 . ARG B 1 159 ? 26.091  -25.571 -11.766 1.00 40.15 ? 370 ARG B NH2 1 
ATOM   3968 N N   . PRO B 1 160 ? 24.219  -34.336 -11.299 1.00 30.77 ? 371 PRO B N   1 
ATOM   3969 C CA  . PRO B 1 160 ? 24.593  -35.738 -11.247 1.00 30.69 ? 371 PRO B CA  1 
ATOM   3970 C C   . PRO B 1 160 ? 25.699  -35.980 -12.245 1.00 31.08 ? 371 PRO B C   1 
ATOM   3971 O O   . PRO B 1 160 ? 25.709  -35.352 -13.283 1.00 32.14 ? 371 PRO B O   1 
ATOM   3972 C CB  . PRO B 1 160 ? 23.313  -36.472 -11.669 1.00 30.61 ? 371 PRO B CB  1 
ATOM   3973 C CG  . PRO B 1 160 ? 22.248  -35.434 -11.708 1.00 31.98 ? 371 PRO B CG  1 
ATOM   3974 C CD  . PRO B 1 160 ? 22.922  -34.145 -11.970 1.00 31.17 ? 371 PRO B CD  1 
ATOM   3975 N N   . LEU B 1 161 ? 26.649  -36.835 -11.913 1.00 31.15 ? 372 LEU B N   1 
ATOM   3976 C CA  . LEU B 1 161 ? 27.764  -37.081 -12.804 1.00 31.25 ? 372 LEU B CA  1 
ATOM   3977 C C   . LEU B 1 161 ? 27.611  -38.484 -13.368 1.00 32.43 ? 372 LEU B C   1 
ATOM   3978 O O   . LEU B 1 161 ? 27.023  -39.390 -12.737 1.00 30.65 ? 372 LEU B O   1 
ATOM   3979 C CB  . LEU B 1 161 ? 29.113  -36.930 -12.090 1.00 31.17 ? 372 LEU B CB  1 
ATOM   3980 C CG  . LEU B 1 161 ? 29.542  -35.508 -11.688 1.00 31.24 ? 372 LEU B CG  1 
ATOM   3981 C CD1 . LEU B 1 161 ? 30.891  -35.578 -10.977 1.00 29.49 ? 372 LEU B CD1 1 
ATOM   3982 C CD2 . LEU B 1 161 ? 29.583  -34.521 -12.926 1.00 32.50 ? 372 LEU B CD2 1 
ATOM   3983 N N   . ASP B 1 162 ? 28.143  -38.652 -14.575 1.00 33.07 ? 373 ASP B N   1 
ATOM   3984 C CA  . ASP B 1 162 ? 28.061  -39.909 -15.283 1.00 33.74 ? 373 ASP B CA  1 
ATOM   3985 C C   . ASP B 1 162 ? 28.909  -40.934 -14.557 1.00 32.57 ? 373 ASP B C   1 
ATOM   3986 O O   . ASP B 1 162 ? 30.028  -40.643 -14.197 1.00 33.25 ? 373 ASP B O   1 
ATOM   3987 C CB  . ASP B 1 162 ? 28.577  -39.670 -16.710 1.00 34.99 ? 373 ASP B CB  1 
ATOM   3988 C CG  . ASP B 1 162 ? 28.262  -40.811 -17.640 1.00 37.33 ? 373 ASP B CG  1 
ATOM   3989 O OD1 . ASP B 1 162 ? 27.770  -41.866 -17.183 1.00 37.88 ? 373 ASP B OD1 1 
ATOM   3990 O OD2 . ASP B 1 162 ? 28.505  -40.641 -18.850 1.00 43.87 ? 373 ASP B OD2 1 
ATOM   3991 N N   . HIS B 1 163 ? 28.380  -42.120 -14.323 1.00 32.82 ? 374 HIS B N   1 
ATOM   3992 C CA  . HIS B 1 163 ? 29.126  -43.163 -13.602 1.00 33.44 ? 374 HIS B CA  1 
ATOM   3993 C C   . HIS B 1 163 ? 30.312  -43.758 -14.400 1.00 34.16 ? 374 HIS B C   1 
ATOM   3994 O O   . HIS B 1 163 ? 31.165  -44.452 -13.846 1.00 33.81 ? 374 HIS B O   1 
ATOM   3995 C CB  . HIS B 1 163 ? 28.177  -44.278 -13.149 1.00 33.63 ? 374 HIS B CB  1 
ATOM   3996 C CG  . HIS B 1 163 ? 27.269  -43.898 -12.010 1.00 35.26 ? 374 HIS B CG  1 
ATOM   3997 N ND1 . HIS B 1 163 ? 26.912  -44.790 -11.020 1.00 36.03 ? 374 HIS B ND1 1 
ATOM   3998 C CD2 . HIS B 1 163 ? 26.637  -42.734 -11.713 1.00 34.89 ? 374 HIS B CD2 1 
ATOM   3999 C CE1 . HIS B 1 163 ? 26.102  -44.195 -10.163 1.00 34.81 ? 374 HIS B CE1 1 
ATOM   4000 N NE2 . HIS B 1 163 ? 25.901  -42.954 -10.570 1.00 35.95 ? 374 HIS B NE2 1 
ATOM   4001 N N   . GLU B 1 164 ? 30.352  -43.472 -15.702 1.00 35.21 ? 375 GLU B N   1 
ATOM   4002 C CA  . GLU B 1 164 ? 31.473  -43.859 -16.570 1.00 35.84 ? 375 GLU B CA  1 
ATOM   4003 C C   . GLU B 1 164 ? 32.493  -42.745 -16.740 1.00 34.89 ? 375 GLU B C   1 
ATOM   4004 O O   . GLU B 1 164 ? 33.430  -42.880 -17.506 1.00 34.64 ? 375 GLU B O   1 
ATOM   4005 C CB  . GLU B 1 164 ? 30.930  -44.245 -17.945 1.00 37.08 ? 375 GLU B CB  1 
ATOM   4006 C CG  . GLU B 1 164 ? 29.773  -45.213 -17.843 1.00 40.16 ? 375 GLU B CG  1 
ATOM   4007 C CD  . GLU B 1 164 ? 29.579  -46.023 -19.099 1.00 45.67 ? 375 GLU B CD  1 
ATOM   4008 O OE1 . GLU B 1 164 ? 29.455  -45.427 -20.201 1.00 47.03 ? 375 GLU B OE1 1 
ATOM   4009 O OE2 . GLU B 1 164 ? 29.570  -47.265 -18.975 1.00 50.23 ? 375 GLU B OE2 1 
ATOM   4010 N N   . SER B 1 165 ? 32.312  -41.631 -16.030 1.00 33.64 ? 376 SER B N   1 
ATOM   4011 C CA  . SER B 1 165 ? 33.250  -40.524 -16.143 1.00 32.44 ? 376 SER B CA  1 
ATOM   4012 C C   . SER B 1 165 ? 34.518  -40.847 -15.384 1.00 31.34 ? 376 SER B C   1 
ATOM   4013 O O   . SER B 1 165 ? 34.528  -41.679 -14.470 1.00 30.57 ? 376 SER B O   1 
ATOM   4014 C CB  . SER B 1 165 ? 32.649  -39.231 -15.580 1.00 33.06 ? 376 SER B CB  1 
ATOM   4015 O OG  . SER B 1 165 ? 32.385  -39.345 -14.175 1.00 30.05 ? 376 SER B OG  1 
ATOM   4016 N N   . TYR B 1 166 ? 35.559  -40.120 -15.750 1.00 30.41 ? 377 TYR B N   1 
ATOM   4017 C CA  . TYR B 1 166 ? 36.831  -40.095 -15.058 1.00 29.83 ? 377 TYR B CA  1 
ATOM   4018 C C   . TYR B 1 166 ? 36.721  -39.712 -13.574 1.00 29.95 ? 377 TYR B C   1 
ATOM   4019 O O   . TYR B 1 166 ? 37.308  -40.353 -12.696 1.00 29.40 ? 377 TYR B O   1 
ATOM   4020 C CB  . TYR B 1 166 ? 37.754  -39.093 -15.767 1.00 29.93 ? 377 TYR B CB  1 
ATOM   4021 C CG  . TYR B 1 166 ? 39.106  -39.058 -15.127 1.00 27.66 ? 377 TYR B CG  1 
ATOM   4022 C CD1 . TYR B 1 166 ? 39.945  -40.172 -15.180 1.00 25.37 ? 377 TYR B CD1 1 
ATOM   4023 C CD2 . TYR B 1 166 ? 39.526  -37.951 -14.403 1.00 23.97 ? 377 TYR B CD2 1 
ATOM   4024 C CE1 . TYR B 1 166 ? 41.218  -40.150 -14.580 1.00 24.95 ? 377 TYR B CE1 1 
ATOM   4025 C CE2 . TYR B 1 166 ? 40.770  -37.927 -13.792 1.00 23.71 ? 377 TYR B CE2 1 
ATOM   4026 C CZ  . TYR B 1 166 ? 41.604  -39.032 -13.882 1.00 25.20 ? 377 TYR B CZ  1 
ATOM   4027 O OH  . TYR B 1 166 ? 42.809  -39.009 -13.253 1.00 31.82 ? 377 TYR B OH  1 
ATOM   4028 N N   . GLU B 1 167 ? 35.943  -38.667 -13.301 1.00 30.80 ? 378 GLU B N   1 
ATOM   4029 C CA  . GLU B 1 167 ? 35.796  -38.134 -11.947 1.00 30.10 ? 378 GLU B CA  1 
ATOM   4030 C C   . GLU B 1 167 ? 35.186  -39.240 -11.052 1.00 29.39 ? 378 GLU B C   1 
ATOM   4031 O O   . GLU B 1 167 ? 35.681  -39.497 -9.927  1.00 28.78 ? 378 GLU B O   1 
ATOM   4032 C CB  . GLU B 1 167 ? 34.945  -36.848 -11.941 1.00 30.67 ? 378 GLU B CB  1 
ATOM   4033 C CG  . GLU B 1 167 ? 35.345  -35.703 -12.910 1.00 35.26 ? 378 GLU B CG  1 
ATOM   4034 C CD  . GLU B 1 167 ? 35.106  -36.051 -14.435 1.00 40.97 ? 378 GLU B CD  1 
ATOM   4035 O OE1 . GLU B 1 167 ? 34.029  -36.586 -14.791 1.00 44.98 ? 378 GLU B OE1 1 
ATOM   4036 O OE2 . GLU B 1 167 ? 35.997  -35.801 -15.281 1.00 45.06 ? 378 GLU B OE2 1 
ATOM   4037 N N   . PHE B 1 168 ? 34.151  -39.918 -11.565 1.00 28.27 ? 379 PHE B N   1 
ATOM   4038 C CA  . PHE B 1 168 ? 33.517  -41.030 -10.846 1.00 28.05 ? 379 PHE B CA  1 
ATOM   4039 C C   . PHE B 1 168 ? 34.510  -42.116 -10.511 1.00 28.43 ? 379 PHE B C   1 
ATOM   4040 O O   . PHE B 1 168 ? 34.513  -42.628 -9.395  1.00 27.51 ? 379 PHE B O   1 
ATOM   4041 C CB  . PHE B 1 168 ? 32.366  -41.621 -11.648 1.00 28.35 ? 379 PHE B CB  1 
ATOM   4042 C CG  . PHE B 1 168 ? 31.486  -42.548 -10.869 1.00 29.21 ? 379 PHE B CG  1 
ATOM   4043 C CD1 . PHE B 1 168 ? 30.327  -42.082 -10.267 1.00 30.21 ? 379 PHE B CD1 1 
ATOM   4044 C CD2 . PHE B 1 168 ? 31.813  -43.889 -10.730 1.00 31.11 ? 379 PHE B CD2 1 
ATOM   4045 C CE1 . PHE B 1 168 ? 29.507  -42.939 -9.532  1.00 30.15 ? 379 PHE B CE1 1 
ATOM   4046 C CE2 . PHE B 1 168 ? 31.012  -44.758 -9.985  1.00 31.53 ? 379 PHE B CE2 1 
ATOM   4047 C CZ  . PHE B 1 168 ? 29.856  -44.286 -9.387  1.00 32.99 ? 379 PHE B CZ  1 
ATOM   4048 N N   . LYS B 1 169 ? 35.342  -42.485 -11.486 1.00 28.95 ? 380 LYS B N   1 
ATOM   4049 C CA  . LYS B 1 169 ? 36.341  -43.524 -11.281 1.00 28.89 ? 380 LYS B CA  1 
ATOM   4050 C C   . LYS B 1 169 ? 37.321  -43.132 -10.191 1.00 27.90 ? 380 LYS B C   1 
ATOM   4051 O O   . LYS B 1 169 ? 37.631  -43.945 -9.332  1.00 28.45 ? 380 LYS B O   1 
ATOM   4052 C CB  . LYS B 1 169 ? 37.136  -43.811 -12.565 1.00 30.13 ? 380 LYS B CB  1 
ATOM   4053 C CG  . LYS B 1 169 ? 38.138  -44.947 -12.421 1.00 30.53 ? 380 LYS B CG  1 
ATOM   4054 C CD  . LYS B 1 169 ? 39.412  -44.718 -13.230 1.00 31.20 ? 380 LYS B CD  1 
ATOM   4055 C CE  . LYS B 1 169 ? 40.290  -43.671 -12.628 1.00 32.30 ? 380 LYS B CE  1 
ATOM   4056 N NZ  . LYS B 1 169 ? 41.657  -43.707 -13.192 1.00 29.79 ? 380 LYS B NZ  1 
ATOM   4057 N N   . VAL B 1 170 ? 37.824  -41.911 -10.260 1.00 27.13 ? 381 VAL B N   1 
ATOM   4058 C CA  . VAL B 1 170 ? 38.803  -41.408 -9.280  1.00 27.26 ? 381 VAL B CA  1 
ATOM   4059 C C   . VAL B 1 170 ? 38.171  -41.340 -7.873  1.00 26.02 ? 381 VAL B C   1 
ATOM   4060 O O   . VAL B 1 170 ? 38.760  -41.782 -6.880  1.00 26.20 ? 381 VAL B O   1 
ATOM   4061 C CB  . VAL B 1 170 ? 39.329  -39.999 -9.681  1.00 27.48 ? 381 VAL B CB  1 
ATOM   4062 C CG1 . VAL B 1 170 ? 40.298  -39.402 -8.625  1.00 26.88 ? 381 VAL B CG1 1 
ATOM   4063 C CG2 . VAL B 1 170 ? 39.989  -40.057 -11.025 1.00 28.92 ? 381 VAL B CG2 1 
ATOM   4064 N N   . ILE B 1 171 ? 36.960  -40.817 -7.805  1.00 25.44 ? 382 ILE B N   1 
ATOM   4065 C CA  . ILE B 1 171 ? 36.290  -40.663 -6.497  1.00 24.31 ? 382 ILE B CA  1 
ATOM   4066 C C   . ILE B 1 171 ? 35.938  -42.030 -5.924  1.00 24.29 ? 382 ILE B C   1 
ATOM   4067 O O   . ILE B 1 171 ? 36.161  -42.260 -4.750  1.00 23.43 ? 382 ILE B O   1 
ATOM   4068 C CB  . ILE B 1 171 ? 35.104  -39.732 -6.612  1.00 23.80 ? 382 ILE B CB  1 
ATOM   4069 C CG1 . ILE B 1 171 ? 35.632  -38.317 -6.926  1.00 23.82 ? 382 ILE B CG1 1 
ATOM   4070 C CG2 . ILE B 1 171 ? 34.260  -39.778 -5.340  1.00 22.35 ? 382 ILE B CG2 1 
ATOM   4071 C CD1 . ILE B 1 171 ? 34.586  -37.363 -7.395  1.00 22.93 ? 382 ILE B CD1 1 
ATOM   4072 N N   . SER B 1 172 ? 35.453  -42.961 -6.755  1.00 24.90 ? 383 SER B N   1 
ATOM   4073 C CA  . SER B 1 172 ? 35.296  -44.370 -6.308  1.00 25.57 ? 383 SER B CA  1 
ATOM   4074 C C   . SER B 1 172 ? 36.570  -44.959 -5.772  1.00 25.40 ? 383 SER B C   1 
ATOM   4075 O O   . SER B 1 172 ? 36.530  -45.606 -4.744  1.00 25.08 ? 383 SER B O   1 
ATOM   4076 C CB  . SER B 1 172 ? 34.780  -45.304 -7.407  1.00 26.33 ? 383 SER B CB  1 
ATOM   4077 O OG  . SER B 1 172 ? 33.514  -44.896 -7.859  1.00 28.93 ? 383 SER B OG  1 
ATOM   4078 N N   . GLN B 1 173 ? 37.697  -44.788 -6.470  1.00 25.45 ? 384 GLN B N   1 
ATOM   4079 C CA  . GLN B 1 173 ? 38.988  -45.317 -5.959  1.00 26.05 ? 384 GLN B CA  1 
ATOM   4080 C C   . GLN B 1 173 ? 39.384  -44.659 -4.644  1.00 25.50 ? 384 GLN B C   1 
ATOM   4081 O O   . GLN B 1 173 ? 40.017  -45.280 -3.811  1.00 27.21 ? 384 GLN B O   1 
ATOM   4082 C CB  . GLN B 1 173 ? 40.162  -45.142 -6.967  1.00 26.03 ? 384 GLN B CB  1 
ATOM   4083 C CG  . GLN B 1 173 ? 40.122  -46.148 -8.099  1.00 27.41 ? 384 GLN B CG  1 
ATOM   4084 C CD  . GLN B 1 173 ? 41.264  -46.042 -9.117  1.00 26.59 ? 384 GLN B CD  1 
ATOM   4085 O OE1 . GLN B 1 173 ? 42.180  -45.234 -8.999  1.00 28.47 ? 384 GLN B OE1 1 
ATOM   4086 N NE2 . GLN B 1 173 ? 41.186  -46.875 -10.134 1.00 25.63 ? 384 GLN B NE2 1 
ATOM   4087 N N   . TYR B 1 174 ? 39.089  -43.376 -4.504  1.00 25.12 ? 385 TYR B N   1 
ATOM   4088 C CA  . TYR B 1 174 ? 39.457  -42.618 -3.301  1.00 24.35 ? 385 TYR B CA  1 
ATOM   4089 C C   . TYR B 1 174 ? 38.618  -43.180 -2.174  1.00 23.86 ? 385 TYR B C   1 
ATOM   4090 O O   . TYR B 1 174 ? 39.141  -43.506 -1.109  1.00 23.93 ? 385 TYR B O   1 
ATOM   4091 C CB  . TYR B 1 174 ? 39.182  -41.124 -3.536  1.00 24.30 ? 385 TYR B CB  1 
ATOM   4092 C CG  . TYR B 1 174 ? 39.686  -40.117 -2.510  1.00 22.28 ? 385 TYR B CG  1 
ATOM   4093 C CD1 . TYR B 1 174 ? 40.618  -40.437 -1.560  1.00 24.05 ? 385 TYR B CD1 1 
ATOM   4094 C CD2 . TYR B 1 174 ? 39.221  -38.822 -2.539  1.00 23.04 ? 385 TYR B CD2 1 
ATOM   4095 C CE1 . TYR B 1 174 ? 41.070  -39.492 -0.644  1.00 24.78 ? 385 TYR B CE1 1 
ATOM   4096 C CE2 . TYR B 1 174 ? 39.674  -37.879 -1.664  1.00 23.05 ? 385 TYR B CE2 1 
ATOM   4097 C CZ  . TYR B 1 174 ? 40.586  -38.215 -0.707  1.00 22.36 ? 385 TYR B CZ  1 
ATOM   4098 O OH  . TYR B 1 174 ? 41.000  -37.274 0.179   1.00 21.96 ? 385 TYR B OH  1 
ATOM   4099 N N   . LEU B 1 175 ? 37.321  -43.308 -2.435  1.00 23.61 ? 386 LEU B N   1 
ATOM   4100 C CA  . LEU B 1 175 ? 36.377  -43.866 -1.457  1.00 23.67 ? 386 LEU B CA  1 
ATOM   4101 C C   . LEU B 1 175 ? 36.823  -45.238 -0.919  1.00 24.23 ? 386 LEU B C   1 
ATOM   4102 O O   . LEU B 1 175 ? 36.908  -45.434 0.295   1.00 23.68 ? 386 LEU B O   1 
ATOM   4103 C CB  . LEU B 1 175 ? 34.985  -44.011 -2.096  1.00 23.78 ? 386 LEU B CB  1 
ATOM   4104 C CG  . LEU B 1 175 ? 33.851  -44.601 -1.241  1.00 22.74 ? 386 LEU B CG  1 
ATOM   4105 C CD1 . LEU B 1 175 ? 33.603  -43.694 -0.002  1.00 20.14 ? 386 LEU B CD1 1 
ATOM   4106 C CD2 . LEU B 1 175 ? 32.611  -44.709 -2.122  1.00 19.84 ? 386 LEU B CD2 1 
ATOM   4107 N N   . GLN B 1 176 ? 37.096  -46.176 -1.833  1.00 24.02 ? 387 GLN B N   1 
ATOM   4108 C CA  . GLN B 1 176 ? 37.453  -47.546 -1.457  1.00 24.64 ? 387 GLN B CA  1 
ATOM   4109 C C   . GLN B 1 176 ? 38.852  -47.638 -0.876  1.00 24.63 ? 387 GLN B C   1 
ATOM   4110 O O   . GLN B 1 176 ? 39.047  -48.258 0.194   1.00 23.65 ? 387 GLN B O   1 
ATOM   4111 C CB  . GLN B 1 176 ? 37.303  -48.518 -2.663  1.00 24.99 ? 387 GLN B CB  1 
ATOM   4112 C CG  . GLN B 1 176 ? 35.852  -48.650 -3.185  1.00 26.59 ? 387 GLN B CG  1 
ATOM   4113 C CD  . GLN B 1 176 ? 34.823  -48.917 -2.063  1.00 27.21 ? 387 GLN B CD  1 
ATOM   4114 O OE1 . GLN B 1 176 ? 35.122  -49.601 -1.098  1.00 27.87 ? 387 GLN B OE1 1 
ATOM   4115 N NE2 . GLN B 1 176 ? 33.635  -48.363 -2.192  1.00 26.34 ? 387 GLN B NE2 1 
ATOM   4116 N N   . SER B 1 177 ? 39.819  -46.989 -1.539  1.00 24.57 ? 388 SER B N   1 
ATOM   4117 C CA  . SER B 1 177 ? 41.242  -47.179 -1.189  1.00 25.26 ? 388 SER B CA  1 
ATOM   4118 C C   . SER B 1 177 ? 41.640  -46.507 0.127   1.00 25.04 ? 388 SER B C   1 
ATOM   4119 O O   . SER B 1 177 ? 42.680  -46.830 0.715   1.00 24.78 ? 388 SER B O   1 
ATOM   4120 C CB  . SER B 1 177 ? 42.178  -46.693 -2.328  1.00 25.61 ? 388 SER B CB  1 
ATOM   4121 O OG  . SER B 1 177 ? 42.267  -45.262 -2.368  1.00 25.12 ? 388 SER B OG  1 
ATOM   4122 N N   . THR B 1 178 ? 40.848  -45.531 0.568   1.00 25.36 ? 389 THR B N   1 
ATOM   4123 C CA  . THR B 1 178 ? 41.135  -44.867 1.836   1.00 24.88 ? 389 THR B CA  1 
ATOM   4124 C C   . THR B 1 178 ? 40.167  -45.326 2.932   1.00 25.54 ? 389 THR B C   1 
ATOM   4125 O O   . THR B 1 178 ? 40.054  -44.678 3.965   1.00 24.82 ? 389 THR B O   1 
ATOM   4126 C CB  . THR B 1 178 ? 41.189  -43.316 1.693   1.00 24.84 ? 389 THR B CB  1 
ATOM   4127 O OG1 . THR B 1 178 ? 39.906  -42.797 1.318   1.00 22.77 ? 389 THR B OG1 1 
ATOM   4128 C CG2 . THR B 1 178 ? 42.260  -42.908 0.630   1.00 24.49 ? 389 THR B CG2 1 
ATOM   4129 N N   . HIS B 1 179 ? 39.490  -46.460 2.728   1.00 26.10 ? 390 HIS B N   1 
ATOM   4130 C CA  . HIS B 1 179 ? 38.727  -47.066 3.835   1.00 25.99 ? 390 HIS B CA  1 
ATOM   4131 C C   . HIS B 1 179 ? 39.719  -47.654 4.845   1.00 27.13 ? 390 HIS B C   1 
ATOM   4132 O O   . HIS B 1 179 ? 40.419  -48.615 4.544   1.00 26.87 ? 390 HIS B O   1 
ATOM   4133 C CB  . HIS B 1 179 ? 37.748  -48.133 3.347   1.00 25.84 ? 390 HIS B CB  1 
ATOM   4134 C CG  . HIS B 1 179 ? 36.686  -48.471 4.345   1.00 24.43 ? 390 HIS B CG  1 
ATOM   4135 N ND1 . HIS B 1 179 ? 35.338  -48.376 4.060   1.00 23.96 ? 390 HIS B ND1 1 
ATOM   4136 C CD2 . HIS B 1 179 ? 36.774  -48.879 5.635   1.00 23.23 ? 390 HIS B CD2 1 
ATOM   4137 C CE1 . HIS B 1 179 ? 34.643  -48.692 5.139   1.00 25.38 ? 390 HIS B CE1 1 
ATOM   4138 N NE2 . HIS B 1 179 ? 35.490  -48.991 6.114   1.00 23.64 ? 390 HIS B NE2 1 
ATOM   4139 N N   . ALA B 1 180 ? 39.746  -47.087 6.056   1.00 27.28 ? 391 ALA B N   1 
ATOM   4140 C CA  . ALA B 1 180 ? 40.677  -47.499 7.093   1.00 28.28 ? 391 ALA B CA  1 
ATOM   4141 C C   . ALA B 1 180 ? 40.395  -48.922 7.570   1.00 29.86 ? 391 ALA B C   1 
ATOM   4142 O O   . ALA B 1 180 ? 39.241  -49.341 7.622   1.00 30.29 ? 391 ALA B O   1 
ATOM   4143 C CB  . ALA B 1 180 ? 40.606  -46.545 8.278   1.00 27.47 ? 391 ALA B CB  1 
ATOM   4144 N N   . PRO B 1 181 ? 41.453  -49.650 7.961   1.00 31.77 ? 392 PRO B N   1 
ATOM   4145 C CA  . PRO B 1 181 ? 41.287  -51.035 8.417   1.00 32.60 ? 392 PRO B CA  1 
ATOM   4146 C C   . PRO B 1 181 ? 40.673  -51.155 9.798   1.00 32.18 ? 392 PRO B C   1 
ATOM   4147 O O   . PRO B 1 181 ? 40.093  -52.188 10.099  1.00 32.46 ? 392 PRO B O   1 
ATOM   4148 C CB  . PRO B 1 181 ? 42.724  -51.584 8.426   1.00 33.69 ? 392 PRO B CB  1 
ATOM   4149 C CG  . PRO B 1 181 ? 43.601  -50.383 8.559   1.00 33.55 ? 392 PRO B CG  1 
ATOM   4150 C CD  . PRO B 1 181 ? 42.880  -49.259 7.870   1.00 32.49 ? 392 PRO B CD  1 
ATOM   4151 N N   . THR B 1 182 ? 40.796  -50.126 10.635  1.00 31.65 ? 393 THR B N   1 
ATOM   4152 C CA  . THR B 1 182 ? 40.144  -50.164 11.928  1.00 31.65 ? 393 THR B CA  1 
ATOM   4153 C C   . THR B 1 182 ? 38.641  -49.792 11.849  1.00 30.23 ? 393 THR B C   1 
ATOM   4154 O O   . THR B 1 182 ? 37.958  -49.793 12.872  1.00 30.63 ? 393 THR B O   1 
ATOM   4155 C CB  . THR B 1 182 ? 40.881  -49.324 12.978  1.00 32.25 ? 393 THR B CB  1 
ATOM   4156 O OG1 . THR B 1 182 ? 40.780  -47.945 12.648  1.00 32.76 ? 393 THR B OG1 1 
ATOM   4157 C CG2 . THR B 1 182 ? 42.396  -49.730 13.048  1.00 34.37 ? 393 THR B CG2 1 
ATOM   4158 N N   . HIS B 1 183 ? 38.138  -49.498 10.646  1.00 28.16 ? 394 HIS B N   1 
ATOM   4159 C CA  . HIS B 1 183 ? 36.726  -49.194 10.419  1.00 26.53 ? 394 HIS B CA  1 
ATOM   4160 C C   . HIS B 1 183 ? 36.060  -50.348 9.648   1.00 26.18 ? 394 HIS B C   1 
ATOM   4161 O O   . HIS B 1 183 ? 35.431  -50.182 8.609   1.00 26.52 ? 394 HIS B O   1 
ATOM   4162 C CB  . HIS B 1 183 ? 36.588  -47.825 9.728   1.00 25.20 ? 394 HIS B CB  1 
ATOM   4163 C CG  . HIS B 1 183 ? 37.256  -46.702 10.483  1.00 25.62 ? 394 HIS B CG  1 
ATOM   4164 N ND1 . HIS B 1 183 ? 37.793  -45.591 9.865   1.00 22.68 ? 394 HIS B ND1 1 
ATOM   4165 C CD2 . HIS B 1 183 ? 37.478  -46.530 11.813  1.00 23.93 ? 394 HIS B CD2 1 
ATOM   4166 C CE1 . HIS B 1 183 ? 38.308  -44.787 10.779  1.00 23.66 ? 394 HIS B CE1 1 
ATOM   4167 N NE2 . HIS B 1 183 ? 38.146  -45.342 11.967  1.00 22.08 ? 394 HIS B NE2 1 
ATOM   4168 N N   . SER B 1 184 ? 36.171  -51.541 10.196  1.00 26.49 ? 395 SER B N   1 
ATOM   4169 C CA  . SER B 1 184 ? 35.828  -52.730 9.446   1.00 26.05 ? 395 SER B CA  1 
ATOM   4170 C C   . SER B 1 184 ? 34.411  -53.189 9.725   1.00 25.60 ? 395 SER B C   1 
ATOM   4171 O O   . SER B 1 184 ? 34.009  -54.280 9.238   1.00 24.26 ? 395 SER B O   1 
ATOM   4172 C CB  . SER B 1 184 ? 36.791  -53.834 9.791   1.00 26.72 ? 395 SER B CB  1 
ATOM   4173 O OG  . SER B 1 184 ? 36.482  -54.288 11.089  1.00 29.18 ? 395 SER B OG  1 
ATOM   4174 N N   . ASP B 1 185 ? 33.647  -52.371 10.469  1.00 24.13 ? 396 ASP B N   1 
ATOM   4175 C CA  . ASP B 1 185 ? 32.255  -52.685 10.756  1.00 23.54 ? 396 ASP B CA  1 
ATOM   4176 C C   . ASP B 1 185 ? 31.280  -52.447 9.597   1.00 22.70 ? 396 ASP B C   1 
ATOM   4177 O O   . ASP B 1 185 ? 30.118  -52.851 9.657   1.00 22.00 ? 396 ASP B O   1 
ATOM   4178 C CB  . ASP B 1 185 ? 31.778  -51.985 12.043  1.00 24.26 ? 396 ASP B CB  1 
ATOM   4179 C CG  . ASP B 1 185 ? 31.920  -50.474 11.998  1.00 24.06 ? 396 ASP B CG  1 
ATOM   4180 O OD1 . ASP B 1 185 ? 33.056  -49.962 11.919  1.00 26.12 ? 396 ASP B OD1 1 
ATOM   4181 O OD2 . ASP B 1 185 ? 30.885  -49.789 12.100  1.00 27.63 ? 396 ASP B OD2 1 
ATOM   4182 N N   . TYR B 1 186 ? 31.754  -51.821 8.528   1.00 22.23 ? 397 TYR B N   1 
ATOM   4183 C CA  . TYR B 1 186 ? 30.996  -51.665 7.256   1.00 21.28 ? 397 TYR B CA  1 
ATOM   4184 C C   . TYR B 1 186 ? 31.941  -51.503 6.078   1.00 20.67 ? 397 TYR B C   1 
ATOM   4185 O O   . TYR B 1 186 ? 33.109  -51.154 6.250   1.00 20.49 ? 397 TYR B O   1 
ATOM   4186 C CB  . TYR B 1 186 ? 30.128  -50.398 7.274   1.00 20.99 ? 397 TYR B CB  1 
ATOM   4187 C CG  . TYR B 1 186 ? 30.895  -49.092 7.553   1.00 21.34 ? 397 TYR B CG  1 
ATOM   4188 C CD1 . TYR B 1 186 ? 31.231  -48.218 6.510   1.00 23.78 ? 397 TYR B CD1 1 
ATOM   4189 C CD2 . TYR B 1 186 ? 31.288  -48.742 8.834   1.00 20.57 ? 397 TYR B CD2 1 
ATOM   4190 C CE1 . TYR B 1 186 ? 31.894  -47.019 6.737   1.00 22.46 ? 397 TYR B CE1 1 
ATOM   4191 C CE2 . TYR B 1 186 ? 31.981  -47.534 9.092   1.00 21.29 ? 397 TYR B CE2 1 
ATOM   4192 C CZ  . TYR B 1 186 ? 32.276  -46.677 8.027   1.00 23.67 ? 397 TYR B CZ  1 
ATOM   4193 O OH  . TYR B 1 186 ? 32.948  -45.498 8.210   1.00 21.86 ? 397 TYR B OH  1 
ATOM   4194 N N   . THR B 1 187 ? 31.396  -51.723 4.892   1.00 20.67 ? 398 THR B N   1 
ATOM   4195 C CA  . THR B 1 187 ? 31.971  -51.260 3.642   1.00 21.39 ? 398 THR B CA  1 
ATOM   4196 C C   . THR B 1 187 ? 30.964  -50.251 3.060   1.00 20.90 ? 398 THR B C   1 
ATOM   4197 O O   . THR B 1 187 ? 29.831  -50.107 3.565   1.00 19.56 ? 398 THR B O   1 
ATOM   4198 C CB  . THR B 1 187 ? 32.179  -52.427 2.655   1.00 22.03 ? 398 THR B CB  1 
ATOM   4199 O OG1 . THR B 1 187 ? 30.900  -52.960 2.299   1.00 21.76 ? 398 THR B OG1 1 
ATOM   4200 C CG2 . THR B 1 187 ? 33.064  -53.540 3.311   1.00 21.56 ? 398 THR B CG2 1 
ATOM   4201 N N   . MET B 1 188 ? 31.391  -49.521 2.032   1.00 20.70 ? 399 MET B N   1 
ATOM   4202 C CA  . MET B 1 188 ? 30.561  -48.505 1.421   1.00 20.18 ? 399 MET B CA  1 
ATOM   4203 C C   . MET B 1 188 ? 30.429  -48.784 -0.071  1.00 21.69 ? 399 MET B C   1 
ATOM   4204 O O   . MET B 1 188 ? 31.427  -49.160 -0.742  1.00 20.68 ? 399 MET B O   1 
ATOM   4205 C CB  . MET B 1 188 ? 31.205  -47.138 1.603   1.00 19.53 ? 399 MET B CB  1 
ATOM   4206 C CG  . MET B 1 188 ? 31.190  -46.631 3.007   1.00 20.83 ? 399 MET B CG  1 
ATOM   4207 S SD  . MET B 1 188 ? 31.871  -44.986 3.252   1.00 21.91 ? 399 MET B SD  1 
ATOM   4208 C CE  . MET B 1 188 ? 33.638  -45.312 3.321   1.00 23.23 ? 399 MET B CE  1 
ATOM   4209 N N   . THR B 1 189 ? 29.223  -48.543 -0.575  1.00 21.32 ? 400 THR B N   1 
ATOM   4210 C CA  . THR B 1 189 ? 28.920  -48.644 -1.962  1.00 23.25 ? 400 THR B CA  1 
ATOM   4211 C C   . THR B 1 189 ? 28.464  -47.276 -2.443  1.00 23.02 ? 400 THR B C   1 
ATOM   4212 O O   . THR B 1 189 ? 27.551  -46.667 -1.866  1.00 23.66 ? 400 THR B O   1 
ATOM   4213 C CB  . THR B 1 189 ? 27.808  -49.682 -2.191  1.00 23.82 ? 400 THR B CB  1 
ATOM   4214 O OG1 . THR B 1 189 ? 28.307  -50.969 -1.828  1.00 25.79 ? 400 THR B OG1 1 
ATOM   4215 C CG2 . THR B 1 189 ? 27.333  -49.722 -3.664  1.00 24.49 ? 400 THR B CG2 1 
ATOM   4216 N N   . LEU B 1 190 ? 29.124  -46.775 -3.477  1.00 22.81 ? 401 LEU B N   1 
ATOM   4217 C CA  . LEU B 1 190 ? 28.774  -45.481 -4.029  1.00 22.58 ? 401 LEU B CA  1 
ATOM   4218 C C   . LEU B 1 190 ? 27.567  -45.605 -4.927  1.00 23.19 ? 401 LEU B C   1 
ATOM   4219 O O   . LEU B 1 190 ? 27.683  -46.164 -6.012  1.00 24.01 ? 401 LEU B O   1 
ATOM   4220 C CB  . LEU B 1 190 ? 29.940  -44.953 -4.832  1.00 22.24 ? 401 LEU B CB  1 
ATOM   4221 C CG  . LEU B 1 190 ? 29.811  -43.547 -5.425  1.00 22.81 ? 401 LEU B CG  1 
ATOM   4222 C CD1 . LEU B 1 190 ? 29.214  -42.581 -4.390  1.00 20.89 ? 401 LEU B CD1 1 
ATOM   4223 C CD2 . LEU B 1 190 ? 31.171  -43.048 -5.918  1.00 20.79 ? 401 LEU B CD2 1 
ATOM   4224 N N   . LEU B 1 191 ? 26.427  -45.059 -4.522  1.00 22.98 ? 402 LEU B N   1 
ATOM   4225 C CA  . LEU B 1 191 ? 25.173  -45.147 -5.310  1.00 24.03 ? 402 LEU B CA  1 
ATOM   4226 C C   . LEU B 1 191 ? 25.048  -44.022 -6.334  1.00 25.02 ? 402 LEU B C   1 
ATOM   4227 O O   . LEU B 1 191 ? 24.508  -44.210 -7.407  1.00 25.94 ? 402 LEU B O   1 
ATOM   4228 C CB  . LEU B 1 191 ? 23.931  -45.067 -4.409  1.00 24.08 ? 402 LEU B CB  1 
ATOM   4229 C CG  . LEU B 1 191 ? 23.655  -46.142 -3.333  1.00 24.96 ? 402 LEU B CG  1 
ATOM   4230 C CD1 . LEU B 1 191 ? 22.440  -45.763 -2.444  1.00 23.34 ? 402 LEU B CD1 1 
ATOM   4231 C CD2 . LEU B 1 191 ? 23.454  -47.513 -3.957  1.00 22.95 ? 402 LEU B CD2 1 
ATOM   4232 N N   . ASP B 1 192 ? 25.515  -42.825 -5.995  1.00 25.15 ? 403 ASP B N   1 
ATOM   4233 C CA  . ASP B 1 192 ? 25.473  -41.721 -6.945  1.00 25.69 ? 403 ASP B CA  1 
ATOM   4234 C C   . ASP B 1 192 ? 26.436  -40.620 -6.522  1.00 24.78 ? 403 ASP B C   1 
ATOM   4235 O O   . ASP B 1 192 ? 26.935  -40.646 -5.406  1.00 23.78 ? 403 ASP B O   1 
ATOM   4236 C CB  . ASP B 1 192 ? 24.036  -41.179 -7.108  1.00 26.19 ? 403 ASP B CB  1 
ATOM   4237 C CG  . ASP B 1 192 ? 23.659  -40.918 -8.579  1.00 30.85 ? 403 ASP B CG  1 
ATOM   4238 O OD1 . ASP B 1 192 ? 24.595  -40.797 -9.441  1.00 34.56 ? 403 ASP B OD1 1 
ATOM   4239 O OD2 . ASP B 1 192 ? 22.428  -40.840 -8.871  1.00 31.59 ? 403 ASP B OD2 1 
ATOM   4240 N N   . LEU B 1 193 ? 26.666  -39.674 -7.437  1.00 25.39 ? 404 LEU B N   1 
ATOM   4241 C CA  . LEU B 1 193 ? 27.688  -38.642 -7.349  1.00 25.46 ? 404 LEU B CA  1 
ATOM   4242 C C   . LEU B 1 193 ? 27.160  -37.364 -7.993  1.00 26.36 ? 404 LEU B C   1 
ATOM   4243 O O   . LEU B 1 193 ? 26.606  -37.394 -9.109  1.00 27.83 ? 404 LEU B O   1 
ATOM   4244 C CB  . LEU B 1 193 ? 28.973  -39.108 -8.033  1.00 26.01 ? 404 LEU B CB  1 
ATOM   4245 C CG  . LEU B 1 193 ? 30.274  -38.295 -7.938  1.00 26.23 ? 404 LEU B CG  1 
ATOM   4246 C CD1 . LEU B 1 193 ? 30.755  -38.196 -6.532  1.00 26.85 ? 404 LEU B CD1 1 
ATOM   4247 C CD2 . LEU B 1 193 ? 31.386  -38.936 -8.819  1.00 25.87 ? 404 LEU B CD2 1 
ATOM   4248 N N   . PHE B 1 194 ? 27.308  -36.255 -7.270  1.00 25.46 ? 405 PHE B N   1 
ATOM   4249 C CA  . PHE B 1 194 ? 26.832  -34.956 -7.700  1.00 26.11 ? 405 PHE B CA  1 
ATOM   4250 C C   . PHE B 1 194 ? 27.999  -33.990 -7.592  1.00 26.44 ? 405 PHE B C   1 
ATOM   4251 O O   . PHE B 1 194 ? 28.812  -34.078 -6.667  1.00 26.57 ? 405 PHE B O   1 
ATOM   4252 C CB  . PHE B 1 194 ? 25.670  -34.470 -6.837  1.00 26.09 ? 405 PHE B CB  1 
ATOM   4253 C CG  . PHE B 1 194 ? 24.521  -35.427 -6.780  1.00 25.11 ? 405 PHE B CG  1 
ATOM   4254 C CD1 . PHE B 1 194 ? 23.409  -35.247 -7.596  1.00 26.90 ? 405 PHE B CD1 1 
ATOM   4255 C CD2 . PHE B 1 194 ? 24.550  -36.512 -5.925  1.00 24.95 ? 405 PHE B CD2 1 
ATOM   4256 C CE1 . PHE B 1 194 ? 22.346  -36.133 -7.553  1.00 26.10 ? 405 PHE B CE1 1 
ATOM   4257 C CE2 . PHE B 1 194 ? 23.498  -37.412 -5.902  1.00 25.71 ? 405 PHE B CE2 1 
ATOM   4258 C CZ  . PHE B 1 194 ? 22.393  -37.218 -6.707  1.00 25.59 ? 405 PHE B CZ  1 
ATOM   4259 N N   . GLU B 1 195 ? 28.124  -33.112 -8.578  1.00 26.91 ? 406 GLU B N   1 
ATOM   4260 C CA  . GLU B 1 195 ? 29.091  -32.020 -8.508  1.00 27.63 ? 406 GLU B CA  1 
ATOM   4261 C C   . GLU B 1 195 ? 28.447  -30.959 -7.668  1.00 26.23 ? 406 GLU B C   1 
ATOM   4262 O O   . GLU B 1 195 ? 27.269  -30.687 -7.832  1.00 26.33 ? 406 GLU B O   1 
ATOM   4263 C CB  . GLU B 1 195 ? 29.371  -31.468 -9.914  1.00 28.67 ? 406 GLU B CB  1 
ATOM   4264 C CG  . GLU B 1 195 ? 30.065  -30.102 -9.957  1.00 32.18 ? 406 GLU B CG  1 
ATOM   4265 C CD  . GLU B 1 195 ? 30.312  -29.659 -11.408 1.00 38.60 ? 406 GLU B CD  1 
ATOM   4266 O OE1 . GLU B 1 195 ? 29.872  -28.545 -11.746 1.00 41.29 ? 406 GLU B OE1 1 
ATOM   4267 O OE2 . GLU B 1 195 ? 30.889  -30.456 -12.203 1.00 40.62 ? 406 GLU B OE2 1 
ATOM   4268 N N   . VAL B 1 196 ? 29.186  -30.335 -6.769  1.00 25.90 ? 407 VAL B N   1 
ATOM   4269 C CA  . VAL B 1 196 ? 28.557  -29.301 -5.908  1.00 25.08 ? 407 VAL B CA  1 
ATOM   4270 C C   . VAL B 1 196 ? 29.153  -27.949 -6.284  1.00 24.76 ? 407 VAL B C   1 
ATOM   4271 O O   . VAL B 1 196 ? 30.353  -27.847 -6.394  1.00 24.78 ? 407 VAL B O   1 
ATOM   4272 C CB  . VAL B 1 196 ? 28.796  -29.591 -4.436  1.00 25.04 ? 407 VAL B CB  1 
ATOM   4273 C CG1 . VAL B 1 196 ? 28.362  -28.373 -3.524  1.00 23.63 ? 407 VAL B CG1 1 
ATOM   4274 C CG2 . VAL B 1 196 ? 28.113  -30.884 -4.020  1.00 24.29 ? 407 VAL B CG2 1 
ATOM   4275 N N   . GLU B 1 197 ? 28.320  -26.945 -6.523  1.00 25.46 ? 408 GLU B N   1 
ATOM   4276 C CA  . GLU B 1 197 ? 28.798  -25.580 -6.762  1.00 27.41 ? 408 GLU B CA  1 
ATOM   4277 C C   . GLU B 1 197 ? 28.044  -24.625 -5.862  1.00 28.28 ? 408 GLU B C   1 
ATOM   4278 O O   . GLU B 1 197 ? 26.965  -24.133 -6.208  1.00 28.14 ? 408 GLU B O   1 
ATOM   4279 C CB  . GLU B 1 197 ? 28.672  -25.158 -8.246  1.00 28.92 ? 408 GLU B CB  1 
ATOM   4280 C CG  . GLU B 1 197 ? 29.328  -23.809 -8.537  1.00 31.01 ? 408 GLU B CG  1 
ATOM   4281 C CD  . GLU B 1 197 ? 29.362  -23.439 -10.015 1.00 36.40 ? 408 GLU B CD  1 
ATOM   4282 O OE1 . GLU B 1 197 ? 29.792  -22.301 -10.342 1.00 38.67 ? 408 GLU B OE1 1 
ATOM   4283 O OE2 . GLU B 1 197 ? 28.949  -24.270 -10.855 1.00 40.63 ? 408 GLU B OE2 1 
ATOM   4284 N N   . LYS B 1 198 ? 28.606  -24.382 -4.677  1.00 28.84 ? 409 LYS B N   1 
ATOM   4285 C CA  . LYS B 1 198 ? 27.954  -23.508 -3.717  1.00 29.71 ? 409 LYS B CA  1 
ATOM   4286 C C   . LYS B 1 198 ? 28.154  -22.064 -4.147  1.00 30.57 ? 409 LYS B C   1 
ATOM   4287 O O   . LYS B 1 198 ? 29.273  -21.633 -4.313  1.00 31.50 ? 409 LYS B O   1 
ATOM   4288 C CB  . LYS B 1 198 ? 28.507  -23.730 -2.298  1.00 28.94 ? 409 LYS B CB  1 
ATOM   4289 C CG  . LYS B 1 198 ? 27.931  -22.806 -1.225  1.00 30.01 ? 409 LYS B CG  1 
ATOM   4290 C CD  . LYS B 1 198 ? 26.436  -22.814 -1.209  1.00 32.18 ? 409 LYS B CD  1 
ATOM   4291 C CE  . LYS B 1 198 ? 25.874  -21.757 -0.260  1.00 34.86 ? 409 LYS B CE  1 
ATOM   4292 N NZ  . LYS B 1 198 ? 24.378  -21.637 -0.394  1.00 35.44 ? 409 LYS B NZ  1 
ATOM   4293 N N   . ASP B 1 199 ? 27.050  -21.348 -4.314  1.00 32.14 ? 410 ASP B N   1 
ATOM   4294 C CA  . ASP B 1 199 ? 27.031  -19.917 -4.592  1.00 34.56 ? 410 ASP B CA  1 
ATOM   4295 C C   . ASP B 1 199 ? 28.116  -19.178 -3.820  1.00 34.20 ? 410 ASP B C   1 
ATOM   4296 O O   . ASP B 1 199 ? 28.109  -19.201 -2.600  1.00 33.09 ? 410 ASP B O   1 
ATOM   4297 C CB  . ASP B 1 199 ? 25.666  -19.339 -4.169  1.00 35.48 ? 410 ASP B CB  1 
ATOM   4298 C CG  . ASP B 1 199 ? 24.567  -19.582 -5.205  1.00 39.56 ? 410 ASP B CG  1 
ATOM   4299 O OD1 . ASP B 1 199 ? 24.626  -20.577 -5.973  1.00 46.53 ? 410 ASP B OD1 1 
ATOM   4300 O OD2 . ASP B 1 199 ? 23.621  -18.761 -5.260  1.00 45.28 ? 410 ASP B OD2 1 
ATOM   4301 N N   . GLY B 1 200 ? 29.054  -18.555 -4.528  1.00 34.54 ? 411 GLY B N   1 
ATOM   4302 C CA  . GLY B 1 200 ? 30.009  -17.634 -3.887  1.00 34.26 ? 411 GLY B CA  1 
ATOM   4303 C C   . GLY B 1 200 ? 31.293  -18.256 -3.373  1.00 33.90 ? 411 GLY B C   1 
ATOM   4304 O O   . GLY B 1 200 ? 32.258  -17.537 -3.094  1.00 34.14 ? 411 GLY B O   1 
ATOM   4305 N N   . GLU B 1 201 ? 31.335  -19.587 -3.257  1.00 32.71 ? 412 GLU B N   1 
ATOM   4306 C CA  . GLU B 1 201 ? 32.531  -20.270 -2.746  1.00 32.15 ? 412 GLU B CA  1 
ATOM   4307 C C   . GLU B 1 201 ? 33.715  -20.196 -3.686  1.00 32.68 ? 412 GLU B C   1 
ATOM   4308 O O   . GLU B 1 201 ? 34.850  -20.067 -3.245  1.00 32.42 ? 412 GLU B O   1 
ATOM   4309 C CB  . GLU B 1 201 ? 32.253  -21.768 -2.456  1.00 32.23 ? 412 GLU B CB  1 
ATOM   4310 C CG  . GLU B 1 201 ? 31.581  -22.021 -1.102  1.00 31.29 ? 412 GLU B CG  1 
ATOM   4311 C CD  . GLU B 1 201 ? 31.771  -23.439 -0.589  1.00 30.36 ? 412 GLU B CD  1 
ATOM   4312 O OE1 . GLU B 1 201 ? 31.918  -24.375 -1.404  1.00 27.32 ? 412 GLU B OE1 1 
ATOM   4313 O OE2 . GLU B 1 201 ? 31.751  -23.599 0.650   1.00 29.85 ? 412 GLU B OE2 1 
ATOM   4314 N N   . LYS B 1 202 ? 33.459  -20.331 -4.980  1.00 33.08 ? 413 LYS B N   1 
ATOM   4315 C CA  . LYS B 1 202 ? 34.530  -20.331 -5.960  1.00 34.62 ? 413 LYS B CA  1 
ATOM   4316 C C   . LYS B 1 202 ? 35.287  -19.000 -5.917  1.00 35.07 ? 413 LYS B C   1 
ATOM   4317 O O   . LYS B 1 202 ? 36.511  -18.983 -5.946  1.00 36.11 ? 413 LYS B O   1 
ATOM   4318 C CB  . LYS B 1 202 ? 33.945  -20.595 -7.360  1.00 35.15 ? 413 LYS B CB  1 
ATOM   4319 C CG  . LYS B 1 202 ? 34.946  -20.725 -8.492  1.00 38.02 ? 413 LYS B CG  1 
ATOM   4320 C CD  . LYS B 1 202 ? 34.242  -21.293 -9.761  1.00 41.52 ? 413 LYS B CD  1 
ATOM   4321 C CE  . LYS B 1 202 ? 35.180  -21.417 -10.944 1.00 43.12 ? 413 LYS B CE  1 
ATOM   4322 N NZ  . LYS B 1 202 ? 35.718  -20.079 -11.315 1.00 43.89 ? 413 LYS B NZ  1 
ATOM   4323 N N   . GLU B 1 203 ? 34.550  -17.904 -5.787  1.00 35.39 ? 414 GLU B N   1 
ATOM   4324 C CA  . GLU B 1 203 ? 35.131  -16.548 -5.831  1.00 36.97 ? 414 GLU B CA  1 
ATOM   4325 C C   . GLU B 1 203 ? 35.915  -16.230 -4.559  1.00 35.61 ? 414 GLU B C   1 
ATOM   4326 O O   . GLU B 1 203 ? 36.951  -15.571 -4.609  1.00 35.89 ? 414 GLU B O   1 
ATOM   4327 C CB  . GLU B 1 203 ? 34.027  -15.487 -6.023  1.00 37.89 ? 414 GLU B CB  1 
ATOM   4328 C CG  . GLU B 1 203 ? 33.384  -15.491 -7.415  1.00 41.21 ? 414 GLU B CG  1 
ATOM   4329 C CD  . GLU B 1 203 ? 32.490  -16.728 -7.738  1.00 44.71 ? 414 GLU B CD  1 
ATOM   4330 O OE1 . GLU B 1 203 ? 32.124  -17.535 -6.832  1.00 46.05 ? 414 GLU B OE1 1 
ATOM   4331 O OE2 . GLU B 1 203 ? 32.159  -16.886 -8.935  1.00 47.71 ? 414 GLU B OE2 1 
ATOM   4332 N N   . ALA B 1 204 ? 35.420  -16.734 -3.430  1.00 33.74 ? 415 ALA B N   1 
ATOM   4333 C CA  . ALA B 1 204 ? 35.983  -16.420 -2.130  1.00 32.16 ? 415 ALA B CA  1 
ATOM   4334 C C   . ALA B 1 204 ? 37.188  -17.299 -1.843  1.00 31.02 ? 415 ALA B C   1 
ATOM   4335 O O   . ALA B 1 204 ? 37.981  -16.985 -0.985  1.00 30.77 ? 415 ALA B O   1 
ATOM   4336 C CB  . ALA B 1 204 ? 34.898  -16.576 -1.029  1.00 30.94 ? 415 ALA B CB  1 
ATOM   4337 N N   . PHE B 1 205 ? 37.343  -18.393 -2.576  1.00 30.68 ? 416 PHE B N   1 
ATOM   4338 C CA  . PHE B 1 205 ? 38.331  -19.426 -2.238  1.00 30.20 ? 416 PHE B CA  1 
ATOM   4339 C C   . PHE B 1 205 ? 39.770  -18.945 -2.301  1.00 31.60 ? 416 PHE B C   1 
ATOM   4340 O O   . PHE B 1 205 ? 40.174  -18.247 -3.242  1.00 30.83 ? 416 PHE B O   1 
ATOM   4341 C CB  . PHE B 1 205 ? 38.146  -20.628 -3.183  1.00 30.54 ? 416 PHE B CB  1 
ATOM   4342 C CG  . PHE B 1 205 ? 38.956  -21.845 -2.808  1.00 29.44 ? 416 PHE B CG  1 
ATOM   4343 C CD1 . PHE B 1 205 ? 38.739  -22.509 -1.597  1.00 26.78 ? 416 PHE B CD1 1 
ATOM   4344 C CD2 . PHE B 1 205 ? 39.888  -22.367 -3.697  1.00 29.93 ? 416 PHE B CD2 1 
ATOM   4345 C CE1 . PHE B 1 205 ? 39.470  -23.637 -1.261  1.00 26.14 ? 416 PHE B CE1 1 
ATOM   4346 C CE2 . PHE B 1 205 ? 40.628  -23.483 -3.371  1.00 27.82 ? 416 PHE B CE2 1 
ATOM   4347 C CZ  . PHE B 1 205 ? 40.417  -24.129 -2.148  1.00 28.62 ? 416 PHE B CZ  1 
ATOM   4348 N N   . ARG B 1 206 ? 40.565  -19.347 -1.316  1.00 31.89 ? 417 ARG B N   1 
ATOM   4349 C CA  . ARG B 1 206 ? 41.995  -19.051 -1.325  1.00 32.78 ? 417 ARG B CA  1 
ATOM   4350 C C   . ARG B 1 206 ? 42.731  -19.875 -2.386  1.00 34.24 ? 417 ARG B C   1 
ATOM   4351 O O   . ARG B 1 206 ? 43.473  -20.803 -2.064  1.00 33.80 ? 417 ARG B O   1 
ATOM   4352 C CB  . ARG B 1 206 ? 42.602  -19.281 0.060   1.00 32.31 ? 417 ARG B CB  1 
ATOM   4353 C CG  . ARG B 1 206 ? 42.059  -18.304 1.136   1.00 31.60 ? 417 ARG B CG  1 
ATOM   4354 C CD  . ARG B 1 206 ? 42.497  -16.865 0.811   1.00 31.28 ? 417 ARG B CD  1 
ATOM   4355 N NE  . ARG B 1 206 ? 43.959  -16.782 0.771   1.00 30.56 ? 417 ARG B NE  1 
ATOM   4356 C CZ  . ARG B 1 206 ? 44.737  -16.549 1.825   1.00 32.44 ? 417 ARG B CZ  1 
ATOM   4357 N NH1 . ARG B 1 206 ? 44.203  -16.341 3.024   1.00 31.40 ? 417 ARG B NH1 1 
ATOM   4358 N NH2 . ARG B 1 206 ? 46.066  -16.496 1.687   1.00 32.80 ? 417 ARG B NH2 1 
ATOM   4359 N N   . GLU B 1 207 ? 42.530  -19.513 -3.653  1.00 36.47 ? 418 GLU B N   1 
ATOM   4360 C CA  . GLU B 1 207 ? 43.225  -20.173 -4.787  1.00 38.19 ? 418 GLU B CA  1 
ATOM   4361 C C   . GLU B 1 207 ? 44.726  -20.098 -4.633  1.00 38.37 ? 418 GLU B C   1 
ATOM   4362 O O   . GLU B 1 207 ? 45.432  -21.019 -5.057  1.00 39.74 ? 418 GLU B O   1 
ATOM   4363 C CB  . GLU B 1 207 ? 42.869  -19.525 -6.127  1.00 39.58 ? 418 GLU B CB  1 
ATOM   4364 C CG  . GLU B 1 207 ? 41.367  -19.477 -6.422  1.00 43.60 ? 418 GLU B CG  1 
ATOM   4365 C CD  . GLU B 1 207 ? 41.041  -19.379 -7.910  1.00 48.22 ? 418 GLU B CD  1 
ATOM   4366 O OE1 . GLU B 1 207 ? 41.598  -18.478 -8.579  1.00 53.67 ? 418 GLU B OE1 1 
ATOM   4367 O OE2 . GLU B 1 207 ? 40.216  -20.190 -8.407  1.00 48.76 ? 418 GLU B OE2 1 
ATOM   4368 N N   . ASP B 1 208 ? 45.203  -19.000 -4.038  1.00 37.66 ? 419 ASP B N   1 
ATOM   4369 C CA  . ASP B 1 208 ? 46.626  -18.720 -3.912  1.00 37.83 ? 419 ASP B CA  1 
ATOM   4370 C C   . ASP B 1 208 ? 47.371  -19.698 -3.046  1.00 37.10 ? 419 ASP B C   1 
ATOM   4371 O O   . ASP B 1 208 ? 48.555  -19.908 -3.254  1.00 37.82 ? 419 ASP B O   1 
ATOM   4372 C CB  . ASP B 1 208 ? 46.870  -17.297 -3.352  1.00 38.21 ? 419 ASP B CB  1 
ATOM   4373 C CG  . ASP B 1 208 ? 46.263  -17.101 -1.946  1.00 38.53 ? 419 ASP B CG  1 
ATOM   4374 O OD1 . ASP B 1 208 ? 45.009  -17.202 -1.822  1.00 37.81 ? 419 ASP B OD1 1 
ATOM   4375 O OD2 . ASP B 1 208 ? 47.038  -16.841 -0.982  1.00 37.23 ? 419 ASP B OD2 1 
ATOM   4376 N N   . LEU B 1 209 ? 46.716  -20.287 -2.050  1.00 35.48 ? 420 LEU B N   1 
ATOM   4377 C CA  . LEU B 1 209 ? 47.454  -21.094 -1.089  1.00 34.34 ? 420 LEU B CA  1 
ATOM   4378 C C   . LEU B 1 209 ? 47.976  -22.388 -1.723  1.00 33.98 ? 420 LEU B C   1 
ATOM   4379 O O   . LEU B 1 209 ? 47.343  -22.934 -2.593  1.00 32.87 ? 420 LEU B O   1 
ATOM   4380 C CB  . LEU B 1 209 ? 46.598  -21.390 0.157   1.00 33.40 ? 420 LEU B CB  1 
ATOM   4381 C CG  . LEU B 1 209 ? 46.298  -20.178 1.056   1.00 33.23 ? 420 LEU B CG  1 
ATOM   4382 C CD1 . LEU B 1 209 ? 45.497  -20.578 2.320   1.00 32.10 ? 420 LEU B CD1 1 
ATOM   4383 C CD2 . LEU B 1 209 ? 47.580  -19.476 1.467   1.00 33.09 ? 420 LEU B CD2 1 
ATOM   4384 N N   . HIS B 1 210 ? 49.137  -22.849 -1.268  1.00 34.06 ? 421 HIS B N   1 
ATOM   4385 C CA  . HIS B 1 210 ? 49.693  -24.147 -1.674  1.00 35.02 ? 421 HIS B CA  1 
ATOM   4386 C C   . HIS B 1 210 ? 49.099  -25.287 -0.866  1.00 34.87 ? 421 HIS B C   1 
ATOM   4387 O O   . HIS B 1 210 ? 48.401  -25.053 0.136   1.00 33.55 ? 421 HIS B O   1 
ATOM   4388 C CB  . HIS B 1 210 ? 51.216  -24.170 -1.515  1.00 35.53 ? 421 HIS B CB  1 
ATOM   4389 C CG  . HIS B 1 210 ? 51.692  -23.833 -0.132  1.00 37.69 ? 421 HIS B CG  1 
ATOM   4390 N ND1 . HIS B 1 210 ? 51.536  -22.577 0.433   1.00 38.23 ? 421 HIS B ND1 1 
ATOM   4391 C CD2 . HIS B 1 210 ? 52.343  -24.583 0.790   1.00 38.74 ? 421 HIS B CD2 1 
ATOM   4392 C CE1 . HIS B 1 210 ? 52.055  -22.582 1.647   1.00 38.80 ? 421 HIS B CE1 1 
ATOM   4393 N NE2 . HIS B 1 210 ? 52.544  -23.789 1.892   1.00 37.81 ? 421 HIS B NE2 1 
ATOM   4394 N N   . ASN B 1 211 ? 49.370  -26.516 -1.314  1.00 34.64 ? 422 ASN B N   1 
ATOM   4395 C CA  . ASN B 1 211 ? 48.975  -27.708 -0.585  1.00 35.12 ? 422 ASN B CA  1 
ATOM   4396 C C   . ASN B 1 211 ? 47.423  -27.825 -0.577  1.00 33.58 ? 422 ASN B C   1 
ATOM   4397 O O   . ASN B 1 211 ? 46.779  -28.108 0.446   1.00 33.43 ? 422 ASN B O   1 
ATOM   4398 C CB  . ASN B 1 211 ? 49.599  -27.638 0.815   1.00 36.12 ? 422 ASN B CB  1 
ATOM   4399 C CG  . ASN B 1 211 ? 49.549  -28.954 1.574   1.00 39.77 ? 422 ASN B CG  1 
ATOM   4400 O OD1 . ASN B 1 211 ? 49.468  -30.040 0.990   1.00 46.30 ? 422 ASN B OD1 1 
ATOM   4401 N ND2 . ASN B 1 211 ? 49.594  -28.855 2.915   1.00 43.27 ? 422 ASN B ND2 1 
ATOM   4402 N N   . ARG B 1 212 ? 46.839  -27.583 -1.745  1.00 31.70 ? 423 ARG B N   1 
ATOM   4403 C CA  . ARG B 1 212 ? 45.422  -27.740 -1.952  1.00 30.23 ? 423 ARG B CA  1 
ATOM   4404 C C   . ARG B 1 212 ? 45.061  -29.212 -2.193  1.00 29.25 ? 423 ARG B C   1 
ATOM   4405 O O   . ARG B 1 212 ? 45.471  -29.797 -3.198  1.00 28.86 ? 423 ARG B O   1 
ATOM   4406 C CB  . ARG B 1 212 ? 44.982  -26.918 -3.141  1.00 30.55 ? 423 ARG B CB  1 
ATOM   4407 C CG  . ARG B 1 212 ? 43.485  -26.769 -3.249  1.00 29.54 ? 423 ARG B CG  1 
ATOM   4408 C CD  . ARG B 1 212 ? 43.086  -26.305 -4.605  1.00 29.66 ? 423 ARG B CD  1 
ATOM   4409 N NE  . ARG B 1 212 ? 43.710  -25.028 -4.936  1.00 31.55 ? 423 ARG B NE  1 
ATOM   4410 C CZ  . ARG B 1 212 ? 43.760  -24.488 -6.155  1.00 36.33 ? 423 ARG B CZ  1 
ATOM   4411 N NH1 . ARG B 1 212 ? 43.270  -25.134 -7.212  1.00 36.86 ? 423 ARG B NH1 1 
ATOM   4412 N NH2 . ARG B 1 212 ? 44.327  -23.293 -6.326  1.00 34.94 ? 423 ARG B NH2 1 
ATOM   4413 N N   . MET B 1 213 ? 44.248  -29.770 -1.295  1.00 27.72 ? 424 MET B N   1 
ATOM   4414 C CA  . MET B 1 213 ? 43.895  -31.192 -1.288  1.00 27.25 ? 424 MET B CA  1 
ATOM   4415 C C   . MET B 1 213 ? 42.364  -31.384 -1.364  1.00 26.59 ? 424 MET B C   1 
ATOM   4416 O O   . MET B 1 213 ? 41.587  -30.560 -0.872  1.00 26.54 ? 424 MET B O   1 
ATOM   4417 C CB  . MET B 1 213 ? 44.412  -31.838 -0.002  1.00 27.02 ? 424 MET B CB  1 
ATOM   4418 C CG  . MET B 1 213 ? 45.886  -31.799 0.197   1.00 27.53 ? 424 MET B CG  1 
ATOM   4419 S SD  . MET B 1 213 ? 46.464  -32.811 1.570   1.00 32.91 ? 424 MET B SD  1 
ATOM   4420 C CE  . MET B 1 213 ? 46.404  -34.486 0.849   1.00 27.89 ? 424 MET B CE  1 
ATOM   4421 N N   . LEU B 1 214 ? 41.936  -32.482 -1.968  1.00 25.74 ? 425 LEU B N   1 
ATOM   4422 C CA  . LEU B 1 214 ? 40.534  -32.814 -2.066  1.00 24.42 ? 425 LEU B CA  1 
ATOM   4423 C C   . LEU B 1 214 ? 40.265  -33.747 -0.889  1.00 23.83 ? 425 LEU B C   1 
ATOM   4424 O O   . LEU B 1 214 ? 40.760  -34.883 -0.867  1.00 24.07 ? 425 LEU B O   1 
ATOM   4425 C CB  . LEU B 1 214 ? 40.227  -33.512 -3.381  1.00 24.38 ? 425 LEU B CB  1 
ATOM   4426 C CG  . LEU B 1 214 ? 38.750  -33.745 -3.703  1.00 23.65 ? 425 LEU B CG  1 
ATOM   4427 C CD1 . LEU B 1 214 ? 38.048  -32.490 -4.157  1.00 23.81 ? 425 LEU B CD1 1 
ATOM   4428 C CD2 . LEU B 1 214 ? 38.638  -34.843 -4.751  1.00 23.27 ? 425 LEU B CD2 1 
ATOM   4429 N N   . LEU B 1 215 ? 39.512  -33.272 0.102   1.00 22.28 ? 426 LEU B N   1 
ATOM   4430 C CA  . LEU B 1 215 ? 39.379  -34.029 1.367   1.00 21.66 ? 426 LEU B CA  1 
ATOM   4431 C C   . LEU B 1 215 ? 37.947  -34.283 1.747   1.00 19.82 ? 426 LEU B C   1 
ATOM   4432 O O   . LEU B 1 215 ? 37.044  -33.581 1.290   1.00 18.53 ? 426 LEU B O   1 
ATOM   4433 C CB  . LEU B 1 215 ? 40.056  -33.285 2.516   1.00 22.64 ? 426 LEU B CB  1 
ATOM   4434 C CG  . LEU B 1 215 ? 41.540  -32.983 2.360   1.00 24.19 ? 426 LEU B CG  1 
ATOM   4435 C CD1 . LEU B 1 215 ? 42.028  -32.064 3.489   1.00 21.89 ? 426 LEU B CD1 1 
ATOM   4436 C CD2 . LEU B 1 215 ? 42.322  -34.261 2.326   1.00 25.77 ? 426 LEU B CD2 1 
ATOM   4437 N N   . TRP B 1 216 ? 37.787  -35.260 2.646   1.00 18.71 ? 427 TRP B N   1 
ATOM   4438 C CA  . TRP B 1 216 ? 36.500  -35.810 3.040   1.00 18.97 ? 427 TRP B CA  1 
ATOM   4439 C C   . TRP B 1 216 ? 35.875  -35.017 4.196   1.00 18.50 ? 427 TRP B C   1 
ATOM   4440 O O   . TRP B 1 216 ? 36.564  -34.606 5.132   1.00 17.93 ? 427 TRP B O   1 
ATOM   4441 C CB  . TRP B 1 216 ? 36.646  -37.267 3.535   1.00 18.76 ? 427 TRP B CB  1 
ATOM   4442 C CG  . TRP B 1 216 ? 37.146  -38.233 2.492   1.00 18.30 ? 427 TRP B CG  1 
ATOM   4443 C CD1 . TRP B 1 216 ? 38.374  -38.763 2.413   1.00 19.30 ? 427 TRP B CD1 1 
ATOM   4444 C CD2 . TRP B 1 216 ? 36.394  -38.783 1.404   1.00 16.22 ? 427 TRP B CD2 1 
ATOM   4445 N NE1 . TRP B 1 216 ? 38.457  -39.622 1.331   1.00 17.53 ? 427 TRP B NE1 1 
ATOM   4446 C CE2 . TRP B 1 216 ? 37.251  -39.626 0.688   1.00 17.79 ? 427 TRP B CE2 1 
ATOM   4447 C CE3 . TRP B 1 216 ? 35.081  -38.612 0.949   1.00 18.09 ? 427 TRP B CE3 1 
ATOM   4448 C CZ2 . TRP B 1 216 ? 36.837  -40.329 -0.449  1.00 19.16 ? 427 TRP B CZ2 1 
ATOM   4449 C CZ3 . TRP B 1 216 ? 34.663  -39.296 -0.189  1.00 18.32 ? 427 TRP B CZ3 1 
ATOM   4450 C CH2 . TRP B 1 216 ? 35.543  -40.145 -0.873  1.00 20.95 ? 427 TRP B CH2 1 
ATOM   4451 N N   . HIS B 1 217 ? 34.564  -34.850 4.122   1.00 18.71 ? 428 HIS B N   1 
ATOM   4452 C CA  . HIS B 1 217 ? 33.811  -34.472 5.281   1.00 18.23 ? 428 HIS B CA  1 
ATOM   4453 C C   . HIS B 1 217 ? 32.521  -35.270 5.340   1.00 18.51 ? 428 HIS B C   1 
ATOM   4454 O O   . HIS B 1 217 ? 31.761  -35.276 4.372   1.00 18.61 ? 428 HIS B O   1 
ATOM   4455 C CB  . HIS B 1 217 ? 33.467  -33.012 5.231   1.00 18.58 ? 428 HIS B CB  1 
ATOM   4456 C CG  . HIS B 1 217 ? 32.824  -32.516 6.491   1.00 17.46 ? 428 HIS B CG  1 
ATOM   4457 N ND1 . HIS B 1 217 ? 33.557  -32.018 7.544   1.00 17.28 ? 428 HIS B ND1 1 
ATOM   4458 C CD2 . HIS B 1 217 ? 31.526  -32.439 6.857   1.00 17.28 ? 428 HIS B CD2 1 
ATOM   4459 C CE1 . HIS B 1 217 ? 32.733  -31.648 8.515   1.00 19.21 ? 428 HIS B CE1 1 
ATOM   4460 N NE2 . HIS B 1 217 ? 31.491  -31.885 8.121   1.00 19.27 ? 428 HIS B NE2 1 
ATOM   4461 N N   . GLY B 1 218 ? 32.307  -35.926 6.490   1.00 17.97 ? 429 GLY B N   1 
ATOM   4462 C CA  . GLY B 1 218 ? 31.073  -36.640 6.799   1.00 17.68 ? 429 GLY B CA  1 
ATOM   4463 C C   . GLY B 1 218 ? 30.264  -35.926 7.870   1.00 17.65 ? 429 GLY B C   1 
ATOM   4464 O O   . GLY B 1 218 ? 30.824  -35.272 8.728   1.00 17.26 ? 429 GLY B O   1 
ATOM   4465 N N   . SER B 1 219 ? 28.942  -35.998 7.767   1.00 17.55 ? 430 SER B N   1 
ATOM   4466 C CA  . SER B 1 219 ? 28.045  -35.382 8.723   1.00 17.59 ? 430 SER B CA  1 
ATOM   4467 C C   . SER B 1 219 ? 26.738  -36.121 8.757   1.00 17.73 ? 430 SER B C   1 
ATOM   4468 O O   . SER B 1 219 ? 26.466  -36.951 7.884   1.00 18.24 ? 430 SER B O   1 
ATOM   4469 C CB  . SER B 1 219 ? 27.818  -33.913 8.365   1.00 18.81 ? 430 SER B CB  1 
ATOM   4470 O OG  . SER B 1 219 ? 27.379  -33.160 9.499   1.00 16.84 ? 430 SER B OG  1 
ATOM   4471 N N   . ARG B 1 220 ? 25.939  -35.829 9.787   1.00 17.65 ? 431 ARG B N   1 
ATOM   4472 C CA  . ARG B 1 220 ? 24.646  -36.455 10.028  1.00 17.49 ? 431 ARG B CA  1 
ATOM   4473 C C   . ARG B 1 220 ? 23.692  -36.078 8.949   1.00 17.27 ? 431 ARG B C   1 
ATOM   4474 O O   . ARG B 1 220 ? 23.796  -34.985 8.430   1.00 17.27 ? 431 ARG B O   1 
ATOM   4475 C CB  . ARG B 1 220 ? 24.066  -35.997 11.397  1.00 17.60 ? 431 ARG B CB  1 
ATOM   4476 C CG  . ARG B 1 220 ? 24.745  -36.669 12.558  1.00 19.65 ? 431 ARG B CG  1 
ATOM   4477 C CD  . ARG B 1 220 ? 24.330  -36.118 13.943  1.00 21.48 ? 431 ARG B CD  1 
ATOM   4478 N NE  . ARG B 1 220 ? 25.143  -36.678 15.033  1.00 24.51 ? 431 ARG B NE  1 
ATOM   4479 C CZ  . ARG B 1 220 ? 24.921  -37.863 15.616  1.00 25.03 ? 431 ARG B CZ  1 
ATOM   4480 N NH1 . ARG B 1 220 ? 23.935  -38.672 15.218  1.00 24.10 ? 431 ARG B NH1 1 
ATOM   4481 N NH2 . ARG B 1 220 ? 25.724  -38.259 16.571  1.00 26.25 ? 431 ARG B NH2 1 
ATOM   4482 N N   . MET B 1 221 ? 22.757  -36.969 8.609   1.00 17.57 ? 432 MET B N   1 
ATOM   4483 C CA  . MET B 1 221 ? 21.800  -36.707 7.536   1.00 18.39 ? 432 MET B CA  1 
ATOM   4484 C C   . MET B 1 221 ? 20.952  -35.480 7.774   1.00 18.01 ? 432 MET B C   1 
ATOM   4485 O O   . MET B 1 221 ? 20.451  -34.888 6.832   1.00 17.83 ? 432 MET B O   1 
ATOM   4486 C CB  . MET B 1 221 ? 20.843  -37.890 7.296   1.00 18.90 ? 432 MET B CB  1 
ATOM   4487 C CG  . MET B 1 221 ? 21.459  -39.027 6.520   1.00 23.13 ? 432 MET B CG  1 
ATOM   4488 S SD  . MET B 1 221 ? 21.959  -38.492 4.844   1.00 26.07 ? 432 MET B SD  1 
ATOM   4489 C CE  . MET B 1 221 ? 20.408  -37.913 4.251   1.00 19.83 ? 432 MET B CE  1 
ATOM   4490 N N   . SER B 1 222 ? 20.736  -35.129 9.036   1.00 18.63 ? 433 SER B N   1 
ATOM   4491 C CA  . SER B 1 222 ? 19.916  -33.989 9.382   1.00 18.48 ? 433 SER B CA  1 
ATOM   4492 C C   . SER B 1 222 ? 20.578  -32.700 9.012   1.00 17.87 ? 433 SER B C   1 
ATOM   4493 O O   . SER B 1 222 ? 19.907  -31.686 8.984   1.00 18.87 ? 433 SER B O   1 
ATOM   4494 C CB  . SER B 1 222 ? 19.669  -33.986 10.889  1.00 19.74 ? 433 SER B CB  1 
ATOM   4495 O OG  . SER B 1 222 ? 20.910  -34.026 11.578  1.00 20.15 ? 433 SER B OG  1 
ATOM   4496 N N   . ASN B 1 223 ? 21.889  -32.738 8.759   1.00 16.90 ? 434 ASN B N   1 
ATOM   4497 C CA  . ASN B 1 223 ? 22.686  -31.546 8.619   1.00 16.84 ? 434 ASN B CA  1 
ATOM   4498 C C   . ASN B 1 223 ? 22.895  -31.007 7.186   1.00 17.36 ? 434 ASN B C   1 
ATOM   4499 O O   . ASN B 1 223 ? 23.265  -29.835 7.035   1.00 17.44 ? 434 ASN B O   1 
ATOM   4500 C CB  . ASN B 1 223 ? 24.033  -31.740 9.328   1.00 17.17 ? 434 ASN B CB  1 
ATOM   4501 C CG  . ASN B 1 223 ? 23.876  -31.951 10.852  1.00 16.64 ? 434 ASN B CG  1 
ATOM   4502 O OD1 . ASN B 1 223 ? 22.769  -31.872 11.366  1.00 22.68 ? 434 ASN B OD1 1 
ATOM   4503 N ND2 . ASN B 1 223 ? 24.985  -32.221 11.561  1.00 16.88 ? 434 ASN B ND2 1 
ATOM   4504 N N   . TRP B 1 224 ? 22.633  -31.824 6.167   1.00 16.78 ? 435 TRP B N   1 
ATOM   4505 C CA  . TRP B 1 224 ? 23.032  -31.503 4.799   1.00 17.14 ? 435 TRP B CA  1 
ATOM   4506 C C   . TRP B 1 224 ? 22.322  -30.260 4.248   1.00 18.05 ? 435 TRP B C   1 
ATOM   4507 O O   . TRP B 1 224 ? 22.927  -29.503 3.525   1.00 18.28 ? 435 TRP B O   1 
ATOM   4508 C CB  . TRP B 1 224 ? 22.849  -32.707 3.877   1.00 17.24 ? 435 TRP B CB  1 
ATOM   4509 C CG  . TRP B 1 224 ? 23.788  -33.784 4.220   1.00 16.32 ? 435 TRP B CG  1 
ATOM   4510 C CD1 . TRP B 1 224 ? 23.492  -35.027 4.698   1.00 16.78 ? 435 TRP B CD1 1 
ATOM   4511 C CD2 . TRP B 1 224 ? 25.206  -33.689 4.198   1.00 16.74 ? 435 TRP B CD2 1 
ATOM   4512 N NE1 . TRP B 1 224 ? 24.652  -35.730 4.928   1.00 16.97 ? 435 TRP B NE1 1 
ATOM   4513 C CE2 . TRP B 1 224 ? 25.716  -34.917 4.640   1.00 13.35 ? 435 TRP B CE2 1 
ATOM   4514 C CE3 . TRP B 1 224 ? 26.093  -32.698 3.795   1.00 16.06 ? 435 TRP B CE3 1 
ATOM   4515 C CZ2 . TRP B 1 224 ? 27.067  -35.171 4.708   1.00 18.34 ? 435 TRP B CZ2 1 
ATOM   4516 C CZ3 . TRP B 1 224 ? 27.451  -32.952 3.889   1.00 16.79 ? 435 TRP B CZ3 1 
ATOM   4517 C CH2 . TRP B 1 224 ? 27.919  -34.173 4.325   1.00 16.43 ? 435 TRP B CH2 1 
ATOM   4518 N N   . VAL B 1 225 ? 21.070  -30.031 4.627   1.00 17.86 ? 436 VAL B N   1 
ATOM   4519 C CA  . VAL B 1 225 ? 20.383  -28.863 4.154   1.00 19.08 ? 436 VAL B CA  1 
ATOM   4520 C C   . VAL B 1 225 ? 21.108  -27.633 4.672   1.00 19.63 ? 436 VAL B C   1 
ATOM   4521 O O   . VAL B 1 225 ? 21.349  -26.702 3.903   1.00 20.13 ? 436 VAL B O   1 
ATOM   4522 C CB  . VAL B 1 225 ? 18.892  -28.830 4.502   1.00 18.43 ? 436 VAL B CB  1 
ATOM   4523 C CG1 . VAL B 1 225 ? 18.333  -27.441 4.212   1.00 19.06 ? 436 VAL B CG1 1 
ATOM   4524 C CG2 . VAL B 1 225 ? 18.178  -29.808 3.660   1.00 18.26 ? 436 VAL B CG2 1 
ATOM   4525 N N   . GLY B 1 226 ? 21.542  -27.658 5.930   1.00 18.69 ? 437 GLY B N   1 
ATOM   4526 C CA  . GLY B 1 226 ? 22.269  -26.517 6.464   1.00 18.14 ? 437 GLY B CA  1 
ATOM   4527 C C   . GLY B 1 226 ? 23.630  -26.341 5.832   1.00 18.19 ? 437 GLY B C   1 
ATOM   4528 O O   . GLY B 1 226 ? 23.999  -25.233 5.483   1.00 18.47 ? 437 GLY B O   1 
ATOM   4529 N N   . ILE B 1 227 ? 24.382  -27.427 5.675   1.00 18.26 ? 438 ILE B N   1 
ATOM   4530 C CA  . ILE B 1 227 ? 25.739  -27.374 5.089   1.00 18.79 ? 438 ILE B CA  1 
ATOM   4531 C C   . ILE B 1 227 ? 25.724  -26.925 3.626   1.00 21.12 ? 438 ILE B C   1 
ATOM   4532 O O   . ILE B 1 227 ? 26.551  -26.103 3.194   1.00 19.95 ? 438 ILE B O   1 
ATOM   4533 C CB  . ILE B 1 227 ? 26.420  -28.746 5.223   1.00 19.19 ? 438 ILE B CB  1 
ATOM   4534 C CG1 . ILE B 1 227 ? 26.760  -28.997 6.693   1.00 18.51 ? 438 ILE B CG1 1 
ATOM   4535 C CG2 . ILE B 1 227 ? 27.666  -28.864 4.299   1.00 16.90 ? 438 ILE B CG2 1 
ATOM   4536 C CD1 . ILE B 1 227 ? 27.244  -30.493 7.024   1.00 15.69 ? 438 ILE B CD1 1 
ATOM   4537 N N   . LEU B 1 228 ? 24.752  -27.425 2.859   1.00 22.49 ? 439 LEU B N   1 
ATOM   4538 C CA  . LEU B 1 228 ? 24.648  -27.036 1.459   1.00 23.92 ? 439 LEU B CA  1 
ATOM   4539 C C   . LEU B 1 228 ? 24.164  -25.595 1.304   1.00 24.39 ? 439 LEU B C   1 
ATOM   4540 O O   . LEU B 1 228 ? 24.722  -24.852 0.491   1.00 25.12 ? 439 LEU B O   1 
ATOM   4541 C CB  . LEU B 1 228 ? 23.763  -28.003 0.659   1.00 24.32 ? 439 LEU B CB  1 
ATOM   4542 C CG  . LEU B 1 228 ? 24.299  -29.438 0.596   1.00 23.86 ? 439 LEU B CG  1 
ATOM   4543 C CD1 . LEU B 1 228 ? 23.374  -30.230 -0.232  1.00 22.35 ? 439 LEU B CD1 1 
ATOM   4544 C CD2 . LEU B 1 228 ? 25.710  -29.510 0.017   1.00 26.67 ? 439 LEU B CD2 1 
ATOM   4545 N N   . SER B 1 229 ? 23.180  -25.190 2.108   1.00 24.16 ? 440 SER B N   1 
ATOM   4546 C CA  . SER B 1 229 ? 22.649  -23.839 2.050   1.00 24.62 ? 440 SER B CA  1 
ATOM   4547 C C   . SER B 1 229 ? 23.566  -22.766 2.685   1.00 24.42 ? 440 SER B C   1 
ATOM   4548 O O   . SER B 1 229 ? 23.707  -21.676 2.133   1.00 23.32 ? 440 SER B O   1 
ATOM   4549 C CB  . SER B 1 229 ? 21.226  -23.781 2.624   1.00 24.82 ? 440 SER B CB  1 
ATOM   4550 O OG  . SER B 1 229 ? 21.171  -24.099 4.008   1.00 25.82 ? 440 SER B OG  1 
ATOM   4551 N N   . HIS B 1 230 ? 24.194  -23.073 3.818   1.00 24.61 ? 441 HIS B N   1 
ATOM   4552 C CA  . HIS B 1 230 ? 25.054  -22.106 4.536   1.00 24.97 ? 441 HIS B CA  1 
ATOM   4553 C C   . HIS B 1 230 ? 26.539  -22.462 4.507   1.00 24.84 ? 441 HIS B C   1 
ATOM   4554 O O   . HIS B 1 230 ? 27.366  -21.715 5.034   1.00 26.31 ? 441 HIS B O   1 
ATOM   4555 C CB  . HIS B 1 230 ? 24.613  -21.976 6.008   1.00 26.04 ? 441 HIS B CB  1 
ATOM   4556 C CG  . HIS B 1 230 ? 23.269  -21.358 6.191   1.00 26.32 ? 441 HIS B CG  1 
ATOM   4557 N ND1 . HIS B 1 230 ? 22.146  -21.828 5.561   1.00 28.32 ? 441 HIS B ND1 1 
ATOM   4558 C CD2 . HIS B 1 230 ? 22.864  -20.320 6.962   1.00 30.33 ? 441 HIS B CD2 1 
ATOM   4559 C CE1 . HIS B 1 230 ? 21.104  -21.093 5.910   1.00 28.36 ? 441 HIS B CE1 1 
ATOM   4560 N NE2 . HIS B 1 230 ? 21.513  -20.169 6.758   1.00 30.28 ? 441 HIS B NE2 1 
ATOM   4561 N N   . GLY B 1 231 ? 26.902  -23.595 3.926   1.00 24.14 ? 442 GLY B N   1 
ATOM   4562 C CA  . GLY B 1 231 ? 28.321  -24.028 3.881   1.00 23.01 ? 442 GLY B CA  1 
ATOM   4563 C C   . GLY B 1 231 ? 28.757  -24.613 5.212   1.00 21.68 ? 442 GLY B C   1 
ATOM   4564 O O   . GLY B 1 231 ? 27.995  -24.593 6.185   1.00 20.68 ? 442 GLY B O   1 
ATOM   4565 N N   . LEU B 1 232 ? 29.986  -25.128 5.255   1.00 20.92 ? 443 LEU B N   1 
ATOM   4566 C CA  . LEU B 1 232 ? 30.592  -25.556 6.487   1.00 20.39 ? 443 LEU B CA  1 
ATOM   4567 C C   . LEU B 1 232 ? 31.037  -24.312 7.232   1.00 20.56 ? 443 LEU B C   1 
ATOM   4568 O O   . LEU B 1 232 ? 31.610  -23.392 6.651   1.00 18.87 ? 443 LEU B O   1 
ATOM   4569 C CB  . LEU B 1 232 ? 31.769  -26.490 6.235   1.00 20.04 ? 443 LEU B CB  1 
ATOM   4570 C CG  . LEU B 1 232 ? 31.380  -27.826 5.598   1.00 20.32 ? 443 LEU B CG  1 
ATOM   4571 C CD1 . LEU B 1 232 ? 32.605  -28.501 4.961   1.00 15.43 ? 443 LEU B CD1 1 
ATOM   4572 C CD2 . LEU B 1 232 ? 30.663  -28.783 6.624   1.00 16.85 ? 443 LEU B CD2 1 
ATOM   4573 N N   . ARG B 1 233 ? 30.728  -24.263 8.521   1.00 21.25 ? 444 ARG B N   1 
ATOM   4574 C CA  . ARG B 1 233 ? 30.884  -23.024 9.312   1.00 21.79 ? 444 ARG B CA  1 
ATOM   4575 C C   . ARG B 1 233 ? 31.738  -23.247 10.533  1.00 21.88 ? 444 ARG B C   1 
ATOM   4576 O O   . ARG B 1 233 ? 31.876  -24.361 11.047  1.00 21.84 ? 444 ARG B O   1 
ATOM   4577 C CB  . ARG B 1 233 ? 29.518  -22.471 9.756   1.00 22.33 ? 444 ARG B CB  1 
ATOM   4578 C CG  . ARG B 1 233 ? 28.735  -21.667 8.715   1.00 23.14 ? 444 ARG B CG  1 
ATOM   4579 C CD  . ARG B 1 233 ? 27.196  -21.932 8.891   1.00 26.16 ? 444 ARG B CD  1 
ATOM   4580 N NE  . ARG B 1 233 ? 26.953  -23.329 8.531   1.00 27.22 ? 444 ARG B NE  1 
ATOM   4581 C CZ  . ARG B 1 233 ? 26.003  -24.140 8.997   1.00 29.71 ? 444 ARG B CZ  1 
ATOM   4582 N NH1 . ARG B 1 233 ? 25.085  -23.723 9.848   1.00 31.27 ? 444 ARG B NH1 1 
ATOM   4583 N NH2 . ARG B 1 233 ? 25.977  -25.411 8.572   1.00 28.81 ? 444 ARG B NH2 1 
ATOM   4584 N N   . ILE B 1 234 ? 32.285  -22.150 11.011  1.00 22.16 ? 445 ILE B N   1 
ATOM   4585 C CA  . ILE B 1 234 ? 33.034  -22.106 12.239  1.00 22.22 ? 445 ILE B CA  1 
ATOM   4586 C C   . ILE B 1 234 ? 31.990  -22.272 13.360  1.00 21.50 ? 445 ILE B C   1 
ATOM   4587 O O   . ILE B 1 234 ? 30.932  -21.655 13.313  1.00 22.18 ? 445 ILE B O   1 
ATOM   4588 C CB  . ILE B 1 234 ? 33.787  -20.751 12.335  1.00 22.92 ? 445 ILE B CB  1 
ATOM   4589 C CG1 . ILE B 1 234 ? 34.804  -20.613 11.168  1.00 23.77 ? 445 ILE B CG1 1 
ATOM   4590 C CG2 . ILE B 1 234 ? 34.474  -20.571 13.701  1.00 23.22 ? 445 ILE B CG2 1 
ATOM   4591 C CD1 . ILE B 1 234 ? 35.844  -21.775 11.051  1.00 24.70 ? 445 ILE B CD1 1 
ATOM   4592 N N   . ALA B 1 235 ? 32.298  -23.102 14.341  1.00 20.10 ? 446 ALA B N   1 
ATOM   4593 C CA  . ALA B 1 235 ? 31.399  -23.368 15.450  1.00 20.14 ? 446 ALA B CA  1 
ATOM   4594 C C   . ALA B 1 235 ? 30.998  -22.075 16.205  1.00 20.11 ? 446 ALA B C   1 
ATOM   4595 O O   . ALA B 1 235 ? 31.736  -21.080 16.238  1.00 19.72 ? 446 ALA B O   1 
ATOM   4596 C CB  . ALA B 1 235 ? 32.013  -24.413 16.418  1.00 18.49 ? 446 ALA B CB  1 
ATOM   4597 N N   . HIS B 1 236 ? 29.786  -22.110 16.752  1.00 19.88 ? 447 HIS B N   1 
ATOM   4598 C CA  . HIS B 1 236 ? 29.252  -21.050 17.589  1.00 20.25 ? 447 HIS B CA  1 
ATOM   4599 C C   . HIS B 1 236 ? 30.279  -20.501 18.600  1.00 19.28 ? 447 HIS B C   1 
ATOM   4600 O O   . HIS B 1 236 ? 30.903  -21.265 19.294  1.00 17.37 ? 447 HIS B O   1 
ATOM   4601 C CB  . HIS B 1 236 ? 28.009  -21.546 18.338  1.00 19.94 ? 447 HIS B CB  1 
ATOM   4602 C CG  . HIS B 1 236 ? 27.112  -20.430 18.759  1.00 23.38 ? 447 HIS B CG  1 
ATOM   4603 N ND1 . HIS B 1 236 ? 27.456  -19.541 19.759  1.00 24.42 ? 447 HIS B ND1 1 
ATOM   4604 C CD2 . HIS B 1 236 ? 25.919  -20.007 18.268  1.00 25.72 ? 447 HIS B CD2 1 
ATOM   4605 C CE1 . HIS B 1 236 ? 26.500  -18.634 19.882  1.00 27.87 ? 447 HIS B CE1 1 
ATOM   4606 N NE2 . HIS B 1 236 ? 25.550  -18.902 19.001  1.00 26.69 ? 447 HIS B NE2 1 
ATOM   4607 N N   . PRO B 1 237 ? 30.437  -19.164 18.686  1.00 20.73 ? 448 PRO B N   1 
ATOM   4608 C CA  . PRO B 1 237 ? 31.377  -18.649 19.685  1.00 22.15 ? 448 PRO B CA  1 
ATOM   4609 C C   . PRO B 1 237 ? 31.053  -19.045 21.137  1.00 21.83 ? 448 PRO B C   1 
ATOM   4610 O O   . PRO B 1 237 ? 31.969  -19.167 21.927  1.00 22.09 ? 448 PRO B O   1 
ATOM   4611 C CB  . PRO B 1 237 ? 31.336  -17.105 19.476  1.00 22.65 ? 448 PRO B CB  1 
ATOM   4612 C CG  . PRO B 1 237 ? 30.036  -16.849 18.734  1.00 23.40 ? 448 PRO B CG  1 
ATOM   4613 C CD  . PRO B 1 237 ? 29.915  -18.075 17.834  1.00 22.11 ? 448 PRO B CD  1 
ATOM   4614 N N   . GLU B 1 238 ? 29.791  -19.289 21.465  1.00 22.35 ? 449 GLU B N   1 
ATOM   4615 C CA  . GLU B 1 238 ? 29.406  -19.739 22.812  1.00 23.36 ? 449 GLU B CA  1 
ATOM   4616 C C   . GLU B 1 238 ? 29.646  -21.227 23.058  1.00 22.61 ? 449 GLU B C   1 
ATOM   4617 O O   . GLU B 1 238 ? 29.615  -21.653 24.189  1.00 22.80 ? 449 GLU B O   1 
ATOM   4618 C CB  . GLU B 1 238 ? 27.943  -19.404 23.133  1.00 23.86 ? 449 GLU B CB  1 
ATOM   4619 C CG  . GLU B 1 238 ? 27.606  -17.916 23.149  1.00 27.72 ? 449 GLU B CG  1 
ATOM   4620 C CD  . GLU B 1 238 ? 28.361  -17.126 24.228  1.00 31.96 ? 449 GLU B CD  1 
ATOM   4621 O OE1 . GLU B 1 238 ? 28.567  -17.643 25.332  1.00 33.92 ? 449 GLU B OE1 1 
ATOM   4622 O OE2 . GLU B 1 238 ? 28.756  -15.969 23.972  1.00 39.56 ? 449 GLU B OE2 1 
ATOM   4623 N N   . ALA B 1 239 ? 29.943  -22.012 22.028  1.00 21.30 ? 450 ALA B N   1 
ATOM   4624 C CA  . ALA B 1 239 ? 30.173  -23.436 22.252  1.00 20.34 ? 450 ALA B CA  1 
ATOM   4625 C C   . ALA B 1 239 ? 31.434  -23.646 23.070  1.00 20.23 ? 450 ALA B C   1 
ATOM   4626 O O   . ALA B 1 239 ? 32.391  -22.931 22.920  1.00 20.39 ? 450 ALA B O   1 
ATOM   4627 C CB  . ALA B 1 239 ? 30.266  -24.206 20.908  1.00 19.49 ? 450 ALA B CB  1 
ATOM   4628 N N   . PRO B 1 240 ? 31.436  -24.652 23.934  1.00 20.24 ? 451 PRO B N   1 
ATOM   4629 C CA  . PRO B 1 240 ? 32.637  -24.935 24.699  1.00 21.06 ? 451 PRO B CA  1 
ATOM   4630 C C   . PRO B 1 240 ? 33.818  -25.348 23.825  1.00 21.07 ? 451 PRO B C   1 
ATOM   4631 O O   . PRO B 1 240 ? 33.659  -26.195 22.965  1.00 20.70 ? 451 PRO B O   1 
ATOM   4632 C CB  . PRO B 1 240 ? 32.215  -26.096 25.628  1.00 20.50 ? 451 PRO B CB  1 
ATOM   4633 C CG  . PRO B 1 240 ? 30.815  -26.384 25.355  1.00 20.92 ? 451 PRO B CG  1 
ATOM   4634 C CD  . PRO B 1 240 ? 30.246  -25.357 24.445  1.00 19.71 ? 451 PRO B CD  1 
ATOM   4635 N N   . ILE B 1 241 ? 34.983  -24.759 24.069  1.00 21.56 ? 452 ILE B N   1 
ATOM   4636 C CA  . ILE B 1 241 ? 36.165  -24.989 23.253  1.00 21.84 ? 452 ILE B CA  1 
ATOM   4637 C C   . ILE B 1 241 ? 36.650  -26.440 23.388  1.00 22.26 ? 452 ILE B C   1 
ATOM   4638 O O   . ILE B 1 241 ? 37.172  -27.032 22.436  1.00 21.53 ? 452 ILE B O   1 
ATOM   4639 C CB  . ILE B 1 241 ? 37.302  -23.959 23.575  1.00 22.69 ? 452 ILE B CB  1 
ATOM   4640 C CG1 . ILE B 1 241 ? 38.379  -23.969 22.470  1.00 24.91 ? 452 ILE B CG1 1 
ATOM   4641 C CG2 . ILE B 1 241 ? 37.955  -24.239 24.961  1.00 21.86 ? 452 ILE B CG2 1 
ATOM   4642 C CD1 . ILE B 1 241 ? 37.901  -23.611 21.078  1.00 23.21 ? 452 ILE B CD1 1 
ATOM   4643 N N   . THR B 1 242 ? 36.403  -27.048 24.537  1.00 22.07 ? 453 THR B N   1 
ATOM   4644 C CA  . THR B 1 242 ? 36.786  -28.410 24.733  1.00 23.01 ? 453 THR B CA  1 
ATOM   4645 C C   . THR B 1 242 ? 35.967  -29.396 23.927  1.00 23.25 ? 453 THR B C   1 
ATOM   4646 O O   . THR B 1 242 ? 36.346  -30.543 23.804  1.00 23.62 ? 453 THR B O   1 
ATOM   4647 C CB  . THR B 1 242 ? 36.749  -28.794 26.213  1.00 24.67 ? 453 THR B CB  1 
ATOM   4648 O OG1 . THR B 1 242 ? 35.408  -28.656 26.720  1.00 26.59 ? 453 THR B OG1 1 
ATOM   4649 C CG2 . THR B 1 242 ? 37.711  -27.910 26.984  1.00 22.95 ? 453 THR B CG2 1 
ATOM   4650 N N   . GLY B 1 243 ? 34.863  -28.960 23.342  1.00 23.38 ? 454 GLY B N   1 
ATOM   4651 C CA  . GLY B 1 243 ? 34.226  -29.764 22.319  1.00 23.66 ? 454 GLY B CA  1 
ATOM   4652 C C   . GLY B 1 243 ? 35.057  -29.996 21.059  1.00 23.82 ? 454 GLY B C   1 
ATOM   4653 O O   . GLY B 1 243 ? 34.701  -30.838 20.260  1.00 25.77 ? 454 GLY B O   1 
ATOM   4654 N N   . TYR B 1 244 ? 36.149  -29.257 20.860  1.00 23.13 ? 455 TYR B N   1 
ATOM   4655 C CA  . TYR B 1 244 ? 36.820  -29.216 19.565  1.00 22.69 ? 455 TYR B CA  1 
ATOM   4656 C C   . TYR B 1 244 ? 38.264  -29.593 19.732  1.00 24.11 ? 455 TYR B C   1 
ATOM   4657 O O   . TYR B 1 244 ? 39.056  -28.823 20.295  1.00 25.38 ? 455 TYR B O   1 
ATOM   4658 C CB  . TYR B 1 244 ? 36.673  -27.844 18.928  1.00 21.74 ? 455 TYR B CB  1 
ATOM   4659 C CG  . TYR B 1 244 ? 35.220  -27.496 18.757  1.00 19.80 ? 455 TYR B CG  1 
ATOM   4660 C CD1 . TYR B 1 244 ? 34.549  -27.771 17.573  1.00 17.87 ? 455 TYR B CD1 1 
ATOM   4661 C CD2 . TYR B 1 244 ? 34.510  -26.939 19.799  1.00 16.15 ? 455 TYR B CD2 1 
ATOM   4662 C CE1 . TYR B 1 244 ? 33.196  -27.508 17.432  1.00 16.56 ? 455 TYR B CE1 1 
ATOM   4663 C CE2 . TYR B 1 244 ? 33.188  -26.638 19.669  1.00 17.61 ? 455 TYR B CE2 1 
ATOM   4664 C CZ  . TYR B 1 244 ? 32.523  -26.921 18.486  1.00 17.61 ? 455 TYR B CZ  1 
ATOM   4665 O OH  . TYR B 1 244 ? 31.199  -26.639 18.393  1.00 14.55 ? 455 TYR B OH  1 
ATOM   4666 N N   . MET B 1 245 ? 38.611  -30.778 19.246  1.00 23.85 ? 456 MET B N   1 
ATOM   4667 C CA  . MET B 1 245 ? 39.930  -31.324 19.485  1.00 25.29 ? 456 MET B CA  1 
ATOM   4668 C C   . MET B 1 245 ? 41.088  -30.411 19.024  1.00 24.12 ? 456 MET B C   1 
ATOM   4669 O O   . MET B 1 245 ? 42.146  -30.383 19.667  1.00 24.34 ? 456 MET B O   1 
ATOM   4670 C CB  . MET B 1 245 ? 40.050  -32.717 18.861  1.00 26.19 ? 456 MET B CB  1 
ATOM   4671 C CG  . MET B 1 245 ? 41.215  -33.532 19.455  1.00 33.22 ? 456 MET B CG  1 
ATOM   4672 S SD  . MET B 1 245 ? 41.396  -35.260 18.827  1.00 44.22 ? 456 MET B SD  1 
ATOM   4673 C CE  . MET B 1 245 ? 39.724  -35.891 19.029  1.00 40.01 ? 456 MET B CE  1 
ATOM   4674 N N   . PHE B 1 246 ? 40.897  -29.676 17.936  1.00 23.46 ? 457 PHE B N   1 
ATOM   4675 C CA  . PHE B 1 246 ? 41.902  -28.709 17.467  1.00 23.39 ? 457 PHE B CA  1 
ATOM   4676 C C   . PHE B 1 246 ? 41.309  -27.322 17.242  1.00 23.23 ? 457 PHE B C   1 
ATOM   4677 O O   . PHE B 1 246 ? 41.759  -26.560 16.366  1.00 23.74 ? 457 PHE B O   1 
ATOM   4678 C CB  . PHE B 1 246 ? 42.563  -29.219 16.201  1.00 24.28 ? 457 PHE B CB  1 
ATOM   4679 C CG  . PHE B 1 246 ? 43.309  -30.506 16.390  1.00 24.27 ? 457 PHE B CG  1 
ATOM   4680 C CD1 . PHE B 1 246 ? 44.537  -30.509 17.021  1.00 24.48 ? 457 PHE B CD1 1 
ATOM   4681 C CD2 . PHE B 1 246 ? 42.786  -31.699 15.941  1.00 24.34 ? 457 PHE B CD2 1 
ATOM   4682 C CE1 . PHE B 1 246 ? 45.264  -31.710 17.182  1.00 27.17 ? 457 PHE B CE1 1 
ATOM   4683 C CE2 . PHE B 1 246 ? 43.488  -32.903 16.100  1.00 26.11 ? 457 PHE B CE2 1 
ATOM   4684 C CZ  . PHE B 1 246 ? 44.736  -32.903 16.736  1.00 26.78 ? 457 PHE B CZ  1 
ATOM   4685 N N   . GLY B 1 247 ? 40.299  -26.987 18.040  1.00 22.07 ? 458 GLY B N   1 
ATOM   4686 C CA  . GLY B 1 247 ? 39.690  -25.661 17.977  1.00 21.41 ? 458 GLY B CA  1 
ATOM   4687 C C   . GLY B 1 247 ? 38.509  -25.595 17.025  1.00 20.69 ? 458 GLY B C   1 
ATOM   4688 O O   . GLY B 1 247 ? 38.148  -26.576 16.380  1.00 19.76 ? 458 GLY B O   1 
ATOM   4689 N N   . LYS B 1 248 ? 37.928  -24.414 16.928  1.00 20.42 ? 459 LYS B N   1 
ATOM   4690 C CA  . LYS B 1 248 ? 36.704  -24.209 16.180  1.00 20.03 ? 459 LYS B CA  1 
ATOM   4691 C C   . LYS B 1 248 ? 37.079  -23.902 14.730  1.00 20.48 ? 459 LYS B C   1 
ATOM   4692 O O   . LYS B 1 248 ? 37.090  -22.745 14.301  1.00 19.57 ? 459 LYS B O   1 
ATOM   4693 C CB  . LYS B 1 248 ? 35.918  -23.057 16.804  1.00 20.53 ? 459 LYS B CB  1 
ATOM   4694 C CG  . LYS B 1 248 ? 35.479  -23.322 18.248  1.00 20.53 ? 459 LYS B CG  1 
ATOM   4695 C CD  . LYS B 1 248 ? 34.621  -22.203 18.797  1.00 20.53 ? 459 LYS B CD  1 
ATOM   4696 C CE  . LYS B 1 248 ? 33.935  -22.573 20.103  1.00 19.45 ? 459 LYS B CE  1 
ATOM   4697 N NZ  . LYS B 1 248 ? 33.248  -21.398 20.736  1.00 17.79 ? 459 LYS B NZ  1 
ATOM   4698 N N   . GLY B 1 249 ? 37.423  -24.963 14.006  1.00 20.12 ? 460 GLY B N   1 
ATOM   4699 C CA  . GLY B 1 249 ? 37.594  -24.908 12.557  1.00 20.41 ? 460 GLY B CA  1 
ATOM   4700 C C   . GLY B 1 249 ? 36.742  -25.921 11.797  1.00 20.01 ? 460 GLY B C   1 
ATOM   4701 O O   . GLY B 1 249 ? 35.828  -26.548 12.353  1.00 19.02 ? 460 GLY B O   1 
ATOM   4702 N N   . ILE B 1 250 ? 37.051  -26.065 10.502  1.00 20.29 ? 461 ILE B N   1 
ATOM   4703 C CA  . ILE B 1 250 ? 36.393  -27.019 9.628   1.00 18.57 ? 461 ILE B CA  1 
ATOM   4704 C C   . ILE B 1 250 ? 37.352  -28.208 9.442   1.00 18.96 ? 461 ILE B C   1 
ATOM   4705 O O   . ILE B 1 250 ? 38.537  -28.030 9.112   1.00 17.83 ? 461 ILE B O   1 
ATOM   4706 C CB  . ILE B 1 250 ? 35.949  -26.364 8.315   1.00 19.95 ? 461 ILE B CB  1 
ATOM   4707 C CG1 . ILE B 1 250 ? 35.159  -25.070 8.646   1.00 20.31 ? 461 ILE B CG1 1 
ATOM   4708 C CG2 . ILE B 1 250 ? 35.096  -27.377 7.499   1.00 17.65 ? 461 ILE B CG2 1 
ATOM   4709 C CD1 . ILE B 1 250 ? 34.816  -24.147 7.514   1.00 22.79 ? 461 ILE B CD1 1 
ATOM   4710 N N   . TYR B 1 251 ? 36.840  -29.412 9.736   1.00 17.86 ? 462 TYR B N   1 
ATOM   4711 C CA  . TYR B 1 251 ? 37.654  -30.593 9.942   1.00 17.35 ? 462 TYR B CA  1 
ATOM   4712 C C   . TYR B 1 251 ? 37.518  -31.538 8.762   1.00 17.77 ? 462 TYR B C   1 
ATOM   4713 O O   . TYR B 1 251 ? 36.423  -31.721 8.243   1.00 17.89 ? 462 TYR B O   1 
ATOM   4714 C CB  . TYR B 1 251 ? 37.197  -31.330 11.175  1.00 18.36 ? 462 TYR B CB  1 
ATOM   4715 C CG  . TYR B 1 251 ? 37.629  -30.737 12.500  1.00 18.23 ? 462 TYR B CG  1 
ATOM   4716 C CD1 . TYR B 1 251 ? 37.218  -29.491 12.889  1.00 15.58 ? 462 TYR B CD1 1 
ATOM   4717 C CD2 . TYR B 1 251 ? 38.413  -31.463 13.380  1.00 21.26 ? 462 TYR B CD2 1 
ATOM   4718 C CE1 . TYR B 1 251 ? 37.591  -28.957 14.124  1.00 16.91 ? 462 TYR B CE1 1 
ATOM   4719 C CE2 . TYR B 1 251 ? 38.784  -30.929 14.614  1.00 22.75 ? 462 TYR B CE2 1 
ATOM   4720 C CZ  . TYR B 1 251 ? 38.372  -29.675 14.979  1.00 20.21 ? 462 TYR B CZ  1 
ATOM   4721 O OH  . TYR B 1 251 ? 38.770  -29.137 16.216  1.00 19.92 ? 462 TYR B OH  1 
ATOM   4722 N N   . PHE B 1 252 ? 38.627  -32.109 8.325   1.00 17.60 ? 463 PHE B N   1 
ATOM   4723 C CA  . PHE B 1 252 ? 38.630  -32.982 7.149   1.00 17.94 ? 463 PHE B CA  1 
ATOM   4724 C C   . PHE B 1 252 ? 39.530  -34.176 7.365   1.00 18.26 ? 463 PHE B C   1 
ATOM   4725 O O   . PHE B 1 252 ? 40.524  -34.111 8.122   1.00 18.77 ? 463 PHE B O   1 
ATOM   4726 C CB  . PHE B 1 252 ? 39.100  -32.263 5.876   1.00 17.54 ? 463 PHE B CB  1 
ATOM   4727 C CG  . PHE B 1 252 ? 38.269  -31.059 5.492   1.00 17.63 ? 463 PHE B CG  1 
ATOM   4728 C CD1 . PHE B 1 252 ? 37.198  -31.185 4.608   1.00 15.92 ? 463 PHE B CD1 1 
ATOM   4729 C CD2 . PHE B 1 252 ? 38.586  -29.819 5.970   1.00 15.60 ? 463 PHE B CD2 1 
ATOM   4730 C CE1 . PHE B 1 252 ? 36.452  -30.151 4.278   1.00 16.58 ? 463 PHE B CE1 1 
ATOM   4731 C CE2 . PHE B 1 252 ? 37.836  -28.726 5.618   1.00 14.60 ? 463 PHE B CE2 1 
ATOM   4732 C CZ  . PHE B 1 252 ? 36.783  -28.867 4.773   1.00 16.80 ? 463 PHE B CZ  1 
ATOM   4733 N N   . ALA B 1 253 ? 39.212  -35.261 6.661   1.00 18.23 ? 464 ALA B N   1 
ATOM   4734 C CA  . ALA B 1 253 ? 40.035  -36.447 6.702   1.00 19.92 ? 464 ALA B CA  1 
ATOM   4735 C C   . ALA B 1 253 ? 40.600  -36.780 5.312   1.00 20.72 ? 464 ALA B C   1 
ATOM   4736 O O   . ALA B 1 253 ? 40.038  -36.375 4.287   1.00 21.19 ? 464 ALA B O   1 
ATOM   4737 C CB  . ALA B 1 253 ? 39.216  -37.617 7.250   1.00 19.72 ? 464 ALA B CB  1 
ATOM   4738 N N   . ASP B 1 254 ? 41.733  -37.479 5.289   1.00 21.98 ? 465 ASP B N   1 
ATOM   4739 C CA  . ASP B 1 254 ? 42.206  -38.113 4.052   1.00 22.16 ? 465 ASP B CA  1 
ATOM   4740 C C   . ASP B 1 254 ? 41.804  -39.593 3.947   1.00 22.04 ? 465 ASP B C   1 
ATOM   4741 O O   . ASP B 1 254 ? 42.126  -40.247 2.968   1.00 21.86 ? 465 ASP B O   1 
ATOM   4742 C CB  . ASP B 1 254 ? 43.704  -37.908 3.805   1.00 22.57 ? 465 ASP B CB  1 
ATOM   4743 C CG  . ASP B 1 254 ? 44.565  -38.424 4.875   1.00 24.12 ? 465 ASP B CG  1 
ATOM   4744 O OD1 . ASP B 1 254 ? 44.173  -39.403 5.552   1.00 25.37 ? 465 ASP B OD1 1 
ATOM   4745 O OD2 . ASP B 1 254 ? 45.696  -37.866 5.014   1.00 26.58 ? 465 ASP B OD2 1 
ATOM   4746 N N   . MET B 1 255 ? 41.094  -40.094 4.955   1.00 21.55 ? 466 MET B N   1 
ATOM   4747 C CA  . MET B 1 255 ? 40.521  -41.433 4.933   1.00 20.66 ? 466 MET B CA  1 
ATOM   4748 C C   . MET B 1 255 ? 39.013  -41.366 4.933   1.00 20.62 ? 466 MET B C   1 
ATOM   4749 O O   . MET B 1 255 ? 38.353  -40.823 5.865   1.00 20.52 ? 466 MET B O   1 
ATOM   4750 C CB  . MET B 1 255 ? 40.983  -42.234 6.139   1.00 21.29 ? 466 MET B CB  1 
ATOM   4751 C CG  . MET B 1 255 ? 42.493  -42.356 6.277   1.00 22.45 ? 466 MET B CG  1 
ATOM   4752 S SD  . MET B 1 255 ? 43.294  -43.462 5.057   1.00 25.89 ? 466 MET B SD  1 
ATOM   4753 C CE  . MET B 1 255 ? 42.904  -45.103 5.738   1.00 19.73 ? 466 MET B CE  1 
ATOM   4754 N N   . SER B 1 256 ? 38.453  -41.968 3.898   1.00 20.17 ? 467 SER B N   1 
ATOM   4755 C CA  . SER B 1 256 ? 37.041  -41.888 3.654   1.00 19.89 ? 467 SER B CA  1 
ATOM   4756 C C   . SER B 1 256 ? 36.227  -42.342 4.887   1.00 19.93 ? 467 SER B C   1 
ATOM   4757 O O   . SER B 1 256 ? 35.241  -41.710 5.233   1.00 20.20 ? 467 SER B O   1 
ATOM   4758 C CB  . SER B 1 256 ? 36.694  -42.710 2.424   1.00 19.62 ? 467 SER B CB  1 
ATOM   4759 O OG  . SER B 1 256 ? 36.876  -44.087 2.694   1.00 19.31 ? 467 SER B OG  1 
ATOM   4760 N N   . SER B 1 257 ? 36.668  -43.413 5.538   1.00 20.02 ? 468 SER B N   1 
ATOM   4761 C CA  . SER B 1 257 ? 35.933  -44.016 6.630   1.00 20.48 ? 468 SER B CA  1 
ATOM   4762 C C   . SER B 1 257 ? 36.043  -43.179 7.918   1.00 21.01 ? 468 SER B C   1 
ATOM   4763 O O   . SER B 1 257 ? 35.099  -43.129 8.681   1.00 20.35 ? 468 SER B O   1 
ATOM   4764 C CB  . SER B 1 257 ? 36.426  -45.429 6.867   1.00 20.32 ? 468 SER B CB  1 
ATOM   4765 O OG  . SER B 1 257 ? 37.797  -45.406 7.235   1.00 21.73 ? 468 SER B OG  1 
ATOM   4766 N N   . LYS B 1 258 ? 37.172  -42.507 8.147   1.00 21.63 ? 469 LYS B N   1 
ATOM   4767 C CA  . LYS B 1 258 ? 37.243  -41.552 9.275   1.00 21.69 ? 469 LYS B CA  1 
ATOM   4768 C C   . LYS B 1 258 ? 36.090  -40.547 9.218   1.00 21.58 ? 469 LYS B C   1 
ATOM   4769 O O   . LYS B 1 258 ? 35.410  -40.301 10.222  1.00 21.10 ? 469 LYS B O   1 
ATOM   4770 C CB  . LYS B 1 258 ? 38.558  -40.798 9.293   1.00 22.20 ? 469 LYS B CB  1 
ATOM   4771 C CG  . LYS B 1 258 ? 38.701  -39.904 10.504  1.00 22.31 ? 469 LYS B CG  1 
ATOM   4772 C CD  . LYS B 1 258 ? 40.109  -39.445 10.736  1.00 19.77 ? 469 LYS B CD  1 
ATOM   4773 C CE  . LYS B 1 258 ? 40.170  -38.563 11.943  1.00 19.88 ? 469 LYS B CE  1 
ATOM   4774 N NZ  . LYS B 1 258 ? 41.559  -38.301 12.435  1.00 18.83 ? 469 LYS B NZ  1 
ATOM   4775 N N   . SER B 1 259 ? 35.862  -39.986 8.030   1.00 20.67 ? 470 SER B N   1 
ATOM   4776 C CA  . SER B 1 259 ? 34.752  -39.063 7.810   1.00 19.64 ? 470 SER B CA  1 
ATOM   4777 C C   . SER B 1 259 ? 33.372  -39.753 7.791   1.00 19.21 ? 470 SER B C   1 
ATOM   4778 O O   . SER B 1 259 ? 32.401  -39.240 8.368   1.00 17.70 ? 470 SER B O   1 
ATOM   4779 C CB  . SER B 1 259 ? 34.989  -38.237 6.520   1.00 19.57 ? 470 SER B CB  1 
ATOM   4780 O OG  . SER B 1 259 ? 35.962  -37.214 6.704   1.00 18.10 ? 470 SER B OG  1 
ATOM   4781 N N   . ALA B 1 260 ? 33.274  -40.924 7.164   1.00 19.32 ? 471 ALA B N   1 
ATOM   4782 C CA  . ALA B 1 260 ? 31.954  -41.607 7.040   1.00 19.04 ? 471 ALA B CA  1 
ATOM   4783 C C   . ALA B 1 260 ? 31.442  -42.056 8.402   1.00 18.96 ? 471 ALA B C   1 
ATOM   4784 O O   . ALA B 1 260 ? 30.248  -42.218 8.576   1.00 19.56 ? 471 ALA B O   1 
ATOM   4785 C CB  . ALA B 1 260 ? 31.978  -42.791 6.067   1.00 17.56 ? 471 ALA B CB  1 
ATOM   4786 N N   . ASN B 1 261 ? 32.336  -42.297 9.349   1.00 19.32 ? 472 ASN B N   1 
ATOM   4787 C CA  . ASN B 1 261 ? 31.910  -42.557 10.752  1.00 19.07 ? 472 ASN B CA  1 
ATOM   4788 C C   . ASN B 1 261 ? 31.058  -41.399 11.326  1.00 18.41 ? 472 ASN B C   1 
ATOM   4789 O O   . ASN B 1 261 ? 30.077  -41.614 12.056  1.00 18.02 ? 472 ASN B O   1 
ATOM   4790 C CB  . ASN B 1 261 ? 33.112  -42.845 11.654  1.00 19.86 ? 472 ASN B CB  1 
ATOM   4791 C CG  . ASN B 1 261 ? 33.766  -44.195 11.384  1.00 20.90 ? 472 ASN B CG  1 
ATOM   4792 O OD1 . ASN B 1 261 ? 33.188  -45.052 10.733  1.00 22.66 ? 472 ASN B OD1 1 
ATOM   4793 N ND2 . ASN B 1 261 ? 34.977  -44.393 11.917  1.00 20.06 ? 472 ASN B ND2 1 
ATOM   4794 N N   . TYR B 1 262 ? 31.350  -40.178 10.908  1.00 17.37 ? 473 TYR B N   1 
ATOM   4795 C CA  . TYR B 1 262 ? 30.565  -39.041 11.330  1.00 17.47 ? 473 TYR B CA  1 
ATOM   4796 C C   . TYR B 1 262 ? 29.254  -38.879 10.587  1.00 18.27 ? 473 TYR B C   1 
ATOM   4797 O O   . TYR B 1 262 ? 28.529  -37.906 10.858  1.00 17.52 ? 473 TYR B O   1 
ATOM   4798 C CB  . TYR B 1 262 ? 31.386  -37.746 11.268  1.00 17.87 ? 473 TYR B CB  1 
ATOM   4799 C CG  . TYR B 1 262 ? 32.512  -37.715 12.295  1.00 19.05 ? 473 TYR B CG  1 
ATOM   4800 C CD1 . TYR B 1 262 ? 32.268  -37.361 13.611  1.00 20.04 ? 473 TYR B CD1 1 
ATOM   4801 C CD2 . TYR B 1 262 ? 33.799  -38.082 11.946  1.00 18.67 ? 473 TYR B CD2 1 
ATOM   4802 C CE1 . TYR B 1 262 ? 33.302  -37.359 14.579  1.00 22.39 ? 473 TYR B CE1 1 
ATOM   4803 C CE2 . TYR B 1 262 ? 34.830  -38.059 12.873  1.00 24.41 ? 473 TYR B CE2 1 
ATOM   4804 C CZ  . TYR B 1 262 ? 34.576  -37.683 14.190  1.00 25.06 ? 473 TYR B CZ  1 
ATOM   4805 O OH  . TYR B 1 262 ? 35.600  -37.653 15.095  1.00 28.78 ? 473 TYR B OH  1 
ATOM   4806 N N   . CYS B 1 263 ? 28.917  -39.818 9.678   1.00 17.56 ? 474 CYS B N   1 
ATOM   4807 C CA  . CYS B 1 263 ? 27.555  -39.916 9.128   1.00 17.35 ? 474 CYS B CA  1 
ATOM   4808 C C   . CYS B 1 263 ? 26.550  -40.503 10.094  1.00 17.87 ? 474 CYS B C   1 
ATOM   4809 O O   . CYS B 1 263 ? 25.331  -40.371 9.887   1.00 17.44 ? 474 CYS B O   1 
ATOM   4810 C CB  . CYS B 1 263 ? 27.539  -40.803 7.875   1.00 18.13 ? 474 CYS B CB  1 
ATOM   4811 S SG  . CYS B 1 263 ? 28.551  -40.083 6.469   1.00 19.26 ? 474 CYS B SG  1 
ATOM   4812 N N   . PHE B 1 264 ? 27.074  -41.230 11.080  1.00 18.54 ? 475 PHE B N   1 
ATOM   4813 C CA  . PHE B 1 264 ? 26.288  -42.003 12.026  1.00 18.39 ? 475 PHE B CA  1 
ATOM   4814 C C   . PHE B 1 264 ? 25.218  -42.753 11.297  1.00 18.83 ? 475 PHE B C   1 
ATOM   4815 O O   . PHE B 1 264 ? 24.068  -42.750 11.709  1.00 18.35 ? 475 PHE B O   1 
ATOM   4816 C CB  . PHE B 1 264 ? 25.720  -41.101 13.132  1.00 18.30 ? 475 PHE B CB  1 
ATOM   4817 C CG  . PHE B 1 264 ? 26.793  -40.491 13.976  1.00 17.49 ? 475 PHE B CG  1 
ATOM   4818 C CD1 . PHE B 1 264 ? 27.321  -41.181 15.060  1.00 19.39 ? 475 PHE B CD1 1 
ATOM   4819 C CD2 . PHE B 1 264 ? 27.310  -39.258 13.661  1.00 17.48 ? 475 PHE B CD2 1 
ATOM   4820 C CE1 . PHE B 1 264 ? 28.325  -40.659 15.804  1.00 18.03 ? 475 PHE B CE1 1 
ATOM   4821 C CE2 . PHE B 1 264 ? 28.322  -38.708 14.412  1.00 17.65 ? 475 PHE B CE2 1 
ATOM   4822 C CZ  . PHE B 1 264 ? 28.832  -39.399 15.476  1.00 21.08 ? 475 PHE B CZ  1 
ATOM   4823 N N   . ALA B 1 265 ? 25.606  -43.413 10.206  1.00 18.81 ? 476 ALA B N   1 
ATOM   4824 C CA  . ALA B 1 265 ? 24.698  -44.311 9.502   1.00 19.00 ? 476 ALA B CA  1 
ATOM   4825 C C   . ALA B 1 265 ? 24.513  -45.588 10.330  1.00 20.41 ? 476 ALA B C   1 
ATOM   4826 O O   . ALA B 1 265 ? 25.297  -45.857 11.237  1.00 20.77 ? 476 ALA B O   1 
ATOM   4827 C CB  . ALA B 1 265 ? 25.255  -44.632 8.115   1.00 19.52 ? 476 ALA B CB  1 
ATOM   4828 N N   . SER B 1 266 ? 23.481  -46.367 10.041  1.00 21.27 ? 477 SER B N   1 
ATOM   4829 C CA  . SER B 1 266 ? 23.273  -47.629 10.768  1.00 23.17 ? 477 SER B CA  1 
ATOM   4830 C C   . SER B 1 266 ? 22.563  -48.658 9.899   1.00 24.79 ? 477 SER B C   1 
ATOM   4831 O O   . SER B 1 266 ? 22.143  -48.374 8.774   1.00 24.93 ? 477 SER B O   1 
ATOM   4832 C CB  . SER B 1 266 ? 22.421  -47.381 12.027  1.00 23.01 ? 477 SER B CB  1 
ATOM   4833 O OG  . SER B 1 266 ? 21.080  -47.116 11.655  1.00 22.34 ? 477 SER B OG  1 
ATOM   4834 N N   . ARG B 1 267 ? 22.369  -49.849 10.454  1.00 27.31 ? 478 ARG B N   1 
ATOM   4835 C CA  . ARG B 1 267 ? 21.644  -50.913 9.768   1.00 28.71 ? 478 ARG B CA  1 
ATOM   4836 C C   . ARG B 1 267 ? 20.277  -50.429 9.316   1.00 28.55 ? 478 ARG B C   1 
ATOM   4837 O O   . ARG B 1 267 ? 19.822  -50.768 8.231   1.00 28.36 ? 478 ARG B O   1 
ATOM   4838 C CB  . ARG B 1 267 ? 21.411  -52.118 10.698  1.00 30.02 ? 478 ARG B CB  1 
ATOM   4839 C CG  . ARG B 1 267 ? 22.630  -52.872 11.177  1.00 34.71 ? 478 ARG B CG  1 
ATOM   4840 C CD  . ARG B 1 267 ? 22.204  -54.017 12.148  1.00 38.88 ? 478 ARG B CD  1 
ATOM   4841 N NE  . ARG B 1 267 ? 22.055  -53.550 13.536  1.00 41.87 ? 478 ARG B NE  1 
ATOM   4842 C CZ  . ARG B 1 267 ? 20.903  -53.368 14.206  1.00 44.60 ? 478 ARG B CZ  1 
ATOM   4843 N NH1 . ARG B 1 267 ? 19.697  -53.592 13.661  1.00 44.92 ? 478 ARG B NH1 1 
ATOM   4844 N NH2 . ARG B 1 267 ? 20.961  -52.947 15.467  1.00 46.00 ? 478 ARG B NH2 1 
ATOM   4845 N N   . LEU B 1 268 ? 19.605  -49.666 10.176  1.00 29.01 ? 479 LEU B N   1 
ATOM   4846 C CA  . LEU B 1 268 ? 18.257  -49.199 9.875   1.00 30.48 ? 479 LEU B CA  1 
ATOM   4847 C C   . LEU B 1 268 ? 18.279  -48.035 8.888   1.00 29.32 ? 479 LEU B C   1 
ATOM   4848 O O   . LEU B 1 268 ? 17.361  -47.865 8.088   1.00 30.15 ? 479 LEU B O   1 
ATOM   4849 C CB  . LEU B 1 268 ? 17.507  -48.776 11.156  1.00 31.53 ? 479 LEU B CB  1 
ATOM   4850 C CG  . LEU B 1 268 ? 16.016  -48.353 10.962  1.00 34.74 ? 479 LEU B CG  1 
ATOM   4851 C CD1 . LEU B 1 268 ? 15.131  -49.488 10.359  1.00 37.61 ? 479 LEU B CD1 1 
ATOM   4852 C CD2 . LEU B 1 268 ? 15.376  -47.820 12.245  1.00 35.30 ? 479 LEU B CD2 1 
ATOM   4853 N N   . LYS B 1 269 ? 19.299  -47.201 8.973   1.00 28.27 ? 480 LYS B N   1 
ATOM   4854 C CA  . LYS B 1 269 ? 19.369  -46.013 8.091   1.00 27.07 ? 480 LYS B CA  1 
ATOM   4855 C C   . LYS B 1 269 ? 20.736  -46.044 7.448   1.00 25.72 ? 480 LYS B C   1 
ATOM   4856 O O   . LYS B 1 269 ? 21.685  -45.415 7.918   1.00 23.78 ? 480 LYS B O   1 
ATOM   4857 C CB  . LYS B 1 269 ? 19.065  -44.757 8.898   1.00 27.13 ? 480 LYS B CB  1 
ATOM   4858 C CG  . LYS B 1 269 ? 17.566  -44.741 9.291   1.00 29.88 ? 480 LYS B CG  1 
ATOM   4859 C CD  . LYS B 1 269 ? 17.207  -43.657 10.259  1.00 33.67 ? 480 LYS B CD  1 
ATOM   4860 C CE  . LYS B 1 269 ? 15.687  -43.351 10.207  1.00 37.24 ? 480 LYS B CE  1 
ATOM   4861 N NZ  . LYS B 1 269 ? 14.822  -44.612 10.216  1.00 39.28 ? 480 LYS B NZ  1 
ATOM   4862 N N   . ASN B 1 270 ? 20.805  -46.841 6.385   1.00 24.97 ? 481 ASN B N   1 
ATOM   4863 C CA  . ASN B 1 270 ? 22.059  -47.221 5.777   1.00 25.66 ? 481 ASN B CA  1 
ATOM   4864 C C   . ASN B 1 270 ? 22.529  -46.351 4.577   1.00 24.54 ? 481 ASN B C   1 
ATOM   4865 O O   . ASN B 1 270 ? 23.513  -46.696 3.947   1.00 24.87 ? 481 ASN B O   1 
ATOM   4866 C CB  . ASN B 1 270 ? 22.004  -48.730 5.416   1.00 26.30 ? 481 ASN B CB  1 
ATOM   4867 C CG  . ASN B 1 270 ? 21.145  -49.024 4.199   1.00 28.57 ? 481 ASN B CG  1 
ATOM   4868 O OD1 . ASN B 1 270 ? 20.109  -48.419 3.983   1.00 33.47 ? 481 ASN B OD1 1 
ATOM   4869 N ND2 . ASN B 1 270 ? 21.589  -49.957 3.394   1.00 31.30 ? 481 ASN B ND2 1 
ATOM   4870 N N   . THR B 1 271 ? 21.804  -45.272 4.271   1.00 23.52 ? 482 THR B N   1 
ATOM   4871 C CA  . THR B 1 271 ? 22.167  -44.292 3.258   1.00 22.61 ? 482 THR B CA  1 
ATOM   4872 C C   . THR B 1 271 ? 22.642  -43.004 3.937   1.00 21.97 ? 482 THR B C   1 
ATOM   4873 O O   . THR B 1 271 ? 21.897  -42.372 4.687   1.00 22.47 ? 482 THR B O   1 
ATOM   4874 C CB  . THR B 1 271 ? 20.971  -43.910 2.347   1.00 23.40 ? 482 THR B CB  1 
ATOM   4875 O OG1 . THR B 1 271 ? 20.404  -45.065 1.735   1.00 23.15 ? 482 THR B OG1 1 
ATOM   4876 C CG2 . THR B 1 271 ? 21.413  -42.930 1.249   1.00 21.67 ? 482 THR B CG2 1 
ATOM   4877 N N   . GLY B 1 272 ? 23.884  -42.626 3.669   1.00 21.39 ? 483 GLY B N   1 
ATOM   4878 C CA  . GLY B 1 272 ? 24.492  -41.383 4.159   1.00 20.08 ? 483 GLY B CA  1 
ATOM   4879 C C   . GLY B 1 272 ? 25.113  -40.625 2.982   1.00 20.50 ? 483 GLY B C   1 
ATOM   4880 O O   . GLY B 1 272 ? 25.170  -41.157 1.867   1.00 20.66 ? 483 GLY B O   1 
ATOM   4881 N N   . LEU B 1 273 ? 25.591  -39.410 3.229   1.00 18.02 ? 484 LEU B N   1 
ATOM   4882 C CA  . LEU B 1 273 ? 26.303  -38.621 2.206   1.00 18.24 ? 484 LEU B CA  1 
ATOM   4883 C C   . LEU B 1 273 ? 27.680  -38.307 2.718   1.00 18.01 ? 484 LEU B C   1 
ATOM   4884 O O   . LEU B 1 273 ? 27.917  -38.302 3.934   1.00 17.42 ? 484 LEU B O   1 
ATOM   4885 C CB  . LEU B 1 273 ? 25.581  -37.347 1.885   1.00 17.28 ? 484 LEU B CB  1 
ATOM   4886 C CG  . LEU B 1 273 ? 24.131  -37.482 1.440   1.00 19.30 ? 484 LEU B CG  1 
ATOM   4887 C CD1 . LEU B 1 273 ? 23.557  -36.098 1.257   1.00 19.81 ? 484 LEU B CD1 1 
ATOM   4888 C CD2 . LEU B 1 273 ? 24.037  -38.275 0.119   1.00 19.58 ? 484 LEU B CD2 1 
ATOM   4889 N N   . LEU B 1 274 ? 28.593  -38.121 1.782   1.00 18.38 ? 485 LEU B N   1 
ATOM   4890 C CA  . LEU B 1 274 ? 29.974  -37.742 2.045   1.00 18.49 ? 485 LEU B CA  1 
ATOM   4891 C C   . LEU B 1 274 ? 30.311  -36.656 1.093   1.00 19.44 ? 485 LEU B C   1 
ATOM   4892 O O   . LEU B 1 274 ? 29.989  -36.720 -0.102  1.00 19.01 ? 485 LEU B O   1 
ATOM   4893 C CB  . LEU B 1 274 ? 30.968  -38.886 1.784   1.00 19.35 ? 485 LEU B CB  1 
ATOM   4894 C CG  . LEU B 1 274 ? 31.276  -39.906 2.853   1.00 19.89 ? 485 LEU B CG  1 
ATOM   4895 C CD1 . LEU B 1 274 ? 32.223  -40.949 2.297   1.00 17.89 ? 485 LEU B CD1 1 
ATOM   4896 C CD2 . LEU B 1 274 ? 31.868  -39.212 4.101   1.00 20.66 ? 485 LEU B CD2 1 
ATOM   4897 N N   . LEU B 1 275 ? 31.002  -35.657 1.624   1.00 19.94 ? 486 LEU B N   1 
ATOM   4898 C CA  . LEU B 1 275 ? 31.337  -34.497 0.876   1.00 20.68 ? 486 LEU B CA  1 
ATOM   4899 C C   . LEU B 1 275 ? 32.820  -34.498 0.607   1.00 20.28 ? 486 LEU B C   1 
ATOM   4900 O O   . LEU B 1 275 ? 33.657  -34.827 1.488   1.00 20.29 ? 486 LEU B O   1 
ATOM   4901 C CB  . LEU B 1 275 ? 30.969  -33.261 1.692   1.00 21.19 ? 486 LEU B CB  1 
ATOM   4902 C CG  . LEU B 1 275 ? 31.055  -31.864 1.109   1.00 21.35 ? 486 LEU B CG  1 
ATOM   4903 C CD1 . LEU B 1 275 ? 29.888  -31.633 0.099   1.00 18.44 ? 486 LEU B CD1 1 
ATOM   4904 C CD2 . LEU B 1 275 ? 31.016  -30.852 2.325   1.00 19.01 ? 486 LEU B CD2 1 
ATOM   4905 N N   . LEU B 1 276 ? 33.147  -34.128 -0.614  1.00 20.02 ? 487 LEU B N   1 
ATOM   4906 C CA  . LEU B 1 276 ? 34.523  -33.887 -0.970  1.00 20.59 ? 487 LEU B CA  1 
ATOM   4907 C C   . LEU B 1 276 ? 34.639  -32.406 -1.237  1.00 19.78 ? 487 LEU B C   1 
ATOM   4908 O O   . LEU B 1 276 ? 33.795  -31.823 -1.877  1.00 19.68 ? 487 LEU B O   1 
ATOM   4909 C CB  . LEU B 1 276 ? 34.931  -34.686 -2.224  1.00 21.04 ? 487 LEU B CB  1 
ATOM   4910 C CG  . LEU B 1 276 ? 35.318  -36.144 -1.981  1.00 21.48 ? 487 LEU B CG  1 
ATOM   4911 C CD1 . LEU B 1 276 ? 35.367  -36.896 -3.328  1.00 21.86 ? 487 LEU B CD1 1 
ATOM   4912 C CD2 . LEU B 1 276 ? 36.615  -36.288 -1.232  1.00 19.45 ? 487 LEU B CD2 1 
ATOM   4913 N N   . SER B 1 277 ? 35.723  -31.828 -0.764  1.00 19.90 ? 488 SER B N   1 
ATOM   4914 C CA  . SER B 1 277 ? 35.952  -30.412 -0.885  1.00 20.60 ? 488 SER B CA  1 
ATOM   4915 C C   . SER B 1 277 ? 37.391  -30.141 -1.167  1.00 20.72 ? 488 SER B C   1 
ATOM   4916 O O   . SER B 1 277 ? 38.275  -30.817 -0.681  1.00 19.92 ? 488 SER B O   1 
ATOM   4917 C CB  . SER B 1 277 ? 35.604  -29.686 0.435   1.00 20.29 ? 488 SER B CB  1 
ATOM   4918 O OG  . SER B 1 277 ? 34.214  -29.760 0.708   1.00 20.15 ? 488 SER B OG  1 
ATOM   4919 N N   . GLU B 1 278 ? 37.615  -29.087 -1.910  1.00 22.11 ? 489 GLU B N   1 
ATOM   4920 C CA  . GLU B 1 278 ? 38.961  -28.565 -2.045  1.00 23.86 ? 489 GLU B CA  1 
ATOM   4921 C C   . GLU B 1 278 ? 39.284  -27.771 -0.824  1.00 23.40 ? 489 GLU B C   1 
ATOM   4922 O O   . GLU B 1 278 ? 38.539  -26.878 -0.448  1.00 23.86 ? 489 GLU B O   1 
ATOM   4923 C CB  . GLU B 1 278 ? 39.053  -27.707 -3.299  1.00 25.13 ? 489 GLU B CB  1 
ATOM   4924 C CG  . GLU B 1 278 ? 38.786  -28.534 -4.547  1.00 27.54 ? 489 GLU B CG  1 
ATOM   4925 C CD  . GLU B 1 278 ? 39.091  -27.806 -5.830  1.00 29.63 ? 489 GLU B CD  1 
ATOM   4926 O OE1 . GLU B 1 278 ? 39.125  -26.566 -5.807  1.00 33.45 ? 489 GLU B OE1 1 
ATOM   4927 O OE2 . GLU B 1 278 ? 39.262  -28.492 -6.862  1.00 32.81 ? 489 GLU B OE2 1 
ATOM   4928 N N   . VAL B 1 279 ? 40.395  -28.125 -0.193  1.00 24.39 ? 490 VAL B N   1 
ATOM   4929 C CA  . VAL B 1 279 ? 40.827  -27.487 1.022   1.00 23.86 ? 490 VAL B CA  1 
ATOM   4930 C C   . VAL B 1 279 ? 42.185  -26.844 0.806   1.00 24.43 ? 490 VAL B C   1 
ATOM   4931 O O   . VAL B 1 279 ? 43.166  -27.534 0.499   1.00 23.67 ? 490 VAL B O   1 
ATOM   4932 C CB  . VAL B 1 279 ? 40.895  -28.470 2.167   1.00 23.31 ? 490 VAL B CB  1 
ATOM   4933 C CG1 . VAL B 1 279 ? 41.219  -27.739 3.483   1.00 21.60 ? 490 VAL B CG1 1 
ATOM   4934 C CG2 . VAL B 1 279 ? 39.553  -29.252 2.269   1.00 23.26 ? 490 VAL B CG2 1 
ATOM   4935 N N   . ALA B 1 280 ? 42.228  -25.527 0.999   1.00 24.15 ? 491 ALA B N   1 
ATOM   4936 C CA  . ALA B 1 280 ? 43.470  -24.747 0.837   1.00 25.50 ? 491 ALA B CA  1 
ATOM   4937 C C   . ALA B 1 280 ? 44.224  -24.744 2.144   1.00 26.03 ? 491 ALA B C   1 
ATOM   4938 O O   . ALA B 1 280 ? 44.010  -23.876 2.968   1.00 26.97 ? 491 ALA B O   1 
ATOM   4939 C CB  . ALA B 1 280 ? 43.150  -23.323 0.409   1.00 25.32 ? 491 ALA B CB  1 
ATOM   4940 N N   . LEU B 1 281 ? 45.110  -25.716 2.325   1.00 26.47 ? 492 LEU B N   1 
ATOM   4941 C CA  . LEU B 1 281 ? 45.758  -25.940 3.592   1.00 26.89 ? 492 LEU B CA  1 
ATOM   4942 C C   . LEU B 1 281 ? 46.899  -24.948 3.834   1.00 28.56 ? 492 LEU B C   1 
ATOM   4943 O O   . LEU B 1 281 ? 47.173  -24.553 4.981   1.00 28.32 ? 492 LEU B O   1 
ATOM   4944 C CB  . LEU B 1 281 ? 46.308  -27.367 3.665   1.00 26.92 ? 492 LEU B CB  1 
ATOM   4945 C CG  . LEU B 1 281 ? 45.314  -28.532 3.496   1.00 27.20 ? 492 LEU B CG  1 
ATOM   4946 C CD1 . LEU B 1 281 ? 46.017  -29.888 3.553   1.00 23.99 ? 492 LEU B CD1 1 
ATOM   4947 C CD2 . LEU B 1 281 ? 44.255  -28.429 4.586   1.00 27.93 ? 492 LEU B CD2 1 
ATOM   4948 N N   . GLY B 1 282 ? 47.564  -24.527 2.764   1.00 29.60 ? 493 GLY B N   1 
ATOM   4949 C CA  . GLY B 1 282 ? 48.804  -23.772 2.930   1.00 31.05 ? 493 GLY B CA  1 
ATOM   4950 C C   . GLY B 1 282 ? 49.788  -24.555 3.784   1.00 31.69 ? 493 GLY B C   1 
ATOM   4951 O O   . GLY B 1 282 ? 49.913  -25.782 3.643   1.00 32.21 ? 493 GLY B O   1 
ATOM   4952 N N   . GLN B 1 283 ? 50.463  -23.852 4.683   1.00 32.41 ? 494 GLN B N   1 
ATOM   4953 C CA  . GLN B 1 283 ? 51.389  -24.468 5.611   1.00 33.67 ? 494 GLN B CA  1 
ATOM   4954 C C   . GLN B 1 283 ? 50.572  -24.961 6.776   1.00 33.72 ? 494 GLN B C   1 
ATOM   4955 O O   . GLN B 1 283 ? 49.760  -24.192 7.333   1.00 32.61 ? 494 GLN B O   1 
ATOM   4956 C CB  . GLN B 1 283 ? 52.416  -23.460 6.153   1.00 34.81 ? 494 GLN B CB  1 
ATOM   4957 C CG  . GLN B 1 283 ? 53.360  -22.887 5.134   1.00 37.29 ? 494 GLN B CG  1 
ATOM   4958 C CD  . GLN B 1 283 ? 54.314  -23.945 4.610   1.00 42.03 ? 494 GLN B CD  1 
ATOM   4959 O OE1 . GLN B 1 283 ? 54.053  -24.594 3.579   1.00 42.14 ? 494 GLN B OE1 1 
ATOM   4960 N NE2 . GLN B 1 283 ? 55.409  -24.161 5.346   1.00 45.05 ? 494 GLN B NE2 1 
ATOM   4961 N N   . CYS B 1 284 ? 50.804  -26.224 7.148   1.00 33.51 ? 495 CYS B N   1 
ATOM   4962 C CA  . CYS B 1 284 ? 50.083  -26.848 8.236   1.00 33.83 ? 495 CYS B CA  1 
ATOM   4963 C C   . CYS B 1 284 ? 50.916  -26.680 9.463   1.00 34.46 ? 495 CYS B C   1 
ATOM   4964 O O   . CYS B 1 284 ? 52.135  -26.838 9.414   1.00 34.67 ? 495 CYS B O   1 
ATOM   4965 C CB  . CYS B 1 284 ? 49.892  -28.350 8.008   1.00 33.02 ? 495 CYS B CB  1 
ATOM   4966 S SG  . CYS B 1 284 ? 48.978  -28.764 6.562   1.00 33.37 ? 495 CYS B SG  1 
ATOM   4967 N N   . ASN B 1 285 ? 50.263  -26.383 10.578  1.00 34.79 ? 496 ASN B N   1 
ATOM   4968 C CA  . ASN B 1 285 ? 50.897  -26.582 11.850  1.00 35.31 ? 496 ASN B CA  1 
ATOM   4969 C C   . ASN B 1 285 ? 50.565  -27.989 12.299  1.00 35.32 ? 496 ASN B C   1 
ATOM   4970 O O   . ASN B 1 285 ? 49.386  -28.306 12.548  1.00 35.32 ? 496 ASN B O   1 
ATOM   4971 C CB  . ASN B 1 285 ? 50.442  -25.569 12.888  1.00 35.60 ? 496 ASN B CB  1 
ATOM   4972 C CG  . ASN B 1 285 ? 51.276  -25.635 14.135  1.00 35.94 ? 496 ASN B CG  1 
ATOM   4973 O OD1 . ASN B 1 285 ? 52.494  -25.774 14.057  1.00 37.13 ? 496 ASN B OD1 1 
ATOM   4974 N ND2 . ASN B 1 285 ? 50.628  -25.584 15.295  1.00 37.17 ? 496 ASN B ND2 1 
ATOM   4975 N N   . GLU B 1 286 ? 51.618  -28.795 12.445  1.00 35.51 ? 497 GLU B N   1 
ATOM   4976 C CA  . GLU B 1 286 ? 51.517  -30.222 12.715  1.00 35.70 ? 497 GLU B CA  1 
ATOM   4977 C C   . GLU B 1 286 ? 51.574  -30.527 14.190  1.00 35.80 ? 497 GLU B C   1 
ATOM   4978 O O   . GLU B 1 286 ? 52.553  -30.189 14.864  1.00 36.11 ? 497 GLU B O   1 
ATOM   4979 C CB  . GLU B 1 286 ? 52.632  -31.014 12.002  1.00 36.16 ? 497 GLU B CB  1 
ATOM   4980 C CG  . GLU B 1 286 ? 52.760  -30.725 10.514  1.00 36.22 ? 497 GLU B CG  1 
ATOM   4981 C CD  . GLU B 1 286 ? 53.701  -31.698 9.784   1.00 37.72 ? 497 GLU B CD  1 
ATOM   4982 O OE1 . GLU B 1 286 ? 54.691  -32.167 10.388  1.00 39.96 ? 497 GLU B OE1 1 
ATOM   4983 O OE2 . GLU B 1 286 ? 53.429  -31.996 8.606   1.00 37.18 ? 497 GLU B OE2 1 
ATOM   4984 N N   . LEU B 1 287 ? 50.521  -31.193 14.672  1.00 35.25 ? 498 LEU B N   1 
ATOM   4985 C CA  . LEU B 1 287 ? 50.393  -31.568 16.069  1.00 35.62 ? 498 LEU B CA  1 
ATOM   4986 C C   . LEU B 1 287 ? 50.157  -33.063 16.251  1.00 36.21 ? 498 LEU B C   1 
ATOM   4987 O O   . LEU B 1 287 ? 49.521  -33.729 15.419  1.00 36.10 ? 498 LEU B O   1 
ATOM   4988 C CB  . LEU B 1 287 ? 49.244  -30.802 16.733  1.00 34.70 ? 498 LEU B CB  1 
ATOM   4989 C CG  . LEU B 1 287 ? 49.400  -29.290 16.749  1.00 34.60 ? 498 LEU B CG  1 
ATOM   4990 C CD1 . LEU B 1 287 ? 48.195  -28.658 17.443  1.00 31.59 ? 498 LEU B CD1 1 
ATOM   4991 C CD2 . LEU B 1 287 ? 50.743  -28.852 17.412  1.00 33.75 ? 498 LEU B CD2 1 
ATOM   4992 N N   . LEU B 1 288 ? 50.650  -33.562 17.378  1.00 37.49 ? 499 LEU B N   1 
ATOM   4993 C CA  . LEU B 1 288 ? 50.637  -34.980 17.702  1.00 38.25 ? 499 LEU B CA  1 
ATOM   4994 C C   . LEU B 1 288 ? 49.431  -35.382 18.541  1.00 37.91 ? 499 LEU B C   1 
ATOM   4995 O O   . LEU B 1 288 ? 49.071  -36.548 18.560  1.00 39.07 ? 499 LEU B O   1 
ATOM   4996 C CB  . LEU B 1 288 ? 51.927  -35.347 18.439  1.00 39.51 ? 499 LEU B CB  1 
ATOM   4997 C CG  . LEU B 1 288 ? 53.190  -35.371 17.569  1.00 40.86 ? 499 LEU B CG  1 
ATOM   4998 C CD1 . LEU B 1 288 ? 54.461  -35.053 18.380  1.00 42.06 ? 499 LEU B CD1 1 
ATOM   4999 C CD2 . LEU B 1 288 ? 53.299  -36.732 16.839  1.00 43.44 ? 499 LEU B CD2 1 
ATOM   5000 N N   . GLU B 1 289 ? 48.808  -34.427 19.222  1.00 37.27 ? 500 GLU B N   1 
ATOM   5001 C CA  . GLU B 1 289 ? 47.686  -34.724 20.124  1.00 37.23 ? 500 GLU B CA  1 
ATOM   5002 C C   . GLU B 1 289 ? 46.728  -33.565 20.202  1.00 35.76 ? 500 GLU B C   1 
ATOM   5003 O O   . GLU B 1 289 ? 47.033  -32.476 19.728  1.00 35.90 ? 500 GLU B O   1 
ATOM   5004 C CB  . GLU B 1 289 ? 48.191  -35.052 21.531  1.00 37.83 ? 500 GLU B CB  1 
ATOM   5005 C CG  . GLU B 1 289 ? 49.168  -34.018 22.091  1.00 40.40 ? 500 GLU B CG  1 
ATOM   5006 C CD  . GLU B 1 289 ? 49.696  -34.398 23.468  1.00 44.19 ? 500 GLU B CD  1 
ATOM   5007 O OE1 . GLU B 1 289 ? 49.238  -35.421 24.017  1.00 44.08 ? 500 GLU B OE1 1 
ATOM   5008 O OE2 . GLU B 1 289 ? 50.578  -33.673 23.998  1.00 47.98 ? 500 GLU B OE2 1 
ATOM   5009 N N   . ALA B 1 290 ? 45.582  -33.823 20.825  1.00 34.80 ? 501 ALA B N   1 
ATOM   5010 C CA  . ALA B 1 290 ? 44.516  -32.839 21.043  1.00 33.42 ? 501 ALA B CA  1 
ATOM   5011 C C   . ALA B 1 290 ? 45.015  -31.575 21.740  1.00 32.73 ? 501 ALA B C   1 
ATOM   5012 O O   . ALA B 1 290 ? 45.814  -31.635 22.683  1.00 33.63 ? 501 ALA B O   1 
ATOM   5013 C CB  . ALA B 1 290 ? 43.378  -33.481 21.868  1.00 32.85 ? 501 ALA B CB  1 
ATOM   5014 N N   . ASN B 1 291 ? 44.552  -30.443 21.233  1.00 31.08 ? 502 ASN B N   1 
ATOM   5015 C CA  . ASN B 1 291 ? 44.758  -29.141 21.838  1.00 30.59 ? 502 ASN B CA  1 
ATOM   5016 C C   . ASN B 1 291 ? 43.705  -28.172 21.309  1.00 29.03 ? 502 ASN B C   1 
ATOM   5017 O O   . ASN B 1 291 ? 43.864  -27.598 20.237  1.00 28.83 ? 502 ASN B O   1 
ATOM   5018 C CB  . ASN B 1 291 ? 46.165  -28.565 21.584  1.00 30.99 ? 502 ASN B CB  1 
ATOM   5019 C CG  . ASN B 1 291 ? 46.365  -27.209 22.287  1.00 32.68 ? 502 ASN B CG  1 
ATOM   5020 O OD1 . ASN B 1 291 ? 45.406  -26.636 22.825  1.00 29.73 ? 502 ASN B OD1 1 
ATOM   5021 N ND2 . ASN B 1 291 ? 47.603  -26.708 22.301  1.00 32.78 ? 502 ASN B ND2 1 
ATOM   5022 N N   . PRO B 1 292 ? 42.637  -27.958 22.078  1.00 28.49 ? 503 PRO B N   1 
ATOM   5023 C CA  . PRO B 1 292 ? 41.542  -27.058 21.689  1.00 27.90 ? 503 PRO B CA  1 
ATOM   5024 C C   . PRO B 1 292 ? 41.938  -25.617 21.420  1.00 28.57 ? 503 PRO B C   1 
ATOM   5025 O O   . PRO B 1 292 ? 41.160  -24.880 20.778  1.00 28.14 ? 503 PRO B O   1 
ATOM   5026 C CB  . PRO B 1 292 ? 40.590  -27.145 22.886  1.00 27.99 ? 503 PRO B CB  1 
ATOM   5027 C CG  . PRO B 1 292 ? 40.813  -28.519 23.398  1.00 28.04 ? 503 PRO B CG  1 
ATOM   5028 C CD  . PRO B 1 292 ? 42.303  -28.710 23.297  1.00 28.38 ? 503 PRO B CD  1 
ATOM   5029 N N   . LYS B 1 293 ? 43.123  -25.204 21.885  1.00 28.73 ? 504 LYS B N   1 
ATOM   5030 C CA  . LYS B 1 293 ? 43.631  -23.870 21.567  1.00 29.55 ? 504 LYS B CA  1 
ATOM   5031 C C   . LYS B 1 293 ? 44.570  -23.891 20.362  1.00 29.08 ? 504 LYS B C   1 
ATOM   5032 O O   . LYS B 1 293 ? 45.299  -22.937 20.142  1.00 28.74 ? 504 LYS B O   1 
ATOM   5033 C CB  . LYS B 1 293 ? 44.318  -23.253 22.790  1.00 30.54 ? 504 LYS B CB  1 
ATOM   5034 C CG  . LYS B 1 293 ? 43.380  -23.103 24.014  1.00 34.70 ? 504 LYS B CG  1 
ATOM   5035 C CD  . LYS B 1 293 ? 44.146  -22.607 25.289  1.00 42.01 ? 504 LYS B CD  1 
ATOM   5036 C CE  . LYS B 1 293 ? 43.512  -23.154 26.594  1.00 43.69 ? 504 LYS B CE  1 
ATOM   5037 N NZ  . LYS B 1 293 ? 44.183  -22.672 27.855  1.00 48.25 ? 504 LYS B NZ  1 
ATOM   5038 N N   . ALA B 1 294 ? 44.529  -24.964 19.558  1.00 28.40 ? 505 ALA B N   1 
ATOM   5039 C CA  . ALA B 1 294 ? 45.435  -25.096 18.401  1.00 27.96 ? 505 ALA B CA  1 
ATOM   5040 C C   . ALA B 1 294 ? 45.419  -23.892 17.462  1.00 27.36 ? 505 ALA B C   1 
ATOM   5041 O O   . ALA B 1 294 ? 46.459  -23.535 16.882  1.00 27.72 ? 505 ALA B O   1 
ATOM   5042 C CB  . ALA B 1 294 ? 45.159  -26.402 17.621  1.00 27.42 ? 505 ALA B CB  1 
ATOM   5043 N N   . GLU B 1 295 ? 44.279  -23.223 17.349  1.00 27.20 ? 506 GLU B N   1 
ATOM   5044 C CA  . GLU B 1 295 ? 44.170  -22.127 16.412  1.00 27.64 ? 506 GLU B CA  1 
ATOM   5045 C C   . GLU B 1 295 ? 45.144  -21.004 16.754  1.00 29.29 ? 506 GLU B C   1 
ATOM   5046 O O   . GLU B 1 295 ? 45.658  -20.310 15.869  1.00 28.39 ? 506 GLU B O   1 
ATOM   5047 C CB  . GLU B 1 295 ? 42.760  -21.571 16.383  1.00 27.15 ? 506 GLU B CB  1 
ATOM   5048 C CG  . GLU B 1 295 ? 42.607  -20.459 15.341  1.00 27.43 ? 506 GLU B CG  1 
ATOM   5049 C CD  . GLU B 1 295 ? 41.211  -19.960 15.216  1.00 26.25 ? 506 GLU B CD  1 
ATOM   5050 O OE1 . GLU B 1 295 ? 40.315  -20.488 15.907  1.00 26.72 ? 506 GLU B OE1 1 
ATOM   5051 O OE2 . GLU B 1 295 ? 41.006  -19.022 14.425  1.00 28.25 ? 506 GLU B OE2 1 
ATOM   5052 N N   . GLY B 1 296 ? 45.378  -20.827 18.050  1.00 30.74 ? 507 GLY B N   1 
ATOM   5053 C CA  . GLY B 1 296 ? 46.262  -19.772 18.524  1.00 32.71 ? 507 GLY B CA  1 
ATOM   5054 C C   . GLY B 1 296 ? 47.719  -20.051 18.206  1.00 34.51 ? 507 GLY B C   1 
ATOM   5055 O O   . GLY B 1 296 ? 48.537  -19.130 18.192  1.00 35.50 ? 507 GLY B O   1 
ATOM   5056 N N   . LEU B 1 297 ? 48.029  -21.328 17.960  1.00 35.55 ? 508 LEU B N   1 
ATOM   5057 C CA  . LEU B 1 297 ? 49.391  -21.790 17.700  1.00 36.92 ? 508 LEU B CA  1 
ATOM   5058 C C   . LEU B 1 297 ? 49.794  -21.688 16.223  1.00 37.21 ? 508 LEU B C   1 
ATOM   5059 O O   . LEU B 1 297 ? 50.961  -21.923 15.878  1.00 37.78 ? 508 LEU B O   1 
ATOM   5060 C CB  . LEU B 1 297 ? 49.541  -23.234 18.179  1.00 37.36 ? 508 LEU B CB  1 
ATOM   5061 C CG  . LEU B 1 297 ? 49.583  -23.463 19.697  1.00 40.40 ? 508 LEU B CG  1 
ATOM   5062 C CD1 . LEU B 1 297 ? 48.491  -22.703 20.444  1.00 43.90 ? 508 LEU B CD1 1 
ATOM   5063 C CD2 . LEU B 1 297 ? 49.517  -24.962 20.026  1.00 41.34 ? 508 LEU B CD2 1 
ATOM   5064 N N   . LEU B 1 298 ? 48.834  -21.324 15.361  1.00 36.92 ? 509 LEU B N   1 
ATOM   5065 C CA  . LEU B 1 298 ? 49.064  -21.199 13.921  1.00 36.96 ? 509 LEU B CA  1 
ATOM   5066 C C   . LEU B 1 298 ? 50.227  -20.240 13.615  1.00 38.10 ? 509 LEU B C   1 
ATOM   5067 O O   . LEU B 1 298 ? 51.180  -20.607 12.922  1.00 37.42 ? 509 LEU B O   1 
ATOM   5068 C CB  . LEU B 1 298 ? 47.807  -20.678 13.209  1.00 36.56 ? 509 LEU B CB  1 
ATOM   5069 C CG  . LEU B 1 298 ? 46.622  -21.605 12.871  1.00 35.13 ? 509 LEU B CG  1 
ATOM   5070 C CD1 . LEU B 1 298 ? 45.646  -20.828 11.967  1.00 33.18 ? 509 LEU B CD1 1 
ATOM   5071 C CD2 . LEU B 1 298 ? 47.056  -22.902 12.201  1.00 32.37 ? 509 LEU B CD2 1 
ATOM   5072 N N   . GLN B 1 299 ? 50.088  -19.011 14.126  1.00 38.67 ? 510 GLN B N   1 
ATOM   5073 C CA  . GLN B 1 299 ? 51.055  -17.939 13.953  1.00 39.77 ? 510 GLN B CA  1 
ATOM   5074 C C   . GLN B 1 299 ? 51.435  -17.777 12.504  1.00 39.40 ? 510 GLN B C   1 
ATOM   5075 O O   . GLN B 1 299 ? 52.603  -17.895 12.171  1.00 39.09 ? 510 GLN B O   1 
ATOM   5076 C CB  . GLN B 1 299 ? 52.329  -18.213 14.758  1.00 40.70 ? 510 GLN B CB  1 
ATOM   5077 C CG  . GLN B 1 299 ? 52.127  -18.416 16.246  1.00 43.69 ? 510 GLN B CG  1 
ATOM   5078 C CD  . GLN B 1 299 ? 51.927  -17.121 17.024  1.00 47.86 ? 510 GLN B CD  1 
ATOM   5079 O OE1 . GLN B 1 299 ? 51.351  -16.142 16.517  1.00 49.98 ? 510 GLN B OE1 1 
ATOM   5080 N NE2 . GLN B 1 299 ? 52.407  -17.110 18.269  1.00 49.49 ? 510 GLN B NE2 1 
ATOM   5081 N N   . GLY B 1 300 ? 50.454  -17.535 11.640  1.00 38.84 ? 511 GLY B N   1 
ATOM   5082 C CA  . GLY B 1 300 ? 50.745  -17.313 10.213  1.00 39.10 ? 511 GLY B CA  1 
ATOM   5083 C C   . GLY B 1 300 ? 50.746  -18.556 9.319   1.00 38.08 ? 511 GLY B C   1 
ATOM   5084 O O   . GLY B 1 300 ? 50.651  -18.442 8.094   1.00 37.71 ? 511 GLY B O   1 
ATOM   5085 N N   . LYS B 1 301 ? 50.866  -19.738 9.924   1.00 37.06 ? 512 LYS B N   1 
ATOM   5086 C CA  . LYS B 1 301 ? 50.479  -20.984 9.237   1.00 35.18 ? 512 LYS B CA  1 
ATOM   5087 C C   . LYS B 1 301 ? 48.967  -20.960 9.003   1.00 33.56 ? 512 LYS B C   1 
ATOM   5088 O O   . LYS B 1 301 ? 48.249  -20.208 9.649   1.00 32.83 ? 512 LYS B O   1 
ATOM   5089 C CB  . LYS B 1 301 ? 50.904  -22.216 10.037  1.00 35.22 ? 512 LYS B CB  1 
ATOM   5090 C CG  . LYS B 1 301 ? 52.418  -22.413 10.139  1.00 36.08 ? 512 LYS B CG  1 
ATOM   5091 C CD  . LYS B 1 301 ? 52.765  -23.555 11.089  1.00 38.66 ? 512 LYS B CD  1 
ATOM   5092 C CE  . LYS B 1 301 ? 54.300  -23.888 11.133  1.00 42.57 ? 512 LYS B CE  1 
ATOM   5093 N NZ  . LYS B 1 301 ? 54.668  -24.768 12.325  1.00 41.62 ? 512 LYS B NZ  1 
ATOM   5094 N N   . HIS B 1 302 ? 48.490  -21.765 8.057   1.00 32.26 ? 513 HIS B N   1 
ATOM   5095 C CA  . HIS B 1 302 ? 47.143  -21.616 7.532   1.00 30.70 ? 513 HIS B CA  1 
ATOM   5096 C C   . HIS B 1 302 ? 46.195  -22.725 7.968   1.00 29.07 ? 513 HIS B C   1 
ATOM   5097 O O   . HIS B 1 302 ? 44.994  -22.650 7.713   1.00 29.07 ? 513 HIS B O   1 
ATOM   5098 C CB  . HIS B 1 302 ? 47.211  -21.561 5.991   1.00 30.68 ? 513 HIS B CB  1 
ATOM   5099 C CG  . HIS B 1 302 ? 48.282  -20.650 5.472   1.00 31.59 ? 513 HIS B CG  1 
ATOM   5100 N ND1 . HIS B 1 302 ? 49.578  -21.071 5.260   1.00 31.13 ? 513 HIS B ND1 1 
ATOM   5101 C CD2 . HIS B 1 302 ? 48.258  -19.334 5.150   1.00 32.22 ? 513 HIS B CD2 1 
ATOM   5102 C CE1 . HIS B 1 302 ? 50.305  -20.058 4.809   1.00 32.12 ? 513 HIS B CE1 1 
ATOM   5103 N NE2 . HIS B 1 302 ? 49.531  -18.988 4.745   1.00 32.55 ? 513 HIS B NE2 1 
ATOM   5104 N N   . SER B 1 303 ? 46.726  -23.779 8.571   1.00 27.38 ? 514 SER B N   1 
ATOM   5105 C CA  . SER B 1 303 ? 45.882  -24.895 8.933   1.00 26.08 ? 514 SER B CA  1 
ATOM   5106 C C   . SER B 1 303 ? 46.562  -25.716 9.985   1.00 26.09 ? 514 SER B C   1 
ATOM   5107 O O   . SER B 1 303 ? 47.754  -25.539 10.249  1.00 26.60 ? 514 SER B O   1 
ATOM   5108 C CB  . SER B 1 303 ? 45.605  -25.767 7.712   1.00 26.81 ? 514 SER B CB  1 
ATOM   5109 O OG  . SER B 1 303 ? 46.802  -26.313 7.220   1.00 26.78 ? 514 SER B OG  1 
ATOM   5110 N N   . THR B 1 304 ? 45.800  -26.609 10.595  1.00 25.02 ? 515 THR B N   1 
ATOM   5111 C CA  . THR B 1 304 ? 46.324  -27.530 11.551  1.00 25.41 ? 515 THR B CA  1 
ATOM   5112 C C   . THR B 1 304 ? 46.251  -28.917 10.949  1.00 25.92 ? 515 THR B C   1 
ATOM   5113 O O   . THR B 1 304 ? 45.299  -29.218 10.277  1.00 24.90 ? 515 THR B O   1 
ATOM   5114 C CB  . THR B 1 304 ? 45.478  -27.542 12.825  1.00 25.50 ? 515 THR B CB  1 
ATOM   5115 O OG1 . THR B 1 304 ? 45.582  -26.266 13.484  1.00 24.84 ? 515 THR B OG1 1 
ATOM   5116 C CG2 . THR B 1 304 ? 45.948  -28.641 13.729  1.00 23.24 ? 515 THR B CG2 1 
ATOM   5117 N N   . LYS B 1 305 ? 47.264  -29.742 11.209  1.00 26.58 ? 516 LYS B N   1 
ATOM   5118 C CA  . LYS B 1 305 ? 47.209  -31.154 10.905  1.00 27.31 ? 516 LYS B CA  1 
ATOM   5119 C C   . LYS B 1 305 ? 47.510  -31.980 12.132  1.00 27.53 ? 516 LYS B C   1 
ATOM   5120 O O   . LYS B 1 305 ? 48.635  -31.925 12.692  1.00 28.33 ? 516 LYS B O   1 
ATOM   5121 C CB  . LYS B 1 305 ? 48.225  -31.511 9.815   1.00 27.84 ? 516 LYS B CB  1 
ATOM   5122 C CG  . LYS B 1 305 ? 48.215  -32.947 9.383   1.00 28.57 ? 516 LYS B CG  1 
ATOM   5123 C CD  . LYS B 1 305 ? 49.080  -33.136 8.111   1.00 31.36 ? 516 LYS B CD  1 
ATOM   5124 C CE  . LYS B 1 305 ? 49.140  -34.594 7.723   1.00 31.21 ? 516 LYS B CE  1 
ATOM   5125 N NZ  . LYS B 1 305 ? 50.197  -34.896 6.714   1.00 31.86 ? 516 LYS B NZ  1 
ATOM   5126 N N   . GLY B 1 306 ? 46.505  -32.748 12.546  1.00 27.42 ? 517 GLY B N   1 
ATOM   5127 C CA  . GLY B 1 306 ? 46.669  -33.821 13.509  1.00 28.05 ? 517 GLY B CA  1 
ATOM   5128 C C   . GLY B 1 306 ? 47.329  -34.971 12.773  1.00 29.59 ? 517 GLY B C   1 
ATOM   5129 O O   . GLY B 1 306 ? 46.802  -35.440 11.777  1.00 30.12 ? 517 GLY B O   1 
ATOM   5130 N N   . LEU B 1 307 ? 48.486  -35.415 13.253  1.00 31.24 ? 518 LEU B N   1 
ATOM   5131 C CA  . LEU B 1 307 ? 49.255  -36.451 12.587  1.00 32.47 ? 518 LEU B CA  1 
ATOM   5132 C C   . LEU B 1 307 ? 48.762  -37.833 13.010  1.00 33.06 ? 518 LEU B C   1 
ATOM   5133 O O   . LEU B 1 307 ? 48.638  -38.119 14.198  1.00 33.26 ? 518 LEU B O   1 
ATOM   5134 C CB  . LEU B 1 307 ? 50.743  -36.278 12.926  1.00 34.02 ? 518 LEU B CB  1 
ATOM   5135 C CG  . LEU B 1 307 ? 51.440  -35.004 12.409  1.00 34.05 ? 518 LEU B CG  1 
ATOM   5136 C CD1 . LEU B 1 307 ? 52.938  -35.013 12.763  1.00 36.60 ? 518 LEU B CD1 1 
ATOM   5137 C CD2 . LEU B 1 307 ? 51.264  -34.849 10.898  1.00 33.42 ? 518 LEU B CD2 1 
ATOM   5138 N N   . GLY B 1 308 ? 48.428  -38.667 12.036  1.00 33.63 ? 519 GLY B N   1 
ATOM   5139 C CA  . GLY B 1 308 ? 48.079  -40.061 12.302  1.00 35.12 ? 519 GLY B CA  1 
ATOM   5140 C C   . GLY B 1 308 ? 49.230  -41.036 12.097  1.00 37.01 ? 519 GLY B C   1 
ATOM   5141 O O   . GLY B 1 308 ? 50.243  -40.687 11.485  1.00 37.82 ? 519 GLY B O   1 
ATOM   5142 N N   . LYS B 1 309 ? 49.052  -42.249 12.619  1.00 39.14 ? 520 LYS B N   1 
ATOM   5143 C CA  . LYS B 1 309 ? 50.019  -43.358 12.500  1.00 41.35 ? 520 LYS B CA  1 
ATOM   5144 C C   . LYS B 1 309 ? 50.044  -43.917 11.094  1.00 41.77 ? 520 LYS B C   1 
ATOM   5145 O O   . LYS B 1 309 ? 51.069  -44.438 10.649  1.00 43.25 ? 520 LYS B O   1 
ATOM   5146 C CB  . LYS B 1 309 ? 49.657  -44.520 13.439  1.00 42.18 ? 520 LYS B CB  1 
ATOM   5147 C CG  . LYS B 1 309 ? 50.179  -44.408 14.871  1.00 44.75 ? 520 LYS B CG  1 
ATOM   5148 C CD  . LYS B 1 309 ? 49.390  -45.313 15.863  1.00 47.96 ? 520 LYS B CD  1 
ATOM   5149 C CE  . LYS B 1 309 ? 49.137  -46.731 15.313  1.00 49.56 ? 520 LYS B CE  1 
ATOM   5150 N NZ  . LYS B 1 309 ? 49.194  -47.782 16.368  1.00 50.33 ? 520 LYS B NZ  1 
ATOM   5151 N N   . MET B 1 310 ? 48.900  -43.840 10.428  1.00 41.88 ? 521 MET B N   1 
ATOM   5152 C CA  . MET B 1 310 ? 48.716  -44.377 9.090   1.00 42.31 ? 521 MET B CA  1 
ATOM   5153 C C   . MET B 1 310 ? 48.084  -43.308 8.205   1.00 41.36 ? 521 MET B C   1 
ATOM   5154 O O   . MET B 1 310 ? 47.182  -42.585 8.640   1.00 40.56 ? 521 MET B O   1 
ATOM   5155 C CB  . MET B 1 310 ? 47.825  -45.616 9.149   1.00 42.69 ? 521 MET B CB  1 
ATOM   5156 C CG  . MET B 1 310 ? 48.462  -46.820 9.858   1.00 46.28 ? 521 MET B CG  1 
ATOM   5157 S SD  . MET B 1 310 ? 49.480  -47.915 8.786   1.00 53.72 ? 521 MET B SD  1 
ATOM   5158 C CE  . MET B 1 310 ? 48.201  -48.838 7.901   1.00 51.22 ? 521 MET B CE  1 
ATOM   5159 N N   . ALA B 1 311 ? 48.581  -43.192 6.977   1.00 41.41 ? 522 ALA B N   1 
ATOM   5160 C CA  . ALA B 1 311 ? 47.994  -42.279 5.986   1.00 40.98 ? 522 ALA B CA  1 
ATOM   5161 C C   . ALA B 1 311 ? 48.354  -42.657 4.543   1.00 40.99 ? 522 ALA B C   1 
ATOM   5162 O O   . ALA B 1 311 ? 49.314  -43.400 4.290   1.00 40.68 ? 522 ALA B O   1 
ATOM   5163 C CB  . ALA B 1 311 ? 48.432  -40.855 6.255   1.00 40.45 ? 522 ALA B CB  1 
ATOM   5164 N N   . PRO B 1 312 ? 47.583  -42.132 3.583   1.00 40.81 ? 523 PRO B N   1 
ATOM   5165 C CA  . PRO B 1 312 ? 48.044  -42.267 2.211   1.00 41.42 ? 523 PRO B CA  1 
ATOM   5166 C C   . PRO B 1 312 ? 49.421  -41.655 2.058   1.00 42.71 ? 523 PRO B C   1 
ATOM   5167 O O   . PRO B 1 312 ? 49.718  -40.660 2.716   1.00 42.51 ? 523 PRO B O   1 
ATOM   5168 C CB  . PRO B 1 312 ? 47.014  -41.493 1.404   1.00 40.65 ? 523 PRO B CB  1 
ATOM   5169 C CG  . PRO B 1 312 ? 45.775  -41.464 2.269   1.00 39.99 ? 523 PRO B CG  1 
ATOM   5170 C CD  . PRO B 1 312 ? 46.262  -41.487 3.682   1.00 40.15 ? 523 PRO B CD  1 
ATOM   5171 N N   . SER B 1 313 ? 50.262  -42.272 1.226   1.00 44.35 ? 524 SER B N   1 
ATOM   5172 C CA  . SER B 1 313 ? 51.615  -41.752 0.928   1.00 45.84 ? 524 SER B CA  1 
ATOM   5173 C C   . SER B 1 313 ? 51.683  -41.195 -0.485  1.00 46.40 ? 524 SER B C   1 
ATOM   5174 O O   . SER B 1 313 ? 50.985  -41.678 -1.389  1.00 46.78 ? 524 SER B O   1 
ATOM   5175 C CB  . SER B 1 313 ? 52.658  -42.859 1.043   1.00 46.53 ? 524 SER B CB  1 
ATOM   5176 O OG  . SER B 1 313 ? 52.412  -43.814 0.039   1.00 45.97 ? 524 SER B OG  1 
ATOM   5177 N N   . SER B 1 314 ? 52.580  -40.233 -0.681  1.00 47.08 ? 525 SER B N   1 
ATOM   5178 C CA  . SER B 1 314 ? 52.601  -39.440 -1.916  1.00 47.53 ? 525 SER B CA  1 
ATOM   5179 C C   . SER B 1 314 ? 52.913  -40.198 -3.210  1.00 47.92 ? 525 SER B C   1 
ATOM   5180 O O   . SER B 1 314 ? 52.563  -39.724 -4.284  1.00 47.82 ? 525 SER B O   1 
ATOM   5181 C CB  . SER B 1 314 ? 53.552  -38.251 -1.780  1.00 47.84 ? 525 SER B CB  1 
ATOM   5182 O OG  . SER B 1 314 ? 54.841  -38.592 -2.231  1.00 48.88 ? 525 SER B OG  1 
ATOM   5183 N N   . ALA B 1 315 ? 53.543  -41.365 -3.129  1.00 48.86 ? 526 ALA B N   1 
ATOM   5184 C CA  . ALA B 1 315 ? 53.788  -42.157 -4.344  1.00 49.49 ? 526 ALA B CA  1 
ATOM   5185 C C   . ALA B 1 315 ? 52.508  -42.459 -5.127  1.00 49.25 ? 526 ALA B C   1 
ATOM   5186 O O   . ALA B 1 315 ? 52.573  -42.650 -6.342  1.00 49.29 ? 526 ALA B O   1 
ATOM   5187 C CB  . ALA B 1 315 ? 54.506  -43.461 -4.009  1.00 50.25 ? 526 ALA B CB  1 
ATOM   5188 N N   . HIS B 1 316 ? 51.351  -42.487 -4.445  1.00 48.54 ? 527 HIS B N   1 
ATOM   5189 C CA  . HIS B 1 316 ? 50.091  -42.944 -5.062  1.00 48.28 ? 527 HIS B CA  1 
ATOM   5190 C C   . HIS B 1 316 ? 49.119  -41.833 -5.417  1.00 47.43 ? 527 HIS B C   1 
ATOM   5191 O O   . HIS B 1 316 ? 48.053  -42.107 -5.964  1.00 47.60 ? 527 HIS B O   1 
ATOM   5192 C CB  . HIS B 1 316 ? 49.350  -43.927 -4.141  1.00 48.26 ? 527 HIS B CB  1 
ATOM   5193 C CG  . HIS B 1 316 ? 50.165  -45.110 -3.738  1.00 50.10 ? 527 HIS B CG  1 
ATOM   5194 N ND1 . HIS B 1 316 ? 50.597  -46.060 -4.644  1.00 52.90 ? 527 HIS B ND1 1 
ATOM   5195 C CD2 . HIS B 1 316 ? 50.620  -45.507 -2.526  1.00 52.08 ? 527 HIS B CD2 1 
ATOM   5196 C CE1 . HIS B 1 316 ? 51.291  -46.988 -4.006  1.00 53.94 ? 527 HIS B CE1 1 
ATOM   5197 N NE2 . HIS B 1 316 ? 51.316  -46.680 -2.719  1.00 54.87 ? 527 HIS B NE2 1 
ATOM   5198 N N   . PHE B 1 317 ? 49.475  -40.594 -5.107  1.00 46.51 ? 528 PHE B N   1 
ATOM   5199 C CA  . PHE B 1 317 ? 48.574  -39.469 -5.301  1.00 45.60 ? 528 PHE B CA  1 
ATOM   5200 C C   . PHE B 1 317 ? 48.311  -39.148 -6.764  1.00 45.12 ? 528 PHE B C   1 
ATOM   5201 O O   . PHE B 1 317 ? 49.076  -39.521 -7.656  1.00 46.65 ? 528 PHE B O   1 
ATOM   5202 C CB  . PHE B 1 317 ? 49.131  -38.207 -4.621  1.00 45.64 ? 528 PHE B CB  1 
ATOM   5203 C CG  . PHE B 1 317 ? 49.238  -38.305 -3.114  1.00 46.13 ? 528 PHE B CG  1 
ATOM   5204 C CD1 . PHE B 1 317 ? 48.951  -39.496 -2.428  1.00 45.94 ? 528 PHE B CD1 1 
ATOM   5205 C CD2 . PHE B 1 317 ? 49.668  -37.200 -2.376  1.00 46.99 ? 528 PHE B CD2 1 
ATOM   5206 C CE1 . PHE B 1 317 ? 49.062  -39.568 -1.055  1.00 45.94 ? 528 PHE B CE1 1 
ATOM   5207 C CE2 . PHE B 1 317 ? 49.783  -37.273 -0.978  1.00 46.45 ? 528 PHE B CE2 1 
ATOM   5208 C CZ  . PHE B 1 317 ? 49.481  -38.458 -0.322  1.00 45.75 ? 528 PHE B CZ  1 
ATOM   5209 N N   . VAL B 1 318 ? 47.254  -38.376 -6.971  1.00 43.47 ? 529 VAL B N   1 
ATOM   5210 C CA  . VAL B 1 318 ? 46.765  -38.008 -8.281  1.00 42.62 ? 529 VAL B CA  1 
ATOM   5211 C C   . VAL B 1 318 ? 46.176  -36.579 -8.180  1.00 41.92 ? 529 VAL B C   1 
ATOM   5212 O O   . VAL B 1 318 ? 46.090  -36.002 -7.093  1.00 40.43 ? 529 VAL B O   1 
ATOM   5213 C CB  . VAL B 1 318 ? 45.722  -39.053 -8.734  1.00 42.71 ? 529 VAL B CB  1 
ATOM   5214 C CG1 . VAL B 1 318 ? 44.617  -38.447 -9.604  1.00 42.89 ? 529 VAL B CG1 1 
ATOM   5215 C CG2 . VAL B 1 318 ? 46.420  -40.236 -9.426  1.00 42.29 ? 529 VAL B CG2 1 
ATOM   5216 N N   . THR B 1 319 ? 45.771  -36.036 -9.321  1.00 41.30 ? 530 THR B N   1 
ATOM   5217 C CA  . THR B 1 319 ? 45.268  -34.694 -9.424  1.00 41.13 ? 530 THR B CA  1 
ATOM   5218 C C   . THR B 1 319 ? 43.835  -34.740 -9.880  1.00 40.49 ? 530 THR B C   1 
ATOM   5219 O O   . THR B 1 319 ? 43.478  -35.521 -10.742 1.00 41.35 ? 530 THR B O   1 
ATOM   5220 C CB  . THR B 1 319 ? 46.126  -33.912 -10.438 1.00 41.86 ? 530 THR B CB  1 
ATOM   5221 O OG1 . THR B 1 319 ? 47.277  -33.435 -9.750  1.00 41.76 ? 530 THR B OG1 1 
ATOM   5222 C CG2 . THR B 1 319 ? 45.361  -32.735 -11.080 1.00 41.53 ? 530 THR B CG2 1 
ATOM   5223 N N   . LEU B 1 320 ? 42.996  -33.927 -9.270  1.00 39.22 ? 531 LEU B N   1 
ATOM   5224 C CA  . LEU B 1 320 ? 41.671  -33.709 -9.792  1.00 38.30 ? 531 LEU B CA  1 
ATOM   5225 C C   . LEU B 1 320 ? 41.488  -32.214 -9.804  1.00 38.69 ? 531 LEU B C   1 
ATOM   5226 O O   . LEU B 1 320 ? 41.392  -31.561 -8.743  1.00 37.41 ? 531 LEU B O   1 
ATOM   5227 C CB  . LEU B 1 320 ? 40.622  -34.403 -8.944  1.00 37.52 ? 531 LEU B CB  1 
ATOM   5228 C CG  . LEU B 1 320 ? 39.296  -34.673 -9.642  1.00 36.48 ? 531 LEU B CG  1 
ATOM   5229 C CD1 . LEU B 1 320 ? 39.474  -35.329 -11.017 1.00 33.54 ? 531 LEU B CD1 1 
ATOM   5230 C CD2 . LEU B 1 320 ? 38.438  -35.562 -8.761  1.00 32.35 ? 531 LEU B CD2 1 
ATOM   5231 N N   . ASN B 1 321 ? 41.543  -31.674 -11.021 1.00 38.83 ? 532 ASN B N   1 
ATOM   5232 C CA  . ASN B 1 321 ? 41.348  -30.256 -11.282 1.00 38.73 ? 532 ASN B CA  1 
ATOM   5233 C C   . ASN B 1 321 ? 42.184  -29.349 -10.419 1.00 37.22 ? 532 ASN B C   1 
ATOM   5234 O O   . ASN B 1 321 ? 41.712  -28.330 -9.961  1.00 36.99 ? 532 ASN B O   1 
ATOM   5235 C CB  . ASN B 1 321 ? 39.851  -29.947 -11.173 1.00 38.86 ? 532 ASN B CB  1 
ATOM   5236 C CG  . ASN B 1 321 ? 39.039  -30.797 -12.138 1.00 40.99 ? 532 ASN B CG  1 
ATOM   5237 O OD1 . ASN B 1 321 ? 39.606  -31.339 -13.096 1.00 45.72 ? 532 ASN B OD1 1 
ATOM   5238 N ND2 . ASN B 1 321 ? 37.719  -30.912 -11.914 1.00 41.15 ? 532 ASN B ND2 1 
ATOM   5239 N N   . GLY B 1 322 ? 43.447  -29.701 -10.216 1.00 36.62 ? 533 GLY B N   1 
ATOM   5240 C CA  . GLY B 1 322 ? 44.346  -28.833 -9.432  1.00 35.43 ? 533 GLY B CA  1 
ATOM   5241 C C   . GLY B 1 322 ? 44.454  -29.185 -7.954  1.00 33.96 ? 533 GLY B C   1 
ATOM   5242 O O   . GLY B 1 322 ? 45.320  -28.655 -7.239  1.00 34.15 ? 533 GLY B O   1 
ATOM   5243 N N   . SER B 1 323 ? 43.588  -30.077 -7.486  1.00 31.67 ? 534 SER B N   1 
ATOM   5244 C CA  . SER B 1 323 ? 43.649  -30.515 -6.109  1.00 30.38 ? 534 SER B CA  1 
ATOM   5245 C C   . SER B 1 323 ? 44.276  -31.896 -6.035  1.00 30.17 ? 534 SER B C   1 
ATOM   5246 O O   . SER B 1 323 ? 43.952  -32.757 -6.831  1.00 29.75 ? 534 SER B O   1 
ATOM   5247 C CB  . SER B 1 323 ? 42.261  -30.498 -5.491  1.00 29.20 ? 534 SER B CB  1 
ATOM   5248 O OG  . SER B 1 323 ? 41.811  -29.176 -5.263  1.00 29.57 ? 534 SER B OG  1 
ATOM   5249 N N   . THR B 1 324 ? 45.170  -32.081 -5.066  1.00 30.49 ? 535 THR B N   1 
ATOM   5250 C CA  . THR B 1 324 ? 45.801  -33.345 -4.779  1.00 31.29 ? 535 THR B CA  1 
ATOM   5251 C C   . THR B 1 324 ? 44.760  -34.293 -4.177  1.00 31.33 ? 535 THR B C   1 
ATOM   5252 O O   . THR B 1 324 ? 44.120  -33.964 -3.140  1.00 30.74 ? 535 THR B O   1 
ATOM   5253 C CB  . THR B 1 324 ? 46.994  -33.156 -3.795  1.00 32.20 ? 535 THR B CB  1 
ATOM   5254 O OG1 . THR B 1 324 ? 48.014  -32.333 -4.395  1.00 33.70 ? 535 THR B OG1 1 
ATOM   5255 C CG2 . THR B 1 324 ? 47.640  -34.477 -3.416  1.00 33.73 ? 535 THR B CG2 1 
ATOM   5256 N N   . VAL B 1 325 ? 44.567  -35.441 -4.844  1.00 30.23 ? 536 VAL B N   1 
ATOM   5257 C CA  . VAL B 1 325 ? 43.705  -36.520 -4.353  1.00 29.45 ? 536 VAL B CA  1 
ATOM   5258 C C   . VAL B 1 325 ? 44.607  -37.589 -3.737  1.00 29.36 ? 536 VAL B C   1 
ATOM   5259 O O   . VAL B 1 325 ? 45.368  -38.236 -4.475  1.00 31.83 ? 536 VAL B O   1 
ATOM   5260 C CB  . VAL B 1 325 ? 42.886  -37.134 -5.475  1.00 29.38 ? 536 VAL B CB  1 
ATOM   5261 C CG1 . VAL B 1 325 ? 42.098  -38.345 -4.946  1.00 30.83 ? 536 VAL B CG1 1 
ATOM   5262 C CG2 . VAL B 1 325 ? 41.948  -36.101 -6.089  1.00 26.73 ? 536 VAL B CG2 1 
ATOM   5263 N N   . PRO B 1 326 ? 44.575  -37.763 -2.397  1.00 28.26 ? 537 PRO B N   1 
ATOM   5264 C CA  . PRO B 1 326 ? 45.489  -38.659 -1.708  1.00 28.72 ? 537 PRO B CA  1 
ATOM   5265 C C   . PRO B 1 326 ? 45.050  -40.122 -1.665  1.00 29.73 ? 537 PRO B C   1 
ATOM   5266 O O   . PRO B 1 326 ? 44.803  -40.669 -0.590  1.00 29.57 ? 537 PRO B O   1 
ATOM   5267 C CB  . PRO B 1 326 ? 45.528  -38.083 -0.302  1.00 29.22 ? 537 PRO B CB  1 
ATOM   5268 C CG  . PRO B 1 326 ? 44.177  -37.558 -0.105  1.00 27.27 ? 537 PRO B CG  1 
ATOM   5269 C CD  . PRO B 1 326 ? 43.819  -36.945 -1.424  1.00 27.95 ? 537 PRO B CD  1 
ATOM   5270 N N   . LEU B 1 327 ? 44.980  -40.746 -2.838  1.00 30.19 ? 538 LEU B N   1 
ATOM   5271 C CA  . LEU B 1 327 ? 44.658  -42.154 -2.934  1.00 31.18 ? 538 LEU B CA  1 
ATOM   5272 C C   . LEU B 1 327 ? 45.460  -43.025 -1.970  1.00 32.00 ? 538 LEU B C   1 
ATOM   5273 O O   . LEU B 1 327 ? 46.618  -42.774 -1.681  1.00 32.78 ? 538 LEU B O   1 
ATOM   5274 C CB  . LEU B 1 327 ? 44.876  -42.636 -4.364  1.00 31.07 ? 538 LEU B CB  1 
ATOM   5275 C CG  . LEU B 1 327 ? 44.017  -41.947 -5.420  1.00 30.03 ? 538 LEU B CG  1 
ATOM   5276 C CD1 . LEU B 1 327 ? 44.318  -42.619 -6.805  1.00 29.83 ? 538 LEU B CD1 1 
ATOM   5277 C CD2 . LEU B 1 327 ? 42.547  -42.009 -5.042  1.00 26.18 ? 538 LEU B CD2 1 
ATOM   5278 N N   . GLY B 1 328 ? 44.814  -44.071 -1.486  1.00 33.16 ? 539 GLY B N   1 
ATOM   5279 C CA  . GLY B 1 328 ? 45.454  -45.053 -0.637  1.00 34.29 ? 539 GLY B CA  1 
ATOM   5280 C C   . GLY B 1 328 ? 46.102  -46.165 -1.452  1.00 35.71 ? 539 GLY B C   1 
ATOM   5281 O O   . GLY B 1 328 ? 46.269  -46.044 -2.665  1.00 34.78 ? 539 GLY B O   1 
ATOM   5282 N N   . PRO B 1 329 ? 46.443  -47.267 -0.790  1.00 37.79 ? 540 PRO B N   1 
ATOM   5283 C CA  . PRO B 1 329 ? 46.151  -47.534 0.619   1.00 38.44 ? 540 PRO B CA  1 
ATOM   5284 C C   . PRO B 1 329 ? 47.050  -46.750 1.548   1.00 39.21 ? 540 PRO B C   1 
ATOM   5285 O O   . PRO B 1 329 ? 48.114  -46.283 1.126   1.00 39.83 ? 540 PRO B O   1 
ATOM   5286 C CB  . PRO B 1 329 ? 46.459  -49.029 0.759   1.00 39.07 ? 540 PRO B CB  1 
ATOM   5287 C CG  . PRO B 1 329 ? 47.593  -49.244 -0.218  1.00 39.38 ? 540 PRO B CG  1 
ATOM   5288 C CD  . PRO B 1 329 ? 47.302  -48.314 -1.380  1.00 38.57 ? 540 PRO B CD  1 
ATOM   5289 N N   . ALA B 1 330 ? 46.630  -46.637 2.808   1.00 39.54 ? 541 ALA B N   1 
ATOM   5290 C CA  . ALA B 1 330 ? 47.436  -45.985 3.829   1.00 40.15 ? 541 ALA B CA  1 
ATOM   5291 C C   . ALA B 1 330 ? 48.571  -46.885 4.282   1.00 41.45 ? 541 ALA B C   1 
ATOM   5292 O O   . ALA B 1 330 ? 48.456  -48.097 4.230   1.00 41.29 ? 541 ALA B O   1 
ATOM   5293 C CB  . ALA B 1 330 ? 46.578  -45.588 5.020   1.00 38.76 ? 541 ALA B CB  1 
ATOM   5294 N N   . SER B 1 331 ? 49.658  -46.277 4.746   1.00 43.02 ? 542 SER B N   1 
ATOM   5295 C CA  . SER B 1 331 ? 50.791  -47.024 5.293   1.00 44.79 ? 542 SER B CA  1 
ATOM   5296 C C   . SER B 1 331 ? 51.341  -46.265 6.479   1.00 45.78 ? 542 SER B C   1 
ATOM   5297 O O   . SER B 1 331 ? 50.936  -45.126 6.726   1.00 45.28 ? 542 SER B O   1 
ATOM   5298 C CB  . SER B 1 331 ? 51.874  -47.209 4.226   1.00 45.13 ? 542 SER B CB  1 
ATOM   5299 O OG  . SER B 1 331 ? 52.288  -45.953 3.715   1.00 45.39 ? 542 SER B OG  1 
ATOM   5300 N N   . ASP B 1 332 ? 52.265  -46.888 7.202   1.00 48.02 ? 543 ASP B N   1 
ATOM   5301 C CA  . ASP B 1 332 ? 52.794  -46.322 8.436   1.00 49.55 ? 543 ASP B CA  1 
ATOM   5302 C C   . ASP B 1 332 ? 53.534  -45.014 8.150   1.00 50.55 ? 543 ASP B C   1 
ATOM   5303 O O   . ASP B 1 332 ? 54.204  -44.884 7.123   1.00 50.97 ? 543 ASP B O   1 
ATOM   5304 C CB  . ASP B 1 332 ? 53.707  -47.329 9.141   1.00 50.79 ? 543 ASP B CB  1 
ATOM   5305 C CG  . ASP B 1 332 ? 54.212  -46.822 10.491  1.00 52.78 ? 543 ASP B CG  1 
ATOM   5306 O OD1 . ASP B 1 332 ? 55.382  -47.084 10.847  1.00 54.91 ? 543 ASP B OD1 1 
ATOM   5307 O OD2 . ASP B 1 332 ? 53.437  -46.150 11.202  1.00 56.40 ? 543 ASP B OD2 1 
ATOM   5308 N N   . THR B 1 333 ? 53.387  -44.041 9.043   1.00 51.34 ? 544 THR B N   1 
ATOM   5309 C CA  . THR B 1 333 ? 53.902  -42.691 8.797   1.00 52.11 ? 544 THR B CA  1 
ATOM   5310 C C   . THR B 1 333 ? 55.208  -42.394 9.539   1.00 54.24 ? 544 THR B C   1 
ATOM   5311 O O   . THR B 1 333 ? 55.799  -41.326 9.346   1.00 54.77 ? 544 THR B O   1 
ATOM   5312 C CB  . THR B 1 333 ? 52.861  -41.625 9.179   1.00 51.10 ? 544 THR B CB  1 
ATOM   5313 O OG1 . THR B 1 333 ? 52.380  -41.887 10.505  1.00 49.16 ? 544 THR B OG1 1 
ATOM   5314 C CG2 . THR B 1 333 ? 51.710  -41.640 8.193   1.00 49.03 ? 544 THR B CG2 1 
ATOM   5315 N N   . GLY B 1 334 ? 55.650  -43.330 10.380  1.00 56.36 ? 545 GLY B N   1 
ATOM   5316 C CA  . GLY B 1 334 ? 56.830  -43.127 11.223  1.00 58.33 ? 545 GLY B CA  1 
ATOM   5317 C C   . GLY B 1 334 ? 56.590  -42.127 12.347  1.00 59.30 ? 545 GLY B C   1 
ATOM   5318 O O   . GLY B 1 334 ? 57.541  -41.645 12.981  1.00 59.72 ? 545 GLY B O   1 
ATOM   5319 N N   . ILE B 1 335 ? 55.317  -41.822 12.590  1.00 59.99 ? 546 ILE B N   1 
ATOM   5320 C CA  . ILE B 1 335 ? 54.907  -40.810 13.559  1.00 60.93 ? 546 ILE B CA  1 
ATOM   5321 C C   . ILE B 1 335 ? 54.340  -41.513 14.786  1.00 61.80 ? 546 ILE B C   1 
ATOM   5322 O O   . ILE B 1 335 ? 53.280  -42.143 14.718  1.00 61.76 ? 546 ILE B O   1 
ATOM   5323 C CB  . ILE B 1 335 ? 53.875  -39.799 12.948  1.00 60.25 ? 546 ILE B CB  1 
ATOM   5324 C CG1 . ILE B 1 335 ? 54.606  -38.771 12.066  1.00 60.48 ? 546 ILE B CG1 1 
ATOM   5325 C CG2 . ILE B 1 335 ? 53.096  -39.087 14.049  1.00 59.32 ? 546 ILE B CG2 1 
ATOM   5326 C CD1 . ILE B 1 335 ? 53.736  -38.121 10.998  1.00 59.86 ? 546 ILE B CD1 1 
ATOM   5327 N N   . LEU B 1 336 ? 55.097  -41.431 15.881  1.00 63.54 ? 547 LEU B N   1 
ATOM   5328 C CA  . LEU B 1 336 ? 54.694  -41.917 17.198  1.00 64.62 ? 547 LEU B CA  1 
ATOM   5329 C C   . LEU B 1 336 ? 54.898  -40.767 18.207  1.00 65.57 ? 547 LEU B C   1 
ATOM   5330 O O   . LEU B 1 336 ? 55.940  -40.094 18.201  1.00 66.08 ? 547 LEU B O   1 
ATOM   5331 C CB  . LEU B 1 336 ? 55.532  -43.143 17.613  1.00 65.59 ? 547 LEU B CB  1 
ATOM   5332 C CG  . LEU B 1 336 ? 54.938  -44.171 18.602  1.00 65.88 ? 547 LEU B CG  1 
ATOM   5333 C CD1 . LEU B 1 336 ? 54.522  -43.534 19.933  1.00 65.11 ? 547 LEU B CD1 1 
ATOM   5334 C CD2 . LEU B 1 336 ? 53.762  -44.953 17.983  1.00 64.64 ? 547 LEU B CD2 1 
ATOM   5335 N N   . ASN B 1 337 ? 53.891  -40.553 19.055  1.00 65.77 ? 548 ASN B N   1 
ATOM   5336 C CA  . ASN B 1 337 ? 53.957  -39.585 20.144  1.00 66.17 ? 548 ASN B CA  1 
ATOM   5337 C C   . ASN B 1 337 ? 54.457  -40.333 21.384  1.00 67.43 ? 548 ASN B C   1 
ATOM   5338 O O   . ASN B 1 337 ? 53.817  -41.291 21.829  1.00 67.80 ? 548 ASN B O   1 
ATOM   5339 C CB  . ASN B 1 337 ? 52.558  -38.983 20.368  1.00 65.49 ? 548 ASN B CB  1 
ATOM   5340 C CG  . ASN B 1 337 ? 52.492  -38.037 21.554  1.00 64.98 ? 548 ASN B CG  1 
ATOM   5341 O OD1 . ASN B 1 337 ? 53.428  -37.289 21.830  1.00 63.92 ? 548 ASN B OD1 1 
ATOM   5342 N ND2 . ASN B 1 337 ? 51.368  -38.063 22.253  1.00 63.71 ? 548 ASN B ND2 1 
ATOM   5343 N N   . PRO B 1 338 ? 55.613  -39.914 21.942  1.00 68.68 ? 549 PRO B N   1 
ATOM   5344 C CA  . PRO B 1 338 ? 56.172  -40.605 23.106  1.00 69.45 ? 549 PRO B CA  1 
ATOM   5345 C C   . PRO B 1 338 ? 55.686  -40.002 24.434  1.00 69.49 ? 549 PRO B C   1 
ATOM   5346 O O   . PRO B 1 338 ? 56.321  -40.180 25.477  1.00 70.32 ? 549 PRO B O   1 
ATOM   5347 C CB  . PRO B 1 338 ? 57.675  -40.405 22.917  1.00 70.48 ? 549 PRO B CB  1 
ATOM   5348 C CG  . PRO B 1 338 ? 57.779  -39.051 22.251  1.00 70.27 ? 549 PRO B CG  1 
ATOM   5349 C CD  . PRO B 1 338 ? 56.482  -38.798 21.510  1.00 68.77 ? 549 PRO B CD  1 
ATOM   5350 N N   . ASP B 1 339 ? 54.558  -39.295 24.375  1.00 68.43 ? 550 ASP B N   1 
ATOM   5351 C CA  . ASP B 1 339 ? 53.899  -38.719 25.537  1.00 67.94 ? 550 ASP B CA  1 
ATOM   5352 C C   . ASP B 1 339 ? 52.678  -39.602 25.862  1.00 66.88 ? 550 ASP B C   1 
ATOM   5353 O O   . ASP B 1 339 ? 52.763  -40.516 26.700  1.00 67.78 ? 550 ASP B O   1 
ATOM   5354 C CB  . ASP B 1 339 ? 53.503  -37.260 25.228  1.00 67.50 ? 550 ASP B CB  1 
ATOM   5355 C CG  . ASP B 1 339 ? 52.850  -36.557 26.408  1.00 68.09 ? 550 ASP B CG  1 
ATOM   5356 O OD1 . ASP B 1 339 ? 53.518  -36.406 27.460  1.00 69.83 ? 550 ASP B OD1 1 
ATOM   5357 O OD2 . ASP B 1 339 ? 51.678  -36.137 26.275  1.00 68.46 ? 550 ASP B OD2 1 
ATOM   5358 N N   . GLY B 1 340 ? 51.559  -39.348 25.184  1.00 64.68 ? 551 GLY B N   1 
ATOM   5359 C CA  . GLY B 1 340 ? 50.353  -40.156 25.328  1.00 63.17 ? 551 GLY B CA  1 
ATOM   5360 C C   . GLY B 1 340 ? 50.021  -40.862 24.029  1.00 61.61 ? 551 GLY B C   1 
ATOM   5361 O O   . GLY B 1 340 ? 50.920  -41.331 23.311  1.00 61.93 ? 551 GLY B O   1 
ATOM   5362 N N   . TYR B 1 341 ? 48.723  -40.919 23.728  1.00 59.25 ? 552 TYR B N   1 
ATOM   5363 C CA  . TYR B 1 341 ? 48.206  -41.613 22.544  1.00 57.20 ? 552 TYR B CA  1 
ATOM   5364 C C   . TYR B 1 341 ? 48.596  -40.904 21.236  1.00 55.22 ? 552 TYR B C   1 
ATOM   5365 O O   . TYR B 1 341 ? 49.014  -39.737 21.227  1.00 55.03 ? 552 TYR B O   1 
ATOM   5366 C CB  . TYR B 1 341 ? 46.674  -41.740 22.640  1.00 56.38 ? 552 TYR B CB  1 
ATOM   5367 N N   . THR B 1 342 ? 48.454  -41.631 20.134  1.00 52.82 ? 553 THR B N   1 
ATOM   5368 C CA  . THR B 1 342 ? 48.664  -41.084 18.796  1.00 50.70 ? 553 THR B CA  1 
ATOM   5369 C C   . THR B 1 342 ? 47.380  -41.298 17.989  1.00 47.69 ? 553 THR B C   1 
ATOM   5370 O O   . THR B 1 342 ? 46.764  -42.345 18.087  1.00 47.26 ? 553 THR B O   1 
ATOM   5371 C CB  . THR B 1 342 ? 49.865  -41.777 18.116  1.00 51.31 ? 553 THR B CB  1 
ATOM   5372 O OG1 . THR B 1 342 ? 50.894  -42.017 19.089  1.00 52.80 ? 553 THR B OG1 1 
ATOM   5373 C CG2 . THR B 1 342 ? 50.441  -40.899 17.007  1.00 52.08 ? 553 THR B CG2 1 
ATOM   5374 N N   . LEU B 1 343 ? 46.958  -40.291 17.229  1.00 44.71 ? 554 LEU B N   1 
ATOM   5375 C CA  . LEU B 1 343 ? 45.803  -40.433 16.336  1.00 42.48 ? 554 LEU B CA  1 
ATOM   5376 C C   . LEU B 1 343 ? 46.038  -41.582 15.343  1.00 40.67 ? 554 LEU B C   1 
ATOM   5377 O O   . LEU B 1 343 ? 47.132  -41.756 14.834  1.00 40.96 ? 554 LEU B O   1 
ATOM   5378 C CB  . LEU B 1 343 ? 45.551  -39.135 15.565  1.00 41.97 ? 554 LEU B CB  1 
ATOM   5379 C CG  . LEU B 1 343 ? 44.798  -37.991 16.265  1.00 42.54 ? 554 LEU B CG  1 
ATOM   5380 C CD1 . LEU B 1 343 ? 44.893  -36.707 15.441  1.00 40.88 ? 554 LEU B CD1 1 
ATOM   5381 C CD2 . LEU B 1 343 ? 43.334  -38.374 16.506  1.00 40.87 ? 554 LEU B CD2 1 
ATOM   5382 N N   . ASN B 1 344 ? 45.016  -42.371 15.077  1.00 38.15 ? 555 ASN B N   1 
ATOM   5383 C CA  . ASN B 1 344 ? 45.160  -43.421 14.085  1.00 37.25 ? 555 ASN B CA  1 
ATOM   5384 C C   . ASN B 1 344 ? 45.425  -42.842 12.726  1.00 35.20 ? 555 ASN B C   1 
ATOM   5385 O O   . ASN B 1 344 ? 46.350  -43.283 12.044  1.00 35.12 ? 555 ASN B O   1 
ATOM   5386 C CB  . ASN B 1 344 ? 43.941  -44.346 14.069  1.00 36.92 ? 555 ASN B CB  1 
ATOM   5387 C CG  . ASN B 1 344 ? 43.939  -45.291 15.263  1.00 38.60 ? 555 ASN B CG  1 
ATOM   5388 O OD1 . ASN B 1 344 ? 44.956  -45.907 15.578  1.00 41.89 ? 555 ASN B OD1 1 
ATOM   5389 N ND2 . ASN B 1 344 ? 42.832  -45.358 15.958  1.00 37.23 ? 555 ASN B ND2 1 
ATOM   5390 N N   . TYR B 1 345 ? 44.641  -41.828 12.371  1.00 32.73 ? 556 TYR B N   1 
ATOM   5391 C CA  . TYR B 1 345 ? 44.676  -41.231 11.053  1.00 31.53 ? 556 TYR B CA  1 
ATOM   5392 C C   . TYR B 1 345 ? 44.724  -39.724 11.163  1.00 30.79 ? 556 TYR B C   1 
ATOM   5393 O O   . TYR B 1 345 ? 44.406  -39.145 12.210  1.00 30.02 ? 556 TYR B O   1 
ATOM   5394 C CB  . TYR B 1 345 ? 43.459  -41.673 10.230  1.00 30.92 ? 556 TYR B CB  1 
ATOM   5395 C CG  . TYR B 1 345 ? 43.205  -43.171 10.333  1.00 31.69 ? 556 TYR B CG  1 
ATOM   5396 C CD1 . TYR B 1 345 ? 44.135  -44.091 9.835   1.00 34.18 ? 556 TYR B CD1 1 
ATOM   5397 C CD2 . TYR B 1 345 ? 42.064  -43.672 10.950  1.00 31.67 ? 556 TYR B CD2 1 
ATOM   5398 C CE1 . TYR B 1 345 ? 43.909  -45.476 9.923   1.00 33.95 ? 556 TYR B CE1 1 
ATOM   5399 C CE2 . TYR B 1 345 ? 41.846  -45.063 11.059  1.00 33.12 ? 556 TYR B CE2 1 
ATOM   5400 C CZ  . TYR B 1 345 ? 42.790  -45.947 10.548  1.00 33.31 ? 556 TYR B CZ  1 
ATOM   5401 O OH  . TYR B 1 345 ? 42.591  -47.299 10.625  1.00 35.30 ? 556 TYR B OH  1 
ATOM   5402 N N   . ASN B 1 346 ? 45.132  -39.102 10.058  1.00 29.81 ? 557 ASN B N   1 
ATOM   5403 C CA  . ASN B 1 346 ? 45.322  -37.670 9.991   1.00 28.42 ? 557 ASN B CA  1 
ATOM   5404 C C   . ASN B 1 346 ? 43.992  -36.963 10.127  1.00 27.24 ? 557 ASN B C   1 
ATOM   5405 O O   . ASN B 1 346 ? 42.949  -37.540 9.928   1.00 27.84 ? 557 ASN B O   1 
ATOM   5406 C CB  . ASN B 1 346 ? 45.914  -37.273 8.632   1.00 28.30 ? 557 ASN B CB  1 
ATOM   5407 C CG  . ASN B 1 346 ? 47.393  -37.600 8.478   1.00 29.77 ? 557 ASN B CG  1 
ATOM   5408 O OD1 . ASN B 1 346 ? 48.159  -37.633 9.441   1.00 31.29 ? 557 ASN B OD1 1 
ATOM   5409 N ND2 . ASN B 1 346 ? 47.811  -37.769 7.226   1.00 27.54 ? 557 ASN B ND2 1 
ATOM   5410 N N   . GLU B 1 347 ? 44.034  -35.697 10.472  1.00 26.60 ? 558 GLU B N   1 
ATOM   5411 C CA  . GLU B 1 347 ? 42.888  -34.838 10.255  1.00 25.28 ? 558 GLU B CA  1 
ATOM   5412 C C   . GLU B 1 347 ? 43.383  -33.432 10.047  1.00 24.31 ? 558 GLU B C   1 
ATOM   5413 O O   . GLU B 1 347 ? 44.409  -33.052 10.574  1.00 26.01 ? 558 GLU B O   1 
ATOM   5414 C CB  . GLU B 1 347 ? 41.858  -34.912 11.387  1.00 25.26 ? 558 GLU B CB  1 
ATOM   5415 C CG  . GLU B 1 347 ? 42.314  -34.507 12.776  1.00 24.52 ? 558 GLU B CG  1 
ATOM   5416 C CD  . GLU B 1 347 ? 41.268  -34.902 13.818  1.00 26.65 ? 558 GLU B CD  1 
ATOM   5417 O OE1 . GLU B 1 347 ? 40.627  -34.006 14.413  1.00 26.18 ? 558 GLU B OE1 1 
ATOM   5418 O OE2 . GLU B 1 347 ? 41.062  -36.126 14.018  1.00 25.33 ? 558 GLU B OE2 1 
ATOM   5419 N N   . TYR B 1 348 ? 42.681  -32.697 9.214   1.00 23.38 ? 559 TYR B N   1 
ATOM   5420 C CA  . TYR B 1 348 ? 43.095  -31.397 8.755   1.00 22.91 ? 559 TYR B CA  1 
ATOM   5421 C C   . TYR B 1 348 ? 42.033  -30.411 9.180   1.00 21.29 ? 559 TYR B C   1 
ATOM   5422 O O   . TYR B 1 348 ? 40.831  -30.672 9.012   1.00 20.14 ? 559 TYR B O   1 
ATOM   5423 C CB  . TYR B 1 348 ? 43.192  -31.387 7.237   1.00 23.38 ? 559 TYR B CB  1 
ATOM   5424 C CG  . TYR B 1 348 ? 44.149  -32.395 6.646   1.00 26.07 ? 559 TYR B CG  1 
ATOM   5425 C CD1 . TYR B 1 348 ? 45.450  -32.036 6.310   1.00 27.02 ? 559 TYR B CD1 1 
ATOM   5426 C CD2 . TYR B 1 348 ? 43.744  -33.715 6.404   1.00 28.88 ? 559 TYR B CD2 1 
ATOM   5427 C CE1 . TYR B 1 348 ? 46.334  -32.964 5.764   1.00 30.69 ? 559 TYR B CE1 1 
ATOM   5428 C CE2 . TYR B 1 348 ? 44.627  -34.648 5.851   1.00 29.77 ? 559 TYR B CE2 1 
ATOM   5429 C CZ  . TYR B 1 348 ? 45.908  -34.259 5.524   1.00 29.91 ? 559 TYR B CZ  1 
ATOM   5430 O OH  . TYR B 1 348 ? 46.775  -35.181 5.009   1.00 32.89 ? 559 TYR B OH  1 
ATOM   5431 N N   . ILE B 1 349 ? 42.467  -29.279 9.717   1.00 20.06 ? 560 ILE B N   1 
ATOM   5432 C CA  . ILE B 1 349 ? 41.543  -28.225 10.110  1.00 19.29 ? 560 ILE B CA  1 
ATOM   5433 C C   . ILE B 1 349 ? 41.902  -26.874 9.527   1.00 19.73 ? 560 ILE B C   1 
ATOM   5434 O O   . ILE B 1 349 ? 43.032  -26.413 9.674   1.00 21.11 ? 560 ILE B O   1 
ATOM   5435 C CB  . ILE B 1 349 ? 41.537  -28.081 11.666  1.00 19.60 ? 560 ILE B CB  1 
ATOM   5436 C CG1 . ILE B 1 349 ? 41.202  -29.417 12.315  1.00 18.96 ? 560 ILE B CG1 1 
ATOM   5437 C CG2 . ILE B 1 349 ? 40.567  -27.011 12.124  1.00 16.96 ? 560 ILE B CG2 1 
ATOM   5438 C CD1 . ILE B 1 349 ? 42.375  -30.288 12.481  1.00 16.98 ? 560 ILE B CD1 1 
ATOM   5439 N N   . VAL B 1 350 ? 40.934  -26.203 8.935   1.00 19.54 ? 561 VAL B N   1 
ATOM   5440 C CA  . VAL B 1 350 ? 41.072  -24.799 8.585   1.00 20.25 ? 561 VAL B CA  1 
ATOM   5441 C C   . VAL B 1 350 ? 40.112  -23.962 9.390   1.00 21.22 ? 561 VAL B C   1 
ATOM   5442 O O   . VAL B 1 350 ? 39.046  -24.431 9.781   1.00 20.49 ? 561 VAL B O   1 
ATOM   5443 C CB  . VAL B 1 350 ? 40.873  -24.546 7.070   1.00 20.41 ? 561 VAL B CB  1 
ATOM   5444 C CG1 . VAL B 1 350 ? 41.819  -25.440 6.315   1.00 20.78 ? 561 VAL B CG1 1 
ATOM   5445 C CG2 . VAL B 1 350 ? 39.451  -24.773 6.612   1.00 19.39 ? 561 VAL B CG2 1 
ATOM   5446 N N   . TYR B 1 351 ? 40.493  -22.705 9.626   1.00 22.24 ? 562 TYR B N   1 
ATOM   5447 C CA  . TYR B 1 351 ? 39.715  -21.815 10.461  1.00 22.60 ? 562 TYR B CA  1 
ATOM   5448 C C   . TYR B 1 351 ? 39.016  -20.669 9.721   1.00 23.35 ? 562 TYR B C   1 
ATOM   5449 O O   . TYR B 1 351 ? 38.472  -19.777 10.366  1.00 22.30 ? 562 TYR B O   1 
ATOM   5450 C CB  . TYR B 1 351 ? 40.626  -21.296 11.586  1.00 23.26 ? 562 TYR B CB  1 
ATOM   5451 C CG  . TYR B 1 351 ? 41.282  -22.447 12.345  1.00 22.27 ? 562 TYR B CG  1 
ATOM   5452 C CD1 . TYR B 1 351 ? 40.678  -23.017 13.465  1.00 19.16 ? 562 TYR B CD1 1 
ATOM   5453 C CD2 . TYR B 1 351 ? 42.474  -23.012 11.895  1.00 19.55 ? 562 TYR B CD2 1 
ATOM   5454 C CE1 . TYR B 1 351 ? 41.275  -24.053 14.141  1.00 17.14 ? 562 TYR B CE1 1 
ATOM   5455 C CE2 . TYR B 1 351 ? 43.070  -24.048 12.578  1.00 20.77 ? 562 TYR B CE2 1 
ATOM   5456 C CZ  . TYR B 1 351 ? 42.469  -24.564 13.702  1.00 19.67 ? 562 TYR B CZ  1 
ATOM   5457 O OH  . TYR B 1 351 ? 43.060  -25.622 14.373  1.00 19.29 ? 562 TYR B OH  1 
ATOM   5458 N N   . ASN B 1 352 ? 38.978  -20.717 8.387   1.00 23.58 ? 563 ASN B N   1 
ATOM   5459 C CA  . ASN B 1 352 ? 38.183  -19.764 7.588   1.00 24.67 ? 563 ASN B CA  1 
ATOM   5460 C C   . ASN B 1 352 ? 37.453  -20.510 6.479   1.00 24.61 ? 563 ASN B C   1 
ATOM   5461 O O   . ASN B 1 352 ? 38.086  -21.230 5.738   1.00 25.00 ? 563 ASN B O   1 
ATOM   5462 C CB  . ASN B 1 352 ? 39.102  -18.680 6.972   1.00 25.55 ? 563 ASN B CB  1 
ATOM   5463 C CG  . ASN B 1 352 ? 38.340  -17.488 6.370   1.00 26.60 ? 563 ASN B CG  1 
ATOM   5464 O OD1 . ASN B 1 352 ? 37.334  -17.633 5.644   1.00 24.93 ? 563 ASN B OD1 1 
ATOM   5465 N ND2 . ASN B 1 352 ? 38.882  -16.274 6.617   1.00 26.94 ? 563 ASN B ND2 1 
ATOM   5466 N N   . PRO B 1 353 ? 36.134  -20.326 6.337   1.00 25.02 ? 564 PRO B N   1 
ATOM   5467 C CA  . PRO B 1 353 ? 35.400  -20.977 5.237   1.00 24.98 ? 564 PRO B CA  1 
ATOM   5468 C C   . PRO B 1 353 ? 35.957  -20.715 3.844   1.00 26.14 ? 564 PRO B C   1 
ATOM   5469 O O   . PRO B 1 353 ? 35.678  -21.507 2.935   1.00 26.78 ? 564 PRO B O   1 
ATOM   5470 C CB  . PRO B 1 353 ? 33.998  -20.395 5.319   1.00 24.96 ? 564 PRO B CB  1 
ATOM   5471 C CG  . PRO B 1 353 ? 34.000  -19.436 6.481   1.00 27.01 ? 564 PRO B CG  1 
ATOM   5472 C CD  . PRO B 1 353 ? 35.273  -19.512 7.211   1.00 25.75 ? 564 PRO B CD  1 
ATOM   5473 N N   . ASN B 1 354 ? 36.691  -19.602 3.666   1.00 24.89 ? 565 ASN B N   1 
ATOM   5474 C CA  . ASN B 1 354 ? 37.323  -19.311 2.393   1.00 25.30 ? 565 ASN B CA  1 
ATOM   5475 C C   . ASN B 1 354 ? 38.496  -20.232 2.045   1.00 24.96 ? 565 ASN B C   1 
ATOM   5476 O O   . ASN B 1 354 ? 39.022  -20.176 0.937   1.00 25.44 ? 565 ASN B O   1 
ATOM   5477 C CB  . ASN B 1 354 ? 37.704  -17.818 2.273   1.00 25.88 ? 565 ASN B CB  1 
ATOM   5478 C CG  . ASN B 1 354 ? 38.917  -17.436 3.057   1.00 24.09 ? 565 ASN B CG  1 
ATOM   5479 O OD1 . ASN B 1 354 ? 39.589  -18.250 3.656   1.00 23.43 ? 565 ASN B OD1 1 
ATOM   5480 N ND2 . ASN B 1 354 ? 39.230  -16.162 3.011   1.00 30.91 ? 565 ASN B ND2 1 
ATOM   5481 N N   . GLN B 1 355 ? 38.891  -21.095 2.975   1.00 23.35 ? 566 GLN B N   1 
ATOM   5482 C CA  . GLN B 1 355 ? 39.779  -22.165 2.646   1.00 21.91 ? 566 GLN B CA  1 
ATOM   5483 C C   . GLN B 1 355 ? 39.073  -23.464 2.207   1.00 21.30 ? 566 GLN B C   1 
ATOM   5484 O O   . GLN B 1 355 ? 39.714  -24.521 2.124   1.00 20.60 ? 566 GLN B O   1 
ATOM   5485 C CB  . GLN B 1 355 ? 40.715  -22.385 3.800   1.00 22.64 ? 566 GLN B CB  1 
ATOM   5486 C CG  . GLN B 1 355 ? 41.715  -21.273 3.898   1.00 22.96 ? 566 GLN B CG  1 
ATOM   5487 C CD  . GLN B 1 355 ? 42.446  -21.311 5.188   1.00 26.34 ? 566 GLN B CD  1 
ATOM   5488 O OE1 . GLN B 1 355 ? 42.020  -20.692 6.169   1.00 26.12 ? 566 GLN B OE1 1 
ATOM   5489 N NE2 . GLN B 1 355 ? 43.523  -22.082 5.235   1.00 25.78 ? 566 GLN B NE2 1 
ATOM   5490 N N   . VAL B 1 356 ? 37.773  -23.366 1.898   1.00 19.86 ? 567 VAL B N   1 
ATOM   5491 C CA  . VAL B 1 356 ? 36.974  -24.500 1.546   1.00 19.38 ? 567 VAL B CA  1 
ATOM   5492 C C   . VAL B 1 356 ? 36.144  -24.227 0.321   1.00 20.03 ? 567 VAL B C   1 
ATOM   5493 O O   . VAL B 1 356 ? 35.401  -23.240 0.275   1.00 20.45 ? 567 VAL B O   1 
ATOM   5494 C CB  . VAL B 1 356 ? 35.962  -24.884 2.656   1.00 18.88 ? 567 VAL B CB  1 
ATOM   5495 C CG1 . VAL B 1 356 ? 35.123  -26.108 2.177   1.00 16.09 ? 567 VAL B CG1 1 
ATOM   5496 C CG2 . VAL B 1 356 ? 36.680  -25.178 3.919   1.00 16.93 ? 567 VAL B CG2 1 
ATOM   5497 N N   . ARG B 1 357 ? 36.233  -25.142 -0.645  1.00 21.02 ? 568 ARG B N   1 
ATOM   5498 C CA  . ARG B 1 357 ? 35.324  -25.146 -1.776  1.00 22.19 ? 568 ARG B CA  1 
ATOM   5499 C C   . ARG B 1 357 ? 34.803  -26.554 -1.981  1.00 22.65 ? 568 ARG B C   1 
ATOM   5500 O O   . ARG B 1 357 ? 35.559  -27.469 -2.365  1.00 22.15 ? 568 ARG B O   1 
ATOM   5501 C CB  . ARG B 1 357 ? 36.064  -24.684 -3.035  1.00 23.48 ? 568 ARG B CB  1 
ATOM   5502 C CG  . ARG B 1 357 ? 35.144  -24.404 -4.196  1.00 28.17 ? 568 ARG B CG  1 
ATOM   5503 C CD  . ARG B 1 357 ? 35.914  -24.236 -5.558  1.00 33.40 ? 568 ARG B CD  1 
ATOM   5504 N NE  . ARG B 1 357 ? 34.959  -24.324 -6.661  1.00 36.63 ? 568 ARG B NE  1 
ATOM   5505 C CZ  . ARG B 1 357 ? 35.263  -24.600 -7.935  1.00 40.92 ? 568 ARG B CZ  1 
ATOM   5506 N NH1 . ARG B 1 357 ? 36.527  -24.827 -8.317  1.00 42.20 ? 568 ARG B NH1 1 
ATOM   5507 N NH2 . ARG B 1 357 ? 34.286  -24.642 -8.844  1.00 39.64 ? 568 ARG B NH2 1 
ATOM   5508 N N   . MET B 1 358 ? 33.508  -26.708 -1.735  1.00 22.84 ? 569 MET B N   1 
ATOM   5509 C CA  . MET B 1 358 ? 32.832  -27.975 -1.787  1.00 23.42 ? 569 MET B CA  1 
ATOM   5510 C C   . MET B 1 358 ? 32.711  -28.323 -3.265  1.00 24.93 ? 569 MET B C   1 
ATOM   5511 O O   . MET B 1 358 ? 32.250  -27.477 -4.057  1.00 26.24 ? 569 MET B O   1 
ATOM   5512 C CB  . MET B 1 358 ? 31.427  -27.889 -1.159  1.00 22.37 ? 569 MET B CB  1 
ATOM   5513 C CG  . MET B 1 358 ? 31.373  -27.519 0.331   1.00 22.87 ? 569 MET B CG  1 
ATOM   5514 S SD  . MET B 1 358 ? 29.724  -27.565 1.072   1.00 21.75 ? 569 MET B SD  1 
ATOM   5515 C CE  . MET B 1 358 ? 28.889  -26.143 0.366   1.00 17.22 ? 569 MET B CE  1 
ATOM   5516 N N   . ARG B 1 359 ? 33.088  -29.557 -3.621  1.00 25.01 ? 570 ARG B N   1 
ATOM   5517 C CA  . ARG B 1 359 ? 33.152  -29.973 -5.016  1.00 25.91 ? 570 ARG B CA  1 
ATOM   5518 C C   . ARG B 1 359 ? 32.308  -31.189 -5.367  1.00 24.74 ? 570 ARG B C   1 
ATOM   5519 O O   . ARG B 1 359 ? 31.724  -31.221 -6.452  1.00 25.20 ? 570 ARG B O   1 
ATOM   5520 C CB  . ARG B 1 359 ? 34.614  -30.218 -5.433  1.00 27.13 ? 570 ARG B CB  1 
ATOM   5521 C CG  . ARG B 1 359 ? 35.396  -28.991 -5.871  1.00 32.07 ? 570 ARG B CG  1 
ATOM   5522 C CD  . ARG B 1 359 ? 34.653  -27.989 -6.800  1.00 37.84 ? 570 ARG B CD  1 
ATOM   5523 N NE  . ARG B 1 359 ? 33.960  -28.596 -7.937  1.00 44.36 ? 570 ARG B NE  1 
ATOM   5524 C CZ  . ARG B 1 359 ? 34.537  -29.023 -9.064  1.00 47.85 ? 570 ARG B CZ  1 
ATOM   5525 N NH1 . ARG B 1 359 ? 35.854  -28.916 -9.248  1.00 49.81 ? 570 ARG B NH1 1 
ATOM   5526 N NH2 . ARG B 1 359 ? 33.785  -29.572 -10.017 1.00 49.99 ? 570 ARG B NH2 1 
ATOM   5527 N N   . TYR B 1 360 ? 32.267  -32.202 -4.488  1.00 23.15 ? 571 TYR B N   1 
ATOM   5528 C CA  . TYR B 1 360 ? 31.489  -33.405 -4.745  1.00 22.48 ? 571 TYR B CA  1 
ATOM   5529 C C   . TYR B 1 360 ? 30.633  -33.884 -3.527  1.00 21.40 ? 571 TYR B C   1 
ATOM   5530 O O   . TYR B 1 360 ? 31.055  -33.801 -2.392  1.00 19.58 ? 571 TYR B O   1 
ATOM   5531 C CB  . TYR B 1 360 ? 32.414  -34.538 -5.206  1.00 22.52 ? 571 TYR B CB  1 
ATOM   5532 C CG  . TYR B 1 360 ? 33.303  -34.197 -6.396  1.00 23.76 ? 571 TYR B CG  1 
ATOM   5533 C CD1 . TYR B 1 360 ? 32.803  -34.212 -7.687  1.00 25.28 ? 571 TYR B CD1 1 
ATOM   5534 C CD2 . TYR B 1 360 ? 34.651  -33.869 -6.218  1.00 22.98 ? 571 TYR B CD2 1 
ATOM   5535 C CE1 . TYR B 1 360 ? 33.625  -33.904 -8.803  1.00 26.48 ? 571 TYR B CE1 1 
ATOM   5536 C CE2 . TYR B 1 360 ? 35.475  -33.550 -7.309  1.00 27.04 ? 571 TYR B CE2 1 
ATOM   5537 C CZ  . TYR B 1 360 ? 34.963  -33.576 -8.600  1.00 27.02 ? 571 TYR B CZ  1 
ATOM   5538 O OH  . TYR B 1 360 ? 35.800  -33.260 -9.664  1.00 30.11 ? 571 TYR B OH  1 
ATOM   5539 N N   . LEU B 1 361 ? 29.433  -34.364 -3.809  1.00 20.68 ? 572 LEU B N   1 
ATOM   5540 C CA  . LEU B 1 361 ? 28.585  -35.025 -2.821  1.00 21.03 ? 572 LEU B CA  1 
ATOM   5541 C C   . LEU B 1 361 ? 28.306  -36.479 -3.246  1.00 21.32 ? 572 LEU B C   1 
ATOM   5542 O O   . LEU B 1 361 ? 27.778  -36.721 -4.334  1.00 21.94 ? 572 LEU B O   1 
ATOM   5543 C CB  . LEU B 1 361 ? 27.288  -34.260 -2.684  1.00 20.77 ? 572 LEU B CB  1 
ATOM   5544 C CG  . LEU B 1 361 ? 26.384  -34.602 -1.476  1.00 21.23 ? 572 LEU B CG  1 
ATOM   5545 C CD1 . LEU B 1 361 ? 27.082  -34.297 -0.164  1.00 15.64 ? 572 LEU B CD1 1 
ATOM   5546 C CD2 . LEU B 1 361 ? 25.091  -33.836 -1.622  1.00 18.43 ? 572 LEU B CD2 1 
ATOM   5547 N N   . LEU B 1 362 ? 28.698  -37.431 -2.402  1.00 21.56 ? 573 LEU B N   1 
ATOM   5548 C CA  . LEU B 1 362 ? 28.510  -38.856 -2.679  1.00 21.54 ? 573 LEU B CA  1 
ATOM   5549 C C   . LEU B 1 362 ? 27.290  -39.381 -1.945  1.00 21.87 ? 573 LEU B C   1 
ATOM   5550 O O   . LEU B 1 362 ? 27.176  -39.184 -0.733  1.00 21.05 ? 573 LEU B O   1 
ATOM   5551 C CB  . LEU B 1 362 ? 29.748  -39.650 -2.245  1.00 21.09 ? 573 LEU B CB  1 
ATOM   5552 C CG  . LEU B 1 362 ? 31.060  -39.467 -3.010  1.00 20.58 ? 573 LEU B CG  1 
ATOM   5553 C CD1 . LEU B 1 362 ? 31.662  -38.057 -2.869  1.00 18.62 ? 573 LEU B CD1 1 
ATOM   5554 C CD2 . LEU B 1 362 ? 32.039  -40.511 -2.556  1.00 19.28 ? 573 LEU B CD2 1 
ATOM   5555 N N   . LYS B 1 363 ? 26.396  -40.089 -2.646  1.00 22.35 ? 574 LYS B N   1 
ATOM   5556 C CA  . LYS B 1 363 ? 25.300  -40.785 -1.962  1.00 22.34 ? 574 LYS B CA  1 
ATOM   5557 C C   . LYS B 1 363 ? 25.789  -42.215 -1.715  1.00 22.84 ? 574 LYS B C   1 
ATOM   5558 O O   . LYS B 1 363 ? 26.010  -42.985 -2.672  1.00 22.22 ? 574 LYS B O   1 
ATOM   5559 C CB  . LYS B 1 363 ? 24.019  -40.732 -2.792  1.00 22.59 ? 574 LYS B CB  1 
ATOM   5560 C CG  . LYS B 1 363 ? 22.746  -41.257 -2.126  1.00 24.80 ? 574 LYS B CG  1 
ATOM   5561 C CD  . LYS B 1 363 ? 21.598  -41.396 -3.184  1.00 27.82 ? 574 LYS B CD  1 
ATOM   5562 C CE  . LYS B 1 363 ? 20.298  -41.977 -2.615  1.00 30.39 ? 574 LYS B CE  1 
ATOM   5563 N NZ  . LYS B 1 363 ? 19.110  -41.555 -3.498  1.00 30.55 ? 574 LYS B NZ  1 
ATOM   5564 N N   . VAL B 1 364 ? 25.982  -42.541 -0.434  1.00 21.16 ? 575 VAL B N   1 
ATOM   5565 C CA  . VAL B 1 364 ? 26.610  -43.771 -0.023  1.00 21.07 ? 575 VAL B CA  1 
ATOM   5566 C C   . VAL B 1 364 ? 25.680  -44.758 0.683   1.00 21.98 ? 575 VAL B C   1 
ATOM   5567 O O   . VAL B 1 364 ? 24.971  -44.425 1.667   1.00 22.12 ? 575 VAL B O   1 
ATOM   5568 C CB  . VAL B 1 364 ? 27.813  -43.496 0.898   1.00 21.14 ? 575 VAL B CB  1 
ATOM   5569 C CG1 . VAL B 1 364 ? 28.486  -44.762 1.251   1.00 19.36 ? 575 VAL B CG1 1 
ATOM   5570 C CG2 . VAL B 1 364 ? 28.792  -42.473 0.240   1.00 19.98 ? 575 VAL B CG2 1 
ATOM   5571 N N   . GLN B 1 365 ? 25.728  -45.994 0.195   1.00 22.01 ? 576 GLN B N   1 
ATOM   5572 C CA  . GLN B 1 365 ? 25.132  -47.137 0.887   1.00 22.75 ? 576 GLN B CA  1 
ATOM   5573 C C   . GLN B 1 365 ? 26.154  -47.808 1.805   1.00 21.99 ? 576 GLN B C   1 
ATOM   5574 O O   . GLN B 1 365 ? 27.147  -48.378 1.327   1.00 22.03 ? 576 GLN B O   1 
ATOM   5575 C CB  . GLN B 1 365 ? 24.612  -48.140 -0.145  1.00 23.48 ? 576 GLN B CB  1 
ATOM   5576 C CG  . GLN B 1 365 ? 24.131  -49.471 0.444   1.00 26.42 ? 576 GLN B CG  1 
ATOM   5577 C CD  . GLN B 1 365 ? 23.718  -50.429 -0.649  1.00 30.21 ? 576 GLN B CD  1 
ATOM   5578 O OE1 . GLN B 1 365 ? 22.702  -50.226 -1.322  1.00 32.99 ? 576 GLN B OE1 1 
ATOM   5579 N NE2 . GLN B 1 365 ? 24.513  -51.466 -0.845  1.00 28.59 ? 576 GLN B NE2 1 
ATOM   5580 N N   . PHE B 1 366 ? 25.899  -47.758 3.111   1.00 21.35 ? 577 PHE B N   1 
ATOM   5581 C CA  . PHE B 1 366 ? 26.726  -48.410 4.109   1.00 20.62 ? 577 PHE B CA  1 
ATOM   5582 C C   . PHE B 1 366 ? 26.262  -49.864 4.155   1.00 22.11 ? 577 PHE B C   1 
ATOM   5583 O O   . PHE B 1 366 ? 25.045  -50.139 4.300   1.00 22.94 ? 577 PHE B O   1 
ATOM   5584 C CB  . PHE B 1 366 ? 26.553  -47.762 5.498   1.00 20.94 ? 577 PHE B CB  1 
ATOM   5585 C CG  . PHE B 1 366 ? 27.161  -46.399 5.607   1.00 19.11 ? 577 PHE B CG  1 
ATOM   5586 C CD1 . PHE B 1 366 ? 28.314  -46.207 6.335   1.00 20.80 ? 577 PHE B CD1 1 
ATOM   5587 C CD2 . PHE B 1 366 ? 26.625  -45.326 4.911   1.00 20.20 ? 577 PHE B CD2 1 
ATOM   5588 C CE1 . PHE B 1 366 ? 28.911  -44.924 6.409   1.00 23.13 ? 577 PHE B CE1 1 
ATOM   5589 C CE2 . PHE B 1 366 ? 27.223  -44.048 4.948   1.00 20.03 ? 577 PHE B CE2 1 
ATOM   5590 C CZ  . PHE B 1 366 ? 28.359  -43.846 5.721   1.00 21.29 ? 577 PHE B CZ  1 
ATOM   5591 N N   . ASN B 1 367 ? 27.202  -50.796 4.056   1.00 21.57 ? 578 ASN B N   1 
ATOM   5592 C CA  . ASN B 1 367 ? 26.848  -52.218 4.069   1.00 23.01 ? 578 ASN B CA  1 
ATOM   5593 C C   . ASN B 1 367 ? 27.269  -52.787 5.394   1.00 22.95 ? 578 ASN B C   1 
ATOM   5594 O O   . ASN B 1 367 ? 28.461  -53.059 5.603   1.00 23.23 ? 578 ASN B O   1 
ATOM   5595 C CB  . ASN B 1 367 ? 27.554  -52.959 2.940   1.00 23.03 ? 578 ASN B CB  1 
ATOM   5596 C CG  . ASN B 1 367 ? 27.353  -52.303 1.633   1.00 24.23 ? 578 ASN B CG  1 
ATOM   5597 O OD1 . ASN B 1 367 ? 26.205  -52.123 1.193   1.00 24.56 ? 578 ASN B OD1 1 
ATOM   5598 N ND2 . ASN B 1 367 ? 28.464  -51.893 0.988   1.00 23.22 ? 578 ASN B ND2 1 
ATOM   5599 N N   . PHE B 1 368 ? 26.325  -52.911 6.317   1.00 22.51 ? 579 PHE B N   1 
ATOM   5600 C CA  . PHE B 1 368 ? 26.679  -53.428 7.630   1.00 23.29 ? 579 PHE B CA  1 
ATOM   5601 C C   . PHE B 1 368 ? 26.529  -54.971 7.632   1.00 24.23 ? 579 PHE B C   1 
ATOM   5602 O O   . PHE B 1 368 ? 27.028  -55.609 8.574   1.00 26.10 ? 579 PHE B O   1 
ATOM   5603 C CB  . PHE B 1 368 ? 25.815  -52.799 8.730   1.00 23.66 ? 579 PHE B CB  1 
ATOM   5604 C CG  . PHE B 1 368 ? 26.086  -51.334 8.960   1.00 22.33 ? 579 PHE B CG  1 
ATOM   5605 C CD1 . PHE B 1 368 ? 27.102  -50.923 9.811   1.00 20.94 ? 579 PHE B CD1 1 
ATOM   5606 C CD2 . PHE B 1 368 ? 25.324  -50.376 8.320   1.00 23.52 ? 579 PHE B CD2 1 
ATOM   5607 C CE1 . PHE B 1 368 ? 27.363  -49.602 9.989   1.00 23.26 ? 579 PHE B CE1 1 
ATOM   5608 C CE2 . PHE B 1 368 ? 25.561  -49.057 8.517   1.00 19.82 ? 579 PHE B CE2 1 
ATOM   5609 C CZ  . PHE B 1 368 ? 26.584  -48.657 9.350   1.00 22.29 ? 579 PHE B CZ  1 
HETATM 5610 C CAJ . 09L C 2 .   ? 16.402  -7.535  12.681  1.00 25.33 ? 601 09L A CAJ 1 
HETATM 5611 C CAK . 09L C 2 .   ? 17.649  -7.405  13.283  1.00 21.83 ? 601 09L A CAK 1 
HETATM 5612 C CAI . 09L C 2 .   ? 16.757  -6.192  13.267  1.00 23.09 ? 601 09L A CAI 1 
HETATM 5613 C CAL . 09L C 2 .   ? 16.200  -5.862  14.661  1.00 23.37 ? 601 09L A CAL 1 
HETATM 5614 O OAB . 09L C 2 .   ? 15.257  -6.514  15.114  1.00 20.35 ? 601 09L A OAB 1 
HETATM 5615 N NAE . 09L C 2 .   ? 16.810  -4.865  15.362  1.00 22.95 ? 601 09L A NAE 1 
HETATM 5616 C CAM . 09L C 2 .   ? 17.982  -4.107  14.865  1.00 20.45 ? 601 09L A CAM 1 
HETATM 5617 C CAO . 09L C 2 .   ? 19.190  -4.245  15.739  1.00 19.24 ? 601 09L A CAO 1 
HETATM 5618 C CAN . 09L C 2 .   ? 16.357  -4.652  16.749  1.00 19.60 ? 601 09L A CAN 1 
HETATM 5619 C CAP . 09L C 2 .   ? 17.599  -4.869  17.586  1.00 17.64 ? 601 09L A CAP 1 
HETATM 5620 N NAF . 09L C 2 .   ? 18.699  -4.019  17.120  1.00 19.26 ? 601 09L A NAF 1 
HETATM 5621 C CAQ . 09L C 2 .   ? 19.055  -2.957  17.895  1.00 18.35 ? 601 09L A CAQ 1 
HETATM 5622 O OAC . 09L C 2 .   ? 18.553  -2.879  19.021  1.00 13.57 ? 601 09L A OAC 1 
HETATM 5623 C CAR . 09L C 2 .   ? 20.104  -2.007  17.591  1.00 14.32 ? 601 09L A CAR 1 
HETATM 5624 C CAS . 09L C 2 .   ? 19.821  -0.633  17.570  1.00 13.04 ? 601 09L A CAS 1 
HETATM 5625 C CAU . 09L C 2 .   ? 21.423  -2.409  17.380  1.00 15.87 ? 601 09L A CAU 1 
HETATM 5626 F FAA . 09L C 2 .   ? 21.742  -3.709  17.394  1.00 14.74 ? 601 09L A FAA 1 
HETATM 5627 C CAX . 09L C 2 .   ? 22.410  -1.475  17.164  1.00 14.41 ? 601 09L A CAX 1 
HETATM 5628 C CAW . 09L C 2 .   ? 22.125  -0.088  17.160  1.00 16.02 ? 601 09L A CAW 1 
HETATM 5629 C CAT . 09L C 2 .   ? 20.821  0.362   17.371  1.00 14.47 ? 601 09L A CAT 1 
HETATM 5630 C CAV . 09L C 2 .   ? 20.512  1.744   17.336  1.00 14.06 ? 601 09L A CAV 1 
HETATM 5631 C CAY . 09L C 2 .   ? 19.467  2.118   18.315  1.00 11.51 ? 601 09L A CAY 1 
HETATM 5632 C CAZ . 09L C 2 .   ? 19.740  2.423   19.636  1.00 10.67 ? 601 09L A CAZ 1 
HETATM 5633 C CBB . 09L C 2 .   ? 21.049  2.371   20.134  1.00 12.51 ? 601 09L A CBB 1 
HETATM 5634 C CBE . 09L C 2 .   ? 21.345  2.659   21.458  1.00 11.71 ? 601 09L A CBE 1 
HETATM 5635 C CBF . 09L C 2 .   ? 20.288  2.974   22.322  1.00 11.52 ? 601 09L A CBF 1 
HETATM 5636 C CBD . 09L C 2 .   ? 18.983  3.007   21.843  1.00 9.15  ? 601 09L A CBD 1 
HETATM 5637 C CBA . 09L C 2 .   ? 18.689  2.742   20.521  1.00 11.21 ? 601 09L A CBA 1 
HETATM 5638 C CBC . 09L C 2 .   ? 17.378  2.820   20.052  1.00 12.15 ? 601 09L A CBC 1 
HETATM 5639 O OAD . 09L C 2 .   ? 16.409  3.124   20.776  1.00 15.75 ? 601 09L A OAD 1 
HETATM 5640 N NAH . 09L C 2 .   ? 17.187  2.520   18.700  1.00 13.09 ? 601 09L A NAH 1 
HETATM 5641 N NAG . 09L C 2 .   ? 18.200  2.209   17.893  1.00 9.14  ? 601 09L A NAG 1 
HETATM 5642 C C1  . GOL D 3 .   ? 14.245  12.459  15.012  1.00 24.56 ? 602 GOL A C1  1 
HETATM 5643 O O1  . GOL D 3 .   ? 14.013  11.080  14.808  1.00 23.26 ? 602 GOL A O1  1 
HETATM 5644 C C2  . GOL D 3 .   ? 15.742  12.784  15.061  1.00 25.52 ? 602 GOL A C2  1 
HETATM 5645 O O2  . GOL D 3 .   ? 16.517  12.010  14.153  1.00 26.19 ? 602 GOL A O2  1 
HETATM 5646 C C3  . GOL D 3 .   ? 15.956  14.257  14.816  1.00 24.06 ? 602 GOL A C3  1 
HETATM 5647 O O3  . GOL D 3 .   ? 17.191  14.591  15.385  1.00 23.01 ? 602 GOL A O3  1 
HETATM 5648 C C1  . GOL E 3 .   ? 21.587  -1.279  13.046  1.00 30.27 ? 603 GOL A C1  1 
HETATM 5649 O O1  . GOL E 3 .   ? 21.224  -2.325  13.906  1.00 26.62 ? 603 GOL A O1  1 
HETATM 5650 C C2  . GOL E 3 .   ? 22.825  -0.559  13.571  1.00 30.75 ? 603 GOL A C2  1 
HETATM 5651 O O2  . GOL E 3 .   ? 22.588  0.842   13.785  1.00 32.68 ? 603 GOL A O2  1 
HETATM 5652 C C3  . GOL E 3 .   ? 23.915  -0.792  12.555  1.00 31.35 ? 603 GOL A C3  1 
HETATM 5653 O O3  . GOL E 3 .   ? 24.953  0.128   12.727  1.00 31.85 ? 603 GOL A O3  1 
HETATM 5654 C CAJ . 09L F 2 .   ? 27.538  -24.878 12.414  1.00 19.35 ? 601 09L B CAJ 1 
HETATM 5655 C CAK . 09L F 2 .   ? 28.725  -25.029 13.157  1.00 18.17 ? 601 09L B CAK 1 
HETATM 5656 C CAI . 09L F 2 .   ? 28.255  -26.197 12.441  1.00 19.85 ? 601 09L B CAI 1 
HETATM 5657 C CAL . 09L F 2 .   ? 29.143  -26.609 11.236  1.00 19.65 ? 601 09L B CAL 1 
HETATM 5658 O OAB . 09L F 2 .   ? 29.075  -25.982 10.187  1.00 22.32 ? 601 09L B OAB 1 
HETATM 5659 N NAE . 09L F 2 .   ? 30.029  -27.610 11.377  1.00 19.89 ? 601 09L B NAE 1 
HETATM 5660 C CAM . 09L F 2 .   ? 30.275  -28.417 12.572  1.00 18.28 ? 601 09L B CAM 1 
HETATM 5661 C CAO . 09L F 2 .   ? 31.679  -28.232 13.075  1.00 19.57 ? 601 09L B CAO 1 
HETATM 5662 C CAN . 09L F 2 .   ? 30.900  -27.942 10.258  1.00 20.79 ? 601 09L B CAN 1 
HETATM 5663 C CAP . 09L F 2 .   ? 32.309  -27.633 10.705  1.00 19.11 ? 601 09L B CAP 1 
HETATM 5664 N NAF . 09L F 2 .   ? 32.567  -28.458 11.884  1.00 20.50 ? 601 09L B NAF 1 
HETATM 5665 C CAQ . 09L F 2 .   ? 33.466  -29.442 11.819  1.00 19.68 ? 601 09L B CAQ 1 
HETATM 5666 O OAC . 09L F 2 .   ? 34.153  -29.573 10.788  1.00 19.26 ? 601 09L B OAC 1 
HETATM 5667 C CAR . 09L F 2 .   ? 33.796  -30.290 12.907  1.00 18.38 ? 601 09L B CAR 1 
HETATM 5668 C CAS . 09L F 2 .   ? 33.664  -31.674 12.740  1.00 18.42 ? 601 09L B CAS 1 
HETATM 5669 C CAU . 09L F 2 .   ? 34.362  -29.818 14.100  1.00 18.21 ? 601 09L B CAU 1 
HETATM 5670 F FAA . 09L F 2 .   ? 34.557  -28.398 14.373  1.00 21.31 ? 601 09L B FAA 1 
HETATM 5671 C CAX . 09L F 2 .   ? 34.755  -30.704 15.060  1.00 16.61 ? 601 09L B CAX 1 
HETATM 5672 C CAW . 09L F 2 .   ? 34.586  -32.081 14.896  1.00 17.40 ? 601 09L B CAW 1 
HETATM 5673 C CAT . 09L F 2 .   ? 34.055  -32.586 13.724  1.00 18.85 ? 601 09L B CAT 1 
HETATM 5674 C CAV . 09L F 2 .   ? 33.905  -34.017 13.565  1.00 19.65 ? 601 09L B CAV 1 
HETATM 5675 C CAY . 09L F 2 .   ? 34.211  -34.467 12.228  1.00 17.80 ? 601 09L B CAY 1 
HETATM 5676 C CAZ . 09L F 2 .   ? 35.500  -34.796 11.721  1.00 17.25 ? 601 09L B CAZ 1 
HETATM 5677 C CBB . 09L F 2 .   ? 36.673  -34.711 12.482  1.00 16.32 ? 601 09L B CBB 1 
HETATM 5678 C CBE . 09L F 2 .   ? 37.933  -35.033 11.914  1.00 14.90 ? 601 09L B CBE 1 
HETATM 5679 C CBF . 09L F 2 .   ? 38.025  -35.451 10.583  1.00 16.31 ? 601 09L B CBF 1 
HETATM 5680 C CBD . 09L F 2 .   ? 36.865  -35.492 9.818   1.00 16.96 ? 601 09L B CBD 1 
HETATM 5681 C CBA . 09L F 2 .   ? 35.619  -35.189 10.381  1.00 18.61 ? 601 09L B CBA 1 
HETATM 5682 C CBC . 09L F 2 .   ? 34.433  -35.274 9.621   1.00 20.56 ? 601 09L B CBC 1 
HETATM 5683 O OAD . 09L F 2 .   ? 34.397  -35.653 8.458   1.00 18.64 ? 601 09L B OAD 1 
HETATM 5684 N NAH . 09L F 2 .   ? 33.219  -34.928 10.211  1.00 20.19 ? 601 09L B NAH 1 
HETATM 5685 N NAG . 09L F 2 .   ? 33.154  -34.565 11.419  1.00 19.75 ? 601 09L B NAG 1 
HETATM 5686 C C1  . GOL G 3 .   ? 28.737  -45.001 10.112  1.00 25.89 ? 602 GOL B C1  1 
HETATM 5687 O O1  . GOL G 3 .   ? 28.388  -43.642 9.969   1.00 24.15 ? 602 GOL B O1  1 
HETATM 5688 C C2  . GOL G 3 .   ? 28.965  -45.425 11.562  1.00 27.57 ? 602 GOL B C2  1 
HETATM 5689 O O2  . GOL G 3 .   ? 29.602  -44.458 12.367  1.00 28.16 ? 602 GOL B O2  1 
HETATM 5690 C C3  . GOL G 3 .   ? 29.601  -46.819 11.601  1.00 27.94 ? 602 GOL B C3  1 
HETATM 5691 O O3  . GOL G 3 .   ? 30.646  -47.018 12.529  1.00 27.66 ? 602 GOL B O3  1 
HETATM 5692 O O   . HOH H 4 .   ? 25.040  2.248   19.886  1.00 14.52 ? 701 HOH A O   1 
HETATM 5693 O O   . HOH H 4 .   ? 3.367   -0.445  39.775  1.00 19.68 ? 702 HOH A O   1 
HETATM 5694 O O   . HOH H 4 .   ? -3.152  -13.077 16.401  1.00 21.17 ? 703 HOH A O   1 
HETATM 5695 O O   . HOH H 4 .   ? 14.639  21.675  14.232  1.00 19.64 ? 704 HOH A O   1 
HETATM 5696 O O   . HOH H 4 .   ? 16.506  18.147  13.319  1.00 18.80 ? 705 HOH A O   1 
HETATM 5697 O O   . HOH H 4 .   ? 4.218   3.745   40.674  1.00 22.95 ? 706 HOH A O   1 
HETATM 5698 O O   . HOH H 4 .   ? 39.818  -9.004  6.330   1.00 24.94 ? 707 HOH A O   1 
HETATM 5699 O O   . HOH H 4 .   ? -12.741 -4.095  12.568  1.00 25.59 ? 708 HOH A O   1 
HETATM 5700 O O   . HOH H 4 .   ? 36.027  -3.775  25.895  1.00 30.88 ? 709 HOH A O   1 
HETATM 5701 O O   . HOH H 4 .   ? 13.508  -9.420  35.369  1.00 11.75 ? 710 HOH A O   1 
HETATM 5702 O O   . HOH H 4 .   ? -12.198 -8.368  3.362   1.00 18.89 ? 711 HOH A O   1 
HETATM 5703 O O   . HOH H 4 .   ? 14.364  22.403  21.996  1.00 22.74 ? 712 HOH A O   1 
HETATM 5704 O O   . HOH H 4 .   ? 30.335  9.900   -4.972  1.00 26.09 ? 713 HOH A O   1 
HETATM 5705 O O   . HOH H 4 .   ? -5.352  5.751   36.743  1.00 26.83 ? 714 HOH A O   1 
HETATM 5706 O O   . HOH H 4 .   ? -22.323 -5.590  14.472  1.00 20.04 ? 715 HOH A O   1 
HETATM 5707 O O   . HOH H 4 .   ? 25.626  0.382   17.538  1.00 17.37 ? 716 HOH A O   1 
HETATM 5708 O O   . HOH H 4 .   ? 6.905   21.998  22.513  1.00 30.13 ? 717 HOH A O   1 
HETATM 5709 O O   . HOH H 4 .   ? 18.798  10.238  -8.516  1.00 35.39 ? 718 HOH A O   1 
HETATM 5710 O O   . HOH H 4 .   ? 31.982  3.317   -7.995  1.00 23.60 ? 719 HOH A O   1 
HETATM 5711 O O   . HOH H 4 .   ? 26.883  2.196   14.962  1.00 38.18 ? 720 HOH A O   1 
HETATM 5712 O O   . HOH H 4 .   ? -5.907  -13.544 6.363   1.00 32.90 ? 721 HOH A O   1 
HETATM 5713 O O   . HOH H 4 .   ? 24.749  8.874   23.616  1.00 7.64  ? 722 HOH A O   1 
HETATM 5714 O O   . HOH H 4 .   ? 17.407  1.358   15.343  1.00 12.11 ? 723 HOH A O   1 
HETATM 5715 O O   . HOH H 4 .   ? -1.224  6.242   6.853   1.00 30.46 ? 724 HOH A O   1 
HETATM 5716 O O   . HOH H 4 .   ? 9.172   5.682   14.199  1.00 6.80  ? 725 HOH A O   1 
HETATM 5717 O O   . HOH H 4 .   ? 12.209  -11.600 18.549  1.00 21.49 ? 726 HOH A O   1 
HETATM 5718 O O   . HOH H 4 .   ? 6.858   -8.869  33.330  1.00 27.83 ? 727 HOH A O   1 
HETATM 5719 O O   . HOH H 4 .   ? 4.403   -5.827  33.819  1.00 26.14 ? 728 HOH A O   1 
HETATM 5720 O O   . HOH H 4 .   ? 16.345  19.308  24.353  1.00 14.32 ? 729 HOH A O   1 
HETATM 5721 O O   . HOH H 4 .   ? -8.210  8.854   26.488  1.00 28.18 ? 730 HOH A O   1 
HETATM 5722 O O   . HOH H 4 .   ? 18.511  -14.746 29.066  1.00 13.76 ? 731 HOH A O   1 
HETATM 5723 O O   . HOH H 4 .   ? 22.087  -10.970 27.458  1.00 12.99 ? 732 HOH A O   1 
HETATM 5724 O O   . HOH H 4 .   ? 7.293   -9.650  0.983   1.00 18.89 ? 733 HOH A O   1 
HETATM 5725 O O   . HOH H 4 .   ? 30.010  -6.701  27.775  1.00 17.94 ? 734 HOH A O   1 
HETATM 5726 O O   . HOH H 4 .   ? 11.602  -0.432  24.450  1.00 13.44 ? 735 HOH A O   1 
HETATM 5727 O O   . HOH H 4 .   ? 27.439  -10.003 19.312  1.00 15.91 ? 736 HOH A O   1 
HETATM 5728 O O   . HOH H 4 .   ? 16.237  2.938   13.560  1.00 10.77 ? 737 HOH A O   1 
HETATM 5729 O O   . HOH H 4 .   ? 31.467  -10.873 20.848  1.00 30.00 ? 738 HOH A O   1 
HETATM 5730 O O   . HOH H 4 .   ? 5.958   -0.670  9.972   1.00 12.87 ? 739 HOH A O   1 
HETATM 5731 O O   . HOH H 4 .   ? 3.495   -1.909  33.240  1.00 23.13 ? 740 HOH A O   1 
HETATM 5732 O O   . HOH H 4 .   ? 5.011   -8.070  25.260  1.00 9.99  ? 741 HOH A O   1 
HETATM 5733 O O   . HOH H 4 .   ? 34.877  -5.903  30.237  1.00 30.06 ? 742 HOH A O   1 
HETATM 5734 O O   . HOH H 4 .   ? 2.826   15.490  25.325  1.00 18.64 ? 743 HOH A O   1 
HETATM 5735 O O   . HOH H 4 .   ? 22.925  0.103   -7.578  1.00 18.12 ? 744 HOH A O   1 
HETATM 5736 O O   . HOH H 4 .   ? -2.246  2.250   5.262   1.00 21.94 ? 745 HOH A O   1 
HETATM 5737 O O   . HOH H 4 .   ? -0.993  -1.530  30.750  1.00 34.41 ? 746 HOH A O   1 
HETATM 5738 O O   . HOH H 4 .   ? 25.358  -13.878 25.032  1.00 17.03 ? 747 HOH A O   1 
HETATM 5739 O O   . HOH H 4 .   ? 2.031   -6.554  28.190  1.00 28.25 ? 748 HOH A O   1 
HETATM 5740 O O   . HOH H 4 .   ? 25.337  5.139   20.757  1.00 29.91 ? 749 HOH A O   1 
HETATM 5741 O O   . HOH H 4 .   ? 10.402  -12.306 26.701  1.00 15.16 ? 750 HOH A O   1 
HETATM 5742 O O   . HOH H 4 .   ? -3.569  5.793   16.452  1.00 18.58 ? 751 HOH A O   1 
HETATM 5743 O O   . HOH H 4 .   ? -7.169  -3.426  20.945  1.00 25.70 ? 752 HOH A O   1 
HETATM 5744 O O   . HOH H 4 .   ? 25.157  6.737   -10.425 1.00 20.31 ? 753 HOH A O   1 
HETATM 5745 O O   . HOH H 4 .   ? 9.600   7.999   12.667  1.00 15.52 ? 754 HOH A O   1 
HETATM 5746 O O   . HOH H 4 .   ? 18.251  -11.846 4.795   1.00 17.76 ? 755 HOH A O   1 
HETATM 5747 O O   . HOH H 4 .   ? 4.761   -13.879 16.962  1.00 37.48 ? 756 HOH A O   1 
HETATM 5748 O O   . HOH H 4 .   ? 5.059   11.342  9.853   1.00 28.18 ? 757 HOH A O   1 
HETATM 5749 O O   . HOH H 4 .   ? 23.616  -12.834 14.701  1.00 19.92 ? 758 HOH A O   1 
HETATM 5750 O O   . HOH H 4 .   ? -5.214  -4.996  29.849  1.00 29.82 ? 759 HOH A O   1 
HETATM 5751 O O   . HOH H 4 .   ? 13.164  4.327   -7.165  1.00 21.77 ? 760 HOH A O   1 
HETATM 5752 O O   . HOH H 4 .   ? 20.161  6.639   27.605  1.00 17.77 ? 761 HOH A O   1 
HETATM 5753 O O   . HOH H 4 .   ? 10.729  -7.634  21.503  1.00 16.75 ? 762 HOH A O   1 
HETATM 5754 O O   . HOH H 4 .   ? 8.854   0.048   -7.658  1.00 26.82 ? 763 HOH A O   1 
HETATM 5755 O O   . HOH H 4 .   ? 9.854   16.772  24.438  1.00 15.02 ? 764 HOH A O   1 
HETATM 5756 O O   . HOH H 4 .   ? 7.872   -3.703  9.182   1.00 14.66 ? 765 HOH A O   1 
HETATM 5757 O O   . HOH H 4 .   ? 21.779  8.189   30.149  1.00 12.32 ? 766 HOH A O   1 
HETATM 5758 O O   . HOH H 4 .   ? 36.432  11.551  28.423  1.00 35.80 ? 767 HOH A O   1 
HETATM 5759 O O   . HOH H 4 .   ? -3.640  -8.784  -0.851  1.00 25.57 ? 768 HOH A O   1 
HETATM 5760 O O   . HOH H 4 .   ? 26.247  2.422   36.309  1.00 14.35 ? 769 HOH A O   1 
HETATM 5761 O O   . HOH H 4 .   ? 24.306  -12.021 19.634  1.00 12.63 ? 770 HOH A O   1 
HETATM 5762 O O   . HOH H 4 .   ? 13.900  6.880   5.347   1.00 30.85 ? 771 HOH A O   1 
HETATM 5763 O O   . HOH H 4 .   ? 17.313  15.278  31.483  1.00 28.38 ? 772 HOH A O   1 
HETATM 5764 O O   . HOH H 4 .   ? 14.946  10.867  8.237   1.00 31.80 ? 773 HOH A O   1 
HETATM 5765 O O   . HOH H 4 .   ? 20.593  9.261   19.729  1.00 19.36 ? 774 HOH A O   1 
HETATM 5766 O O   . HOH H 4 .   ? 28.391  -11.841 14.158  1.00 27.02 ? 775 HOH A O   1 
HETATM 5767 O O   . HOH H 4 .   ? -13.236 3.219   18.839  1.00 20.61 ? 776 HOH A O   1 
HETATM 5768 O O   . HOH H 4 .   ? 34.984  -10.457 23.486  1.00 23.48 ? 777 HOH A O   1 
HETATM 5769 O O   . HOH H 4 .   ? 8.716   -14.539 22.946  1.00 16.28 ? 778 HOH A O   1 
HETATM 5770 O O   . HOH H 4 .   ? 34.063  0.197   32.680  1.00 31.98 ? 779 HOH A O   1 
HETATM 5771 O O   . HOH H 4 .   ? 17.726  2.444   11.349  1.00 15.67 ? 780 HOH A O   1 
HETATM 5772 O O   . HOH H 4 .   ? 16.340  -12.675 17.281  1.00 18.68 ? 781 HOH A O   1 
HETATM 5773 O O   . HOH H 4 .   ? 11.390  -10.705 23.235  1.00 13.17 ? 782 HOH A O   1 
HETATM 5774 O O   . HOH H 4 .   ? 18.744  15.123  18.350  1.00 17.10 ? 783 HOH A O   1 
HETATM 5775 O O   . HOH H 4 .   ? 35.657  -8.337  8.781   1.00 20.06 ? 784 HOH A O   1 
HETATM 5776 O O   . HOH H 4 .   ? 13.965  -4.390  12.840  1.00 16.18 ? 785 HOH A O   1 
HETATM 5777 O O   . HOH H 4 .   ? 3.191   -12.162 26.121  1.00 15.79 ? 786 HOH A O   1 
HETATM 5778 O O   . HOH H 4 .   ? -8.087  -9.514  14.271  1.00 24.08 ? 787 HOH A O   1 
HETATM 5779 O O   . HOH H 4 .   ? 33.439  -4.278  32.407  1.00 29.15 ? 788 HOH A O   1 
HETATM 5780 O O   . HOH H 4 .   ? 4.897   19.676  15.407  1.00 35.99 ? 789 HOH A O   1 
HETATM 5781 O O   . HOH H 4 .   ? 31.812  -9.115  11.010  1.00 15.19 ? 790 HOH A O   1 
HETATM 5782 O O   . HOH H 4 .   ? 43.839  -4.128  -2.563  1.00 27.94 ? 791 HOH A O   1 
HETATM 5783 O O   . HOH H 4 .   ? 24.899  1.675   -7.804  1.00 25.41 ? 792 HOH A O   1 
HETATM 5784 O O   . HOH H 4 .   ? 12.524  -10.401 5.931   1.00 17.30 ? 793 HOH A O   1 
HETATM 5785 O O   . HOH H 4 .   ? 8.478   9.805   10.878  1.00 19.85 ? 794 HOH A O   1 
HETATM 5786 O O   . HOH H 4 .   ? 6.160   -1.962  33.421  1.00 21.92 ? 795 HOH A O   1 
HETATM 5787 O O   . HOH H 4 .   ? 3.180   8.245   3.163   1.00 38.32 ? 796 HOH A O   1 
HETATM 5788 O O   . HOH H 4 .   ? 27.395  -5.568  37.307  1.00 30.73 ? 797 HOH A O   1 
HETATM 5789 O O   . HOH H 4 .   ? 3.735   -9.566  27.113  1.00 19.13 ? 798 HOH A O   1 
HETATM 5790 O O   . HOH H 4 .   ? 22.252  4.725   -9.317  1.00 24.40 ? 799 HOH A O   1 
HETATM 5791 O O   . HOH H 4 .   ? 10.905  -13.275 24.270  1.00 18.09 ? 800 HOH A O   1 
HETATM 5792 O O   . HOH H 4 .   ? 26.855  6.288   33.203  1.00 17.55 ? 801 HOH A O   1 
HETATM 5793 O O   . HOH H 4 .   ? 20.519  -7.605  10.811  1.00 17.10 ? 802 HOH A O   1 
HETATM 5794 O O   . HOH H 4 .   ? -0.252  14.021  25.386  1.00 29.68 ? 803 HOH A O   1 
HETATM 5795 O O   . HOH H 4 .   ? 30.670  -12.385 3.227   1.00 27.09 ? 804 HOH A O   1 
HETATM 5796 O O   . HOH H 4 .   ? 22.728  10.083  21.989  1.00 17.09 ? 805 HOH A O   1 
HETATM 5797 O O   . HOH H 4 .   ? 15.320  -2.217  13.511  1.00 15.54 ? 806 HOH A O   1 
HETATM 5798 O O   . HOH H 4 .   ? 15.151  -0.649  15.602  1.00 15.95 ? 807 HOH A O   1 
HETATM 5799 O O   . HOH H 4 .   ? 17.498  -1.424  12.162  1.00 13.57 ? 808 HOH A O   1 
HETATM 5800 O O   . HOH H 4 .   ? 16.800  0.024   10.092  1.00 11.83 ? 809 HOH A O   1 
HETATM 5801 O O   . HOH H 4 .   ? 13.055  5.800   7.852   1.00 17.56 ? 810 HOH A O   1 
HETATM 5802 O O   . HOH H 4 .   ? 11.263  6.460   9.872   1.00 11.34 ? 811 HOH A O   1 
HETATM 5803 O O   . HOH H 4 .   ? 9.362   8.236   8.913   1.00 9.00  ? 812 HOH A O   1 
HETATM 5804 O O   . HOH H 4 .   ? 7.413   7.798   7.029   1.00 19.07 ? 813 HOH A O   1 
HETATM 5805 O O   . HOH H 4 .   ? 17.647  -7.645  7.203   1.00 16.68 ? 814 HOH A O   1 
HETATM 5806 O O   . HOH H 4 .   ? 14.286  19.697  23.180  1.00 10.32 ? 815 HOH A O   1 
HETATM 5807 O O   . HOH H 4 .   ? -2.250  -9.522  17.343  1.00 20.35 ? 816 HOH A O   1 
HETATM 5808 O O   . HOH H 4 .   ? 27.708  -14.898 20.745  1.00 31.70 ? 817 HOH A O   1 
HETATM 5809 O O   . HOH H 4 .   ? -3.425  10.090  17.320  1.00 19.04 ? 818 HOH A O   1 
HETATM 5810 O O   . HOH H 4 .   ? 4.469   8.767   10.198  1.00 23.38 ? 819 HOH A O   1 
HETATM 5811 O O   . HOH H 4 .   ? 44.855  0.233   -0.336  1.00 29.37 ? 820 HOH A O   1 
HETATM 5812 O O   . HOH H 4 .   ? 2.092   9.900   10.052  1.00 25.82 ? 821 HOH A O   1 
HETATM 5813 O O   . HOH H 4 .   ? -3.657  -10.702 18.884  1.00 32.19 ? 822 HOH A O   1 
HETATM 5814 O O   . HOH H 4 .   ? -10.418 4.152   22.715  1.00 24.31 ? 823 HOH A O   1 
HETATM 5815 O O   . HOH H 4 .   ? 30.005  -8.885  20.587  1.00 15.54 ? 824 HOH A O   1 
HETATM 5816 O O   . HOH H 4 .   ? 36.879  -8.242  0.439   1.00 35.26 ? 825 HOH A O   1 
HETATM 5817 O O   . HOH H 4 .   ? 15.024  -6.768  9.410   1.00 28.55 ? 826 HOH A O   1 
HETATM 5818 O O   . HOH H 4 .   ? 17.719  -18.311 28.512  1.00 19.46 ? 827 HOH A O   1 
HETATM 5819 O O   . HOH H 4 .   ? 5.390   -11.513 7.268   1.00 21.06 ? 828 HOH A O   1 
HETATM 5820 O O   . HOH H 4 .   ? 20.602  -7.209  17.020  1.00 23.98 ? 829 HOH A O   1 
HETATM 5821 O O   . HOH H 4 .   ? 16.419  8.363   6.404   1.00 32.64 ? 830 HOH A O   1 
HETATM 5822 O O   . HOH H 4 .   ? 7.123   -17.982 24.655  1.00 27.39 ? 831 HOH A O   1 
HETATM 5823 O O   . HOH H 4 .   ? -3.209  -9.002  6.494   1.00 23.65 ? 832 HOH A O   1 
HETATM 5824 O O   . HOH H 4 .   ? 36.049  -8.452  -2.406  1.00 17.49 ? 833 HOH A O   1 
HETATM 5825 O O   . HOH H 4 .   ? 9.043   -8.433  -0.499  1.00 25.88 ? 834 HOH A O   1 
HETATM 5826 O O   . HOH H 4 .   ? 6.631   -2.920  -5.144  1.00 20.73 ? 835 HOH A O   1 
HETATM 5827 O O   . HOH H 4 .   ? 11.758  12.337  6.531   1.00 22.36 ? 836 HOH A O   1 
HETATM 5828 O O   . HOH H 4 .   ? 30.323  2.194   37.417  1.00 34.99 ? 837 HOH A O   1 
HETATM 5829 O O   . HOH H 4 .   ? 1.191   -7.287  0.069   1.00 26.97 ? 838 HOH A O   1 
HETATM 5830 O O   . HOH H 4 .   ? 1.069   7.424   1.840   1.00 37.54 ? 839 HOH A O   1 
HETATM 5831 O O   . HOH H 4 .   ? -3.375  6.389   10.310  1.00 21.50 ? 840 HOH A O   1 
HETATM 5832 O O   . HOH H 4 .   ? -8.514  3.767   26.615  1.00 41.53 ? 841 HOH A O   1 
HETATM 5833 O O   . HOH H 4 .   ? -0.847  -11.568 22.999  1.00 34.65 ? 842 HOH A O   1 
HETATM 5834 O O   . HOH H 4 .   ? 31.049  -14.074 27.544  1.00 31.81 ? 843 HOH A O   1 
HETATM 5835 O O   . HOH H 4 .   ? 35.475  9.400   35.212  1.00 45.33 ? 844 HOH A O   1 
HETATM 5836 O O   . HOH H 4 .   ? 36.390  -11.280 2.038   1.00 23.14 ? 845 HOH A O   1 
HETATM 5837 O O   . HOH H 4 .   ? 4.920   2.061   6.912   1.00 23.45 ? 846 HOH A O   1 
HETATM 5838 O O   . HOH H 4 .   ? 29.308  5.251   1.372   1.00 30.78 ? 847 HOH A O   1 
HETATM 5839 O O   . HOH H 4 .   ? 7.828   -5.331  35.338  1.00 20.04 ? 848 HOH A O   1 
HETATM 5840 O O   . HOH H 4 .   ? 20.625  -9.365  -3.627  1.00 28.51 ? 849 HOH A O   1 
HETATM 5841 O O   . HOH H 4 .   ? 10.326  -13.611 6.327   1.00 32.42 ? 850 HOH A O   1 
HETATM 5842 O O   . HOH H 4 .   ? 26.065  13.992  28.260  1.00 21.17 ? 851 HOH A O   1 
HETATM 5843 O O   . HOH H 4 .   ? -4.576  7.770   18.041  1.00 23.05 ? 852 HOH A O   1 
HETATM 5844 O O   . HOH H 4 .   ? 31.123  -4.205  35.113  1.00 29.68 ? 853 HOH A O   1 
HETATM 5845 O O   . HOH H 4 .   ? 18.995  0.127   13.862  1.00 22.84 ? 854 HOH A O   1 
HETATM 5846 O O   . HOH H 4 .   ? 3.125   2.150   -3.138  1.00 34.43 ? 855 HOH A O   1 
HETATM 5847 O O   . HOH H 4 .   ? -3.885  13.204  21.627  1.00 34.00 ? 856 HOH A O   1 
HETATM 5848 O O   . HOH H 4 .   ? 16.863  11.841  37.439  1.00 22.87 ? 857 HOH A O   1 
HETATM 5849 O O   . HOH H 4 .   ? 19.273  -14.260 14.893  1.00 33.41 ? 858 HOH A O   1 
HETATM 5850 O O   . HOH H 4 .   ? 21.744  -15.886 35.696  1.00 31.72 ? 859 HOH A O   1 
HETATM 5851 O O   . HOH H 4 .   ? 4.815   -9.302  -3.196  1.00 34.92 ? 860 HOH A O   1 
HETATM 5852 O O   . HOH I 4 .   ? 44.058  -36.507 -12.867 1.00 20.60 ? 701 HOH B O   1 
HETATM 5853 O O   . HOH I 4 .   ? 28.300  -54.038 10.973  1.00 10.50 ? 702 HOH B O   1 
HETATM 5854 O O   . HOH I 4 .   ? 28.769  -50.558 13.308  1.00 20.77 ? 703 HOH B O   1 
HETATM 5855 O O   . HOH I 4 .   ? 44.391  -23.156 -2.962  1.00 20.06 ? 704 HOH B O   1 
HETATM 5856 O O   . HOH I 4 .   ? 13.825  -39.147 33.252  1.00 14.63 ? 705 HOH B O   1 
HETATM 5857 O O   . HOH I 4 .   ? 41.713  -16.888 4.632   1.00 23.54 ? 706 HOH B O   1 
HETATM 5858 O O   . HOH I 4 .   ? 9.987   -38.992 31.468  1.00 24.23 ? 707 HOH B O   1 
HETATM 5859 O O   . HOH I 4 .   ? 34.547  -55.014 6.544   1.00 18.40 ? 708 HOH B O   1 
HETATM 5860 O O   . HOH I 4 .   ? 41.424  -26.282 26.595  1.00 16.98 ? 709 HOH B O   1 
HETATM 5861 O O   . HOH I 4 .   ? 24.323  -50.356 12.539  1.00 28.68 ? 710 HOH B O   1 
HETATM 5862 O O   . HOH I 4 .   ? 38.023  -13.433 6.057   1.00 28.22 ? 711 HOH B O   1 
HETATM 5863 O O   . HOH I 4 .   ? 43.508  -26.690 29.731  1.00 27.82 ? 712 HOH B O   1 
HETATM 5864 O O   . HOH I 4 .   ? 13.231  -36.639 34.392  1.00 26.14 ? 713 HOH B O   1 
HETATM 5865 O O   . HOH I 4 .   ? 16.567  -35.202 6.724   1.00 17.11 ? 714 HOH B O   1 
HETATM 5866 O O   . HOH I 4 .   ? 41.888  -41.101 13.749  1.00 11.55 ? 715 HOH B O   1 
HETATM 5867 O O   . HOH I 4 .   ? 39.450  -42.512 13.161  1.00 14.07 ? 716 HOH B O   1 
HETATM 5868 O O   . HOH I 4 .   ? 34.977  -22.740 26.227  1.00 16.55 ? 717 HOH B O   1 
HETATM 5869 O O   . HOH I 4 .   ? 35.739  -19.895 21.558  1.00 20.17 ? 718 HOH B O   1 
HETATM 5870 O O   . HOH I 4 .   ? 30.659  -33.856 12.111  1.00 18.59 ? 719 HOH B O   1 
HETATM 5871 O O   . HOH I 4 .   ? 25.074  -38.520 6.180   1.00 10.31 ? 720 HOH B O   1 
HETATM 5872 O O   . HOH I 4 .   ? 19.899  -29.230 7.784   1.00 11.50 ? 721 HOH B O   1 
HETATM 5873 O O   . HOH I 4 .   ? 12.806  -23.369 11.946  1.00 14.19 ? 722 HOH B O   1 
HETATM 5874 O O   . HOH I 4 .   ? 19.047  -44.522 5.178   1.00 22.44 ? 723 HOH B O   1 
HETATM 5875 O O   . HOH I 4 .   ? 42.644  -21.209 8.649   1.00 18.10 ? 724 HOH B O   1 
HETATM 5876 O O   . HOH I 4 .   ? 39.136  -37.402 15.467  1.00 28.58 ? 725 HOH B O   1 
HETATM 5877 O O   . HOH I 4 .   ? 25.796  -32.529 14.491  1.00 11.12 ? 726 HOH B O   1 
HETATM 5878 O O   . HOH I 4 .   ? 19.551  -22.212 12.976  1.00 25.27 ? 727 HOH B O   1 
HETATM 5879 O O   . HOH I 4 .   ? 22.557  -36.815 22.885  1.00 27.27 ? 728 HOH B O   1 
HETATM 5880 O O   . HOH I 4 .   ? 26.589  -28.270 10.354  1.00 22.39 ? 729 HOH B O   1 
HETATM 5881 O O   . HOH I 4 .   ? 11.754  -21.402 1.906   1.00 42.39 ? 730 HOH B O   1 
HETATM 5882 O O   . HOH I 4 .   ? 19.603  -32.468 5.765   1.00 18.34 ? 731 HOH B O   1 
HETATM 5883 O O   . HOH I 4 .   ? 27.893  -14.228 25.980  1.00 27.80 ? 732 HOH B O   1 
HETATM 5884 O O   . HOH I 4 .   ? 35.302  -20.577 -0.499  1.00 15.92 ? 733 HOH B O   1 
HETATM 5885 O O   . HOH I 4 .   ? 23.801  -52.525 5.637   1.00 20.65 ? 734 HOH B O   1 
HETATM 5886 O O   . HOH I 4 .   ? 22.046  -42.573 7.553   1.00 13.24 ? 735 HOH B O   1 
HETATM 5887 O O   . HOH I 4 .   ? 15.284  -18.552 15.213  1.00 27.12 ? 736 HOH B O   1 
HETATM 5888 O O   . HOH I 4 .   ? 7.668   -36.467 27.069  1.00 27.09 ? 737 HOH B O   1 
HETATM 5889 O O   . HOH I 4 .   ? 32.087  -26.709 -7.874  1.00 33.99 ? 738 HOH B O   1 
HETATM 5890 O O   . HOH I 4 .   ? 21.744  -16.012 25.618  1.00 22.79 ? 739 HOH B O   1 
HETATM 5891 O O   . HOH I 4 .   ? 31.162  -24.969 -3.912  1.00 16.95 ? 740 HOH B O   1 
HETATM 5892 O O   . HOH I 4 .   ? 28.450  -24.639 16.829  1.00 17.11 ? 741 HOH B O   1 
HETATM 5893 O O   . HOH I 4 .   ? 39.606  -22.050 17.711  1.00 11.06 ? 742 HOH B O   1 
HETATM 5894 O O   . HOH I 4 .   ? 30.410  -21.414 5.229   1.00 32.02 ? 743 HOH B O   1 
HETATM 5895 O O   . HOH I 4 .   ? 30.444  -32.566 14.487  1.00 15.13 ? 744 HOH B O   1 
HETATM 5896 O O   . HOH I 4 .   ? 34.721  -32.489 2.262   1.00 17.95 ? 745 HOH B O   1 
HETATM 5897 O O   . HOH I 4 .   ? 14.875  -32.444 29.783  1.00 17.01 ? 746 HOH B O   1 
HETATM 5898 O O   . HOH I 4 .   ? 31.255  -25.309 2.824   1.00 18.02 ? 747 HOH B O   1 
HETATM 5899 O O   . HOH I 4 .   ? 23.159  -43.627 14.985  1.00 31.84 ? 748 HOH B O   1 
HETATM 5900 O O   . HOH I 4 .   ? 27.281  -34.911 14.704  1.00 16.12 ? 749 HOH B O   1 
HETATM 5901 O O   . HOH I 4 .   ? 41.903  -22.961 18.898  1.00 20.36 ? 750 HOH B O   1 
HETATM 5902 O O   . HOH I 4 .   ? 33.592  -19.455 1.286   1.00 13.77 ? 751 HOH B O   1 
HETATM 5903 O O   . HOH I 4 .   ? 14.403  -42.422 16.611  1.00 26.63 ? 752 HOH B O   1 
HETATM 5904 O O   . HOH I 4 .   ? 24.134  -40.890 7.587   1.00 14.98 ? 753 HOH B O   1 
HETATM 5905 O O   . HOH I 4 .   ? 23.768  -18.783 -0.014  1.00 27.74 ? 754 HOH B O   1 
HETATM 5906 O O   . HOH I 4 .   ? 43.424  -19.100 10.063  1.00 21.28 ? 755 HOH B O   1 
HETATM 5907 O O   . HOH I 4 .   ? 36.061  -41.335 12.602  1.00 19.43 ? 756 HOH B O   1 
HETATM 5908 O O   . HOH I 4 .   ? 9.795   -37.182 21.462  1.00 29.35 ? 757 HOH B O   1 
HETATM 5909 O O   . HOH I 4 .   ? 28.359  -35.639 12.258  1.00 16.80 ? 758 HOH B O   1 
HETATM 5910 O O   . HOH I 4 .   ? 30.790  -20.980 -6.330  1.00 19.26 ? 759 HOH B O   1 
HETATM 5911 O O   . HOH I 4 .   ? 30.886  -48.581 -4.971  1.00 24.94 ? 760 HOH B O   1 
HETATM 5912 O O   . HOH I 4 .   ? 28.240  -30.994 13.970  1.00 14.54 ? 761 HOH B O   1 
HETATM 5913 O O   . HOH I 4 .   ? 37.261  -31.201 -9.614  1.00 17.66 ? 762 HOH B O   1 
HETATM 5914 O O   . HOH I 4 .   ? 19.125  -41.960 4.757   1.00 21.41 ? 763 HOH B O   1 
HETATM 5915 O O   . HOH I 4 .   ? 42.927  -20.633 19.971  1.00 25.65 ? 764 HOH B O   1 
HETATM 5916 O O   . HOH I 4 .   ? 38.477  -34.191 16.061  1.00 21.33 ? 765 HOH B O   1 
HETATM 5917 O O   . HOH I 4 .   ? 34.047  -49.465 1.473   1.00 18.76 ? 766 HOH B O   1 
HETATM 5918 O O   . HOH I 4 .   ? 16.130  -16.760 17.906  1.00 20.97 ? 767 HOH B O   1 
HETATM 5919 O O   . HOH I 4 .   ? 23.944  -24.778 16.609  1.00 12.26 ? 768 HOH B O   1 
HETATM 5920 O O   . HOH I 4 .   ? 42.435  -39.061 7.610   1.00 24.59 ? 769 HOH B O   1 
HETATM 5921 O O   . HOH I 4 .   ? 33.397  -19.154 17.093  1.00 17.90 ? 770 HOH B O   1 
HETATM 5922 O O   . HOH I 4 .   ? 11.929  -27.679 29.471  1.00 27.78 ? 771 HOH B O   1 
HETATM 5923 O O   . HOH I 4 .   ? 17.178  -37.433 5.758   1.00 27.61 ? 772 HOH B O   1 
HETATM 5924 O O   . HOH I 4 .   ? 27.772  -30.200 11.353  1.00 23.13 ? 773 HOH B O   1 
HETATM 5925 O O   . HOH I 4 .   ? 29.624  -32.022 10.183  1.00 18.23 ? 774 HOH B O   1 
HETATM 5926 O O   . HOH I 4 .   ? 20.899  -41.127 9.579   1.00 12.96 ? 775 HOH B O   1 
HETATM 5927 O O   . HOH I 4 .   ? 22.687  -39.468 10.359  1.00 11.85 ? 776 HOH B O   1 
HETATM 5928 O O   . HOH I 4 .   ? -0.181  -22.196 -2.879  1.00 31.49 ? 777 HOH B O   1 
HETATM 5929 O O   . HOH I 4 .   ? 21.295  -15.564 18.885  1.00 12.78 ? 778 HOH B O   1 
HETATM 5930 O O   . HOH I 4 .   ? 39.371  -23.995 -6.818  1.00 37.09 ? 779 HOH B O   1 
HETATM 5931 O O   . HOH I 4 .   ? 21.281  -33.761 35.983  1.00 32.98 ? 780 HOH B O   1 
HETATM 5932 O O   . HOH I 4 .   ? 47.687  -16.865 20.319  1.00 29.68 ? 781 HOH B O   1 
HETATM 5933 O O   . HOH I 4 .   ? 13.875  -37.250 30.638  1.00 24.52 ? 782 HOH B O   1 
HETATM 5934 O O   . HOH I 4 .   ? 22.100  -38.721 13.194  1.00 25.90 ? 783 HOH B O   1 
HETATM 5935 O O   . HOH I 4 .   ? 20.475  -48.504 -1.063  1.00 27.43 ? 784 HOH B O   1 
HETATM 5936 O O   . HOH I 4 .   ? 47.513  -25.490 15.310  1.00 23.26 ? 785 HOH B O   1 
HETATM 5937 O O   . HOH I 4 .   ? 42.710  -18.137 12.864  1.00 30.95 ? 786 HOH B O   1 
HETATM 5938 O O   . HOH I 4 .   ? 37.687  -20.199 15.022  1.00 24.12 ? 787 HOH B O   1 
HETATM 5939 O O   . HOH I 4 .   ? 37.071  -32.335 17.610  1.00 19.22 ? 788 HOH B O   1 
HETATM 5940 O O   . HOH I 4 .   ? 16.352  -21.530 6.358   1.00 22.35 ? 789 HOH B O   1 
HETATM 5941 O O   . HOH I 4 .   ? 21.101  -42.937 11.473  1.00 27.31 ? 790 HOH B O   1 
HETATM 5942 O O   . HOH I 4 .   ? 29.571  -36.620 -15.922 1.00 32.93 ? 791 HOH B O   1 
HETATM 5943 O O   . HOH I 4 .   ? 37.731  -18.592 12.650  1.00 25.78 ? 792 HOH B O   1 
HETATM 5944 O O   . HOH I 4 .   ? 25.790  -22.070 -7.637  1.00 28.64 ? 793 HOH B O   1 
HETATM 5945 O O   . HOH I 4 .   ? 17.253  -22.545 25.406  1.00 27.58 ? 794 HOH B O   1 
HETATM 5946 O O   . HOH I 4 .   ? 47.500  -18.054 15.500  1.00 31.61 ? 795 HOH B O   1 
HETATM 5947 O O   . HOH I 4 .   ? 11.969  -38.844 22.667  1.00 49.01 ? 796 HOH B O   1 
HETATM 5948 O O   . HOH I 4 .   ? 33.960  -47.491 11.843  1.00 19.81 ? 797 HOH B O   1 
HETATM 5949 O O   . HOH I 4 .   ? 50.107  -37.483 5.988   1.00 19.41 ? 798 HOH B O   1 
HETATM 5950 O O   . HOH I 4 .   ? 45.421  -40.596 7.576   1.00 19.96 ? 799 HOH B O   1 
HETATM 5951 O O   . HOH I 4 .   ? 11.036  -35.161 1.632   1.00 30.11 ? 800 HOH B O   1 
HETATM 5952 O O   . HOH I 4 .   ? 7.780   -29.439 14.985  1.00 24.75 ? 801 HOH B O   1 
HETATM 5953 O O   . HOH I 4 .   ? 20.076  -43.847 -5.151  1.00 38.71 ? 802 HOH B O   1 
HETATM 5954 O O   . HOH I 4 .   ? 35.609  -23.467 30.627  1.00 28.98 ? 803 HOH B O   1 
HETATM 5955 O O   . HOH I 4 .   ? 52.632  -34.653 7.683   1.00 33.77 ? 804 HOH B O   1 
HETATM 5956 O O   . HOH I 4 .   ? 11.638  -24.729 -0.042  1.00 24.04 ? 805 HOH B O   1 
HETATM 5957 O O   . HOH I 4 .   ? 33.253  -21.903 2.257   1.00 19.69 ? 806 HOH B O   1 
HETATM 5958 O O   . HOH I 4 .   ? 12.810  -24.353 14.318  1.00 28.12 ? 807 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 12  ? 0.5167 0.7179 0.5771 0.0360  0.0185  0.0330  223 ASP A N   
2    C CA  . ASP A 12  ? 0.5158 0.7001 0.5725 0.0388  0.0200  0.0313  223 ASP A CA  
3    C C   . ASP A 12  ? 0.5126 0.6897 0.5681 0.0316  0.0202  0.0262  223 ASP A C   
4    O O   . ASP A 12  ? 0.5204 0.7030 0.5779 0.0283  0.0216  0.0246  223 ASP A O   
5    C CB  . ASP A 12  ? 0.5203 0.7086 0.5781 0.0446  0.0222  0.0334  223 ASP A CB  
6    N N   . LEU A 13  ? 0.5022 0.6669 0.5545 0.0293  0.0190  0.0240  224 LEU A N   
7    C CA  . LEU A 13  ? 0.4898 0.6475 0.5409 0.0224  0.0189  0.0194  224 LEU A CA  
8    C C   . LEU A 13  ? 0.4723 0.6232 0.5223 0.0219  0.0210  0.0173  224 LEU A C   
9    O O   . LEU A 13  ? 0.4562 0.6072 0.5072 0.0159  0.0216  0.0144  224 LEU A O   
10   C CB  . LEU A 13  ? 0.4922 0.6368 0.5397 0.0219  0.0174  0.0182  224 LEU A CB  
11   C CG  . LEU A 13  ? 0.5124 0.6610 0.5601 0.0226  0.0154  0.0204  224 LEU A CG  
12   C CD1 . LEU A 13  ? 0.5252 0.6586 0.5692 0.0243  0.0145  0.0202  224 LEU A CD1 
13   C CD2 . LEU A 13  ? 0.5266 0.6860 0.5765 0.0159  0.0142  0.0185  224 LEU A CD2 
14   N N   . GLY A 14  ? 0.4620 0.6071 0.5100 0.0284  0.0222  0.0189  225 GLY A N   
15   C CA  . GLY A 14  ? 0.4573 0.5978 0.5042 0.0289  0.0244  0.0176  225 GLY A CA  
16   C C   . GLY A 14  ? 0.4512 0.6057 0.5026 0.0258  0.0259  0.0181  225 GLY A C   
17   O O   . GLY A 14  ? 0.4333 0.5862 0.4853 0.0210  0.0271  0.0159  225 GLY A O   
18   N N   . THR A 15  ? 0.4480 0.6163 0.5028 0.0284  0.0259  0.0212  226 THR A N   
19   C CA  . THR A 15  ? 0.4450 0.6286 0.5047 0.0252  0.0272  0.0219  226 THR A CA  
20   C C   . THR A 15  ? 0.4272 0.6160 0.4897 0.0160  0.0263  0.0189  226 THR A C   
21   O O   . THR A 15  ? 0.4239 0.6141 0.4884 0.0113  0.0279  0.0172  226 THR A O   
22   C CB  . THR A 15  ? 0.4516 0.6507 0.5147 0.0305  0.0274  0.0262  226 THR A CB  
23   O OG1 . THR A 15  ? 0.4658 0.6810 0.5343 0.0258  0.0282  0.0265  226 THR A OG1 
24   C CG2 . THR A 15  ? 0.4672 0.6701 0.5305 0.0328  0.0251  0.0283  226 THR A CG2 
25   N N   . GLU A 16  ? 0.4118 0.6026 0.4744 0.0135  0.0240  0.0182  227 GLU A N   
26   C CA  . GLU A 16  ? 0.4119 0.6072 0.4768 0.0048  0.0232  0.0147  227 GLU A CA  
27   C C   . GLU A 16  ? 0.4063 0.5889 0.4695 0.0001  0.0245  0.0110  227 GLU A C   
28   O O   . GLU A 16  ? 0.4037 0.5909 0.4701 -0.0064 0.0255  0.0087  227 GLU A O   
29   C CB  . GLU A 16  ? 0.4106 0.6065 0.4743 0.0034  0.0206  0.0140  227 GLU A CB  
30   C CG  . GLU A 16  ? 0.4250 0.6344 0.4905 0.0074  0.0190  0.0179  227 GLU A CG  
31   C CD  . GLU A 16  ? 0.4065 0.6335 0.4768 0.0082  0.0199  0.0203  227 GLU A CD  
32   O OE1 . GLU A 16  ? 0.3469 0.5872 0.4211 0.0019  0.0193  0.0185  227 GLU A OE1 
33   O OE2 . GLU A 16  ? 0.3968 0.6243 0.4671 0.0151  0.0211  0.0239  227 GLU A OE2 
34   N N   . ASN A 17  ? 0.3953 0.5622 0.4537 0.0032  0.0244  0.0105  228 ASN A N   
35   C CA  . ASN A 17  ? 0.3911 0.5452 0.4473 0.0001  0.0256  0.0076  228 ASN A CA  
36   C C   . ASN A 17  ? 0.3831 0.5392 0.4414 -0.0009 0.0284  0.0080  228 ASN A C   
37   O O   . ASN A 17  ? 0.3751 0.5275 0.4345 -0.0064 0.0297  0.0057  228 ASN A O   
38   C CB  . ASN A 17  ? 0.3975 0.5363 0.4484 0.0051  0.0250  0.0078  228 ASN A CB  
39   C CG  . ASN A 17  ? 0.4076 0.5344 0.4560 0.0035  0.0266  0.0058  228 ASN A CG  
40   O OD1 . ASN A 17  ? 0.4090 0.5314 0.4556 0.0076  0.0281  0.0070  228 ASN A OD1 
41   N ND2 . ASN A 17  ? 0.4256 0.5474 0.4740 -0.0021 0.0263  0.0028  228 ASN A ND2 
42   N N   . LEU A 18  ? 0.3699 0.5318 0.4288 0.0045  0.0295  0.0112  229 LEU A N   
43   C CA  . LEU A 18  ? 0.3670 0.5316 0.4276 0.0048  0.0323  0.0123  229 LEU A CA  
44   C C   . LEU A 18  ? 0.3542 0.5327 0.4210 -0.0016 0.0333  0.0121  229 LEU A C   
45   O O   . LEU A 18  ? 0.3545 0.5316 0.4230 -0.0056 0.0355  0.0114  229 LEU A O   
46   C CB  . LEU A 18  ? 0.3727 0.5396 0.4317 0.0133  0.0330  0.0157  229 LEU A CB  
47   C CG  . LEU A 18  ? 0.3855 0.5499 0.4434 0.0166  0.0358  0.0169  229 LEU A CG  
48   C CD1 . LEU A 18  ? 0.3757 0.5242 0.4287 0.0168  0.0363  0.0150  229 LEU A CD1 
49   C CD2 . LEU A 18  ? 0.3977 0.5665 0.4544 0.0252  0.0362  0.0200  229 LEU A CD2 
50   N N   . TYR A 19  ? 0.3343 0.5263 0.4045 -0.0028 0.0317  0.0127  230 TYR A N   
51   C CA  . TYR A 19  ? 0.3244 0.5300 0.4006 -0.0099 0.0323  0.0117  230 TYR A CA  
52   C C   . TYR A 19  ? 0.3231 0.5243 0.4004 -0.0186 0.0318  0.0072  230 TYR A C   
53   O O   . TYR A 19  ? 0.3137 0.5184 0.3950 -0.0249 0.0336  0.0057  230 TYR A O   
54   C CB  . TYR A 19  ? 0.3208 0.5435 0.4003 -0.0084 0.0305  0.0137  230 TYR A CB  
55   C CG  . TYR A 19  ? 0.3016 0.5335 0.3826 -0.0018 0.0318  0.0181  230 TYR A CG  
56   C CD1 . TYR A 19  ? 0.2984 0.5459 0.3852 -0.0046 0.0332  0.0195  230 TYR A CD1 
57   C CD2 . TYR A 19  ? 0.3035 0.5289 0.3802 0.0072  0.0317  0.0209  230 TYR A CD2 
58   C CE1 . TYR A 19  ? 0.2910 0.5479 0.3793 0.0017  0.0346  0.0237  230 TYR A CE1 
59   C CE2 . TYR A 19  ? 0.3031 0.5372 0.3812 0.0138  0.0332  0.0248  230 TYR A CE2 
60   C CZ  . TYR A 19  ? 0.2920 0.5422 0.3759 0.0111  0.0346  0.0263  230 TYR A CZ  
61   O OH  . TYR A 19  ? 0.3405 0.6002 0.4260 0.0175  0.0361  0.0302  230 TYR A OH  
62   N N   . PHE A 20  ? 0.3203 0.5140 0.3943 -0.0190 0.0297  0.0050  231 PHE A N   
63   C CA  . PHE A 20  ? 0.3257 0.5142 0.4001 -0.0266 0.0294  0.0004  231 PHE A CA  
64   C C   . PHE A 20  ? 0.3362 0.5086 0.4082 -0.0277 0.0315  -0.0009 231 PHE A C   
65   O O   . PHE A 20  ? 0.3403 0.5086 0.4140 -0.0343 0.0324  -0.0043 231 PHE A O   
66   C CB  . PHE A 20  ? 0.3251 0.5132 0.3971 -0.0265 0.0264  -0.0012 231 PHE A CB  
67   C CG  . PHE A 20  ? 0.3213 0.5271 0.3969 -0.0285 0.0246  -0.0010 231 PHE A CG  
68   C CD1 . PHE A 20  ? 0.3039 0.5173 0.3828 -0.0365 0.0240  -0.0051 231 PHE A CD1 
69   C CD2 . PHE A 20  ? 0.3216 0.5376 0.3977 -0.0223 0.0236  0.0033  231 PHE A CD2 
70   C CE1 . PHE A 20  ? 0.2895 0.5206 0.3717 -0.0384 0.0222  -0.0051 231 PHE A CE1 
71   C CE2 . PHE A 20  ? 0.3128 0.5466 0.3925 -0.0239 0.0220  0.0039  231 PHE A CE2 
72   C CZ  . PHE A 20  ? 0.2897 0.5315 0.3724 -0.0321 0.0212  -0.0003 231 PHE A CZ  
73   N N   . GLN A 21  ? 0.3408 0.5049 0.4093 -0.0212 0.0324  0.0018  232 GLN A N   
74   C CA  . GLN A 21  ? 0.3508 0.4998 0.4160 -0.0207 0.0341  0.0011  232 GLN A CA  
75   C C   . GLN A 21  ? 0.3444 0.4833 0.4072 -0.0240 0.0328  -0.0024 232 GLN A C   
76   O O   . GLN A 21  ? 0.3433 0.4756 0.4069 -0.0289 0.0343  -0.0047 232 GLN A O   
77   C CB  . GLN A 21  ? 0.3640 0.5142 0.4328 -0.0246 0.0374  0.0016  232 GLN A CB  
78   C CG  . GLN A 21  ? 0.3913 0.5524 0.4624 -0.0209 0.0387  0.0053  232 GLN A CG  
79   C CD  . GLN A 21  ? 0.4192 0.5802 0.4931 -0.0236 0.0422  0.0066  232 GLN A CD  
80   O OE1 . GLN A 21  ? 0.4322 0.5941 0.5102 -0.0309 0.0435  0.0047  232 GLN A OE1 
81   N NE2 . GLN A 21  ? 0.4508 0.6109 0.5228 -0.0177 0.0439  0.0099  232 GLN A NE2 
82   N N   . SER A 22  ? 0.3445 0.4826 0.4045 -0.0210 0.0302  -0.0025 233 SER A N   
83   C CA  . SER A 22  ? 0.3373 0.4678 0.3951 -0.0235 0.0287  -0.0055 233 SER A CA  
84   C C   . SER A 22  ? 0.3203 0.4359 0.3732 -0.0193 0.0290  -0.0049 233 SER A C   
85   O O   . SER A 22  ? 0.3162 0.4291 0.3674 -0.0144 0.0300  -0.0024 233 SER A O   
86   C CB  . SER A 22  ? 0.3464 0.4835 0.4034 -0.0216 0.0257  -0.0051 233 SER A CB  
87   O OG  . SER A 22  ? 0.3751 0.5259 0.4362 -0.0264 0.0250  -0.0065 233 SER A OG  
88   N N   . MET A 23  ? 0.2985 0.4053 0.3491 -0.0212 0.0282  -0.0074 234 MET A N   
89   C CA  . MET A 23  ? 0.2867 0.3804 0.3326 -0.0173 0.0279  -0.0070 234 MET A CA  
90   C C   . MET A 23  ? 0.2706 0.3639 0.3137 -0.0102 0.0266  -0.0041 234 MET A C   
91   O O   . MET A 23  ? 0.2524 0.3536 0.2964 -0.0082 0.0251  -0.0027 234 MET A O   
92   C CB  . MET A 23  ? 0.2858 0.3738 0.3302 -0.0201 0.0265  -0.0099 234 MET A CB  
93   C CG  . MET A 23  ? 0.2802 0.3563 0.3202 -0.0168 0.0256  -0.0098 234 MET A CG  
94   S SD  . MET A 23  ? 0.2842 0.3586 0.3233 -0.0201 0.0235  -0.0127 234 MET A SD  
95   C CE  . MET A 23  ? 0.2607 0.3316 0.3020 -0.0266 0.0259  -0.0164 234 MET A CE  
96   N N   . ASP A 24  ? 0.2642 0.3483 0.3040 -0.0064 0.0274  -0.0032 235 ASP A N   
97   C CA  . ASP A 24  ? 0.2739 0.3554 0.3107 0.0001  0.0264  -0.0012 235 ASP A CA  
98   C C   . ASP A 24  ? 0.2666 0.3474 0.3022 0.0013  0.0238  -0.0013 235 ASP A C   
99   O O   . ASP A 24  ? 0.2599 0.3365 0.2949 -0.0018 0.0227  -0.0032 235 ASP A O   
100  C CB  . ASP A 24  ? 0.2785 0.3487 0.3114 0.0028  0.0273  -0.0014 235 ASP A CB  
101  C CG  . ASP A 24  ? 0.3090 0.3751 0.3382 0.0094  0.0263  -0.0001 235 ASP A CG  
102  O OD1 . ASP A 24  ? 0.3622 0.4237 0.3895 0.0109  0.0242  -0.0006 235 ASP A OD1 
103  O OD2 . ASP A 24  ? 0.3658 0.4330 0.3941 0.0131  0.0277  0.0012  235 ASP A OD2 
104  N N   . LEU A 25  ? 0.2625 0.3476 0.2979 0.0058  0.0229  0.0010  236 LEU A N   
105  C CA  . LEU A 25  ? 0.2713 0.3568 0.3062 0.0071  0.0205  0.0017  236 LEU A CA  
106  C C   . LEU A 25  ? 0.2563 0.3294 0.2874 0.0083  0.0192  0.0007  236 LEU A C   
107  O O   . LEU A 25  ? 0.2544 0.3272 0.2854 0.0073  0.0175  0.0007  236 LEU A O   
108  C CB  . LEU A 25  ? 0.2778 0.3692 0.3133 0.0125  0.0202  0.0048  236 LEU A CB  
109  C CG  . LEU A 25  ? 0.3015 0.4077 0.3412 0.0117  0.0208  0.0065  236 LEU A CG  
110  C CD1 . LEU A 25  ? 0.3301 0.4397 0.3697 0.0187  0.0210  0.0098  236 LEU A CD1 
111  C CD2 . LEU A 25  ? 0.3285 0.4430 0.3706 0.0073  0.0193  0.0059  236 LEU A CD2 
112  N N   . ARG A 26  ? 0.2475 0.3116 0.2758 0.0105  0.0199  0.0000  237 ARG A N   
113  C CA  . ARG A 26  ? 0.2537 0.3067 0.2786 0.0116  0.0187  -0.0011 237 ARG A CA  
114  C C   . ARG A 26  ? 0.2498 0.2998 0.2749 0.0065  0.0186  -0.0033 237 ARG A C   
115  O O   . ARG A 26  ? 0.2492 0.2949 0.2732 0.0056  0.0170  -0.0039 237 ARG A O   
116  C CB  . ARG A 26  ? 0.2516 0.2974 0.2732 0.0157  0.0195  -0.0013 237 ARG A CB  
117  C CG  . ARG A 26  ? 0.2731 0.3202 0.2940 0.0216  0.0194  0.0005  237 ARG A CG  
118  C CD  . ARG A 26  ? 0.3173 0.3630 0.3362 0.0249  0.0213  0.0004  237 ARG A CD  
119  N NE  . ARG A 26  ? 0.3152 0.3506 0.3300 0.0263  0.0208  -0.0015 237 ARG A NE  
120  C CZ  . ARG A 26  ? 0.2938 0.3267 0.3061 0.0287  0.0221  -0.0022 237 ARG A CZ  
121  N NH1 . ARG A 26  ? 0.2834 0.3078 0.2920 0.0298  0.0213  -0.0040 237 ARG A NH1 
122  N NH2 . ARG A 26  ? 0.2824 0.3222 0.2958 0.0302  0.0243  -0.0009 237 ARG A NH2 
123  N N   . VAL A 27  ? 0.2472 0.2998 0.2739 0.0031  0.0204  -0.0044 238 VAL A N   
124  C CA  . VAL A 27  ? 0.2377 0.2880 0.2651 -0.0018 0.0207  -0.0066 238 VAL A CA  
125  C C   . VAL A 27  ? 0.2394 0.2962 0.2689 -0.0050 0.0194  -0.0072 238 VAL A C   
126  O O   . VAL A 27  ? 0.2311 0.2842 0.2598 -0.0070 0.0185  -0.0087 238 VAL A O   
127  C CB  . VAL A 27  ? 0.2409 0.2922 0.2701 -0.0048 0.0233  -0.0074 238 VAL A CB  
128  C CG1 . VAL A 27  ? 0.2143 0.2627 0.2445 -0.0098 0.0238  -0.0099 238 VAL A CG1 
129  C CG2 . VAL A 27  ? 0.2038 0.2489 0.2305 -0.0014 0.0246  -0.0064 238 VAL A CG2 
130  N N   . GLN A 28  ? 0.2337 0.3010 0.2659 -0.0052 0.0193  -0.0061 239 GLN A N   
131  C CA  . GLN A 28  ? 0.2269 0.3020 0.2609 -0.0078 0.0179  -0.0064 239 GLN A CA  
132  C C   . GLN A 28  ? 0.2233 0.2939 0.2551 -0.0056 0.0158  -0.0055 239 GLN A C   
133  O O   . GLN A 28  ? 0.2003 0.2717 0.2321 -0.0086 0.0150  -0.0069 239 GLN A O   
134  C CB  . GLN A 28  ? 0.2251 0.3128 0.2619 -0.0069 0.0177  -0.0045 239 GLN A CB  
135  C CG  . GLN A 28  ? 0.2530 0.3481 0.2932 -0.0105 0.0196  -0.0056 239 GLN A CG  
136  C CD  . GLN A 28  ? 0.2734 0.3828 0.3168 -0.0100 0.0192  -0.0036 239 GLN A CD  
137  O OE1 . GLN A 28  ? 0.2506 0.3672 0.2946 -0.0101 0.0176  -0.0029 239 GLN A OE1 
138  N NE2 . GLN A 28  ? 0.2918 0.4058 0.3372 -0.0095 0.0209  -0.0026 239 GLN A NE2 
139  N N   . GLU A 29  ? 0.2277 0.2939 0.2576 -0.0005 0.0151  -0.0031 240 GLU A N   
140  C CA  . GLU A 29  ? 0.2398 0.3017 0.2681 0.0015  0.0133  -0.0018 240 GLU A CA  
141  C C   . GLU A 29  ? 0.2336 0.2861 0.2598 -0.0004 0.0129  -0.0039 240 GLU A C   
142  O O   . GLU A 29  ? 0.2194 0.2713 0.2453 -0.0014 0.0116  -0.0037 240 GLU A O   
143  C CB  . GLU A 29  ? 0.2542 0.3122 0.2812 0.0073  0.0128  0.0008  240 GLU A CB  
144  C CG  . GLU A 29  ? 0.2976 0.3656 0.3269 0.0101  0.0130  0.0038  240 GLU A CG  
145  C CD  . GLU A 29  ? 0.3503 0.4278 0.3816 0.0086  0.0117  0.0055  240 GLU A CD  
146  O OE1 . GLU A 29  ? 0.3992 0.4730 0.4296 0.0087  0.0104  0.0063  240 GLU A OE1 
147  O OE2 . GLU A 29  ? 0.3866 0.4760 0.4206 0.0074  0.0121  0.0062  240 GLU A OE2 
148  N N   . LEU A 30  ? 0.2338 0.2798 0.2587 -0.0008 0.0142  -0.0056 241 LEU A N   
149  C CA  . LEU A 30  ? 0.2300 0.2677 0.2530 -0.0023 0.0140  -0.0074 241 LEU A CA  
150  C C   . LEU A 30  ? 0.2305 0.2713 0.2549 -0.0071 0.0142  -0.0095 241 LEU A C   
151  O O   . LEU A 30  ? 0.2339 0.2721 0.2576 -0.0081 0.0132  -0.0100 241 LEU A O   
152  C CB  . LEU A 30  ? 0.2317 0.2633 0.2533 -0.0013 0.0155  -0.0083 241 LEU A CB  
153  C CG  . LEU A 30  ? 0.2254 0.2493 0.2452 -0.0026 0.0156  -0.0100 241 LEU A CG  
154  C CD1 . LEU A 30  ? 0.1981 0.2158 0.2158 -0.0006 0.0137  -0.0095 241 LEU A CD1 
155  C CD2 . LEU A 30  ? 0.2265 0.2468 0.2453 -0.0016 0.0176  -0.0103 241 LEU A CD2 
156  N N   . ILE A 31  ? 0.2290 0.2760 0.2557 -0.0100 0.0157  -0.0108 242 ILE A N   
157  C CA  . ILE A 31  ? 0.2344 0.2844 0.2624 -0.0147 0.0162  -0.0134 242 ILE A CA  
158  C C   . ILE A 31  ? 0.2344 0.2909 0.2629 -0.0155 0.0144  -0.0130 242 ILE A C   
159  O O   . ILE A 31  ? 0.2254 0.2810 0.2535 -0.0179 0.0141  -0.0148 242 ILE A O   
160  C CB  . ILE A 31  ? 0.2335 0.2901 0.2645 -0.0181 0.0180  -0.0149 242 ILE A CB  
161  C CG1 . ILE A 31  ? 0.2540 0.3043 0.2848 -0.0180 0.0202  -0.0153 242 ILE A CG1 
162  C CG2 . ILE A 31  ? 0.2177 0.2783 0.2502 -0.0231 0.0183  -0.0182 242 ILE A CG2 
163  C CD1 . ILE A 31  ? 0.2669 0.3085 0.2965 -0.0193 0.0212  -0.0171 242 ILE A CD1 
164  N N   . LYS A 32  ? 0.2353 0.2989 0.2647 -0.0133 0.0134  -0.0104 243 LYS A N   
165  C CA  . LYS A 32  ? 0.2543 0.3252 0.2842 -0.0137 0.0117  -0.0092 243 LYS A CA  
166  C C   . LYS A 32  ? 0.2475 0.3114 0.2753 -0.0121 0.0104  -0.0081 243 LYS A C   
167  O O   . LYS A 32  ? 0.2403 0.3077 0.2681 -0.0139 0.0096  -0.0085 243 LYS A O   
168  C CB  . LYS A 32  ? 0.2552 0.3339 0.2863 -0.0104 0.0109  -0.0057 243 LYS A CB  
169  C CG  . LYS A 32  ? 0.3102 0.4002 0.3440 -0.0120 0.0116  -0.0060 243 LYS A CG  
170  C CD  . LYS A 32  ? 0.3462 0.4415 0.3808 -0.0071 0.0109  -0.0016 243 LYS A CD  
171  C CE  . LYS A 32  ? 0.3999 0.5091 0.4375 -0.0081 0.0111  -0.0010 243 LYS A CE  
172  N NZ  . LYS A 32  ? 0.4054 0.5174 0.4437 -0.0025 0.0111  0.0032  243 LYS A NZ  
173  N N   . LEU A 33  ? 0.2405 0.2953 0.2667 -0.0088 0.0103  -0.0068 244 LEU A N   
174  C CA  . LEU A 33  ? 0.2379 0.2858 0.2625 -0.0075 0.0091  -0.0057 244 LEU A CA  
175  C C   . LEU A 33  ? 0.2320 0.2759 0.2558 -0.0106 0.0094  -0.0085 244 LEU A C   
176  O O   . LEU A 33  ? 0.2258 0.2708 0.2494 -0.0116 0.0085  -0.0082 244 LEU A O   
177  C CB  . LEU A 33  ? 0.2394 0.2784 0.2623 -0.0036 0.0088  -0.0045 244 LEU A CB  
178  C CG  . LEU A 33  ? 0.2694 0.3009 0.2910 -0.0022 0.0075  -0.0034 244 LEU A CG  
179  C CD1 . LEU A 33  ? 0.2733 0.3086 0.2960 -0.0017 0.0061  -0.0004 244 LEU A CD1 
180  C CD2 . LEU A 33  ? 0.2597 0.2837 0.2798 0.0015  0.0074  -0.0028 244 LEU A CD2 
181  N N   . ILE A 34  ? 0.2193 0.2589 0.2427 -0.0119 0.0110  -0.0110 245 ILE A N   
182  C CA  . ILE A 34  ? 0.2182 0.2528 0.2408 -0.0139 0.0114  -0.0132 245 ILE A CA  
183  C C   . ILE A 34  ? 0.2249 0.2658 0.2486 -0.0178 0.0120  -0.0157 245 ILE A C   
184  O O   . ILE A 34  ? 0.2138 0.2526 0.2369 -0.0191 0.0120  -0.0170 245 ILE A O   
185  C CB  . ILE A 34  ? 0.2112 0.2381 0.2327 -0.0134 0.0129  -0.0145 245 ILE A CB  
186  C CG1 . ILE A 34  ? 0.2015 0.2310 0.2246 -0.0154 0.0151  -0.0162 245 ILE A CG1 
187  C CG2 . ILE A 34  ? 0.2057 0.2266 0.2256 -0.0094 0.0121  -0.0125 245 ILE A CG2 
188  C CD1 . ILE A 34  ? 0.1716 0.1937 0.1939 -0.0151 0.0169  -0.0171 245 ILE A CD1 
189  N N   . CYS A 35  ? 0.2231 0.2721 0.2486 -0.0195 0.0125  -0.0165 246 CYS A N   
190  C CA  . CYS A 35  ? 0.2338 0.2895 0.2603 -0.0234 0.0130  -0.0194 246 CYS A CA  
191  C C   . CYS A 35  ? 0.2413 0.3057 0.2678 -0.0235 0.0113  -0.0180 246 CYS A C   
192  O O   . CYS A 35  ? 0.2341 0.3061 0.2614 -0.0266 0.0114  -0.0204 246 CYS A O   
193  C CB  . CYS A 35  ? 0.2327 0.2936 0.2613 -0.0260 0.0144  -0.0214 246 CYS A CB  
194  S SG  . CYS A 35  ? 0.2593 0.3112 0.2883 -0.0268 0.0170  -0.0231 246 CYS A SG  
195  N N   . ASN A 36  ? 0.2562 0.3197 0.2820 -0.0202 0.0097  -0.0141 247 ASN A N   
196  C CA  . ASN A 36  ? 0.2749 0.3470 0.3010 -0.0197 0.0082  -0.0116 247 ASN A CA  
197  C C   . ASN A 36  ? 0.2724 0.3451 0.2976 -0.0215 0.0079  -0.0129 247 ASN A C   
198  O O   . ASN A 36  ? 0.2517 0.3170 0.2758 -0.0202 0.0076  -0.0118 247 ASN A O   
199  C CB  . ASN A 36  ? 0.2835 0.3524 0.3094 -0.0154 0.0070  -0.0069 247 ASN A CB  
200  C CG  . ASN A 36  ? 0.3213 0.3991 0.3479 -0.0142 0.0057  -0.0033 247 ASN A CG  
201  O OD1 . ASN A 36  ? 0.3660 0.4501 0.3925 -0.0161 0.0053  -0.0036 247 ASN A OD1 
202  N ND2 . ASN A 36  ? 0.3904 0.4688 0.4177 -0.0107 0.0052  0.0005  247 ASN A ND2 
203  N N   . VAL A 37  ? 0.2747 0.3564 0.3003 -0.0245 0.0081  -0.0155 248 VAL A N   
204  C CA  . VAL A 37  ? 0.2877 0.3704 0.3121 -0.0264 0.0083  -0.0175 248 VAL A CA  
205  C C   . VAL A 37  ? 0.2834 0.3699 0.3073 -0.0245 0.0068  -0.0133 248 VAL A C   
206  O O   . VAL A 37  ? 0.2648 0.3483 0.2878 -0.0246 0.0068  -0.0134 248 VAL A O   
207  C CB  . VAL A 37  ? 0.2958 0.3869 0.3205 -0.0303 0.0090  -0.0223 248 VAL A CB  
208  C CG1 . VAL A 37  ? 0.3133 0.4063 0.3365 -0.0317 0.0092  -0.0242 248 VAL A CG1 
209  C CG2 . VAL A 37  ? 0.3029 0.3883 0.3284 -0.0327 0.0109  -0.0265 248 VAL A CG2 
210  N N   . GLN A 38  ? 0.3006 0.3940 0.3253 -0.0226 0.0056  -0.0094 249 GLN A N   
211  C CA  . GLN A 38  ? 0.3100 0.4062 0.3346 -0.0203 0.0044  -0.0044 249 GLN A CA  
212  C C   . GLN A 38  ? 0.3023 0.3864 0.3266 -0.0181 0.0042  -0.0020 249 GLN A C   
213  O O   . GLN A 38  ? 0.2983 0.3815 0.3224 -0.0178 0.0037  0.0001  249 GLN A O   
214  C CB  . GLN A 38  ? 0.3355 0.4398 0.3614 -0.0180 0.0036  -0.0004 249 GLN A CB  
215  C CG  . GLN A 38  ? 0.3888 0.4970 0.4149 -0.0155 0.0025  0.0055  249 GLN A CG  
216  C CD  . GLN A 38  ? 0.4703 0.5897 0.4957 -0.0174 0.0022  0.0051  249 GLN A CD  
217  O OE1 . GLN A 38  ? 0.5033 0.6201 0.5276 -0.0190 0.0026  0.0033  249 GLN A OE1 
218  N NE2 . GLN A 38  ? 0.5236 0.6566 0.5496 -0.0172 0.0016  0.0067  249 GLN A NE2 
219  N N   . ALA A 39  ? 0.2750 0.3501 0.2994 -0.0168 0.0046  -0.0026 250 ALA A N   
220  C CA  . ALA A 39  ? 0.2643 0.3284 0.2884 -0.0149 0.0042  -0.0009 250 ALA A CA  
221  C C   . ALA A 39  ? 0.2532 0.3126 0.2764 -0.0168 0.0046  -0.0034 250 ALA A C   
222  O O   . ALA A 39  ? 0.2305 0.2859 0.2537 -0.0161 0.0040  -0.0013 250 ALA A O   
223  C CB  . ALA A 39  ? 0.2604 0.3168 0.2845 -0.0129 0.0045  -0.0012 250 ALA A CB  
224  N N   . MET A 40  ? 0.2439 0.3042 0.2666 -0.0192 0.0059  -0.0079 251 MET A N   
225  C CA  . MET A 40  ? 0.2475 0.3043 0.2694 -0.0207 0.0066  -0.0104 251 MET A CA  
226  C C   . MET A 40  ? 0.2568 0.3200 0.2787 -0.0214 0.0061  -0.0090 251 MET A C   
227  O O   . MET A 40  ? 0.2300 0.2892 0.2516 -0.0213 0.0060  -0.0084 251 MET A O   
228  C CB  . MET A 40  ? 0.2554 0.3126 0.2770 -0.0231 0.0084  -0.0155 251 MET A CB  
229  C CG  . MET A 40  ? 0.2547 0.3048 0.2765 -0.0225 0.0093  -0.0169 251 MET A CG  
230  S SD  . MET A 40  ? 0.2847 0.3367 0.3070 -0.0258 0.0115  -0.0221 251 MET A SD  
231  C CE  . MET A 40  ? 0.3394 0.3830 0.3620 -0.0240 0.0123  -0.0213 251 MET A CE  
232  N N   . GLU A 41  ? 0.2710 0.3448 0.2930 -0.0222 0.0058  -0.0084 252 GLU A N   
233  C CA  . GLU A 41  ? 0.2887 0.3705 0.3105 -0.0227 0.0053  -0.0066 252 GLU A CA  
234  C C   . GLU A 41  ? 0.2859 0.3643 0.3085 -0.0205 0.0042  -0.0010 252 GLU A C   
235  O O   . GLU A 41  ? 0.2754 0.3533 0.2980 -0.0209 0.0042  0.0000  252 GLU A O   
236  C CB  . GLU A 41  ? 0.3025 0.3974 0.3242 -0.0236 0.0050  -0.0066 252 GLU A CB  
237  C CG  . GLU A 41  ? 0.3785 0.4808 0.3989 -0.0266 0.0060  -0.0119 252 GLU A CG  
238  C CD  . GLU A 41  ? 0.4604 0.5737 0.4809 -0.0283 0.0059  -0.0143 252 GLU A CD  
239  O OE1 . GLU A 41  ? 0.5118 0.6329 0.5330 -0.0269 0.0047  -0.0103 252 GLU A OE1 
240  O OE2 . GLU A 41  ? 0.4720 0.5861 0.4920 -0.0312 0.0070  -0.0203 252 GLU A OE2 
241  N N   . GLU A 42  ? 0.2915 0.3670 0.3150 -0.0183 0.0033  0.0025  253 GLU A N   
242  C CA  . GLU A 42  ? 0.2950 0.3656 0.3197 -0.0164 0.0024  0.0075  253 GLU A CA  
243  C C   . GLU A 42  ? 0.2865 0.3468 0.3111 -0.0167 0.0024  0.0063  253 GLU A C   
244  O O   . GLU A 42  ? 0.2710 0.3298 0.2964 -0.0168 0.0019  0.0090  253 GLU A O   
245  C CB  . GLU A 42  ? 0.3050 0.3730 0.3306 -0.0138 0.0018  0.0106  253 GLU A CB  
246  C CG  . GLU A 42  ? 0.3383 0.4176 0.3644 -0.0129 0.0017  0.0131  253 GLU A CG  
247  C CD  . GLU A 42  ? 0.4163 0.4941 0.4432 -0.0100 0.0014  0.0155  253 GLU A CD  
248  O OE1 . GLU A 42  ? 0.4861 0.5549 0.5128 -0.0090 0.0016  0.0138  253 GLU A OE1 
249  O OE2 . GLU A 42  ? 0.4560 0.5426 0.4837 -0.0086 0.0012  0.0191  253 GLU A OE2 
250  N N   . MET A 43  ? 0.2687 0.3226 0.2925 -0.0170 0.0030  0.0024  254 MET A N   
251  C CA  . MET A 43  ? 0.2637 0.3086 0.2873 -0.0170 0.0029  0.0014  254 MET A CA  
252  C C   . MET A 43  ? 0.2552 0.3027 0.2787 -0.0187 0.0034  0.0003  254 MET A C   
253  O O   . MET A 43  ? 0.2328 0.2763 0.2570 -0.0187 0.0028  0.0016  254 MET A O   
254  C CB  . MET A 43  ? 0.2616 0.2999 0.2841 -0.0167 0.0036  -0.0023 254 MET A CB  
255  C CG  . MET A 43  ? 0.2633 0.2961 0.2858 -0.0144 0.0030  -0.0010 254 MET A CG  
256  S SD  . MET A 43  ? 0.2483 0.2745 0.2695 -0.0139 0.0041  -0.0048 254 MET A SD  
257  C CE  . MET A 43  ? 0.2593 0.2921 0.2808 -0.0138 0.0049  -0.0054 254 MET A CE  
258  N N   . MET A 44  ? 0.2487 0.3028 0.2714 -0.0201 0.0045  -0.0026 255 MET A N   
259  C CA  . MET A 44  ? 0.2568 0.3133 0.2791 -0.0214 0.0053  -0.0041 255 MET A CA  
260  C C   . MET A 44  ? 0.2692 0.3322 0.2925 -0.0215 0.0045  0.0000  255 MET A C   
261  O O   . MET A 44  ? 0.2685 0.3310 0.2923 -0.0219 0.0046  0.0007  255 MET A O   
262  C CB  . MET A 44  ? 0.2494 0.3107 0.2705 -0.0229 0.0069  -0.0090 255 MET A CB  
263  C CG  . MET A 44  ? 0.2522 0.3067 0.2728 -0.0231 0.0081  -0.0130 255 MET A CG  
264  S SD  . MET A 44  ? 0.2883 0.3325 0.3090 -0.0220 0.0084  -0.0134 255 MET A SD  
265  C CE  . MET A 44  ? 0.3032 0.3420 0.3246 -0.0202 0.0064  -0.0093 255 MET A CE  
266  N N   . MET A 45  ? 0.2846 0.3538 0.3083 -0.0210 0.0039  0.0031  256 MET A N   
267  C CA  . MET A 45  ? 0.3086 0.3838 0.3334 -0.0208 0.0033  0.0080  256 MET A CA  
268  C C   . MET A 45  ? 0.3086 0.3759 0.3352 -0.0202 0.0024  0.0117  256 MET A C   
269  O O   . MET A 45  ? 0.3058 0.3752 0.3335 -0.0209 0.0024  0.0141  256 MET A O   
270  C CB  . MET A 45  ? 0.3182 0.4016 0.3432 -0.0199 0.0029  0.0113  256 MET A CB  
271  C CG  . MET A 45  ? 0.3539 0.4488 0.3772 -0.0211 0.0036  0.0084  256 MET A CG  
272  S SD  . MET A 45  ? 0.4466 0.5519 0.4701 -0.0197 0.0029  0.0122  256 MET A SD  
273  C CE  . MET A 45  ? 0.4389 0.5453 0.4645 -0.0181 0.0022  0.0206  256 MET A CE  
274  N N   . GLU A 46  ? 0.3122 0.3705 0.3393 -0.0191 0.0017  0.0117  257 GLU A N   
275  C CA  . GLU A 46  ? 0.3183 0.3684 0.3470 -0.0188 0.0007  0.0142  257 GLU A CA  
276  C C   . GLU A 46  ? 0.3104 0.3569 0.3391 -0.0201 0.0009  0.0116  257 GLU A C   
277  O O   . GLU A 46  ? 0.2933 0.3365 0.3237 -0.0207 0.0002  0.0139  257 GLU A O   
278  C CB  . GLU A 46  ? 0.3281 0.3700 0.3567 -0.0171 0.0001  0.0141  257 GLU A CB  
279  C CG  . GLU A 46  ? 0.3790 0.4111 0.4088 -0.0170 -0.0010 0.0150  257 GLU A CG  
280  C CD  . GLU A 46  ? 0.4465 0.4780 0.4790 -0.0170 -0.0017 0.0205  257 GLU A CD  
281  O OE1 . GLU A 46  ? 0.4954 0.5206 0.5293 -0.0180 -0.0025 0.0211  257 GLU A OE1 
282  O OE2 . GLU A 46  ? 0.4698 0.5069 0.5028 -0.0161 -0.0014 0.0242  257 GLU A OE2 
283  N N   . MET A 47  ? 0.3011 0.3485 0.3281 -0.0204 0.0020  0.0071  258 MET A N   
284  C CA  . MET A 47  ? 0.2996 0.3449 0.3265 -0.0211 0.0024  0.0049  258 MET A CA  
285  C C   . MET A 47  ? 0.2894 0.3432 0.3168 -0.0222 0.0033  0.0057  258 MET A C   
286  O O   . MET A 47  ? 0.2763 0.3300 0.3037 -0.0225 0.0040  0.0039  258 MET A O   
287  C CB  . MET A 47  ? 0.2992 0.3407 0.3243 -0.0207 0.0035  0.0000  258 MET A CB  
288  C CG  . MET A 47  ? 0.2962 0.3296 0.3208 -0.0195 0.0028  -0.0007 258 MET A CG  
289  S SD  . MET A 47  ? 0.2996 0.3282 0.3225 -0.0189 0.0043  -0.0055 258 MET A SD  
290  C CE  . MET A 47  ? 0.2514 0.2761 0.2750 -0.0187 0.0040  -0.0055 258 MET A CE  
291  N N   . LYS A 48  ? 0.2845 0.3460 0.3121 -0.0224 0.0033  0.0085  259 LYS A N   
292  C CA  . LYS A 48  ? 0.2859 0.3568 0.3137 -0.0232 0.0041  0.0098  259 LYS A CA  
293  C C   . LYS A 48  ? 0.2729 0.3495 0.2984 -0.0235 0.0057  0.0050  259 LYS A C   
294  O O   . LYS A 48  ? 0.2534 0.3373 0.2788 -0.0240 0.0066  0.0051  259 LYS A O   
295  C CB  . LYS A 48  ? 0.2849 0.3551 0.3148 -0.0239 0.0039  0.0121  259 LYS A CB  
296  C CG  . LYS A 48  ? 0.3368 0.4006 0.3692 -0.0242 0.0023  0.0161  259 LYS A CG  
297  C CD  . LYS A 48  ? 0.4052 0.4726 0.4394 -0.0243 0.0018  0.0218  259 LYS A CD  
298  C CE  . LYS A 48  ? 0.4350 0.4984 0.4726 -0.0256 0.0008  0.0261  259 LYS A CE  
299  N NZ  . LYS A 48  ? 0.4616 0.5184 0.5000 -0.0264 0.0002  0.0233  259 LYS A NZ  
300  N N   . TYR A 49  ? 0.2630 0.3367 0.2869 -0.0234 0.0062  0.0007  260 TYR A N   
301  C CA  . TYR A 49  ? 0.2591 0.3373 0.2811 -0.0240 0.0078  -0.0042 260 TYR A CA  
302  C C   . TYR A 49  ? 0.2653 0.3543 0.2864 -0.0246 0.0077  -0.0034 260 TYR A C   
303  O O   . TYR A 49  ? 0.2715 0.3621 0.2932 -0.0241 0.0066  -0.0003 260 TYR A O   
304  C CB  . TYR A 49  ? 0.2690 0.3402 0.2901 -0.0240 0.0085  -0.0087 260 TYR A CB  
305  C CG  . TYR A 49  ? 0.2489 0.3234 0.2684 -0.0251 0.0104  -0.0144 260 TYR A CG  
306  C CD1 . TYR A 49  ? 0.2290 0.3009 0.2480 -0.0249 0.0121  -0.0176 260 TYR A CD1 
307  C CD2 . TYR A 49  ? 0.2294 0.3092 0.2479 -0.0262 0.0105  -0.0166 260 TYR A CD2 
308  C CE1 . TYR A 49  ? 0.2686 0.3422 0.2862 -0.0259 0.0140  -0.0231 260 TYR A CE1 
309  C CE2 . TYR A 49  ? 0.2090 0.2910 0.2262 -0.0276 0.0122  -0.0223 260 TYR A CE2 
310  C CZ  . TYR A 49  ? 0.2591 0.3375 0.2758 -0.0275 0.0140  -0.0257 260 TYR A CZ  
311  O OH  . TYR A 49  ? 0.3258 0.4057 0.3413 -0.0290 0.0159  -0.0315 260 TYR A OH  
312  N N   . ASN A 50  ? 0.2764 0.3731 0.2961 -0.0253 0.0090  -0.0062 261 ASN A N   
313  C CA  . ASN A 50  ? 0.2869 0.3957 0.3056 -0.0257 0.0088  -0.0052 261 ASN A CA  
314  C C   . ASN A 50  ? 0.2956 0.4072 0.3126 -0.0268 0.0092  -0.0102 261 ASN A C   
315  O O   . ASN A 50  ? 0.2909 0.4061 0.3062 -0.0280 0.0106  -0.0155 261 ASN A O   
316  C CB  . ASN A 50  ? 0.2822 0.3992 0.2999 -0.0259 0.0100  -0.0055 261 ASN A CB  
317  C CG  . ASN A 50  ? 0.3010 0.4315 0.3178 -0.0260 0.0096  -0.0028 261 ASN A CG  
318  O OD1 . ASN A 50  ? 0.2902 0.4251 0.3064 -0.0262 0.0088  -0.0026 261 ASN A OD1 
319  N ND2 . ASN A 50  ? 0.2652 0.4028 0.2820 -0.0256 0.0101  -0.0003 261 ASN A ND2 
320  N N   . THR A 51  ? 0.3147 0.4243 0.3324 -0.0265 0.0081  -0.0085 262 THR A N   
321  C CA  . THR A 51  ? 0.3242 0.4365 0.3410 -0.0278 0.0083  -0.0127 262 THR A CA  
322  C C   . THR A 51  ? 0.3496 0.4762 0.3648 -0.0289 0.0083  -0.0142 262 THR A C   
323  O O   . THR A 51  ? 0.3319 0.4619 0.3462 -0.0307 0.0087  -0.0192 262 THR A O   
324  C CB  . THR A 51  ? 0.3162 0.4251 0.3344 -0.0268 0.0070  -0.0096 262 THR A CB  
325  O OG1 . THR A 51  ? 0.3301 0.4424 0.3493 -0.0250 0.0057  -0.0027 262 THR A OG1 
326  C CG2 . THR A 51  ? 0.2961 0.3913 0.3152 -0.0261 0.0071  -0.0101 262 THR A CG2 
327  N N   . LYS A 52  ? 0.3745 0.5099 0.3896 -0.0280 0.0077  -0.0096 263 LYS A N   
328  C CA  . LYS A 52  ? 0.4054 0.5556 0.4185 -0.0289 0.0078  -0.0111 263 LYS A CA  
329  C C   . LYS A 52  ? 0.4129 0.5653 0.4238 -0.0305 0.0096  -0.0180 263 LYS A C   
330  O O   . LYS A 52  ? 0.4228 0.5821 0.4320 -0.0323 0.0100  -0.0233 263 LYS A O   
331  C CB  . LYS A 52  ? 0.4156 0.5748 0.4290 -0.0272 0.0071  -0.0038 263 LYS A CB  
332  C CG  . LYS A 52  ? 0.4553 0.6142 0.4708 -0.0253 0.0055  0.0034  263 LYS A CG  
333  C CD  . LYS A 52  ? 0.4975 0.6568 0.5131 -0.0257 0.0048  0.0011  263 LYS A CD  
334  C CE  . LYS A 52  ? 0.5262 0.6888 0.5435 -0.0234 0.0035  0.0082  263 LYS A CE  
335  N NZ  . LYS A 52  ? 0.5385 0.6870 0.5581 -0.0218 0.0032  0.0115  263 LYS A NZ  
336  N N   . LYS A 53  ? 0.4245 0.5708 0.4356 -0.0298 0.0106  -0.0179 264 LYS A N   
337  C CA  . LYS A 53  ? 0.4355 0.5838 0.4448 -0.0306 0.0126  -0.0237 264 LYS A CA  
338  C C   . LYS A 53  ? 0.4314 0.5699 0.4404 -0.0320 0.0141  -0.0311 264 LYS A C   
339  O O   . LYS A 53  ? 0.4343 0.5755 0.4414 -0.0332 0.0157  -0.0374 264 LYS A O   
340  C CB  . LYS A 53  ? 0.4409 0.5867 0.4510 -0.0289 0.0132  -0.0200 264 LYS A CB  
341  C CG  . LYS A 53  ? 0.4828 0.6342 0.4909 -0.0289 0.0151  -0.0242 264 LYS A CG  
342  C CD  . LYS A 53  ? 0.4955 0.6457 0.5051 -0.0271 0.0155  -0.0190 264 LYS A CD  
343  C CE  . LYS A 53  ? 0.5090 0.6604 0.5173 -0.0265 0.0178  -0.0234 264 LYS A CE  
344  N NZ  . LYS A 53  ? 0.5063 0.6524 0.5170 -0.0250 0.0180  -0.0190 264 LYS A NZ  
345  N N   . ALA A 54  ? 0.4154 0.5422 0.4262 -0.0317 0.0137  -0.0301 265 ALA A N   
346  C CA  . ALA A 54  ? 0.4028 0.5200 0.4138 -0.0329 0.0153  -0.0361 265 ALA A CA  
347  C C   . ALA A 54  ? 0.3866 0.4997 0.3989 -0.0335 0.0141  -0.0349 265 ALA A C   
348  O O   . ALA A 54  ? 0.3716 0.4756 0.3854 -0.0322 0.0135  -0.0317 265 ALA A O   
349  C CB  . ALA A 54  ? 0.3955 0.5017 0.4074 -0.0313 0.0165  -0.0358 265 ALA A CB  
350  N N   . PRO A 55  ? 0.3885 0.5094 0.4003 -0.0355 0.0136  -0.0375 266 PRO A N   
351  C CA  . PRO A 55  ? 0.3826 0.5005 0.3959 -0.0358 0.0125  -0.0359 266 PRO A CA  
352  C C   . PRO A 55  ? 0.3787 0.4834 0.3932 -0.0362 0.0138  -0.0387 266 PRO A C   
353  O O   . PRO A 55  ? 0.3586 0.4582 0.3727 -0.0374 0.0159  -0.0439 266 PRO A O   
354  C CB  . PRO A 55  ? 0.3942 0.5244 0.4068 -0.0382 0.0119  -0.0390 266 PRO A CB  
355  C CG  . PRO A 55  ? 0.3944 0.5360 0.4047 -0.0383 0.0121  -0.0399 266 PRO A CG  
356  C CD  . PRO A 55  ? 0.3891 0.5222 0.3989 -0.0375 0.0139  -0.0420 266 PRO A CD  
357  N N   . LEU A 56  ? 0.3713 0.4705 0.3873 -0.0349 0.0127  -0.0347 267 LEU A N   
358  C CA  . LEU A 56  ? 0.3711 0.4582 0.3882 -0.0347 0.0138  -0.0360 267 LEU A CA  
359  C C   . LEU A 56  ? 0.3755 0.4623 0.3928 -0.0378 0.0155  -0.0423 267 LEU A C   
360  O O   . LEU A 56  ? 0.3783 0.4563 0.3959 -0.0383 0.0175  -0.0455 267 LEU A O   
361  C CB  . LEU A 56  ? 0.3618 0.4453 0.3801 -0.0328 0.0123  -0.0309 267 LEU A CB  
362  C CG  . LEU A 56  ? 0.3459 0.4269 0.3644 -0.0300 0.0109  -0.0250 267 LEU A CG  
363  C CD1 . LEU A 56  ? 0.3662 0.4442 0.3857 -0.0282 0.0095  -0.0207 267 LEU A CD1 
364  C CD2 . LEU A 56  ? 0.3296 0.4014 0.3480 -0.0290 0.0119  -0.0255 267 LEU A CD2 
365  N N   . GLY A 57  ? 0.3893 0.4862 0.4065 -0.0400 0.0148  -0.0441 268 GLY A N   
366  C CA  . GLY A 57  ? 0.4010 0.4990 0.4188 -0.0436 0.0162  -0.0503 268 GLY A CA  
367  C C   . GLY A 57  ? 0.4114 0.5066 0.4282 -0.0455 0.0185  -0.0566 268 GLY A C   
368  O O   . GLY A 57  ? 0.4232 0.5146 0.4409 -0.0483 0.0202  -0.0618 268 GLY A O   
369  N N   . LYS A 58  ? 0.4125 0.5096 0.4275 -0.0439 0.0186  -0.0562 269 LYS A N   
370  C CA  . LYS A 58  ? 0.4208 0.5156 0.4346 -0.0449 0.0210  -0.0621 269 LYS A CA  
371  C C   . LYS A 58  ? 0.4082 0.4909 0.4223 -0.0422 0.0227  -0.0609 269 LYS A C   
372  O O   . LYS A 58  ? 0.4051 0.4844 0.4183 -0.0423 0.0249  -0.0651 269 LYS A O   
373  C CB  . LYS A 58  ? 0.4318 0.5393 0.4433 -0.0450 0.0202  -0.0631 269 LYS A CB  
374  C CG  . LYS A 58  ? 0.4712 0.5919 0.4822 -0.0482 0.0190  -0.0662 269 LYS A CG  
375  C CD  . LYS A 58  ? 0.5184 0.6533 0.5268 -0.0476 0.0178  -0.0653 269 LYS A CD  
376  C CE  . LYS A 58  ? 0.5300 0.6797 0.5381 -0.0497 0.0157  -0.0656 269 LYS A CE  
377  N NZ  . LYS A 58  ? 0.5403 0.6920 0.5502 -0.0478 0.0135  -0.0580 269 LYS A NZ  
378  N N   . LEU A 59  ? 0.3944 0.4708 0.4095 -0.0397 0.0217  -0.0552 270 LEU A N   
379  C CA  . LEU A 59  ? 0.3912 0.4567 0.4068 -0.0371 0.0230  -0.0536 270 LEU A CA  
380  C C   . LEU A 59  ? 0.3872 0.4425 0.4038 -0.0382 0.0259  -0.0579 270 LEU A C   
381  O O   . LEU A 59  ? 0.3967 0.4499 0.4146 -0.0402 0.0261  -0.0592 270 LEU A O   
382  C CB  . LEU A 59  ? 0.4006 0.4625 0.4171 -0.0348 0.0210  -0.0472 270 LEU A CB  
383  C CG  . LEU A 59  ? 0.4113 0.4648 0.4283 -0.0318 0.0211  -0.0435 270 LEU A CG  
384  C CD1 . LEU A 59  ? 0.4087 0.4663 0.4249 -0.0303 0.0208  -0.0419 270 LEU A CD1 
385  C CD2 . LEU A 59  ? 0.4344 0.4860 0.4522 -0.0306 0.0189  -0.0384 270 LEU A CD2 
386  N N   . THR A 60  ? 0.3751 0.4242 0.3914 -0.0367 0.0281  -0.0598 271 THR A N   
387  C CA  . THR A 60  ? 0.3691 0.4076 0.3865 -0.0371 0.0312  -0.0634 271 THR A CA  
388  C C   . THR A 60  ? 0.3622 0.3918 0.3801 -0.0334 0.0321  -0.0596 271 THR A C   
389  O O   . THR A 60  ? 0.3663 0.3986 0.3836 -0.0309 0.0306  -0.0558 271 THR A O   
390  C CB  . THR A 60  ? 0.3755 0.4144 0.3919 -0.0385 0.0339  -0.0701 271 THR A CB  
391  O OG1 . THR A 60  ? 0.3541 0.3940 0.3694 -0.0354 0.0343  -0.0688 271 THR A OG1 
392  C CG2 . THR A 60  ? 0.3765 0.4265 0.3919 -0.0420 0.0328  -0.0742 271 THR A CG2 
393  N N   . VAL A 61  ? 0.3615 0.3810 0.3807 -0.0331 0.0345  -0.0607 272 VAL A N   
394  C CA  . VAL A 61  ? 0.3653 0.3773 0.3849 -0.0293 0.0352  -0.0568 272 VAL A CA  
395  C C   . VAL A 61  ? 0.3630 0.3741 0.3820 -0.0268 0.0370  -0.0580 272 VAL A C   
396  O O   . VAL A 61  ? 0.3563 0.3665 0.3753 -0.0235 0.0363  -0.0539 272 VAL A O   
397  C CB  . VAL A 61  ? 0.3727 0.3744 0.3939 -0.0286 0.0370  -0.0554 272 VAL A CB  
398  C CG1 . VAL A 61  ? 0.3709 0.3737 0.3931 -0.0320 0.0362  -0.0561 272 VAL A CG1 
399  C CG2 . VAL A 61  ? 0.3773 0.3703 0.3993 -0.0275 0.0409  -0.0581 272 VAL A CG2 
400  N N   . ALA A 62  ? 0.3491 0.3611 0.3675 -0.0284 0.0393  -0.0638 273 ALA A N   
401  C CA  . ALA A 62  ? 0.3464 0.3597 0.3639 -0.0259 0.0408  -0.0652 273 ALA A CA  
402  C C   . ALA A 62  ? 0.3209 0.3443 0.3373 -0.0246 0.0379  -0.0614 273 ALA A C   
403  O O   . ALA A 62  ? 0.3267 0.3499 0.3431 -0.0215 0.0382  -0.0588 273 ALA A O   
404  C CB  . ALA A 62  ? 0.3339 0.3475 0.3507 -0.0281 0.0437  -0.0729 273 ALA A CB  
405  N N   . GLN A 63  ? 0.3175 0.3496 0.3331 -0.0271 0.0351  -0.0608 274 GLN A N   
406  C CA  . GLN A 63  ? 0.3155 0.3568 0.3304 -0.0261 0.0323  -0.0565 274 GLN A CA  
407  C C   . GLN A 63  ? 0.2968 0.3345 0.3129 -0.0234 0.0307  -0.0500 274 GLN A C   
408  O O   . GLN A 63  ? 0.2933 0.3338 0.3095 -0.0213 0.0301  -0.0471 274 GLN A O   
409  C CB  . GLN A 63  ? 0.3221 0.3725 0.3363 -0.0289 0.0298  -0.0561 274 GLN A CB  
410  C CG  . GLN A 63  ? 0.3699 0.4316 0.3823 -0.0301 0.0296  -0.0588 274 GLN A CG  
411  C CD  . GLN A 63  ? 0.4003 0.4688 0.4118 -0.0337 0.0289  -0.0626 274 GLN A CD  
412  O OE1 . GLN A 63  ? 0.4339 0.5038 0.4462 -0.0351 0.0269  -0.0603 274 GLN A OE1 
413  N NE2 . GLN A 63  ? 0.4379 0.5115 0.4478 -0.0352 0.0305  -0.0687 274 GLN A NE2 
414  N N   . ILE A 64  ? 0.2825 0.3140 0.2995 -0.0237 0.0299  -0.0481 275 ILE A N   
415  C CA  . ILE A 64  ? 0.2678 0.2956 0.2857 -0.0215 0.0282  -0.0428 275 ILE A CA  
416  C C   . ILE A 64  ? 0.2711 0.2935 0.2897 -0.0183 0.0302  -0.0421 275 ILE A C   
417  O O   . ILE A 64  ? 0.2602 0.2842 0.2793 -0.0164 0.0288  -0.0382 275 ILE A O   
418  C CB  . ILE A 64  ? 0.2670 0.2898 0.2856 -0.0224 0.0273  -0.0415 275 ILE A CB  
419  C CG1 . ILE A 64  ? 0.2488 0.2784 0.2670 -0.0248 0.0251  -0.0411 275 ILE A CG1 
420  C CG2 . ILE A 64  ? 0.2537 0.2720 0.2729 -0.0199 0.0260  -0.0368 275 ILE A CG2 
421  C CD1 . ILE A 64  ? 0.2612 0.2872 0.2800 -0.0263 0.0249  -0.0414 275 ILE A CD1 
422  N N   . LYS A 65  ? 0.2848 0.3010 0.3035 -0.0178 0.0334  -0.0458 276 LYS A N   
423  C CA  . LYS A 65  ? 0.2943 0.3054 0.3138 -0.0143 0.0356  -0.0448 276 LYS A CA  
424  C C   . LYS A 65  ? 0.2919 0.3094 0.3111 -0.0126 0.0358  -0.0445 276 LYS A C   
425  O O   . LYS A 65  ? 0.2761 0.2932 0.2961 -0.0097 0.0357  -0.0413 276 LYS A O   
426  C CB  . LYS A 65  ? 0.3093 0.3122 0.3292 -0.0142 0.0395  -0.0491 276 LYS A CB  
427  C CG  . LYS A 65  ? 0.3325 0.3299 0.3532 -0.0101 0.0422  -0.0481 276 LYS A CG  
428  C CD  . LYS A 65  ? 0.4010 0.3908 0.4220 -0.0101 0.0466  -0.0531 276 LYS A CD  
429  C CE  . LYS A 65  ? 0.4415 0.4261 0.4635 -0.0053 0.0495  -0.0517 276 LYS A CE  
430  N NZ  . LYS A 65  ? 0.4846 0.4581 0.5078 -0.0046 0.0533  -0.0533 276 LYS A NZ  
431  N N   . ALA A 66  ? 0.2954 0.3193 0.3134 -0.0144 0.0361  -0.0480 277 ALA A N   
432  C CA  . ALA A 66  ? 0.2995 0.3311 0.3172 -0.0130 0.0363  -0.0476 277 ALA A CA  
433  C C   . ALA A 66  ? 0.2870 0.3246 0.3054 -0.0127 0.0328  -0.0417 277 ALA A C   
434  O O   . ALA A 66  ? 0.2946 0.3357 0.3138 -0.0105 0.0328  -0.0391 277 ALA A O   
435  C CB  . ALA A 66  ? 0.2889 0.3272 0.3046 -0.0153 0.0372  -0.0529 277 ALA A CB  
436  N N   . GLY A 67  ? 0.2753 0.3139 0.2938 -0.0148 0.0300  -0.0393 278 GLY A N   
437  C CA  . GLY A 67  ? 0.2586 0.3004 0.2781 -0.0145 0.0270  -0.0337 278 GLY A CA  
438  C C   . GLY A 67  ? 0.2609 0.2976 0.2818 -0.0120 0.0268  -0.0307 278 GLY A C   
439  O O   . GLY A 67  ? 0.2419 0.2826 0.2640 -0.0109 0.0255  -0.0272 278 GLY A O   
440  N N   . TYR A 68  ? 0.2588 0.2869 0.2797 -0.0111 0.0280  -0.0317 279 TYR A N   
441  C CA  . TYR A 68  ? 0.2500 0.2739 0.2721 -0.0084 0.0276  -0.0285 279 TYR A CA  
442  C C   . TYR A 68  ? 0.2611 0.2875 0.2840 -0.0057 0.0295  -0.0283 279 TYR A C   
443  O O   . TYR A 68  ? 0.2514 0.2798 0.2756 -0.0040 0.0282  -0.0247 279 TYR A O   
444  C CB  . TYR A 68  ? 0.2498 0.2646 0.2716 -0.0075 0.0292  -0.0296 279 TYR A CB  
445  C CG  . TYR A 68  ? 0.2397 0.2515 0.2611 -0.0091 0.0272  -0.0284 279 TYR A CG  
446  C CD1 . TYR A 68  ? 0.2414 0.2538 0.2632 -0.0087 0.0242  -0.0245 279 TYR A CD1 
447  C CD2 . TYR A 68  ? 0.2421 0.2504 0.2629 -0.0110 0.0283  -0.0312 279 TYR A CD2 
448  C CE1 . TYR A 68  ? 0.2499 0.2591 0.2711 -0.0098 0.0226  -0.0236 279 TYR A CE1 
449  C CE2 . TYR A 68  ? 0.2554 0.2611 0.2759 -0.0122 0.0267  -0.0300 279 TYR A CE2 
450  C CZ  . TYR A 68  ? 0.2556 0.2618 0.2762 -0.0114 0.0239  -0.0263 279 TYR A CZ  
451  O OH  . TYR A 68  ? 0.2495 0.2532 0.2696 -0.0122 0.0226  -0.0253 279 TYR A OH  
452  N N   . GLN A 69  ? 0.2632 0.2894 0.2854 -0.0052 0.0325  -0.0324 280 GLN A N   
453  C CA  . GLN A 69  ? 0.2789 0.3073 0.3018 -0.0022 0.0350  -0.0329 280 GLN A CA  
454  C C   . GLN A 69  ? 0.2635 0.3017 0.2871 -0.0023 0.0332  -0.0302 280 GLN A C   
455  O O   . GLN A 69  ? 0.2642 0.3050 0.2893 0.0004  0.0336  -0.0278 280 GLN A O   
456  C CB  . GLN A 69  ? 0.2875 0.3135 0.3091 -0.0021 0.0386  -0.0387 280 GLN A CB  
457  C CG  . GLN A 69  ? 0.3218 0.3370 0.3436 -0.0007 0.0414  -0.0406 280 GLN A CG  
458  C CD  . GLN A 69  ? 0.3850 0.3963 0.4058 -0.0015 0.0449  -0.0468 280 GLN A CD  
459  O OE1 . GLN A 69  ? 0.4215 0.4382 0.4410 -0.0042 0.0447  -0.0503 280 GLN A OE1 
460  N NE2 . GLN A 69  ? 0.3976 0.3994 0.4191 0.0006  0.0483  -0.0482 280 GLN A NE2 
461  N N   . SER A 70  ? 0.2587 0.3031 0.2815 -0.0053 0.0314  -0.0303 281 SER A N   
462  C CA  . SER A 70  ? 0.2516 0.3056 0.2755 -0.0056 0.0297  -0.0270 281 SER A CA  
463  C C   . SER A 70  ? 0.2428 0.2968 0.2687 -0.0058 0.0267  -0.0219 281 SER A C   
464  O O   . SER A 70  ? 0.2378 0.2975 0.2655 -0.0048 0.0261  -0.0188 281 SER A O   
465  C CB  . SER A 70  ? 0.2431 0.3038 0.2657 -0.0086 0.0285  -0.0276 281 SER A CB  
466  O OG  . SER A 70  ? 0.2830 0.3441 0.3036 -0.0086 0.0312  -0.0330 281 SER A OG  
467  N N   . LEU A 71  ? 0.2356 0.2833 0.2612 -0.0070 0.0249  -0.0211 282 LEU A N   
468  C CA  . LEU A 71  ? 0.2335 0.2805 0.2607 -0.0072 0.0221  -0.0169 282 LEU A CA  
469  C C   . LEU A 71  ? 0.2281 0.2740 0.2567 -0.0041 0.0230  -0.0156 282 LEU A C   
470  O O   . LEU A 71  ? 0.2148 0.2643 0.2454 -0.0041 0.0210  -0.0122 282 LEU A O   
471  C CB  . LEU A 71  ? 0.2320 0.2724 0.2584 -0.0086 0.0203  -0.0168 282 LEU A CB  
472  C CG  . LEU A 71  ? 0.2363 0.2787 0.2626 -0.0115 0.0177  -0.0152 282 LEU A CG  
473  C CD1 . LEU A 71  ? 0.2195 0.2544 0.2448 -0.0120 0.0164  -0.0153 282 LEU A CD1 
474  C CD2 . LEU A 71  ? 0.1823 0.2304 0.2108 -0.0126 0.0153  -0.0111 282 LEU A CD2 
475  N N   . LYS A 72  ? 0.2438 0.2846 0.2716 -0.0015 0.0260  -0.0183 283 LYS A N   
476  C CA  . LYS A 72  ? 0.2591 0.2989 0.2882 0.0022  0.0273  -0.0168 283 LYS A CA  
477  C C   . LYS A 72  ? 0.2678 0.3164 0.2986 0.0037  0.0281  -0.0154 283 LYS A C   
478  O O   . LYS A 72  ? 0.2469 0.2993 0.2798 0.0053  0.0271  -0.0122 283 LYS A O   
479  C CB  . LYS A 72  ? 0.2714 0.3030 0.2994 0.0047  0.0308  -0.0197 283 LYS A CB  
480  C CG  . LYS A 72  ? 0.3011 0.3317 0.3303 0.0094  0.0332  -0.0185 283 LYS A CG  
481  C CD  . LYS A 72  ? 0.3458 0.3771 0.3763 0.0108  0.0309  -0.0144 283 LYS A CD  
482  C CE  . LYS A 72  ? 0.3624 0.3903 0.3935 0.0157  0.0337  -0.0132 283 LYS A CE  
483  N NZ  . LYS A 72  ? 0.3807 0.4146 0.4135 0.0191  0.0358  -0.0125 283 LYS A NZ  
484  N N   . LYS A 73  ? 0.2801 0.3329 0.3101 0.0030  0.0296  -0.0178 284 LYS A N   
485  C CA  . LYS A 73  ? 0.2848 0.3467 0.3163 0.0043  0.0305  -0.0166 284 LYS A CA  
486  C C   . LYS A 73  ? 0.2739 0.3431 0.3077 0.0020  0.0270  -0.0120 284 LYS A C   
487  O O   . LYS A 73  ? 0.2656 0.3411 0.3018 0.0035  0.0269  -0.0092 284 LYS A O   
488  C CB  . LYS A 73  ? 0.2972 0.3628 0.3270 0.0037  0.0326  -0.0201 284 LYS A CB  
489  C CG  . LYS A 73  ? 0.3444 0.4041 0.3725 0.0065  0.0367  -0.0250 284 LYS A CG  
490  C CD  . LYS A 73  ? 0.3918 0.4581 0.4185 0.0063  0.0388  -0.0284 284 LYS A CD  
491  C CE  . LYS A 73  ? 0.4190 0.4786 0.4435 0.0076  0.0426  -0.0344 284 LYS A CE  
492  N NZ  . LYS A 73  ? 0.4174 0.4789 0.4394 0.0041  0.0423  -0.0385 284 LYS A NZ  
493  N N   . ILE A 74  ? 0.2551 0.3233 0.2883 -0.0017 0.0244  -0.0112 285 ILE A N   
494  C CA  . ILE A 74  ? 0.2492 0.3220 0.2847 -0.0043 0.0210  -0.0070 285 ILE A CA  
495  C C   . ILE A 74  ? 0.2437 0.3145 0.2810 -0.0033 0.0193  -0.0046 285 ILE A C   
496  O O   . ILE A 74  ? 0.2318 0.3093 0.2721 -0.0037 0.0180  -0.0014 285 ILE A O   
497  C CB  . ILE A 74  ? 0.2443 0.3146 0.2787 -0.0079 0.0187  -0.0066 285 ILE A CB  
498  C CG1 . ILE A 74  ? 0.2559 0.3310 0.2887 -0.0091 0.0200  -0.0083 285 ILE A CG1 
499  C CG2 . ILE A 74  ? 0.2238 0.2968 0.2608 -0.0104 0.0154  -0.0024 285 ILE A CG2 
500  C CD1 . ILE A 74  ? 0.2457 0.3189 0.2773 -0.0120 0.0181  -0.0081 285 ILE A CD1 
501  N N   . GLU A 75  ? 0.2470 0.3095 0.2829 -0.0019 0.0195  -0.0061 286 GLU A N   
502  C CA  . GLU A 75  ? 0.2384 0.2997 0.2756 -0.0005 0.0181  -0.0040 286 GLU A CA  
503  C C   . GLU A 75  ? 0.2450 0.3129 0.2845 0.0027  0.0197  -0.0026 286 GLU A C   
504  O O   . GLU A 75  ? 0.2256 0.2990 0.2676 0.0024  0.0176  0.0004  286 GLU A O   
505  C CB  . GLU A 75  ? 0.2404 0.2926 0.2755 0.0013  0.0187  -0.0057 286 GLU A CB  
506  C CG  . GLU A 75  ? 0.2572 0.3091 0.2934 0.0024  0.0167  -0.0034 286 GLU A CG  
507  C CD  . GLU A 75  ? 0.2842 0.3277 0.3182 0.0046  0.0177  -0.0046 286 GLU A CD  
508  O OE1 . GLU A 75  ? 0.2996 0.3405 0.3330 0.0081  0.0209  -0.0054 286 GLU A OE1 
509  O OE2 . GLU A 75  ? 0.2856 0.3253 0.3185 0.0030  0.0153  -0.0044 286 GLU A OE2 
510  N N   . ASP A 76  ? 0.2516 0.3192 0.2901 0.0057  0.0234  -0.0048 287 ASP A N   
511  C CA  . ASP A 76  ? 0.2721 0.3456 0.3125 0.0095  0.0255  -0.0037 287 ASP A CA  
512  C C   . ASP A 76  ? 0.2735 0.3583 0.3169 0.0079  0.0240  -0.0007 287 ASP A C   
513  O O   . ASP A 76  ? 0.2545 0.3453 0.3005 0.0096  0.0236  0.0020  287 ASP A O   
514  C CB  . ASP A 76  ? 0.2833 0.3541 0.3219 0.0127  0.0299  -0.0072 287 ASP A CB  
515  C CG  . ASP A 76  ? 0.3017 0.3616 0.3382 0.0146  0.0320  -0.0098 287 ASP A CG  
516  O OD1 . ASP A 76  ? 0.3277 0.3832 0.3642 0.0152  0.0306  -0.0082 287 ASP A OD1 
517  O OD2 . ASP A 76  ? 0.3423 0.3980 0.3769 0.0155  0.0351  -0.0136 287 ASP A OD2 
518  N N   . CYS A 77  ? 0.2850 0.3730 0.3280 0.0046  0.0233  -0.0009 288 CYS A N   
519  C CA  . CYS A 77  ? 0.3000 0.3985 0.3459 0.0025  0.0221  0.0023  288 CYS A CA  
520  C C   . CYS A 77  ? 0.2952 0.3961 0.3441 -0.0001 0.0183  0.0059  288 CYS A C   
521  O O   . CYS A 77  ? 0.3063 0.4156 0.3587 0.0004  0.0178  0.0087  288 CYS A O   
522  C CB  . CYS A 77  ? 0.2989 0.3998 0.3437 -0.0007 0.0218  0.0019  288 CYS A CB  
523  S SG  . CYS A 77  ? 0.3642 0.4668 0.4062 0.0018  0.0260  -0.0021 288 CYS A SG  
524  N N   . ILE A 78  ? 0.2888 0.3827 0.3365 -0.0030 0.0158  0.0055  289 ILE A N   
525  C CA  . ILE A 78  ? 0.2904 0.3851 0.3406 -0.0057 0.0122  0.0081  289 ILE A CA  
526  C C   . ILE A 78  ? 0.2982 0.3954 0.3499 -0.0026 0.0121  0.0090  289 ILE A C   
527  O O   . ILE A 78  ? 0.3058 0.4105 0.3611 -0.0039 0.0103  0.0117  289 ILE A O   
528  C CB  . ILE A 78  ? 0.2866 0.3722 0.3348 -0.0082 0.0099  0.0069  289 ILE A CB  
529  C CG1 . ILE A 78  ? 0.2915 0.3763 0.3389 -0.0114 0.0095  0.0070  289 ILE A CG1 
530  C CG2 . ILE A 78  ? 0.2966 0.3826 0.3470 -0.0106 0.0063  0.0088  289 ILE A CG2 
531  C CD1 . ILE A 78  ? 0.2721 0.3472 0.3165 -0.0125 0.0085  0.0050  289 ILE A CD1 
532  N N   . ARG A 79  ? 0.3066 0.3982 0.3559 0.0015  0.0143  0.0069  290 ARG A N   
533  C CA  . ARG A 79  ? 0.3287 0.4225 0.3792 0.0050  0.0145  0.0081  290 ARG A CA  
534  C C   . ARG A 79  ? 0.3440 0.4492 0.3979 0.0072  0.0158  0.0105  290 ARG A C   
535  O O   . ARG A 79  ? 0.3394 0.4511 0.3960 0.0076  0.0141  0.0129  290 ARG A O   
536  C CB  . ARG A 79  ? 0.3278 0.4130 0.3751 0.0093  0.0173  0.0058  290 ARG A CB  
537  C CG  . ARG A 79  ? 0.3513 0.4358 0.3987 0.0127  0.0170  0.0071  290 ARG A CG  
538  C CD  . ARG A 79  ? 0.3725 0.4479 0.4170 0.0169  0.0205  0.0051  290 ARG A CD  
539  N NE  . ARG A 79  ? 0.3926 0.4580 0.4340 0.0148  0.0199  0.0028  290 ARG A NE  
540  C CZ  . ARG A 79  ? 0.4136 0.4754 0.4539 0.0135  0.0173  0.0032  290 ARG A CZ  
541  N NH1 . ARG A 79  ? 0.3985 0.4660 0.4404 0.0139  0.0147  0.0056  290 ARG A NH1 
542  N NH2 . ARG A 79  ? 0.4101 0.4633 0.4476 0.0119  0.0172  0.0011  290 ARG A NH2 
543  N N   . ALA A 80  ? 0.3660 0.4742 0.4197 0.0085  0.0188  0.0096  291 ALA A N   
544  C CA  . ALA A 80  ? 0.3846 0.5039 0.4414 0.0109  0.0205  0.0118  291 ALA A CA  
545  C C   . ALA A 80  ? 0.3963 0.5255 0.4567 0.0065  0.0181  0.0148  291 ALA A C   
546  O O   . ALA A 80  ? 0.4107 0.5500 0.4739 0.0080  0.0195  0.0168  291 ALA A O   
547  C CB  . ALA A 80  ? 0.3844 0.5028 0.4391 0.0147  0.0250  0.0093  291 ALA A CB  
548  N N   . GLY A 81  ? 0.4217 0.5481 0.4824 0.0013  0.0149  0.0154  292 GLY A N   
549  C CA  . GLY A 81  ? 0.4458 0.5803 0.5102 -0.0034 0.0127  0.0185  292 GLY A CA  
550  C C   . GLY A 81  ? 0.4719 0.6113 0.5361 -0.0039 0.0150  0.0188  292 GLY A C   
551  O O   . GLY A 81  ? 0.4685 0.6164 0.5362 -0.0070 0.0140  0.0221  292 GLY A O   
552  N N   . GLN A 82  ? 0.5044 0.6387 0.5647 -0.0009 0.0180  0.0155  293 GLN A N   
553  C CA  . GLN A 82  ? 0.5290 0.6679 0.5881 -0.0007 0.0204  0.0150  293 GLN A CA  
554  C C   . GLN A 82  ? 0.5430 0.6785 0.6009 -0.0052 0.0187  0.0152  293 GLN A C   
555  O O   . GLN A 82  ? 0.5632 0.6889 0.6181 -0.0059 0.0180  0.0126  293 GLN A O   
556  C CB  . GLN A 82  ? 0.5341 0.6677 0.5890 0.0036  0.0241  0.0105  293 GLN A CB  
557  C CG  . GLN A 82  ? 0.5588 0.6958 0.6143 0.0091  0.0272  0.0098  293 GLN A CG  
558  C CD  . GLN A 82  ? 0.5958 0.7232 0.6472 0.0128  0.0304  0.0049  293 GLN A CD  
559  O OE1 . GLN A 82  ? 0.6300 0.7492 0.6782 0.0108  0.0301  0.0020  293 GLN A OE1 
560  N NE2 . GLN A 82  ? 0.6224 0.7506 0.6740 0.0181  0.0335  0.0040  293 GLN A NE2 
561  N N   . HIS A 83  ? 0.5614 0.7055 0.6218 -0.0079 0.0182  0.0184  294 HIS A N   
562  C CA  . HIS A 83  ? 0.5668 0.7092 0.6256 -0.0111 0.0176  0.0188  294 HIS A CA  
563  C C   . HIS A 83  ? 0.5654 0.7172 0.6234 -0.0093 0.0207  0.0189  294 HIS A C   
564  O O   . HIS A 83  ? 0.5494 0.7072 0.6081 -0.0057 0.0230  0.0184  294 HIS A O   
565  C CB  . HIS A 83  ? 0.5706 0.7136 0.6332 -0.0162 0.0141  0.0230  294 HIS A CB  
566  C CG  . HIS A 83  ? 0.5943 0.7297 0.6577 -0.0171 0.0114  0.0223  294 HIS A CG  
567  N ND1 . HIS A 83  ? 0.6214 0.7525 0.6830 -0.0134 0.0122  0.0194  294 HIS A ND1 
568  C CD2 . HIS A 83  ? 0.6344 0.7660 0.7000 -0.0211 0.0081  0.0242  294 HIS A CD2 
569  C CE1 . HIS A 83  ? 0.6337 0.7595 0.6962 -0.0150 0.0094  0.0195  294 HIS A CE1 
570  N NE2 . HIS A 83  ? 0.6481 0.7738 0.7130 -0.0197 0.0068  0.0220  294 HIS A NE2 
571  N N   . GLY A 84  ? 0.5652 0.7183 0.6213 -0.0112 0.0209  0.0192  295 GLY A N   
572  C CA  . GLY A 84  ? 0.5624 0.7240 0.6167 -0.0091 0.0240  0.0181  295 GLY A CA  
573  C C   . GLY A 84  ? 0.5559 0.7123 0.6057 -0.0049 0.0269  0.0118  295 GLY A C   
574  O O   . GLY A 84  ? 0.5483 0.6938 0.5955 -0.0047 0.0263  0.0085  295 GLY A O   
575  N N   . ARG A 85  ? 0.5525 0.7164 0.6013 -0.0015 0.0301  0.0102  296 ARG A N   
576  C CA  . ARG A 85  ? 0.5497 0.7103 0.5936 0.0013  0.0331  0.0041  296 ARG A CA  
577  C C   . ARG A 85  ? 0.5406 0.6873 0.5818 0.0023  0.0331  -0.0007 296 ARG A C   
578  O O   . ARG A 85  ? 0.5293 0.6711 0.5670 0.0013  0.0333  -0.0044 296 ARG A O   
579  C CB  . ARG A 85  ? 0.5520 0.7205 0.5954 0.0058  0.0369  0.0021  296 ARG A CB  
580  C CG  . ARG A 85  ? 0.5736 0.7415 0.6118 0.0072  0.0396  -0.0039 296 ARG A CG  
581  C CD  . ARG A 85  ? 0.6025 0.7766 0.6394 0.0119  0.0438  -0.0072 296 ARG A CD  
582  N NE  . ARG A 85  ? 0.6166 0.7872 0.6484 0.0131  0.0462  -0.0143 296 ARG A NE  
583  C CZ  . ARG A 85  ? 0.6385 0.8136 0.6680 0.0169  0.0501  -0.0186 296 ARG A CZ  
584  N NH1 . ARG A 85  ? 0.6484 0.8320 0.6804 0.0204  0.0520  -0.0162 296 ARG A NH1 
585  N NH2 . ARG A 85  ? 0.6540 0.8256 0.6790 0.0174  0.0520  -0.0255 296 ARG A NH2 
586  N N   . ALA A 86  ? 0.5306 0.6718 0.5735 0.0044  0.0330  -0.0006 297 ALA A N   
587  C CA  . ALA A 86  ? 0.5258 0.6544 0.5662 0.0059  0.0337  -0.0049 297 ALA A CA  
588  C C   . ALA A 86  ? 0.5106 0.6320 0.5500 0.0017  0.0305  -0.0046 297 ALA A C   
589  O O   . ALA A 86  ? 0.4865 0.6012 0.5226 0.0013  0.0313  -0.0087 297 ALA A O   
590  C CB  . ALA A 86  ? 0.5234 0.6484 0.5660 0.0092  0.0341  -0.0039 297 ALA A CB  
591  N N   . LEU A 87  ? 0.5090 0.6327 0.5512 -0.0014 0.0273  0.0003  298 LEU A N   
592  C CA  . LEU A 87  ? 0.5056 0.6235 0.5474 -0.0052 0.0242  0.0013  298 LEU A CA  
593  C C   . LEU A 87  ? 0.5065 0.6261 0.5457 -0.0072 0.0244  0.0001  298 LEU A C   
594  O O   . LEU A 87  ? 0.5008 0.6129 0.5373 -0.0081 0.0240  -0.0029 298 LEU A O   
595  C CB  . LEU A 87  ? 0.5035 0.6249 0.5495 -0.0081 0.0210  0.0068  298 LEU A CB  
596  C CG  . LEU A 87  ? 0.5020 0.6165 0.5480 -0.0117 0.0178  0.0081  298 LEU A CG  
597  C CD1 . LEU A 87  ? 0.4961 0.5991 0.5391 -0.0106 0.0178  0.0041  298 LEU A CD1 
598  C CD2 . LEU A 87  ? 0.4769 0.5929 0.5271 -0.0142 0.0150  0.0125  298 LEU A CD2 
599  N N   . MET A 88  ? 0.5037 0.6339 0.5439 -0.0081 0.0248  0.0027  299 MET A N   
600  C CA  . MET A 88  ? 0.5008 0.6356 0.5385 -0.0096 0.0252  0.0020  299 MET A CA  
601  C C   . MET A 88  ? 0.5002 0.6297 0.5335 -0.0078 0.0274  -0.0047 299 MET A C   
602  O O   . MET A 88  ? 0.4770 0.6010 0.5082 -0.0094 0.0264  -0.0066 299 MET A O   
603  C CB  . MET A 88  ? 0.5125 0.6606 0.5514 -0.0091 0.0266  0.0049  299 MET A CB  
604  C CG  . MET A 88  ? 0.5338 0.6889 0.5696 -0.0096 0.0277  0.0037  299 MET A CG  
605  S SD  . MET A 88  ? 0.5970 0.7666 0.6325 -0.0070 0.0310  0.0038  299 MET A SD  
606  C CE  . MET A 88  ? 0.5505 0.7142 0.5838 -0.0023 0.0343  -0.0035 299 MET A CE  
607  N N   . GLU A 89  ? 0.5042 0.6351 0.5365 -0.0043 0.0305  -0.0082 300 GLU A N   
608  C CA  . GLU A 89  ? 0.5238 0.6484 0.5524 -0.0026 0.0329  -0.0151 300 GLU A CA  
609  C C   . GLU A 89  ? 0.5177 0.6300 0.5454 -0.0039 0.0315  -0.0170 300 GLU A C   
610  O O   . GLU A 89  ? 0.5164 0.6252 0.5412 -0.0051 0.0319  -0.0210 300 GLU A O   
611  C CB  . GLU A 89  ? 0.5349 0.6595 0.5634 0.0017  0.0365  -0.0182 300 GLU A CB  
612  C CG  . GLU A 89  ? 0.5636 0.6997 0.5909 0.0034  0.0390  -0.0195 300 GLU A CG  
613  C CD  . GLU A 89  ? 0.6041 0.7394 0.6309 0.0082  0.0429  -0.0231 300 GLU A CD  
614  O OE1 . GLU A 89  ? 0.6145 0.7399 0.6419 0.0103  0.0439  -0.0249 300 GLU A OE1 
615  O OE2 . GLU A 89  ? 0.6226 0.7677 0.6488 0.0101  0.0451  -0.0238 300 GLU A OE2 
616  N N   . ALA A 90  ? 0.5067 0.6134 0.5369 -0.0039 0.0297  -0.0139 301 ALA A N   
617  C CA  . ALA A 90  ? 0.4950 0.5911 0.5249 -0.0051 0.0280  -0.0145 301 ALA A CA  
618  C C   . ALA A 90  ? 0.4761 0.5714 0.5055 -0.0088 0.0251  -0.0125 301 ALA A C   
619  O O   . ALA A 90  ? 0.4816 0.5719 0.5088 -0.0098 0.0252  -0.0157 301 ALA A O   
620  C CB  . ALA A 90  ? 0.4944 0.5870 0.5271 -0.0038 0.0269  -0.0114 301 ALA A CB  
621  N N   . CYS A 91  ? 0.4576 0.5577 0.4895 -0.0108 0.0226  -0.0073 302 CYS A N   
622  C CA  . CYS A 91  ? 0.4510 0.5496 0.4829 -0.0138 0.0199  -0.0049 302 CYS A CA  
623  C C   . CYS A 91  ? 0.4567 0.5599 0.4861 -0.0150 0.0205  -0.0066 302 CYS A C   
624  O O   . CYS A 91  ? 0.4496 0.5480 0.4772 -0.0162 0.0197  -0.0083 302 CYS A O   
625  C CB  . CYS A 91  ? 0.4505 0.5537 0.4860 -0.0158 0.0176  0.0011  302 CYS A CB  
626  S SG  . CYS A 91  ? 0.4372 0.5326 0.4757 -0.0167 0.0148  0.0039  302 CYS A SG  
627  N N   . ASN A 92  ? 0.4580 0.5714 0.4871 -0.0147 0.0218  -0.0059 303 ASN A N   
628  C CA  . ASN A 92  ? 0.4546 0.5741 0.4809 -0.0156 0.0224  -0.0076 303 ASN A CA  
629  C C   . ASN A 92  ? 0.4372 0.5516 0.4602 -0.0147 0.0243  -0.0147 303 ASN A C   
630  O O   . ASN A 92  ? 0.4432 0.5586 0.4641 -0.0162 0.0238  -0.0167 303 ASN A O   
631  C CB  . ASN A 92  ? 0.4575 0.5897 0.4840 -0.0150 0.0238  -0.0057 303 ASN A CB  
632  C CG  . ASN A 92  ? 0.4963 0.6330 0.5268 -0.0158 0.0224  0.0011  303 ASN A CG  
633  O OD1 . ASN A 92  ? 0.5558 0.6871 0.5891 -0.0156 0.0215  0.0029  303 ASN A OD1 
634  N ND2 . ASN A 92  ? 0.5655 0.7124 0.5965 -0.0169 0.0222  0.0052  303 ASN A ND2 
635  N N   . GLU A 93  ? 0.4109 0.5197 0.4337 -0.0125 0.0263  -0.0183 304 GLU A N   
636  C CA  . GLU A 93  ? 0.3970 0.4992 0.4172 -0.0120 0.0282  -0.0248 304 GLU A CA  
637  C C   . GLU A 93  ? 0.3628 0.4552 0.3830 -0.0136 0.0265  -0.0253 304 GLU A C   
638  O O   . GLU A 93  ? 0.3562 0.4464 0.3743 -0.0148 0.0270  -0.0294 304 GLU A O   
639  C CB  . GLU A 93  ? 0.4152 0.5128 0.4356 -0.0089 0.0311  -0.0281 304 GLU A CB  
640  C CG  . GLU A 93  ? 0.4537 0.5416 0.4722 -0.0086 0.0330  -0.0341 304 GLU A CG  
641  C CD  . GLU A 93  ? 0.5280 0.6093 0.5476 -0.0052 0.0354  -0.0354 304 GLU A CD  
642  O OE1 . GLU A 93  ? 0.5851 0.6715 0.6049 -0.0027 0.0375  -0.0359 304 GLU A OE1 
643  O OE2 . GLU A 93  ? 0.5661 0.6375 0.5863 -0.0048 0.0354  -0.0358 304 GLU A OE2 
644  N N   . PHE A 94  ? 0.3284 0.4154 0.3508 -0.0135 0.0246  -0.0213 305 PHE A N   
645  C CA  . PHE A 94  ? 0.3031 0.3822 0.3254 -0.0149 0.0229  -0.0212 305 PHE A CA  
646  C C   . PHE A 94  ? 0.2847 0.3685 0.3058 -0.0173 0.0214  -0.0207 305 PHE A C   
647  O O   . PHE A 94  ? 0.2632 0.3437 0.2827 -0.0184 0.0216  -0.0239 305 PHE A O   
648  C CB  . PHE A 94  ? 0.2940 0.3690 0.3188 -0.0149 0.0206  -0.0165 305 PHE A CB  
649  C CG  . PHE A 94  ? 0.2755 0.3432 0.3000 -0.0161 0.0187  -0.0161 305 PHE A CG  
650  C CD1 . PHE A 94  ? 0.2356 0.2951 0.2590 -0.0153 0.0199  -0.0195 305 PHE A CD1 
651  C CD2 . PHE A 94  ? 0.2630 0.3319 0.2885 -0.0179 0.0161  -0.0122 305 PHE A CD2 
652  C CE1 . PHE A 94  ? 0.2335 0.2870 0.2567 -0.0162 0.0183  -0.0190 305 PHE A CE1 
653  C CE2 . PHE A 94  ? 0.2481 0.3105 0.2733 -0.0186 0.0145  -0.0119 305 PHE A CE2 
654  C CZ  . PHE A 94  ? 0.2317 0.2867 0.2556 -0.0177 0.0157  -0.0154 305 PHE A CZ  
655  N N   . TYR A 95  ? 0.2732 0.3652 0.2953 -0.0181 0.0201  -0.0163 306 TYR A N   
656  C CA  . TYR A 95  ? 0.2794 0.3765 0.3008 -0.0200 0.0185  -0.0143 306 TYR A CA  
657  C C   . TYR A 95  ? 0.2876 0.3905 0.3061 -0.0206 0.0199  -0.0189 306 TYR A C   
658  O O   . TYR A 95  ? 0.2849 0.3890 0.3024 -0.0220 0.0187  -0.0191 306 TYR A O   
659  C CB  . TYR A 95  ? 0.2764 0.3812 0.2999 -0.0205 0.0172  -0.0081 306 TYR A CB  
660  C CG  . TYR A 95  ? 0.2573 0.3566 0.2838 -0.0209 0.0152  -0.0033 306 TYR A CG  
661  C CD1 . TYR A 95  ? 0.2467 0.3373 0.2735 -0.0215 0.0134  -0.0029 306 TYR A CD1 
662  C CD2 . TYR A 95  ? 0.2718 0.3750 0.3010 -0.0208 0.0149  0.0007  306 TYR A CD2 
663  C CE1 . TYR A 95  ? 0.2390 0.3245 0.2684 -0.0220 0.0116  0.0007  306 TYR A CE1 
664  C CE2 . TYR A 95  ? 0.2330 0.3314 0.2652 -0.0217 0.0129  0.0046  306 TYR A CE2 
665  C CZ  . TYR A 95  ? 0.2459 0.3352 0.2779 -0.0223 0.0112  0.0043  306 TYR A CZ  
666  O OH  . TYR A 95  ? 0.2191 0.3033 0.2538 -0.0232 0.0092  0.0074  306 TYR A OH  
667  N N   . THR A 96  ? 0.2934 0.3997 0.3105 -0.0195 0.0223  -0.0229 307 THR A N   
668  C CA  . THR A 96  ? 0.3030 0.4142 0.3171 -0.0201 0.0239  -0.0286 307 THR A CA  
669  C C   . THR A 96  ? 0.3085 0.4107 0.3218 -0.0211 0.0244  -0.0336 307 THR A C   
670  O O   . THR A 96  ? 0.3080 0.4135 0.3196 -0.0229 0.0241  -0.0365 307 THR A O   
671  C CB  . THR A 96  ? 0.3113 0.4268 0.3243 -0.0182 0.0268  -0.0321 307 THR A CB  
672  O OG1 . THR A 96  ? 0.3329 0.4585 0.3467 -0.0176 0.0264  -0.0273 307 THR A OG1 
673  C CG2 . THR A 96  ? 0.2882 0.4073 0.2980 -0.0190 0.0286  -0.0392 307 THR A CG2 
674  N N   . ARG A 97  ? 0.3116 0.4031 0.3262 -0.0199 0.0251  -0.0342 308 ARG A N   
675  C CA  . ARG A 97  ? 0.3137 0.3960 0.3279 -0.0208 0.0258  -0.0383 308 ARG A CA  
676  C C   . ARG A 97  ? 0.2855 0.3645 0.3004 -0.0223 0.0233  -0.0355 308 ARG A C   
677  O O   . ARG A 97  ? 0.2877 0.3636 0.3019 -0.0238 0.0235  -0.0387 308 ARG A O   
678  C CB  . ARG A 97  ? 0.3245 0.3971 0.3397 -0.0185 0.0278  -0.0396 308 ARG A CB  
679  C CG  . ARG A 97  ? 0.3602 0.4340 0.3741 -0.0170 0.0311  -0.0445 308 ARG A CG  
680  C CD  . ARG A 97  ? 0.4041 0.4708 0.4196 -0.0140 0.0328  -0.0437 308 ARG A CD  
681  N NE  . ARG A 97  ? 0.4348 0.5021 0.4493 -0.0121 0.0361  -0.0482 308 ARG A NE  
682  C CZ  . ARG A 97  ? 0.4625 0.5228 0.4779 -0.0091 0.0387  -0.0493 308 ARG A CZ  
683  N NH1 . ARG A 97  ? 0.4849 0.5373 0.5021 -0.0078 0.0381  -0.0460 308 ARG A NH1 
684  N NH2 . ARG A 97  ? 0.4585 0.5197 0.4729 -0.0072 0.0419  -0.0537 308 ARG A NH2 
685  N N   . ILE A 98  ? 0.2606 0.3401 0.2771 -0.0219 0.0211  -0.0296 309 ILE A N   
686  C CA  . ILE A 98  ? 0.2462 0.3224 0.2635 -0.0228 0.0189  -0.0267 309 ILE A CA  
687  C C   . ILE A 98  ? 0.2359 0.3207 0.2538 -0.0233 0.0169  -0.0216 309 ILE A C   
688  O O   . ILE A 98  ? 0.2177 0.3016 0.2374 -0.0227 0.0156  -0.0169 309 ILE A O   
689  C CB  . ILE A 98  ? 0.2354 0.3019 0.2543 -0.0215 0.0183  -0.0245 309 ILE A CB  
690  C CG1 . ILE A 98  ? 0.2560 0.3144 0.2745 -0.0204 0.0207  -0.0288 309 ILE A CG1 
691  C CG2 . ILE A 98  ? 0.2536 0.3165 0.2732 -0.0222 0.0159  -0.0214 309 ILE A CG2 
692  C CD1 . ILE A 98  ? 0.2024 0.2583 0.2197 -0.0218 0.0221  -0.0337 309 ILE A CD1 
693  N N   . PRO A 99  ? 0.2420 0.3353 0.2584 -0.0246 0.0167  -0.0227 310 PRO A N   
694  C CA  . PRO A 99  ? 0.2368 0.3394 0.2536 -0.0248 0.0153  -0.0176 310 PRO A CA  
695  C C   . PRO A 99  ? 0.2325 0.3313 0.2513 -0.0247 0.0130  -0.0118 310 PRO A C   
696  O O   . PRO A 99  ? 0.2161 0.3091 0.2351 -0.0250 0.0121  -0.0122 310 PRO A O   
697  C CB  . PRO A 99  ? 0.2550 0.3660 0.2696 -0.0261 0.0154  -0.0206 310 PRO A CB  
698  C CG  . PRO A 99  ? 0.2670 0.3750 0.2799 -0.0267 0.0177  -0.0282 310 PRO A CG  
699  C CD  . PRO A 99  ? 0.2432 0.3383 0.2577 -0.0260 0.0179  -0.0285 310 PRO A CD  
700  N N   . HIS A 100 ? 0.2165 0.3184 0.2371 -0.0243 0.0122  -0.0064 311 HIS A N   
701  C CA  . HIS A 100 ? 0.2143 0.3130 0.2371 -0.0243 0.0102  -0.0006 311 HIS A CA  
702  C C   . HIS A 100 ? 0.2313 0.3401 0.2543 -0.0246 0.0095  0.0041  311 HIS A C   
703  O O   . HIS A 100 ? 0.2336 0.3524 0.2554 -0.0247 0.0106  0.0036  311 HIS A O   
704  C CB  . HIS A 100 ? 0.2082 0.3015 0.2335 -0.0241 0.0096  0.0023  311 HIS A CB  
705  C CG  . HIS A 100 ? 0.2144 0.2972 0.2398 -0.0235 0.0097  -0.0008 311 HIS A CG  
706  N ND1 . HIS A 100 ? 0.2073 0.2875 0.2310 -0.0229 0.0114  -0.0063 311 HIS A ND1 
707  C CD2 . HIS A 100 ? 0.2246 0.2992 0.2517 -0.0233 0.0083  0.0011  311 HIS A CD2 
708  C CE1 . HIS A 100 ? 0.2179 0.2892 0.2423 -0.0222 0.0112  -0.0072 311 HIS A CE1 
709  N NE2 . HIS A 100 ? 0.1872 0.2553 0.2135 -0.0225 0.0092  -0.0030 311 HIS A NE2 
710  N N   . ASP A 101 ? 0.2326 0.3388 0.2572 -0.0245 0.0079  0.0089  312 ASP A N   
711  C CA  . ASP A 101 ? 0.2397 0.3546 0.2651 -0.0244 0.0074  0.0145  312 ASP A CA  
712  C C   . ASP A 101 ? 0.2380 0.3489 0.2666 -0.0246 0.0065  0.0205  312 ASP A C   
713  O O   . ASP A 101 ? 0.2318 0.3350 0.2621 -0.0244 0.0053  0.0230  312 ASP A O   
714  C CB  . ASP A 101 ? 0.2453 0.3608 0.2700 -0.0239 0.0064  0.0155  312 ASP A CB  
715  C CG  . ASP A 101 ? 0.2910 0.4169 0.3163 -0.0233 0.0061  0.0217  312 ASP A CG  
716  O OD1 . ASP A 101 ? 0.3049 0.4350 0.3318 -0.0235 0.0064  0.0263  312 ASP A OD1 
717  O OD2 . ASP A 101 ? 0.3246 0.4551 0.3490 -0.0227 0.0056  0.0223  312 ASP A OD2 
718  N N   . PHE A 102 ? 0.2252 0.3416 0.2550 -0.0251 0.0073  0.0226  313 PHE A N   
719  C CA  . PHE A 102 ? 0.2297 0.3438 0.2632 -0.0258 0.0066  0.0287  313 PHE A CA  
720  C C   . PHE A 102 ? 0.2330 0.3560 0.2677 -0.0258 0.0067  0.0356  313 PHE A C   
721  O O   . PHE A 102 ? 0.2246 0.3477 0.2626 -0.0266 0.0065  0.0409  313 PHE A O   
722  C CB  . PHE A 102 ? 0.2303 0.3445 0.2650 -0.0264 0.0073  0.0275  313 PHE A CB  
723  C CG  . PHE A 102 ? 0.2340 0.3387 0.2682 -0.0262 0.0072  0.0221  313 PHE A CG  
724  C CD1 . PHE A 102 ? 0.2384 0.3322 0.2741 -0.0266 0.0056  0.0226  313 PHE A CD1 
725  C CD2 . PHE A 102 ? 0.2323 0.3389 0.2643 -0.0254 0.0087  0.0167  313 PHE A CD2 
726  C CE1 . PHE A 102 ? 0.2650 0.3509 0.3001 -0.0262 0.0055  0.0181  313 PHE A CE1 
727  C CE2 . PHE A 102 ? 0.2534 0.3513 0.2849 -0.0249 0.0087  0.0123  313 PHE A CE2 
728  C CZ  . PHE A 102 ? 0.2566 0.3446 0.2897 -0.0253 0.0071  0.0132  313 PHE A CZ  
729  N N   . GLY A 103 ? 0.2377 0.3684 0.2700 -0.0248 0.0069  0.0356  314 GLY A N   
730  C CA  . GLY A 103 ? 0.2479 0.3888 0.2811 -0.0243 0.0072  0.0422  314 GLY A CA  
731  C C   . GLY A 103 ? 0.2551 0.4047 0.2890 -0.0249 0.0085  0.0444  314 GLY A C   
732  O O   . GLY A 103 ? 0.2690 0.4226 0.3008 -0.0249 0.0095  0.0393  314 GLY A O   
733  N N   . LEU A 104 ? 0.2444 0.3961 0.2818 -0.0254 0.0085  0.0521  315 LEU A N   
734  C CA  . LEU A 104 ? 0.2436 0.4048 0.2822 -0.0260 0.0098  0.0554  315 LEU A CA  
735  C C   . LEU A 104 ? 0.2364 0.3915 0.2782 -0.0277 0.0098  0.0552  315 LEU A C   
736  O O   . LEU A 104 ? 0.2222 0.3847 0.2655 -0.0283 0.0109  0.0581  315 LEU A O   
737  C CB  . LEU A 104 ? 0.2474 0.4151 0.2884 -0.0257 0.0101  0.0647  315 LEU A CB  
738  C CG  . LEU A 104 ? 0.2588 0.4356 0.2963 -0.0238 0.0102  0.0648  315 LEU A CG  
739  C CD1 . LEU A 104 ? 0.2849 0.4641 0.3249 -0.0229 0.0100  0.0739  315 LEU A CD1 
740  C CD2 . LEU A 104 ? 0.2992 0.4909 0.3332 -0.0232 0.0116  0.0621  315 LEU A CD2 
741  N N   . ARG A 105 ? 0.2300 0.3722 0.2727 -0.0283 0.0086  0.0517  316 ARG A N   
742  C CA  . ARG A 105 ? 0.2333 0.3690 0.2792 -0.0300 0.0082  0.0516  316 ARG A CA  
743  C C   . ARG A 105 ? 0.2304 0.3690 0.2742 -0.0294 0.0093  0.0454  316 ARG A C   
744  O O   . ARG A 105 ? 0.2226 0.3616 0.2624 -0.0280 0.0098  0.0393  316 ARG A O   
745  C CB  . ARG A 105 ? 0.2390 0.3605 0.2857 -0.0304 0.0065  0.0496  316 ARG A CB  
746  C CG  . ARG A 105 ? 0.2703 0.3835 0.3204 -0.0323 0.0055  0.0495  316 ARG A CG  
747  C CD  . ARG A 105 ? 0.3060 0.4062 0.3555 -0.0320 0.0039  0.0462  316 ARG A CD  
748  N NE  . ARG A 105 ? 0.3586 0.4529 0.4093 -0.0331 0.0031  0.0429  316 ARG A NE  
749  C CZ  . ARG A 105 ? 0.3334 0.4195 0.3821 -0.0323 0.0023  0.0376  316 ARG A CZ  
750  N NH1 . ARG A 105 ? 0.3153 0.3975 0.3609 -0.0306 0.0022  0.0349  316 ARG A NH1 
751  N NH2 . ARG A 105 ? 0.3599 0.4424 0.4101 -0.0332 0.0017  0.0354  316 ARG A NH2 
752  N N   . THR A 106 ? 0.2264 0.3671 0.2732 -0.0305 0.0097  0.0470  317 THR A N   
753  C CA  . THR A 106 ? 0.2273 0.3692 0.2728 -0.0297 0.0107  0.0415  317 THR A CA  
754  C C   . THR A 106 ? 0.2346 0.3650 0.2781 -0.0289 0.0098  0.0350  317 THR A C   
755  O O   . THR A 106 ? 0.2249 0.3454 0.2704 -0.0300 0.0081  0.0356  317 THR A O   
756  C CB  . THR A 106 ? 0.2230 0.3662 0.2729 -0.0312 0.0107  0.0444  317 THR A CB  
757  O OG1 . THR A 106 ? 0.2179 0.3696 0.2709 -0.0325 0.0112  0.0517  317 THR A OG1 
758  C CG2 . THR A 106 ? 0.2032 0.3506 0.2516 -0.0295 0.0123  0.0395  317 THR A CG2 
759  N N   . PRO A 107 ? 0.2389 0.3705 0.2783 -0.0271 0.0111  0.0288  318 PRO A N   
760  C CA  . PRO A 107 ? 0.2550 0.3756 0.2932 -0.0265 0.0104  0.0236  318 PRO A CA  
761  C C   . PRO A 107 ? 0.2715 0.3865 0.3126 -0.0270 0.0097  0.0238  318 PRO A C   
762  O O   . PRO A 107 ? 0.2810 0.4019 0.3234 -0.0266 0.0108  0.0241  318 PRO A O   
763  C CB  . PRO A 107 ? 0.2614 0.3851 0.2956 -0.0247 0.0123  0.0174  318 PRO A CB  
764  C CG  . PRO A 107 ? 0.2389 0.3743 0.2714 -0.0246 0.0132  0.0191  318 PRO A CG  
765  C CD  . PRO A 107 ? 0.2377 0.3793 0.2737 -0.0257 0.0129  0.0262  318 PRO A CD  
766  N N   . PRO A 108 ? 0.2890 0.3938 0.3313 -0.0278 0.0078  0.0237  319 PRO A N   
767  C CA  . PRO A 108 ? 0.3114 0.4125 0.3569 -0.0288 0.0068  0.0247  319 PRO A CA  
768  C C   . PRO A 108 ? 0.3295 0.4286 0.3736 -0.0269 0.0077  0.0199  319 PRO A C   
769  O O   . PRO A 108 ? 0.3374 0.4339 0.3781 -0.0250 0.0088  0.0153  319 PRO A O   
770  C CB  . PRO A 108 ? 0.3162 0.4071 0.3627 -0.0300 0.0045  0.0256  319 PRO A CB  
771  C CG  . PRO A 108 ? 0.2940 0.3813 0.3369 -0.0286 0.0048  0.0227  319 PRO A CG  
772  C CD  . PRO A 108 ? 0.2917 0.3887 0.3327 -0.0279 0.0065  0.0232  319 PRO A CD  
773  N N   . LEU A 109 ? 0.3533 0.4543 0.4003 -0.0273 0.0075  0.0211  320 LEU A N   
774  C CA  . LEU A 109 ? 0.3659 0.4653 0.4121 -0.0251 0.0084  0.0173  320 LEU A CA  
775  C C   . LEU A 109 ? 0.3655 0.4541 0.4107 -0.0248 0.0069  0.0148  320 LEU A C   
776  O O   . LEU A 109 ? 0.3791 0.4622 0.4253 -0.0267 0.0048  0.0165  320 LEU A O   
777  C CB  . LEU A 109 ? 0.3753 0.4806 0.4253 -0.0256 0.0083  0.0199  320 LEU A CB  
778  C CG  . LEU A 109 ? 0.3908 0.5077 0.4417 -0.0246 0.0105  0.0213  320 LEU A CG  
779  C CD1 . LEU A 109 ? 0.4359 0.5569 0.4904 -0.0244 0.0103  0.0228  320 LEU A CD1 
780  C CD2 . LEU A 109 ? 0.3949 0.5138 0.4417 -0.0214 0.0133  0.0168  320 LEU A CD2 
781  N N   . ILE A 110 ? 0.3628 0.4483 0.4057 -0.0222 0.0082  0.0107  321 ILE A N   
782  C CA  . ILE A 110 ? 0.3576 0.4342 0.3997 -0.0214 0.0071  0.0084  321 ILE A CA  
783  C C   . ILE A 110 ? 0.3692 0.4479 0.4135 -0.0205 0.0069  0.0089  321 ILE A C   
784  O O   . ILE A 110 ? 0.3578 0.4408 0.4019 -0.0182 0.0090  0.0077  321 ILE A O   
785  C CB  . ILE A 110 ? 0.3490 0.4207 0.3873 -0.0192 0.0089  0.0039  321 ILE A CB  
786  C CG1 . ILE A 110 ? 0.3368 0.4069 0.3731 -0.0204 0.0087  0.0035  321 ILE A CG1 
787  C CG2 . ILE A 110 ? 0.3557 0.4195 0.3932 -0.0179 0.0083  0.0020  321 ILE A CG2 
788  C CD1 . ILE A 110 ? 0.2919 0.3640 0.3254 -0.0191 0.0111  -0.0001 321 ILE A CD1 
789  N N   . ARG A 111 ? 0.3935 0.4702 0.4402 -0.0224 0.0044  0.0109  322 ARG A N   
790  C CA  . ARG A 111 ? 0.4196 0.5004 0.4690 -0.0220 0.0039  0.0119  322 ARG A CA  
791  C C   . ARG A 111 ? 0.4173 0.4925 0.4671 -0.0223 0.0015  0.0111  322 ARG A C   
792  O O   . ARG A 111 ? 0.4168 0.4958 0.4684 -0.0214 0.0012  0.0115  322 ARG A O   
793  C CB  . ARG A 111 ? 0.4380 0.5277 0.4916 -0.0245 0.0033  0.0160  322 ARG A CB  
794  C CG  . ARG A 111 ? 0.4946 0.5824 0.5507 -0.0285 0.0010  0.0189  322 ARG A CG  
795  C CD  . ARG A 111 ? 0.5775 0.6740 0.6385 -0.0315 0.0004  0.0234  322 ARG A CD  
796  N NE  . ARG A 111 ? 0.6379 0.7445 0.6995 -0.0302 0.0029  0.0250  322 ARG A NE  
797  C CZ  . ARG A 111 ? 0.6851 0.8001 0.7505 -0.0325 0.0031  0.0294  322 ARG A CZ  
798  N NH1 . ARG A 111 ? 0.7026 0.8165 0.7718 -0.0367 0.0009  0.0328  322 ARG A NH1 
799  N NH2 . ARG A 111 ? 0.6845 0.8089 0.7498 -0.0308 0.0056  0.0304  322 ARG A NH2 
800  N N   . THR A 112 ? 0.4183 0.4854 0.4664 -0.0233 0.0000  0.0100  323 THR A N   
801  C CA  . THR A 112 ? 0.4240 0.4860 0.4717 -0.0232 -0.0020 0.0087  323 THR A CA  
802  C C   . THR A 112 ? 0.4206 0.4752 0.4643 -0.0204 -0.0010 0.0055  323 THR A C   
803  O O   . THR A 112 ? 0.4202 0.4723 0.4615 -0.0195 0.0007  0.0042  323 THR A O   
804  C CB  . THR A 112 ? 0.4262 0.4844 0.4757 -0.0269 -0.0050 0.0099  323 THR A CB  
805  O OG1 . THR A 112 ? 0.4463 0.4980 0.4936 -0.0272 -0.0049 0.0093  323 THR A OG1 
806  C CG2 . THR A 112 ? 0.4350 0.4998 0.4890 -0.0303 -0.0059 0.0134  323 THR A CG2 
807  N N   . GLN A 113 ? 0.4101 0.4620 0.4531 -0.0193 -0.0022 0.0043  324 GLN A N   
808  C CA  . GLN A 113 ? 0.3995 0.4445 0.4389 -0.0168 -0.0015 0.0017  324 GLN A CA  
809  C C   . GLN A 113 ? 0.3949 0.4335 0.4324 -0.0180 -0.0018 0.0008  324 GLN A C   
810  O O   . GLN A 113 ? 0.3925 0.4274 0.4273 -0.0162 0.0001  -0.0009 324 GLN A O   
811  C CB  . GLN A 113 ? 0.4012 0.4450 0.4406 -0.0163 -0.0036 0.0012  324 GLN A CB  
812  C CG  . GLN A 113 ? 0.4064 0.4442 0.4422 -0.0133 -0.0028 -0.0009 324 GLN A CG  
813  C CD  . GLN A 113 ? 0.3953 0.4258 0.4289 -0.0144 -0.0037 -0.0022 324 GLN A CD  
814  O OE1 . GLN A 113 ? 0.4289 0.4583 0.4637 -0.0174 -0.0057 -0.0016 324 GLN A OE1 
815  N NE2 . GLN A 113 ? 0.3644 0.3898 0.3949 -0.0120 -0.0021 -0.0038 324 GLN A NE2 
816  N N   . LYS A 114 ? 0.3868 0.4241 0.4258 -0.0209 -0.0041 0.0021  325 LYS A N   
817  C CA  . LYS A 114 ? 0.3866 0.4181 0.4239 -0.0217 -0.0044 0.0016  325 LYS A CA  
818  C C   . LYS A 114 ? 0.3617 0.3954 0.3986 -0.0218 -0.0025 0.0023  325 LYS A C   
819  O O   . LYS A 114 ? 0.3476 0.3774 0.3823 -0.0211 -0.0018 0.0011  325 LYS A O   
820  C CB  . LYS A 114 ? 0.4016 0.4301 0.4407 -0.0245 -0.0072 0.0026  325 LYS A CB  
821  C CG  . LYS A 114 ? 0.4448 0.4753 0.4865 -0.0272 -0.0075 0.0056  325 LYS A CG  
822  C CD  . LYS A 114 ? 0.4901 0.5146 0.5329 -0.0295 -0.0098 0.0061  325 LYS A CD  
823  C CE  . LYS A 114 ? 0.5158 0.5404 0.5602 -0.0311 -0.0093 0.0091  325 LYS A CE  
824  N NZ  . LYS A 114 ? 0.5130 0.5461 0.5591 -0.0315 -0.0077 0.0117  325 LYS A NZ  
825  N N   . GLU A 115 ? 0.3447 0.3854 0.3838 -0.0227 -0.0017 0.0043  326 GLU A N   
826  C CA  . GLU A 115 ? 0.3319 0.3760 0.3701 -0.0225 0.0003  0.0045  326 GLU A CA  
827  C C   . GLU A 115 ? 0.3127 0.3557 0.3481 -0.0198 0.0028  0.0013  326 GLU A C   
828  O O   . GLU A 115 ? 0.2979 0.3395 0.3313 -0.0195 0.0039  -0.0001 326 GLU A O   
829  C CB  . GLU A 115 ? 0.3388 0.3913 0.3798 -0.0238 0.0008  0.0073  326 GLU A CB  
830  C CG  . GLU A 115 ? 0.3718 0.4249 0.4157 -0.0269 -0.0012 0.0110  326 GLU A CG  
831  C CD  . GLU A 115 ? 0.4073 0.4689 0.4549 -0.0286 -0.0011 0.0143  326 GLU A CD  
832  O OE1 . GLU A 115 ? 0.4247 0.4925 0.4723 -0.0271 0.0006  0.0137  326 GLU A OE1 
833  O OE2 . GLU A 115 ? 0.4275 0.4893 0.4779 -0.0314 -0.0025 0.0175  326 GLU A OE2 
834  N N   . LEU A 116 ? 0.2841 0.3276 0.3195 -0.0178 0.0036  0.0001  327 LEU A N   
835  C CA  . LEU A 116 ? 0.2795 0.3203 0.3125 -0.0151 0.0061  -0.0028 327 LEU A CA  
836  C C   . LEU A 116 ? 0.2691 0.3022 0.2996 -0.0147 0.0058  -0.0047 327 LEU A C   
837  O O   . LEU A 116 ? 0.2694 0.3006 0.2981 -0.0142 0.0076  -0.0067 327 LEU A O   
838  C CB  . LEU A 116 ? 0.2788 0.3208 0.3124 -0.0127 0.0070  -0.0031 327 LEU A CB  
839  C CG  . LEU A 116 ? 0.2685 0.3176 0.3037 -0.0116 0.0088  -0.0025 327 LEU A CG  
840  C CD1 . LEU A 116 ? 0.2824 0.3315 0.3180 -0.0086 0.0095  -0.0025 327 LEU A CD1 
841  C CD2 . LEU A 116 ? 0.2691 0.3192 0.3027 -0.0107 0.0117  -0.0048 327 LEU A CD2 
842  N N   . SER A 117 ? 0.2476 0.2769 0.2781 -0.0150 0.0036  -0.0040 328 SER A N   
843  C CA  . SER A 117 ? 0.2392 0.2620 0.2676 -0.0146 0.0031  -0.0054 328 SER A CA  
844  C C   . SER A 117 ? 0.2286 0.2506 0.2562 -0.0160 0.0033  -0.0055 328 SER A C   
845  O O   . SER A 117 ? 0.2181 0.2370 0.2439 -0.0152 0.0045  -0.0073 328 SER A O   
846  C CB  . SER A 117 ? 0.2520 0.2719 0.2807 -0.0152 0.0005  -0.0047 328 SER A CB  
847  O OG  . SER A 117 ? 0.2501 0.2641 0.2766 -0.0147 0.0001  -0.0059 328 SER A OG  
848  N N   . GLU A 118 ? 0.2212 0.2467 0.2505 -0.0180 0.0022  -0.0033 329 GLU A N   
849  C CA  . GLU A 118 ? 0.2245 0.2502 0.2532 -0.0190 0.0022  -0.0029 329 GLU A CA  
850  C C   . GLU A 118 ? 0.2155 0.2444 0.2429 -0.0184 0.0046  -0.0048 329 GLU A C   
851  O O   . GLU A 118 ? 0.1896 0.2168 0.2156 -0.0184 0.0051  -0.0061 329 GLU A O   
852  C CB  . GLU A 118 ? 0.2338 0.2631 0.2649 -0.0210 0.0008  0.0005  329 GLU A CB  
853  C CG  . GLU A 118 ? 0.3023 0.3267 0.3345 -0.0219 -0.0016 0.0018  329 GLU A CG  
854  C CD  . GLU A 118 ? 0.3636 0.3910 0.3991 -0.0241 -0.0029 0.0052  329 GLU A CD  
855  O OE1 . GLU A 118 ? 0.4066 0.4408 0.4435 -0.0250 -0.0020 0.0071  329 GLU A OE1 
856  O OE2 . GLU A 118 ? 0.4366 0.4592 0.4730 -0.0251 -0.0048 0.0059  329 GLU A OE2 
857  N N   . LYS A 119 ? 0.1939 0.2271 0.2217 -0.0180 0.0061  -0.0055 330 LYS A N   
858  C CA  . LYS A 119 ? 0.2026 0.2385 0.2291 -0.0176 0.0086  -0.0081 330 LYS A CA  
859  C C   . LYS A 119 ? 0.1986 0.2289 0.2233 -0.0162 0.0103  -0.0114 330 LYS A C   
860  O O   . LYS A 119 ? 0.2144 0.2451 0.2379 -0.0167 0.0117  -0.0138 330 LYS A O   
861  C CB  . LYS A 119 ? 0.2043 0.2462 0.2318 -0.0172 0.0100  -0.0080 330 LYS A CB  
862  C CG  . LYS A 119 ? 0.2293 0.2779 0.2588 -0.0187 0.0088  -0.0046 330 LYS A CG  
863  C CD  . LYS A 119 ? 0.2583 0.3109 0.2872 -0.0202 0.0085  -0.0037 330 LYS A CD  
864  C CE  . LYS A 119 ? 0.2677 0.3177 0.2976 -0.0214 0.0061  -0.0006 330 LYS A CE  
865  N NZ  . LYS A 119 ? 0.2887 0.3437 0.3183 -0.0224 0.0060  0.0012  330 LYS A NZ  
866  N N   . ILE A 120 ? 0.1936 0.2192 0.2183 -0.0147 0.0102  -0.0114 331 ILE A N   
867  C CA  . ILE A 120 ? 0.2000 0.2197 0.2232 -0.0132 0.0116  -0.0136 331 ILE A CA  
868  C C   . ILE A 120 ? 0.1985 0.2149 0.2206 -0.0141 0.0108  -0.0140 331 ILE A C   
869  O O   . ILE A 120 ? 0.1922 0.2067 0.2134 -0.0141 0.0125  -0.0162 331 ILE A O   
870  C CB  . ILE A 120 ? 0.2012 0.2177 0.2247 -0.0112 0.0113  -0.0127 331 ILE A CB  
871  C CG1 . ILE A 120 ? 0.2274 0.2466 0.2518 -0.0096 0.0132  -0.0130 331 ILE A CG1 
872  C CG2 . ILE A 120 ? 0.1992 0.2094 0.2211 -0.0097 0.0124  -0.0140 331 ILE A CG2 
873  C CD1 . ILE A 120 ? 0.2454 0.2641 0.2705 -0.0075 0.0125  -0.0114 331 ILE A CD1 
874  N N   . GLN A 121 ? 0.2031 0.2191 0.2257 -0.0147 0.0083  -0.0118 332 GLN A N   
875  C CA  . GLN A 121 ? 0.1962 0.2095 0.2178 -0.0151 0.0075  -0.0119 332 GLN A CA  
876  C C   . GLN A 121 ? 0.1912 0.2088 0.2127 -0.0165 0.0084  -0.0127 332 GLN A C   
877  O O   . GLN A 121 ? 0.1880 0.2042 0.2086 -0.0166 0.0090  -0.0140 332 GLN A O   
878  C CB  . GLN A 121 ? 0.1969 0.2092 0.2192 -0.0155 0.0049  -0.0094 332 GLN A CB  
879  C CG  . GLN A 121 ? 0.2478 0.2561 0.2699 -0.0145 0.0035  -0.0090 332 GLN A CG  
880  C CD  . GLN A 121 ? 0.2915 0.2996 0.3150 -0.0156 0.0010  -0.0068 332 GLN A CD  
881  O OE1 . GLN A 121 ? 0.3050 0.3129 0.3288 -0.0164 0.0002  -0.0057 332 GLN A OE1 
882  N NE2 . GLN A 121 ? 0.3630 0.3714 0.3876 -0.0159 -0.0002 -0.0061 332 GLN A NE2 
883  N N   . LEU A 122 ? 0.1759 0.1994 0.1983 -0.0176 0.0083  -0.0118 333 LEU A N   
884  C CA  . LEU A 122 ? 0.1742 0.2032 0.1963 -0.0189 0.0091  -0.0128 333 LEU A CA  
885  C C   . LEU A 122 ? 0.1666 0.1949 0.1876 -0.0189 0.0117  -0.0169 333 LEU A C   
886  O O   . LEU A 122 ? 0.1504 0.1802 0.1707 -0.0199 0.0123  -0.0186 333 LEU A O   
887  C CB  . LEU A 122 ? 0.1832 0.2194 0.2062 -0.0197 0.0089  -0.0111 333 LEU A CB  
888  C CG  . LEU A 122 ? 0.1992 0.2428 0.2215 -0.0209 0.0099  -0.0124 333 LEU A CG  
889  C CD1 . LEU A 122 ? 0.2412 0.2859 0.2630 -0.0215 0.0091  -0.0120 333 LEU A CD1 
890  C CD2 . LEU A 122 ? 0.2932 0.3436 0.3167 -0.0214 0.0093  -0.0094 333 LEU A CD2 
891  N N   . LEU A 123 ? 0.1579 0.1841 0.1789 -0.0179 0.0133  -0.0183 334 LEU A N   
892  C CA  . LEU A 123 ? 0.1801 0.2047 0.2004 -0.0179 0.0161  -0.0223 334 LEU A CA  
893  C C   . LEU A 123 ? 0.1820 0.2001 0.2018 -0.0176 0.0168  -0.0234 334 LEU A C   
894  O O   . LEU A 123 ? 0.1922 0.2099 0.2116 -0.0188 0.0185  -0.0264 334 LEU A O   
895  C CB  . LEU A 123 ? 0.1737 0.1973 0.1943 -0.0164 0.0179  -0.0233 334 LEU A CB  
896  C CG  . LEU A 123 ? 0.2101 0.2405 0.2312 -0.0165 0.0182  -0.0230 334 LEU A CG  
897  C CD1 . LEU A 123 ? 0.2329 0.2611 0.2543 -0.0144 0.0205  -0.0243 334 LEU A CD1 
898  C CD2 . LEU A 123 ? 0.2409 0.2772 0.2611 -0.0183 0.0189  -0.0254 334 LEU A CD2 
899  N N   . GLU A 124 ? 0.1776 0.1911 0.1974 -0.0161 0.0156  -0.0212 335 GLU A N   
900  C CA  . GLU A 124 ? 0.1885 0.1966 0.2077 -0.0156 0.0163  -0.0218 335 GLU A CA  
901  C C   . GLU A 124 ? 0.1906 0.2012 0.2097 -0.0172 0.0155  -0.0221 335 GLU A C   
902  O O   . GLU A 124 ? 0.2040 0.2132 0.2230 -0.0181 0.0170  -0.0241 335 GLU A O   
903  C CB  . GLU A 124 ? 0.1859 0.1897 0.2048 -0.0135 0.0150  -0.0195 335 GLU A CB  
904  C CG  . GLU A 124 ? 0.1868 0.1886 0.2060 -0.0117 0.0165  -0.0195 335 GLU A CG  
905  C CD  . GLU A 124 ? 0.2199 0.2189 0.2387 -0.0095 0.0152  -0.0174 335 GLU A CD  
906  O OE1 . GLU A 124 ? 0.2357 0.2345 0.2541 -0.0097 0.0128  -0.0159 335 GLU A OE1 
907  O OE2 . GLU A 124 ? 0.1933 0.1905 0.2122 -0.0076 0.0168  -0.0173 335 GLU A OE2 
908  N N   . ALA A 125 ? 0.1833 0.1981 0.2026 -0.0178 0.0132  -0.0200 336 ALA A N   
909  C CA  . ALA A 125 ? 0.1709 0.1891 0.1901 -0.0189 0.0124  -0.0197 336 ALA A CA  
910  C C   . ALA A 125 ? 0.1827 0.2061 0.2021 -0.0210 0.0139  -0.0227 336 ALA A C   
911  O O   . ALA A 125 ? 0.1725 0.1970 0.1919 -0.0221 0.0144  -0.0240 336 ALA A O   
912  C CB  . ALA A 125 ? 0.1771 0.1986 0.1969 -0.0188 0.0100  -0.0164 336 ALA A CB  
913  N N   . LEU A 126 ? 0.1751 0.2025 0.1945 -0.0217 0.0146  -0.0238 337 LEU A N   
914  C CA  . LEU A 126 ? 0.1762 0.2085 0.1953 -0.0238 0.0160  -0.0273 337 LEU A CA  
915  C C   . LEU A 126 ? 0.1820 0.2093 0.2013 -0.0245 0.0185  -0.0310 337 LEU A C   
916  O O   . LEU A 126 ? 0.1763 0.2067 0.1957 -0.0267 0.0192  -0.0338 337 LEU A O   
917  C CB  . LEU A 126 ? 0.1734 0.2100 0.1923 -0.0239 0.0167  -0.0283 337 LEU A CB  
918  C CG  . LEU A 126 ? 0.1893 0.2330 0.2083 -0.0238 0.0147  -0.0248 337 LEU A CG  
919  C CD1 . LEU A 126 ? 0.1683 0.2159 0.1870 -0.0237 0.0158  -0.0260 337 LEU A CD1 
920  C CD2 . LEU A 126 ? 0.1917 0.2431 0.2104 -0.0253 0.0137  -0.0246 337 LEU A CD2 
921  N N   . GLY A 127 ? 0.1826 0.2025 0.2019 -0.0228 0.0197  -0.0309 338 GLY A N   
922  C CA  . GLY A 127 ? 0.2038 0.2178 0.2235 -0.0232 0.0224  -0.0336 338 GLY A CA  
923  C C   . GLY A 127 ? 0.2128 0.2259 0.2329 -0.0241 0.0221  -0.0332 338 GLY A C   
924  O O   . GLY A 127 ? 0.2192 0.2319 0.2400 -0.0263 0.0238  -0.0362 338 GLY A O   
925  N N   . ASP A 128 ? 0.2055 0.2184 0.2253 -0.0227 0.0199  -0.0298 339 ASP A N   
926  C CA  . ASP A 128 ? 0.2115 0.2241 0.2317 -0.0230 0.0196  -0.0290 339 ASP A CA  
927  C C   . ASP A 128 ? 0.2063 0.2267 0.2270 -0.0253 0.0187  -0.0300 339 ASP A C   
928  O O   . ASP A 128 ? 0.2045 0.2259 0.2260 -0.0266 0.0194  -0.0310 339 ASP A O   
929  C CB  . ASP A 128 ? 0.2051 0.2149 0.2245 -0.0204 0.0176  -0.0253 339 ASP A CB  
930  C CG  . ASP A 128 ? 0.2564 0.2589 0.2753 -0.0182 0.0187  -0.0245 339 ASP A CG  
931  O OD1 . ASP A 128 ? 0.2792 0.2781 0.2986 -0.0186 0.0213  -0.0263 339 ASP A OD1 
932  O OD2 . ASP A 128 ? 0.3055 0.3060 0.3237 -0.0160 0.0170  -0.0221 339 ASP A OD2 
933  N N   . ILE A 129 ? 0.2000 0.2267 0.2203 -0.0257 0.0172  -0.0294 340 ILE A N   
934  C CA  . ILE A 129 ? 0.1946 0.2301 0.2153 -0.0278 0.0165  -0.0303 340 ILE A CA  
935  C C   . ILE A 129 ? 0.2130 0.2507 0.2342 -0.0309 0.0186  -0.0354 340 ILE A C   
936  O O   . ILE A 129 ? 0.1944 0.2374 0.2164 -0.0331 0.0187  -0.0370 340 ILE A O   
937  C CB  . ILE A 129 ? 0.1858 0.2278 0.2060 -0.0272 0.0145  -0.0280 340 ILE A CB  
938  C CG1 . ILE A 129 ? 0.1877 0.2276 0.2079 -0.0247 0.0125  -0.0232 340 ILE A CG1 
939  C CG2 . ILE A 129 ? 0.2081 0.2605 0.2286 -0.0293 0.0140  -0.0291 340 ILE A CG2 
940  C CD1 . ILE A 129 ? 0.1457 0.1896 0.1658 -0.0239 0.0108  -0.0201 340 ILE A CD1 
941  N N   . GLU A 130 ? 0.2190 0.2530 0.2399 -0.0311 0.0204  -0.0379 341 GLU A N   
942  C CA  . GLU A 130 ? 0.2436 0.2780 0.2648 -0.0340 0.0227  -0.0432 341 GLU A CA  
943  C C   . GLU A 130 ? 0.2521 0.2816 0.2749 -0.0355 0.0244  -0.0447 341 GLU A C   
944  O O   . GLU A 130 ? 0.2515 0.2848 0.2753 -0.0388 0.0253  -0.0483 341 GLU A O   
945  C CB  . GLU A 130 ? 0.2431 0.2726 0.2637 -0.0330 0.0246  -0.0451 341 GLU A CB  
946  C CG  . GLU A 130 ? 0.2996 0.3291 0.3205 -0.0359 0.0272  -0.0514 341 GLU A CG  
947  C CD  . GLU A 130 ? 0.3207 0.3418 0.3432 -0.0372 0.0300  -0.0537 341 GLU A CD  
948  O OE1 . GLU A 130 ? 0.3321 0.3461 0.3552 -0.0350 0.0304  -0.0504 341 GLU A OE1 
949  O OE2 . GLU A 130 ? 0.3376 0.3594 0.3609 -0.0405 0.0318  -0.0588 341 GLU A OE2 
950  N N   . ILE A 131 ? 0.2568 0.2786 0.2798 -0.0331 0.0248  -0.0418 342 ILE A N   
951  C CA  . ILE A 131 ? 0.2602 0.2781 0.2847 -0.0339 0.0262  -0.0418 342 ILE A CA  
952  C C   . ILE A 131 ? 0.2506 0.2758 0.2758 -0.0352 0.0245  -0.0407 342 ILE A C   
953  O O   . ILE A 131 ? 0.2532 0.2806 0.2801 -0.0382 0.0257  -0.0431 342 ILE A O   
954  C CB  . ILE A 131 ? 0.2561 0.2655 0.2802 -0.0305 0.0267  -0.0383 342 ILE A CB  
955  C CG1 . ILE A 131 ? 0.2513 0.2533 0.2752 -0.0294 0.0292  -0.0396 342 ILE A CG1 
956  C CG2 . ILE A 131 ? 0.2639 0.2706 0.2892 -0.0310 0.0279  -0.0374 342 ILE A CG2 
957  C CD1 . ILE A 131 ? 0.2126 0.2082 0.2355 -0.0253 0.0290  -0.0356 342 ILE A CD1 
958  N N   . ALA A 132 ? 0.2444 0.2735 0.2686 -0.0329 0.0218  -0.0370 343 ALA A N   
959  C CA  . ALA A 132 ? 0.2437 0.2797 0.2686 -0.0332 0.0202  -0.0353 343 ALA A CA  
960  C C   . ALA A 132 ? 0.2578 0.3037 0.2837 -0.0368 0.0200  -0.0384 343 ALA A C   
961  O O   . ALA A 132 ? 0.2461 0.2960 0.2736 -0.0386 0.0203  -0.0391 343 ALA A O   
962  C CB  . ALA A 132 ? 0.2222 0.2601 0.2459 -0.0300 0.0176  -0.0309 343 ALA A CB  
963  N N   . ILE A 133 ? 0.2609 0.3113 0.2858 -0.0379 0.0196  -0.0405 344 ILE A N   
964  C CA  . ILE A 133 ? 0.2717 0.3330 0.2970 -0.0410 0.0190  -0.0433 344 ILE A CA  
965  C C   . ILE A 133 ? 0.2829 0.3437 0.3100 -0.0452 0.0213  -0.0486 344 ILE A C   
966  O O   . ILE A 133 ? 0.2802 0.3498 0.3086 -0.0481 0.0207  -0.0504 344 ILE A O   
967  C CB  . ILE A 133 ? 0.2855 0.3522 0.3091 -0.0410 0.0182  -0.0443 344 ILE A CB  
968  C CG1 . ILE A 133 ? 0.2788 0.3489 0.3014 -0.0376 0.0157  -0.0386 344 ILE A CG1 
969  C CG2 . ILE A 133 ? 0.2936 0.3714 0.3174 -0.0448 0.0181  -0.0487 344 ILE A CG2 
970  C CD1 . ILE A 133 ? 0.3083 0.3838 0.3295 -0.0372 0.0149  -0.0383 344 ILE A CD1 
971  N N   . LYS A 134 ? 0.2881 0.3388 0.3155 -0.0456 0.0238  -0.0508 345 LYS A N   
972  C CA  . LYS A 134 ? 0.3024 0.3496 0.3318 -0.0494 0.0264  -0.0553 345 LYS A CA  
973  C C   . LYS A 134 ? 0.2978 0.3443 0.3294 -0.0498 0.0267  -0.0531 345 LYS A C   
974  O O   . LYS A 134 ? 0.2943 0.3443 0.3281 -0.0537 0.0277  -0.0561 345 LYS A O   
975  C CB  . LYS A 134 ? 0.3138 0.3489 0.3431 -0.0485 0.0292  -0.0567 345 LYS A CB  
976  C CG  . LYS A 134 ? 0.3770 0.4111 0.4059 -0.0509 0.0311  -0.0625 345 LYS A CG  
977  C CD  . LYS A 134 ? 0.4136 0.4352 0.4424 -0.0489 0.0339  -0.0628 345 LYS A CD  
978  C CE  . LYS A 134 ? 0.4476 0.4676 0.4759 -0.0507 0.0360  -0.0686 345 LYS A CE  
979  N NZ  . LYS A 134 ? 0.4859 0.5035 0.5120 -0.0468 0.0358  -0.0671 345 LYS A NZ  
980  N N   . LEU A 135 ? 0.2964 0.3379 0.3273 -0.0458 0.0261  -0.0480 346 LEU A N   
981  C CA  . LEU A 135 ? 0.2984 0.3381 0.3310 -0.0455 0.0267  -0.0456 346 LEU A CA  
982  C C   . LEU A 135 ? 0.2929 0.3439 0.3268 -0.0468 0.0249  -0.0448 346 LEU A C   
983  O O   . LEU A 135 ? 0.3000 0.3530 0.3364 -0.0491 0.0260  -0.0455 346 LEU A O   
984  C CB  . LEU A 135 ? 0.2988 0.3319 0.3299 -0.0405 0.0261  -0.0406 346 LEU A CB  
985  C CG  . LEU A 135 ? 0.3075 0.3371 0.3397 -0.0393 0.0272  -0.0379 346 LEU A CG  
986  C CD1 . LEU A 135 ? 0.2952 0.3142 0.3259 -0.0359 0.0284  -0.0358 346 LEU A CD1 
987  C CD2 . LEU A 135 ? 0.2842 0.3205 0.3161 -0.0370 0.0248  -0.0344 346 LEU A CD2 
988  N N   . VAL A 136 ? 0.2981 0.3569 0.3305 -0.0453 0.0223  -0.0432 347 VAL A N   
989  C CA  . VAL A 136 ? 0.3014 0.3719 0.3351 -0.0456 0.0204  -0.0415 347 VAL A CA  
990  C C   . VAL A 136 ? 0.3136 0.3948 0.3487 -0.0505 0.0203  -0.0460 347 VAL A C   
991  O O   . VAL A 136 ? 0.3123 0.4045 0.3487 -0.0509 0.0188  -0.0448 347 VAL A O   
992  C CB  . VAL A 136 ? 0.3035 0.3776 0.3352 -0.0414 0.0178  -0.0370 347 VAL A CB  
993  C CG1 . VAL A 136 ? 0.2722 0.3362 0.3026 -0.0370 0.0178  -0.0331 347 VAL A CG1 
994  C CG2 . VAL A 136 ? 0.3030 0.3803 0.3328 -0.0418 0.0168  -0.0384 347 VAL A CG2 
995  N N   . LYS A 137 ? 0.3258 0.4042 0.3610 -0.0539 0.0219  -0.0512 348 LYS A N   
996  C CA  . LYS A 137 ? 0.3528 0.4403 0.3897 -0.0593 0.0221  -0.0566 348 LYS A CA  
997  C C   . LYS A 137 ? 0.3494 0.4400 0.3898 -0.0622 0.0230  -0.0569 348 LYS A C   
998  O O   . LYS A 137 ? 0.3360 0.4174 0.3779 -0.0622 0.0252  -0.0563 348 LYS A O   
999  C CB  . LYS A 137 ? 0.3650 0.4457 0.4015 -0.0624 0.0244  -0.0625 348 LYS A CB  
1000 C CG  . LYS A 137 ? 0.4288 0.5096 0.4620 -0.0604 0.0235  -0.0632 348 LYS A CG  
1001 C CD  . LYS A 137 ? 0.5065 0.5825 0.5395 -0.0637 0.0259  -0.0699 348 LYS A CD  
1002 C CE  . LYS A 137 ? 0.5439 0.6198 0.5737 -0.0613 0.0253  -0.0704 348 LYS A CE  
1003 N NZ  . LYS A 137 ? 0.5749 0.6448 0.6046 -0.0640 0.0281  -0.0770 348 LYS A NZ  
1004 N N   . THR A 138 ? 0.3563 0.4606 0.3981 -0.0644 0.0213  -0.0576 349 THR A N   
1005 C CA  . THR A 138 ? 0.3700 0.4797 0.4155 -0.0671 0.0219  -0.0575 349 THR A CA  
1006 C C   . THR A 138 ? 0.3822 0.4996 0.4300 -0.0740 0.0224  -0.0643 349 THR A C   
1007 O O   . THR A 138 ? 0.3763 0.4995 0.4225 -0.0759 0.0215  -0.0683 349 THR A O   
1008 C CB  . THR A 138 ? 0.3655 0.4864 0.4112 -0.0638 0.0194  -0.0524 349 THR A CB  
1009 O OG1 . THR A 138 ? 0.3775 0.5114 0.4221 -0.0647 0.0171  -0.0537 349 THR A OG1 
1010 C CG2 . THR A 138 ? 0.3615 0.4748 0.4047 -0.0571 0.0187  -0.0462 349 THR A CG2 
1011 N N   . GLU A 139 ? 0.3980 0.5158 0.4497 -0.0778 0.0241  -0.0657 350 GLU A N   
1012 C CA  . GLU A 139 ? 0.4152 0.5425 0.4699 -0.0847 0.0242  -0.0717 350 GLU A CA  
1013 C C   . GLU A 139 ? 0.4171 0.5626 0.4729 -0.0845 0.0213  -0.0694 350 GLU A C   
1014 O O   . GLU A 139 ? 0.4224 0.5713 0.4802 -0.0826 0.0211  -0.0648 350 GLU A O   
1015 C CB  . GLU A 139 ? 0.4254 0.5464 0.4844 -0.0890 0.0272  -0.0735 350 GLU A CB  
1016 C CG  . GLU A 139 ? 0.4372 0.5453 0.4968 -0.0929 0.0303  -0.0789 350 GLU A CG  
1017 C CD  . GLU A 139 ? 0.4466 0.5467 0.5106 -0.0957 0.0336  -0.0783 350 GLU A CD  
1018 O OE1 . GLU A 139 ? 0.4456 0.5546 0.5133 -0.0981 0.0333  -0.0769 350 GLU A OE1 
1019 O OE2 . GLU A 139 ? 0.4720 0.5572 0.5359 -0.0953 0.0365  -0.0788 350 GLU A OE2 
1020 N N   . LEU A 140 ? 0.4201 0.5777 0.4743 -0.0860 0.0191  -0.0723 351 LEU A N   
1021 C CA  . LEU A 140 ? 0.4275 0.6037 0.4828 -0.0857 0.0163  -0.0700 351 LEU A CA  
1022 C C   . LEU A 140 ? 0.4106 0.5938 0.4711 -0.0892 0.0169  -0.0697 351 LEU A C   
1023 O O   . LEU A 140 ? 0.4065 0.5973 0.4682 -0.0857 0.0157  -0.0640 351 LEU A O   
1024 C CB  . LEU A 140 ? 0.4368 0.6258 0.4907 -0.0894 0.0145  -0.0756 351 LEU A CB  
1025 C CG  . LEU A 140 ? 0.4731 0.6800 0.5254 -0.0866 0.0112  -0.0724 351 LEU A CG  
1026 C CD1 . LEU A 140 ? 0.5001 0.7131 0.5491 -0.0888 0.0102  -0.0779 351 LEU A CD1 
1027 C CD2 . LEU A 140 ? 0.5022 0.7266 0.5583 -0.0891 0.0097  -0.0717 351 LEU A CD2 
1028 N N   . GLN A 141 ? 0.3979 0.5785 0.4615 -0.0961 0.0189  -0.0759 352 GLN A N   
1029 C CA  . GLN A 141 ? 0.3874 0.5766 0.4564 -0.1007 0.0194  -0.0765 352 GLN A CA  
1030 C C   . GLN A 141 ? 0.3612 0.5394 0.4329 -0.0994 0.0221  -0.0725 352 GLN A C   
1031 O O   . GLN A 141 ? 0.3450 0.5297 0.4215 -0.1033 0.0228  -0.0727 352 GLN A O   
1032 C CB  . GLN A 141 ? 0.4012 0.5952 0.4730 -0.1097 0.0201  -0.0855 352 GLN A CB  
1033 C CG  . GLN A 141 ? 0.4295 0.6386 0.4992 -0.1116 0.0173  -0.0897 352 GLN A CG  
1034 C CD  . GLN A 141 ? 0.4722 0.7016 0.5426 -0.1092 0.0140  -0.0851 352 GLN A CD  
1035 O OE1 . GLN A 141 ? 0.5071 0.7402 0.5740 -0.1025 0.0121  -0.0796 352 GLN A OE1 
1036 N NE2 . GLN A 141 ? 0.4638 0.7067 0.5392 -0.1146 0.0136  -0.0871 352 GLN A NE2 
1037 N N   . SER A 142 ? 0.3401 0.5030 0.4090 -0.0939 0.0234  -0.0685 353 SER A N   
1038 C CA  . SER A 142 ? 0.3299 0.4829 0.4011 -0.0926 0.0260  -0.0648 353 SER A CA  
1039 C C   . SER A 142 ? 0.3172 0.4805 0.3902 -0.0890 0.0248  -0.0586 353 SER A C   
1040 O O   . SER A 142 ? 0.3023 0.4738 0.3730 -0.0841 0.0222  -0.0548 353 SER A O   
1041 C CB  . SER A 142 ? 0.3318 0.4673 0.3992 -0.0873 0.0274  -0.0619 353 SER A CB  
1042 O OG  . SER A 142 ? 0.3304 0.4590 0.3996 -0.0852 0.0295  -0.0574 353 SER A OG  
1043 N N   . PRO A 143 ? 0.3169 0.4790 0.3941 -0.0911 0.0270  -0.0571 354 PRO A N   
1044 C CA  . PRO A 143 ? 0.3147 0.4857 0.3931 -0.0867 0.0262  -0.0509 354 PRO A CA  
1045 C C   . PRO A 143 ? 0.3079 0.4678 0.3823 -0.0783 0.0265  -0.0447 354 PRO A C   
1046 O O   . PRO A 143 ? 0.3002 0.4663 0.3746 -0.0733 0.0255  -0.0395 354 PRO A O   
1047 C CB  . PRO A 143 ? 0.3196 0.4937 0.4040 -0.0921 0.0286  -0.0515 354 PRO A CB  
1048 C CG  . PRO A 143 ? 0.3301 0.4891 0.4154 -0.0972 0.0317  -0.0562 354 PRO A CG  
1049 C CD  . PRO A 143 ? 0.3281 0.4823 0.4091 -0.0975 0.0304  -0.0608 354 PRO A CD  
1050 N N   . GLU A 144 ? 0.3123 0.4563 0.3835 -0.0767 0.0278  -0.0455 355 GLU A N   
1051 C CA  . GLU A 144 ? 0.3143 0.4479 0.3816 -0.0692 0.0279  -0.0404 355 GLU A CA  
1052 C C   . GLU A 144 ? 0.2934 0.4311 0.3567 -0.0638 0.0248  -0.0379 355 GLU A C   
1053 O O   . GLU A 144 ? 0.2899 0.4291 0.3513 -0.0651 0.0233  -0.0409 355 GLU A O   
1054 C CB  . GLU A 144 ? 0.3325 0.4491 0.3975 -0.0692 0.0299  -0.0421 355 GLU A CB  
1055 C CG  . GLU A 144 ? 0.3994 0.5064 0.4668 -0.0714 0.0334  -0.0418 355 GLU A CG  
1056 C CD  . GLU A 144 ? 0.4665 0.5571 0.5306 -0.0689 0.0350  -0.0418 355 GLU A CD  
1057 O OE1 . GLU A 144 ? 0.5356 0.6186 0.5980 -0.0642 0.0360  -0.0376 355 GLU A OE1 
1058 O OE2 . GLU A 144 ? 0.5006 0.5864 0.5635 -0.0712 0.0350  -0.0461 355 GLU A OE2 
1059 N N   . HIS A 145 ? 0.2713 0.4096 0.3333 -0.0574 0.0240  -0.0324 356 HIS A N   
1060 C CA  . HIS A 145 ? 0.2612 0.3996 0.3193 -0.0517 0.0216  -0.0295 356 HIS A CA  
1061 C C   . HIS A 145 ? 0.2550 0.3807 0.3092 -0.0510 0.0216  -0.0314 356 HIS A C   
1062 O O   . HIS A 145 ? 0.2489 0.3621 0.3024 -0.0515 0.0236  -0.0323 356 HIS A O   
1063 C CB  . HIS A 145 ? 0.2544 0.3911 0.3113 -0.0449 0.0215  -0.0237 356 HIS A CB  
1064 C CG  . HIS A 145 ? 0.2458 0.3857 0.3000 -0.0394 0.0190  -0.0204 356 HIS A CG  
1065 N ND1 . HIS A 145 ? 0.2191 0.3499 0.2695 -0.0370 0.0180  -0.0203 356 HIS A ND1 
1066 C CD2 . HIS A 145 ? 0.2088 0.3600 0.2639 -0.0361 0.0175  -0.0169 356 HIS A CD2 
1067 C CE1 . HIS A 145 ? 0.2252 0.3613 0.2743 -0.0326 0.0160  -0.0169 356 HIS A CE1 
1068 N NE2 . HIS A 145 ? 0.2431 0.3912 0.2948 -0.0317 0.0157  -0.0147 356 HIS A NE2 
1069 N N   . PRO A 146 ? 0.2483 0.3775 0.3001 -0.0499 0.0193  -0.0318 357 PRO A N   
1070 C CA  . PRO A 146 ? 0.2589 0.3772 0.3072 -0.0489 0.0192  -0.0331 357 PRO A CA  
1071 C C   . PRO A 146 ? 0.2574 0.3617 0.3033 -0.0443 0.0202  -0.0301 357 PRO A C   
1072 O O   . PRO A 146 ? 0.2656 0.3590 0.3103 -0.0453 0.0217  -0.0322 357 PRO A O   
1073 C CB  . PRO A 146 ? 0.2529 0.3793 0.2993 -0.0464 0.0165  -0.0313 357 PRO A CB  
1074 C CG  . PRO A 146 ? 0.2496 0.3923 0.2990 -0.0500 0.0155  -0.0329 357 PRO A CG  
1075 C CD  . PRO A 146 ? 0.2582 0.4030 0.3109 -0.0505 0.0170  -0.0316 357 PRO A CD  
1076 N N   . LEU A 147 ? 0.2574 0.3621 0.3026 -0.0392 0.0195  -0.0255 358 LEU A N   
1077 C CA  . LEU A 147 ? 0.2634 0.3557 0.3061 -0.0350 0.0203  -0.0231 358 LEU A CA  
1078 C C   . LEU A 147 ? 0.2668 0.3513 0.3107 -0.0370 0.0231  -0.0244 358 LEU A C   
1079 O O   . LEU A 147 ? 0.2694 0.3426 0.3111 -0.0353 0.0239  -0.0242 358 LEU A O   
1080 C CB  . LEU A 147 ? 0.2613 0.3556 0.3031 -0.0292 0.0192  -0.0184 358 LEU A CB  
1081 C CG  . LEU A 147 ? 0.2706 0.3717 0.3114 -0.0264 0.0166  -0.0161 358 LEU A CG  
1082 C CD1 . LEU A 147 ? 0.2927 0.3948 0.3330 -0.0205 0.0160  -0.0115 358 LEU A CD1 
1083 C CD2 . LEU A 147 ? 0.2767 0.3711 0.3147 -0.0260 0.0155  -0.0168 358 LEU A CD2 
1084 N N   . ASP A 148 ? 0.2721 0.3627 0.3197 -0.0408 0.0246  -0.0256 359 ASP A N   
1085 C CA  . ASP A 148 ? 0.2716 0.3550 0.3208 -0.0428 0.0276  -0.0263 359 ASP A CA  
1086 C C   . ASP A 148 ? 0.2656 0.3412 0.3146 -0.0468 0.0289  -0.0304 359 ASP A C   
1087 O O   . ASP A 148 ? 0.2621 0.3270 0.3104 -0.0463 0.0310  -0.0302 359 ASP A O   
1088 C CB  . ASP A 148 ? 0.2769 0.3694 0.3306 -0.0465 0.0290  -0.0265 359 ASP A CB  
1089 C CG  . ASP A 148 ? 0.3084 0.4071 0.3626 -0.0420 0.0287  -0.0219 359 ASP A CG  
1090 O OD1 . ASP A 148 ? 0.3820 0.4745 0.4331 -0.0363 0.0284  -0.0188 359 ASP A OD1 
1091 O OD2 . ASP A 148 ? 0.3693 0.4794 0.4270 -0.0441 0.0287  -0.0217 359 ASP A OD2 
1092 N N   . GLN A 149 ? 0.2608 0.3425 0.3105 -0.0506 0.0278  -0.0341 360 GLN A N   
1093 C CA  . GLN A 149 ? 0.2649 0.3398 0.3140 -0.0538 0.0288  -0.0384 360 GLN A CA  
1094 C C   . GLN A 149 ? 0.2554 0.3196 0.3004 -0.0494 0.0284  -0.0369 360 GLN A C   
1095 O O   . GLN A 149 ? 0.2687 0.3227 0.3132 -0.0498 0.0304  -0.0381 360 GLN A O   
1096 C CB  . GLN A 149 ? 0.2668 0.3517 0.3167 -0.0580 0.0273  -0.0426 360 GLN A CB  
1097 C CG  . GLN A 149 ? 0.2694 0.3654 0.3236 -0.0633 0.0277  -0.0451 360 GLN A CG  
1098 C CD  . GLN A 149 ? 0.2824 0.3894 0.3367 -0.0670 0.0258  -0.0493 360 GLN A CD  
1099 O OE1 . GLN A 149 ? 0.2813 0.3842 0.3344 -0.0694 0.0262  -0.0537 360 GLN A OE1 
1100 N NE2 . GLN A 149 ? 0.2350 0.3565 0.2908 -0.0672 0.0237  -0.0480 360 GLN A NE2 
1101 N N   . HIS A 150 ? 0.2524 0.3190 0.2947 -0.0451 0.0258  -0.0341 361 HIS A N   
1102 C CA  . HIS A 150 ? 0.2474 0.3046 0.2861 -0.0410 0.0252  -0.0325 361 HIS A CA  
1103 C C   . HIS A 150 ? 0.2498 0.2970 0.2877 -0.0381 0.0269  -0.0300 361 HIS A C   
1104 O O   . HIS A 150 ? 0.2434 0.2812 0.2799 -0.0374 0.0281  -0.0306 361 HIS A O   
1105 C CB  . HIS A 150 ? 0.2331 0.2944 0.2696 -0.0368 0.0222  -0.0294 361 HIS A CB  
1106 C CG  . HIS A 150 ? 0.2210 0.2933 0.2580 -0.0386 0.0203  -0.0306 361 HIS A CG  
1107 N ND1 . HIS A 150 ? 0.2287 0.3063 0.2672 -0.0436 0.0208  -0.0350 361 HIS A ND1 
1108 C CD2 . HIS A 150 ? 0.2269 0.3062 0.2630 -0.0359 0.0179  -0.0278 361 HIS A CD2 
1109 C CE1 . HIS A 150 ? 0.2148 0.3031 0.2532 -0.0439 0.0187  -0.0349 361 HIS A CE1 
1110 N NE2 . HIS A 150 ? 0.2144 0.3039 0.2515 -0.0392 0.0170  -0.0302 361 HIS A NE2 
1111 N N   . TYR A 151 ? 0.2421 0.2920 0.2806 -0.0358 0.0269  -0.0270 362 TYR A N   
1112 C CA  . TYR A 151 ? 0.2553 0.2979 0.2929 -0.0328 0.0285  -0.0243 362 TYR A CA  
1113 C C   . TYR A 151 ? 0.2572 0.2929 0.2964 -0.0356 0.0317  -0.0258 362 TYR A C   
1114 O O   . TYR A 151 ? 0.2363 0.2632 0.2736 -0.0332 0.0327  -0.0246 362 TYR A O   
1115 C CB  . TYR A 151 ? 0.2647 0.3136 0.3034 -0.0308 0.0284  -0.0214 362 TYR A CB  
1116 C CG  . TYR A 151 ? 0.2731 0.3158 0.3104 -0.0271 0.0298  -0.0185 362 TYR A CG  
1117 C CD1 . TYR A 151 ? 0.2896 0.3254 0.3231 -0.0225 0.0287  -0.0169 362 TYR A CD1 
1118 C CD2 . TYR A 151 ? 0.2855 0.3299 0.3253 -0.0283 0.0323  -0.0175 362 TYR A CD2 
1119 C CE1 . TYR A 151 ? 0.2861 0.3171 0.3180 -0.0190 0.0300  -0.0145 362 TYR A CE1 
1120 C CE2 . TYR A 151 ? 0.2917 0.3312 0.3299 -0.0247 0.0337  -0.0146 362 TYR A CE2 
1121 C CZ  . TYR A 151 ? 0.2488 0.2818 0.2828 -0.0200 0.0325  -0.0133 362 TYR A CZ  
1122 O OH  . TYR A 151 ? 0.2250 0.2540 0.2571 -0.0164 0.0337  -0.0108 362 TYR A OH  
1123 N N   . ARG A 152 ? 0.2710 0.3108 0.3139 -0.0407 0.0334  -0.0283 363 ARG A N   
1124 C CA  . ARG A 152 ? 0.2794 0.3120 0.3244 -0.0439 0.0368  -0.0298 363 ARG A CA  
1125 C C   . ARG A 152 ? 0.2732 0.2973 0.3164 -0.0440 0.0372  -0.0322 363 ARG A C   
1126 O O   . ARG A 152 ? 0.2584 0.2734 0.3015 -0.0433 0.0397  -0.0314 363 ARG A O   
1127 C CB  . ARG A 152 ? 0.2951 0.3341 0.3446 -0.0503 0.0382  -0.0331 363 ARG A CB  
1128 C CG  . ARG A 152 ? 0.3568 0.3877 0.4091 -0.0541 0.0420  -0.0349 363 ARG A CG  
1129 C CD  . ARG A 152 ? 0.4091 0.4466 0.4665 -0.0606 0.0435  -0.0376 363 ARG A CD  
1130 N NE  . ARG A 152 ? 0.4672 0.5167 0.5256 -0.0636 0.0408  -0.0408 363 ARG A NE  
1131 C CZ  . ARG A 152 ? 0.4797 0.5304 0.5372 -0.0661 0.0397  -0.0454 363 ARG A CZ  
1132 N NH1 . ARG A 152 ? 0.4884 0.5515 0.5466 -0.0685 0.0372  -0.0477 363 ARG A NH1 
1133 N NH2 . ARG A 152 ? 0.5022 0.5426 0.5579 -0.0659 0.0409  -0.0476 363 ARG A NH2 
1134 N N   . ASN A 153 ? 0.2624 0.2901 0.3042 -0.0445 0.0350  -0.0346 364 ASN A N   
1135 C CA  . ASN A 153 ? 0.2659 0.2869 0.3061 -0.0446 0.0354  -0.0370 364 ASN A CA  
1136 C C   . ASN A 153 ? 0.2570 0.2707 0.2938 -0.0394 0.0348  -0.0339 364 ASN A C   
1137 O O   . ASN A 153 ? 0.2651 0.2720 0.3010 -0.0389 0.0358  -0.0350 364 ASN A O   
1138 C CB  . ASN A 153 ? 0.2626 0.2906 0.3022 -0.0468 0.0332  -0.0404 364 ASN A CB  
1139 C CG  . ASN A 153 ? 0.3049 0.3386 0.3477 -0.0528 0.0343  -0.0450 364 ASN A CG  
1140 O OD1 . ASN A 153 ? 0.3380 0.3665 0.3833 -0.0559 0.0373  -0.0469 364 ASN A OD1 
1141 N ND2 . ASN A 153 ? 0.3597 0.4041 0.4025 -0.0546 0.0319  -0.0469 364 ASN A ND2 
1142 N N   . LEU A 154 ? 0.2419 0.2573 0.2770 -0.0354 0.0330  -0.0301 365 LEU A N   
1143 C CA  . LEU A 154 ? 0.2308 0.2397 0.2629 -0.0307 0.0325  -0.0272 365 LEU A CA  
1144 C C   . LEU A 154 ? 0.2427 0.2434 0.2752 -0.0297 0.0356  -0.0257 365 LEU A C   
1145 O O   . LEU A 154 ? 0.2341 0.2286 0.2645 -0.0267 0.0357  -0.0245 365 LEU A O   
1146 C CB  . LEU A 154 ? 0.2281 0.2406 0.2584 -0.0268 0.0301  -0.0240 365 LEU A CB  
1147 C CG  . LEU A 154 ? 0.1995 0.2184 0.2287 -0.0261 0.0269  -0.0239 365 LEU A CG  
1148 C CD1 . LEU A 154 ? 0.1768 0.1959 0.2040 -0.0215 0.0252  -0.0206 365 LEU A CD1 
1149 C CD2 . LEU A 154 ? 0.2273 0.2438 0.2550 -0.0260 0.0257  -0.0253 365 LEU A CD2 
1150 N N   . HIS A 155 ? 0.2521 0.2535 0.2874 -0.0320 0.0380  -0.0255 366 HIS A N   
1151 C CA  . HIS A 155 ? 0.2520 0.2466 0.2879 -0.0308 0.0411  -0.0230 366 HIS A CA  
1152 C C   . HIS A 155 ? 0.2476 0.2401 0.2798 -0.0251 0.0398  -0.0192 366 HIS A C   
1153 O O   . HIS A 155 ? 0.2277 0.2138 0.2584 -0.0225 0.0408  -0.0176 366 HIS A O   
1154 C CB  . HIS A 155 ? 0.2685 0.2551 0.3052 -0.0323 0.0437  -0.0249 366 HIS A CB  
1155 C CG  . HIS A 155 ? 0.3028 0.2902 0.3432 -0.0381 0.0455  -0.0290 366 HIS A CG  
1156 N ND1 . HIS A 155 ? 0.3632 0.3513 0.4036 -0.0405 0.0448  -0.0333 366 HIS A ND1 
1157 C CD2 . HIS A 155 ? 0.3336 0.3217 0.3778 -0.0421 0.0482  -0.0297 366 HIS A CD2 
1158 C CE1 . HIS A 155 ? 0.3826 0.3715 0.4264 -0.0458 0.0467  -0.0369 366 HIS A CE1 
1159 N NE2 . HIS A 155 ? 0.3763 0.3652 0.4227 -0.0471 0.0487  -0.0348 366 HIS A NE2 
1160 N N   . CYS A 156 ? 0.2445 0.2429 0.2756 -0.0232 0.0376  -0.0179 367 CYS A N   
1161 C CA  . CYS A 156 ? 0.2473 0.2444 0.2748 -0.0181 0.0360  -0.0151 367 CYS A CA  
1162 C C   . CYS A 156 ? 0.2517 0.2553 0.2792 -0.0168 0.0350  -0.0137 367 CYS A C   
1163 O O   . CYS A 156 ? 0.2630 0.2725 0.2913 -0.0181 0.0330  -0.0150 367 CYS A O   
1164 C CB  . CYS A 156 ? 0.2502 0.2464 0.2751 -0.0164 0.0328  -0.0161 367 CYS A CB  
1165 S SG  . CYS A 156 ? 0.2378 0.2311 0.2583 -0.0106 0.0307  -0.0136 367 CYS A SG  
1166 N N   . ALA A 157 ? 0.2489 0.2521 0.2758 -0.0143 0.0364  -0.0110 368 ALA A N   
1167 C CA  . ALA A 157 ? 0.2442 0.2537 0.2710 -0.0127 0.0358  -0.0095 368 ALA A CA  
1168 C C   . ALA A 157 ? 0.2338 0.2435 0.2569 -0.0085 0.0326  -0.0093 368 ALA A C   
1169 O O   . ALA A 157 ? 0.2295 0.2341 0.2497 -0.0058 0.0318  -0.0089 368 ALA A O   
1170 C CB  . ALA A 157 ? 0.2443 0.2536 0.2712 -0.0109 0.0385  -0.0066 368 ALA A CB  
1171 N N   . LEU A 158 ? 0.2271 0.2431 0.2509 -0.0081 0.0309  -0.0095 369 LEU A N   
1172 C CA  . LEU A 158 ? 0.2244 0.2408 0.2452 -0.0041 0.0283  -0.0090 369 LEU A CA  
1173 C C   . LEU A 158 ? 0.2341 0.2564 0.2553 -0.0016 0.0288  -0.0073 369 LEU A C   
1174 O O   . LEU A 158 ? 0.2242 0.2535 0.2484 -0.0036 0.0289  -0.0073 369 LEU A O   
1175 C CB  . LEU A 158 ? 0.2128 0.2313 0.2343 -0.0056 0.0258  -0.0105 369 LEU A CB  
1176 C CG  . LEU A 158 ? 0.2003 0.2142 0.2216 -0.0080 0.0252  -0.0123 369 LEU A CG  
1177 C CD1 . LEU A 158 ? 0.2230 0.2410 0.2455 -0.0101 0.0232  -0.0136 369 LEU A CD1 
1178 C CD2 . LEU A 158 ? 0.1788 0.1858 0.1966 -0.0048 0.0242  -0.0118 369 LEU A CD2 
1179 N N   . ARG A 159 ? 0.2466 0.2665 0.2647 0.0027  0.0290  -0.0060 370 ARG A N   
1180 C CA  . ARG A 159 ? 0.2703 0.2954 0.2883 0.0058  0.0298  -0.0044 370 ARG A CA  
1181 C C   . ARG A 159 ? 0.2622 0.2855 0.2767 0.0105  0.0276  -0.0046 370 ARG A C   
1182 O O   . ARG A 159 ? 0.2656 0.2830 0.2765 0.0130  0.0267  -0.0051 370 ARG A O   
1183 C CB  . ARG A 159 ? 0.2775 0.3020 0.2948 0.0070  0.0326  -0.0026 370 ARG A CB  
1184 C CG  . ARG A 159 ? 0.3253 0.3493 0.3460 0.0022  0.0352  -0.0022 370 ARG A CG  
1185 C CD  . ARG A 159 ? 0.3732 0.3977 0.3941 0.0031  0.0384  0.0003  370 ARG A CD  
1186 N NE  . ARG A 159 ? 0.4164 0.4382 0.4405 -0.0015 0.0407  0.0004  370 ARG A NE  
1187 C CZ  . ARG A 159 ? 0.3967 0.4115 0.4196 -0.0016 0.0415  0.0006  370 ARG A CZ  
1188 N NH1 . ARG A 159 ? 0.3961 0.4065 0.4145 0.0025  0.0401  0.0008  370 ARG A NH1 
1189 N NH2 . ARG A 159 ? 0.4379 0.4501 0.4641 -0.0057 0.0440  0.0007  370 ARG A NH2 
1190 N N   . PRO A 160 ? 0.2577 0.2864 0.2734 0.0120  0.0267  -0.0042 371 PRO A N   
1191 C CA  . PRO A 160 ? 0.2639 0.2897 0.2765 0.0165  0.0248  -0.0045 371 PRO A CA  
1192 C C   . PRO A 160 ? 0.2696 0.2943 0.2789 0.0212  0.0259  -0.0040 371 PRO A C   
1193 O O   . PRO A 160 ? 0.2573 0.2871 0.2678 0.0216  0.0282  -0.0025 371 PRO A O   
1194 C CB  . PRO A 160 ? 0.2631 0.2953 0.2783 0.0168  0.0240  -0.0037 371 PRO A CB  
1195 C CG  . PRO A 160 ? 0.2757 0.3157 0.2950 0.0132  0.0258  -0.0028 371 PRO A CG  
1196 C CD  . PRO A 160 ? 0.2591 0.2964 0.2790 0.0095  0.0274  -0.0034 371 PRO A CD  
1197 N N   . LEU A 161 ? 0.2820 0.3004 0.2874 0.0244  0.0243  -0.0054 372 LEU A N   
1198 C CA  . LEU A 161 ? 0.2977 0.3149 0.2993 0.0290  0.0251  -0.0056 372 LEU A CA  
1199 C C   . LEU A 161 ? 0.3058 0.3238 0.3061 0.0335  0.0244  -0.0060 372 LEU A C   
1200 O O   . LEU A 161 ? 0.2994 0.3152 0.3003 0.0339  0.0226  -0.0066 372 LEU A O   
1201 C CB  . LEU A 161 ? 0.2958 0.3058 0.2935 0.0296  0.0238  -0.0073 372 LEU A CB  
1202 C CG  . LEU A 161 ? 0.3001 0.3093 0.2986 0.0263  0.0250  -0.0065 372 LEU A CG  
1203 C CD1 . LEU A 161 ? 0.3023 0.3059 0.2967 0.0278  0.0238  -0.0078 372 LEU A CD1 
1204 C CD2 . LEU A 161 ? 0.3082 0.3233 0.3084 0.0261  0.0284  -0.0040 372 LEU A CD2 
1205 N N   . ASP A 162 ? 0.3221 0.3429 0.3203 0.0374  0.0262  -0.0055 373 ASP A N   
1206 C CA  . ASP A 162 ? 0.3380 0.3596 0.3347 0.0425  0.0261  -0.0060 373 ASP A CA  
1207 C C   . ASP A 162 ? 0.3345 0.3471 0.3272 0.0448  0.0237  -0.0090 373 ASP A C   
1208 O O   . ASP A 162 ? 0.3354 0.3437 0.3246 0.0450  0.0231  -0.0107 373 ASP A O   
1209 C CB  . ASP A 162 ? 0.3575 0.3841 0.3525 0.0459  0.0287  -0.0050 373 ASP A CB  
1210 C CG  . ASP A 162 ? 0.3846 0.4142 0.3787 0.0513  0.0294  -0.0050 373 ASP A CG  
1211 O OD1 . ASP A 162 ? 0.3908 0.4155 0.3836 0.0540  0.0278  -0.0068 373 ASP A OD1 
1212 O OD2 . ASP A 162 ? 0.4753 0.5125 0.4705 0.0529  0.0320  -0.0030 373 ASP A OD2 
1213 N N   . HIS A 163 ? 0.3433 0.3535 0.3367 0.0465  0.0224  -0.0095 374 HIS A N   
1214 C CA  . HIS A 163 ? 0.3593 0.3607 0.3496 0.0483  0.0202  -0.0124 374 HIS A CA  
1215 C C   . HIS A 163 ? 0.3857 0.3846 0.3711 0.0533  0.0207  -0.0150 374 HIS A C   
1216 O O   . HIS A 163 ? 0.4011 0.3927 0.3832 0.0540  0.0190  -0.0181 374 HIS A O   
1217 C CB  . HIS A 163 ? 0.3697 0.3692 0.3623 0.0493  0.0191  -0.0118 374 HIS A CB  
1218 C CG  . HIS A 163 ? 0.3705 0.3708 0.3670 0.0444  0.0179  -0.0101 374 HIS A CG  
1219 N ND1 . HIS A 163 ? 0.3740 0.3699 0.3718 0.0442  0.0161  -0.0099 374 HIS A ND1 
1220 C CD2 . HIS A 163 ? 0.3764 0.3815 0.3756 0.0398  0.0182  -0.0086 374 HIS A CD2 
1221 C CE1 . HIS A 163 ? 0.3903 0.3890 0.3912 0.0397  0.0154  -0.0082 374 HIS A CE1 
1222 N NE2 . HIS A 163 ? 0.3924 0.3964 0.3941 0.0370  0.0166  -0.0077 374 HIS A NE2 
1223 N N   . GLU A 164 ? 0.3886 0.3938 0.3734 0.0566  0.0232  -0.0139 375 GLU A N   
1224 C CA  . GLU A 164 ? 0.4027 0.4069 0.3825 0.0615  0.0240  -0.0163 375 GLU A CA  
1225 C C   . GLU A 164 ? 0.3943 0.4005 0.3714 0.0603  0.0247  -0.0164 375 GLU A C   
1226 O O   . GLU A 164 ? 0.3971 0.4047 0.3701 0.0642  0.0258  -0.0178 375 GLU A O   
1227 C CB  . GLU A 164 ? 0.4137 0.4244 0.3942 0.0663  0.0265  -0.0148 375 GLU A CB  
1228 C CG  . GLU A 164 ? 0.4442 0.4523 0.4267 0.0689  0.0259  -0.0147 375 GLU A CG  
1229 C CD  . GLU A 164 ? 0.5358 0.5505 0.5188 0.0745  0.0285  -0.0133 375 GLU A CD  
1230 O OE1 . GLU A 164 ? 0.5357 0.5603 0.5219 0.0737  0.0304  -0.0098 375 GLU A OE1 
1231 O OE2 . GLU A 164 ? 0.5994 0.6094 0.5796 0.0798  0.0286  -0.0158 375 GLU A OE2 
1232 N N   . SER A 165 ? 0.3732 0.3796 0.3524 0.0553  0.0243  -0.0149 376 SER A N   
1233 C CA  . SER A 165 ? 0.3595 0.3679 0.3366 0.0544  0.0253  -0.0142 376 SER A CA  
1234 C C   . SER A 165 ? 0.3590 0.3612 0.3317 0.0547  0.0230  -0.0176 376 SER A C   
1235 O O   . SER A 165 ? 0.3686 0.3643 0.3408 0.0542  0.0205  -0.0203 376 SER A O   
1236 C CB  . SER A 165 ? 0.3679 0.3787 0.3493 0.0491  0.0260  -0.0112 376 SER A CB  
1237 O OG  . SER A 165 ? 0.3296 0.3350 0.3126 0.0452  0.0236  -0.0122 376 SER A OG  
1238 N N   . TYR A 166 ? 0.3528 0.3574 0.3223 0.0556  0.0239  -0.0173 377 TYR A N   
1239 C CA  . TYR A 166 ? 0.3481 0.3486 0.3138 0.0555  0.0218  -0.0200 377 TYR A CA  
1240 C C   . TYR A 166 ? 0.3506 0.3473 0.3191 0.0504  0.0200  -0.0194 377 TYR A C   
1241 O O   . TYR A 166 ? 0.3466 0.3382 0.3134 0.0495  0.0173  -0.0224 377 TYR A O   
1242 C CB  . TYR A 166 ? 0.3446 0.3500 0.3064 0.0580  0.0235  -0.0190 377 TYR A CB  
1243 C CG  . TYR A 166 ? 0.3347 0.3375 0.2928 0.0575  0.0212  -0.0213 377 TYR A CG  
1244 C CD1 . TYR A 166 ? 0.3052 0.3045 0.2588 0.0598  0.0189  -0.0262 377 TYR A CD1 
1245 C CD2 . TYR A 166 ? 0.3052 0.3090 0.2646 0.0546  0.0215  -0.0186 377 TYR A CD2 
1246 C CE1 . TYR A 166 ? 0.3353 0.3331 0.2857 0.0591  0.0166  -0.0285 377 TYR A CE1 
1247 C CE2 . TYR A 166 ? 0.3034 0.3057 0.2597 0.0543  0.0194  -0.0204 377 TYR A CE2 
1248 C CZ  . TYR A 166 ? 0.3210 0.3208 0.2729 0.0564  0.0168  -0.0253 377 TYR A CZ  
1249 O OH  . TYR A 166 ? 0.3200 0.3194 0.2690 0.0560  0.0146  -0.0272 377 TYR A OH  
1250 N N   . GLU A 167 ? 0.3520 0.3514 0.3247 0.0471  0.0216  -0.0158 378 GLU A N   
1251 C CA  . GLU A 167 ? 0.3559 0.3523 0.3317 0.0424  0.0203  -0.0151 378 GLU A CA  
1252 C C   . GLU A 167 ? 0.3390 0.3303 0.3162 0.0410  0.0177  -0.0174 378 GLU A C   
1253 O O   . GLU A 167 ? 0.3422 0.3292 0.3187 0.0393  0.0154  -0.0191 378 GLU A O   
1254 C CB  . GLU A 167 ? 0.3509 0.3509 0.3315 0.0391  0.0227  -0.0115 378 GLU A CB  
1255 C CG  . GLU A 167 ? 0.4037 0.4073 0.3840 0.0391  0.0253  -0.0086 378 GLU A CG  
1256 C CD  . GLU A 167 ? 0.5006 0.5093 0.4782 0.0433  0.0276  -0.0075 378 GLU A CD  
1257 O OE1 . GLU A 167 ? 0.5166 0.5277 0.4945 0.0454  0.0280  -0.0081 378 GLU A OE1 
1258 O OE2 . GLU A 167 ? 0.5232 0.5341 0.4983 0.0450  0.0290  -0.0059 378 GLU A OE2 
1259 N N   . PHE A 168 ? 0.3305 0.3227 0.3098 0.0419  0.0181  -0.0171 379 PHE A N   
1260 C CA  . PHE A 168 ? 0.3218 0.3092 0.3025 0.0412  0.0159  -0.0186 379 PHE A CA  
1261 C C   . PHE A 168 ? 0.3250 0.3064 0.3019 0.0433  0.0137  -0.0224 379 PHE A C   
1262 O O   . PHE A 168 ? 0.3031 0.2796 0.2808 0.0410  0.0114  -0.0238 379 PHE A O   
1263 C CB  . PHE A 168 ? 0.3235 0.3138 0.3067 0.0428  0.0171  -0.0172 379 PHE A CB  
1264 C CG  . PHE A 168 ? 0.3101 0.2966 0.2958 0.0416  0.0153  -0.0175 379 PHE A CG  
1265 C CD1 . PHE A 168 ? 0.3312 0.3200 0.3212 0.0379  0.0152  -0.0151 379 PHE A CD1 
1266 C CD2 . PHE A 168 ? 0.3234 0.3039 0.3070 0.0444  0.0138  -0.0200 379 PHE A CD2 
1267 C CE1 . PHE A 168 ? 0.3216 0.3077 0.3139 0.0371  0.0136  -0.0149 379 PHE A CE1 
1268 C CE2 . PHE A 168 ? 0.3006 0.2772 0.2867 0.0435  0.0124  -0.0197 379 PHE A CE2 
1269 C CZ  . PHE A 168 ? 0.3284 0.3080 0.3187 0.0399  0.0123  -0.0169 379 PHE A CZ  
1270 N N   . LYS A 169 ? 0.3273 0.3093 0.3000 0.0476  0.0143  -0.0244 380 LYS A N   
1271 C CA  . LYS A 169 ? 0.3372 0.3134 0.3063 0.0493  0.0122  -0.0288 380 LYS A CA  
1272 C C   . LYS A 169 ? 0.3177 0.2915 0.2854 0.0463  0.0100  -0.0303 380 LYS A C   
1273 O O   . LYS A 169 ? 0.3302 0.2985 0.2978 0.0449  0.0076  -0.0328 380 LYS A O   
1274 C CB  . LYS A 169 ? 0.3576 0.3357 0.3218 0.0544  0.0133  -0.0311 380 LYS A CB  
1275 C CG  . LYS A 169 ? 0.3938 0.3653 0.3541 0.0561  0.0111  -0.0364 380 LYS A CG  
1276 C CD  . LYS A 169 ? 0.4523 0.4267 0.4065 0.0597  0.0114  -0.0394 380 LYS A CD  
1277 C CE  . LYS A 169 ? 0.4744 0.4515 0.4269 0.0572  0.0102  -0.0392 380 LYS A CE  
1278 N NZ  . LYS A 169 ? 0.4345 0.4135 0.3809 0.0605  0.0097  -0.0430 380 LYS A NZ  
1279 N N   . VAL A 170 ? 0.3062 0.2845 0.2729 0.0456  0.0108  -0.0286 381 VAL A N   
1280 C CA  . VAL A 170 ? 0.3089 0.2860 0.2743 0.0434  0.0088  -0.0298 381 VAL A CA  
1281 C C   . VAL A 170 ? 0.2932 0.2673 0.2630 0.0387  0.0073  -0.0286 381 VAL A C   
1282 O O   . VAL A 170 ? 0.2643 0.2350 0.2337 0.0368  0.0048  -0.0308 381 VAL A O   
1283 C CB  . VAL A 170 ? 0.3214 0.3044 0.2855 0.0439  0.0106  -0.0271 381 VAL A CB  
1284 C CG1 . VAL A 170 ? 0.3514 0.3341 0.3131 0.0429  0.0085  -0.0287 381 VAL A CG1 
1285 C CG2 . VAL A 170 ? 0.3522 0.3396 0.3127 0.0485  0.0127  -0.0272 381 VAL A CG2 
1286 N N   . ILE A 171 ? 0.2764 0.2524 0.2502 0.0368  0.0089  -0.0253 382 ILE A N   
1287 C CA  . ILE A 171 ? 0.2806 0.2546 0.2584 0.0326  0.0078  -0.0241 382 ILE A CA  
1288 C C   . ILE A 171 ? 0.2827 0.2513 0.2614 0.0321  0.0056  -0.0262 382 ILE A C   
1289 O O   . ILE A 171 ? 0.2844 0.2499 0.2643 0.0293  0.0036  -0.0270 382 ILE A O   
1290 C CB  . ILE A 171 ? 0.2669 0.2446 0.2486 0.0307  0.0100  -0.0206 382 ILE A CB  
1291 C CG1 . ILE A 171 ? 0.2726 0.2539 0.2536 0.0305  0.0119  -0.0187 382 ILE A CG1 
1292 C CG2 . ILE A 171 ? 0.2694 0.2454 0.2549 0.0267  0.0088  -0.0197 382 ILE A CG2 
1293 C CD1 . ILE A 171 ? 0.3085 0.2932 0.2929 0.0288  0.0144  -0.0157 382 ILE A CD1 
1294 N N   . SER A 172 ? 0.3037 0.2708 0.2817 0.0350  0.0062  -0.0270 383 SER A N   
1295 C CA  . SER A 172 ? 0.3113 0.2722 0.2899 0.0351  0.0044  -0.0291 383 SER A CA  
1296 C C   . SER A 172 ? 0.2991 0.2555 0.2749 0.0347  0.0020  -0.0330 383 SER A C   
1297 O O   . SER A 172 ? 0.2795 0.2313 0.2572 0.0323  0.0001  -0.0338 383 SER A O   
1298 C CB  . SER A 172 ? 0.3201 0.2801 0.2983 0.0390  0.0056  -0.0294 383 SER A CB  
1299 O OG  . SER A 172 ? 0.3693 0.3339 0.3510 0.0385  0.0074  -0.0256 383 SER A OG  
1300 N N   . GLN A 173 ? 0.3030 0.2611 0.2744 0.0371  0.0020  -0.0354 384 GLN A N   
1301 C CA  . GLN A 173 ? 0.3200 0.2747 0.2885 0.0364  -0.0005 -0.0396 384 GLN A CA  
1302 C C   . GLN A 173 ? 0.2980 0.2541 0.2682 0.0324  -0.0022 -0.0388 384 GLN A C   
1303 O O   . GLN A 173 ? 0.3010 0.2533 0.2714 0.0301  -0.0047 -0.0413 384 GLN A O   
1304 C CB  . GLN A 173 ? 0.3390 0.2965 0.3021 0.0401  -0.0001 -0.0424 384 GLN A CB  
1305 C CG  . GLN A 173 ? 0.3792 0.3337 0.3401 0.0442  0.0008  -0.0450 384 GLN A CG  
1306 C CD  . GLN A 173 ? 0.4165 0.3741 0.3715 0.0481  0.0012  -0.0482 384 GLN A CD  
1307 O OE1 . GLN A 173 ? 0.4483 0.4103 0.4007 0.0476  0.0004  -0.0489 384 GLN A OE1 
1308 N NE2 . GLN A 173 ? 0.4318 0.3877 0.3847 0.0522  0.0025  -0.0502 384 GLN A NE2 
1309 N N   . TYR A 174 ? 0.2909 0.2523 0.2622 0.0315  -0.0008 -0.0353 385 TYR A N   
1310 C CA  . TYR A 174 ? 0.2709 0.2338 0.2442 0.0280  -0.0019 -0.0339 385 TYR A CA  
1311 C C   . TYR A 174 ? 0.2654 0.2242 0.2429 0.0245  -0.0033 -0.0333 385 TYR A C   
1312 O O   . TYR A 174 ? 0.2797 0.2368 0.2579 0.0220  -0.0055 -0.0348 385 TYR A O   
1313 C CB  . TYR A 174 ? 0.2663 0.2343 0.2410 0.0278  0.0005  -0.0299 385 TYR A CB  
1314 C CG  . TYR A 174 ? 0.2412 0.2116 0.2170 0.0254  -0.0001 -0.0285 385 TYR A CG  
1315 C CD1 . TYR A 174 ? 0.2314 0.2013 0.2063 0.0241  -0.0028 -0.0307 385 TYR A CD1 
1316 C CD2 . TYR A 174 ? 0.2202 0.1939 0.1980 0.0248  0.0023  -0.0249 385 TYR A CD2 
1317 C CE1 . TYR A 174 ? 0.2244 0.1972 0.2005 0.0224  -0.0031 -0.0290 385 TYR A CE1 
1318 C CE2 . TYR A 174 ? 0.2042 0.1798 0.1829 0.0233  0.0021  -0.0235 385 TYR A CE2 
1319 C CZ  . TYR A 174 ? 0.2091 0.1846 0.1871 0.0222  -0.0006 -0.0254 385 TYR A CZ  
1320 O OH  . TYR A 174 ? 0.1951 0.1731 0.1742 0.0210  -0.0007 -0.0237 385 TYR A OH  
1321 N N   . LEU A 175 ? 0.2447 0.2028 0.2251 0.0244  -0.0018 -0.0309 386 LEU A N   
1322 C CA  . LEU A 175 ? 0.2378 0.1930 0.2222 0.0215  -0.0027 -0.0296 386 LEU A CA  
1323 C C   . LEU A 175 ? 0.2434 0.1923 0.2277 0.0208  -0.0050 -0.0326 386 LEU A C   
1324 O O   . LEU A 175 ? 0.2225 0.1697 0.2090 0.0175  -0.0068 -0.0326 386 LEU A O   
1325 C CB  . LEU A 175 ? 0.2359 0.1921 0.2225 0.0228  -0.0007 -0.0271 386 LEU A CB  
1326 C CG  . LEU A 175 ? 0.2269 0.1813 0.2175 0.0205  -0.0013 -0.0250 386 LEU A CG  
1327 C CD1 . LEU A 175 ? 0.1791 0.1364 0.1723 0.0164  -0.0017 -0.0231 386 LEU A CD1 
1328 C CD2 . LEU A 175 ? 0.1777 0.1341 0.1697 0.0226  0.0006  -0.0229 386 LEU A CD2 
1329 N N   . GLN A 176 ? 0.2500 0.1954 0.2317 0.0239  -0.0049 -0.0352 387 GLN A N   
1330 C CA  . GLN A 176 ? 0.2692 0.2075 0.2509 0.0233  -0.0068 -0.0384 387 GLN A CA  
1331 C C   . GLN A 176 ? 0.2697 0.2072 0.2492 0.0216  -0.0092 -0.0421 387 GLN A C   
1332 O O   . GLN A 176 ? 0.2819 0.2154 0.2636 0.0185  -0.0111 -0.0432 387 GLN A O   
1333 C CB  . GLN A 176 ? 0.2821 0.2164 0.2616 0.0276  -0.0057 -0.0405 387 GLN A CB  
1334 C CG  . GLN A 176 ? 0.3102 0.2452 0.2922 0.0295  -0.0035 -0.0367 387 GLN A CG  
1335 C CD  . GLN A 176 ? 0.3285 0.2619 0.3154 0.0264  -0.0039 -0.0333 387 GLN A CD  
1336 O OE1 . GLN A 176 ? 0.3528 0.2813 0.3414 0.0236  -0.0058 -0.0343 387 GLN A OE1 
1337 N NE2 . GLN A 176 ? 0.3348 0.2728 0.3242 0.0268  -0.0022 -0.0292 387 GLN A NE2 
1338 N N   . SER A 177 ? 0.2789 0.2206 0.2542 0.0237  -0.0091 -0.0441 388 SER A N   
1339 C CA  . SER A 177 ? 0.2817 0.2237 0.2542 0.0226  -0.0114 -0.0483 388 SER A CA  
1340 C C   . SER A 177 ? 0.2742 0.2195 0.2491 0.0186  -0.0132 -0.0469 388 SER A C   
1341 O O   . SER A 177 ? 0.2742 0.2190 0.2484 0.0165  -0.0157 -0.0502 388 SER A O   
1342 C CB  . SER A 177 ? 0.2902 0.2374 0.2575 0.0264  -0.0106 -0.0499 388 SER A CB  
1343 O OG  . SER A 177 ? 0.2508 0.2053 0.2183 0.0266  -0.0093 -0.0461 388 SER A OG  
1344 N N   . THR A 178 ? 0.2711 0.2202 0.2489 0.0174  -0.0118 -0.0423 389 THR A N   
1345 C CA  . THR A 178 ? 0.2614 0.2137 0.2418 0.0139  -0.0131 -0.0407 389 THR A CA  
1346 C C   . THR A 178 ? 0.2712 0.2206 0.2568 0.0105  -0.0133 -0.0382 389 THR A C   
1347 O O   . THR A 178 ? 0.2793 0.2322 0.2675 0.0081  -0.0134 -0.0355 389 THR A O   
1348 C CB  . THR A 178 ? 0.2539 0.2131 0.2336 0.0150  -0.0114 -0.0376 389 THR A CB  
1349 O OG1 . THR A 178 ? 0.2093 0.1690 0.1911 0.0157  -0.0088 -0.0340 389 THR A OG1 
1350 C CG2 . THR A 178 ? 0.2163 0.1791 0.1911 0.0185  -0.0111 -0.0395 389 THR A CG2 
1351 N N   . HIS A 179 ? 0.2764 0.2197 0.2632 0.0106  -0.0133 -0.0387 390 HIS A N   
1352 C CA  . HIS A 179 ? 0.2867 0.2272 0.2781 0.0073  -0.0138 -0.0365 390 HIS A CA  
1353 C C   . HIS A 179 ? 0.2971 0.2356 0.2898 0.0036  -0.0166 -0.0390 390 HIS A C   
1354 O O   . HIS A 179 ? 0.3010 0.2351 0.2920 0.0037  -0.0180 -0.0431 390 HIS A O   
1355 C CB  . HIS A 179 ? 0.2925 0.2275 0.2851 0.0089  -0.0127 -0.0357 390 HIS A CB  
1356 C CG  . HIS A 179 ? 0.2960 0.2292 0.2933 0.0063  -0.0126 -0.0322 390 HIS A CG  
1357 N ND1 . HIS A 179 ? 0.2743 0.2073 0.2733 0.0078  -0.0108 -0.0289 390 HIS A ND1 
1358 C CD2 . HIS A 179 ? 0.2583 0.1907 0.2589 0.0022  -0.0142 -0.0314 390 HIS A CD2 
1359 C CE1 . HIS A 179 ? 0.2737 0.2058 0.2767 0.0050  -0.0112 -0.0261 390 HIS A CE1 
1360 N NE2 . HIS A 179 ? 0.2713 0.2029 0.2754 0.0015  -0.0132 -0.0274 390 HIS A NE2 
1361 N N   . ALA A 180 ? 0.3032 0.2454 0.2990 0.0003  -0.0174 -0.0367 391 ALA A N   
1362 C CA  . ALA A 180 ? 0.3119 0.2545 0.3088 -0.0032 -0.0201 -0.0392 391 ALA A CA  
1363 C C   . ALA A 180 ? 0.3228 0.2579 0.3224 -0.0059 -0.0214 -0.0404 391 ALA A C   
1364 O O   . ALA A 180 ? 0.3261 0.2573 0.3282 -0.0058 -0.0201 -0.0377 391 ALA A O   
1365 C CB  . ALA A 180 ? 0.2906 0.2397 0.2902 -0.0057 -0.0205 -0.0363 391 ALA A CB  
1366 N N   . PRO A 181 ? 0.3537 0.2872 0.3532 -0.0084 -0.0239 -0.0445 392 PRO A N   
1367 C CA  . PRO A 181 ? 0.3722 0.2977 0.3745 -0.0113 -0.0250 -0.0461 392 PRO A CA  
1368 C C   . PRO A 181 ? 0.3771 0.3033 0.3850 -0.0152 -0.0251 -0.0417 392 PRO A C   
1369 O O   . PRO A 181 ? 0.3881 0.3076 0.3990 -0.0166 -0.0248 -0.0406 392 PRO A O   
1370 C CB  . PRO A 181 ? 0.3810 0.3067 0.3815 -0.0135 -0.0278 -0.0518 392 PRO A CB  
1371 C CG  . PRO A 181 ? 0.3666 0.3026 0.3655 -0.0131 -0.0285 -0.0512 392 PRO A CG  
1372 C CD  . PRO A 181 ? 0.3594 0.2981 0.3556 -0.0083 -0.0257 -0.0481 392 PRO A CD  
1373 N N   . THR A 182 ? 0.3813 0.3158 0.3906 -0.0165 -0.0251 -0.0388 393 THR A N   
1374 C CA  . THR A 182 ? 0.3722 0.3082 0.3868 -0.0201 -0.0251 -0.0346 393 THR A CA  
1375 C C   . THR A 182 ? 0.3560 0.2919 0.3720 -0.0183 -0.0226 -0.0297 393 THR A C   
1376 O O   . THR A 182 ? 0.3688 0.3055 0.3890 -0.0209 -0.0223 -0.0260 393 THR A O   
1377 C CB  . THR A 182 ? 0.3715 0.3160 0.3877 -0.0228 -0.0264 -0.0339 393 THR A CB  
1378 O OG1 . THR A 182 ? 0.3778 0.3290 0.3910 -0.0196 -0.0253 -0.0330 393 THR A OG1 
1379 C CG2 . THR A 182 ? 0.3979 0.3423 0.4137 -0.0255 -0.0294 -0.0388 393 THR A CG2 
1380 N N   . HIS A 183 ? 0.3376 0.2729 0.3504 -0.0140 -0.0207 -0.0296 394 HIS A N   
1381 C CA  . HIS A 183 ? 0.3062 0.2427 0.3203 -0.0124 -0.0184 -0.0251 394 HIS A CA  
1382 C C   . HIS A 183 ? 0.3020 0.2309 0.3160 -0.0103 -0.0175 -0.0251 394 HIS A C   
1383 O O   . HIS A 183 ? 0.2979 0.2273 0.3101 -0.0068 -0.0157 -0.0241 394 HIS A O   
1384 C CB  . HIS A 183 ? 0.2918 0.2345 0.3030 -0.0093 -0.0168 -0.0244 394 HIS A CB  
1385 C CG  . HIS A 183 ? 0.2681 0.2177 0.2791 -0.0106 -0.0173 -0.0245 394 HIS A CG  
1386 N ND1 . HIS A 183 ? 0.1998 0.1533 0.2074 -0.0080 -0.0166 -0.0256 394 HIS A ND1 
1387 C CD2 . HIS A 183 ? 0.2543 0.2077 0.2682 -0.0139 -0.0184 -0.0232 394 HIS A CD2 
1388 C CE1 . HIS A 183 ? 0.2367 0.1958 0.2451 -0.0095 -0.0172 -0.0251 394 HIS A CE1 
1389 N NE2 . HIS A 183 ? 0.2418 0.2012 0.2540 -0.0131 -0.0183 -0.0238 394 HIS A NE2 
1390 N N   . SER A 184 ? 0.2997 0.2216 0.3160 -0.0124 -0.0186 -0.0261 395 SER A N   
1391 C CA  . SER A 184 ? 0.2993 0.2125 0.3157 -0.0103 -0.0177 -0.0265 395 SER A CA  
1392 C C   . SER A 184 ? 0.2985 0.2104 0.3186 -0.0100 -0.0161 -0.0209 395 SER A C   
1393 O O   . SER A 184 ? 0.2920 0.1961 0.3131 -0.0085 -0.0154 -0.0205 395 SER A O   
1394 C CB  . SER A 184 ? 0.3109 0.2161 0.3282 -0.0129 -0.0196 -0.0305 395 SER A CB  
1395 O OG  . SER A 184 ? 0.3060 0.2117 0.3281 -0.0178 -0.0206 -0.0280 395 SER A OG  
1396 N N   . ASP A 185 ? 0.2853 0.2046 0.3075 -0.0114 -0.0155 -0.0166 396 ASP A N   
1397 C CA  . ASP A 185 ? 0.2748 0.1949 0.2999 -0.0108 -0.0139 -0.0111 396 ASP A CA  
1398 C C   . ASP A 185 ? 0.2670 0.1882 0.2900 -0.0060 -0.0120 -0.0098 396 ASP A C   
1399 O O   . ASP A 185 ? 0.2755 0.1964 0.3007 -0.0047 -0.0107 -0.0056 396 ASP A O   
1400 C CB  . ASP A 185 ? 0.2737 0.2022 0.3016 -0.0137 -0.0139 -0.0072 396 ASP A CB  
1401 C CG  . ASP A 185 ? 0.2760 0.2129 0.3014 -0.0134 -0.0138 -0.0085 396 ASP A CG  
1402 O OD1 . ASP A 185 ? 0.2809 0.2178 0.3039 -0.0139 -0.0150 -0.0125 396 ASP A OD1 
1403 O OD2 . ASP A 185 ? 0.2797 0.2231 0.3053 -0.0126 -0.0124 -0.0056 396 ASP A OD2 
1404 N N   . TYR A 186 ? 0.2508 0.1740 0.2698 -0.0034 -0.0117 -0.0130 397 TYR A N   
1405 C CA  . TYR A 186 ? 0.2332 0.1578 0.2503 0.0010  -0.0099 -0.0122 397 TYR A CA  
1406 C C   . TYR A 186 ? 0.2333 0.1556 0.2461 0.0037  -0.0100 -0.0170 397 TYR A C   
1407 O O   . TYR A 186 ? 0.2264 0.1481 0.2374 0.0022  -0.0114 -0.0207 397 TYR A O   
1408 C CB  . TYR A 186 ? 0.2391 0.1735 0.2562 0.0011  -0.0087 -0.0094 397 TYR A CB  
1409 C CG  . TYR A 186 ? 0.2036 0.1433 0.2187 -0.0003 -0.0093 -0.0118 397 TYR A CG  
1410 C CD1 . TYR A 186 ? 0.2255 0.1673 0.2372 0.0022  -0.0085 -0.0141 397 TYR A CD1 
1411 C CD2 . TYR A 186 ? 0.2203 0.1628 0.2370 -0.0040 -0.0104 -0.0113 397 TYR A CD2 
1412 C CE1 . TYR A 186 ? 0.2093 0.1554 0.2192 0.0012  -0.0088 -0.0159 397 TYR A CE1 
1413 C CE2 . TYR A 186 ? 0.2112 0.1582 0.2262 -0.0049 -0.0107 -0.0132 397 TYR A CE2 
1414 C CZ  . TYR A 186 ? 0.2321 0.1806 0.2437 -0.0022 -0.0098 -0.0154 397 TYR A CZ  
1415 O OH  . TYR A 186 ? 0.2010 0.1537 0.2110 -0.0027 -0.0099 -0.0168 397 TYR A OH  
1416 N N   . THR A 187 ? 0.2465 0.1682 0.2578 0.0079  -0.0084 -0.0167 398 THR A N   
1417 C CA  . THR A 187 ? 0.2467 0.1693 0.2537 0.0111  -0.0079 -0.0201 398 THR A CA  
1418 C C   . THR A 187 ? 0.2512 0.1821 0.2580 0.0129  -0.0061 -0.0173 398 THR A C   
1419 O O   . THR A 187 ? 0.2452 0.1802 0.2549 0.0121  -0.0053 -0.0132 398 THR A O   
1420 C CB  . THR A 187 ? 0.2571 0.1721 0.2624 0.0149  -0.0073 -0.0226 398 THR A CB  
1421 O OG1 . THR A 187 ? 0.2633 0.1782 0.2707 0.0176  -0.0056 -0.0185 398 THR A OG1 
1422 C CG2 . THR A 187 ? 0.2449 0.1503 0.2506 0.0129  -0.0090 -0.0262 398 THR A CG2 
1423 N N   . MET A 188 ? 0.2551 0.1887 0.2586 0.0153  -0.0053 -0.0196 399 MET A N   
1424 C CA  . MET A 188 ? 0.2598 0.2011 0.2630 0.0164  -0.0036 -0.0175 399 MET A CA  
1425 C C   . MET A 188 ? 0.2708 0.2121 0.2718 0.0211  -0.0020 -0.0184 399 MET A C   
1426 O O   . MET A 188 ? 0.2551 0.1923 0.2530 0.0232  -0.0023 -0.0220 399 MET A O   
1427 C CB  . MET A 188 ? 0.2608 0.2064 0.2623 0.0145  -0.0039 -0.0190 399 MET A CB  
1428 C CG  . MET A 188 ? 0.2804 0.2287 0.2846 0.0103  -0.0048 -0.0173 399 MET A CG  
1429 S SD  . MET A 188 ? 0.2728 0.2267 0.2753 0.0089  -0.0046 -0.0185 399 MET A SD  
1430 C CE  . MET A 188 ? 0.2566 0.2059 0.2559 0.0092  -0.0064 -0.0227 399 MET A CE  
1431 N N   . THR A 189 ? 0.2762 0.2227 0.2787 0.0226  -0.0004 -0.0153 400 THR A N   
1432 C CA  . THR A 189 ? 0.2811 0.2294 0.2822 0.0270  0.0013  -0.0153 400 THR A CA  
1433 C C   . THR A 189 ? 0.2778 0.2349 0.2790 0.0261  0.0026  -0.0141 400 THR A C   
1434 O O   . THR A 189 ? 0.2534 0.2155 0.2572 0.0234  0.0026  -0.0116 400 THR A O   
1435 C CB  . THR A 189 ? 0.2887 0.2362 0.2923 0.0296  0.0022  -0.0122 400 THR A CB  
1436 O OG1 . THR A 189 ? 0.3007 0.2387 0.3046 0.0301  0.0011  -0.0134 400 THR A OG1 
1437 C CG2 . THR A 189 ? 0.2909 0.2420 0.2934 0.0345  0.0042  -0.0117 400 THR A CG2 
1438 N N   . LEU A 190 ? 0.2748 0.2336 0.2731 0.0283  0.0036  -0.0160 401 LEU A N   
1439 C CA  . LEU A 190 ? 0.2723 0.2385 0.2707 0.0275  0.0051  -0.0150 401 LEU A CA  
1440 C C   . LEU A 190 ? 0.2785 0.2502 0.2789 0.0297  0.0067  -0.0124 401 LEU A C   
1441 O O   . LEU A 190 ? 0.2841 0.2553 0.2832 0.0337  0.0077  -0.0128 401 LEU A O   
1442 C CB  . LEU A 190 ? 0.2781 0.2442 0.2728 0.0293  0.0057  -0.0176 401 LEU A CB  
1443 C CG  . LEU A 190 ? 0.2727 0.2456 0.2675 0.0282  0.0075  -0.0165 401 LEU A CG  
1444 C CD1 . LEU A 190 ? 0.2601 0.2351 0.2571 0.0237  0.0071  -0.0154 401 LEU A CD1 
1445 C CD2 . LEU A 190 ? 0.2626 0.2349 0.2535 0.0304  0.0081  -0.0187 401 LEU A CD2 
1446 N N   . LEU A 191 ? 0.2762 0.2539 0.2797 0.0270  0.0070  -0.0098 402 LEU A N   
1447 C CA  . LEU A 191 ? 0.2745 0.2592 0.2802 0.0286  0.0084  -0.0071 402 LEU A CA  
1448 C C   . LEU A 191 ? 0.2739 0.2654 0.2794 0.0288  0.0103  -0.0072 402 LEU A C   
1449 O O   . LEU A 191 ? 0.2828 0.2788 0.2889 0.0318  0.0117  -0.0060 402 LEU A O   
1450 C CB  . LEU A 191 ? 0.2697 0.2587 0.2788 0.0257  0.0078  -0.0045 402 LEU A CB  
1451 C CG  . LEU A 191 ? 0.2808 0.2648 0.2910 0.0258  0.0064  -0.0031 402 LEU A CG  
1452 C CD1 . LEU A 191 ? 0.2863 0.2772 0.2998 0.0230  0.0061  -0.0001 402 LEU A CD1 
1453 C CD2 . LEU A 191 ? 0.2787 0.2586 0.2888 0.0308  0.0068  -0.0021 402 LEU A CD2 
1454 N N   . ASP A 192 ? 0.2562 0.2487 0.2612 0.0257  0.0106  -0.0084 403 ASP A N   
1455 C CA  . ASP A 192 ? 0.2446 0.2429 0.2497 0.0253  0.0126  -0.0082 403 ASP A CA  
1456 C C   . ASP A 192 ? 0.2359 0.2322 0.2397 0.0228  0.0128  -0.0096 403 ASP A C   
1457 O O   . ASP A 192 ? 0.2413 0.2333 0.2445 0.0207  0.0114  -0.0106 403 ASP A O   
1458 C CB  . ASP A 192 ? 0.2515 0.2584 0.2604 0.0233  0.0135  -0.0061 403 ASP A CB  
1459 C CG  . ASP A 192 ? 0.2588 0.2724 0.2684 0.0247  0.0157  -0.0052 403 ASP A CG  
1460 O OD1 . ASP A 192 ? 0.3210 0.3330 0.3283 0.0268  0.0168  -0.0060 403 ASP A OD1 
1461 O OD2 . ASP A 192 ? 0.3098 0.3315 0.3227 0.0235  0.0163  -0.0035 403 ASP A OD2 
1462 N N   . LEU A 193 ? 0.2338 0.2333 0.2370 0.0231  0.0148  -0.0095 404 LEU A N   
1463 C CA  . LEU A 193 ? 0.2202 0.2174 0.2217 0.0217  0.0153  -0.0105 404 LEU A CA  
1464 C C   . LEU A 193 ? 0.2353 0.2380 0.2389 0.0197  0.0178  -0.0092 404 LEU A C   
1465 O O   . LEU A 193 ? 0.2283 0.2362 0.2330 0.0211  0.0194  -0.0080 404 LEU A O   
1466 C CB  . LEU A 193 ? 0.2293 0.2227 0.2267 0.0255  0.0152  -0.0119 404 LEU A CB  
1467 C CG  . LEU A 193 ? 0.1803 0.1726 0.1757 0.0250  0.0160  -0.0123 404 LEU A CG  
1468 C CD1 . LEU A 193 ? 0.1938 0.1818 0.1890 0.0225  0.0142  -0.0133 404 LEU A CD1 
1469 C CD2 . LEU A 193 ? 0.2069 0.1979 0.1982 0.0293  0.0162  -0.0135 404 LEU A CD2 
1470 N N   . PHE A 194 ? 0.2253 0.2270 0.2299 0.0162  0.0181  -0.0094 405 PHE A N   
1471 C CA  . PHE A 194 ? 0.2312 0.2367 0.2381 0.0136  0.0206  -0.0085 405 PHE A CA  
1472 C C   . PHE A 194 ? 0.2337 0.2358 0.2390 0.0134  0.0218  -0.0084 405 PHE A C   
1473 O O   . PHE A 194 ? 0.2262 0.2237 0.2299 0.0133  0.0206  -0.0093 405 PHE A O   
1474 C CB  . PHE A 194 ? 0.2294 0.2376 0.2398 0.0092  0.0205  -0.0087 405 PHE A CB  
1475 C CG  . PHE A 194 ? 0.2211 0.2337 0.2333 0.0093  0.0192  -0.0083 405 PHE A CG  
1476 C CD1 . PHE A 194 ? 0.2427 0.2628 0.2577 0.0084  0.0205  -0.0073 405 PHE A CD1 
1477 C CD2 . PHE A 194 ? 0.2262 0.2360 0.2375 0.0104  0.0169  -0.0085 405 PHE A CD2 
1478 C CE1 . PHE A 194 ? 0.2681 0.2930 0.2847 0.0090  0.0193  -0.0065 405 PHE A CE1 
1479 C CE2 . PHE A 194 ? 0.2280 0.2418 0.2409 0.0110  0.0159  -0.0075 405 PHE A CE2 
1480 C CZ  . PHE A 194 ? 0.2493 0.2708 0.2648 0.0105  0.0170  -0.0064 405 PHE A CZ  
1481 N N   . GLU A 195 ? 0.2420 0.2468 0.2479 0.0135  0.0245  -0.0070 406 GLU A N   
1482 C CA  . GLU A 195 ? 0.2556 0.2580 0.2611 0.0129  0.0262  -0.0063 406 GLU A CA  
1483 C C   . GLU A 195 ? 0.2336 0.2352 0.2424 0.0081  0.0270  -0.0067 406 GLU A C   
1484 O O   . GLU A 195 ? 0.2196 0.2250 0.2317 0.0052  0.0273  -0.0071 406 GLU A O   
1485 C CB  . GLU A 195 ? 0.2691 0.2750 0.2747 0.0143  0.0290  -0.0042 406 GLU A CB  
1486 C CG  . GLU A 195 ? 0.3395 0.3434 0.3451 0.0136  0.0315  -0.0025 406 GLU A CG  
1487 C CD  . GLU A 195 ? 0.4316 0.4399 0.4376 0.0152  0.0345  0.0000  406 GLU A CD  
1488 O OE1 . GLU A 195 ? 0.4674 0.4761 0.4764 0.0125  0.0374  0.0018  406 GLU A OE1 
1489 O OE2 . GLU A 195 ? 0.4342 0.4453 0.4376 0.0191  0.0341  0.0002  406 GLU A OE2 
1490 N N   . VAL A 196 ? 0.2230 0.2201 0.2310 0.0076  0.0273  -0.0067 407 VAL A N   
1491 C CA  . VAL A 196 ? 0.2104 0.2057 0.2210 0.0038  0.0281  -0.0074 407 VAL A CA  
1492 C C   . VAL A 196 ? 0.2108 0.2039 0.2222 0.0034  0.0313  -0.0057 407 VAL A C   
1493 O O   . VAL A 196 ? 0.2075 0.1982 0.2162 0.0064  0.0316  -0.0044 407 VAL A O   
1494 C CB  . VAL A 196 ? 0.2017 0.1932 0.2110 0.0037  0.0258  -0.0088 407 VAL A CB  
1495 C CG1 . VAL A 196 ? 0.1894 0.1793 0.2014 0.0000  0.0269  -0.0098 407 VAL A CG1 
1496 C CG2 . VAL A 196 ? 0.2278 0.2205 0.2363 0.0043  0.0228  -0.0100 407 VAL A CG2 
1497 N N   . GLU A 197 ? 0.2148 0.2086 0.2298 -0.0003 0.0336  -0.0059 408 GLU A N   
1498 C CA  . GLU A 197 ? 0.2279 0.2184 0.2443 -0.0012 0.0369  -0.0042 408 GLU A CA  
1499 C C   . GLU A 197 ? 0.2373 0.2255 0.2570 -0.0055 0.0381  -0.0061 408 GLU A C   
1500 O O   . GLU A 197 ? 0.2321 0.2229 0.2552 -0.0093 0.0393  -0.0072 408 GLU A O   
1501 C CB  . GLU A 197 ? 0.2424 0.2362 0.2605 -0.0012 0.0398  -0.0018 408 GLU A CB  
1502 C CG  . GLU A 197 ? 0.2781 0.2680 0.2972 -0.0012 0.0434  0.0008  408 GLU A CG  
1503 C CD  . GLU A 197 ? 0.3573 0.3509 0.3777 -0.0007 0.0462  0.0038  408 GLU A CD  
1504 O OE1 . GLU A 197 ? 0.3744 0.3651 0.3966 -0.0015 0.0497  0.0064  408 GLU A OE1 
1505 O OE2 . GLU A 197 ? 0.4180 0.4173 0.4377 0.0005  0.0452  0.0039  408 GLU A OE2 
1506 N N   . LYS A 198 ? 0.2457 0.2293 0.2643 -0.0049 0.0376  -0.0067 409 LYS A N   
1507 C CA  . LYS A 198 ? 0.2555 0.2365 0.2767 -0.0085 0.0385  -0.0089 409 LYS A CA  
1508 C C   . LYS A 198 ? 0.2528 0.2293 0.2764 -0.0099 0.0427  -0.0075 409 LYS A C   
1509 O O   . LYS A 198 ? 0.2507 0.2238 0.2730 -0.0068 0.0442  -0.0047 409 LYS A O   
1510 C CB  . LYS A 198 ? 0.2560 0.2342 0.2750 -0.0068 0.0364  -0.0098 409 LYS A CB  
1511 C CG  . LYS A 198 ? 0.2861 0.2606 0.3070 -0.0093 0.0378  -0.0117 409 LYS A CG  
1512 C CD  . LYS A 198 ? 0.3476 0.3257 0.3705 -0.0132 0.0369  -0.0150 409 LYS A CD  
1513 C CE  . LYS A 198 ? 0.3859 0.3606 0.4110 -0.0162 0.0389  -0.0175 409 LYS A CE  
1514 N NZ  . LYS A 198 ? 0.4043 0.3834 0.4319 -0.0207 0.0388  -0.0205 409 LYS A NZ  
1515 N N   . ASP A 199 ? 0.2757 0.2523 0.3031 -0.0145 0.0446  -0.0096 410 ASP A N   
1516 C CA  . ASP A 199 ? 0.3004 0.2720 0.3308 -0.0164 0.0489  -0.0085 410 ASP A CA  
1517 C C   . ASP A 199 ? 0.2919 0.2565 0.3210 -0.0136 0.0502  -0.0071 410 ASP A C   
1518 O O   . ASP A 199 ? 0.2940 0.2574 0.3220 -0.0132 0.0485  -0.0091 410 ASP A O   
1519 C CB  . ASP A 199 ? 0.3148 0.2865 0.3491 -0.0221 0.0501  -0.0124 410 ASP A CB  
1520 C CG  . ASP A 199 ? 0.3698 0.3488 0.4064 -0.0254 0.0497  -0.0134 410 ASP A CG  
1521 O OD1 . ASP A 199 ? 0.4156 0.3995 0.4509 -0.0230 0.0485  -0.0109 410 ASP A OD1 
1522 O OD2 . ASP A 199 ? 0.4175 0.3980 0.4574 -0.0304 0.0504  -0.0169 410 ASP A OD2 
1523 N N   . GLY A 200 ? 0.3004 0.2615 0.3298 -0.0113 0.0532  -0.0032 411 GLY A N   
1524 C CA  . GLY A 200 ? 0.3012 0.2558 0.3300 -0.0087 0.0551  -0.0013 411 GLY A CA  
1525 C C   . GLY A 200 ? 0.3068 0.2627 0.3311 -0.0031 0.0528  0.0013  411 GLY A C   
1526 O O   . GLY A 200 ? 0.2918 0.2439 0.3155 0.0001  0.0548  0.0045  411 GLY A O   
1527 N N   . GLU A 201 ? 0.3020 0.2634 0.3234 -0.0019 0.0488  0.0001  412 GLU A N   
1528 C CA  . GLU A 201 ? 0.3094 0.2719 0.3268 0.0027  0.0463  0.0016  412 GLU A CA  
1529 C C   . GLU A 201 ? 0.3193 0.2827 0.3347 0.0066  0.0478  0.0061  412 GLU A C   
1530 O O   . GLU A 201 ? 0.3216 0.2839 0.3349 0.0103  0.0477  0.0084  412 GLU A O   
1531 C CB  . GLU A 201 ? 0.3077 0.2750 0.3227 0.0029  0.0418  -0.0009 412 GLU A CB  
1532 C CG  . GLU A 201 ? 0.2967 0.2633 0.3122 0.0008  0.0397  -0.0042 412 GLU A CG  
1533 C CD  . GLU A 201 ? 0.2521 0.2225 0.2650 0.0019  0.0353  -0.0057 412 GLU A CD  
1534 O OE1 . GLU A 201 ? 0.2294 0.2029 0.2406 0.0031  0.0338  -0.0053 412 GLU A OE1 
1535 O OE2 . GLU A 201 ? 0.2955 0.2653 0.3081 0.0016  0.0336  -0.0073 412 GLU A OE2 
1536 N N   . LYS A 202 ? 0.3287 0.2948 0.3447 0.0061  0.0491  0.0075  413 LYS A N   
1537 C CA  . LYS A 202 ? 0.3506 0.3184 0.3646 0.0099  0.0506  0.0118  413 LYS A CA  
1538 C C   . LYS A 202 ? 0.3584 0.3213 0.3739 0.0114  0.0546  0.0157  413 LYS A C   
1539 O O   . LYS A 202 ? 0.3667 0.3304 0.3794 0.0158  0.0547  0.0190  413 LYS A O   
1540 C CB  . LYS A 202 ? 0.3596 0.3315 0.3747 0.0086  0.0519  0.0127  413 LYS A CB  
1541 C CG  . LYS A 202 ? 0.4175 0.3925 0.4304 0.0125  0.0535  0.0171  413 LYS A CG  
1542 C CD  . LYS A 202 ? 0.4791 0.4581 0.4943 0.0103  0.0553  0.0178  413 LYS A CD  
1543 C CE  . LYS A 202 ? 0.5177 0.5010 0.5305 0.0144  0.0570  0.0222  413 LYS A CE  
1544 N NZ  . LYS A 202 ? 0.5403 0.5283 0.5476 0.0185  0.0532  0.0207  413 LYS A NZ  
1545 N N   . GLU A 203 ? 0.3687 0.3264 0.3886 0.0078  0.0578  0.0153  414 GLU A N   
1546 C CA  . GLU A 203 ? 0.3871 0.3392 0.4088 0.0093  0.0621  0.0194  414 GLU A CA  
1547 C C   . GLU A 203 ? 0.3740 0.3227 0.3945 0.0119  0.0614  0.0192  414 GLU A C   
1548 O O   . GLU A 203 ? 0.3850 0.3313 0.4051 0.0156  0.0637  0.0235  414 GLU A O   
1549 C CB  . GLU A 203 ? 0.4061 0.3530 0.4333 0.0047  0.0664  0.0193  414 GLU A CB  
1550 C CG  . GLU A 203 ? 0.4587 0.4066 0.4887 -0.0013 0.0652  0.0139  414 GLU A CG  
1551 C CD  . GLU A 203 ? 0.4994 0.4550 0.5282 -0.0021 0.0628  0.0130  414 GLU A CD  
1552 O OE1 . GLU A 203 ? 0.4542 0.4140 0.4807 -0.0021 0.0587  0.0097  414 GLU A OE1 
1553 O OE2 . GLU A 203 ? 0.5295 0.4873 0.5599 -0.0026 0.0653  0.0161  414 GLU A OE2 
1554 N N   . ALA A 204 ? 0.3482 0.2975 0.3681 0.0104  0.0581  0.0146  415 ALA A N   
1555 C CA  . ALA A 204 ? 0.3320 0.2791 0.3508 0.0128  0.0572  0.0144  415 ALA A CA  
1556 C C   . ALA A 204 ? 0.3172 0.2694 0.3315 0.0177  0.0541  0.0164  415 ALA A C   
1557 O O   . ALA A 204 ? 0.3017 0.2533 0.3152 0.0208  0.0541  0.0181  415 ALA A O   
1558 C CB  . ALA A 204 ? 0.3215 0.2677 0.3416 0.0092  0.0552  0.0090  415 ALA A CB  
1559 N N   . PHE A 205 ? 0.3095 0.2673 0.3210 0.0184  0.0515  0.0162  416 PHE A N   
1560 C CA  . PHE A 205 ? 0.3038 0.2667 0.3110 0.0218  0.0476  0.0161  416 PHE A CA  
1561 C C   . PHE A 205 ? 0.3147 0.2793 0.3197 0.0269  0.0487  0.0208  416 PHE A C   
1562 O O   . PHE A 205 ? 0.3137 0.2776 0.3191 0.0286  0.0521  0.0250  416 PHE A O   
1563 C CB  . PHE A 205 ? 0.3020 0.2696 0.3069 0.0212  0.0450  0.0143  416 PHE A CB  
1564 C CG  . PHE A 205 ? 0.3024 0.2748 0.3030 0.0239  0.0408  0.0131  416 PHE A CG  
1565 C CD1 . PHE A 205 ? 0.2783 0.2510 0.2785 0.0226  0.0372  0.0096  416 PHE A CD1 
1566 C CD2 . PHE A 205 ? 0.3221 0.2988 0.3191 0.0275  0.0403  0.0152  416 PHE A CD2 
1567 C CE1 . PHE A 205 ? 0.2910 0.2676 0.2876 0.0246  0.0334  0.0082  416 PHE A CE1 
1568 C CE2 . PHE A 205 ? 0.2995 0.2803 0.2925 0.0296  0.0364  0.0134  416 PHE A CE2 
1569 C CZ  . PHE A 205 ? 0.3028 0.2833 0.2957 0.0280  0.0329  0.0098  416 PHE A CZ  
1570 N N   . ARG A 206 ? 0.3174 0.2847 0.3200 0.0293  0.0458  0.0203  417 ARG A N   
1571 C CA  . ARG A 206 ? 0.3292 0.2997 0.3294 0.0344  0.0462  0.0245  417 ARG A CA  
1572 C C   . ARG A 206 ? 0.3339 0.3108 0.3297 0.0369  0.0443  0.0254  417 ARG A C   
1573 O O   . ARG A 206 ? 0.3043 0.2864 0.2967 0.0388  0.0405  0.0239  417 ARG A O   
1574 C CB  . ARG A 206 ? 0.3286 0.3010 0.3281 0.0358  0.0435  0.0234  417 ARG A CB  
1575 C CG  . ARG A 206 ? 0.3564 0.3231 0.3597 0.0343  0.0457  0.0229  417 ARG A CG  
1576 C CD  . ARG A 206 ? 0.3698 0.3327 0.3752 0.0372  0.0506  0.0280  417 ARG A CD  
1577 N NE  . ARG A 206 ? 0.3880 0.3563 0.3907 0.0427  0.0503  0.0326  417 ARG A NE  
1578 C CZ  . ARG A 206 ? 0.4242 0.3953 0.4266 0.0458  0.0493  0.0340  417 ARG A CZ  
1579 N NH1 . ARG A 206 ? 0.4179 0.3866 0.4224 0.0441  0.0486  0.0312  417 ARG A NH1 
1580 N NH2 . ARG A 206 ? 0.4585 0.4355 0.4582 0.0507  0.0491  0.0384  417 ARG A NH2 
1581 N N   . GLU A 207 ? 0.3542 0.3309 0.3503 0.0369  0.0471  0.0277  418 GLU A N   
1582 C CA  . GLU A 207 ? 0.3774 0.3602 0.3696 0.0398  0.0463  0.0293  418 GLU A CA  
1583 C C   . GLU A 207 ? 0.3849 0.3729 0.3734 0.0450  0.0457  0.0327  418 GLU A C   
1584 O O   . GLU A 207 ? 0.3822 0.3763 0.3663 0.0472  0.0429  0.0315  418 GLU A O   
1585 C CB  . GLU A 207 ? 0.3874 0.3689 0.3814 0.0394  0.0506  0.0327  418 GLU A CB  
1586 C CG  . GLU A 207 ? 0.4438 0.4228 0.4404 0.0346  0.0508  0.0294  418 GLU A CG  
1587 C CD  . GLU A 207 ? 0.5322 0.5114 0.5308 0.0341  0.0549  0.0329  418 GLU A CD  
1588 O OE1 . GLU A 207 ? 0.5774 0.5595 0.5742 0.0379  0.0572  0.0379  418 GLU A OE1 
1589 O OE2 . GLU A 207 ? 0.5779 0.5549 0.5798 0.0298  0.0559  0.0309  418 GLU A OE2 
1590 N N   . ASP A 208 ? 0.3887 0.3745 0.3791 0.0471  0.0484  0.0368  419 ASP A N   
1591 C CA  . ASP A 208 ? 0.4008 0.3922 0.3883 0.0524  0.0483  0.0410  419 ASP A CA  
1592 C C   . ASP A 208 ? 0.4006 0.3979 0.3848 0.0534  0.0431  0.0375  419 ASP A C   
1593 O O   . ASP A 208 ? 0.4206 0.4255 0.4006 0.0573  0.0414  0.0391  419 ASP A O   
1594 C CB  . ASP A 208 ? 0.4107 0.3976 0.4018 0.0543  0.0525  0.0460  419 ASP A CB  
1595 C CG  . ASP A 208 ? 0.4162 0.3981 0.4105 0.0517  0.0515  0.0427  419 ASP A CG  
1596 O OD1 . ASP A 208 ? 0.4105 0.3868 0.4075 0.0468  0.0513  0.0384  419 ASP A OD1 
1597 O OD2 . ASP A 208 ? 0.4308 0.4149 0.4249 0.0548  0.0510  0.0445  419 ASP A OD2 
1598 N N   . LEU A 209 ? 0.3776 0.3721 0.3635 0.0499  0.0404  0.0326  420 LEU A N   
1599 C CA  . LEU A 209 ? 0.3666 0.3664 0.3501 0.0506  0.0358  0.0298  420 LEU A CA  
1600 C C   . LEU A 209 ? 0.3604 0.3660 0.3392 0.0510  0.0319  0.0265  420 LEU A C   
1601 O O   . LEU A 209 ? 0.3549 0.3587 0.3331 0.0490  0.0317  0.0240  420 LEU A O   
1602 C CB  . LEU A 209 ? 0.3520 0.3476 0.3386 0.0466  0.0339  0.0256  420 LEU A CB  
1603 C CG  . LEU A 209 ? 0.3313 0.3228 0.3218 0.0470  0.0367  0.0281  420 LEU A CG  
1604 C CD1 . LEU A 209 ? 0.3170 0.3050 0.3102 0.0428  0.0348  0.0235  420 LEU A CD1 
1605 C CD2 . LEU A 209 ? 0.3075 0.3051 0.2965 0.0519  0.0365  0.0320  420 LEU A CD2 
1606 N N   . HIS A 210 ? 0.3585 0.3713 0.3341 0.0536  0.0289  0.0262  421 HIS A N   
1607 C CA  . HIS A 210 ? 0.3750 0.3932 0.3460 0.0538  0.0249  0.0221  421 HIS A CA  
1608 C C   . HIS A 210 ? 0.3640 0.3794 0.3361 0.0493  0.0210  0.0158  421 HIS A C   
1609 O O   . HIS A 210 ? 0.3518 0.3622 0.3278 0.0464  0.0212  0.0150  421 HIS A O   
1610 C CB  . HIS A 210 ? 0.3855 0.4130 0.3528 0.0578  0.0229  0.0237  421 HIS A CB  
1611 C CG  . HIS A 210 ? 0.4308 0.4603 0.4004 0.0584  0.0220  0.0252  421 HIS A CG  
1612 N ND1 . HIS A 210 ? 0.4751 0.5005 0.4488 0.0592  0.0258  0.0297  421 HIS A ND1 
1613 C CD2 . HIS A 210 ? 0.4618 0.4975 0.4303 0.0584  0.0180  0.0229  421 HIS A CD2 
1614 C CE1 . HIS A 210 ? 0.4537 0.4827 0.4287 0.0601  0.0241  0.0302  421 HIS A CE1 
1615 N NE2 . HIS A 210 ? 0.4736 0.5094 0.4455 0.0595  0.0194  0.0262  421 HIS A NE2 
1616 N N   . ASN A 211 ? 0.3585 0.3769 0.3270 0.0489  0.0175  0.0116  422 ASN A N   
1617 C CA  . ASN A 211 ? 0.3643 0.3804 0.3334 0.0451  0.0137  0.0060  422 ASN A CA  
1618 C C   . ASN A 211 ? 0.3444 0.3526 0.3171 0.0413  0.0151  0.0045  422 ASN A C   
1619 O O   . ASN A 211 ? 0.3361 0.3411 0.3121 0.0381  0.0140  0.0028  422 ASN A O   
1620 C CB  . ASN A 211 ? 0.3774 0.3961 0.3482 0.0444  0.0116  0.0059  422 ASN A CB  
1621 C CG  . ASN A 211 ? 0.4230 0.4416 0.3937 0.0411  0.0072  0.0005  422 ASN A CG  
1622 O OD1 . ASN A 211 ? 0.5021 0.5201 0.4704 0.0401  0.0051  -0.0035 422 ASN A OD1 
1623 N ND2 . ASN A 211 ? 0.4876 0.5069 0.4613 0.0393  0.0057  0.0004  422 ASN A ND2 
1624 N N   . ARG A 212 ? 0.3102 0.3163 0.2824 0.0417  0.0176  0.0054  423 ARG A N   
1625 C CA  . ARG A 212 ? 0.2874 0.2876 0.2628 0.0384  0.0189  0.0040  423 ARG A CA  
1626 C C   . ARG A 212 ? 0.2810 0.2806 0.2545 0.0368  0.0156  -0.0009 423 ARG A C   
1627 O O   . ARG A 212 ? 0.2827 0.2851 0.2524 0.0391  0.0149  -0.0021 423 ARG A O   
1628 C CB  . ARG A 212 ? 0.2893 0.2882 0.2654 0.0394  0.0231  0.0075  423 ARG A CB  
1629 C CG  . ARG A 212 ? 0.2892 0.2829 0.2692 0.0358  0.0247  0.0064  423 ARG A CG  
1630 C CD  . ARG A 212 ? 0.2702 0.2637 0.2508 0.0365  0.0285  0.0094  423 ARG A CD  
1631 N NE  . ARG A 212 ? 0.2694 0.2639 0.2503 0.0391  0.0320  0.0145  423 ARG A NE  
1632 C CZ  . ARG A 212 ? 0.3098 0.3060 0.2902 0.0410  0.0352  0.0180  423 ARG A CZ  
1633 N NH1 . ARG A 212 ? 0.2838 0.2814 0.2631 0.0407  0.0353  0.0167  423 ARG A NH1 
1634 N NH2 . ARG A 212 ? 0.3104 0.3070 0.2913 0.0434  0.0384  0.0231  423 ARG A NH2 
1635 N N   . MET A 213 ? 0.2598 0.2557 0.2361 0.0333  0.0138  -0.0036 424 MET A N   
1636 C CA  . MET A 213 ? 0.2421 0.2366 0.2173 0.0316  0.0107  -0.0080 424 MET A CA  
1637 C C   . MET A 213 ? 0.2295 0.2194 0.2081 0.0286  0.0117  -0.0087 424 MET A C   
1638 O O   . MET A 213 ? 0.2172 0.2050 0.1995 0.0266  0.0135  -0.0070 424 MET A O   
1639 C CB  . MET A 213 ? 0.2511 0.2464 0.2265 0.0301  0.0070  -0.0105 424 MET A CB  
1640 C CG  . MET A 213 ? 0.2873 0.2883 0.2594 0.0326  0.0054  -0.0104 424 MET A CG  
1641 S SD  . MET A 213 ? 0.3585 0.3605 0.3314 0.0298  0.0008  -0.0141 424 MET A SD  
1642 C CE  . MET A 213 ? 0.3179 0.3178 0.2876 0.0293  -0.0019 -0.0194 424 MET A CE  
1643 N N   . LEU A 214 ? 0.2164 0.2050 0.1938 0.0284  0.0104  -0.0114 425 LEU A N   
1644 C CA  . LEU A 214 ? 0.2066 0.1919 0.1869 0.0258  0.0109  -0.0123 425 LEU A CA  
1645 C C   . LEU A 214 ? 0.2066 0.1897 0.1883 0.0232  0.0077  -0.0149 425 LEU A C   
1646 O O   . LEU A 214 ? 0.1947 0.1772 0.1742 0.0237  0.0051  -0.0178 425 LEU A O   
1647 C CB  . LEU A 214 ? 0.2021 0.1876 0.1807 0.0275  0.0116  -0.0131 425 LEU A CB  
1648 C CG  . LEU A 214 ? 0.2027 0.1865 0.1842 0.0257  0.0127  -0.0131 425 LEU A CG  
1649 C CD1 . LEU A 214 ? 0.2030 0.1876 0.1873 0.0247  0.0162  -0.0100 425 LEU A CD1 
1650 C CD2 . LEU A 214 ? 0.1827 0.1668 0.1617 0.0280  0.0124  -0.0149 425 LEU A CD2 
1651 N N   . LEU A 215 ? 0.1939 0.1756 0.1793 0.0204  0.0081  -0.0140 426 LEU A N   
1652 C CA  . LEU A 215 ? 0.1988 0.1792 0.1858 0.0178  0.0054  -0.0157 426 LEU A CA  
1653 C C   . LEU A 215 ? 0.1862 0.1645 0.1766 0.0150  0.0057  -0.0157 426 LEU A C   
1654 O O   . LEU A 215 ? 0.1680 0.1463 0.1600 0.0144  0.0083  -0.0143 426 LEU A O   
1655 C CB  . LEU A 215 ? 0.1959 0.1782 0.1838 0.0174  0.0050  -0.0145 426 LEU A CB  
1656 C CG  . LEU A 215 ? 0.2108 0.1964 0.1957 0.0202  0.0045  -0.0141 426 LEU A CG  
1657 C CD1 . LEU A 215 ? 0.1783 0.1662 0.1649 0.0199  0.0046  -0.0123 426 LEU A CD1 
1658 C CD2 . LEU A 215 ? 0.1769 0.1629 0.1592 0.0204  0.0011  -0.0174 426 LEU A CD2 
1659 N N   . TRP A 216 ? 0.1878 0.1648 0.1792 0.0131  0.0032  -0.0173 427 TRP A N   
1660 C CA  . TRP A 216 ? 0.1776 0.1531 0.1718 0.0106  0.0029  -0.0174 427 TRP A CA  
1661 C C   . TRP A 216 ? 0.1690 0.1456 0.1664 0.0081  0.0037  -0.0161 427 TRP A C   
1662 O O   . TRP A 216 ? 0.1728 0.1504 0.1705 0.0077  0.0030  -0.0158 427 TRP A O   
1663 C CB  . TRP A 216 ? 0.1731 0.1463 0.1672 0.0097  0.0000  -0.0193 427 TRP A CB  
1664 C CG  . TRP A 216 ? 0.1848 0.1560 0.1760 0.0119  -0.0010 -0.0212 427 TRP A CG  
1665 C CD1 . TRP A 216 ? 0.1810 0.1517 0.1695 0.0131  -0.0029 -0.0235 427 TRP A CD1 
1666 C CD2 . TRP A 216 ? 0.1803 0.1502 0.1710 0.0134  0.0001  -0.0214 427 TRP A CD2 
1667 N NE1 . TRP A 216 ? 0.2213 0.1899 0.2073 0.0153  -0.0030 -0.0253 427 TRP A NE1 
1668 C CE2 . TRP A 216 ? 0.1997 0.1678 0.1871 0.0158  -0.0011 -0.0238 427 TRP A CE2 
1669 C CE3 . TRP A 216 ? 0.1910 0.1616 0.1837 0.0131  0.0019  -0.0198 427 TRP A CE3 
1670 C CZ2 . TRP A 216 ? 0.2242 0.1908 0.2102 0.0181  -0.0003 -0.0245 427 TRP A CZ2 
1671 C CZ3 . TRP A 216 ? 0.2337 0.2036 0.2252 0.0154  0.0026  -0.0202 427 TRP A CZ3 
1672 C CH2 . TRP A 216 ? 0.2367 0.2044 0.2250 0.0180  0.0015  -0.0225 427 TRP A CH2 
1673 N N   . HIS A 217 ? 0.1677 0.1444 0.1673 0.0065  0.0049  -0.0155 428 HIS A N   
1674 C CA  . HIS A 217 ? 0.1494 0.1273 0.1518 0.0039  0.0052  -0.0149 428 HIS A CA  
1675 C C   . HIS A 217 ? 0.1510 0.1292 0.1552 0.0023  0.0047  -0.0149 428 HIS A C   
1676 O O   . HIS A 217 ? 0.1515 0.1302 0.1557 0.0028  0.0058  -0.0147 428 HIS A O   
1677 C CB  . HIS A 217 ? 0.1471 0.1260 0.1505 0.0037  0.0081  -0.0140 428 HIS A CB  
1678 C CG  . HIS A 217 ? 0.1431 0.1233 0.1490 0.0013  0.0085  -0.0138 428 HIS A CG  
1679 N ND1 . HIS A 217 ? 0.1519 0.1327 0.1583 0.0013  0.0083  -0.0135 428 HIS A ND1 
1680 C CD2 . HIS A 217 ? 0.1514 0.1331 0.1594 -0.0010 0.0089  -0.0141 428 HIS A CD2 
1681 C CE1 . HIS A 217 ? 0.1546 0.1369 0.1632 -0.0008 0.0087  -0.0136 428 HIS A CE1 
1682 N NE2 . HIS A 217 ? 0.1170 0.1000 0.1265 -0.0023 0.0091  -0.0140 428 HIS A NE2 
1683 N N   . GLY A 218 ? 0.1499 0.1284 0.1557 0.0004  0.0029  -0.0147 429 GLY A N   
1684 C CA  . GLY A 218 ? 0.1501 0.1296 0.1578 -0.0012 0.0024  -0.0141 429 GLY A CA  
1685 C C   . GLY A 218 ? 0.1583 0.1410 0.1682 -0.0035 0.0034  -0.0135 429 GLY A C   
1686 O O   . GLY A 218 ? 0.1636 0.1471 0.1740 -0.0041 0.0035  -0.0135 429 GLY A O   
1687 N N   . SER A 219 ? 0.1664 0.1517 0.1777 -0.0046 0.0040  -0.0129 430 SER A N   
1688 C CA  . SER A 219 ? 0.1666 0.1557 0.1797 -0.0068 0.0049  -0.0127 430 SER A CA  
1689 C C   . SER A 219 ? 0.1704 0.1628 0.1849 -0.0079 0.0044  -0.0116 430 SER A C   
1690 O O   . SER A 219 ? 0.1779 0.1695 0.1921 -0.0067 0.0038  -0.0109 430 SER A O   
1691 C CB  . SER A 219 ? 0.1721 0.1623 0.1853 -0.0072 0.0074  -0.0139 430 SER A CB  
1692 O OG  . SER A 219 ? 0.1652 0.1581 0.1797 -0.0091 0.0083  -0.0143 430 SER A OG  
1693 N N   . ARG A 220 ? 0.1806 0.1771 0.1966 -0.0098 0.0047  -0.0113 431 ARG A N   
1694 C CA  . ARG A 220 ? 0.1763 0.1771 0.1935 -0.0107 0.0042  -0.0099 431 ARG A CA  
1695 C C   . ARG A 220 ? 0.1812 0.1851 0.1984 -0.0107 0.0055  -0.0105 431 ARG A C   
1696 O O   . ARG A 220 ? 0.1716 0.1751 0.1883 -0.0109 0.0072  -0.0124 431 ARG A O   
1697 C CB  . ARG A 220 ? 0.1756 0.1810 0.1940 -0.0127 0.0044  -0.0097 431 ARG A CB  
1698 C CG  . ARG A 220 ? 0.1873 0.1910 0.2063 -0.0131 0.0030  -0.0084 431 ARG A CG  
1699 C CD  . ARG A 220 ? 0.1925 0.2012 0.2127 -0.0148 0.0035  -0.0082 431 ARG A CD  
1700 N NE  . ARG A 220 ? 0.2137 0.2213 0.2348 -0.0152 0.0021  -0.0068 431 ARG A NE  
1701 C CZ  . ARG A 220 ? 0.2181 0.2271 0.2407 -0.0160 0.0007  -0.0042 431 ARG A CZ  
1702 N NH1 . ARG A 220 ? 0.2442 0.2556 0.2673 -0.0160 0.0005  -0.0023 431 ARG A NH1 
1703 N NH2 . ARG A 220 ? 0.2193 0.2276 0.2432 -0.0168 -0.0004 -0.0031 431 ARG A NH2 
1704 N N   . MET A 221 ? 0.1883 0.1955 0.2063 -0.0104 0.0048  -0.0088 432 MET A N   
1705 C CA  . MET A 221 ? 0.2002 0.2117 0.2185 -0.0103 0.0059  -0.0092 432 MET A CA  
1706 C C   . MET A 221 ? 0.1986 0.2152 0.2176 -0.0127 0.0073  -0.0112 432 MET A C   
1707 O O   . MET A 221 ? 0.2155 0.2343 0.2347 -0.0132 0.0086  -0.0125 432 MET A O   
1708 C CB  . MET A 221 ? 0.2110 0.2261 0.2303 -0.0092 0.0048  -0.0064 432 MET A CB  
1709 C CG  . MET A 221 ? 0.2298 0.2393 0.2483 -0.0063 0.0040  -0.0052 432 MET A CG  
1710 S SD  . MET A 221 ? 0.2433 0.2501 0.2604 -0.0044 0.0053  -0.0070 432 MET A SD  
1711 C CE  . MET A 221 ? 0.1374 0.1537 0.1562 -0.0054 0.0065  -0.0067 432 MET A CE  
1712 N N   . SER A 222 ? 0.1995 0.2178 0.2188 -0.0144 0.0073  -0.0117 433 SER A N   
1713 C CA  . SER A 222 ? 0.2047 0.2277 0.2244 -0.0168 0.0088  -0.0142 433 SER A CA  
1714 C C   . SER A 222 ? 0.2039 0.2223 0.2232 -0.0173 0.0108  -0.0170 433 SER A C   
1715 O O   . SER A 222 ? 0.2198 0.2410 0.2396 -0.0193 0.0124  -0.0196 433 SER A O   
1716 C CB  . SER A 222 ? 0.2135 0.2393 0.2334 -0.0179 0.0084  -0.0140 433 SER A CB  
1717 O OG  . SER A 222 ? 0.2070 0.2273 0.2266 -0.0170 0.0079  -0.0133 433 SER A OG  
1718 N N   . ASN A 223 ? 0.1871 0.1988 0.2055 -0.0154 0.0107  -0.0164 434 ASN A N   
1719 C CA  . ASN A 223 ? 0.1745 0.1817 0.1924 -0.0154 0.0126  -0.0182 434 ASN A CA  
1720 C C   . ASN A 223 ? 0.1826 0.1874 0.2004 -0.0148 0.0141  -0.0188 434 ASN A C   
1721 O O   . ASN A 223 ? 0.1745 0.1761 0.1924 -0.0152 0.0162  -0.0202 434 ASN A O   
1722 C CB  . ASN A 223 ? 0.1722 0.1747 0.1893 -0.0137 0.0117  -0.0172 434 ASN A CB  
1723 C CG  . ASN A 223 ? 0.1819 0.1870 0.1995 -0.0146 0.0107  -0.0167 434 ASN A CG  
1724 O OD1 . ASN A 223 ? 0.1575 0.1681 0.1759 -0.0162 0.0106  -0.0169 434 ASN A OD1 
1725 N ND2 . ASN A 223 ? 0.1735 0.1757 0.1908 -0.0134 0.0099  -0.0158 434 ASN A ND2 
1726 N N   . TRP A 224 ? 0.1584 0.1647 0.1761 -0.0139 0.0133  -0.0175 435 TRP A N   
1727 C CA  . TRP A 224 ? 0.1708 0.1749 0.1883 -0.0128 0.0146  -0.0175 435 TRP A CA  
1728 C C   . TRP A 224 ? 0.1779 0.1839 0.1969 -0.0152 0.0171  -0.0194 435 TRP A C   
1729 O O   . TRP A 224 ? 0.1896 0.1921 0.2086 -0.0149 0.0189  -0.0197 435 TRP A O   
1730 C CB  . TRP A 224 ? 0.1571 0.1629 0.1742 -0.0108 0.0133  -0.0157 435 TRP A CB  
1731 C CG  . TRP A 224 ? 0.1354 0.1373 0.1510 -0.0083 0.0113  -0.0142 435 TRP A CG  
1732 C CD1 . TRP A 224 ? 0.1256 0.1288 0.1414 -0.0077 0.0093  -0.0127 435 TRP A CD1 
1733 C CD2 . TRP A 224 ? 0.1164 0.1126 0.1302 -0.0065 0.0111  -0.0141 435 TRP A CD2 
1734 N NE1 . TRP A 224 ? 0.1636 0.1616 0.1780 -0.0059 0.0079  -0.0121 435 TRP A NE1 
1735 C CE2 . TRP A 224 ? 0.1359 0.1301 0.1489 -0.0051 0.0088  -0.0131 435 TRP A CE2 
1736 C CE3 . TRP A 224 ? 0.1441 0.1369 0.1569 -0.0057 0.0126  -0.0147 435 TRP A CE3 
1737 C CZ2 . TRP A 224 ? 0.1717 0.1611 0.1829 -0.0033 0.0078  -0.0132 435 TRP A CZ2 
1738 C CZ3 . TRP A 224 ? 0.1444 0.1331 0.1553 -0.0035 0.0117  -0.0143 435 TRP A CZ3 
1739 C CH2 . TRP A 224 ? 0.1576 0.1448 0.1676 -0.0025 0.0092  -0.0138 435 TRP A CH2 
1740 N N   . VAL A 225 ? 0.1789 0.1906 0.1993 -0.0179 0.0171  -0.0209 436 VAL A N   
1741 C CA  . VAL A 225 ? 0.2051 0.2186 0.2271 -0.0208 0.0194  -0.0233 436 VAL A CA  
1742 C C   . VAL A 225 ? 0.2097 0.2171 0.2318 -0.0215 0.0216  -0.0250 436 VAL A C   
1743 O O   . VAL A 225 ? 0.2049 0.2093 0.2280 -0.0223 0.0239  -0.0258 436 VAL A O   
1744 C CB  . VAL A 225 ? 0.1944 0.2163 0.2178 -0.0238 0.0188  -0.0250 436 VAL A CB  
1745 C CG1 . VAL A 225 ? 0.2145 0.2371 0.2396 -0.0275 0.0213  -0.0287 436 VAL A CG1 
1746 C CG2 . VAL A 225 ? 0.2029 0.2309 0.2269 -0.0229 0.0174  -0.0230 436 VAL A CG2 
1747 N N   . GLY A 226 ? 0.2104 0.2160 0.2315 -0.0209 0.0209  -0.0252 437 GLY A N   
1748 C CA  . GLY A 226 ? 0.2119 0.2116 0.2328 -0.0204 0.0228  -0.0261 437 GLY A CA  
1749 C C   . GLY A 226 ? 0.2159 0.2096 0.2359 -0.0176 0.0236  -0.0240 437 GLY A C   
1750 O O   . GLY A 226 ? 0.1966 0.1859 0.2173 -0.0177 0.0263  -0.0245 437 GLY A O   
1751 N N   . ILE A 227 ? 0.2131 0.2066 0.2316 -0.0150 0.0214  -0.0216 438 ILE A N   
1752 C CA  . ILE A 227 ? 0.1989 0.1877 0.2160 -0.0121 0.0218  -0.0197 438 ILE A CA  
1753 C C   . ILE A 227 ? 0.2018 0.1898 0.2196 -0.0122 0.0239  -0.0192 438 ILE A C   
1754 O O   . ILE A 227 ? 0.1881 0.1721 0.2056 -0.0108 0.0257  -0.0183 438 ILE A O   
1755 C CB  . ILE A 227 ? 0.1976 0.1865 0.2128 -0.0096 0.0189  -0.0178 438 ILE A CB  
1756 C CG1 . ILE A 227 ? 0.1729 0.1621 0.1879 -0.0097 0.0173  -0.0179 438 ILE A CG1 
1757 C CG2 . ILE A 227 ? 0.1664 0.1515 0.1798 -0.0065 0.0192  -0.0162 438 ILE A CG2 
1758 C CD1 . ILE A 227 ? 0.1408 0.1306 0.1547 -0.0084 0.0141  -0.0165 438 ILE A CD1 
1759 N N   . LEU A 228 ? 0.2002 0.1926 0.2191 -0.0138 0.0236  -0.0197 439 LEU A N   
1760 C CA  . LEU A 228 ? 0.2064 0.1990 0.2261 -0.0139 0.0254  -0.0190 439 LEU A CA  
1761 C C   . LEU A 228 ? 0.2204 0.2115 0.2424 -0.0170 0.0286  -0.0207 439 LEU A C   
1762 O O   . LEU A 228 ? 0.2219 0.2100 0.2445 -0.0165 0.0309  -0.0196 439 LEU A O   
1763 C CB  . LEU A 228 ? 0.2015 0.2000 0.2216 -0.0142 0.0239  -0.0186 439 LEU A CB  
1764 C CG  . LEU A 228 ? 0.1953 0.1937 0.2130 -0.0107 0.0213  -0.0168 439 LEU A CG  
1765 C CD1 . LEU A 228 ? 0.1756 0.1795 0.1941 -0.0105 0.0204  -0.0161 439 LEU A CD1 
1766 C CD2 . LEU A 228 ? 0.1433 0.1371 0.1589 -0.0075 0.0218  -0.0152 439 LEU A CD2 
1767 N N   . SER A 229 ? 0.2257 0.2188 0.2491 -0.0200 0.0287  -0.0235 440 SER A N   
1768 C CA  . SER A 229 ? 0.2361 0.2277 0.2619 -0.0234 0.0316  -0.0259 440 SER A CA  
1769 C C   . SER A 229 ? 0.2404 0.2246 0.2661 -0.0223 0.0339  -0.0259 440 SER A C   
1770 O O   . SER A 229 ? 0.2410 0.2211 0.2685 -0.0236 0.0371  -0.0263 440 SER A O   
1771 C CB  . SER A 229 ? 0.2432 0.2403 0.2703 -0.0270 0.0309  -0.0294 440 SER A CB  
1772 O OG  . SER A 229 ? 0.2459 0.2436 0.2714 -0.0261 0.0291  -0.0300 440 SER A OG  
1773 N N   . HIS A 230 ? 0.2359 0.2182 0.2596 -0.0197 0.0324  -0.0251 441 HIS A N   
1774 C CA  . HIS A 230 ? 0.2429 0.2190 0.2664 -0.0181 0.0345  -0.0248 441 HIS A CA  
1775 C C   . HIS A 230 ? 0.2427 0.2157 0.2642 -0.0138 0.0340  -0.0213 441 HIS A C   
1776 O O   . HIS A 230 ? 0.2446 0.2131 0.2660 -0.0120 0.0357  -0.0205 441 HIS A O   
1777 C CB  . HIS A 230 ? 0.2495 0.2266 0.2729 -0.0188 0.0338  -0.0271 441 HIS A CB  
1778 C CG  . HIS A 230 ? 0.2660 0.2444 0.2913 -0.0228 0.0355  -0.0312 441 HIS A CG  
1779 N ND1 . HIS A 230 ? 0.3027 0.2870 0.3290 -0.0261 0.0345  -0.0331 441 HIS A ND1 
1780 C CD2 . HIS A 230 ? 0.2885 0.2634 0.3148 -0.0240 0.0378  -0.0341 441 HIS A CD2 
1781 C CE1 . HIS A 230 ? 0.3397 0.3245 0.3674 -0.0295 0.0361  -0.0372 441 HIS A CE1 
1782 N NE2 . HIS A 230 ? 0.3251 0.3039 0.3528 -0.0282 0.0382  -0.0380 441 HIS A NE2 
1783 N N   . GLY A 231 ? 0.2247 0.2004 0.2445 -0.0119 0.0316  -0.0193 442 GLY A N   
1784 C CA  . GLY A 231 ? 0.2168 0.1904 0.2343 -0.0080 0.0306  -0.0166 442 GLY A CA  
1785 C C   . GLY A 231 ? 0.2095 0.1844 0.2258 -0.0069 0.0279  -0.0168 442 GLY A C   
1786 O O   . GLY A 231 ? 0.1919 0.1687 0.2090 -0.0088 0.0273  -0.0188 442 GLY A O   
1787 N N   . LEU A 232 ? 0.2069 0.1814 0.2210 -0.0038 0.0263  -0.0148 443 LEU A N   
1788 C CA  . LEU A 232 ? 0.2099 0.1853 0.2232 -0.0026 0.0241  -0.0146 443 LEU A CA  
1789 C C   . LEU A 232 ? 0.2100 0.1827 0.2244 -0.0019 0.0266  -0.0144 443 LEU A C   
1790 O O   . LEU A 232 ? 0.2095 0.1790 0.2240 -0.0003 0.0292  -0.0130 443 LEU A O   
1791 C CB  . LEU A 232 ? 0.1955 0.1713 0.2064 0.0003  0.0219  -0.0128 443 LEU A CB  
1792 C CG  . LEU A 232 ? 0.1916 0.1695 0.2014 -0.0001 0.0194  -0.0132 443 LEU A CG  
1793 C CD1 . LEU A 232 ? 0.1704 0.1479 0.1776 0.0028  0.0179  -0.0119 443 LEU A CD1 
1794 C CD2 . LEU A 232 ? 0.1601 0.1406 0.1707 -0.0021 0.0168  -0.0143 443 LEU A CD2 
1795 N N   . ARG A 233 ? 0.2031 0.1771 0.2183 -0.0029 0.0262  -0.0158 444 ARG A N   
1796 C CA  . ARG A 233 ? 0.2259 0.1973 0.2424 -0.0023 0.0289  -0.0162 444 ARG A CA  
1797 C C   . ARG A 233 ? 0.2305 0.2037 0.2465 -0.0002 0.0274  -0.0150 444 ARG A C   
1798 O O   . ARG A 233 ? 0.2344 0.2114 0.2497 -0.0005 0.0242  -0.0148 444 ARG A O   
1799 C CB  . ARG A 233 ? 0.2274 0.1989 0.2457 -0.0055 0.0305  -0.0194 444 ARG A CB  
1800 C CG  . ARG A 233 ? 0.2528 0.2226 0.2723 -0.0082 0.0326  -0.0211 444 ARG A CG  
1801 C CD  . ARG A 233 ? 0.2769 0.2513 0.2972 -0.0120 0.0316  -0.0244 444 ARG A CD  
1802 N NE  . ARG A 233 ? 0.3059 0.2850 0.3251 -0.0124 0.0282  -0.0235 444 ARG A NE  
1803 C CZ  . ARG A 233 ? 0.3272 0.3117 0.3465 -0.0144 0.0262  -0.0248 444 ARG A CZ  
1804 N NH1 . ARG A 233 ? 0.3436 0.3303 0.3637 -0.0165 0.0269  -0.0274 444 ARG A NH1 
1805 N NH2 . ARG A 233 ? 0.3392 0.3268 0.3576 -0.0141 0.0234  -0.0233 444 ARG A NH2 
1806 N N   . ILE A 234 ? 0.2303 0.2009 0.2471 0.0020  0.0300  -0.0141 445 ILE A N   
1807 C CA  . ILE A 234 ? 0.2368 0.2094 0.2538 0.0041  0.0295  -0.0132 445 ILE A CA  
1808 C C   . ILE A 234 ? 0.2333 0.2087 0.2514 0.0017  0.0291  -0.0158 445 ILE A C   
1809 O O   . ILE A 234 ? 0.2273 0.2010 0.2463 -0.0003 0.0311  -0.0183 445 ILE A O   
1810 C CB  . ILE A 234 ? 0.2422 0.2107 0.2601 0.0071  0.0332  -0.0116 445 ILE A CB  
1811 C CG1 . ILE A 234 ? 0.2403 0.2067 0.2570 0.0097  0.0339  -0.0085 445 ILE A CG1 
1812 C CG2 . ILE A 234 ? 0.2560 0.2269 0.2744 0.0097  0.0331  -0.0104 445 ILE A CG2 
1813 C CD1 . ILE A 234 ? 0.1958 0.1669 0.2103 0.0111  0.0299  -0.0067 445 ILE A CD1 
1814 N N   . ALA A 235 ? 0.2341 0.2143 0.2521 0.0019  0.0264  -0.0151 446 ALA A N   
1815 C CA  . ALA A 235 ? 0.2251 0.2094 0.2440 -0.0004 0.0254  -0.0171 446 ALA A CA  
1816 C C   . ALA A 235 ? 0.2279 0.2107 0.2480 0.0001  0.0289  -0.0189 446 ALA A C   
1817 O O   . ALA A 235 ? 0.2228 0.2020 0.2433 0.0029  0.0314  -0.0179 446 ALA A O   
1818 C CB  . ALA A 235 ? 0.2037 0.1933 0.2227 0.0000  0.0222  -0.0153 446 ALA A CB  
1819 N N   . HIS A 236 ? 0.2491 0.2344 0.2696 -0.0024 0.0290  -0.0216 447 HIS A N   
1820 C CA  . HIS A 236 ? 0.2654 0.2498 0.2867 -0.0021 0.0321  -0.0241 447 HIS A CA  
1821 C C   . HIS A 236 ? 0.2635 0.2484 0.2856 0.0015  0.0332  -0.0222 447 HIS A C   
1822 O O   . HIS A 236 ? 0.2541 0.2438 0.2762 0.0026  0.0306  -0.0197 447 HIS A O   
1823 C CB  . HIS A 236 ? 0.2667 0.2567 0.2880 -0.0050 0.0311  -0.0267 447 HIS A CB  
1824 C CG  . HIS A 236 ? 0.2741 0.2626 0.2958 -0.0056 0.0344  -0.0306 447 HIS A CG  
1825 N ND1 . HIS A 236 ? 0.3075 0.2960 0.3299 -0.0031 0.0365  -0.0311 447 HIS A ND1 
1826 C CD2 . HIS A 236 ? 0.3096 0.2964 0.3313 -0.0084 0.0360  -0.0345 447 HIS A CD2 
1827 C CE1 . HIS A 236 ? 0.2951 0.2813 0.3175 -0.0042 0.0395  -0.0353 447 HIS A CE1 
1828 N NE2 . HIS A 236 ? 0.2945 0.2798 0.3166 -0.0077 0.0391  -0.0376 447 HIS A NE2 
1829 N N   . PRO A 237 ? 0.2777 0.2578 0.3005 0.0035  0.0371  -0.0234 448 PRO A N   
1830 C CA  . PRO A 237 ? 0.2744 0.2552 0.2981 0.0076  0.0386  -0.0215 448 PRO A CA  
1831 C C   . PRO A 237 ? 0.2569 0.2451 0.2811 0.0075  0.0373  -0.0219 448 PRO A C   
1832 O O   . PRO A 237 ? 0.2393 0.2312 0.2642 0.0104  0.0367  -0.0192 448 PRO A O   
1833 C CB  . PRO A 237 ? 0.2954 0.2688 0.3199 0.0089  0.0434  -0.0238 448 PRO A CB  
1834 C CG  . PRO A 237 ? 0.3077 0.2761 0.3319 0.0059  0.0443  -0.0258 448 PRO A CG  
1835 C CD  . PRO A 237 ? 0.2847 0.2580 0.3079 0.0023  0.0404  -0.0261 448 PRO A CD  
1836 N N   . GLU A 238 ? 0.2675 0.2586 0.2913 0.0044  0.0369  -0.0251 449 GLU A N   
1837 C CA  . GLU A 238 ? 0.2765 0.2754 0.3007 0.0042  0.0359  -0.0253 449 GLU A CA  
1838 C C   . GLU A 238 ? 0.2623 0.2679 0.2866 0.0023  0.0315  -0.0226 449 GLU A C   
1839 O O   . GLU A 238 ? 0.2604 0.2730 0.2854 0.0022  0.0304  -0.0218 449 GLU A O   
1840 C CB  . GLU A 238 ? 0.2956 0.2956 0.3192 0.0020  0.0376  -0.0299 449 GLU A CB  
1841 C CG  . GLU A 238 ? 0.3607 0.3535 0.3845 0.0035  0.0422  -0.0334 449 GLU A CG  
1842 C CD  . GLU A 238 ? 0.4524 0.4468 0.4770 0.0073  0.0447  -0.0333 449 GLU A CD  
1843 O OE1 . GLU A 238 ? 0.5004 0.5000 0.5259 0.0097  0.0431  -0.0295 449 GLU A OE1 
1844 O OE2 . GLU A 238 ? 0.5183 0.5091 0.5429 0.0079  0.0483  -0.0374 449 GLU A OE2 
1845 N N   . ALA A 239 ? 0.2399 0.2434 0.2635 0.0009  0.0291  -0.0212 450 ALA A N   
1846 C CA  . ALA A 239 ? 0.2237 0.2323 0.2474 -0.0008 0.0251  -0.0187 450 ALA A CA  
1847 C C   . ALA A 239 ? 0.2170 0.2293 0.2420 0.0015  0.0239  -0.0156 450 ALA A C   
1848 O O   . ALA A 239 ? 0.1981 0.2078 0.2233 0.0046  0.0253  -0.0145 450 ALA A O   
1849 C CB  . ALA A 239 ? 0.1974 0.2026 0.2201 -0.0022 0.0231  -0.0179 450 ALA A CB  
1850 N N   . PRO A 240 ? 0.2282 0.2472 0.2543 0.0000  0.0214  -0.0140 451 PRO A N   
1851 C CA  . PRO A 240 ? 0.2328 0.2564 0.2605 0.0016  0.0200  -0.0112 451 PRO A CA  
1852 C C   . PRO A 240 ? 0.2427 0.2635 0.2699 0.0027  0.0182  -0.0094 451 PRO A C   
1853 O O   . PRO A 240 ? 0.2432 0.2614 0.2694 0.0007  0.0161  -0.0095 451 PRO A O   
1854 C CB  . PRO A 240 ? 0.2249 0.2550 0.2539 -0.0015 0.0173  -0.0099 451 PRO A CB  
1855 C CG  . PRO A 240 ? 0.2240 0.2546 0.2521 -0.0033 0.0183  -0.0120 451 PRO A CG  
1856 C CD  . PRO A 240 ? 0.2256 0.2490 0.2518 -0.0032 0.0201  -0.0147 451 PRO A CD  
1857 N N   . ILE A 241 ? 0.2508 0.2729 0.2788 0.0059  0.0189  -0.0077 452 ILE A N   
1858 C CA  . ILE A 241 ? 0.2593 0.2797 0.2865 0.0072  0.0173  -0.0060 452 ILE A CA  
1859 C C   . ILE A 241 ? 0.2528 0.2773 0.2807 0.0045  0.0131  -0.0048 452 ILE A C   
1860 O O   . ILE A 241 ? 0.2421 0.2638 0.2685 0.0041  0.0112  -0.0047 452 ILE A O   
1861 C CB  . ILE A 241 ? 0.2599 0.2815 0.2877 0.0117  0.0191  -0.0041 452 ILE A CB  
1862 C CG1 . ILE A 241 ? 0.2797 0.2990 0.3060 0.0133  0.0179  -0.0026 452 ILE A CG1 
1863 C CG2 . ILE A 241 ? 0.2556 0.2859 0.2860 0.0126  0.0180  -0.0021 452 ILE A CG2 
1864 C CD1 . ILE A 241 ? 0.2941 0.3054 0.3182 0.0132  0.0194  -0.0040 452 ILE A CD1 
1865 N N   . THR A 242 ? 0.2551 0.2858 0.2851 0.0026  0.0117  -0.0041 453 THR A N   
1866 C CA  . THR A 242 ? 0.2464 0.2803 0.2775 -0.0005 0.0079  -0.0031 453 THR A CA  
1867 C C   . THR A 242 ? 0.2404 0.2696 0.2701 -0.0034 0.0063  -0.0042 453 THR A C   
1868 O O   . THR A 242 ? 0.2340 0.2641 0.2644 -0.0058 0.0033  -0.0036 453 THR A O   
1869 C CB  . THR A 242 ? 0.2579 0.2995 0.2920 -0.0024 0.0070  -0.0016 453 THR A CB  
1870 O OG1 . THR A 242 ? 0.2376 0.2792 0.2716 -0.0035 0.0089  -0.0027 453 THR A OG1 
1871 C CG2 . THR A 242 ? 0.2534 0.3014 0.2895 0.0005  0.0080  0.0000  453 THR A CG2 
1872 N N   . GLY A 243 ? 0.2326 0.2569 0.2605 -0.0034 0.0083  -0.0060 454 GLY A N   
1873 C CA  . GLY A 243 ? 0.2400 0.2602 0.2666 -0.0057 0.0069  -0.0069 454 GLY A CA  
1874 C C   . GLY A 243 ? 0.2382 0.2536 0.2628 -0.0046 0.0058  -0.0072 454 GLY A C   
1875 O O   . GLY A 243 ? 0.2616 0.2736 0.2851 -0.0060 0.0045  -0.0079 454 GLY A O   
1876 N N   . TYR A 244 ? 0.2262 0.2417 0.2503 -0.0017 0.0065  -0.0066 455 TYR A N   
1877 C CA  . TYR A 244 ? 0.2219 0.2332 0.2437 0.0000  0.0062  -0.0069 455 TYR A CA  
1878 C C   . TYR A 244 ? 0.2199 0.2347 0.2417 0.0011  0.0039  -0.0058 455 TYR A C   
1879 O O   . TYR A 244 ? 0.2278 0.2460 0.2503 0.0036  0.0049  -0.0044 455 TYR A O   
1880 C CB  . TYR A 244 ? 0.2053 0.2130 0.2259 0.0029  0.0099  -0.0071 455 TYR A CB  
1881 C CG  . TYR A 244 ? 0.2055 0.2102 0.2261 0.0014  0.0119  -0.0088 455 TYR A CG  
1882 C CD1 . TYR A 244 ? 0.1857 0.1858 0.2047 0.0003  0.0121  -0.0101 455 TYR A CD1 
1883 C CD2 . TYR A 244 ? 0.1681 0.1755 0.1903 0.0008  0.0136  -0.0094 455 TYR A CD2 
1884 C CE1 . TYR A 244 ? 0.1863 0.1850 0.2055 -0.0014 0.0138  -0.0118 455 TYR A CE1 
1885 C CE2 . TYR A 244 ? 0.1612 0.1668 0.1832 -0.0008 0.0152  -0.0114 455 TYR A CE2 
1886 C CZ  . TYR A 244 ? 0.1732 0.1747 0.1938 -0.0021 0.0153  -0.0126 455 TYR A CZ  
1887 O OH  . TYR A 244 ? 0.1742 0.1751 0.1947 -0.0039 0.0168  -0.0146 455 TYR A OH  
1888 N N   . MET A 245 ? 0.2217 0.2357 0.2428 -0.0008 0.0009  -0.0064 456 MET A N   
1889 C CA  . MET A 245 ? 0.2233 0.2412 0.2445 -0.0007 -0.0019 -0.0060 456 MET A CA  
1890 C C   . MET A 245 ? 0.2280 0.2473 0.2475 0.0032  -0.0009 -0.0051 456 MET A C   
1891 O O   . MET A 245 ? 0.2246 0.2498 0.2451 0.0041  -0.0024 -0.0041 456 MET A O   
1892 C CB  . MET A 245 ? 0.2408 0.2556 0.2608 -0.0031 -0.0048 -0.0077 456 MET A CB  
1893 C CG  . MET A 245 ? 0.2884 0.3072 0.3085 -0.0035 -0.0080 -0.0081 456 MET A CG  
1894 S SD  . MET A 245 ? 0.3553 0.3699 0.3741 -0.0065 -0.0113 -0.0106 456 MET A SD  
1895 C CE  . MET A 245 ? 0.4066 0.4189 0.4284 -0.0104 -0.0114 -0.0101 456 MET A CE  
1896 N N   . PHE A 246 ? 0.2181 0.2325 0.2354 0.0057  0.0016  -0.0051 457 PHE A N   
1897 C CA  . PHE A 246 ? 0.2200 0.2355 0.2358 0.0097  0.0030  -0.0036 457 PHE A CA  
1898 C C   . PHE A 246 ? 0.2208 0.2325 0.2366 0.0122  0.0073  -0.0026 457 PHE A C   
1899 O O   . PHE A 246 ? 0.2247 0.2340 0.2387 0.0152  0.0092  -0.0015 457 PHE A O   
1900 C CB  . PHE A 246 ? 0.2223 0.2358 0.2348 0.0105  0.0015  -0.0044 457 PHE A CB  
1901 C CG  . PHE A 246 ? 0.2208 0.2379 0.2331 0.0083  -0.0027 -0.0058 457 PHE A CG  
1902 C CD1 . PHE A 246 ? 0.2243 0.2486 0.2373 0.0093  -0.0045 -0.0049 457 PHE A CD1 
1903 C CD2 . PHE A 246 ? 0.2533 0.2667 0.2649 0.0053  -0.0047 -0.0081 457 PHE A CD2 
1904 C CE1 . PHE A 246 ? 0.2432 0.2708 0.2562 0.0069  -0.0083 -0.0066 457 PHE A CE1 
1905 C CE2 . PHE A 246 ? 0.2460 0.2620 0.2576 0.0031  -0.0083 -0.0098 457 PHE A CE2 
1906 C CZ  . PHE A 246 ? 0.2614 0.2844 0.2738 0.0036  -0.0102 -0.0092 457 PHE A CZ  
1907 N N   . GLY A 247 ? 0.2140 0.2249 0.2318 0.0108  0.0089  -0.0031 458 GLY A N   
1908 C CA  . GLY A 247 ? 0.2081 0.2149 0.2262 0.0127  0.0131  -0.0029 458 GLY A CA  
1909 C C   . GLY A 247 ? 0.1981 0.1987 0.2152 0.0109  0.0146  -0.0048 458 GLY A C   
1910 O O   . GLY A 247 ? 0.1899 0.1891 0.2059 0.0085  0.0124  -0.0061 458 GLY A O   
1911 N N   . LYS A 248 ? 0.1897 0.1866 0.2073 0.0121  0.0183  -0.0049 459 LYS A N   
1912 C CA  . LYS A 248 ? 0.2001 0.1919 0.2174 0.0101  0.0200  -0.0070 459 LYS A CA  
1913 C C   . LYS A 248 ? 0.2007 0.1882 0.2161 0.0115  0.0211  -0.0062 459 LYS A C   
1914 O O   . LYS A 248 ? 0.2044 0.1879 0.2200 0.0133  0.0246  -0.0055 459 LYS A O   
1915 C CB  . LYS A 248 ? 0.2094 0.1992 0.2282 0.0104  0.0235  -0.0081 459 LYS A CB  
1916 C CG  . LYS A 248 ? 0.2538 0.2484 0.2741 0.0084  0.0223  -0.0093 459 LYS A CG  
1917 C CD  . LYS A 248 ? 0.2498 0.2428 0.2713 0.0090  0.0259  -0.0108 459 LYS A CD  
1918 C CE  . LYS A 248 ? 0.2664 0.2650 0.2891 0.0075  0.0249  -0.0117 459 LYS A CE  
1919 N NZ  . LYS A 248 ? 0.2341 0.2312 0.2577 0.0082  0.0286  -0.0139 459 LYS A NZ  
1920 N N   . GLY A 249 ? 0.1935 0.1820 0.2072 0.0106  0.0182  -0.0063 460 GLY A N   
1921 C CA  . GLY A 249 ? 0.1949 0.1802 0.2066 0.0116  0.0189  -0.0057 460 GLY A CA  
1922 C C   . GLY A 249 ? 0.1961 0.1800 0.2071 0.0087  0.0174  -0.0077 460 GLY A C   
1923 O O   . GLY A 249 ? 0.1780 0.1627 0.1901 0.0058  0.0164  -0.0094 460 GLY A O   
1924 N N   . ILE A 250 ? 0.1890 0.1713 0.1981 0.0097  0.0173  -0.0072 461 ILE A N   
1925 C CA  . ILE A 250 ? 0.1738 0.1550 0.1819 0.0077  0.0160  -0.0087 461 ILE A CA  
1926 C C   . ILE A 250 ? 0.1800 0.1635 0.1862 0.0085  0.0126  -0.0087 461 ILE A C   
1927 O O   . ILE A 250 ? 0.1655 0.1500 0.1698 0.0111  0.0124  -0.0075 461 ILE A O   
1928 C CB  . ILE A 250 ? 0.1766 0.1547 0.1843 0.0083  0.0188  -0.0082 461 ILE A CB  
1929 C CG1 . ILE A 250 ? 0.1632 0.1385 0.1731 0.0074  0.0224  -0.0085 461 ILE A CG1 
1930 C CG2 . ILE A 250 ? 0.1657 0.1435 0.1727 0.0065  0.0176  -0.0096 461 ILE A CG2 
1931 C CD1 . ILE A 250 ? 0.1816 0.1536 0.1916 0.0079  0.0256  -0.0076 461 ILE A CD1 
1932 N N   . TYR A 251 ? 0.1749 0.1592 0.1815 0.0061  0.0100  -0.0102 462 TYR A N   
1933 C CA  . TYR A 251 ? 0.1706 0.1565 0.1758 0.0061  0.0066  -0.0109 462 TYR A CA  
1934 C C   . TYR A 251 ? 0.1758 0.1596 0.1791 0.0062  0.0056  -0.0120 462 TYR A C   
1935 O O   . TYR A 251 ? 0.1792 0.1613 0.1830 0.0050  0.0065  -0.0125 462 TYR A O   
1936 C CB  . TYR A 251 ? 0.1767 0.1644 0.1841 0.0034  0.0045  -0.0115 462 TYR A CB  
1937 C CG  . TYR A 251 ? 0.1561 0.1472 0.1652 0.0036  0.0046  -0.0105 462 TYR A CG  
1938 C CD1 . TYR A 251 ? 0.1820 0.1730 0.1924 0.0044  0.0077  -0.0096 462 TYR A CD1 
1939 C CD2 . TYR A 251 ? 0.1636 0.1580 0.1734 0.0028  0.0019  -0.0105 462 TYR A CD2 
1940 C CE1 . TYR A 251 ? 0.1394 0.1336 0.1514 0.0051  0.0080  -0.0086 462 TYR A CE1 
1941 C CE2 . TYR A 251 ? 0.1760 0.1744 0.1877 0.0031  0.0020  -0.0094 462 TYR A CE2 
1942 C CZ  . TYR A 251 ? 0.1679 0.1664 0.1807 0.0044  0.0051  -0.0083 462 TYR A CZ  
1943 O OH  . TYR A 251 ? 0.1710 0.1738 0.1857 0.0051  0.0054  -0.0071 462 TYR A OH  
1944 N N   . PHE A 252 ? 0.1716 0.1563 0.1725 0.0078  0.0037  -0.0125 463 PHE A N   
1945 C CA  . PHE A 252 ? 0.1849 0.1677 0.1833 0.0086  0.0028  -0.0138 463 PHE A CA  
1946 C C   . PHE A 252 ? 0.1922 0.1757 0.1894 0.0082  -0.0006 -0.0157 463 PHE A C   
1947 O O   . PHE A 252 ? 0.1856 0.1719 0.1831 0.0080  -0.0022 -0.0157 463 PHE A O   
1948 C CB  . PHE A 252 ? 0.1818 0.1647 0.1778 0.0117  0.0050  -0.0127 463 PHE A CB  
1949 C CG  . PHE A 252 ? 0.1789 0.1604 0.1764 0.0116  0.0086  -0.0111 463 PHE A CG  
1950 C CD1 . PHE A 252 ? 0.1619 0.1417 0.1601 0.0106  0.0097  -0.0116 463 PHE A CD1 
1951 C CD2 . PHE A 252 ? 0.1482 0.1303 0.1469 0.0126  0.0108  -0.0092 463 PHE A CD2 
1952 C CE1 . PHE A 252 ? 0.1291 0.1079 0.1289 0.0101  0.0129  -0.0105 463 PHE A CE1 
1953 C CE2 . PHE A 252 ? 0.1306 0.1107 0.1309 0.0122  0.0142  -0.0081 463 PHE A CE2 
1954 C CZ  . PHE A 252 ? 0.1166 0.0951 0.1175 0.0107  0.0151  -0.0090 463 PHE A CZ  
1955 N N   . ALA A 253 ? 0.2137 0.1945 0.2097 0.0079  -0.0018 -0.0174 464 ALA A N   
1956 C CA  . ALA A 253 ? 0.2208 0.2011 0.2151 0.0078  -0.0048 -0.0198 464 ALA A CA  
1957 C C   . ALA A 253 ? 0.2344 0.2138 0.2249 0.0106  -0.0046 -0.0212 464 ALA A C   
1958 O O   . ALA A 253 ? 0.2314 0.2097 0.2212 0.0122  -0.0024 -0.0203 464 ALA A O   
1959 C CB  . ALA A 253 ? 0.2177 0.1950 0.2142 0.0050  -0.0065 -0.0208 464 ALA A CB  
1960 N N   . ASP A 254 ? 0.2428 0.2231 0.2309 0.0113  -0.0070 -0.0235 465 ASP A N   
1961 C CA  . ASP A 254 ? 0.2362 0.2153 0.2205 0.0137  -0.0073 -0.0258 465 ASP A CA  
1962 C C   . ASP A 254 ? 0.2508 0.2250 0.2353 0.0122  -0.0092 -0.0287 465 ASP A C   
1963 O O   . ASP A 254 ? 0.2656 0.2379 0.2470 0.0141  -0.0097 -0.0312 465 ASP A O   
1964 C CB  . ASP A 254 ? 0.2325 0.2161 0.2133 0.0158  -0.0085 -0.0268 465 ASP A CB  
1965 C CG  . ASP A 254 ? 0.2444 0.2300 0.2260 0.0135  -0.0118 -0.0289 465 ASP A CG  
1966 O OD1 . ASP A 254 ? 0.2391 0.2213 0.2232 0.0103  -0.0135 -0.0304 465 ASP A OD1 
1967 O OD2 . ASP A 254 ? 0.2261 0.2171 0.2057 0.0149  -0.0127 -0.0290 465 ASP A OD2 
1968 N N   . MET A 255 ? 0.2220 0.1939 0.2103 0.0089  -0.0102 -0.0282 466 MET A N   
1969 C CA  . MET A 255 ? 0.2210 0.1876 0.2103 0.0075  -0.0114 -0.0300 466 MET A CA  
1970 C C   . MET A 255 ? 0.2231 0.1878 0.2152 0.0069  -0.0096 -0.0275 466 MET A C   
1971 O O   . MET A 255 ? 0.2184 0.1849 0.2136 0.0046  -0.0092 -0.0252 466 MET A O   
1972 C CB  . MET A 255 ? 0.2140 0.1796 0.2055 0.0041  -0.0142 -0.0315 466 MET A CB  
1973 C CG  . MET A 255 ? 0.2200 0.1885 0.2092 0.0040  -0.0166 -0.0344 466 MET A CG  
1974 S SD  . MET A 255 ? 0.2558 0.2210 0.2401 0.0066  -0.0176 -0.0392 466 MET A SD  
1975 C CE  . MET A 255 ? 0.1814 0.1381 0.1683 0.0038  -0.0191 -0.0414 466 MET A CE  
1976 N N   . SER A 256 ? 0.2189 0.1806 0.2099 0.0088  -0.0086 -0.0280 467 SER A N   
1977 C CA  . SER A 256 ? 0.2240 0.1852 0.2171 0.0088  -0.0067 -0.0256 467 SER A CA  
1978 C C   . SER A 256 ? 0.2231 0.1833 0.2202 0.0056  -0.0075 -0.0239 467 SER A C   
1979 O O   . SER A 256 ? 0.2165 0.1793 0.2159 0.0045  -0.0061 -0.0214 467 SER A O   
1980 C CB  . SER A 256 ? 0.2334 0.1916 0.2247 0.0116  -0.0060 -0.0267 467 SER A CB  
1981 O OG  . SER A 256 ? 0.2299 0.1828 0.2215 0.0110  -0.0079 -0.0287 467 SER A OG  
1982 N N   . SER A 257 ? 0.2306 0.1874 0.2287 0.0038  -0.0097 -0.0254 468 SER A N   
1983 C CA  . SER A 257 ? 0.2162 0.1717 0.2180 0.0010  -0.0104 -0.0235 468 SER A CA  
1984 C C   . SER A 257 ? 0.2081 0.1681 0.2122 -0.0017 -0.0107 -0.0219 468 SER A C   
1985 O O   . SER A 257 ? 0.1997 0.1610 0.2067 -0.0036 -0.0103 -0.0195 468 SER A O   
1986 C CB  . SER A 257 ? 0.2194 0.1690 0.2219 -0.0001 -0.0123 -0.0254 468 SER A CB  
1987 O OG  . SER A 257 ? 0.2449 0.1946 0.2461 -0.0013 -0.0144 -0.0283 468 SER A OG  
1988 N N   . LYS A 258 ? 0.2121 0.1750 0.2147 -0.0017 -0.0114 -0.0231 469 LYS A N   
1989 C CA  . LYS A 258 ? 0.2083 0.1759 0.2131 -0.0036 -0.0114 -0.0214 469 LYS A CA  
1990 C C   . LYS A 258 ? 0.2103 0.1806 0.2160 -0.0031 -0.0088 -0.0190 469 LYS A C   
1991 O O   . LYS A 258 ? 0.1755 0.1483 0.1840 -0.0051 -0.0084 -0.0171 469 LYS A O   
1992 C CB  . LYS A 258 ? 0.2149 0.1857 0.2178 -0.0029 -0.0122 -0.0228 469 LYS A CB  
1993 C CG  . LYS A 258 ? 0.2365 0.2125 0.2416 -0.0042 -0.0119 -0.0209 469 LYS A CG  
1994 C CD  . LYS A 258 ? 0.2350 0.2148 0.2388 -0.0037 -0.0133 -0.0220 469 LYS A CD  
1995 C CE  . LYS A 258 ? 0.2246 0.2097 0.2306 -0.0042 -0.0124 -0.0197 469 LYS A CE  
1996 N NZ  . LYS A 258 ? 0.2263 0.2162 0.2316 -0.0036 -0.0139 -0.0202 469 LYS A NZ  
1997 N N   . SER A 259 ? 0.1883 0.1584 0.1917 -0.0005 -0.0070 -0.0192 470 SER A N   
1998 C CA  . SER A 259 ? 0.1809 0.1534 0.1853 -0.0003 -0.0045 -0.0174 470 SER A CA  
1999 C C   . SER A 259 ? 0.1816 0.1532 0.1878 -0.0012 -0.0042 -0.0162 470 SER A C   
2000 O O   . SER A 259 ? 0.1668 0.1413 0.1751 -0.0027 -0.0031 -0.0146 470 SER A O   
2001 C CB  . SER A 259 ? 0.1897 0.1627 0.1915 0.0025  -0.0025 -0.0177 470 SER A CB  
2002 O OG  . SER A 259 ? 0.1672 0.1421 0.1677 0.0035  -0.0021 -0.0178 470 SER A OG  
2003 N N   . ALA A 260 ? 0.1808 0.1489 0.1864 -0.0002 -0.0050 -0.0169 471 ALA A N   
2004 C CA  . ALA A 260 ? 0.1737 0.1414 0.1812 -0.0005 -0.0046 -0.0152 471 ALA A CA  
2005 C C   . ALA A 260 ? 0.1822 0.1508 0.1928 -0.0033 -0.0056 -0.0134 471 ALA A C   
2006 O O   . ALA A 260 ? 0.1944 0.1650 0.2067 -0.0038 -0.0049 -0.0113 471 ALA A O   
2007 C CB  . ALA A 260 ? 0.1608 0.1241 0.1670 0.0017  -0.0051 -0.0161 471 ALA A CB  
2008 N N   . ASN A 261 ? 0.1843 0.1520 0.1957 -0.0052 -0.0073 -0.0139 472 ASN A N   
2009 C CA  . ASN A 261 ? 0.1985 0.1683 0.2131 -0.0080 -0.0079 -0.0118 472 ASN A CA  
2010 C C   . ASN A 261 ? 0.2083 0.1838 0.2239 -0.0087 -0.0063 -0.0103 472 ASN A C   
2011 O O   . ASN A 261 ? 0.2337 0.2118 0.2515 -0.0103 -0.0061 -0.0081 472 ASN A O   
2012 C CB  . ASN A 261 ? 0.1916 0.1610 0.2071 -0.0100 -0.0098 -0.0127 472 ASN A CB  
2013 C CG  . ASN A 261 ? 0.2085 0.1722 0.2237 -0.0102 -0.0117 -0.0144 472 ASN A CG  
2014 O OD1 . ASN A 261 ? 0.1968 0.1561 0.2119 -0.0092 -0.0116 -0.0142 472 ASN A OD1 
2015 N ND2 . ASN A 261 ? 0.1985 0.1621 0.2135 -0.0115 -0.0134 -0.0163 472 ASN A ND2 
2016 N N   . TYR A 262 ? 0.2077 0.1852 0.2216 -0.0076 -0.0049 -0.0115 473 TYR A N   
2017 C CA  . TYR A 262 ? 0.2071 0.1894 0.2219 -0.0083 -0.0030 -0.0106 473 TYR A CA  
2018 C C   . TYR A 262 ? 0.2020 0.1861 0.2169 -0.0078 -0.0015 -0.0100 473 TYR A C   
2019 O O   . TYR A 262 ? 0.1969 0.1848 0.2124 -0.0086 0.0000  -0.0099 473 TYR A O   
2020 C CB  . TYR A 262 ? 0.2003 0.1836 0.2138 -0.0074 -0.0019 -0.0119 473 TYR A CB  
2021 C CG  . TYR A 262 ? 0.2135 0.1973 0.2275 -0.0082 -0.0033 -0.0120 473 TYR A CG  
2022 C CD1 . TYR A 262 ? 0.2089 0.1964 0.2251 -0.0099 -0.0032 -0.0109 473 TYR A CD1 
2023 C CD2 . TYR A 262 ? 0.2322 0.2135 0.2446 -0.0072 -0.0048 -0.0133 473 TYR A CD2 
2024 C CE1 . TYR A 262 ? 0.2118 0.2008 0.2289 -0.0106 -0.0045 -0.0108 473 TYR A CE1 
2025 C CE2 . TYR A 262 ? 0.2153 0.1982 0.2285 -0.0080 -0.0063 -0.0135 473 TYR A CE2 
2026 C CZ  . TYR A 262 ? 0.2485 0.2354 0.2643 -0.0098 -0.0061 -0.0121 473 TYR A CZ  
2027 O OH  . TYR A 262 ? 0.2888 0.2781 0.3055 -0.0106 -0.0075 -0.0121 473 TYR A OH  
2028 N N   . CYS A 263 ? 0.2037 0.1853 0.2180 -0.0064 -0.0019 -0.0098 474 CYS A N   
2029 C CA  . CYS A 263 ? 0.1999 0.1844 0.2149 -0.0061 -0.0009 -0.0086 474 CYS A CA  
2030 C C   . CYS A 263 ? 0.2077 0.1955 0.2251 -0.0079 -0.0014 -0.0061 474 CYS A C   
2031 O O   . CYS A 263 ? 0.1926 0.1852 0.2108 -0.0082 -0.0004 -0.0050 474 CYS A O   
2032 C CB  . CYS A 263 ? 0.2200 0.2012 0.2338 -0.0037 -0.0010 -0.0086 474 CYS A CB  
2033 S SG  . CYS A 263 ? 0.2040 0.1828 0.2148 -0.0014 0.0000  -0.0111 474 CYS A SG  
2034 N N   . PHE A 264 ? 0.2072 0.1928 0.2257 -0.0090 -0.0029 -0.0052 475 PHE A N   
2035 C CA  . PHE A 264 ? 0.2206 0.2089 0.2416 -0.0105 -0.0034 -0.0022 475 PHE A CA  
2036 C C   . PHE A 264 ? 0.2271 0.2159 0.2486 -0.0090 -0.0031 -0.0001 475 PHE A C   
2037 O O   . PHE A 264 ? 0.2228 0.2171 0.2456 -0.0097 -0.0026 0.0022  475 PHE A O   
2038 C CB  . PHE A 264 ? 0.2069 0.2015 0.2288 -0.0124 -0.0026 -0.0019 475 PHE A CB  
2039 C CG  . PHE A 264 ? 0.2203 0.2144 0.2424 -0.0136 -0.0030 -0.0030 475 PHE A CG  
2040 C CD1 . PHE A 264 ? 0.2547 0.2482 0.2788 -0.0153 -0.0044 -0.0014 475 PHE A CD1 
2041 C CD2 . PHE A 264 ? 0.2169 0.2111 0.2374 -0.0130 -0.0020 -0.0055 475 PHE A CD2 
2042 C CE1 . PHE A 264 ? 0.2562 0.2502 0.2806 -0.0163 -0.0050 -0.0024 475 PHE A CE1 
2043 C CE2 . PHE A 264 ? 0.2387 0.2329 0.2594 -0.0136 -0.0024 -0.0062 475 PHE A CE2 
2044 C CZ  . PHE A 264 ? 0.2792 0.2738 0.3020 -0.0153 -0.0040 -0.0047 475 PHE A CZ  
2045 N N   . ALA A 265 ? 0.2417 0.2255 0.2620 -0.0068 -0.0033 -0.0009 476 ALA A N   
2046 C CA  . ALA A 265 ? 0.2452 0.2289 0.2662 -0.0049 -0.0030 0.0014  476 ALA A CA  
2047 C C   . ALA A 265 ? 0.2526 0.2336 0.2761 -0.0057 -0.0041 0.0045  476 ALA A C   
2048 O O   . ALA A 265 ? 0.2615 0.2398 0.2859 -0.0077 -0.0051 0.0043  476 ALA A O   
2049 C CB  . ALA A 265 ? 0.2475 0.2264 0.2666 -0.0019 -0.0028 -0.0003 476 ALA A CB  
2050 N N   . SER A 266 ? 0.2601 0.2420 0.2848 -0.0040 -0.0036 0.0075  477 SER A N   
2051 C CA  . SER A 266 ? 0.2902 0.2689 0.3174 -0.0044 -0.0042 0.0111  477 SER A CA  
2052 C C   . SER A 266 ? 0.3006 0.2772 0.3282 -0.0009 -0.0036 0.0134  477 SER A C   
2053 O O   . SER A 266 ? 0.2813 0.2607 0.3075 0.0015  -0.0027 0.0126  477 SER A O   
2054 C CB  . SER A 266 ? 0.2794 0.2659 0.3087 -0.0066 -0.0040 0.0144  477 SER A CB  
2055 O OG  . SER A 266 ? 0.2919 0.2865 0.3209 -0.0053 -0.0030 0.0161  477 SER A OG  
2056 N N   . ARG A 267 ? 0.3339 0.3060 0.3639 -0.0008 -0.0038 0.0168  478 ARG A N   
2057 C CA  . ARG A 267 ? 0.3559 0.3256 0.3870 0.0027  -0.0030 0.0200  478 ARG A CA  
2058 C C   . ARG A 267 ? 0.3480 0.3282 0.3793 0.0043  -0.0020 0.0229  478 ARG A C   
2059 O O   . ARG A 267 ? 0.3537 0.3350 0.3844 0.0077  -0.0011 0.0236  478 ARG A O   
2060 C CB  . ARG A 267 ? 0.3764 0.3395 0.4106 0.0022  -0.0032 0.0237  478 ARG A CB  
2061 C CG  . ARG A 267 ? 0.4335 0.3981 0.4696 -0.0022 -0.0041 0.0248  478 ARG A CG  
2062 C CD  . ARG A 267 ? 0.5064 0.4642 0.5461 -0.0032 -0.0042 0.0285  478 ARG A CD  
2063 N NE  . ARG A 267 ? 0.5305 0.4951 0.5725 -0.0063 -0.0042 0.0324  478 ARG A NE  
2064 C CZ  . ARG A 267 ? 0.5609 0.5339 0.6041 -0.0053 -0.0032 0.0376  478 ARG A CZ  
2065 N NH1 . ARG A 267 ? 0.5584 0.5346 0.6011 -0.0013 -0.0021 0.0399  478 ARG A NH1 
2066 N NH2 . ARG A 267 ? 0.5843 0.5635 0.6294 -0.0081 -0.0032 0.0407  478 ARG A NH2 
2067 N N   . LEU A 268 ? 0.3500 0.3387 0.3819 0.0017  -0.0020 0.0242  479 LEU A N   
2068 C CA  . LEU A 268 ? 0.3597 0.3596 0.3917 0.0025  -0.0013 0.0265  479 LEU A CA  
2069 C C   . LEU A 268 ? 0.3483 0.3526 0.3779 0.0031  -0.0008 0.0224  479 LEU A C   
2070 O O   . LEU A 268 ? 0.3519 0.3626 0.3815 0.0052  -0.0001 0.0238  479 LEU A O   
2071 C CB  . LEU A 268 ? 0.3700 0.3776 0.4030 -0.0007 -0.0015 0.0281  479 LEU A CB  
2072 C CG  . LEU A 268 ? 0.4179 0.4228 0.4532 -0.0029 -0.0019 0.0314  479 LEU A CG  
2073 C CD1 . LEU A 268 ? 0.4452 0.4381 0.4811 -0.0042 -0.0028 0.0295  479 LEU A CD1 
2074 C CD2 . LEU A 268 ? 0.4095 0.4232 0.4447 -0.0060 -0.0020 0.0312  479 LEU A CD2 
2075 N N   . LYS A 269 ? 0.3409 0.3419 0.3687 0.0012  -0.0011 0.0178  480 LYS A N   
2076 C CA  . LYS A 269 ? 0.3358 0.3403 0.3615 0.0012  -0.0005 0.0139  480 LYS A CA  
2077 C C   . LYS A 269 ? 0.3219 0.3178 0.3458 0.0021  -0.0007 0.0104  480 LYS A C   
2078 O O   . LYS A 269 ? 0.3055 0.2988 0.3283 0.0001  -0.0011 0.0074  480 LYS A O   
2079 C CB  . LYS A 269 ? 0.3429 0.3526 0.3682 -0.0023 -0.0005 0.0118  480 LYS A CB  
2080 C CG  . LYS A 269 ? 0.3908 0.4111 0.4162 -0.0030 0.0003  0.0120  480 LYS A CG  
2081 C CD  . LYS A 269 ? 0.4283 0.4554 0.4555 -0.0033 0.0001  0.0162  480 LYS A CD  
2082 C CE  . LYS A 269 ? 0.4411 0.4796 0.4683 -0.0034 0.0007  0.0165  480 LYS A CE  
2083 N NZ  . LYS A 269 ? 0.4495 0.4902 0.4775 -0.0001 0.0009  0.0194  480 LYS A NZ  
2084 N N   . ASN A 270 ? 0.3193 0.3110 0.3429 0.0055  -0.0004 0.0108  481 ASN A N   
2085 C CA  . ASN A 270 ? 0.3191 0.3017 0.3410 0.0067  -0.0008 0.0078  481 ASN A CA  
2086 C C   . ASN A 270 ? 0.3087 0.2923 0.3281 0.0077  0.0000  0.0044  481 ASN A C   
2087 O O   . ASN A 270 ? 0.3268 0.3041 0.3444 0.0094  -0.0002 0.0019  481 ASN A O   
2088 C CB  . ASN A 270 ? 0.3265 0.3021 0.3492 0.0098  -0.0009 0.0098  481 ASN A CB  
2089 C CG  . ASN A 270 ? 0.3490 0.3275 0.3716 0.0140  0.0004  0.0113  481 ASN A CG  
2090 O OD1 . ASN A 270 ? 0.4010 0.3883 0.4237 0.0142  0.0012  0.0119  481 ASN A OD1 
2091 N ND2 . ASN A 270 ? 0.3785 0.3495 0.4011 0.0172  0.0006  0.0117  481 ASN A ND2 
2092 N N   . THR A 271 ? 0.2898 0.2815 0.3093 0.0067  0.0009  0.0041  482 THR A N   
2093 C CA  . THR A 271 ? 0.2855 0.2786 0.3032 0.0074  0.0019  0.0013  482 THR A CA  
2094 C C   . THR A 271 ? 0.2596 0.2537 0.2765 0.0042  0.0020  -0.0011 482 THR A C   
2095 O O   . THR A 271 ? 0.2697 0.2695 0.2879 0.0017  0.0022  -0.0005 482 THR A O   
2096 C CB  . THR A 271 ? 0.2789 0.2802 0.2975 0.0085  0.0031  0.0026  482 THR A CB  
2097 O OG1 . THR A 271 ? 0.3268 0.3266 0.3459 0.0124  0.0033  0.0047  482 THR A OG1 
2098 C CG2 . THR A 271 ? 0.2990 0.3020 0.3163 0.0084  0.0043  -0.0001 482 THR A CG2 
2099 N N   . GLY A 272 ? 0.2437 0.2328 0.2586 0.0046  0.0020  -0.0038 483 GLY A N   
2100 C CA  . GLY A 272 ? 0.2306 0.2201 0.2447 0.0022  0.0023  -0.0059 483 GLY A CA  
2101 C C   . GLY A 272 ? 0.2270 0.2154 0.2391 0.0036  0.0036  -0.0079 483 GLY A C   
2102 O O   . GLY A 272 ? 0.2146 0.2019 0.2258 0.0065  0.0040  -0.0079 483 GLY A O   
2103 N N   . LEU A 273 ? 0.2005 0.1896 0.2121 0.0019  0.0043  -0.0094 484 LEU A N   
2104 C CA  . LEU A 273 ? 0.1875 0.1756 0.1974 0.0030  0.0057  -0.0108 484 LEU A CA  
2105 C C   . LEU A 273 ? 0.1843 0.1681 0.1925 0.0030  0.0051  -0.0122 484 LEU A C   
2106 O O   . LEU A 273 ? 0.1958 0.1790 0.2047 0.0012  0.0042  -0.0122 484 LEU A O   
2107 C CB  . LEU A 273 ? 0.1812 0.1742 0.1923 0.0011  0.0077  -0.0111 484 LEU A CB  
2108 C CG  . LEU A 273 ? 0.1860 0.1854 0.1993 0.0003  0.0083  -0.0100 484 LEU A CG  
2109 C CD1 . LEU A 273 ? 0.1281 0.1316 0.1426 -0.0022 0.0102  -0.0111 484 LEU A CD1 
2110 C CD2 . LEU A 273 ? 0.2191 0.2190 0.2319 0.0034  0.0083  -0.0090 484 LEU A CD2 
2111 N N   . LEU A 274 ? 0.1804 0.1621 0.1863 0.0053  0.0057  -0.0131 485 LEU A N   
2112 C CA  . LEU A 274 ? 0.1923 0.1712 0.1963 0.0057  0.0054  -0.0142 485 LEU A CA  
2113 C C   . LEU A 274 ? 0.1948 0.1751 0.1978 0.0066  0.0076  -0.0143 485 LEU A C   
2114 O O   . LEU A 274 ? 0.2102 0.1921 0.2128 0.0081  0.0089  -0.0139 485 LEU A O   
2115 C CB  . LEU A 274 ? 0.1997 0.1745 0.2013 0.0080  0.0037  -0.0155 485 LEU A CB  
2116 C CG  . LEU A 274 ? 0.2189 0.1906 0.2211 0.0068  0.0013  -0.0159 485 LEU A CG  
2117 C CD1 . LEU A 274 ? 0.1717 0.1390 0.1716 0.0092  -0.0001 -0.0177 485 LEU A CD1 
2118 C CD2 . LEU A 274 ? 0.1989 0.1712 0.2014 0.0049  0.0007  -0.0161 485 LEU A CD2 
2119 N N   . LEU A 275 ? 0.1821 0.1619 0.1847 0.0059  0.0082  -0.0144 486 LEU A N   
2120 C CA  . LEU A 275 ? 0.1821 0.1627 0.1841 0.0067  0.0106  -0.0139 486 LEU A CA  
2121 C C   . LEU A 275 ? 0.1816 0.1604 0.1805 0.0094  0.0101  -0.0142 486 LEU A C   
2122 O O   . LEU A 275 ? 0.1833 0.1607 0.1813 0.0094  0.0082  -0.0149 486 LEU A O   
2123 C CB  . LEU A 275 ? 0.1785 0.1598 0.1825 0.0043  0.0119  -0.0136 486 LEU A CB  
2124 C CG  . LEU A 275 ? 0.2244 0.2056 0.2285 0.0046  0.0148  -0.0128 486 LEU A CG  
2125 C CD1 . LEU A 275 ? 0.2036 0.1871 0.2090 0.0041  0.0169  -0.0124 486 LEU A CD1 
2126 C CD2 . LEU A 275 ? 0.2030 0.1837 0.2089 0.0026  0.0157  -0.0129 486 LEU A CD2 
2127 N N   . LEU A 276 ? 0.1837 0.1634 0.1811 0.0115  0.0119  -0.0136 487 LEU A N   
2128 C CA  . LEU A 276 ? 0.1843 0.1636 0.1788 0.0140  0.0121  -0.0134 487 LEU A CA  
2129 C C   . LEU A 276 ? 0.1775 0.1578 0.1728 0.0140  0.0151  -0.0115 487 LEU A C   
2130 O O   . LEU A 276 ? 0.1784 0.1600 0.1754 0.0133  0.0175  -0.0104 487 LEU A O   
2131 C CB  . LEU A 276 ? 0.1745 0.1540 0.1659 0.0171  0.0116  -0.0143 487 LEU A CB  
2132 C CG  . LEU A 276 ? 0.1822 0.1594 0.1721 0.0178  0.0086  -0.0166 487 LEU A CG  
2133 C CD1 . LEU A 276 ? 0.1623 0.1398 0.1496 0.0210  0.0089  -0.0175 487 LEU A CD1 
2134 C CD2 . LEU A 276 ? 0.1782 0.1542 0.1661 0.0181  0.0065  -0.0179 487 LEU A CD2 
2135 N N   . SER A 277 ? 0.1844 0.1643 0.1785 0.0150  0.0151  -0.0108 488 SER A N   
2136 C CA  . SER A 277 ? 0.1918 0.1716 0.1868 0.0152  0.0180  -0.0086 488 SER A CA  
2137 C C   . SER A 277 ? 0.2030 0.1840 0.1950 0.0185  0.0180  -0.0074 488 SER A C   
2138 O O   . SER A 277 ? 0.2000 0.1815 0.1898 0.0196  0.0154  -0.0086 488 SER A O   
2139 C CB  . SER A 277 ? 0.1996 0.1782 0.1973 0.0128  0.0181  -0.0086 488 SER A CB  
2140 O OG  . SER A 277 ? 0.2040 0.1824 0.2043 0.0096  0.0179  -0.0099 488 SER A OG  
2141 N N   . GLU A 278 ? 0.2032 0.1847 0.1953 0.0198  0.0212  -0.0047 489 GLU A N   
2142 C CA  . GLU A 278 ? 0.2151 0.1981 0.2045 0.0230  0.0216  -0.0028 489 GLU A CA  
2143 C C   . GLU A 278 ? 0.2010 0.1828 0.1922 0.0224  0.0219  -0.0018 489 GLU A C   
2144 O O   . GLU A 278 ? 0.2201 0.1994 0.2145 0.0204  0.0242  -0.0009 489 GLU A O   
2145 C CB  . GLU A 278 ? 0.2190 0.2033 0.2079 0.0251  0.0250  0.0003  489 GLU A CB  
2146 C CG  . GLU A 278 ? 0.2681 0.2540 0.2558 0.0256  0.0250  -0.0006 489 GLU A CG  
2147 C CD  . GLU A 278 ? 0.3197 0.3073 0.3077 0.0269  0.0286  0.0025  489 GLU A CD  
2148 O OE1 . GLU A 278 ? 0.3532 0.3395 0.3432 0.0267  0.0316  0.0056  489 GLU A OE1 
2149 O OE2 . GLU A 278 ? 0.3859 0.3759 0.3722 0.0282  0.0286  0.0019  489 GLU A OE2 
2150 N N   . VAL A 279 ? 0.1988 0.1827 0.1878 0.0243  0.0198  -0.0018 490 VAL A N   
2151 C CA  . VAL A 279 ? 0.1830 0.1668 0.1734 0.0241  0.0195  -0.0010 490 VAL A CA  
2152 C C   . VAL A 279 ? 0.2018 0.1889 0.1900 0.0280  0.0203  0.0019  490 VAL A C   
2153 O O   . VAL A 279 ? 0.2094 0.2002 0.1940 0.0302  0.0181  0.0012  490 VAL A O   
2154 C CB  . VAL A 279 ? 0.1661 0.1508 0.1567 0.0224  0.0157  -0.0039 490 VAL A CB  
2155 C CG1 . VAL A 279 ? 0.1708 0.1562 0.1633 0.0222  0.0157  -0.0028 490 VAL A CG1 
2156 C CG2 . VAL A 279 ? 0.1440 0.1261 0.1365 0.0189  0.0148  -0.0065 490 VAL A CG2 
2157 N N   . ALA A 280 ? 0.2001 0.1858 0.1902 0.0290  0.0237  0.0052  491 ALA A N   
2158 C CA  . ALA A 280 ? 0.2166 0.2053 0.2050 0.0331  0.0250  0.0089  491 ALA A CA  
2159 C C   . ALA A 280 ? 0.2315 0.2232 0.2200 0.0339  0.0228  0.0089  491 ALA A C   
2160 O O   . ALA A 280 ? 0.2446 0.2344 0.2360 0.0339  0.0246  0.0106  491 ALA A O   
2161 C CB  . ALA A 280 ? 0.2091 0.1943 0.2000 0.0338  0.0298  0.0128  491 ALA A CB  
2162 N N   . LEU A 281 ? 0.2432 0.2398 0.2288 0.0347  0.0190  0.0069  492 LEU A N   
2163 C CA  . LEU A 281 ? 0.2484 0.2486 0.2344 0.0348  0.0163  0.0062  492 LEU A CA  
2164 C C   . LEU A 281 ? 0.2704 0.2748 0.2560 0.0388  0.0179  0.0105  492 LEU A C   
2165 O O   . LEU A 281 ? 0.2603 0.2668 0.2477 0.0391  0.0173  0.0113  492 LEU A O   
2166 C CB  . LEU A 281 ? 0.2453 0.2492 0.2285 0.0339  0.0118  0.0025  492 LEU A CB  
2167 C CG  . LEU A 281 ? 0.2440 0.2437 0.2281 0.0300  0.0100  -0.0016 492 LEU A CG  
2168 C CD1 . LEU A 281 ? 0.2120 0.2145 0.1930 0.0296  0.0060  -0.0053 492 LEU A CD1 
2169 C CD2 . LEU A 281 ? 0.2107 0.2077 0.1989 0.0267  0.0098  -0.0024 492 LEU A CD2 
2170 N N   . GLY A 282 ? 0.2819 0.2880 0.2651 0.0423  0.0201  0.0137  493 GLY A N   
2171 C CA  . GLY A 282 ? 0.2951 0.3065 0.2775 0.0468  0.0214  0.0183  493 GLY A CA  
2172 C C   . GLY A 282 ? 0.3040 0.3230 0.2845 0.0474  0.0170  0.0165  493 GLY A C   
2173 O O   . GLY A 282 ? 0.3057 0.3269 0.2838 0.0455  0.0133  0.0122  493 GLY A O   
2174 N N   . GLN A 283 ? 0.3277 0.3510 0.3094 0.0500  0.0175  0.0197  494 GLN A N   
2175 C CA  . GLN A 283 ? 0.3465 0.3778 0.3273 0.0501  0.0133  0.0181  494 GLN A CA  
2176 C C   . GLN A 283 ? 0.3359 0.3646 0.3201 0.0457  0.0111  0.0144  494 GLN A C   
2177 O O   . GLN A 283 ? 0.3522 0.3767 0.3401 0.0451  0.0135  0.0159  494 GLN A O   
2178 C CB  . GLN A 283 ? 0.3587 0.3966 0.3399 0.0551  0.0149  0.0236  494 GLN A CB  
2179 C CG  . GLN A 283 ? 0.4021 0.4457 0.3794 0.0598  0.0161  0.0273  494 GLN A CG  
2180 C CD  . GLN A 283 ? 0.4690 0.5217 0.4419 0.0598  0.0113  0.0238  494 GLN A CD  
2181 O OE1 . GLN A 283 ? 0.4754 0.5267 0.4452 0.0583  0.0099  0.0203  494 GLN A OE1 
2182 N NE2 . GLN A 283 ? 0.5264 0.5887 0.4990 0.0614  0.0086  0.0245  494 GLN A NE2 
2183 N N   . CYS A 284 ? 0.3322 0.3636 0.3151 0.0426  0.0067  0.0097  495 CYS A N   
2184 C CA  . CYS A 284 ? 0.3406 0.3705 0.3266 0.0383  0.0042  0.0064  495 CYS A CA  
2185 C C   . CYS A 284 ? 0.3372 0.3749 0.3251 0.0390  0.0024  0.0076  495 CYS A C   
2186 O O   . CYS A 284 ? 0.3321 0.3781 0.3177 0.0407  -0.0001 0.0076  495 CYS A O   
2187 C CB  . CYS A 284 ? 0.3330 0.3622 0.3173 0.0346  0.0004  0.0010  495 CYS A CB  
2188 S SG  . CYS A 284 ? 0.3408 0.3610 0.3237 0.0330  0.0020  -0.0011 495 CYS A SG  
2189 N N   . ASN A 285 ? 0.3321 0.3675 0.3240 0.0376  0.0035  0.0083  496 ASN A N   
2190 C CA  . ASN A 285 ? 0.3342 0.3766 0.3286 0.0367  0.0010  0.0081  496 ASN A CA  
2191 C C   . ASN A 285 ? 0.3380 0.3799 0.3331 0.0312  -0.0030 0.0031  496 ASN A C   
2192 O O   . ASN A 285 ? 0.3264 0.3620 0.3238 0.0279  -0.0025 0.0014  496 ASN A O   
2193 C CB  . ASN A 285 ? 0.3346 0.3754 0.3329 0.0378  0.0041  0.0110  496 ASN A CB  
2194 C CG  . ASN A 285 ? 0.3569 0.4066 0.3579 0.0377  0.0018  0.0116  496 ASN A CG  
2195 O OD1 . ASN A 285 ? 0.3481 0.4068 0.3477 0.0394  -0.0007 0.0123  496 ASN A OD1 
2196 N ND2 . ASN A 285 ? 0.3106 0.3585 0.3153 0.0356  0.0025  0.0112  496 ASN A ND2 
2197 N N   . GLU A 286 ? 0.3396 0.3885 0.3330 0.0304  -0.0070 0.0009  497 GLU A N   
2198 C CA  . GLU A 286 ? 0.3423 0.3902 0.3361 0.0253  -0.0108 -0.0039 497 GLU A CA  
2199 C C   . GLU A 286 ? 0.3410 0.3935 0.3392 0.0224  -0.0127 -0.0041 497 GLU A C   
2200 O O   . GLU A 286 ? 0.3501 0.4116 0.3491 0.0241  -0.0139 -0.0023 497 GLU A O   
2201 C CB  . GLU A 286 ? 0.3396 0.3925 0.3294 0.0254  -0.0142 -0.0069 497 GLU A CB  
2202 C CG  . GLU A 286 ? 0.3487 0.3988 0.3341 0.0285  -0.0125 -0.0066 497 GLU A CG  
2203 C CD  . GLU A 286 ? 0.3835 0.4388 0.3647 0.0286  -0.0159 -0.0101 497 GLU A CD  
2204 O OE1 . GLU A 286 ? 0.4179 0.4815 0.3996 0.0275  -0.0193 -0.0116 497 GLU A OE1 
2205 O OE2 . GLU A 286 ? 0.3913 0.4429 0.3688 0.0299  -0.0152 -0.0115 497 GLU A OE2 
2206 N N   . LEU A 287 ? 0.3479 0.3947 0.3487 0.0182  -0.0131 -0.0061 498 LEU A N   
2207 C CA  . LEU A 287 ? 0.3459 0.3967 0.3511 0.0149  -0.0148 -0.0062 498 LEU A CA  
2208 C C   . LEU A 287 ? 0.3581 0.4070 0.3642 0.0095  -0.0184 -0.0104 498 LEU A C   
2209 O O   . LEU A 287 ? 0.3658 0.4070 0.3702 0.0079  -0.0185 -0.0129 498 LEU A O   
2210 C CB  . LEU A 287 ? 0.3382 0.3850 0.3466 0.0151  -0.0115 -0.0038 498 LEU A CB  
2211 C CG  . LEU A 287 ? 0.3304 0.3781 0.3389 0.0201  -0.0075 0.0003  498 LEU A CG  
2212 C CD1 . LEU A 287 ? 0.3396 0.3815 0.3507 0.0196  -0.0041 0.0013  498 LEU A CD1 
2213 C CD2 . LEU A 287 ? 0.3141 0.3723 0.3240 0.0226  -0.0084 0.0028  498 LEU A CD2 
2214 N N   . LEU A 288 ? 0.3653 0.4212 0.3745 0.0067  -0.0212 -0.0109 499 LEU A N   
2215 C CA  . LEU A 288 ? 0.3717 0.4264 0.3821 0.0013  -0.0248 -0.0148 499 LEU A CA  
2216 C C   . LEU A 288 ? 0.3587 0.4093 0.3734 -0.0026 -0.0243 -0.0144 499 LEU A C   
2217 O O   . LEU A 288 ? 0.3662 0.4129 0.3820 -0.0069 -0.0264 -0.0172 499 LEU A O   
2218 C CB  . LEU A 288 ? 0.3858 0.4512 0.3971 0.0000  -0.0284 -0.0160 499 LEU A CB  
2219 C CG  . LEU A 288 ? 0.4135 0.4822 0.4201 0.0018  -0.0305 -0.0186 499 LEU A CG  
2220 C CD1 . LEU A 288 ? 0.4354 0.5175 0.4429 0.0017  -0.0335 -0.0187 499 LEU A CD1 
2221 C CD2 . LEU A 288 ? 0.4414 0.5024 0.4461 -0.0019 -0.0327 -0.0238 499 LEU A CD2 
2222 N N   . GLU A 289 ? 0.3387 0.3902 0.3558 -0.0010 -0.0215 -0.0110 500 GLU A N   
2223 C CA  . GLU A 289 ? 0.3377 0.3862 0.3585 -0.0043 -0.0207 -0.0103 500 GLU A CA  
2224 C C   . GLU A 289 ? 0.3133 0.3597 0.3346 -0.0013 -0.0166 -0.0074 500 GLU A C   
2225 O O   . GLU A 289 ? 0.2905 0.3382 0.3101 0.0032  -0.0143 -0.0056 500 GLU A O   
2226 C CB  . GLU A 289 ? 0.3444 0.4012 0.3697 -0.0077 -0.0231 -0.0099 500 GLU A CB  
2227 C CG  . GLU A 289 ? 0.3767 0.4436 0.4034 -0.0043 -0.0223 -0.0069 500 GLU A CG  
2228 C CD  . GLU A 289 ? 0.4230 0.4994 0.4546 -0.0076 -0.0247 -0.0062 500 GLU A CD  
2229 O OE1 . GLU A 289 ? 0.4647 0.5398 0.4986 -0.0130 -0.0272 -0.0081 500 GLU A OE1 
2230 O OE2 . GLU A 289 ? 0.4569 0.5423 0.4901 -0.0048 -0.0239 -0.0034 500 GLU A OE2 
2231 N N   . ALA A 290 ? 0.3032 0.3465 0.3271 -0.0038 -0.0156 -0.0070 501 ALA A N   
2232 C CA  . ALA A 290 ? 0.3034 0.3437 0.3277 -0.0018 -0.0118 -0.0052 501 ALA A CA  
2233 C C   . ALA A 290 ? 0.3015 0.3479 0.3269 0.0022  -0.0096 -0.0024 501 ALA A C   
2234 O O   . ALA A 290 ? 0.3163 0.3711 0.3439 0.0023  -0.0110 -0.0012 501 ALA A O   
2235 C CB  . ALA A 290 ? 0.2912 0.3301 0.3186 -0.0056 -0.0117 -0.0050 501 ALA A CB  
2236 N N   . ASN A 291 ? 0.3015 0.3433 0.3252 0.0055  -0.0061 -0.0015 502 ASN A N   
2237 C CA  . ASN A 291 ? 0.3012 0.3461 0.3260 0.0094  -0.0030 0.0010  502 ASN A CA  
2238 C C   . ASN A 291 ? 0.2903 0.3276 0.3140 0.0110  0.0010  0.0009  502 ASN A C   
2239 O O   . ASN A 291 ? 0.2962 0.3285 0.3172 0.0135  0.0027  0.0010  502 ASN A O   
2240 C CB  . ASN A 291 ? 0.3092 0.3589 0.3327 0.0136  -0.0029 0.0028  502 ASN A CB  
2241 C CG  . ASN A 291 ? 0.3185 0.3709 0.3435 0.0181  0.0006  0.0058  502 ASN A CG  
2242 O OD1 . ASN A 291 ? 0.3502 0.3998 0.3767 0.0181  0.0033  0.0059  502 ASN A OD1 
2243 N ND2 . ASN A 291 ? 0.3254 0.3837 0.3499 0.0220  0.0006  0.0082  502 ASN A ND2 
2244 N N   . PRO A 292 ? 0.2814 0.3180 0.3071 0.0095  0.0025  0.0007  503 PRO A N   
2245 C CA  . PRO A 292 ? 0.2730 0.3029 0.2978 0.0107  0.0062  0.0001  503 PRO A CA  
2246 C C   . PRO A 292 ? 0.2661 0.2943 0.2901 0.0156  0.0098  0.0017  503 PRO A C   
2247 O O   . PRO A 292 ? 0.2499 0.2714 0.2728 0.0163  0.0127  0.0009  503 PRO A O   
2248 C CB  . PRO A 292 ? 0.2714 0.3037 0.2988 0.0085  0.0068  -0.0003 503 PRO A CB  
2249 C CG  . PRO A 292 ? 0.2552 0.2917 0.2841 0.0045  0.0028  -0.0006 503 PRO A CG  
2250 C CD  . PRO A 292 ? 0.2773 0.3189 0.3061 0.0061  0.0008  0.0007  503 PRO A CD  
2251 N N   . LYS A 293 ? 0.2715 0.3057 0.2964 0.0188  0.0096  0.0041  504 LYS A N   
2252 C CA  . LYS A 293 ? 0.2972 0.3298 0.3215 0.0240  0.0132  0.0064  504 LYS A CA  
2253 C C   . LYS A 293 ? 0.2985 0.3296 0.3200 0.0263  0.0128  0.0076  504 LYS A C   
2254 O O   . LYS A 293 ? 0.3017 0.3334 0.3229 0.0310  0.0151  0.0104  504 LYS A O   
2255 C CB  . LYS A 293 ? 0.3098 0.3505 0.3368 0.0272  0.0139  0.0090  504 LYS A CB  
2256 C CG  . LYS A 293 ? 0.3586 0.4007 0.3882 0.0260  0.0153  0.0082  504 LYS A CG  
2257 C CD  . LYS A 293 ? 0.4313 0.4803 0.4634 0.0306  0.0174  0.0111  504 LYS A CD  
2258 C CE  . LYS A 293 ? 0.4702 0.5241 0.5053 0.0290  0.0177  0.0104  504 LYS A CE  
2259 N NZ  . LYS A 293 ? 0.4543 0.5161 0.4911 0.0245  0.0133  0.0101  504 LYS A NZ  
2260 N N   . ALA A 294 ? 0.2938 0.3232 0.3133 0.0233  0.0099  0.0056  505 ALA A N   
2261 C CA  . ALA A 294 ? 0.2885 0.3177 0.3050 0.0252  0.0090  0.0064  505 ALA A CA  
2262 C C   . ALA A 294 ? 0.2805 0.3039 0.2957 0.0289  0.0131  0.0083  505 ALA A C   
2263 O O   . ALA A 294 ? 0.2789 0.3044 0.2923 0.0322  0.0132  0.0105  505 ALA A O   
2264 C CB  . ALA A 294 ? 0.2833 0.3097 0.2978 0.0213  0.0059  0.0034  505 ALA A CB  
2265 N N   . GLU A 295 ? 0.2933 0.3096 0.3093 0.0283  0.0164  0.0075  506 GLU A N   
2266 C CA  . GLU A 295 ? 0.3030 0.3128 0.3180 0.0312  0.0204  0.0090  506 GLU A CA  
2267 C C   . GLU A 295 ? 0.3261 0.3389 0.3418 0.0367  0.0228  0.0132  506 GLU A C   
2268 O O   . GLU A 295 ? 0.3258 0.3366 0.3401 0.0399  0.0248  0.0158  506 GLU A O   
2269 C CB  . GLU A 295 ? 0.3000 0.3020 0.3162 0.0292  0.0236  0.0069  506 GLU A CB  
2270 C CG  . GLU A 295 ? 0.2947 0.2892 0.3100 0.0311  0.0276  0.0082  506 GLU A CG  
2271 C CD  . GLU A 295 ? 0.2974 0.2845 0.3139 0.0285  0.0305  0.0056  506 GLU A CD  
2272 O OE1 . GLU A 295 ? 0.2834 0.2710 0.3010 0.0253  0.0295  0.0026  506 GLU A OE1 
2273 O OE2 . GLU A 295 ? 0.3153 0.2960 0.3316 0.0295  0.0339  0.0065  506 GLU A OE2 
2274 N N   . GLY A 296 ? 0.3385 0.3569 0.3567 0.0380  0.0227  0.0141  507 GLY A N   
2275 C CA  . GLY A 296 ? 0.3477 0.3691 0.3670 0.0436  0.0254  0.0183  507 GLY A CA  
2276 C C   . GLY A 296 ? 0.3519 0.3821 0.3697 0.0464  0.0227  0.0212  507 GLY A C   
2277 O O   . GLY A 296 ? 0.3321 0.3656 0.3505 0.0516  0.0247  0.0253  507 GLY A O   
2278 N N   . LEU A 297 ? 0.3530 0.3871 0.3690 0.0429  0.0182  0.0189  508 LEU A N   
2279 C CA  . LEU A 297 ? 0.3665 0.4094 0.3807 0.0447  0.0150  0.0206  508 LEU A CA  
2280 C C   . LEU A 297 ? 0.3709 0.4107 0.3815 0.0467  0.0159  0.0218  508 LEU A C   
2281 O O   . LEU A 297 ? 0.3701 0.4172 0.3786 0.0487  0.0136  0.0233  508 LEU A O   
2282 C CB  . LEU A 297 ? 0.3689 0.4172 0.3828 0.0397  0.0097  0.0169  508 LEU A CB  
2283 C CG  . LEU A 297 ? 0.3940 0.4485 0.4113 0.0370  0.0074  0.0157  508 LEU A CG  
2284 C CD1 . LEU A 297 ? 0.4339 0.4818 0.4534 0.0344  0.0095  0.0139  508 LEU A CD1 
2285 C CD2 . LEU A 297 ? 0.4311 0.4904 0.4477 0.0324  0.0022  0.0126  508 LEU A CD2 
2286 N N   . LEU A 298 ? 0.3776 0.4074 0.3874 0.0460  0.0189  0.0211  509 LEU A N   
2287 C CA  . LEU A 298 ? 0.3888 0.4159 0.3952 0.0473  0.0195  0.0222  509 LEU A CA  
2288 C C   . LEU A 298 ? 0.4092 0.4409 0.4148 0.0535  0.0216  0.0276  509 LEU A C   
2289 O O   . LEU A 298 ? 0.3994 0.4365 0.4019 0.0550  0.0197  0.0286  509 LEU A O   
2290 C CB  . LEU A 298 ? 0.3840 0.4003 0.3906 0.0456  0.0229  0.0210  509 LEU A CB  
2291 C CG  . LEU A 298 ? 0.3645 0.3763 0.3709 0.0399  0.0209  0.0160  509 LEU A CG  
2292 C CD1 . LEU A 298 ? 0.3645 0.3667 0.3716 0.0388  0.0247  0.0155  509 LEU A CD1 
2293 C CD2 . LEU A 298 ? 0.3466 0.3615 0.3497 0.0381  0.0170  0.0139  509 LEU A CD2 
2294 N N   . GLN A 299 ? 0.4348 0.4644 0.4430 0.0571  0.0257  0.0311  510 GLN A N   
2295 C CA  . GLN A 299 ? 0.4526 0.4864 0.4606 0.0636  0.0282  0.0371  510 GLN A CA  
2296 C C   . GLN A 299 ? 0.4657 0.4981 0.4703 0.0656  0.0293  0.0395  510 GLN A C   
2297 O O   . GLN A 299 ? 0.4735 0.5148 0.4755 0.0685  0.0273  0.0419  510 GLN A O   
2298 C CB  . GLN A 299 ? 0.4572 0.5044 0.4654 0.0658  0.0247  0.0386  510 GLN A CB  
2299 C CG  . GLN A 299 ? 0.4408 0.4912 0.4526 0.0644  0.0237  0.0371  510 GLN A CG  
2300 N N   . GLY A 300 ? 0.4723 0.4943 0.4768 0.0636  0.0321  0.0384  511 GLY A N   
2301 C CA  . GLY A 300 ? 0.4758 0.4960 0.4774 0.0653  0.0336  0.0408  511 GLY A CA  
2302 C C   . GLY A 300 ? 0.4653 0.4850 0.4639 0.0609  0.0304  0.0364  511 GLY A C   
2303 O O   . GLY A 300 ? 0.4736 0.4877 0.4711 0.0605  0.0327  0.0369  511 GLY A O   
2304 N N   . LYS A 301 ? 0.4482 0.4739 0.4457 0.0579  0.0253  0.0322  512 LYS A N   
2305 C CA  . LYS A 301 ? 0.4272 0.4521 0.4221 0.0537  0.0220  0.0275  512 LYS A CA  
2306 C C   . LYS A 301 ? 0.3960 0.4107 0.3929 0.0495  0.0239  0.0245  512 LYS A C   
2307 O O   . LYS A 301 ? 0.3897 0.3993 0.3899 0.0492  0.0267  0.0250  512 LYS A O   
2308 C CB  . LYS A 301 ? 0.4307 0.4629 0.4250 0.0510  0.0166  0.0236  512 LYS A CB  
2309 C CG  . LYS A 301 ? 0.4549 0.4983 0.4470 0.0546  0.0143  0.0258  512 LYS A CG  
2310 C CD  . LYS A 301 ? 0.4815 0.5316 0.4725 0.0512  0.0087  0.0212  512 LYS A CD  
2311 C CE  . LYS A 301 ? 0.5008 0.5628 0.4886 0.0546  0.0061  0.0228  512 LYS A CE  
2312 N NZ  . LYS A 301 ? 0.5214 0.5894 0.5079 0.0508  0.0006  0.0176  512 LYS A NZ  
2313 N N   . HIS A 302 ? 0.3619 0.3740 0.3566 0.0465  0.0223  0.0212  513 HIS A N   
2314 C CA  . HIS A 302 ? 0.3430 0.3462 0.3391 0.0433  0.0246  0.0193  513 HIS A CA  
2315 C C   . HIS A 302 ? 0.3167 0.3178 0.3137 0.0380  0.0216  0.0140  513 HIS A C   
2316 O O   . HIS A 302 ? 0.3109 0.3058 0.3097 0.0352  0.0233  0.0123  513 HIS A O   
2317 C CB  . HIS A 302 ? 0.3496 0.3511 0.3433 0.0444  0.0263  0.0207  513 HIS A CB  
2318 C CG  . HIS A 302 ? 0.3505 0.3545 0.3432 0.0496  0.0292  0.0264  513 HIS A CG  
2319 N ND1 . HIS A 302 ? 0.3604 0.3727 0.3495 0.0530  0.0272  0.0282  513 HIS A ND1 
2320 C CD2 . HIS A 302 ? 0.3896 0.3889 0.3844 0.0521  0.0342  0.0308  513 HIS A CD2 
2321 C CE1 . HIS A 302 ? 0.3834 0.3966 0.3724 0.0576  0.0307  0.0339  513 HIS A CE1 
2322 N NE2 . HIS A 302 ? 0.3782 0.3832 0.3708 0.0572  0.0351  0.0357  513 HIS A NE2 
2323 N N   . SER A 303 ? 0.2949 0.3016 0.2906 0.0368  0.0172  0.0116  514 SER A N   
2324 C CA  . SER A 303 ? 0.2793 0.2842 0.2760 0.0321  0.0144  0.0072  514 SER A CA  
2325 C C   . SER A 303 ? 0.2683 0.2797 0.2654 0.0311  0.0105  0.0058  514 SER A C   
2326 O O   . SER A 303 ? 0.2707 0.2888 0.2667 0.0340  0.0094  0.0077  514 SER A O   
2327 C CB  . SER A 303 ? 0.2720 0.2747 0.2661 0.0306  0.0132  0.0048  514 SER A CB  
2328 O OG  . SER A 303 ? 0.2640 0.2720 0.2545 0.0329  0.0111  0.0050  514 SER A OG  
2329 N N   . THR A 304 ? 0.2620 0.2719 0.2607 0.0270  0.0084  0.0026  515 THR A N   
2330 C CA  . THR A 304 ? 0.2588 0.2743 0.2581 0.0250  0.0043  0.0007  515 THR A CA  
2331 C C   . THR A 304 ? 0.2651 0.2793 0.2624 0.0223  0.0011  -0.0030 515 THR A C   
2332 O O   . THR A 304 ? 0.2690 0.2772 0.2661 0.0203  0.0018  -0.0046 515 THR A O   
2333 C CB  . THR A 304 ? 0.2600 0.2752 0.2631 0.0223  0.0042  0.0001  515 THR A CB  
2334 O OG1 . THR A 304 ? 0.2721 0.2880 0.2772 0.0251  0.0074  0.0032  515 THR A OG1 
2335 C CG2 . THR A 304 ? 0.2341 0.2555 0.2385 0.0199  0.0001  -0.0015 515 THR A CG2 
2336 N N   . LYS A 305 ? 0.2696 0.2895 0.2654 0.0222  -0.0023 -0.0043 516 LYS A N   
2337 C CA  . LYS A 305 ? 0.2815 0.3000 0.2757 0.0193  -0.0056 -0.0083 516 LYS A CA  
2338 C C   . LYS A 305 ? 0.2770 0.2989 0.2738 0.0157  -0.0090 -0.0102 516 LYS A C   
2339 O O   . LYS A 305 ? 0.2745 0.3037 0.2716 0.0163  -0.0110 -0.0098 516 LYS A O   
2340 C CB  . LYS A 305 ? 0.2845 0.3059 0.2743 0.0216  -0.0070 -0.0093 516 LYS A CB  
2341 C CG  . LYS A 305 ? 0.3064 0.3248 0.2945 0.0188  -0.0099 -0.0139 516 LYS A CG  
2342 C CD  . LYS A 305 ? 0.2845 0.3061 0.2679 0.0215  -0.0109 -0.0153 516 LYS A CD  
2343 C CE  . LYS A 305 ? 0.3154 0.3341 0.2969 0.0190  -0.0139 -0.0203 516 LYS A CE  
2344 N NZ  . LYS A 305 ? 0.2919 0.3143 0.2683 0.0220  -0.0147 -0.0218 516 LYS A NZ  
2345 N N   . GLY A 306 ? 0.2667 0.2837 0.2657 0.0120  -0.0095 -0.0118 517 GLY A N   
2346 C CA  . GLY A 306 ? 0.2704 0.2894 0.2720 0.0081  -0.0126 -0.0136 517 GLY A CA  
2347 C C   . GLY A 306 ? 0.2854 0.3037 0.2846 0.0067  -0.0157 -0.0173 517 GLY A C   
2348 O O   . GLY A 306 ? 0.2912 0.3032 0.2885 0.0064  -0.0153 -0.0191 517 GLY A O   
2349 N N   . LEU A 307 ? 0.2989 0.3236 0.2981 0.0058  -0.0188 -0.0187 518 LEU A N   
2350 C CA  . LEU A 307 ? 0.3117 0.3367 0.3077 0.0051  -0.0217 -0.0226 518 LEU A CA  
2351 C C   . LEU A 307 ? 0.3240 0.3443 0.3220 0.0002  -0.0241 -0.0260 518 LEU A C   
2352 O O   . LEU A 307 ? 0.3317 0.3548 0.3335 -0.0032 -0.0258 -0.0259 518 LEU A O   
2353 C CB  . LEU A 307 ? 0.3084 0.3433 0.3033 0.0063  -0.0239 -0.0229 518 LEU A CB  
2354 C CG  . LEU A 307 ? 0.2978 0.3388 0.2903 0.0116  -0.0219 -0.0194 518 LEU A CG  
2355 C CD1 . LEU A 307 ? 0.3346 0.3870 0.3265 0.0122  -0.0249 -0.0198 518 LEU A CD1 
2356 C CD2 . LEU A 307 ? 0.3103 0.3472 0.2982 0.0149  -0.0201 -0.0198 518 LEU A CD2 
2357 N N   . GLY A 308 ? 0.3376 0.3508 0.3332 0.0000  -0.0242 -0.0287 519 GLY A N   
2358 C CA  . GLY A 308 ? 0.3458 0.3535 0.3432 -0.0041 -0.0263 -0.0318 519 GLY A CA  
2359 C C   . GLY A 308 ? 0.3583 0.3677 0.3539 -0.0059 -0.0298 -0.0366 519 GLY A C   
2360 O O   . GLY A 308 ? 0.3611 0.3753 0.3528 -0.0033 -0.0306 -0.0380 519 GLY A O   
2361 N N   . LYS A 309 ? 0.3721 0.3774 0.3705 -0.0104 -0.0319 -0.0390 520 LYS A N   
2362 C CA  . LYS A 309 ? 0.3956 0.4004 0.3928 -0.0130 -0.0352 -0.0443 520 LYS A CA  
2363 C C   . LYS A 309 ? 0.3975 0.3960 0.3897 -0.0105 -0.0349 -0.0480 520 LYS A C   
2364 O O   . LYS A 309 ? 0.4051 0.4054 0.3944 -0.0108 -0.0372 -0.0527 520 LYS A O   
2365 C CB  . LYS A 309 ? 0.4076 0.4078 0.4098 -0.0186 -0.0368 -0.0454 520 LYS A CB  
2366 C CG  . LYS A 309 ? 0.4582 0.4668 0.4645 -0.0225 -0.0392 -0.0449 520 LYS A CG  
2367 C CD  . LYS A 309 ? 0.4816 0.4886 0.4939 -0.0261 -0.0386 -0.0415 520 LYS A CD  
2368 C CE  . LYS A 309 ? 0.5057 0.5039 0.5207 -0.0306 -0.0398 -0.0440 520 LYS A CE  
2369 N NZ  . LYS A 309 ? 0.5017 0.4978 0.5217 -0.0329 -0.0382 -0.0395 520 LYS A NZ  
2370 N N   . MET A 310 ? 0.3934 0.3850 0.3850 -0.0083 -0.0321 -0.0462 521 MET A N   
2371 C CA  . MET A 310 ? 0.4009 0.3863 0.3882 -0.0057 -0.0313 -0.0492 521 MET A CA  
2372 C C   . MET A 310 ? 0.3854 0.3712 0.3702 -0.0010 -0.0280 -0.0458 521 MET A C   
2373 O O   . MET A 310 ? 0.3694 0.3547 0.3570 -0.0008 -0.0257 -0.0415 521 MET A O   
2374 C CB  . MET A 310 ? 0.4105 0.3858 0.4000 -0.0082 -0.0313 -0.0508 521 MET A CB  
2375 C CG  . MET A 310 ? 0.4557 0.4288 0.4480 -0.0133 -0.0345 -0.0546 521 MET A CG  
2376 S SD  . MET A 310 ? 0.5684 0.5397 0.5556 -0.0130 -0.0371 -0.0624 521 MET A SD  
2377 C CE  . MET A 310 ? 0.4786 0.4364 0.4654 -0.0120 -0.0354 -0.0644 521 MET A CE  
2378 N N   . ALA A 311 ? 0.3817 0.3690 0.3614 0.0027  -0.0276 -0.0478 522 ALA A N   
2379 C CA  . ALA A 311 ? 0.3770 0.3647 0.3544 0.0070  -0.0243 -0.0446 522 ALA A CA  
2380 C C   . ALA A 311 ? 0.3782 0.3636 0.3505 0.0102  -0.0239 -0.0479 522 ALA A C   
2381 O O   . ALA A 311 ? 0.3729 0.3592 0.3425 0.0098  -0.0263 -0.0527 522 ALA A O   
2382 C CB  . ALA A 311 ? 0.3537 0.3500 0.3304 0.0092  -0.0234 -0.0412 522 ALA A CB  
2383 N N   . PRO A 312 ? 0.3781 0.3610 0.3492 0.0133  -0.0208 -0.0456 523 PRO A N   
2384 C CA  . PRO A 312 ? 0.3909 0.3740 0.3568 0.0173  -0.0199 -0.0478 523 PRO A CA  
2385 C C   . PRO A 312 ? 0.4093 0.4011 0.3710 0.0196  -0.0210 -0.0487 523 PRO A C   
2386 O O   . PRO A 312 ? 0.4031 0.4011 0.3661 0.0195  -0.0210 -0.0455 523 PRO A O   
2387 C CB  . PRO A 312 ? 0.3794 0.3614 0.3459 0.0199  -0.0162 -0.0433 523 PRO A CB  
2388 C CG  . PRO A 312 ? 0.3660 0.3433 0.3377 0.0167  -0.0156 -0.0411 523 PRO A CG  
2389 C CD  . PRO A 312 ? 0.3707 0.3500 0.3454 0.0129  -0.0182 -0.0415 523 PRO A CD  
2390 N N   . SER A 313 ? 0.4293 0.4218 0.3861 0.0218  -0.0219 -0.0530 524 SER A N   
2391 C CA  . SER A 313 ? 0.4436 0.4452 0.3961 0.0241  -0.0231 -0.0542 524 SER A CA  
2392 C C   . SER A 313 ? 0.4398 0.4447 0.3879 0.0294  -0.0202 -0.0519 524 SER A C   
2393 O O   . SER A 313 ? 0.4303 0.4302 0.3776 0.0311  -0.0181 -0.0520 524 SER A O   
2394 C CB  . SER A 313 ? 0.4585 0.4600 0.4081 0.0225  -0.0267 -0.0613 524 SER A CB  
2395 O OG  . SER A 313 ? 0.4922 0.4893 0.4377 0.0252  -0.0257 -0.0649 524 SER A OG  
2396 N N   . SER A 314 ? 0.4494 0.4635 0.3950 0.0320  -0.0199 -0.0494 525 SER A N   
2397 C CA  . SER A 314 ? 0.4587 0.4768 0.4010 0.0369  -0.0167 -0.0458 525 SER A CA  
2398 C C   . SER A 314 ? 0.4682 0.4858 0.4052 0.0399  -0.0164 -0.0499 525 SER A C   
2399 O O   . SER A 314 ? 0.4720 0.4903 0.4072 0.0434  -0.0132 -0.0469 525 SER A O   
2400 C CB  . SER A 314 ? 0.4647 0.4933 0.4053 0.0392  -0.0168 -0.0424 525 SER A CB  
2401 O OG  . SER A 314 ? 0.4683 0.5030 0.4052 0.0390  -0.0204 -0.0474 525 SER A OG  
2402 N N   . ALA A 315 ? 0.4824 0.4989 0.4169 0.0385  -0.0196 -0.0567 526 ALA A N   
2403 C CA  . ALA A 315 ? 0.5006 0.5166 0.4296 0.0415  -0.0195 -0.0615 526 ALA A CA  
2404 C C   . ALA A 315 ? 0.5023 0.5102 0.4325 0.0428  -0.0165 -0.0605 526 ALA A C   
2405 O O   . ALA A 315 ? 0.5090 0.5182 0.4350 0.0468  -0.0148 -0.0616 526 ALA A O   
2406 C CB  . ALA A 315 ? 0.5041 0.5182 0.4310 0.0389  -0.0235 -0.0698 526 ALA A CB  
2407 N N   . HIS A 316 ? 0.5006 0.5012 0.4366 0.0397  -0.0158 -0.0581 527 HIS A N   
2408 C CA  . HIS A 316 ? 0.5002 0.4936 0.4379 0.0406  -0.0133 -0.0572 527 HIS A CA  
2409 C C   . HIS A 316 ? 0.4923 0.4868 0.4330 0.0417  -0.0097 -0.0502 527 HIS A C   
2410 O O   . HIS A 316 ? 0.4946 0.4843 0.4373 0.0421  -0.0077 -0.0489 527 HIS A O   
2411 C CB  . HIS A 316 ? 0.5025 0.4866 0.4444 0.0366  -0.0149 -0.0598 527 HIS A CB  
2412 C CG  . HIS A 316 ? 0.5328 0.5147 0.4729 0.0344  -0.0185 -0.0666 527 HIS A CG  
2413 N ND1 . HIS A 316 ? 0.5594 0.5394 0.4947 0.0367  -0.0191 -0.0725 527 HIS A ND1 
2414 C CD2 . HIS A 316 ? 0.5354 0.5170 0.4778 0.0300  -0.0217 -0.0686 527 HIS A CD2 
2415 C CE1 . HIS A 316 ? 0.5640 0.5421 0.4989 0.0336  -0.0226 -0.0782 527 HIS A CE1 
2416 N NE2 . HIS A 316 ? 0.5607 0.5401 0.5000 0.0294  -0.0242 -0.0758 527 HIS A NE2 
2417 N N   . PHE A 317 ? 0.4824 0.4834 0.4236 0.0422  -0.0087 -0.0456 528 PHE A N   
2418 C CA  . PHE A 317 ? 0.4726 0.4735 0.4172 0.0426  -0.0053 -0.0394 528 PHE A CA  
2419 C C   . PHE A 317 ? 0.4739 0.4764 0.4160 0.0466  -0.0020 -0.0377 528 PHE A C   
2420 O O   . PHE A 317 ? 0.4774 0.4837 0.4144 0.0499  -0.0021 -0.0402 528 PHE A O   
2421 C CB  . PHE A 317 ? 0.4642 0.4707 0.4102 0.0424  -0.0046 -0.0346 528 PHE A CB  
2422 C CG  . PHE A 317 ? 0.4712 0.4766 0.4207 0.0384  -0.0073 -0.0352 528 PHE A CG  
2423 C CD1 . PHE A 317 ? 0.4600 0.4594 0.4119 0.0347  -0.0098 -0.0391 528 PHE A CD1 
2424 C CD2 . PHE A 317 ? 0.4651 0.4758 0.4158 0.0385  -0.0070 -0.0314 528 PHE A CD2 
2425 C CE1 . PHE A 317 ? 0.4648 0.4641 0.4201 0.0311  -0.0120 -0.0391 528 PHE A CE1 
2426 C CE2 . PHE A 317 ? 0.4426 0.4533 0.3966 0.0352  -0.0092 -0.0316 528 PHE A CE2 
2427 C CZ  . PHE A 317 ? 0.4428 0.4480 0.3991 0.0313  -0.0118 -0.0355 528 PHE A CZ  
2428 N N   . VAL A 318 ? 0.4618 0.4619 0.4077 0.0460  0.0009  -0.0336 529 VAL A N   
2429 C CA  . VAL A 318 ? 0.4607 0.4628 0.4056 0.0491  0.0043  -0.0309 529 VAL A CA  
2430 C C   . VAL A 318 ? 0.4622 0.4659 0.4111 0.0480  0.0071  -0.0247 529 VAL A C   
2431 O O   . VAL A 318 ? 0.4527 0.4545 0.4050 0.0449  0.0062  -0.0234 529 VAL A O   
2432 C CB  . VAL A 318 ? 0.4662 0.4625 0.4125 0.0488  0.0046  -0.0333 529 VAL A CB  
2433 C CG1 . VAL A 318 ? 0.4555 0.4523 0.4046 0.0495  0.0081  -0.0292 529 VAL A CG1 
2434 C CG2 . VAL A 318 ? 0.4440 0.4401 0.3851 0.0518  0.0032  -0.0388 529 VAL A CG2 
2435 N N   . THR A 319 ? 0.4563 0.4635 0.4047 0.0505  0.0106  -0.0208 530 THR A N   
2436 C CA  . THR A 319 ? 0.4490 0.4564 0.4017 0.0490  0.0135  -0.0152 530 THR A CA  
2437 C C   . THR A 319 ? 0.4342 0.4397 0.3898 0.0484  0.0163  -0.0136 530 THR A C   
2438 O O   . THR A 319 ? 0.4352 0.4424 0.3885 0.0510  0.0171  -0.0148 530 THR A O   
2439 C CB  . THR A 319 ? 0.4561 0.4696 0.4068 0.0518  0.0157  -0.0108 530 THR A CB  
2440 O OG1 . THR A 319 ? 0.4763 0.4943 0.4237 0.0555  0.0180  -0.0096 530 THR A OG1 
2441 C CG2 . THR A 319 ? 0.4619 0.4790 0.4094 0.0527  0.0128  -0.0124 530 THR A CG2 
2442 N N   . LEU A 320 ? 0.4054 0.4079 0.3662 0.0451  0.0176  -0.0110 531 LEU A N   
2443 C CA  . LEU A 320 ? 0.3859 0.3875 0.3502 0.0439  0.0201  -0.0093 531 LEU A CA  
2444 C C   . LEU A 320 ? 0.3747 0.3771 0.3424 0.0425  0.0234  -0.0044 531 LEU A C   
2445 O O   . LEU A 320 ? 0.3461 0.3456 0.3169 0.0396  0.0230  -0.0036 531 LEU A O   
2446 C CB  . LEU A 320 ? 0.3834 0.3800 0.3509 0.0406  0.0181  -0.0120 531 LEU A CB  
2447 C CG  . LEU A 320 ? 0.3988 0.3947 0.3697 0.0393  0.0196  -0.0115 531 LEU A CG  
2448 C CD1 . LEU A 320 ? 0.3987 0.3980 0.3669 0.0431  0.0209  -0.0119 531 LEU A CD1 
2449 C CD2 . LEU A 320 ? 0.3699 0.3613 0.3430 0.0368  0.0170  -0.0143 531 LEU A CD2 
2450 N N   . ASN A 321 ? 0.3750 0.3815 0.3421 0.0447  0.0266  -0.0011 532 ASN A N   
2451 C CA  . ASN A 321 ? 0.3630 0.3701 0.3335 0.0436  0.0304  0.0039  532 ASN A CA  
2452 C C   . ASN A 321 ? 0.3525 0.3582 0.3235 0.0431  0.0304  0.0059  532 ASN A C   
2453 O O   . ASN A 321 ? 0.3323 0.3348 0.3076 0.0402  0.0321  0.0080  532 ASN A O   
2454 C CB  . ASN A 321 ? 0.3707 0.3752 0.3467 0.0396  0.0319  0.0043  532 ASN A CB  
2455 C CG  . ASN A 321 ? 0.4051 0.4123 0.3812 0.0404  0.0324  0.0032  532 ASN A CG  
2456 O OD1 . ASN A 321 ? 0.4140 0.4258 0.3885 0.0431  0.0347  0.0054  532 ASN A OD1 
2457 N ND2 . ASN A 321 ? 0.3549 0.3596 0.3331 0.0381  0.0305  0.0003  532 ASN A ND2 
2458 N N   . GLY A 322 ? 0.3462 0.3545 0.3128 0.0460  0.0283  0.0049  533 GLY A N   
2459 C CA  . GLY A 322 ? 0.3480 0.3566 0.3145 0.0466  0.0286  0.0075  533 GLY A CA  
2460 C C   . GLY A 322 ? 0.3536 0.3591 0.3211 0.0444  0.0252  0.0046  533 GLY A C   
2461 O O   . GLY A 322 ? 0.3577 0.3642 0.3251 0.0452  0.0252  0.0067  533 GLY A O   
2462 N N   . SER A 323 ? 0.3417 0.3440 0.3101 0.0418  0.0225  0.0002  534 SER A N   
2463 C CA  . SER A 323 ? 0.3373 0.3370 0.3067 0.0395  0.0193  -0.0025 534 SER A CA  
2464 C C   . SER A 323 ? 0.3429 0.3436 0.3085 0.0404  0.0155  -0.0072 534 SER A C   
2465 O O   . SER A 323 ? 0.3473 0.3475 0.3115 0.0410  0.0150  -0.0097 534 SER A O   
2466 C CB  . SER A 323 ? 0.3367 0.3313 0.3109 0.0353  0.0194  -0.0035 534 SER A CB  
2467 O OG  . SER A 323 ? 0.3346 0.3277 0.3126 0.0339  0.0226  0.0000  534 SER A OG  
2468 N N   . THR A 324 ? 0.3373 0.3393 0.3018 0.0403  0.0127  -0.0086 535 THR A N   
2469 C CA  . THR A 324 ? 0.3427 0.3453 0.3039 0.0405  0.0090  -0.0136 535 THR A CA  
2470 C C   . THR A 324 ? 0.3314 0.3283 0.2953 0.0370  0.0070  -0.0168 535 THR A C   
2471 O O   . THR A 324 ? 0.3313 0.3255 0.2992 0.0340  0.0067  -0.0160 535 THR A O   
2472 C CB  . THR A 324 ? 0.3440 0.3502 0.3037 0.0408  0.0065  -0.0141 535 THR A CB  
2473 O OG1 . THR A 324 ? 0.3707 0.3829 0.3276 0.0446  0.0083  -0.0107 535 THR A OG1 
2474 C CG2 . THR A 324 ? 0.3554 0.3618 0.3122 0.0403  0.0025  -0.0197 535 THR A CG2 
2475 N N   . VAL A 325 ? 0.3199 0.3151 0.2817 0.0377  0.0058  -0.0204 536 VAL A N   
2476 C CA  . VAL A 325 ? 0.2983 0.2882 0.2624 0.0349  0.0039  -0.0234 536 VAL A CA  
2477 C C   . VAL A 325 ? 0.3049 0.2942 0.2666 0.0344  0.0002  -0.0279 536 VAL A C   
2478 O O   . VAL A 325 ? 0.3156 0.3064 0.2729 0.0370  -0.0007 -0.0308 536 VAL A O   
2479 C CB  . VAL A 325 ? 0.3030 0.2907 0.2669 0.0361  0.0053  -0.0242 536 VAL A CB  
2480 C CG1 . VAL A 325 ? 0.2776 0.2598 0.2445 0.0333  0.0037  -0.0262 536 VAL A CG1 
2481 C CG2 . VAL A 325 ? 0.2636 0.2532 0.2294 0.0368  0.0090  -0.0200 536 VAL A CG2 
2482 N N   . PRO A 326 ? 0.2943 0.2817 0.2589 0.0310  -0.0020 -0.0286 537 PRO A N   
2483 C CA  . PRO A 326 ? 0.2963 0.2835 0.2593 0.0298  -0.0056 -0.0327 537 PRO A CA  
2484 C C   . PRO A 326 ? 0.2984 0.2793 0.2621 0.0281  -0.0074 -0.0366 537 PRO A C   
2485 O O   . PRO A 326 ? 0.2822 0.2599 0.2492 0.0246  -0.0091 -0.0373 537 PRO A O   
2486 C CB  . PRO A 326 ? 0.2906 0.2792 0.2571 0.0269  -0.0067 -0.0309 537 PRO A CB  
2487 C CG  . PRO A 326 ? 0.2916 0.2776 0.2623 0.0254  -0.0042 -0.0274 537 PRO A CG  
2488 C CD  . PRO A 326 ? 0.2903 0.2767 0.2595 0.0283  -0.0010 -0.0253 537 PRO A CD  
2489 N N   . LEU A 327 ? 0.2981 0.2776 0.2585 0.0309  -0.0068 -0.0390 538 LEU A N   
2490 C CA  . LEU A 327 ? 0.3081 0.2812 0.2687 0.0302  -0.0080 -0.0427 538 LEU A CA  
2491 C C   . LEU A 327 ? 0.3051 0.2761 0.2655 0.0275  -0.0116 -0.0470 538 LEU A C   
2492 O O   . LEU A 327 ? 0.2818 0.2575 0.2399 0.0275  -0.0133 -0.0486 538 LEU A O   
2493 C CB  . LEU A 327 ? 0.3177 0.2907 0.2740 0.0343  -0.0069 -0.0452 538 LEU A CB  
2494 C CG  . LEU A 327 ? 0.3368 0.3120 0.2934 0.0370  -0.0033 -0.0413 538 LEU A CG  
2495 C CD1 . LEU A 327 ? 0.3711 0.3470 0.3230 0.0414  -0.0024 -0.0440 538 LEU A CD1 
2496 C CD2 . LEU A 327 ? 0.3086 0.2795 0.2703 0.0349  -0.0022 -0.0388 538 LEU A CD2 
2497 N N   . GLY A 328 ? 0.3049 0.2691 0.2681 0.0252  -0.0126 -0.0486 539 GLY A N   
2498 C CA  . GLY A 328 ? 0.3285 0.2895 0.2924 0.0221  -0.0157 -0.0526 539 GLY A CA  
2499 C C   . GLY A 328 ? 0.3518 0.3102 0.3111 0.0242  -0.0169 -0.0585 539 GLY A C   
2500 O O   . GLY A 328 ? 0.3315 0.2922 0.2866 0.0283  -0.0154 -0.0593 539 GLY A O   
2501 N N   . PRO A 329 ? 0.3847 0.3382 0.3449 0.0211  -0.0196 -0.0628 540 PRO A N   
2502 C CA  . PRO A 329 ? 0.4010 0.3516 0.3663 0.0161  -0.0213 -0.0619 540 PRO A CA  
2503 C C   . PRO A 329 ? 0.4010 0.3592 0.3670 0.0138  -0.0231 -0.0608 540 PRO A C   
2504 O O   . PRO A 329 ? 0.4150 0.3803 0.3770 0.0160  -0.0234 -0.0617 540 PRO A O   
2505 C CB  . PRO A 329 ? 0.4124 0.3553 0.3774 0.0144  -0.0234 -0.0678 540 PRO A CB  
2506 C CG  . PRO A 329 ? 0.4125 0.3582 0.3714 0.0175  -0.0240 -0.0727 540 PRO A CG  
2507 C CD  . PRO A 329 ? 0.4056 0.3553 0.3618 0.0225  -0.0209 -0.0694 540 PRO A CD  
2508 N N   . ALA A 330 ? 0.4012 0.3584 0.3722 0.0096  -0.0241 -0.0587 541 ALA A N   
2509 C CA  . ALA A 330 ? 0.3994 0.3638 0.3720 0.0071  -0.0258 -0.0573 541 ALA A CA  
2510 C C   . ALA A 330 ? 0.4186 0.3834 0.3905 0.0041  -0.0293 -0.0627 541 ALA A C   
2511 O O   . ALA A 330 ? 0.4095 0.3668 0.3827 0.0018  -0.0304 -0.0663 541 ALA A O   
2512 C CB  . ALA A 330 ? 0.3890 0.3525 0.3674 0.0039  -0.0252 -0.0528 541 ALA A CB  
2513 N N   . SER A 331 ? 0.4292 0.4030 0.3997 0.0039  -0.0309 -0.0631 542 SER A N   
2514 C CA  . SER A 331 ? 0.4618 0.4378 0.4318 0.0006  -0.0346 -0.0684 542 SER A CA  
2515 C C   . SER A 331 ? 0.4679 0.4529 0.4409 -0.0019 -0.0361 -0.0657 542 SER A C   
2516 O O   . SER A 331 ? 0.4477 0.4369 0.4222 -0.0003 -0.0341 -0.0600 542 SER A O   
2517 C CB  . SER A 331 ? 0.4655 0.4449 0.4290 0.0038  -0.0355 -0.0735 542 SER A CB  
2518 O OG  . SER A 331 ? 0.4694 0.4579 0.4295 0.0080  -0.0341 -0.0702 542 SER A OG  
2519 N N   . ASP A 332 ? 0.4887 0.4764 0.4628 -0.0059 -0.0395 -0.0697 543 ASP A N   
2520 C CA  . ASP A 332 ? 0.5008 0.4972 0.4785 -0.0087 -0.0411 -0.0672 543 ASP A CA  
2521 C C   . ASP A 332 ? 0.5039 0.5116 0.4784 -0.0046 -0.0406 -0.0644 543 ASP A C   
2522 O O   . ASP A 332 ? 0.5073 0.5187 0.4763 -0.0012 -0.0409 -0.0669 543 ASP A O   
2523 C CB  . ASP A 332 ? 0.5155 0.5131 0.4952 -0.0141 -0.0450 -0.0724 543 ASP A CB  
2524 C CG  . ASP A 332 ? 0.5439 0.5506 0.5282 -0.0172 -0.0465 -0.0693 543 ASP A CG  
2525 O OD1 . ASP A 332 ? 0.5846 0.5876 0.5745 -0.0207 -0.0461 -0.0664 543 ASP A OD1 
2526 O OD2 . ASP A 332 ? 0.5600 0.5779 0.5422 -0.0157 -0.0479 -0.0691 543 ASP A OD2 
2527 N N   . THR A 333 ? 0.5062 0.5195 0.4842 -0.0046 -0.0396 -0.0588 544 THR A N   
2528 C CA  . THR A 333 ? 0.5071 0.5303 0.4829 -0.0004 -0.0385 -0.0550 544 THR A CA  
2529 C C   . THR A 333 ? 0.5291 0.5640 0.5057 -0.0021 -0.0417 -0.0559 544 THR A C   
2530 O O   . THR A 333 ? 0.5199 0.5639 0.4949 0.0015  -0.0410 -0.0524 544 THR A O   
2531 C CB  . THR A 333 ? 0.4981 0.5205 0.4771 0.0013  -0.0351 -0.0482 544 THR A CB  
2532 O OG1 . THR A 333 ? 0.4811 0.5021 0.4659 -0.0032 -0.0358 -0.0467 544 THR A OG1 
2533 C CG2 . THR A 333 ? 0.4783 0.4918 0.4559 0.0039  -0.0317 -0.0467 544 THR A CG2 
2534 N N   . GLY A 334 ? 0.5534 0.5882 0.5327 -0.0075 -0.0450 -0.0601 545 GLY A N   
2535 C CA  . GLY A 334 ? 0.5813 0.6278 0.5623 -0.0098 -0.0482 -0.0609 545 GLY A CA  
2536 C C   . GLY A 334 ? 0.5978 0.6499 0.5837 -0.0099 -0.0469 -0.0545 545 GLY A C   
2537 O O   . GLY A 334 ? 0.5957 0.6592 0.5828 -0.0102 -0.0488 -0.0536 545 GLY A O   
2538 N N   . ILE A 335 ? 0.6215 0.6661 0.6102 -0.0093 -0.0438 -0.0503 546 ILE A N   
2539 C CA  . ILE A 335 ? 0.6378 0.6868 0.6309 -0.0089 -0.0421 -0.0444 546 ILE A CA  
2540 C C   . ILE A 335 ? 0.6644 0.7104 0.6636 -0.0147 -0.0432 -0.0445 546 ILE A C   
2541 O O   . ILE A 335 ? 0.6695 0.7052 0.6700 -0.0173 -0.0428 -0.0461 546 ILE A O   
2542 C CB  . ILE A 335 ? 0.6310 0.6750 0.6230 -0.0043 -0.0376 -0.0396 546 ILE A CB  
2543 C CG1 . ILE A 335 ? 0.6318 0.6838 0.6200 0.0014  -0.0363 -0.0367 546 ILE A CG1 
2544 C CG2 . ILE A 335 ? 0.6036 0.6458 0.6010 -0.0059 -0.0357 -0.0353 546 ILE A CG2 
2545 C CD1 . ILE A 335 ? 0.6276 0.6735 0.6123 0.0059  -0.0326 -0.0346 546 ILE A CD1 
2546 N N   . LEU A 336 ? 0.6967 0.7524 0.6997 -0.0165 -0.0447 -0.0425 547 LEU A N   
2547 C CA  . LEU A 336 ? 0.7234 0.7791 0.7327 -0.0219 -0.0458 -0.0418 547 LEU A CA  
2548 C C   . LEU A 336 ? 0.7395 0.8064 0.7522 -0.0206 -0.0452 -0.0370 547 LEU A C   
2549 O O   . LEU A 336 ? 0.7459 0.8243 0.7586 -0.0204 -0.0475 -0.0374 547 LEU A O   
2550 C CB  . LEU A 336 ? 0.7364 0.7931 0.7473 -0.0278 -0.0499 -0.0475 547 LEU A CB  
2551 C CG  . LEU A 336 ? 0.7402 0.8048 0.7575 -0.0330 -0.0522 -0.0466 547 LEU A CG  
2552 C CD1 . LEU A 336 ? 0.7526 0.8089 0.7740 -0.0397 -0.0536 -0.0496 547 LEU A CD1 
2553 C CD2 . LEU A 336 ? 0.7426 0.8216 0.7593 -0.0333 -0.0555 -0.0485 547 LEU A CD2 
2554 N N   . ASN A 337 ? 0.7556 0.8194 0.7711 -0.0196 -0.0421 -0.0324 548 ASN A N   
2555 C CA  . ASN A 337 ? 0.7626 0.8354 0.7824 -0.0191 -0.0413 -0.0279 548 ASN A CA  
2556 C C   . ASN A 337 ? 0.7719 0.8517 0.7966 -0.0251 -0.0449 -0.0296 548 ASN A C   
2557 O O   . ASN A 337 ? 0.7753 0.8488 0.8029 -0.0303 -0.0460 -0.0316 548 ASN A O   
2558 C CB  . ASN A 337 ? 0.7612 0.8272 0.7831 -0.0182 -0.0376 -0.0240 548 ASN A CB  
2559 C CG  . ASN A 337 ? 0.7634 0.8379 0.7895 -0.0172 -0.0362 -0.0194 548 ASN A CG  
2560 O OD1 . ASN A 337 ? 0.7711 0.8555 0.7970 -0.0141 -0.0364 -0.0176 548 ASN A OD1 
2561 N ND2 . ASN A 337 ? 0.7512 0.8220 0.7811 -0.0195 -0.0347 -0.0174 548 ASN A ND2 
2562 N N   . PRO A 338 ? 0.7813 0.8744 0.8071 -0.0244 -0.0467 -0.0288 549 PRO A N   
2563 C CA  . PRO A 338 ? 0.7844 0.8854 0.8160 -0.0303 -0.0498 -0.0296 549 PRO A CA  
2564 C C   . PRO A 338 ? 0.7784 0.8818 0.8157 -0.0312 -0.0477 -0.0246 549 PRO A C   
2565 O O   . PRO A 338 ? 0.7834 0.8894 0.8260 -0.0369 -0.0494 -0.0250 549 PRO A O   
2566 C CB  . PRO A 338 ? 0.7858 0.9015 0.8163 -0.0286 -0.0523 -0.0302 549 PRO A CB  
2567 C CG  . PRO A 338 ? 0.7826 0.8997 0.8085 -0.0207 -0.0493 -0.0267 549 PRO A CG  
2568 C CD  . PRO A 338 ? 0.7840 0.8861 0.8060 -0.0187 -0.0465 -0.0274 549 PRO A CD  
2569 N N   . ASP A 339 ? 0.7693 0.8716 0.8055 -0.0257 -0.0438 -0.0202 550 ASP A N   
2570 C CA  . ASP A 339 ? 0.7582 0.8635 0.7990 -0.0255 -0.0414 -0.0155 550 ASP A CA  
2571 C C   . ASP A 339 ? 0.7410 0.8358 0.7840 -0.0288 -0.0399 -0.0152 550 ASP A C   
2572 O O   . ASP A 339 ? 0.7383 0.8361 0.7855 -0.0296 -0.0383 -0.0118 550 ASP A O   
2573 C CB  . ASP A 339 ? 0.7585 0.8658 0.7970 -0.0182 -0.0377 -0.0114 550 ASP A CB  
2574 C CG  . ASP A 339 ? 0.7701 0.8910 0.8084 -0.0146 -0.0387 -0.0096 550 ASP A CG  
2575 O OD1 . ASP A 339 ? 0.7873 0.9129 0.8267 -0.0100 -0.0358 -0.0053 550 ASP A OD1 
2576 O OD2 . ASP A 339 ? 0.7922 0.9193 0.8294 -0.0162 -0.0422 -0.0126 550 ASP A OD2 
2577 N N   . GLY A 340 ? 0.7227 0.8059 0.7630 -0.0304 -0.0402 -0.0184 551 GLY A N   
2578 C CA  . GLY A 340 ? 0.7022 0.7755 0.7442 -0.0331 -0.0386 -0.0177 551 GLY A CA  
2579 C C   . GLY A 340 ? 0.6864 0.7467 0.7247 -0.0332 -0.0382 -0.0206 551 GLY A C   
2580 O O   . GLY A 340 ? 0.6922 0.7498 0.7281 -0.0347 -0.0406 -0.0249 551 GLY A O   
2581 N N   . TYR A 341 ? 0.6584 0.7113 0.6963 -0.0318 -0.0352 -0.0184 552 TYR A N   
2582 C CA  . TYR A 341 ? 0.6382 0.6790 0.6737 -0.0321 -0.0345 -0.0203 552 TYR A CA  
2583 C C   . TYR A 341 ? 0.6138 0.6505 0.6434 -0.0267 -0.0326 -0.0210 552 TYR A C   
2584 O O   . TYR A 341 ? 0.6175 0.6531 0.6461 -0.0231 -0.0295 -0.0183 552 TYR A O   
2585 C CB  . TYR A 341 ? 0.6307 0.6669 0.6692 -0.0337 -0.0323 -0.0173 552 TYR A CB  
2586 N N   . THR A 342 ? 0.5781 0.6129 0.6043 -0.0263 -0.0345 -0.0249 553 THR A N   
2587 C CA  . THR A 342 ? 0.5507 0.5816 0.5713 -0.0217 -0.0331 -0.0260 553 THR A CA  
2588 C C   . THR A 342 ? 0.5138 0.5340 0.5329 -0.0209 -0.0309 -0.0259 553 THR A C   
2589 O O   . THR A 342 ? 0.5105 0.5249 0.5320 -0.0243 -0.0313 -0.0263 553 THR A O   
2590 C CB  . THR A 342 ? 0.5586 0.5905 0.5761 -0.0222 -0.0361 -0.0306 553 THR A CB  
2591 O OG1 . THR A 342 ? 0.5897 0.6319 0.6096 -0.0243 -0.0387 -0.0311 553 THR A OG1 
2592 C CG2 . THR A 342 ? 0.5717 0.6035 0.5835 -0.0168 -0.0348 -0.0312 553 THR A CG2 
2593 N N   . LEU A 343 ? 0.4657 0.4836 0.4811 -0.0163 -0.0284 -0.0250 554 LEU A N   
2594 C CA  . LEU A 343 ? 0.4324 0.4413 0.4461 -0.0152 -0.0263 -0.0250 554 LEU A CA  
2595 C C   . LEU A 343 ? 0.4113 0.4140 0.4226 -0.0163 -0.0282 -0.0292 554 LEU A C   
2596 O O   . LEU A 343 ? 0.4041 0.4094 0.4130 -0.0160 -0.0302 -0.0321 554 LEU A O   
2597 C CB  . LEU A 343 ? 0.4207 0.4295 0.4311 -0.0103 -0.0233 -0.0232 554 LEU A CB  
2598 C CG  . LEU A 343 ? 0.4047 0.4170 0.4171 -0.0088 -0.0206 -0.0194 554 LEU A CG  
2599 C CD1 . LEU A 343 ? 0.3772 0.3907 0.3864 -0.0041 -0.0183 -0.0181 554 LEU A CD1 
2600 C CD2 . LEU A 343 ? 0.3742 0.3816 0.3889 -0.0104 -0.0188 -0.0179 554 LEU A CD2 
2601 N N   . ASN A 344 ? 0.3895 0.3842 0.4013 -0.0172 -0.0273 -0.0294 555 ASN A N   
2602 C CA  . ASN A 344 ? 0.3804 0.3682 0.3896 -0.0172 -0.0284 -0.0332 555 ASN A CA  
2603 C C   . ASN A 344 ? 0.3589 0.3457 0.3627 -0.0125 -0.0270 -0.0343 555 ASN A C   
2604 O O   . ASN A 344 ? 0.3577 0.3434 0.3581 -0.0116 -0.0285 -0.0381 555 ASN A O   
2605 C CB  . ASN A 344 ? 0.3831 0.3629 0.3945 -0.0190 -0.0276 -0.0324 555 ASN A CB  
2606 C CG  . ASN A 344 ? 0.4099 0.3901 0.4266 -0.0239 -0.0289 -0.0311 555 ASN A CG  
2607 O OD1 . ASN A 344 ? 0.4103 0.3936 0.4287 -0.0270 -0.0314 -0.0331 555 ASN A OD1 
2608 N ND2 . ASN A 344 ? 0.4479 0.4260 0.4675 -0.0246 -0.0272 -0.0276 555 ASN A ND2 
2609 N N   . TYR A 345 ? 0.3252 0.3122 0.3284 -0.0096 -0.0240 -0.0311 556 TYR A N   
2610 C CA  . TYR A 345 ? 0.3041 0.2905 0.3028 -0.0052 -0.0222 -0.0313 556 TYR A CA  
2611 C C   . TYR A 345 ? 0.2814 0.2733 0.2798 -0.0025 -0.0199 -0.0279 556 TYR A C   
2612 O O   . TYR A 345 ? 0.2561 0.2511 0.2578 -0.0037 -0.0192 -0.0252 556 TYR A O   
2613 C CB  . TYR A 345 ? 0.2981 0.2773 0.2963 -0.0043 -0.0203 -0.0311 556 TYR A CB  
2614 C CG  . TYR A 345 ? 0.3148 0.2879 0.3143 -0.0069 -0.0221 -0.0336 556 TYR A CG  
2615 C CD1 . TYR A 345 ? 0.3387 0.3094 0.3354 -0.0068 -0.0241 -0.0380 556 TYR A CD1 
2616 C CD2 . TYR A 345 ? 0.3332 0.3031 0.3367 -0.0097 -0.0219 -0.0316 556 TYR A CD2 
2617 C CE1 . TYR A 345 ? 0.3571 0.3210 0.3552 -0.0093 -0.0256 -0.0405 556 TYR A CE1 
2618 C CE2 . TYR A 345 ? 0.3403 0.3039 0.3454 -0.0122 -0.0233 -0.0335 556 TYR A CE2 
2619 C CZ  . TYR A 345 ? 0.3465 0.3068 0.3490 -0.0120 -0.0251 -0.0381 556 TYR A CZ  
2620 O OH  . TYR A 345 ? 0.3883 0.3415 0.3924 -0.0142 -0.0263 -0.0401 556 TYR A OH  
2621 N N   . ASN A 346 ? 0.2721 0.2653 0.2666 0.0013  -0.0187 -0.0281 557 ASN A N   
2622 C CA  . ASN A 346 ? 0.2532 0.2508 0.2471 0.0043  -0.0164 -0.0249 557 ASN A CA  
2623 C C   . ASN A 346 ? 0.2402 0.2351 0.2366 0.0041  -0.0134 -0.0220 557 ASN A C   
2624 O O   . ASN A 346 ? 0.2399 0.2297 0.2373 0.0027  -0.0129 -0.0224 557 ASN A O   
2625 C CB  . ASN A 346 ? 0.2520 0.2499 0.2413 0.0083  -0.0151 -0.0253 557 ASN A CB  
2626 C CG  . ASN A 346 ? 0.2680 0.2708 0.2541 0.0093  -0.0177 -0.0278 557 ASN A CG  
2627 O OD1 . ASN A 346 ? 0.2725 0.2807 0.2599 0.0078  -0.0198 -0.0282 557 ASN A OD1 
2628 N ND2 . ASN A 346 ? 0.2564 0.2583 0.2383 0.0120  -0.0173 -0.0295 557 ASN A ND2 
2629 N N   . GLU A 347 ? 0.2326 0.2310 0.2299 0.0058  -0.0113 -0.0190 558 GLU A N   
2630 C CA  . GLU A 347 ? 0.2231 0.2187 0.2214 0.0067  -0.0079 -0.0168 558 GLU A CA  
2631 C C   . GLU A 347 ? 0.2226 0.2212 0.2197 0.0102  -0.0055 -0.0143 558 GLU A C   
2632 O O   . GLU A 347 ? 0.2302 0.2341 0.2271 0.0114  -0.0064 -0.0135 558 GLU A O   
2633 C CB  . GLU A 347 ? 0.2214 0.2165 0.2237 0.0039  -0.0075 -0.0157 558 GLU A CB  
2634 C CG  . GLU A 347 ? 0.2186 0.2189 0.2235 0.0028  -0.0083 -0.0145 558 GLU A CG  
2635 C CD  . GLU A 347 ? 0.2336 0.2332 0.2422 -0.0006 -0.0087 -0.0142 558 GLU A CD  
2636 O OE1 . GLU A 347 ? 0.2323 0.2327 0.2428 -0.0006 -0.0065 -0.0125 558 GLU A OE1 
2637 O OE2 . GLU A 347 ? 0.2295 0.2272 0.2388 -0.0032 -0.0109 -0.0157 558 GLU A OE2 
2638 N N   . TYR A 348 ? 0.2176 0.2130 0.2141 0.0117  -0.0024 -0.0130 559 TYR A N   
2639 C CA  . TYR A 348 ? 0.2169 0.2138 0.2124 0.0151  0.0004  -0.0103 559 TYR A CA  
2640 C C   . TYR A 348 ? 0.1951 0.1894 0.1935 0.0144  0.0036  -0.0086 559 TYR A C   
2641 O O   . TYR A 348 ? 0.1854 0.1760 0.1849 0.0123  0.0043  -0.0096 559 TYR A O   
2642 C CB  . TYR A 348 ? 0.2281 0.2231 0.2203 0.0173  0.0016  -0.0105 559 TYR A CB  
2643 C CG  . TYR A 348 ? 0.2567 0.2539 0.2455 0.0183  -0.0011 -0.0127 559 TYR A CG  
2644 C CD1 . TYR A 348 ? 0.2744 0.2768 0.2607 0.0212  -0.0017 -0.0117 559 TYR A CD1 
2645 C CD2 . TYR A 348 ? 0.2701 0.2642 0.2581 0.0164  -0.0031 -0.0158 559 TYR A CD2 
2646 C CE1 . TYR A 348 ? 0.3106 0.3155 0.2933 0.0220  -0.0044 -0.0145 559 TYR A CE1 
2647 C CE2 . TYR A 348 ? 0.3072 0.3027 0.2919 0.0173  -0.0055 -0.0185 559 TYR A CE2 
2648 C CZ  . TYR A 348 ? 0.3264 0.3274 0.3083 0.0200  -0.0062 -0.0181 559 TYR A CZ  
2649 O OH  . TYR A 348 ? 0.4017 0.4043 0.3799 0.0207  -0.0087 -0.0214 559 TYR A OH  
2650 N N   . ILE A 349 ? 0.1791 0.1755 0.1786 0.0163  0.0055  -0.0062 560 ILE A N   
2651 C CA  . ILE A 349 ? 0.1728 0.1667 0.1749 0.0158  0.0086  -0.0051 560 ILE A CA  
2652 C C   . ILE A 349 ? 0.1781 0.1709 0.1797 0.0192  0.0122  -0.0023 560 ILE A C   
2653 O O   . ILE A 349 ? 0.1899 0.1862 0.1905 0.0222  0.0122  -0.0002 560 ILE A O   
2654 C CB  . ILE A 349 ? 0.1715 0.1684 0.1763 0.0146  0.0077  -0.0049 560 ILE A CB  
2655 C CG1 . ILE A 349 ? 0.1403 0.1385 0.1460 0.0111  0.0042  -0.0072 560 ILE A CG1 
2656 C CG2 . ILE A 349 ? 0.1412 0.1354 0.1485 0.0141  0.0110  -0.0044 560 ILE A CG2 
2657 C CD1 . ILE A 349 ? 0.1206 0.1237 0.1254 0.0112  0.0006  -0.0077 560 ILE A CD1 
2658 N N   . VAL A 350 ? 0.1829 0.1709 0.1853 0.0187  0.0153  -0.0021 561 VAL A N   
2659 C CA  . VAL A 350 ? 0.1965 0.1822 0.1993 0.0214  0.0193  0.0007  561 VAL A CA  
2660 C C   . VAL A 350 ? 0.1931 0.1758 0.1991 0.0199  0.0218  0.0003  561 VAL A C   
2661 O O   . VAL A 350 ? 0.1970 0.1787 0.2042 0.0165  0.0209  -0.0023 561 VAL A O   
2662 C CB  . VAL A 350 ? 0.1965 0.1792 0.1979 0.0220  0.0214  0.0015  561 VAL A CB  
2663 C CG1 . VAL A 350 ? 0.1755 0.1618 0.1734 0.0243  0.0194  0.0022  561 VAL A CG1 
2664 C CG2 . VAL A 350 ? 0.2124 0.1918 0.2148 0.0184  0.0215  -0.0011 561 VAL A CG2 
2665 N N   . TYR A 351 ? 0.2086 0.1896 0.2157 0.0225  0.0251  0.0028  562 TYR A N   
2666 C CA  . TYR A 351 ? 0.2111 0.1893 0.2211 0.0216  0.0277  0.0021  562 TYR A CA  
2667 C C   . TYR A 351 ? 0.2233 0.1950 0.2347 0.0214  0.0322  0.0025  562 TYR A C   
2668 O O   . TYR A 351 ? 0.2324 0.2010 0.2460 0.0214  0.0350  0.0021  562 TYR A O   
2669 C CB  . TYR A 351 ? 0.2196 0.2012 0.2306 0.0247  0.0279  0.0042  562 TYR A CB  
2670 C CG  . TYR A 351 ? 0.2119 0.2003 0.2221 0.0242  0.0235  0.0036  562 TYR A CG  
2671 C CD1 . TYR A 351 ? 0.2144 0.2051 0.2262 0.0214  0.0217  0.0014  562 TYR A CD1 
2672 C CD2 . TYR A 351 ? 0.2128 0.2058 0.2208 0.0263  0.0212  0.0052  562 TYR A CD2 
2673 C CE1 . TYR A 351 ? 0.2118 0.2085 0.2233 0.0206  0.0177  0.0009  562 TYR A CE1 
2674 C CE2 . TYR A 351 ? 0.2280 0.2271 0.2355 0.0254  0.0171  0.0042  562 TYR A CE2 
2675 C CZ  . TYR A 351 ? 0.1967 0.1974 0.2063 0.0224  0.0154  0.0022  562 TYR A CZ  
2676 O OH  . TYR A 351 ? 0.2213 0.2279 0.2308 0.0210  0.0114  0.0013  562 TYR A OH  
2677 N N   . ASN A 352 ? 0.2303 0.2000 0.2406 0.0209  0.0329  0.0029  563 ASN A N   
2678 C CA  . ASN A 352 ? 0.2304 0.1941 0.2423 0.0198  0.0369  0.0030  563 ASN A CA  
2679 C C   . ASN A 352 ? 0.2312 0.1952 0.2421 0.0171  0.0356  0.0014  563 ASN A C   
2680 O O   . ASN A 352 ? 0.2177 0.1849 0.2261 0.0184  0.0334  0.0024  563 ASN A O   
2681 C CB  . ASN A 352 ? 0.2409 0.2024 0.2528 0.0237  0.0402  0.0074  563 ASN A CB  
2682 C CG  . ASN A 352 ? 0.2634 0.2177 0.2778 0.0227  0.0451  0.0078  563 ASN A CG  
2683 O OD1 . ASN A 352 ? 0.2522 0.2041 0.2674 0.0194  0.0459  0.0060  563 ASN A OD1 
2684 N ND2 . ASN A 352 ? 0.3227 0.2736 0.3388 0.0257  0.0485  0.0103  563 ASN A ND2 
2685 N N   . PRO A 353 ? 0.2294 0.1904 0.2422 0.0134  0.0370  -0.0012 564 PRO A N   
2686 C CA  . PRO A 353 ? 0.2278 0.1895 0.2402 0.0108  0.0362  -0.0026 564 PRO A CA  
2687 C C   . PRO A 353 ? 0.2307 0.1916 0.2421 0.0128  0.0380  0.0005  564 PRO A C   
2688 O O   . PRO A 353 ? 0.2227 0.1858 0.2327 0.0121  0.0366  0.0001  564 PRO A O   
2689 C CB  . PRO A 353 ? 0.2342 0.1927 0.2494 0.0069  0.0384  -0.0054 564 PRO A CB  
2690 C CG  . PRO A 353 ? 0.2391 0.1968 0.2555 0.0070  0.0388  -0.0067 564 PRO A CG  
2691 C CD  . PRO A 353 ? 0.2273 0.1851 0.2427 0.0115  0.0392  -0.0034 564 PRO A CD  
2692 N N   . ASN A 354 ? 0.2358 0.1937 0.2478 0.0155  0.0413  0.0037  565 ASN A N   
2693 C CA  . ASN A 354 ? 0.2421 0.1997 0.2532 0.0177  0.0434  0.0073  565 ASN A CA  
2694 C C   . ASN A 354 ? 0.2362 0.1993 0.2434 0.0211  0.0404  0.0091  565 ASN A C   
2695 O O   . ASN A 354 ? 0.2323 0.1965 0.2381 0.0233  0.0417  0.0120  565 ASN A O   
2696 C CB  . ASN A 354 ? 0.2468 0.1991 0.2601 0.0197  0.0482  0.0108  565 ASN A CB  
2697 C CG  . ASN A 354 ? 0.2744 0.2279 0.2865 0.0246  0.0484  0.0142  565 ASN A CG  
2698 O OD1 . ASN A 354 ? 0.2713 0.2301 0.2810 0.0263  0.0448  0.0138  565 ASN A OD1 
2699 N ND2 . ASN A 354 ? 0.3289 0.2776 0.3430 0.0268  0.0528  0.0177  565 ASN A ND2 
2700 N N   . GLN A 355 ? 0.2221 0.1887 0.2276 0.0213  0.0365  0.0071  566 GLN A N   
2701 C CA  . GLN A 355 ? 0.2164 0.1881 0.2183 0.0235  0.0332  0.0074  566 GLN A CA  
2702 C C   . GLN A 355 ? 0.2129 0.1863 0.2137 0.0210  0.0302  0.0041  566 GLN A C   
2703 O O   . GLN A 355 ? 0.2015 0.1785 0.1994 0.0223  0.0271  0.0032  566 GLN A O   
2704 C CB  . GLN A 355 ? 0.2070 0.1819 0.2080 0.0255  0.0308  0.0076  566 GLN A CB  
2705 C CG  . GLN A 355 ? 0.2253 0.2016 0.2256 0.0299  0.0329  0.0120  566 GLN A CG  
2706 C CD  . GLN A 355 ? 0.2611 0.2404 0.2618 0.0315  0.0314  0.0124  566 GLN A CD  
2707 O OE1 . GLN A 355 ? 0.2802 0.2565 0.2837 0.0308  0.0331  0.0122  566 GLN A OE1 
2708 N NE2 . GLN A 355 ? 0.2338 0.2193 0.2316 0.0336  0.0281  0.0126  566 GLN A NE2 
2709 N N   . VAL A 356 ? 0.2079 0.1788 0.2109 0.0176  0.0314  0.0023  567 VAL A N   
2710 C CA  . VAL A 356 ? 0.2047 0.1772 0.2072 0.0153  0.0289  -0.0005 567 VAL A CA  
2711 C C   . VAL A 356 ? 0.2114 0.1831 0.2152 0.0139  0.0313  -0.0002 567 VAL A C   
2712 O O   . VAL A 356 ? 0.2220 0.1907 0.2286 0.0120  0.0344  0.0002  567 VAL A O   
2713 C CB  . VAL A 356 ? 0.1986 0.1708 0.2030 0.0121  0.0271  -0.0035 567 VAL A CB  
2714 C CG1 . VAL A 356 ? 0.1959 0.1697 0.1999 0.0102  0.0249  -0.0058 567 VAL A CG1 
2715 C CG2 . VAL A 356 ? 0.1794 0.1531 0.1830 0.0133  0.0247  -0.0037 567 VAL A CG2 
2716 N N   . ARG A 357 ? 0.2067 0.1809 0.2083 0.0146  0.0298  -0.0006 568 ARG A N   
2717 C CA  . ARG A 357 ? 0.2133 0.1880 0.2162 0.0131  0.0314  -0.0007 568 ARG A CA  
2718 C C   . ARG A 357 ? 0.2061 0.1834 0.2080 0.0123  0.0283  -0.0032 568 ARG A C   
2719 O O   . ARG A 357 ? 0.1984 0.1776 0.1972 0.0148  0.0264  -0.0034 568 ARG A O   
2720 C CB  . ARG A 357 ? 0.2310 0.2069 0.2325 0.0159  0.0338  0.0026  568 ARG A CB  
2721 C CG  . ARG A 357 ? 0.2698 0.2470 0.2731 0.0142  0.0358  0.0029  568 ARG A CG  
2722 C CD  . ARG A 357 ? 0.3281 0.3069 0.3302 0.0169  0.0385  0.0065  568 ARG A CD  
2723 N NE  . ARG A 357 ? 0.3972 0.3782 0.4014 0.0148  0.0398  0.0063  568 ARG A NE  
2724 C CZ  . ARG A 357 ? 0.4450 0.4294 0.4480 0.0167  0.0411  0.0082  568 ARG A CZ  
2725 N NH1 . ARG A 357 ? 0.4689 0.4552 0.4682 0.0210  0.0412  0.0106  568 ARG A NH1 
2726 N NH2 . ARG A 357 ? 0.4506 0.4375 0.4561 0.0144  0.0422  0.0079  568 ARG A NH2 
2727 N N   . MET A 358 ? 0.2112 0.1885 0.2156 0.0089  0.0280  -0.0052 569 MET A N   
2728 C CA  . MET A 358 ? 0.2139 0.1936 0.2180 0.0082  0.0255  -0.0071 569 MET A CA  
2729 C C   . MET A 358 ? 0.2186 0.2007 0.2218 0.0096  0.0265  -0.0061 569 MET A C   
2730 O O   . MET A 358 ? 0.2166 0.1991 0.2214 0.0090  0.0295  -0.0045 569 MET A O   
2731 C CB  . MET A 358 ? 0.2090 0.1892 0.2162 0.0043  0.0254  -0.0089 569 MET A CB  
2732 C CG  . MET A 358 ? 0.2067 0.1850 0.2147 0.0030  0.0246  -0.0099 569 MET A CG  
2733 S SD  . MET A 358 ? 0.2320 0.2122 0.2428 -0.0011 0.0240  -0.0123 569 MET A SD  
2734 C CE  . MET A 358 ? 0.1910 0.1712 0.2049 -0.0038 0.0278  -0.0124 569 MET A CE  
2735 N N   . ARG A 359 ? 0.2288 0.2124 0.2298 0.0114  0.0241  -0.0071 570 ARG A N   
2736 C CA  . ARG A 359 ? 0.2300 0.2161 0.2292 0.0139  0.0247  -0.0063 570 ARG A CA  
2737 C C   . ARG A 359 ? 0.2215 0.2096 0.2207 0.0140  0.0230  -0.0078 570 ARG A C   
2738 O O   . ARG A 359 ? 0.2284 0.2197 0.2287 0.0142  0.0245  -0.0070 570 ARG A O   
2739 C CB  . ARG A 359 ? 0.2570 0.2427 0.2521 0.0177  0.0239  -0.0058 570 ARG A CB  
2740 C CG  . ARG A 359 ? 0.3270 0.3125 0.3216 0.0191  0.0265  -0.0031 570 ARG A CG  
2741 C CD  . ARG A 359 ? 0.4006 0.3877 0.3974 0.0184  0.0303  -0.0006 570 ARG A CD  
2742 N NE  . ARG A 359 ? 0.5052 0.4955 0.5024 0.0184  0.0301  -0.0014 570 ARG A NE  
2743 C CZ  . ARG A 359 ? 0.5515 0.5449 0.5461 0.0216  0.0305  -0.0006 570 ARG A CZ  
2744 N NH1 . ARG A 359 ? 0.5770 0.5712 0.5682 0.0251  0.0311  0.0010  570 ARG A NH1 
2745 N NH2 . ARG A 359 ? 0.5458 0.5422 0.5413 0.0215  0.0304  -0.0014 570 ARG A NH2 
2746 N N   . TYR A 360 ? 0.2049 0.1915 0.2034 0.0139  0.0200  -0.0096 571 TYR A N   
2747 C CA  . TYR A 360 ? 0.2008 0.1887 0.1996 0.0142  0.0185  -0.0106 571 TYR A CA  
2748 C C   . TYR A 360 ? 0.1917 0.1787 0.1925 0.0116  0.0165  -0.0117 571 TYR A C   
2749 O O   . TYR A 360 ? 0.1746 0.1591 0.1752 0.0105  0.0152  -0.0123 571 TYR A O   
2750 C CB  . TYR A 360 ? 0.2079 0.1948 0.2031 0.0179  0.0169  -0.0116 571 TYR A CB  
2751 C CG  . TYR A 360 ? 0.2218 0.2103 0.2144 0.0210  0.0187  -0.0107 571 TYR A CG  
2752 C CD1 . TYR A 360 ? 0.2299 0.2222 0.2230 0.0225  0.0205  -0.0097 571 TYR A CD1 
2753 C CD2 . TYR A 360 ? 0.2432 0.2305 0.2330 0.0227  0.0185  -0.0106 571 TYR A CD2 
2754 C CE1 . TYR A 360 ? 0.2589 0.2532 0.2494 0.0255  0.0223  -0.0086 571 TYR A CE1 
2755 C CE2 . TYR A 360 ? 0.2353 0.2249 0.2225 0.0257  0.0203  -0.0094 571 TYR A CE2 
2756 C CZ  . TYR A 360 ? 0.2656 0.2585 0.2531 0.0271  0.0222  -0.0084 571 TYR A CZ  
2757 O OH  . TYR A 360 ? 0.3427 0.3384 0.3276 0.0303  0.0240  -0.0070 571 TYR A OH  
2758 N N   . LEU A 361 ? 0.1831 0.1730 0.1859 0.0108  0.0163  -0.0116 572 LEU A N   
2759 C CA  . LEU A 361 ? 0.2049 0.1951 0.2095 0.0087  0.0146  -0.0120 572 LEU A CA  
2760 C C   . LEU A 361 ? 0.2098 0.2001 0.2136 0.0111  0.0132  -0.0120 572 LEU A C   
2761 O O   . LEU A 361 ? 0.2189 0.2126 0.2233 0.0125  0.0142  -0.0113 572 LEU A O   
2762 C CB  . LEU A 361 ? 0.1900 0.1844 0.1980 0.0054  0.0160  -0.0117 572 LEU A CB  
2763 C CG  . LEU A 361 ? 0.1995 0.1949 0.2092 0.0029  0.0144  -0.0121 572 LEU A CG  
2764 C CD1 . LEU A 361 ? 0.1132 0.1049 0.1223 0.0018  0.0134  -0.0128 572 LEU A CD1 
2765 C CD2 . LEU A 361 ? 0.1592 0.1600 0.1720 -0.0004 0.0159  -0.0122 572 LEU A CD2 
2766 N N   . LEU A 362 ? 0.2213 0.2080 0.2242 0.0116  0.0109  -0.0128 573 LEU A N   
2767 C CA  . LEU A 362 ? 0.2166 0.2017 0.2188 0.0140  0.0095  -0.0129 573 LEU A CA  
2768 C C   . LEU A 362 ? 0.2212 0.2080 0.2262 0.0122  0.0085  -0.0117 573 LEU A C   
2769 O O   . LEU A 362 ? 0.2320 0.2185 0.2381 0.0094  0.0077  -0.0117 573 LEU A O   
2770 C CB  . LEU A 362 ? 0.2082 0.1876 0.2078 0.0153  0.0076  -0.0145 573 LEU A CB  
2771 C CG  . LEU A 362 ? 0.2108 0.1885 0.2068 0.0180  0.0080  -0.0159 573 LEU A CG  
2772 C CD1 . LEU A 362 ? 0.2350 0.2139 0.2305 0.0167  0.0091  -0.0156 573 LEU A CD1 
2773 C CD2 . LEU A 362 ? 0.2244 0.1969 0.2184 0.0190  0.0056  -0.0180 573 LEU A CD2 
2774 N N   . LYS A 363 ? 0.2260 0.2154 0.2321 0.0139  0.0087  -0.0105 574 LYS A N   
2775 C CA  . LYS A 363 ? 0.2328 0.2240 0.2412 0.0129  0.0077  -0.0089 574 LYS A CA  
2776 C C   . LYS A 363 ? 0.2454 0.2305 0.2526 0.0154  0.0062  -0.0091 574 LYS A C   
2777 O O   . LYS A 363 ? 0.2352 0.2184 0.2409 0.0190  0.0066  -0.0094 574 LYS A O   
2778 C CB  . LYS A 363 ? 0.2403 0.2388 0.2508 0.0134  0.0090  -0.0072 574 LYS A CB  
2779 C CG  . LYS A 363 ? 0.2674 0.2698 0.2805 0.0123  0.0081  -0.0051 574 LYS A CG  
2780 C CD  . LYS A 363 ? 0.2945 0.3046 0.3094 0.0138  0.0092  -0.0033 574 LYS A CD  
2781 C CE  . LYS A 363 ? 0.3081 0.3234 0.3255 0.0133  0.0084  -0.0007 574 LYS A CE  
2782 N NZ  . LYS A 363 ? 0.3054 0.3303 0.3248 0.0140  0.0094  0.0008  574 LYS A NZ  
2783 N N   . VAL A 364 ? 0.2291 0.2110 0.2370 0.0135  0.0046  -0.0090 575 VAL A N   
2784 C CA  . VAL A 364 ? 0.2390 0.2139 0.2460 0.0148  0.0030  -0.0096 575 VAL A CA  
2785 C C   . VAL A 364 ? 0.2417 0.2168 0.2514 0.0144  0.0023  -0.0069 575 VAL A C   
2786 O O   . VAL A 364 ? 0.2296 0.2091 0.2414 0.0117  0.0022  -0.0052 575 VAL A O   
2787 C CB  . VAL A 364 ? 0.2392 0.2101 0.2449 0.0126  0.0017  -0.0116 575 VAL A CB  
2788 C CG1 . VAL A 364 ? 0.2616 0.2255 0.2667 0.0134  0.0001  -0.0127 575 VAL A CG1 
2789 C CG2 . VAL A 364 ? 0.2388 0.2104 0.2420 0.0133  0.0027  -0.0136 575 VAL A CG2 
2790 N N   . GLN A 365 ? 0.2457 0.2161 0.2552 0.0174  0.0020  -0.0065 576 GLN A N   
2791 C CA  . GLN A 365 ? 0.2594 0.2277 0.2713 0.0173  0.0013  -0.0037 576 GLN A CA  
2792 C C   . GLN A 365 ? 0.2478 0.2081 0.2594 0.0158  -0.0003 -0.0052 576 GLN A C   
2793 O O   . GLN A 365 ? 0.2555 0.2097 0.2648 0.0172  -0.0008 -0.0083 576 GLN A O   
2794 C CB  . GLN A 365 ? 0.2770 0.2447 0.2894 0.0216  0.0023  -0.0020 576 GLN A CB  
2795 C CG  . GLN A 365 ? 0.2888 0.2531 0.3037 0.0225  0.0019  0.0013  576 GLN A CG  
2796 C CD  . GLN A 365 ? 0.3444 0.3068 0.3591 0.0276  0.0031  0.0024  576 GLN A CD  
2797 O OE1 . GLN A 365 ? 0.3733 0.3434 0.3891 0.0295  0.0043  0.0047  576 GLN A OE1 
2798 N NE2 . GLN A 365 ? 0.3287 0.2813 0.3421 0.0299  0.0029  0.0002  576 GLN A NE2 
2799 N N   . PHE A 366 ? 0.2338 0.1947 0.2477 0.0128  -0.0012 -0.0032 577 PHE A N   
2800 C CA  . PHE A 366 ? 0.2407 0.1950 0.2550 0.0106  -0.0028 -0.0042 577 PHE A CA  
2801 C C   . PHE A 366 ? 0.2519 0.2006 0.2683 0.0122  -0.0029 -0.0018 577 PHE A C   
2802 O O   . PHE A 366 ? 0.2586 0.2111 0.2772 0.0129  -0.0021 0.0022  577 PHE A O   
2803 C CB  . PHE A 366 ? 0.2280 0.1864 0.2440 0.0064  -0.0036 -0.0031 577 PHE A CB  
2804 C CG  . PHE A 366 ? 0.2276 0.1895 0.2418 0.0048  -0.0036 -0.0058 577 PHE A CG  
2805 C CD1 . PHE A 366 ? 0.1992 0.1582 0.2128 0.0026  -0.0049 -0.0079 577 PHE A CD1 
2806 C CD2 . PHE A 366 ? 0.2388 0.2067 0.2521 0.0054  -0.0021 -0.0059 577 PHE A CD2 
2807 C CE1 . PHE A 366 ? 0.2475 0.2096 0.2596 0.0015  -0.0047 -0.0098 577 PHE A CE1 
2808 C CE2 . PHE A 366 ? 0.2419 0.2121 0.2538 0.0040  -0.0019 -0.0080 577 PHE A CE2 
2809 C CZ  . PHE A 366 ? 0.2134 0.1806 0.2246 0.0024  -0.0031 -0.0097 577 PHE A CZ  
2810 N N   . ASN A 367 ? 0.2552 0.1950 0.2708 0.0129  -0.0037 -0.0043 578 ASN A N   
2811 C CA  . ASN A 367 ? 0.2755 0.2080 0.2929 0.0147  -0.0034 -0.0024 578 ASN A CA  
2812 C C   . ASN A 367 ? 0.2754 0.2029 0.2952 0.0109  -0.0048 -0.0019 578 ASN A C   
2813 O O   . ASN A 367 ? 0.2904 0.2122 0.3091 0.0092  -0.0062 -0.0058 578 ASN A O   
2814 C CB  . ASN A 367 ? 0.2833 0.2085 0.2981 0.0184  -0.0031 -0.0061 578 ASN A CB  
2815 C CG  . ASN A 367 ? 0.3167 0.2475 0.3290 0.0221  -0.0016 -0.0067 578 ASN A CG  
2816 O OD1 . ASN A 367 ? 0.3329 0.2698 0.3467 0.0240  -0.0003 -0.0031 578 ASN A OD1 
2817 N ND2 . ASN A 367 ? 0.3131 0.2427 0.3218 0.0230  -0.0018 -0.0113 578 ASN A ND2 
2818 N N   . PHE A 368 ? 0.2734 0.2043 0.2966 0.0094  -0.0046 0.0029  579 PHE A N   
2819 C CA  . PHE A 368 ? 0.2982 0.2254 0.3242 0.0055  -0.0057 0.0042  579 PHE A CA  
2820 C C   . PHE A 368 ? 0.3031 0.2199 0.3314 0.0066  -0.0054 0.0057  579 PHE A C   
2821 O O   . PHE A 368 ? 0.3210 0.2326 0.3515 0.0031  -0.0065 0.0053  579 PHE A O   
2822 C CB  . PHE A 368 ? 0.2851 0.2213 0.3135 0.0030  -0.0056 0.0087  579 PHE A CB  
2823 C CG  . PHE A 368 ? 0.2852 0.2294 0.3118 0.0009  -0.0060 0.0065  579 PHE A CG  
2824 C CD1 . PHE A 368 ? 0.2880 0.2314 0.3145 -0.0027 -0.0074 0.0040  579 PHE A CD1 
2825 C CD2 . PHE A 368 ? 0.2452 0.1970 0.2701 0.0026  -0.0050 0.0066  579 PHE A CD2 
2826 C CE1 . PHE A 368 ? 0.2905 0.2405 0.3154 -0.0040 -0.0076 0.0021  579 PHE A CE1 
2827 C CE2 . PHE A 368 ? 0.2295 0.1873 0.2528 0.0008  -0.0051 0.0044  579 PHE A CE2 
2828 C CZ  . PHE A 368 ? 0.2162 0.1730 0.2395 -0.0022 -0.0063 0.0023  579 PHE A CZ  
2829 N N   . THR B 15  ? 0.8680 0.8599 0.6027 -0.0883 -0.0457 -0.0458 226 THR B N   
2830 C CA  . THR B 15  ? 0.8833 0.8622 0.5968 -0.0851 -0.0494 -0.0391 226 THR B CA  
2831 C C   . THR B 15  ? 0.8795 0.8636 0.5868 -0.0754 -0.0609 -0.0337 226 THR B C   
2832 O O   . THR B 15  ? 0.9004 0.8790 0.5884 -0.0733 -0.0664 -0.0299 226 THR B O   
2833 C CB  . THR B 15  ? 0.9046 0.8786 0.6004 -0.0932 -0.0471 -0.0423 226 THR B CB  
2834 O OG1 . THR B 15  ? 0.9262 0.9136 0.6159 -0.0934 -0.0551 -0.0454 226 THR B OG1 
2835 C CG2 . THR B 15  ? 0.8995 0.8711 0.6035 -0.1031 -0.0359 -0.0491 226 THR B CG2 
2836 N N   . GLU B 16  ? 0.8505 0.8447 0.5742 -0.0693 -0.0642 -0.0334 227 GLU B N   
2837 C CA  . GLU B 16  ? 0.8373 0.8351 0.5591 -0.0589 -0.0739 -0.0279 227 GLU B CA  
2838 C C   . GLU B 16  ? 0.8318 0.8113 0.5434 -0.0535 -0.0730 -0.0193 227 GLU B C   
2839 O O   . GLU B 16  ? 0.8342 0.8108 0.5357 -0.0456 -0.0807 -0.0135 227 GLU B O   
2840 C CB  . GLU B 16  ? 0.8186 0.8309 0.5625 -0.0551 -0.0755 -0.0305 227 GLU B CB  
2841 C CG  . GLU B 16  ? 0.8160 0.8384 0.5615 -0.0452 -0.0861 -0.0276 227 GLU B CG  
2842 C CD  . GLU B 16  ? 0.8188 0.8598 0.5643 -0.0459 -0.0938 -0.0332 227 GLU B CD  
2843 O OE1 . GLU B 16  ? 0.8052 0.8565 0.5542 -0.0378 -0.1025 -0.0317 227 GLU B OE1 
2844 O OE2 . GLU B 16  ? 0.7794 0.8251 0.5216 -0.0544 -0.0911 -0.0392 227 GLU B OE2 
2845 N N   . ASN B 17  ? 0.8067 0.7740 0.5211 -0.0578 -0.0635 -0.0189 228 ASN B N   
2846 C CA  . ASN B 17  ? 0.7990 0.7489 0.5053 -0.0540 -0.0611 -0.0119 228 ASN B CA  
2847 C C   . ASN B 17  ? 0.8060 0.7417 0.4876 -0.0539 -0.0631 -0.0071 228 ASN B C   
2848 O O   . ASN B 17  ? 0.8187 0.7418 0.4919 -0.0484 -0.0641 -0.0005 228 ASN B O   
2849 C CB  . ASN B 17  ? 0.7829 0.7252 0.4991 -0.0594 -0.0504 -0.0137 228 ASN B CB  
2850 N N   . LEU B 18  ? 0.8077 0.7449 0.4773 -0.0602 -0.0633 -0.0105 229 LEU B N   
2851 C CA  . LEU B 18  ? 0.8213 0.7463 0.4654 -0.0603 -0.0663 -0.0061 229 LEU B CA  
2852 C C   . LEU B 18  ? 0.8204 0.7464 0.4551 -0.0499 -0.0774 0.0003  229 LEU B C   
2853 O O   . LEU B 18  ? 0.8282 0.7397 0.4428 -0.0470 -0.0796 0.0066  229 LEU B O   
2854 C CB  . LEU B 18  ? 0.8328 0.7632 0.4673 -0.0687 -0.0658 -0.0119 229 LEU B CB  
2855 C CG  . LEU B 18  ? 0.8358 0.7596 0.4702 -0.0798 -0.0547 -0.0172 229 LEU B CG  
2856 C CD1 . LEU B 18  ? 0.8367 0.7693 0.4642 -0.0874 -0.0553 -0.0237 229 LEU B CD1 
2857 C CD2 . LEU B 18  ? 0.8685 0.7710 0.4868 -0.0814 -0.0491 -0.0122 229 LEU B CD2 
2858 N N   . TYR B 19  ? 0.7942 0.7377 0.4436 -0.0445 -0.0842 -0.0018 230 TYR B N   
2859 C CA  . TYR B 19  ? 0.7951 0.7439 0.4391 -0.0343 -0.0956 0.0029  230 TYR B CA  
2860 C C   . TYR B 19  ? 0.7861 0.7310 0.4396 -0.0249 -0.0972 0.0082  230 TYR B C   
2861 O O   . TYR B 19  ? 0.7891 0.7249 0.4301 -0.0169 -0.1028 0.0153  230 TYR B O   
2862 C CB  . TYR B 19  ? 0.7816 0.7535 0.4362 -0.0341 -0.1024 -0.0034 230 TYR B CB  
2863 C CG  . TYR B 19  ? 0.7862 0.7627 0.4290 -0.0423 -0.1026 -0.0084 230 TYR B CG  
2864 C CD1 . TYR B 19  ? 0.7854 0.7579 0.4057 -0.0399 -0.1099 -0.0046 230 TYR B CD1 
2865 C CD2 . TYR B 19  ? 0.7719 0.7566 0.4257 -0.0524 -0.0954 -0.0169 230 TYR B CD2 
2866 C CE1 . TYR B 19  ? 0.8101 0.7873 0.4191 -0.0478 -0.1101 -0.0094 230 TYR B CE1 
2867 C CE2 . TYR B 19  ? 0.7816 0.7707 0.4248 -0.0603 -0.0952 -0.0220 230 TYR B CE2 
2868 C CZ  . TYR B 19  ? 0.7952 0.7809 0.4160 -0.0581 -0.1027 -0.0183 230 TYR B CZ  
2869 O OH  . TYR B 19  ? 0.8078 0.7980 0.4173 -0.0663 -0.1024 -0.0235 230 TYR B OH  
2870 N N   . PHE B 20  ? 0.7684 0.7199 0.4435 -0.0259 -0.0921 0.0048  231 PHE B N   
2871 C CA  . PHE B 20  ? 0.7728 0.7257 0.4602 -0.0172 -0.0946 0.0083  231 PHE B CA  
2872 C C   . PHE B 20  ? 0.7744 0.7129 0.4658 -0.0179 -0.0862 0.0112  231 PHE B C   
2873 O O   . PHE B 20  ? 0.7882 0.7210 0.4809 -0.0102 -0.0883 0.0163  231 PHE B O   
2874 C CB  . PHE B 20  ? 0.7560 0.7304 0.4655 -0.0159 -0.0973 0.0024  231 PHE B CB  
2875 C CG  . PHE B 20  ? 0.7720 0.7623 0.4792 -0.0129 -0.1072 -0.0001 231 PHE B CG  
2876 C CD1 . PHE B 20  ? 0.8033 0.7936 0.5018 -0.0027 -0.1170 0.0054  231 PHE B CD1 
2877 C CD2 . PHE B 20  ? 0.7742 0.7792 0.4873 -0.0202 -0.1067 -0.0079 231 PHE B CD2 
2878 C CE1 . PHE B 20  ? 0.8165 0.8227 0.5127 0.0006  -0.1269 0.0030  231 PHE B CE1 
2879 C CE2 . PHE B 20  ? 0.7906 0.8115 0.5015 -0.0178 -0.1160 -0.0108 231 PHE B CE2 
2880 C CZ  . PHE B 20  ? 0.8072 0.8292 0.5097 -0.0072 -0.1264 -0.0053 231 PHE B CZ  
2881 N N   . GLN B 21  ? 0.7773 0.7103 0.4710 -0.0268 -0.0768 0.0079  232 GLN B N   
2882 C CA  . GLN B 21  ? 0.7774 0.6971 0.4746 -0.0280 -0.0687 0.0103  232 GLN B CA  
2883 C C   . GLN B 21  ? 0.7596 0.6876 0.4777 -0.0235 -0.0682 0.0097  232 GLN B C   
2884 O O   . GLN B 21  ? 0.7738 0.6975 0.4922 -0.0158 -0.0714 0.0145  232 GLN B O   
2885 C CB  . GLN B 21  ? 0.7937 0.6941 0.4719 -0.0241 -0.0691 0.0176  232 GLN B CB  
2886 N N   . SER B 22  ? 0.7404 0.6799 0.4754 -0.0284 -0.0642 0.0037  233 SER B N   
2887 C CA  . SER B 22  ? 0.7185 0.6659 0.4731 -0.0253 -0.0629 0.0027  233 SER B CA  
2888 C C   . SER B 22  ? 0.7023 0.6411 0.4633 -0.0297 -0.0536 0.0023  233 SER B C   
2889 O O   . SER B 22  ? 0.7042 0.6354 0.4588 -0.0367 -0.0475 0.0007  233 SER B O   
2890 C CB  . SER B 22  ? 0.7068 0.6728 0.4765 -0.0276 -0.0644 -0.0037 233 SER B CB  
2891 O OG  . SER B 22  ? 0.7236 0.6999 0.4886 -0.0239 -0.0733 -0.0043 233 SER B OG  
2892 N N   . MET B 23  ? 0.6767 0.6172 0.4502 -0.0257 -0.0525 0.0037  234 MET B N   
2893 C CA  . MET B 23  ? 0.6571 0.5944 0.4411 -0.0295 -0.0445 0.0023  234 MET B CA  
2894 C C   . MET B 23  ? 0.6389 0.5826 0.4296 -0.0373 -0.0398 -0.0036 234 MET B C   
2895 O O   . MET B 23  ? 0.6340 0.5909 0.4335 -0.0382 -0.0422 -0.0075 234 MET B O   
2896 C CB  . MET B 23  ? 0.6421 0.5863 0.4417 -0.0244 -0.0454 0.0030  234 MET B CB  
2897 C CG  . MET B 23  ? 0.6511 0.5928 0.4617 -0.0275 -0.0378 0.0020  234 MET B CG  
2898 S SD  . MET B 23  ? 0.6403 0.5882 0.4663 -0.0215 -0.0388 0.0035  234 MET B SD  
2899 C CE  . MET B 23  ? 0.6542 0.5900 0.4676 -0.0146 -0.0423 0.0096  234 MET B CE  
2900 N N   . ASP B 24  ? 0.6308 0.5654 0.4180 -0.0432 -0.0327 -0.0045 235 ASP B N   
2901 C CA  . ASP B 24  ? 0.6229 0.5621 0.4172 -0.0504 -0.0273 -0.0100 235 ASP B CA  
2902 C C   . ASP B 24  ? 0.6036 0.5548 0.4165 -0.0493 -0.0269 -0.0126 235 ASP B C   
2903 O O   . ASP B 24  ? 0.5923 0.5439 0.4135 -0.0447 -0.0271 -0.0100 235 ASP B O   
2904 C CB  . ASP B 24  ? 0.6250 0.5531 0.4172 -0.0554 -0.0192 -0.0104 235 ASP B CB  
2905 C CG  . ASP B 24  ? 0.6453 0.5769 0.4441 -0.0628 -0.0132 -0.0162 235 ASP B CG  
2906 O OD1 . ASP B 24  ? 0.6758 0.6174 0.4885 -0.0634 -0.0125 -0.0193 235 ASP B OD1 
2907 O OD2 . ASP B 24  ? 0.6793 0.6032 0.4694 -0.0682 -0.0086 -0.0179 235 ASP B OD2 
2908 N N   . LEU B 25  ? 0.5874 0.5478 0.4067 -0.0538 -0.0259 -0.0178 236 LEU B N   
2909 C CA  . LEU B 25  ? 0.5741 0.5455 0.4102 -0.0535 -0.0251 -0.0206 236 LEU B CA  
2910 C C   . LEU B 25  ? 0.5472 0.5140 0.3935 -0.0535 -0.0190 -0.0194 236 LEU B C   
2911 O O   . LEU B 25  ? 0.5355 0.5077 0.3929 -0.0502 -0.0196 -0.0186 236 LEU B O   
2912 C CB  . LEU B 25  ? 0.5820 0.5617 0.4223 -0.0599 -0.0230 -0.0271 236 LEU B CB  
2913 C CG  . LEU B 25  ? 0.5837 0.5768 0.4383 -0.0601 -0.0239 -0.0309 236 LEU B CG  
2914 C CD1 . LEU B 25  ? 0.5984 0.5939 0.4637 -0.0544 -0.0247 -0.0278 236 LEU B CD1 
2915 C CD2 . LEU B 25  ? 0.6134 0.6180 0.4645 -0.0597 -0.0307 -0.0340 236 LEU B CD2 
2916 N N   . ARG B 26  ? 0.5341 0.4914 0.3767 -0.0574 -0.0132 -0.0195 237 ARG B N   
2917 C CA  . ARG B 26  ? 0.5091 0.4628 0.3613 -0.0579 -0.0074 -0.0189 237 ARG B CA  
2918 C C   . ARG B 26  ? 0.4942 0.4439 0.3470 -0.0520 -0.0091 -0.0139 237 ARG B C   
2919 O O   . ARG B 26  ? 0.4631 0.4148 0.3268 -0.0503 -0.0069 -0.0131 237 ARG B O   
2920 C CB  . ARG B 26  ? 0.5141 0.4597 0.3621 -0.0635 -0.0010 -0.0210 237 ARG B CB  
2921 C CG  . ARG B 26  ? 0.5189 0.4687 0.3684 -0.0697 0.0018  -0.0266 237 ARG B CG  
2922 C CD  . ARG B 26  ? 0.5397 0.4814 0.3768 -0.0747 0.0048  -0.0282 237 ARG B CD  
2923 N NE  . ARG B 26  ? 0.5115 0.4453 0.3516 -0.0766 0.0113  -0.0281 237 ARG B NE  
2924 C CZ  . ARG B 26  ? 0.5022 0.4274 0.3327 -0.0805 0.0151  -0.0291 237 ARG B CZ  
2925 N NH1 . ARG B 26  ? 0.5239 0.4437 0.3594 -0.0818 0.0210  -0.0296 237 ARG B NH1 
2926 N NH2 . ARG B 26  ? 0.4916 0.4138 0.3073 -0.0830 0.0128  -0.0296 237 ARG B NH2 
2927 N N   . VAL B 27  ? 0.4916 0.4354 0.3323 -0.0489 -0.0129 -0.0105 238 VAL B N   
2928 C CA  . VAL B 27  ? 0.4890 0.4293 0.3298 -0.0431 -0.0150 -0.0061 238 VAL B CA  
2929 C C   . VAL B 27  ? 0.4834 0.4342 0.3330 -0.0381 -0.0201 -0.0055 238 VAL B C   
2930 O O   . VAL B 27  ? 0.4595 0.4117 0.3175 -0.0349 -0.0194 -0.0039 238 VAL B O   
2931 C CB  . VAL B 27  ? 0.4988 0.4287 0.3235 -0.0411 -0.0174 -0.0025 238 VAL B CB  
2932 C CG1 . VAL B 27  ? 0.4865 0.4125 0.3118 -0.0354 -0.0190 0.0016  238 VAL B CG1 
2933 C CG2 . VAL B 27  ? 0.4961 0.4156 0.3121 -0.0469 -0.0116 -0.0036 238 VAL B CG2 
2934 N N   . GLN B 28  ? 0.4827 0.4412 0.3305 -0.0376 -0.0250 -0.0074 239 GLN B N   
2935 C CA  . GLN B 28  ? 0.4883 0.4584 0.3457 -0.0337 -0.0293 -0.0081 239 GLN B CA  
2936 C C   . GLN B 28  ? 0.4729 0.4484 0.3454 -0.0351 -0.0249 -0.0099 239 GLN B C   
2937 O O   . GLN B 28  ? 0.4589 0.4375 0.3385 -0.0311 -0.0260 -0.0083 239 GLN B O   
2938 C CB  . GLN B 28  ? 0.4990 0.4789 0.3552 -0.0351 -0.0335 -0.0118 239 GLN B CB  
2939 C CG  . GLN B 28  ? 0.5108 0.4904 0.3552 -0.0308 -0.0407 -0.0096 239 GLN B CG  
2940 C CD  . GLN B 28  ? 0.5139 0.5053 0.3586 -0.0324 -0.0451 -0.0139 239 GLN B CD  
2941 O OE1 . GLN B 28  ? 0.5316 0.5354 0.3879 -0.0315 -0.0469 -0.0170 239 GLN B OE1 
2942 N NE2 . GLN B 28  ? 0.4927 0.4806 0.3244 -0.0352 -0.0466 -0.0144 239 GLN B NE2 
2943 N N   . GLU B 29  ? 0.4729 0.4487 0.3494 -0.0410 -0.0197 -0.0133 240 GLU B N   
2944 C CA  . GLU B 29  ? 0.4649 0.4448 0.3547 -0.0425 -0.0154 -0.0148 240 GLU B CA  
2945 C C   . GLU B 29  ? 0.4501 0.4236 0.3432 -0.0403 -0.0123 -0.0113 240 GLU B C   
2946 O O   . GLU B 29  ? 0.4373 0.4150 0.3400 -0.0385 -0.0114 -0.0107 240 GLU B O   
2947 C CB  . GLU B 29  ? 0.4756 0.4559 0.3684 -0.0491 -0.0102 -0.0191 240 GLU B CB  
2948 C CG  . GLU B 29  ? 0.4933 0.4824 0.3857 -0.0521 -0.0127 -0.0238 240 GLU B CG  
2949 C CD  . GLU B 29  ? 0.5354 0.5358 0.4375 -0.0501 -0.0154 -0.0254 240 GLU B CD  
2950 O OE1 . GLU B 29  ? 0.5338 0.5352 0.4458 -0.0495 -0.0122 -0.0248 240 GLU B OE1 
2951 O OE2 . GLU B 29  ? 0.5629 0.5716 0.4628 -0.0490 -0.0208 -0.0274 240 GLU B OE2 
2952 N N   . LEU B 30  ? 0.4344 0.3980 0.3191 -0.0405 -0.0107 -0.0091 241 LEU B N   
2953 C CA  . LEU B 30  ? 0.4187 0.3769 0.3059 -0.0386 -0.0079 -0.0063 241 LEU B CA  
2954 C C   . LEU B 30  ? 0.4163 0.3764 0.3045 -0.0329 -0.0120 -0.0032 241 LEU B C   
2955 O O   . LEU B 30  ? 0.4143 0.3765 0.3106 -0.0310 -0.0106 -0.0021 241 LEU B O   
2956 C CB  . LEU B 30  ? 0.4177 0.3653 0.2951 -0.0405 -0.0054 -0.0053 241 LEU B CB  
2957 C CG  . LEU B 30  ? 0.4096 0.3516 0.2885 -0.0390 -0.0026 -0.0029 241 LEU B CG  
2958 C CD1 . LEU B 30  ? 0.3746 0.3194 0.2651 -0.0408 0.0020  -0.0042 241 LEU B CD1 
2959 C CD2 . LEU B 30  ? 0.4108 0.3426 0.2784 -0.0412 -0.0006 -0.0024 241 LEU B CD2 
2960 N N   . ILE B 31  ? 0.4204 0.3794 0.2999 -0.0298 -0.0170 -0.0018 242 ILE B N   
2961 C CA  . ILE B 31  ? 0.4223 0.3830 0.3025 -0.0239 -0.0211 0.0008  242 ILE B CA  
2962 C C   . ILE B 31  ? 0.4167 0.3888 0.3092 -0.0222 -0.0226 -0.0008 242 ILE B C   
2963 O O   . ILE B 31  ? 0.4053 0.3787 0.3033 -0.0190 -0.0225 0.0008  242 ILE B O   
2964 C CB  . ILE B 31  ? 0.4298 0.3879 0.2988 -0.0205 -0.0268 0.0024  242 ILE B CB  
2965 C CG1 . ILE B 31  ? 0.4543 0.3991 0.3097 -0.0217 -0.0250 0.0048  242 ILE B CG1 
2966 C CG2 . ILE B 31  ? 0.4278 0.3894 0.2997 -0.0139 -0.0312 0.0045  242 ILE B CG2 
2967 C CD1 . ILE B 31  ? 0.4674 0.4041 0.3230 -0.0214 -0.0208 0.0069  242 ILE B CD1 
2968 N N   . LYS B 32  ? 0.4086 0.3890 0.3051 -0.0246 -0.0236 -0.0043 243 LYS B N   
2969 C CA  . LYS B 32  ? 0.4157 0.4070 0.3239 -0.0239 -0.0242 -0.0064 243 LYS B CA  
2970 C C   . LYS B 32  ? 0.3920 0.3827 0.3089 -0.0257 -0.0189 -0.0061 243 LYS B C   
2971 O O   . LYS B 32  ? 0.3884 0.3845 0.3131 -0.0236 -0.0190 -0.0060 243 LYS B O   
2972 C CB  . LYS B 32  ? 0.4201 0.4200 0.3315 -0.0276 -0.0248 -0.0110 243 LYS B CB  
2973 C CG  . LYS B 32  ? 0.4795 0.4846 0.3852 -0.0252 -0.0312 -0.0121 243 LYS B CG  
2974 C CD  . LYS B 32  ? 0.5227 0.5365 0.4312 -0.0301 -0.0312 -0.0174 243 LYS B CD  
2975 C CE  . LYS B 32  ? 0.5360 0.5593 0.4580 -0.0322 -0.0286 -0.0208 243 LYS B CE  
2976 N NZ  . LYS B 32  ? 0.5605 0.5911 0.4893 -0.0270 -0.0320 -0.0203 243 LYS B NZ  
2977 N N   . LEU B 33  ? 0.3863 0.3707 0.3018 -0.0295 -0.0142 -0.0062 244 LEU B N   
2978 C CA  . LEU B 33  ? 0.3764 0.3596 0.2994 -0.0309 -0.0094 -0.0056 244 LEU B CA  
2979 C C   . LEU B 33  ? 0.3636 0.3438 0.2871 -0.0269 -0.0097 -0.0021 244 LEU B C   
2980 O O   . LEU B 33  ? 0.3559 0.3403 0.2866 -0.0255 -0.0090 -0.0015 244 LEU B O   
2981 C CB  . LEU B 33  ? 0.3714 0.3483 0.2926 -0.0352 -0.0048 -0.0065 244 LEU B CB  
2982 C CG  . LEU B 33  ? 0.3781 0.3538 0.3072 -0.0364 0.0002  -0.0059 244 LEU B CG  
2983 C CD1 . LEU B 33  ? 0.3802 0.3630 0.3185 -0.0372 0.0012  -0.0074 244 LEU B CD1 
2984 C CD2 . LEU B 33  ? 0.4078 0.3779 0.3354 -0.0404 0.0045  -0.0074 244 LEU B CD2 
2985 N N   . ILE B 34  ? 0.3586 0.3312 0.2738 -0.0255 -0.0105 0.0000  245 ILE B N   
2986 C CA  . ILE B 34  ? 0.3433 0.3124 0.2589 -0.0228 -0.0097 0.0027  245 ILE B CA  
2987 C C   . ILE B 34  ? 0.3424 0.3156 0.2595 -0.0181 -0.0135 0.0038  245 ILE B C   
2988 O O   . ILE B 34  ? 0.3324 0.3061 0.2535 -0.0164 -0.0125 0.0051  245 ILE B O   
2989 C CB  . ILE B 34  ? 0.3479 0.3072 0.2547 -0.0233 -0.0083 0.0041  245 ILE B CB  
2990 C CG1 . ILE B 34  ? 0.3476 0.3024 0.2437 -0.0215 -0.0120 0.0050  245 ILE B CG1 
2991 C CG2 . ILE B 34  ? 0.3633 0.3195 0.2707 -0.0278 -0.0039 0.0026  245 ILE B CG2 
2992 C CD1 . ILE B 34  ? 0.3381 0.2820 0.2246 -0.0224 -0.0100 0.0064  245 ILE B CD1 
2993 N N   . CYS B 35  ? 0.3403 0.3170 0.2545 -0.0160 -0.0180 0.0030  246 CYS B N   
2994 C CA  . CYS B 35  ? 0.3515 0.3324 0.2677 -0.0110 -0.0219 0.0038  246 CYS B CA  
2995 C C   . CYS B 35  ? 0.3472 0.3392 0.2741 -0.0107 -0.0224 0.0015  246 CYS B C   
2996 O O   . CYS B 35  ? 0.3560 0.3526 0.2857 -0.0067 -0.0254 0.0014  246 CYS B O   
2997 C CB  . CYS B 35  ? 0.3575 0.3368 0.2654 -0.0078 -0.0270 0.0043  246 CYS B CB  
2998 S SG  . CYS B 35  ? 0.3885 0.3535 0.2821 -0.0075 -0.0265 0.0074  246 CYS B SG  
2999 N N   . ASN B 36  ? 0.3522 0.3480 0.2851 -0.0149 -0.0191 -0.0005 247 ASN B N   
3000 C CA  . ASN B 36  ? 0.3578 0.3632 0.3002 -0.0157 -0.0186 -0.0030 247 ASN B CA  
3001 C C   . ASN B 36  ? 0.3504 0.3569 0.2980 -0.0136 -0.0171 -0.0015 247 ASN B C   
3002 O O   . ASN B 36  ? 0.3377 0.3401 0.2863 -0.0152 -0.0133 0.0002  247 ASN B O   
3003 C CB  . ASN B 36  ? 0.3614 0.3673 0.3073 -0.0211 -0.0144 -0.0049 247 ASN B CB  
3004 C CG  . ASN B 36  ? 0.3781 0.3931 0.3330 -0.0231 -0.0132 -0.0080 247 ASN B CG  
3005 O OD1 . ASN B 36  ? 0.3782 0.3979 0.3384 -0.0212 -0.0133 -0.0080 247 ASN B OD1 
3006 N ND2 . ASN B 36  ? 0.4155 0.4326 0.3719 -0.0274 -0.0113 -0.0110 247 ASN B ND2 
3007 N N   . VAL B 37  ? 0.3518 0.3640 0.3024 -0.0099 -0.0202 -0.0021 248 VAL B N   
3008 C CA  . VAL B 37  ? 0.3442 0.3574 0.2988 -0.0077 -0.0190 -0.0010 248 VAL B CA  
3009 C C   . VAL B 37  ? 0.3384 0.3569 0.3008 -0.0111 -0.0152 -0.0024 248 VAL B C   
3010 O O   . VAL B 37  ? 0.3116 0.3279 0.2755 -0.0115 -0.0123 -0.0006 248 VAL B O   
3011 C CB  . VAL B 37  ? 0.3632 0.3811 0.3191 -0.0027 -0.0232 -0.0018 248 VAL B CB  
3012 C CG1 . VAL B 37  ? 0.3736 0.3954 0.3360 -0.0014 -0.0215 -0.0021 248 VAL B CG1 
3013 C CG2 . VAL B 37  ? 0.3637 0.3733 0.3106 0.0011  -0.0261 0.0008  248 VAL B CG2 
3014 N N   . GLN B 38  ? 0.3367 0.3617 0.3034 -0.0138 -0.0150 -0.0056 249 GLN B N   
3015 C CA  . GLN B 38  ? 0.3307 0.3592 0.3037 -0.0177 -0.0108 -0.0071 249 GLN B CA  
3016 C C   . GLN B 38  ? 0.3113 0.3320 0.2823 -0.0205 -0.0065 -0.0044 249 GLN B C   
3017 O O   . GLN B 38  ? 0.2904 0.3109 0.2645 -0.0215 -0.0032 -0.0032 249 GLN B O   
3018 C CB  . GLN B 38  ? 0.3494 0.3850 0.3263 -0.0207 -0.0111 -0.0114 249 GLN B CB  
3019 C CG  . GLN B 38  ? 0.3991 0.4359 0.3810 -0.0259 -0.0058 -0.0130 249 GLN B CG  
3020 C CD  . GLN B 38  ? 0.5005 0.5460 0.4899 -0.0265 -0.0047 -0.0159 249 GLN B CD  
3021 O OE1 . GLN B 38  ? 0.5364 0.5825 0.5273 -0.0243 -0.0043 -0.0144 249 GLN B OE1 
3022 N NE2 . GLN B 38  ? 0.5345 0.5874 0.5287 -0.0299 -0.0040 -0.0207 249 GLN B NE2 
3023 N N   . ALA B 39  ? 0.2966 0.3110 0.2623 -0.0215 -0.0063 -0.0034 250 ALA B N   
3024 C CA  . ALA B 39  ? 0.2950 0.3026 0.2597 -0.0235 -0.0024 -0.0010 250 ALA B CA  
3025 C C   . ALA B 39  ? 0.2833 0.2875 0.2465 -0.0207 -0.0023 0.0023  250 ALA B C   
3026 O O   . ALA B 39  ? 0.2888 0.2913 0.2539 -0.0215 0.0006  0.0041  250 ALA B O   
3027 C CB  . ALA B 39  ? 0.2929 0.2946 0.2530 -0.0256 -0.0017 -0.0012 250 ALA B CB  
3028 N N   . MET B 40  ? 0.2865 0.2902 0.2462 -0.0174 -0.0054 0.0029  251 MET B N   
3029 C CA  . MET B 40  ? 0.2783 0.2794 0.2368 -0.0153 -0.0050 0.0053  251 MET B CA  
3030 C C   . MET B 40  ? 0.2790 0.2851 0.2430 -0.0153 -0.0034 0.0054  251 MET B C   
3031 O O   . MET B 40  ? 0.2657 0.2700 0.2300 -0.0156 -0.0012 0.0074  251 MET B O   
3032 C CB  . MET B 40  ? 0.2808 0.2798 0.2347 -0.0117 -0.0083 0.0057  251 MET B CB  
3033 C CG  . MET B 40  ? 0.2768 0.2694 0.2236 -0.0119 -0.0095 0.0061  251 MET B CG  
3034 S SD  . MET B 40  ? 0.3209 0.3101 0.2613 -0.0074 -0.0135 0.0067  251 MET B SD  
3035 C CE  . MET B 40  ? 0.3604 0.3409 0.2914 -0.0089 -0.0138 0.0074  251 MET B CE  
3036 N N   . GLU B 41  ? 0.2874 0.3003 0.2554 -0.0150 -0.0045 0.0029  252 GLU B N   
3037 C CA  . GLU B 41  ? 0.3045 0.3228 0.2778 -0.0156 -0.0026 0.0022  252 GLU B CA  
3038 C C   . GLU B 41  ? 0.2889 0.3054 0.2638 -0.0189 0.0016  0.0036  252 GLU B C   
3039 O O   . GLU B 41  ? 0.2736 0.2894 0.2487 -0.0189 0.0035  0.0056  252 GLU B O   
3040 C CB  . GLU B 41  ? 0.3139 0.3406 0.2923 -0.0157 -0.0041 -0.0017 252 GLU B CB  
3041 C CG  . GLU B 41  ? 0.3788 0.4100 0.3587 -0.0117 -0.0072 -0.0030 252 GLU B CG  
3042 C CD  . GLU B 41  ? 0.4540 0.4926 0.4373 -0.0103 -0.0107 -0.0067 252 GLU B CD  
3043 O OE1 . GLU B 41  ? 0.4905 0.5332 0.4768 -0.0134 -0.0099 -0.0092 252 GLU B OE1 
3044 O OE2 . GLU B 41  ? 0.4770 0.5173 0.4600 -0.0059 -0.0142 -0.0072 252 GLU B OE2 
3045 N N   . GLU B 42  ? 0.2769 0.2920 0.2524 -0.0217 0.0029  0.0027  253 GLU B N   
3046 C CA  . GLU B 42  ? 0.2818 0.2936 0.2585 -0.0246 0.0070  0.0041  253 GLU B CA  
3047 C C   . GLU B 42  ? 0.2809 0.2865 0.2543 -0.0235 0.0079  0.0079  253 GLU B C   
3048 O O   . GLU B 42  ? 0.2686 0.2724 0.2427 -0.0242 0.0106  0.0101  253 GLU B O   
3049 C CB  . GLU B 42  ? 0.2897 0.3007 0.2675 -0.0277 0.0084  0.0019  253 GLU B CB  
3050 C CG  . GLU B 42  ? 0.3330 0.3515 0.3151 -0.0295 0.0080  -0.0024 253 GLU B CG  
3051 C CD  . GLU B 42  ? 0.3824 0.4013 0.3652 -0.0326 0.0087  -0.0055 253 GLU B CD  
3052 O OE1 . GLU B 42  ? 0.4373 0.4515 0.4165 -0.0326 0.0079  -0.0049 253 GLU B OE1 
3053 O OE2 . GLU B 42  ? 0.4624 0.4869 0.4497 -0.0355 0.0102  -0.0091 253 GLU B OE2 
3054 N N   . MET B 43  ? 0.2792 0.2814 0.2489 -0.0219 0.0058  0.0084  254 MET B N   
3055 C CA  . MET B 43  ? 0.2920 0.2894 0.2594 -0.0209 0.0066  0.0112  254 MET B CA  
3056 C C   . MET B 43  ? 0.2810 0.2803 0.2481 -0.0191 0.0063  0.0130  254 MET B C   
3057 O O   . MET B 43  ? 0.2700 0.2678 0.2372 -0.0190 0.0079  0.0154  254 MET B O   
3058 C CB  . MET B 43  ? 0.3001 0.2937 0.2633 -0.0200 0.0048  0.0108  254 MET B CB  
3059 C CG  . MET B 43  ? 0.3347 0.3245 0.2972 -0.0223 0.0061  0.0098  254 MET B CG  
3060 S SD  . MET B 43  ? 0.3262 0.3108 0.2826 -0.0218 0.0044  0.0092  254 MET B SD  
3061 C CE  . MET B 43  ? 0.3281 0.3152 0.2820 -0.0220 0.0014  0.0065  254 MET B CE  
3062 N N   . MET B 44  ? 0.2792 0.2821 0.2461 -0.0176 0.0043  0.0117  255 MET B N   
3063 C CA  . MET B 44  ? 0.2861 0.2908 0.2526 -0.0162 0.0043  0.0129  255 MET B CA  
3064 C C   . MET B 44  ? 0.3021 0.3096 0.2711 -0.0177 0.0068  0.0138  255 MET B C   
3065 O O   . MET B 44  ? 0.2986 0.3058 0.2663 -0.0174 0.0077  0.0160  255 MET B O   
3066 C CB  . MET B 44  ? 0.2732 0.2803 0.2390 -0.0140 0.0019  0.0111  255 MET B CB  
3067 C CG  . MET B 44  ? 0.2656 0.2684 0.2273 -0.0123 -0.0002 0.0110  255 MET B CG  
3068 S SD  . MET B 44  ? 0.2993 0.2975 0.2575 -0.0123 0.0009  0.0131  255 MET B SD  
3069 C CE  . MET B 44  ? 0.2098 0.2039 0.1675 -0.0142 0.0020  0.0136  255 MET B CE  
3070 N N   . MET B 45  ? 0.3168 0.3269 0.2889 -0.0195 0.0079  0.0119  256 MET B N   
3071 C CA  . MET B 45  ? 0.3319 0.3432 0.3057 -0.0217 0.0111  0.0128  256 MET B CA  
3072 C C   . MET B 45  ? 0.3264 0.3325 0.2985 -0.0223 0.0133  0.0163  256 MET B C   
3073 O O   . MET B 45  ? 0.3141 0.3197 0.2848 -0.0226 0.0150  0.0187  256 MET B O   
3074 C CB  . MET B 45  ? 0.3469 0.3615 0.3246 -0.0243 0.0126  0.0096  256 MET B CB  
3075 C CG  . MET B 45  ? 0.4038 0.4251 0.3843 -0.0231 0.0102  0.0059  256 MET B CG  
3076 S SD  . MET B 45  ? 0.5565 0.5844 0.5429 -0.0264 0.0120  0.0013  256 MET B SD  
3077 C CE  . MET B 45  ? 0.5458 0.5744 0.5324 -0.0288 0.0165  0.0025  256 MET B CE  
3078 N N   . GLU B 46  ? 0.3313 0.3332 0.3030 -0.0223 0.0131  0.0167  257 GLU B N   
3079 C CA  . GLU B 46  ? 0.3447 0.3414 0.3158 -0.0224 0.0151  0.0197  257 GLU B CA  
3080 C C   . GLU B 46  ? 0.3371 0.3335 0.3057 -0.0200 0.0137  0.0226  257 GLU B C   
3081 O O   . GLU B 46  ? 0.3298 0.3241 0.2976 -0.0195 0.0151  0.0257  257 GLU B O   
3082 C CB  . GLU B 46  ? 0.3678 0.3609 0.3396 -0.0230 0.0151  0.0185  257 GLU B CB  
3083 C CG  . GLU B 46  ? 0.4391 0.4265 0.4115 -0.0232 0.0175  0.0207  257 GLU B CG  
3084 C CD  . GLU B 46  ? 0.5366 0.5224 0.5077 -0.0205 0.0163  0.0233  257 GLU B CD  
3085 O OE1 . GLU B 46  ? 0.6036 0.5888 0.5743 -0.0198 0.0148  0.0220  257 GLU B OE1 
3086 O OE2 . GLU B 46  ? 0.5759 0.5614 0.5464 -0.0191 0.0168  0.0266  257 GLU B OE2 
3087 N N   . MET B 47  ? 0.3223 0.3210 0.2895 -0.0184 0.0111  0.0213  258 MET B N   
3088 C CA  . MET B 47  ? 0.3129 0.3124 0.2780 -0.0166 0.0099  0.0231  258 MET B CA  
3089 C C   . MET B 47  ? 0.3024 0.3059 0.2664 -0.0166 0.0101  0.0236  258 MET B C   
3090 O O   . MET B 47  ? 0.2897 0.2952 0.2518 -0.0155 0.0090  0.0241  258 MET B O   
3091 C CB  . MET B 47  ? 0.3168 0.3160 0.2805 -0.0156 0.0077  0.0211  258 MET B CB  
3092 C CG  . MET B 47  ? 0.3150 0.3102 0.2790 -0.0160 0.0077  0.0202  258 MET B CG  
3093 S SD  . MET B 47  ? 0.3211 0.3145 0.2818 -0.0152 0.0058  0.0182  258 MET B SD  
3094 C CE  . MET B 47  ? 0.2193 0.2138 0.1801 -0.0142 0.0061  0.0199  258 MET B CE  
3095 N N   . LYS B 48  ? 0.2962 0.3013 0.2615 -0.0183 0.0118  0.0228  259 LYS B N   
3096 C CA  . LYS B 48  ? 0.2960 0.3045 0.2602 -0.0190 0.0128  0.0231  259 LYS B CA  
3097 C C   . LYS B 48  ? 0.2920 0.3051 0.2566 -0.0183 0.0113  0.0202  259 LYS B C   
3098 O O   . LYS B 48  ? 0.2646 0.2808 0.2282 -0.0190 0.0123  0.0200  259 LYS B O   
3099 C CB  . LYS B 48  ? 0.3061 0.3137 0.2669 -0.0183 0.0132  0.0270  259 LYS B CB  
3100 C CG  . LYS B 48  ? 0.3291 0.3317 0.2895 -0.0181 0.0145  0.0304  259 LYS B CG  
3101 C CD  . LYS B 48  ? 0.3515 0.3513 0.3131 -0.0205 0.0177  0.0304  259 LYS B CD  
3102 C CE  . LYS B 48  ? 0.4076 0.4077 0.3659 -0.0220 0.0201  0.0324  259 LYS B CE  
3103 N NZ  . LYS B 48  ? 0.3924 0.3911 0.3522 -0.0254 0.0238  0.0308  259 LYS B NZ  
3104 N N   . TYR B 49  ? 0.2845 0.2974 0.2502 -0.0171 0.0092  0.0179  260 TYR B N   
3105 C CA  . TYR B 49  ? 0.2792 0.2954 0.2456 -0.0159 0.0079  0.0151  260 TYR B CA  
3106 C C   . TYR B 49  ? 0.2855 0.3060 0.2555 -0.0170 0.0089  0.0125  260 TYR B C   
3107 O O   . TYR B 49  ? 0.2854 0.3058 0.2578 -0.0184 0.0096  0.0117  260 TYR B O   
3108 C CB  . TYR B 49  ? 0.2780 0.2916 0.2436 -0.0141 0.0054  0.0138  260 TYR B CB  
3109 C CG  . TYR B 49  ? 0.2939 0.3095 0.2599 -0.0121 0.0039  0.0113  260 TYR B CG  
3110 C CD1 . TYR B 49  ? 0.2992 0.3145 0.2630 -0.0112 0.0038  0.0112  260 TYR B CD1 
3111 C CD2 . TYR B 49  ? 0.3082 0.3261 0.2770 -0.0112 0.0027  0.0088  260 TYR B CD2 
3112 C CE1 . TYR B 49  ? 0.3208 0.3368 0.2849 -0.0092 0.0028  0.0089  260 TYR B CE1 
3113 C CE2 . TYR B 49  ? 0.3091 0.3285 0.2786 -0.0088 0.0012  0.0067  260 TYR B CE2 
3114 C CZ  . TYR B 49  ? 0.3116 0.3295 0.2786 -0.0078 0.0014  0.0069  260 TYR B CZ  
3115 O OH  . TYR B 49  ? 0.3197 0.3382 0.2874 -0.0052 0.0003  0.0047  260 TYR B OH  
3116 N N   . ASN B 50  ? 0.2949 0.3195 0.2659 -0.0166 0.0091  0.0105  261 ASN B N   
3117 C CA  . ASN B 50  ? 0.3055 0.3355 0.2809 -0.0178 0.0104  0.0074  261 ASN B CA  
3118 C C   . ASN B 50  ? 0.3192 0.3520 0.2981 -0.0154 0.0078  0.0041  261 ASN B C   
3119 O O   . ASN B 50  ? 0.3050 0.3404 0.2851 -0.0134 0.0069  0.0020  261 ASN B O   
3120 C CB  . ASN B 50  ? 0.3074 0.3409 0.2823 -0.0188 0.0125  0.0068  261 ASN B CB  
3121 C CG  . ASN B 50  ? 0.3176 0.3564 0.2968 -0.0213 0.0152  0.0038  261 ASN B CG  
3122 O OD1 . ASN B 50  ? 0.2987 0.3405 0.2826 -0.0213 0.0145  0.0009  261 ASN B OD1 
3123 N ND2 . ASN B 50  ? 0.3089 0.3492 0.2862 -0.0236 0.0182  0.0042  261 ASN B ND2 
3124 N N   . THR B 51  ? 0.3446 0.3766 0.3250 -0.0154 0.0064  0.0034  262 THR B N   
3125 C CA  . THR B 51  ? 0.3684 0.4034 0.3518 -0.0130 0.0034  0.0005  262 THR B CA  
3126 C C   . THR B 51  ? 0.3905 0.4336 0.3801 -0.0128 0.0038  -0.0036 262 THR B C   
3127 O O   . THR B 51  ? 0.3929 0.4388 0.3847 -0.0095 0.0009  -0.0059 262 THR B O   
3128 C CB  . THR B 51  ? 0.3671 0.4008 0.3508 -0.0138 0.0022  0.0002  262 THR B CB  
3129 O OG1 . THR B 51  ? 0.3798 0.4152 0.3659 -0.0177 0.0054  -0.0003 262 THR B OG1 
3130 C CG2 . THR B 51  ? 0.3842 0.4101 0.3622 -0.0134 0.0013  0.0034  262 THR B CG2 
3131 N N   . LYS B 52  ? 0.4126 0.4593 0.4047 -0.0163 0.0074  -0.0047 263 LYS B N   
3132 C CA  . LYS B 52  ? 0.4310 0.4861 0.4296 -0.0167 0.0084  -0.0092 263 LYS B CA  
3133 C C   . LYS B 52  ? 0.4207 0.4776 0.4198 -0.0143 0.0083  -0.0103 263 LYS B C   
3134 O O   . LYS B 52  ? 0.4238 0.4860 0.4279 -0.0116 0.0065  -0.0138 263 LYS B O   
3135 C CB  . LYS B 52  ? 0.4417 0.4994 0.4424 -0.0218 0.0131  -0.0103 263 LYS B CB  
3136 C CG  . LYS B 52  ? 0.4976 0.5543 0.4993 -0.0248 0.0142  -0.0105 263 LYS B CG  
3137 C CD  . LYS B 52  ? 0.5370 0.5986 0.5432 -0.0229 0.0104  -0.0140 263 LYS B CD  
3138 C CE  . LYS B 52  ? 0.5598 0.6207 0.5669 -0.0266 0.0119  -0.0148 263 LYS B CE  
3139 N NZ  . LYS B 52  ? 0.5810 0.6327 0.5824 -0.0293 0.0151  -0.0102 263 LYS B NZ  
3140 N N   . LYS B 53  ? 0.4176 0.4702 0.4116 -0.0152 0.0101  -0.0074 264 LYS B N   
3141 C CA  . LYS B 53  ? 0.4129 0.4668 0.4067 -0.0137 0.0106  -0.0086 264 LYS B CA  
3142 C C   . LYS B 53  ? 0.3986 0.4484 0.3901 -0.0092 0.0072  -0.0079 264 LYS B C   
3143 O O   . LYS B 53  ? 0.3864 0.4379 0.3797 -0.0070 0.0072  -0.0100 264 LYS B O   
3144 C CB  . LYS B 53  ? 0.4275 0.4788 0.4161 -0.0168 0.0138  -0.0059 264 LYS B CB  
3145 C CG  . LYS B 53  ? 0.4499 0.5035 0.4381 -0.0166 0.0154  -0.0076 264 LYS B CG  
3146 C CD  . LYS B 53  ? 0.4917 0.5445 0.4749 -0.0205 0.0189  -0.0054 264 LYS B CD  
3147 C CE  . LYS B 53  ? 0.5065 0.5615 0.4884 -0.0207 0.0205  -0.0073 264 LYS B CE  
3148 N NZ  . LYS B 53  ? 0.5219 0.5772 0.4987 -0.0248 0.0240  -0.0057 264 LYS B NZ  
3149 N N   . ALA B 54  ? 0.3844 0.4284 0.3720 -0.0082 0.0049  -0.0049 265 ALA B N   
3150 C CA  . ALA B 54  ? 0.3721 0.4108 0.3564 -0.0044 0.0021  -0.0041 265 ALA B CA  
3151 C C   . ALA B 54  ? 0.3634 0.3990 0.3465 -0.0027 -0.0011 -0.0032 265 ALA B C   
3152 O O   . ALA B 54  ? 0.3547 0.3845 0.3330 -0.0036 -0.0015 -0.0003 265 ALA B O   
3153 C CB  . ALA B 54  ? 0.3715 0.4046 0.3498 -0.0055 0.0034  -0.0013 265 ALA B CB  
3154 N N   . PRO B 55  ? 0.3606 0.4010 0.3485 -0.0003 -0.0035 -0.0059 266 PRO B N   
3155 C CA  . PRO B 55  ? 0.3566 0.3957 0.3435 0.0009  -0.0067 -0.0055 266 PRO B CA  
3156 C C   . PRO B 55  ? 0.3501 0.3801 0.3297 0.0031  -0.0087 -0.0027 266 PRO B C   
3157 O O   . PRO B 55  ? 0.3370 0.3633 0.3143 0.0057  -0.0089 -0.0024 266 PRO B O   
3158 C CB  . PRO B 55  ? 0.3674 0.4137 0.3605 0.0043  -0.0094 -0.0092 266 PRO B CB  
3159 C CG  . PRO B 55  ? 0.3714 0.4245 0.3706 0.0033  -0.0064 -0.0122 266 PRO B CG  
3160 C CD  . PRO B 55  ? 0.3632 0.4108 0.3577 0.0017  -0.0035 -0.0098 266 PRO B CD  
3161 N N   . LEU B 56  ? 0.3454 0.3717 0.3215 0.0017  -0.0096 -0.0009 267 LEU B N   
3162 C CA  . LEU B 56  ? 0.3499 0.3672 0.3186 0.0026  -0.0106 0.0017  267 LEU B CA  
3163 C C   . LEU B 56  ? 0.3558 0.3698 0.3217 0.0074  -0.0139 0.0015  267 LEU B C   
3164 O O   . LEU B 56  ? 0.3684 0.3745 0.3284 0.0086  -0.0137 0.0032  267 LEU B O   
3165 C CB  . LEU B 56  ? 0.3497 0.3646 0.3159 0.0001  -0.0109 0.0028  267 LEU B CB  
3166 C CG  . LEU B 56  ? 0.3324 0.3485 0.3005 -0.0042 -0.0075 0.0037  267 LEU B CG  
3167 C CD1 . LEU B 56  ? 0.3391 0.3536 0.3061 -0.0065 -0.0074 0.0041  267 LEU B CD1 
3168 C CD2 . LEU B 56  ? 0.3240 0.3357 0.2889 -0.0050 -0.0052 0.0059  267 LEU B CD2 
3169 N N   . GLY B 57  ? 0.3633 0.3832 0.3335 0.0101  -0.0167 -0.0007 268 GLY B N   
3170 C CA  . GLY B 57  ? 0.3876 0.4048 0.3556 0.0155  -0.0202 -0.0008 268 GLY B CA  
3171 C C   . GLY B 57  ? 0.3947 0.4096 0.3634 0.0184  -0.0191 -0.0013 268 GLY B C   
3172 O O   . GLY B 57  ? 0.3990 0.4092 0.3647 0.0231  -0.0215 -0.0007 268 GLY B O   
3173 N N   . LYS B 58  ? 0.3939 0.4121 0.3664 0.0158  -0.0154 -0.0023 269 LYS B N   
3174 C CA  . LYS B 58  ? 0.3978 0.4144 0.3713 0.0179  -0.0136 -0.0034 269 LYS B CA  
3175 C C   . LYS B 58  ? 0.3902 0.3995 0.3578 0.0150  -0.0103 -0.0015 269 LYS B C   
3176 O O   . LYS B 58  ? 0.3959 0.4025 0.3630 0.0161  -0.0084 -0.0023 269 LYS B O   
3177 C CB  . LYS B 58  ? 0.3998 0.4265 0.3820 0.0172  -0.0119 -0.0069 269 LYS B CB  
3178 C CG  . LYS B 58  ? 0.4305 0.4653 0.4198 0.0209  -0.0151 -0.0098 269 LYS B CG  
3179 C CD  . LYS B 58  ? 0.4945 0.5398 0.4929 0.0192  -0.0125 -0.0139 269 LYS B CD  
3180 C CE  . LYS B 58  ? 0.5223 0.5776 0.5294 0.0226  -0.0156 -0.0177 269 LYS B CE  
3181 N NZ  . LYS B 58  ? 0.5409 0.6045 0.5523 0.0185  -0.0154 -0.0195 269 LYS B NZ  
3182 N N   . LEU B 59  ? 0.3794 0.3856 0.3429 0.0116  -0.0096 0.0008  270 LEU B N   
3183 C CA  . LEU B 59  ? 0.3757 0.3764 0.3345 0.0089  -0.0068 0.0022  270 LEU B CA  
3184 C C   . LEU B 59  ? 0.3678 0.3586 0.3200 0.0113  -0.0072 0.0031  270 LEU B C   
3185 O O   . LEU B 59  ? 0.3648 0.3509 0.3134 0.0138  -0.0098 0.0043  270 LEU B O   
3186 C CB  . LEU B 59  ? 0.3743 0.3747 0.3312 0.0049  -0.0060 0.0041  270 LEU B CB  
3187 C CG  . LEU B 59  ? 0.3887 0.3885 0.3442 0.0016  -0.0029 0.0048  270 LEU B CG  
3188 C CD1 . LEU B 59  ? 0.4101 0.4160 0.3697 0.0010  -0.0009 0.0030  270 LEU B CD1 
3189 C CD2 . LEU B 59  ? 0.3847 0.3854 0.3400 -0.0015 -0.0023 0.0066  270 LEU B CD2 
3190 N N   . THR B 60  ? 0.3560 0.3433 0.3064 0.0107  -0.0045 0.0024  271 THR B N   
3191 C CA  . THR B 60  ? 0.3568 0.3337 0.3007 0.0125  -0.0039 0.0030  271 THR B CA  
3192 C C   . THR B 60  ? 0.3439 0.3160 0.2828 0.0084  -0.0011 0.0037  271 THR B C   
3193 O O   . THR B 60  ? 0.3236 0.3012 0.2649 0.0048  0.0006  0.0034  271 THR B O   
3194 C CB  . THR B 60  ? 0.3646 0.3402 0.3103 0.0153  -0.0025 0.0007  271 THR B CB  
3195 O OG1 . THR B 60  ? 0.3501 0.3293 0.2976 0.0117  0.0011  -0.0010 271 THR B OG1 
3196 C CG2 . THR B 60  ? 0.3661 0.3484 0.3186 0.0194  -0.0049 -0.0009 271 THR B CG2 
3197 N N   . VAL B 61  ? 0.3478 0.3097 0.2797 0.0090  -0.0006 0.0046  272 VAL B N   
3198 C CA  . VAL B 61  ? 0.3490 0.3062 0.2764 0.0050  0.0024  0.0045  272 VAL B CA  
3199 C C   . VAL B 61  ? 0.3421 0.3029 0.2721 0.0028  0.0055  0.0021  272 VAL B C   
3200 O O   . VAL B 61  ? 0.3326 0.2973 0.2634 -0.0010 0.0072  0.0017  272 VAL B O   
3201 C CB  . VAL B 61  ? 0.3693 0.3137 0.2881 0.0060  0.0031  0.0054  272 VAL B CB  
3202 C CG1 . VAL B 61  ? 0.3627 0.3023 0.2775 0.0016  0.0073  0.0041  272 VAL B CG1 
3203 C CG2 . VAL B 61  ? 0.3682 0.3096 0.2833 0.0069  0.0002  0.0078  272 VAL B CG2 
3204 N N   . ALA B 62  ? 0.3430 0.3032 0.2747 0.0054  0.0063  0.0004  273 ALA B N   
3205 C CA  . ALA B 62  ? 0.3325 0.2961 0.2664 0.0032  0.0095  -0.0024 273 ALA B CA  
3206 C C   . ALA B 62  ? 0.3175 0.2928 0.2569 0.0005  0.0094  -0.0028 273 ALA B C   
3207 O O   . ALA B 62  ? 0.2980 0.2770 0.2374 -0.0031 0.0115  -0.0041 273 ALA B O   
3208 C CB  . ALA B 62  ? 0.3565 0.3180 0.2923 0.0069  0.0102  -0.0043 273 ALA B CB  
3209 N N   . GLN B 63  ? 0.3164 0.2978 0.2603 0.0022  0.0069  -0.0018 274 GLN B N   
3210 C CA  . GLN B 63  ? 0.3131 0.3041 0.2611 -0.0004 0.0070  -0.0016 274 GLN B CA  
3211 C C   . GLN B 63  ? 0.2993 0.2913 0.2454 -0.0036 0.0069  0.0004  274 GLN B C   
3212 O O   . GLN B 63  ? 0.2977 0.2955 0.2450 -0.0062 0.0079  0.0003  274 GLN B O   
3213 C CB  . GLN B 63  ? 0.3144 0.3106 0.2673 0.0017  0.0047  -0.0012 274 GLN B CB  
3214 C CG  . GLN B 63  ? 0.3608 0.3590 0.3176 0.0045  0.0053  -0.0040 274 GLN B CG  
3215 C CD  . GLN B 63  ? 0.3932 0.3955 0.3548 0.0075  0.0026  -0.0041 274 GLN B CD  
3216 O OE1 . GLN B 63  ? 0.3841 0.3878 0.3459 0.0072  0.0004  -0.0022 274 GLN B OE1 
3217 N NE2 . GLN B 63  ? 0.3923 0.3974 0.3585 0.0104  0.0028  -0.0068 274 GLN B NE2 
3218 N N   . ILE B 64  ? 0.2980 0.2845 0.2411 -0.0031 0.0055  0.0022  275 ILE B N   
3219 C CA  . ILE B 64  ? 0.2896 0.2768 0.2316 -0.0058 0.0056  0.0037  275 ILE B CA  
3220 C C   . ILE B 64  ? 0.2831 0.2695 0.2227 -0.0084 0.0081  0.0021  275 ILE B C   
3221 O O   . ILE B 64  ? 0.2493 0.2409 0.1901 -0.0108 0.0085  0.0024  275 ILE B O   
3222 C CB  . ILE B 64  ? 0.2899 0.2709 0.2288 -0.0051 0.0041  0.0053  275 ILE B CB  
3223 C CG1 . ILE B 64  ? 0.3127 0.2968 0.2547 -0.0032 0.0016  0.0065  275 ILE B CG1 
3224 C CG2 . ILE B 64  ? 0.2701 0.2513 0.2081 -0.0079 0.0049  0.0062  275 ILE B CG2 
3225 C CD1 . ILE B 64  ? 0.3351 0.3136 0.2738 -0.0021 -0.0002 0.0077  275 ILE B CD1 
3226 N N   . LYS B 65  ? 0.2844 0.2643 0.2207 -0.0079 0.0097  0.0003  276 LYS B N   
3227 C CA  . LYS B 65  ? 0.2975 0.2763 0.2315 -0.0108 0.0125  -0.0021 276 LYS B CA  
3228 C C   . LYS B 65  ? 0.2855 0.2731 0.2226 -0.0126 0.0135  -0.0037 276 LYS B C   
3229 O O   . LYS B 65  ? 0.2869 0.2791 0.2242 -0.0154 0.0142  -0.0045 276 LYS B O   
3230 C CB  . LYS B 65  ? 0.3134 0.2824 0.2429 -0.0099 0.0146  -0.0038 276 LYS B CB  
3231 C CG  . LYS B 65  ? 0.3443 0.3123 0.2721 -0.0130 0.0183  -0.0074 276 LYS B CG  
3232 C CD  . LYS B 65  ? 0.3528 0.3081 0.2747 -0.0124 0.0206  -0.0083 276 LYS B CD  
3233 C CE  . LYS B 65  ? 0.3757 0.3282 0.2965 -0.0135 0.0244  -0.0120 276 LYS B CE  
3234 N NZ  . LYS B 65  ? 0.3577 0.2963 0.2729 -0.0110 0.0261  -0.0118 276 LYS B NZ  
3235 N N   . ALA B 66  ? 0.2765 0.2671 0.2161 -0.0109 0.0133  -0.0043 277 ALA B N   
3236 C CA  . ALA B 66  ? 0.2760 0.2749 0.2180 -0.0127 0.0143  -0.0058 277 ALA B CA  
3237 C C   . ALA B 66  ? 0.2674 0.2733 0.2109 -0.0140 0.0126  -0.0032 277 ALA B C   
3238 O O   . ALA B 66  ? 0.2913 0.3032 0.2347 -0.0163 0.0132  -0.0038 277 ALA B O   
3239 C CB  . ALA B 66  ? 0.2761 0.2771 0.2212 -0.0105 0.0145  -0.0069 277 ALA B CB  
3240 N N   . GLY B 67  ? 0.2645 0.2693 0.2093 -0.0125 0.0105  -0.0003 278 GLY B N   
3241 C CA  . GLY B 67  ? 0.2508 0.2600 0.1966 -0.0135 0.0092  0.0024  278 GLY B CA  
3242 C C   . GLY B 67  ? 0.2401 0.2502 0.1844 -0.0155 0.0094  0.0022  278 GLY B C   
3243 O O   . GLY B 67  ? 0.2310 0.2474 0.1760 -0.0167 0.0090  0.0031  278 GLY B O   
3244 N N   . TYR B 68  ? 0.2405 0.2445 0.1828 -0.0157 0.0101  0.0011  279 TYR B N   
3245 C CA  . TYR B 68  ? 0.2446 0.2498 0.1861 -0.0179 0.0108  -0.0001 279 TYR B CA  
3246 C C   . TYR B 68  ? 0.2456 0.2570 0.1869 -0.0202 0.0121  -0.0028 279 TYR B C   
3247 O O   . TYR B 68  ? 0.2333 0.2512 0.1758 -0.0215 0.0114  -0.0028 279 TYR B O   
3248 C CB  . TYR B 68  ? 0.2567 0.2532 0.1952 -0.0185 0.0123  -0.0016 279 TYR B CB  
3249 C CG  . TYR B 68  ? 0.2836 0.2750 0.2217 -0.0172 0.0111  0.0007  279 TYR B CG  
3250 C CD1 . TYR B 68  ? 0.2971 0.2918 0.2376 -0.0177 0.0100  0.0024  279 TYR B CD1 
3251 C CD2 . TYR B 68  ? 0.2809 0.2638 0.2158 -0.0156 0.0111  0.0011  279 TYR B CD2 
3252 C CE1 . TYR B 68  ? 0.3083 0.2984 0.2483 -0.0171 0.0093  0.0039  279 TYR B CE1 
3253 C CE2 . TYR B 68  ? 0.2907 0.2691 0.2244 -0.0150 0.0100  0.0029  279 TYR B CE2 
3254 C CZ  . TYR B 68  ? 0.3027 0.2848 0.2391 -0.0159 0.0094  0.0041  279 TYR B CZ  
3255 O OH  . TYR B 68  ? 0.2819 0.2600 0.2174 -0.0157 0.0086  0.0055  279 TYR B OH  
3256 N N   . GLN B 69  ? 0.2492 0.2589 0.1892 -0.0203 0.0138  -0.0052 280 GLN B N   
3257 C CA  . GLN B 69  ? 0.2622 0.2775 0.2017 -0.0228 0.0155  -0.0084 280 GLN B CA  
3258 C C   . GLN B 69  ? 0.2490 0.2738 0.1898 -0.0232 0.0138  -0.0067 280 GLN B C   
3259 O O   . GLN B 69  ? 0.2507 0.2821 0.1911 -0.0252 0.0136  -0.0080 280 GLN B O   
3260 C CB  . GLN B 69  ? 0.2685 0.2790 0.2066 -0.0227 0.0180  -0.0113 280 GLN B CB  
3261 C CG  . GLN B 69  ? 0.2999 0.3009 0.2353 -0.0232 0.0203  -0.0134 280 GLN B CG  
3262 C CD  . GLN B 69  ? 0.3479 0.3413 0.2816 -0.0219 0.0226  -0.0154 280 GLN B CD  
3263 O OE1 . GLN B 69  ? 0.3696 0.3645 0.3051 -0.0200 0.0223  -0.0152 280 GLN B OE1 
3264 N NE2 . GLN B 69  ? 0.3840 0.3685 0.3142 -0.0230 0.0253  -0.0175 280 GLN B NE2 
3265 N N   . SER B 70  ? 0.2387 0.2641 0.1808 -0.0212 0.0125  -0.0037 281 SER B N   
3266 C CA  . SER B 70  ? 0.2372 0.2702 0.1792 -0.0217 0.0112  -0.0016 281 SER B CA  
3267 C C   . SER B 70  ? 0.2374 0.2737 0.1800 -0.0215 0.0090  0.0011  281 SER B C   
3268 O O   . SER B 70  ? 0.2332 0.2765 0.1748 -0.0225 0.0080  0.0016  281 SER B O   
3269 C CB  . SER B 70  ? 0.2380 0.2704 0.1814 -0.0202 0.0110  0.0006  281 SER B CB  
3270 O OG  . SER B 70  ? 0.2409 0.2717 0.1846 -0.0202 0.0130  -0.0025 281 SER B OG  
3271 N N   . LEU B 71  ? 0.2337 0.2651 0.1778 -0.0201 0.0082  0.0027  282 LEU B N   
3272 C CA  . LEU B 71  ? 0.2322 0.2662 0.1777 -0.0196 0.0064  0.0049  282 LEU B CA  
3273 C C   . LEU B 71  ? 0.2523 0.2915 0.1977 -0.0215 0.0065  0.0018  282 LEU B C   
3274 O O   . LEU B 71  ? 0.2422 0.2876 0.1888 -0.0211 0.0046  0.0032  282 LEU B O   
3275 C CB  . LEU B 71  ? 0.2252 0.2526 0.1723 -0.0183 0.0062  0.0062  282 LEU B CB  
3276 C CG  . LEU B 71  ? 0.2404 0.2646 0.1887 -0.0164 0.0054  0.0096  282 LEU B CG  
3277 C CD1 . LEU B 71  ? 0.2583 0.2766 0.2077 -0.0158 0.0053  0.0100  282 LEU B CD1 
3278 C CD2 . LEU B 71  ? 0.2174 0.2463 0.1663 -0.0156 0.0040  0.0133  282 LEU B CD2 
3279 N N   . LYS B 72  ? 0.2734 0.3099 0.2176 -0.0234 0.0088  -0.0024 283 LYS B N   
3280 C CA  . LYS B 72  ? 0.3006 0.3425 0.2450 -0.0260 0.0095  -0.0063 283 LYS B CA  
3281 C C   . LYS B 72  ? 0.2912 0.3429 0.2345 -0.0271 0.0084  -0.0068 283 LYS B C   
3282 O O   . LYS B 72  ? 0.2932 0.3529 0.2375 -0.0279 0.0069  -0.0078 283 LYS B O   
3283 C CB  . LYS B 72  ? 0.3065 0.3419 0.2490 -0.0282 0.0130  -0.0109 283 LYS B CB  
3284 C CG  . LYS B 72  ? 0.3694 0.4105 0.3119 -0.0318 0.0146  -0.0159 283 LYS B CG  
3285 C CD  . LYS B 72  ? 0.4183 0.4620 0.3636 -0.0325 0.0140  -0.0169 283 LYS B CD  
3286 C CE  . LYS B 72  ? 0.4403 0.4946 0.3870 -0.0356 0.0142  -0.0216 283 LYS B CE  
3287 N NZ  . LYS B 72  ? 0.4517 0.5069 0.3959 -0.0393 0.0173  -0.0267 283 LYS B NZ  
3288 N N   . LYS B 73  ? 0.3024 0.3538 0.2435 -0.0271 0.0091  -0.0063 284 LYS B N   
3289 C CA  . LYS B 73  ? 0.3122 0.3721 0.2512 -0.0284 0.0083  -0.0065 284 LYS B CA  
3290 C C   . LYS B 73  ? 0.3094 0.3743 0.2484 -0.0262 0.0048  -0.0015 284 LYS B C   
3291 O O   . LYS B 73  ? 0.3140 0.3875 0.2514 -0.0268 0.0030  -0.0014 284 LYS B O   
3292 C CB  . LYS B 73  ? 0.3272 0.3849 0.2642 -0.0290 0.0104  -0.0073 284 LYS B CB  
3293 C CG  . LYS B 73  ? 0.3884 0.4416 0.3251 -0.0310 0.0139  -0.0125 284 LYS B CG  
3294 C CD  . LYS B 73  ? 0.4627 0.5096 0.3997 -0.0295 0.0156  -0.0121 284 LYS B CD  
3295 C CE  . LYS B 73  ? 0.5125 0.5581 0.4485 -0.0315 0.0192  -0.0171 284 LYS B CE  
3296 N NZ  . LYS B 73  ? 0.5462 0.5948 0.4819 -0.0314 0.0198  -0.0165 284 LYS B NZ  
3297 N N   . ILE B 74  ? 0.2870 0.3464 0.2275 -0.0235 0.0039  0.0028  285 ILE B N   
3298 C CA  . ILE B 74  ? 0.2864 0.3486 0.2271 -0.0211 0.0011  0.0077  285 ILE B CA  
3299 C C   . ILE B 74  ? 0.2866 0.3538 0.2301 -0.0205 -0.0009 0.0068  285 ILE B C   
3300 O O   . ILE B 74  ? 0.2929 0.3676 0.2357 -0.0195 -0.0036 0.0087  285 ILE B O   
3301 C CB  . ILE B 74  ? 0.2830 0.3378 0.2252 -0.0189 0.0012  0.0116  285 ILE B CB  
3302 C CG1 . ILE B 74  ? 0.2804 0.3324 0.2204 -0.0195 0.0030  0.0122  285 ILE B CG1 
3303 C CG2 . ILE B 74  ? 0.2506 0.3068 0.1934 -0.0163 -0.0012 0.0164  285 ILE B CG2 
3304 C CD1 . ILE B 74  ? 0.2878 0.3326 0.2298 -0.0179 0.0035  0.0150  285 ILE B CD1 
3305 N N   . GLU B 75  ? 0.2869 0.3503 0.2334 -0.0212 0.0005  0.0038  286 GLU B N   
3306 C CA  . GLU B 75  ? 0.2861 0.3547 0.2360 -0.0212 -0.0007 0.0018  286 GLU B CA  
3307 C C   . GLU B 75  ? 0.2950 0.3746 0.2441 -0.0231 -0.0019 -0.0013 286 GLU B C   
3308 O O   . GLU B 75  ? 0.2821 0.3695 0.2334 -0.0215 -0.0049 -0.0005 286 GLU B O   
3309 C CB  . GLU B 75  ? 0.2838 0.3465 0.2359 -0.0228 0.0019  -0.0019 286 GLU B CB  
3310 C CG  . GLU B 75  ? 0.2935 0.3624 0.2499 -0.0233 0.0011  -0.0047 286 GLU B CG  
3311 C CD  . GLU B 75  ? 0.3240 0.3865 0.2818 -0.0256 0.0043  -0.0087 286 GLU B CD  
3312 O OE1 . GLU B 75  ? 0.3301 0.3888 0.2852 -0.0286 0.0073  -0.0125 286 GLU B OE1 
3313 O OE2 . GLU B 75  ? 0.3487 0.4094 0.3099 -0.0244 0.0040  -0.0079 286 GLU B OE2 
3314 N N   . ASP B 76  ? 0.3111 0.3914 0.2571 -0.0262 0.0003  -0.0051 287 ASP B N   
3315 C CA  . ASP B 76  ? 0.3308 0.4219 0.2755 -0.0287 -0.0005 -0.0089 287 ASP B CA  
3316 C C   . ASP B 76  ? 0.3403 0.4392 0.2822 -0.0267 -0.0043 -0.0047 287 ASP B C   
3317 O O   . ASP B 76  ? 0.3505 0.4599 0.2928 -0.0269 -0.0069 -0.0061 287 ASP B O   
3318 C CB  . ASP B 76  ? 0.3360 0.4256 0.2776 -0.0325 0.0031  -0.0135 287 ASP B CB  
3319 C CG  . ASP B 76  ? 0.3363 0.4178 0.2794 -0.0347 0.0071  -0.0179 287 ASP B CG  
3320 O OD1 . ASP B 76  ? 0.3611 0.4426 0.3074 -0.0352 0.0073  -0.0199 287 ASP B OD1 
3321 O OD2 . ASP B 76  ? 0.3585 0.4332 0.2991 -0.0359 0.0101  -0.0193 287 ASP B OD2 
3322 N N   . CYS B 77  ? 0.3536 0.4475 0.2922 -0.0250 -0.0044 0.0002  288 CYS B N   
3323 C CA  . CYS B 77  ? 0.3653 0.4646 0.2999 -0.0231 -0.0076 0.0049  288 CYS B CA  
3324 C C   . CYS B 77  ? 0.3756 0.4780 0.3133 -0.0191 -0.0114 0.0087  288 CYS B C   
3325 O O   . CYS B 77  ? 0.3891 0.5005 0.3251 -0.0178 -0.0149 0.0101  288 CYS B O   
3326 C CB  . CYS B 77  ? 0.3606 0.4526 0.2914 -0.0225 -0.0062 0.0091  288 CYS B CB  
3327 S SG  . CYS B 77  ? 0.3947 0.4846 0.3222 -0.0267 -0.0019 0.0046  288 CYS B SG  
3328 N N   . ILE B 78  ? 0.3785 0.4737 0.3208 -0.0170 -0.0107 0.0104  289 ILE B N   
3329 C CA  . ILE B 78  ? 0.3903 0.4876 0.3364 -0.0130 -0.0138 0.0137  289 ILE B CA  
3330 C C   . ILE B 78  ? 0.4157 0.5235 0.3661 -0.0134 -0.0158 0.0093  289 ILE B C   
3331 O O   . ILE B 78  ? 0.4307 0.5460 0.3824 -0.0102 -0.0198 0.0116  289 ILE B O   
3332 C CB  . ILE B 78  ? 0.3780 0.4655 0.3284 -0.0114 -0.0121 0.0153  289 ILE B CB  
3333 C CG1 . ILE B 78  ? 0.3708 0.4487 0.3175 -0.0110 -0.0103 0.0195  289 ILE B CG1 
3334 C CG2 . ILE B 78  ? 0.3854 0.4756 0.3405 -0.0073 -0.0150 0.0181  289 ILE B CG2 
3335 C CD1 . ILE B 78  ? 0.3571 0.4253 0.3072 -0.0110 -0.0078 0.0193  289 ILE B CD1 
3336 N N   . ARG B 79  ? 0.4374 0.5460 0.3901 -0.0173 -0.0130 0.0028  290 ARG B N   
3337 C CA  . ARG B 79  ? 0.4587 0.5781 0.4154 -0.0187 -0.0142 -0.0026 290 ARG B CA  
3338 C C   . ARG B 79  ? 0.4630 0.5946 0.4163 -0.0189 -0.0177 -0.0030 290 ARG B C   
3339 O O   . ARG B 79  ? 0.4585 0.6006 0.4153 -0.0167 -0.0214 -0.0034 290 ARG B O   
3340 C CB  . ARG B 79  ? 0.4681 0.5855 0.4257 -0.0239 -0.0099 -0.0098 290 ARG B CB  
3341 C CG  . ARG B 79  ? 0.4987 0.6120 0.4618 -0.0242 -0.0079 -0.0124 290 ARG B CG  
3342 C CD  . ARG B 79  ? 0.5653 0.6817 0.5301 -0.0293 -0.0046 -0.0204 290 ARG B CD  
3343 N NE  . ARG B 79  ? 0.6242 0.7414 0.5956 -0.0290 -0.0041 -0.0228 290 ARG B NE  
3344 C CZ  . ARG B 79  ? 0.6574 0.7638 0.6301 -0.0281 -0.0020 -0.0210 290 ARG B CZ  
3345 N NH1 . ARG B 79  ? 0.6725 0.7804 0.6512 -0.0282 -0.0012 -0.0236 290 ARG B NH1 
3346 N NH2 . ARG B 79  ? 0.6812 0.7758 0.6494 -0.0272 -0.0005 -0.0170 290 ARG B NH2 
3347 N N   . ALA B 80  ? 0.4736 0.6043 0.4204 -0.0215 -0.0162 -0.0033 291 ALA B N   
3348 C CA  . ALA B 80  ? 0.4880 0.6302 0.4304 -0.0227 -0.0189 -0.0043 291 ALA B CA  
3349 C C   . ALA B 80  ? 0.5055 0.6506 0.4439 -0.0178 -0.0238 0.0032  291 ALA B C   
3350 O O   . ALA B 80  ? 0.5218 0.6774 0.4565 -0.0178 -0.0272 0.0032  291 ALA B O   
3351 C CB  . ALA B 80  ? 0.4781 0.6179 0.4147 -0.0275 -0.0153 -0.0075 291 ALA B CB  
3352 N N   . GLY B 81  ? 0.5277 0.6633 0.4665 -0.0139 -0.0240 0.0095  292 GLY B N   
3353 C CA  . GLY B 81  ? 0.5509 0.6866 0.4857 -0.0091 -0.0279 0.0172  292 GLY B CA  
3354 C C   . GLY B 81  ? 0.5751 0.7063 0.5002 -0.0102 -0.0269 0.0212  292 GLY B C   
3355 O O   . GLY B 81  ? 0.5919 0.7248 0.5116 -0.0071 -0.0302 0.0271  292 GLY B O   
3356 N N   . GLN B 82  ? 0.5902 0.7155 0.5132 -0.0146 -0.0223 0.0183  293 GLN B N   
3357 C CA  . GLN B 82  ? 0.6171 0.7395 0.5315 -0.0167 -0.0207 0.0206  293 GLN B CA  
3358 C C   . GLN B 82  ? 0.6265 0.7366 0.5393 -0.0150 -0.0184 0.0261  293 GLN B C   
3359 O O   . GLN B 82  ? 0.6309 0.7342 0.5495 -0.0130 -0.0176 0.0272  293 GLN B O   
3360 C CB  . GLN B 82  ? 0.6180 0.7415 0.5315 -0.0222 -0.0167 0.0138  293 GLN B CB  
3361 C CG  . GLN B 82  ? 0.6360 0.7717 0.5499 -0.0251 -0.0181 0.0076  293 GLN B CG  
3362 C CD  . GLN B 82  ? 0.6592 0.8042 0.5648 -0.0260 -0.0210 0.0089  293 GLN B CD  
3363 O OE1 . GLN B 82  ? 0.6684 0.8129 0.5686 -0.0227 -0.0239 0.0156  293 GLN B OE1 
3364 N NE2 . GLN B 82  ? 0.6663 0.8198 0.5705 -0.0306 -0.0199 0.0022  293 GLN B NE2 
3365 N N   . HIS B 83  ? 0.6464 0.7540 0.5512 -0.0163 -0.0173 0.0293  294 HIS B N   
3366 C CA  . HIS B 83  ? 0.6515 0.7477 0.5543 -0.0157 -0.0145 0.0339  294 HIS B CA  
3367 C C   . HIS B 83  ? 0.6476 0.7408 0.5446 -0.0197 -0.0106 0.0330  294 HIS B C   
3368 O O   . HIS B 83  ? 0.6304 0.7151 0.5289 -0.0204 -0.0071 0.0337  294 HIS B O   
3369 C CB  . HIS B 83  ? 0.6662 0.7594 0.5654 -0.0113 -0.0173 0.0416  294 HIS B CB  
3370 C CG  . HIS B 83  ? 0.7005 0.7903 0.6072 -0.0070 -0.0189 0.0436  294 HIS B CG  
3371 N ND1 . HIS B 83  ? 0.7409 0.8364 0.6553 -0.0062 -0.0206 0.0393  294 HIS B ND1 
3372 C CD2 . HIS B 83  ? 0.7476 0.8288 0.6553 -0.0037 -0.0186 0.0489  294 HIS B CD2 
3373 C CE1 . HIS B 83  ? 0.7602 0.8510 0.6801 -0.0025 -0.0214 0.0419  294 HIS B CE1 
3374 N NE2 . HIS B 83  ? 0.7706 0.8527 0.6866 -0.0008 -0.0202 0.0478  294 HIS B NE2 
3375 N N   . GLY B 84  ? 0.6406 0.7411 0.5310 -0.0225 -0.0110 0.0311  295 GLY B N   
3376 C CA  . GLY B 84  ? 0.6367 0.7351 0.5214 -0.0267 -0.0070 0.0297  295 GLY B CA  
3377 C C   . GLY B 84  ? 0.6256 0.7222 0.5159 -0.0300 -0.0027 0.0230  295 GLY B C   
3378 O O   . GLY B 84  ? 0.5943 0.6851 0.4920 -0.0286 -0.0014 0.0219  295 GLY B O   
3379 N N   . ARG B 85  ? 0.6284 0.7298 0.5150 -0.0342 -0.0005 0.0183  296 ARG B N   
3380 C CA  . ARG B 85  ? 0.6248 0.7234 0.5160 -0.0371 0.0041  0.0123  296 ARG B CA  
3381 C C   . ARG B 85  ? 0.6082 0.7036 0.5086 -0.0353 0.0041  0.0094  296 ARG B C   
3382 O O   . ARG B 85  ? 0.5960 0.6853 0.5011 -0.0355 0.0072  0.0071  296 ARG B O   
3383 C CB  . ARG B 85  ? 0.6334 0.7389 0.5207 -0.0417 0.0062  0.0064  296 ARG B CB  
3384 C CG  . ARG B 85  ? 0.6546 0.7560 0.5448 -0.0445 0.0116  0.0016  296 ARG B CG  
3385 C CD  . ARG B 85  ? 0.6849 0.7923 0.5722 -0.0493 0.0145  -0.0050 296 ARG B CD  
3386 N NE  . ARG B 85  ? 0.7171 0.8199 0.6082 -0.0511 0.0197  -0.0092 296 ARG B NE  
3387 C CZ  . ARG B 85  ? 0.7404 0.8463 0.6302 -0.0552 0.0236  -0.0153 296 ARG B CZ  
3388 N NH1 . ARG B 85  ? 0.7605 0.8743 0.6446 -0.0586 0.0231  -0.0181 296 ARG B NH1 
3389 N NH2 . ARG B 85  ? 0.7367 0.8381 0.6312 -0.0558 0.0279  -0.0188 296 ARG B NH2 
3390 N N   . ALA B 86  ? 0.5916 0.6911 0.4942 -0.0334 0.0006  0.0095  297 ALA B N   
3391 C CA  . ALA B 86  ? 0.5759 0.6732 0.4862 -0.0324 0.0008  0.0062  297 ALA B CA  
3392 C C   . ALA B 86  ? 0.5544 0.6424 0.4693 -0.0292 0.0011  0.0097  297 ALA B C   
3393 O O   . ALA B 86  ? 0.5378 0.6198 0.4562 -0.0297 0.0040  0.0073  297 ALA B O   
3394 C CB  . ALA B 86  ? 0.5749 0.6800 0.4864 -0.0315 -0.0029 0.0052  297 ALA B CB  
3395 N N   . LEU B 87  ? 0.5511 0.6383 0.4658 -0.0259 -0.0019 0.0153  298 LEU B N   
3396 C CA  . LEU B 87  ? 0.5465 0.6257 0.4652 -0.0230 -0.0018 0.0188  298 LEU B CA  
3397 C C   . LEU B 87  ? 0.5473 0.6197 0.4649 -0.0238 0.0012  0.0203  298 LEU B C   
3398 O O   . LEU B 87  ? 0.5208 0.5868 0.4433 -0.0228 0.0026  0.0200  298 LEU B O   
3399 C CB  . LEU B 87  ? 0.5439 0.6241 0.4620 -0.0194 -0.0055 0.0244  298 LEU B CB  
3400 C CG  . LEU B 87  ? 0.5480 0.6214 0.4715 -0.0163 -0.0059 0.0270  298 LEU B CG  
3401 C CD1 . LEU B 87  ? 0.5304 0.6033 0.4603 -0.0166 -0.0054 0.0224  298 LEU B CD1 
3402 C CD2 . LEU B 87  ? 0.5534 0.6279 0.4762 -0.0126 -0.0092 0.0323  298 LEU B CD2 
3403 N N   . MET B 88  ? 0.5443 0.6187 0.4558 -0.0257 0.0023  0.0215  299 MET B N   
3404 C CA  . MET B 88  ? 0.5406 0.6102 0.4510 -0.0272 0.0057  0.0220  299 MET B CA  
3405 C C   . MET B 88  ? 0.5244 0.5924 0.4397 -0.0288 0.0086  0.0164  299 MET B C   
3406 O O   . MET B 88  ? 0.5178 0.5802 0.4376 -0.0277 0.0099  0.0164  299 MET B O   
3407 C CB  . MET B 88  ? 0.5634 0.6363 0.4656 -0.0299 0.0069  0.0232  299 MET B CB  
3408 C CG  . MET B 88  ? 0.5929 0.6627 0.4946 -0.0327 0.0115  0.0214  299 MET B CG  
3409 S SD  . MET B 88  ? 0.6675 0.7424 0.5600 -0.0374 0.0140  0.0199  299 MET B SD  
3410 C CE  . MET B 88  ? 0.6445 0.7233 0.5418 -0.0402 0.0170  0.0112  299 MET B CE  
3411 N N   . GLU B 89  ? 0.5097 0.5825 0.4241 -0.0311 0.0096  0.0115  300 GLU B N   
3412 C CA  . GLU B 89  ? 0.5085 0.5792 0.4275 -0.0322 0.0125  0.0060  300 GLU B CA  
3413 C C   . GLU B 89  ? 0.4768 0.5424 0.4018 -0.0296 0.0115  0.0054  300 GLU B C   
3414 O O   . GLU B 89  ? 0.4698 0.5311 0.3989 -0.0291 0.0134  0.0029  300 GLU B O   
3415 C CB  . GLU B 89  ? 0.5185 0.5946 0.4354 -0.0354 0.0142  0.0005  300 GLU B CB  
3416 C CG  . GLU B 89  ? 0.5758 0.6557 0.4873 -0.0387 0.0166  -0.0004 300 GLU B CG  
3417 C CD  . GLU B 89  ? 0.6333 0.7175 0.5438 -0.0422 0.0194  -0.0069 300 GLU B CD  
3418 O OE1 . GLU B 89  ? 0.6810 0.7651 0.5948 -0.0422 0.0197  -0.0109 300 GLU B OE1 
3419 O OE2 . GLU B 89  ? 0.6737 0.7611 0.5799 -0.0452 0.0218  -0.0083 300 GLU B OE2 
3420 N N   . ALA B 90  ? 0.4450 0.5111 0.3706 -0.0279 0.0086  0.0077  301 ALA B N   
3421 C CA  . ALA B 90  ? 0.4216 0.4829 0.3522 -0.0260 0.0081  0.0067  301 ALA B CA  
3422 C C   . ALA B 90  ? 0.3939 0.4489 0.3272 -0.0236 0.0078  0.0103  301 ALA B C   
3423 O O   . ALA B 90  ? 0.3671 0.4170 0.3039 -0.0228 0.0088  0.0087  301 ALA B O   
3424 C CB  . ALA B 90  ? 0.4120 0.4769 0.3429 -0.0254 0.0055  0.0069  301 ALA B CB  
3425 N N   . CYS B 91  ? 0.3825 0.4378 0.3139 -0.0226 0.0065  0.0151  302 CYS B N   
3426 C CA  . CYS B 91  ? 0.3743 0.4240 0.3081 -0.0210 0.0066  0.0182  302 CYS B CA  
3427 C C   . CYS B 91  ? 0.3679 0.4153 0.3029 -0.0221 0.0093  0.0165  302 CYS B C   
3428 O O   . CYS B 91  ? 0.3554 0.3985 0.2944 -0.0210 0.0097  0.0158  302 CYS B O   
3429 C CB  . CYS B 91  ? 0.3835 0.4333 0.3144 -0.0197 0.0051  0.0236  302 CYS B CB  
3430 S SG  . CYS B 91  ? 0.3747 0.4264 0.3073 -0.0172 0.0016  0.0253  302 CYS B SG  
3431 N N   . ASN B 92  ? 0.3618 0.4128 0.2936 -0.0243 0.0111  0.0152  303 ASN B N   
3432 C CA  . ASN B 92  ? 0.3647 0.4149 0.2986 -0.0256 0.0140  0.0125  303 ASN B CA  
3433 C C   . ASN B 92  ? 0.3449 0.3934 0.2835 -0.0246 0.0146  0.0080  303 ASN B C   
3434 O O   . ASN B 92  ? 0.3398 0.3858 0.2825 -0.0236 0.0153  0.0070  303 ASN B O   
3435 C CB  . ASN B 92  ? 0.3764 0.4313 0.3059 -0.0286 0.0162  0.0111  303 ASN B CB  
3436 C CG  . ASN B 92  ? 0.4117 0.4665 0.3360 -0.0297 0.0166  0.0156  303 ASN B CG  
3437 O OD1 . ASN B 92  ? 0.4282 0.4789 0.3532 -0.0283 0.0159  0.0194  303 ASN B OD1 
3438 N ND2 . ASN B 92  ? 0.4428 0.5016 0.3612 -0.0324 0.0180  0.0152  303 ASN B ND2 
3439 N N   . GLU B 93  ? 0.3400 0.3899 0.2779 -0.0250 0.0142  0.0053  304 GLU B N   
3440 C CA  . GLU B 93  ? 0.3384 0.3850 0.2798 -0.0238 0.0149  0.0017  304 GLU B CA  
3441 C C   . GLU B 93  ? 0.3165 0.3574 0.2609 -0.0211 0.0131  0.0036  304 GLU B C   
3442 O O   . GLU B 93  ? 0.3086 0.3463 0.2563 -0.0195 0.0135  0.0021  304 GLU B O   
3443 C CB  . GLU B 93  ? 0.3453 0.3934 0.2848 -0.0250 0.0152  -0.0014 304 GLU B CB  
3444 C CG  . GLU B 93  ? 0.3612 0.4046 0.3032 -0.0240 0.0165  -0.0053 304 GLU B CG  
3445 C CD  . GLU B 93  ? 0.4016 0.4457 0.3415 -0.0257 0.0172  -0.0082 304 GLU B CD  
3446 O OE1 . GLU B 93  ? 0.4305 0.4790 0.3684 -0.0283 0.0190  -0.0113 304 GLU B OE1 
3447 O OE2 . GLU B 93  ? 0.3935 0.4338 0.3338 -0.0249 0.0161  -0.0078 304 GLU B OE2 
3448 N N   . PHE B 94  ? 0.3008 0.3409 0.2443 -0.0205 0.0111  0.0068  305 PHE B N   
3449 C CA  . PHE B 94  ? 0.2889 0.3237 0.2350 -0.0184 0.0097  0.0083  305 PHE B CA  
3450 C C   . PHE B 94  ? 0.2734 0.3066 0.2220 -0.0176 0.0100  0.0097  305 PHE B C   
3451 O O   . PHE B 94  ? 0.2649 0.2946 0.2163 -0.0161 0.0096  0.0087  305 PHE B O   
3452 C CB  . PHE B 94  ? 0.2893 0.3239 0.2346 -0.0179 0.0079  0.0111  305 PHE B CB  
3453 C CG  . PHE B 94  ? 0.2652 0.2945 0.2128 -0.0163 0.0069  0.0126  305 PHE B CG  
3454 C CD1 . PHE B 94  ? 0.2722 0.2970 0.2207 -0.0155 0.0069  0.0104  305 PHE B CD1 
3455 C CD2 . PHE B 94  ? 0.2672 0.2955 0.2157 -0.0157 0.0063  0.0160  305 PHE B CD2 
3456 C CE1 . PHE B 94  ? 0.2798 0.2997 0.2296 -0.0143 0.0060  0.0117  305 PHE B CE1 
3457 C CE2 . PHE B 94  ? 0.2731 0.2968 0.2237 -0.0146 0.0057  0.0169  305 PHE B CE2 
3458 C CZ  . PHE B 94  ? 0.2691 0.2890 0.2203 -0.0140 0.0055  0.0147  305 PHE B CZ  
3459 N N   . TYR B 95  ? 0.2781 0.3139 0.2255 -0.0188 0.0107  0.0119  306 TYR B N   
3460 C CA  . TYR B 95  ? 0.2750 0.3097 0.2249 -0.0188 0.0115  0.0128  306 TYR B CA  
3461 C C   . TYR B 95  ? 0.2736 0.3100 0.2268 -0.0188 0.0130  0.0089  306 TYR B C   
3462 O O   . TYR B 95  ? 0.2434 0.2791 0.2002 -0.0182 0.0132  0.0083  306 TYR B O   
3463 C CB  . TYR B 95  ? 0.2861 0.3222 0.2332 -0.0204 0.0126  0.0161  306 TYR B CB  
3464 C CG  . TYR B 95  ? 0.2888 0.3227 0.2338 -0.0195 0.0110  0.0204  306 TYR B CG  
3465 C CD1 . TYR B 95  ? 0.2937 0.3236 0.2414 -0.0179 0.0097  0.0214  306 TYR B CD1 
3466 C CD2 . TYR B 95  ? 0.2889 0.3247 0.2291 -0.0202 0.0109  0.0234  306 TYR B CD2 
3467 C CE1 . TYR B 95  ? 0.2751 0.3031 0.2217 -0.0169 0.0086  0.0249  306 TYR B CE1 
3468 C CE2 . TYR B 95  ? 0.2862 0.3200 0.2251 -0.0187 0.0093  0.0274  306 TYR B CE2 
3469 C CZ  . TYR B 95  ? 0.2782 0.3081 0.2208 -0.0170 0.0083  0.0280  306 TYR B CZ  
3470 O OH  . TYR B 95  ? 0.2600 0.2880 0.2021 -0.0153 0.0070  0.0316  306 TYR B OH  
3471 N N   . THR B 96  ? 0.2760 0.3149 0.2283 -0.0195 0.0142  0.0059  307 THR B N   
3472 C CA  . THR B 96  ? 0.2852 0.3256 0.2414 -0.0190 0.0156  0.0019  307 THR B CA  
3473 C C   . THR B 96  ? 0.2801 0.3164 0.2391 -0.0159 0.0139  0.0004  307 THR B C   
3474 O O   . THR B 96  ? 0.2819 0.3183 0.2452 -0.0142 0.0136  -0.0012 307 THR B O   
3475 C CB  . THR B 96  ? 0.2957 0.3394 0.2504 -0.0205 0.0177  -0.0013 307 THR B CB  
3476 O OG1 . THR B 96  ? 0.3188 0.3659 0.2689 -0.0235 0.0189  0.0005  307 THR B OG1 
3477 C CG2 . THR B 96  ? 0.3322 0.3780 0.2920 -0.0198 0.0195  -0.0055 307 THR B CG2 
3478 N N   . ARG B 97  ? 0.2751 0.3077 0.2315 -0.0152 0.0127  0.0010  308 ARG B N   
3479 C CA  . ARG B 97  ? 0.2682 0.2954 0.2256 -0.0124 0.0113  0.0000  308 ARG B CA  
3480 C C   . ARG B 97  ? 0.2583 0.2825 0.2169 -0.0110 0.0092  0.0024  308 ARG B C   
3481 O O   . ARG B 97  ? 0.2400 0.2611 0.2001 -0.0085 0.0080  0.0014  308 ARG B O   
3482 C CB  . ARG B 97  ? 0.2702 0.2941 0.2239 -0.0129 0.0115  -0.0004 308 ARG B CB  
3483 C CG  . ARG B 97  ? 0.2929 0.3191 0.2457 -0.0142 0.0138  -0.0038 308 ARG B CG  
3484 C CD  . ARG B 97  ? 0.2996 0.3243 0.2488 -0.0158 0.0144  -0.0048 308 ARG B CD  
3485 N NE  . ARG B 97  ? 0.3100 0.3367 0.2585 -0.0174 0.0171  -0.0086 308 ARG B NE  
3486 C CZ  . ARG B 97  ? 0.3381 0.3632 0.2840 -0.0190 0.0185  -0.0110 308 ARG B CZ  
3487 N NH1 . ARG B 97  ? 0.3507 0.3723 0.2948 -0.0192 0.0175  -0.0100 308 ARG B NH1 
3488 N NH2 . ARG B 97  ? 0.3277 0.3548 0.2731 -0.0208 0.0212  -0.0149 308 ARG B NH2 
3489 N N   . ILE B 98  ? 0.2423 0.2673 0.1999 -0.0124 0.0088  0.0054  309 ILE B N   
3490 C CA  . ILE B 98  ? 0.2349 0.2568 0.1932 -0.0116 0.0072  0.0075  309 ILE B CA  
3491 C C   . ILE B 98  ? 0.2400 0.2650 0.2001 -0.0131 0.0081  0.0091  309 ILE B C   
3492 O O   . ILE B 98  ? 0.2417 0.2669 0.1998 -0.0145 0.0085  0.0118  309 ILE B O   
3493 C CB  . ILE B 98  ? 0.2305 0.2490 0.1859 -0.0119 0.0064  0.0094  309 ILE B CB  
3494 C CG1 . ILE B 98  ? 0.2550 0.2701 0.2082 -0.0112 0.0064  0.0075  309 ILE B CG1 
3495 C CG2 . ILE B 98  ? 0.2306 0.2459 0.1869 -0.0114 0.0052  0.0113  309 ILE B CG2 
3496 C CD1 . ILE B 98  ? 0.2308 0.2405 0.1839 -0.0090 0.0053  0.0065  309 ILE B CD1 
3497 N N   . PRO B 99  ? 0.2359 0.2636 0.1997 -0.0129 0.0085  0.0072  310 PRO B N   
3498 C CA  . PRO B 99  ? 0.2417 0.2725 0.2065 -0.0152 0.0104  0.0081  310 PRO B CA  
3499 C C   . PRO B 99  ? 0.2403 0.2682 0.2046 -0.0161 0.0103  0.0111  310 PRO B C   
3500 O O   . PRO B 99  ? 0.2194 0.2446 0.1850 -0.0150 0.0087  0.0112  310 PRO B O   
3501 C CB  . PRO B 99  ? 0.2462 0.2809 0.2161 -0.0148 0.0110  0.0045  310 PRO B CB  
3502 C CG  . PRO B 99  ? 0.2569 0.2915 0.2276 -0.0123 0.0099  0.0020  310 PRO B CG  
3503 C CD  . PRO B 99  ? 0.2490 0.2779 0.2161 -0.0108 0.0080  0.0038  310 PRO B CD  
3504 N N   . HIS B 100 ? 0.2511 0.2795 0.2132 -0.0181 0.0121  0.0136  311 HIS B N   
3505 C CA  . HIS B 100 ? 0.2465 0.2715 0.2077 -0.0190 0.0127  0.0168  311 HIS B CA  
3506 C C   . HIS B 100 ? 0.2674 0.2938 0.2296 -0.0216 0.0157  0.0167  311 HIS B C   
3507 O O   . HIS B 100 ? 0.2629 0.2930 0.2248 -0.0231 0.0175  0.0151  311 HIS B O   
3508 C CB  . HIS B 100 ? 0.2595 0.2827 0.2164 -0.0187 0.0123  0.0205  311 HIS B CB  
3509 C CG  . HIS B 100 ? 0.2250 0.2461 0.1814 -0.0168 0.0099  0.0209  311 HIS B CG  
3510 N ND1 . HIS B 100 ? 0.2282 0.2501 0.1849 -0.0157 0.0086  0.0182  311 HIS B ND1 
3511 C CD2 . HIS B 100 ? 0.2212 0.2394 0.1769 -0.0159 0.0090  0.0235  311 HIS B CD2 
3512 C CE1 . HIS B 100 ? 0.2551 0.2745 0.2110 -0.0146 0.0072  0.0190  311 HIS B CE1 
3513 N NE2 . HIS B 100 ? 0.2535 0.2711 0.2092 -0.0147 0.0073  0.0220  311 HIS B NE2 
3514 N N   . ASP B 101 ? 0.2839 0.3070 0.2468 -0.0226 0.0167  0.0183  312 ASP B N   
3515 C CA  . ASP B 101 ? 0.2910 0.3144 0.2547 -0.0257 0.0202  0.0181  312 ASP B CA  
3516 C C   . ASP B 101 ? 0.2920 0.3097 0.2512 -0.0264 0.0218  0.0230  312 ASP B C   
3517 O O   . ASP B 101 ? 0.2909 0.3041 0.2510 -0.0261 0.0218  0.0245  312 ASP B O   
3518 C CB  . ASP B 101 ? 0.3047 0.3293 0.2739 -0.0265 0.0205  0.0148  312 ASP B CB  
3519 C CG  . ASP B 101 ? 0.3256 0.3509 0.2962 -0.0304 0.0247  0.0136  312 ASP B CG  
3520 O OD1 . ASP B 101 ? 0.3232 0.3467 0.2897 -0.0323 0.0276  0.0159  312 ASP B OD1 
3521 O OD2 . ASP B 101 ? 0.3593 0.3869 0.3348 -0.0316 0.0251  0.0102  312 ASP B OD2 
3522 N N   . PHE B 102 ? 0.2723 0.2899 0.2265 -0.0273 0.0232  0.0255  313 PHE B N   
3523 C CA  . PHE B 102 ? 0.2683 0.2803 0.2176 -0.0275 0.0245  0.0306  313 PHE B CA  
3524 C C   . PHE B 102 ? 0.2798 0.2893 0.2273 -0.0312 0.0293  0.0310  313 PHE B C   
3525 O O   . PHE B 102 ? 0.2802 0.2846 0.2219 -0.0317 0.0311  0.0355  313 PHE B O   
3526 C CB  . PHE B 102 ? 0.2659 0.2790 0.2098 -0.0257 0.0226  0.0337  313 PHE B CB  
3527 C CG  . PHE B 102 ? 0.2766 0.2913 0.2221 -0.0225 0.0185  0.0334  313 PHE B CG  
3528 C CD1 . PHE B 102 ? 0.2544 0.2651 0.2013 -0.0204 0.0171  0.0355  313 PHE B CD1 
3529 C CD2 . PHE B 102 ? 0.2924 0.3124 0.2378 -0.0219 0.0167  0.0307  313 PHE B CD2 
3530 C CE1 . PHE B 102 ? 0.2808 0.2931 0.2292 -0.0180 0.0139  0.0348  313 PHE B CE1 
3531 C CE2 . PHE B 102 ? 0.2795 0.3004 0.2260 -0.0196 0.0137  0.0302  313 PHE B CE2 
3532 C CZ  . PHE B 102 ? 0.2920 0.3093 0.2400 -0.0177 0.0123  0.0321  313 PHE B CZ  
3533 N N   . GLY B 103 ? 0.2796 0.2927 0.2320 -0.0337 0.0312  0.0262  314 GLY B N   
3534 C CA  . GLY B 103 ? 0.2920 0.3039 0.2435 -0.0380 0.0362  0.0252  314 GLY B CA  
3535 C C   . GLY B 103 ? 0.3044 0.3160 0.2488 -0.0397 0.0385  0.0275  314 GLY B C   
3536 O O   . GLY B 103 ? 0.3061 0.3232 0.2499 -0.0392 0.0371  0.0257  314 GLY B O   
3537 N N   . LEU B 104 ? 0.3096 0.3139 0.2478 -0.0416 0.0419  0.0318  315 LEU B N   
3538 C CA  . LEU B 104 ? 0.3247 0.3271 0.2545 -0.0437 0.0445  0.0346  315 LEU B CA  
3539 C C   . LEU B 104 ? 0.3164 0.3159 0.2387 -0.0401 0.0412  0.0408  315 LEU B C   
3540 O O   . LEU B 104 ? 0.3230 0.3214 0.2373 -0.0413 0.0424  0.0436  315 LEU B O   
3541 C CB  . LEU B 104 ? 0.3469 0.3421 0.2730 -0.0480 0.0506  0.0361  315 LEU B CB  
3542 C CG  . LEU B 104 ? 0.3739 0.3724 0.3070 -0.0525 0.0548  0.0297  315 LEU B CG  
3543 C CD1 . LEU B 104 ? 0.4089 0.3982 0.3370 -0.0570 0.0613  0.0319  315 LEU B CD1 
3544 C CD2 . LEU B 104 ? 0.4107 0.4185 0.3467 -0.0548 0.0557  0.0241  315 LEU B CD2 
3545 N N   . ARG B 105 ? 0.3086 0.3075 0.2337 -0.0359 0.0369  0.0424  316 ARG B N   
3546 C CA  . ARG B 105 ? 0.3084 0.3054 0.2280 -0.0321 0.0334  0.0477  316 ARG B CA  
3547 C C   . ARG B 105 ? 0.3022 0.3073 0.2212 -0.0307 0.0297  0.0459  316 ARG B C   
3548 O O   . ARG B 105 ? 0.3010 0.3120 0.2262 -0.0307 0.0284  0.0407  316 ARG B O   
3549 C CB  . ARG B 105 ? 0.3100 0.3033 0.2342 -0.0287 0.0311  0.0493  316 ARG B CB  
3550 C CG  . ARG B 105 ? 0.3442 0.3359 0.2651 -0.0243 0.0273  0.0542  316 ARG B CG  
3551 C CD  . ARG B 105 ? 0.3841 0.3726 0.3111 -0.0216 0.0259  0.0543  316 ARG B CD  
3552 N NE  . ARG B 105 ? 0.4339 0.4251 0.3607 -0.0174 0.0213  0.0565  316 ARG B NE  
3553 C CZ  . ARG B 105 ? 0.3984 0.3935 0.3309 -0.0154 0.0182  0.0537  316 ARG B CZ  
3554 N NH1 . ARG B 105 ? 0.3979 0.3939 0.3365 -0.0168 0.0188  0.0492  316 ARG B NH1 
3555 N NH2 . ARG B 105 ? 0.4298 0.4278 0.3615 -0.0120 0.0145  0.0557  316 ARG B NH2 
3556 N N   . THR B 106 ? 0.3094 0.3145 0.2208 -0.0294 0.0280  0.0500  317 THR B N   
3557 C CA  . THR B 106 ? 0.3164 0.3289 0.2268 -0.0279 0.0244  0.0486  317 THR B CA  
3558 C C   . THR B 106 ? 0.3072 0.3230 0.2253 -0.0248 0.0206  0.0459  317 THR B C   
3559 O O   . THR B 106 ? 0.2993 0.3119 0.2193 -0.0219 0.0186  0.0485  317 THR B O   
3560 C CB  . THR B 106 ? 0.3259 0.3377 0.2274 -0.0259 0.0220  0.0543  317 THR B CB  
3561 O OG1 . THR B 106 ? 0.3275 0.3335 0.2206 -0.0282 0.0256  0.0582  317 THR B OG1 
3562 C CG2 . THR B 106 ? 0.3098 0.3303 0.2090 -0.0261 0.0194  0.0518  317 THR B CG2 
3563 N N   . PRO B 107 ? 0.3160 0.3378 0.2386 -0.0256 0.0199  0.0405  318 PRO B N   
3564 C CA  . PRO B 107 ? 0.3171 0.3407 0.2452 -0.0228 0.0166  0.0385  318 PRO B CA  
3565 C C   . PRO B 107 ? 0.3270 0.3518 0.2521 -0.0199 0.0131  0.0419  318 PRO B C   
3566 O O   . PRO B 107 ? 0.3335 0.3618 0.2530 -0.0203 0.0122  0.0431  318 PRO B O   
3567 C CB  . PRO B 107 ? 0.3143 0.3435 0.2453 -0.0240 0.0166  0.0329  318 PRO B CB  
3568 C CG  . PRO B 107 ? 0.3071 0.3365 0.2382 -0.0273 0.0205  0.0309  318 PRO B CG  
3569 C CD  . PRO B 107 ? 0.3217 0.3479 0.2451 -0.0287 0.0223  0.0358  318 PRO B CD  
3570 N N   . PRO B 108 ? 0.3384 0.3606 0.2671 -0.0172 0.0112  0.0432  319 PRO B N   
3571 C CA  . PRO B 108 ? 0.3515 0.3754 0.2778 -0.0143 0.0080  0.0465  319 PRO B CA  
3572 C C   . PRO B 108 ? 0.3613 0.3919 0.2894 -0.0137 0.0053  0.0431  319 PRO B C   
3573 O O   . PRO B 108 ? 0.3367 0.3685 0.2691 -0.0146 0.0056  0.0386  319 PRO B O   
3574 C CB  . PRO B 108 ? 0.3634 0.3819 0.2938 -0.0119 0.0076  0.0487  319 PRO B CB  
3575 C CG  . PRO B 108 ? 0.3502 0.3671 0.2865 -0.0133 0.0091  0.0443  319 PRO B CG  
3576 C CD  . PRO B 108 ? 0.3340 0.3517 0.2685 -0.0166 0.0119  0.0422  319 PRO B CD  
3577 N N   . LEU B 109 ? 0.3732 0.4080 0.2980 -0.0120 0.0025  0.0452  320 LEU B N   
3578 C CA  . LEU B 109 ? 0.3828 0.4244 0.3096 -0.0116 0.0001  0.0418  320 LEU B CA  
3579 C C   . LEU B 109 ? 0.3775 0.4175 0.3110 -0.0095 -0.0011 0.0405  320 LEU B C   
3580 O O   . LEU B 109 ? 0.3827 0.4176 0.3185 -0.0075 -0.0010 0.0433  320 LEU B O   
3581 C CB  . LEU B 109 ? 0.3940 0.4418 0.3154 -0.0105 -0.0027 0.0440  320 LEU B CB  
3582 C CG  . LEU B 109 ? 0.4068 0.4579 0.3210 -0.0135 -0.0015 0.0437  320 LEU B CG  
3583 C CD1 . LEU B 109 ? 0.4050 0.4637 0.3141 -0.0127 -0.0048 0.0450  320 LEU B CD1 
3584 C CD2 . LEU B 109 ? 0.4020 0.4553 0.3179 -0.0170 0.0009  0.0378  320 LEU B CD2 
3585 N N   . ILE B 110 ? 0.3818 0.4253 0.3182 -0.0105 -0.0015 0.0357  321 ILE B N   
3586 C CA  . ILE B 110 ? 0.3752 0.4182 0.3170 -0.0093 -0.0025 0.0336  321 ILE B CA  
3587 C C   . ILE B 110 ? 0.3967 0.4476 0.3382 -0.0083 -0.0053 0.0329  321 ILE B C   
3588 O O   . ILE B 110 ? 0.3854 0.4418 0.3248 -0.0103 -0.0055 0.0298  321 ILE B O   
3589 C CB  . ILE B 110 ? 0.3591 0.4002 0.3034 -0.0114 -0.0008 0.0287  321 ILE B CB  
3590 C CG1 . ILE B 110 ? 0.3421 0.3769 0.2870 -0.0121 0.0014  0.0292  321 ILE B CG1 
3591 C CG2 . ILE B 110 ? 0.3461 0.3867 0.2945 -0.0107 -0.0014 0.0264  321 ILE B CG2 
3592 C CD1 . ILE B 110 ? 0.3485 0.3829 0.2936 -0.0140 0.0030  0.0251  321 ILE B CD1 
3593 N N   . ARG B 111 ? 0.4271 0.4790 0.3708 -0.0053 -0.0074 0.0356  322 ARG B N   
3594 C CA  . ARG B 111 ? 0.4566 0.5173 0.3998 -0.0038 -0.0106 0.0357  322 ARG B CA  
3595 C C   . ARG B 111 ? 0.4532 0.5164 0.4027 -0.0011 -0.0125 0.0349  322 ARG B C   
3596 O O   . ARG B 111 ? 0.4684 0.5401 0.4189 0.0001  -0.0153 0.0339  322 ARG B O   
3597 C CB  . ARG B 111 ? 0.4717 0.5337 0.4086 -0.0020 -0.0124 0.0411  322 ARG B CB  
3598 C CG  . ARG B 111 ? 0.5290 0.5821 0.4644 -0.0002 -0.0110 0.0465  322 ARG B CG  
3599 C CD  . ARG B 111 ? 0.6057 0.6596 0.5345 0.0022  -0.0130 0.0523  322 ARG B CD  
3600 N NE  . ARG B 111 ? 0.6503 0.7053 0.5714 -0.0009 -0.0118 0.0526  322 ARG B NE  
3601 C CZ  . ARG B 111 ? 0.7293 0.7847 0.6424 0.0001  -0.0130 0.0575  322 ARG B CZ  
3602 N NH1 . ARG B 111 ? 0.7572 0.8117 0.6688 0.0048  -0.0159 0.0629  322 ARG B NH1 
3603 N NH2 . ARG B 111 ? 0.7463 0.8026 0.6526 -0.0034 -0.0113 0.0569  322 ARG B NH2 
3604 N N   . THR B 112 ? 0.4510 0.5075 0.4050 -0.0005 -0.0108 0.0348  323 THR B N   
3605 C CA  . THR B 112 ? 0.4449 0.5035 0.4054 0.0015  -0.0118 0.0333  323 THR B CA  
3606 C C   . THR B 112 ? 0.4370 0.4924 0.4010 -0.0013 -0.0093 0.0283  323 THR B C   
3607 O O   . THR B 112 ? 0.4107 0.4607 0.3721 -0.0040 -0.0069 0.0270  323 THR B O   
3608 C CB  . THR B 112 ? 0.4499 0.5029 0.4127 0.0052  -0.0120 0.0381  323 THR B CB  
3609 O OG1 . THR B 112 ? 0.5030 0.5598 0.4726 0.0076  -0.0133 0.0365  323 THR B OG1 
3610 C CG2 . THR B 112 ? 0.4235 0.4667 0.3866 0.0036  -0.0086 0.0383  323 THR B CG2 
3611 N N   . GLN B 113 ? 0.4353 0.4937 0.4050 -0.0005 -0.0097 0.0256  324 GLN B N   
3612 C CA  . GLN B 113 ? 0.4322 0.4874 0.4047 -0.0033 -0.0071 0.0208  324 GLN B CA  
3613 C C   . GLN B 113 ? 0.4334 0.4782 0.4055 -0.0037 -0.0047 0.0225  324 GLN B C   
3614 O O   . GLN B 113 ? 0.4184 0.4584 0.3884 -0.0064 -0.0026 0.0201  324 GLN B O   
3615 C CB  . GLN B 113 ? 0.4394 0.4999 0.4185 -0.0024 -0.0077 0.0177  324 GLN B CB  
3616 C CG  . GLN B 113 ? 0.4443 0.5018 0.4251 -0.0061 -0.0047 0.0121  324 GLN B CG  
3617 C CD  . GLN B 113 ? 0.4616 0.5093 0.4435 -0.0065 -0.0021 0.0127  324 GLN B CD  
3618 O OE1 . GLN B 113 ? 0.4390 0.4837 0.4230 -0.0037 -0.0025 0.0163  324 GLN B OE1 
3619 N NE2 . GLN B 113 ? 0.4397 0.4822 0.4197 -0.0100 0.0007  0.0090  324 GLN B NE2 
3620 N N   . LYS B 114 ? 0.4306 0.4721 0.4048 -0.0008 -0.0050 0.0264  325 LYS B N   
3621 C CA  . LYS B 114 ? 0.4344 0.4667 0.4084 -0.0014 -0.0026 0.0276  325 LYS B CA  
3622 C C   . LYS B 114 ? 0.4173 0.4456 0.3859 -0.0033 -0.0016 0.0288  325 LYS B C   
3623 O O   . LYS B 114 ? 0.4148 0.4373 0.3828 -0.0052 0.0003  0.0275  325 LYS B O   
3624 C CB  . LYS B 114 ? 0.4457 0.4748 0.4227 0.0019  -0.0027 0.0317  325 LYS B CB  
3625 C CG  . LYS B 114 ? 0.4967 0.5278 0.4706 0.0047  -0.0048 0.0367  325 LYS B CG  
3626 C CD  . LYS B 114 ? 0.5398 0.5646 0.5143 0.0074  -0.0039 0.0415  325 LYS B CD  
3627 C CE  . LYS B 114 ? 0.5494 0.5730 0.5174 0.0081  -0.0046 0.0463  325 LYS B CE  
3628 N NZ  . LYS B 114 ? 0.5403 0.5726 0.5051 0.0090  -0.0078 0.0467  325 LYS B NZ  
3629 N N   . GLU B 115 ? 0.4051 0.4369 0.3700 -0.0029 -0.0029 0.0311  326 GLU B N   
3630 C CA  . GLU B 115 ? 0.4032 0.4322 0.3636 -0.0047 -0.0017 0.0318  326 GLU B CA  
3631 C C   . GLU B 115 ? 0.3897 0.4194 0.3488 -0.0075 -0.0009 0.0273  326 GLU B C   
3632 O O   . GLU B 115 ? 0.3918 0.4171 0.3497 -0.0089 0.0006  0.0264  326 GLU B O   
3633 C CB  . GLU B 115 ? 0.4075 0.4396 0.3636 -0.0037 -0.0029 0.0354  326 GLU B CB  
3634 C CG  . GLU B 115 ? 0.4237 0.4515 0.3794 -0.0014 -0.0027 0.0407  326 GLU B CG  
3635 C CD  . GLU B 115 ? 0.4584 0.4890 0.4087 0.0000  -0.0042 0.0449  326 GLU B CD  
3636 O OE1 . GLU B 115 ? 0.4240 0.4615 0.3715 -0.0006 -0.0059 0.0436  326 GLU B OE1 
3637 O OE2 . GLU B 115 ? 0.5097 0.5351 0.4578 0.0014  -0.0033 0.0494  326 GLU B OE2 
3638 N N   . LEU B 116 ? 0.3786 0.4138 0.3381 -0.0081 -0.0018 0.0243  327 LEU B N   
3639 C CA  . LEU B 116 ? 0.3644 0.3990 0.3228 -0.0107 -0.0005 0.0198  327 LEU B CA  
3640 C C   . LEU B 116 ? 0.3526 0.3803 0.3127 -0.0114 0.0011  0.0181  327 LEU B C   
3641 O O   . LEU B 116 ? 0.3368 0.3599 0.2947 -0.0127 0.0024  0.0166  327 LEU B O   
3642 C CB  . LEU B 116 ? 0.3658 0.4074 0.3251 -0.0115 -0.0013 0.0166  327 LEU B CB  
3643 C CG  . LEU B 116 ? 0.3761 0.4196 0.3329 -0.0142 -0.0002 0.0124  327 LEU B CG  
3644 C CD1 . LEU B 116 ? 0.3539 0.3983 0.3068 -0.0149 0.0000  0.0133  327 LEU B CD1 
3645 C CD2 . LEU B 116 ? 0.3062 0.3584 0.2648 -0.0149 -0.0013 0.0096  327 LEU B CD2 
3646 N N   . SER B 117 ? 0.3350 0.3621 0.2987 -0.0104 0.0010  0.0185  328 SER B N   
3647 C CA  . SER B 117 ? 0.3372 0.3580 0.3020 -0.0113 0.0027  0.0168  328 SER B CA  
3648 C C   . SER B 117 ? 0.3245 0.3390 0.2877 -0.0114 0.0034  0.0186  328 SER B C   
3649 O O   . SER B 117 ? 0.3169 0.3263 0.2783 -0.0128 0.0045  0.0167  328 SER B O   
3650 C CB  . SER B 117 ? 0.3308 0.3528 0.3005 -0.0100 0.0026  0.0170  328 SER B CB  
3651 O OG  . SER B 117 ? 0.3653 0.3808 0.3357 -0.0112 0.0045  0.0156  328 SER B OG  
3652 N N   . GLU B 118 ? 0.3133 0.3279 0.2769 -0.0099 0.0029  0.0222  329 GLU B N   
3653 C CA  . GLU B 118 ? 0.3223 0.3321 0.2850 -0.0103 0.0039  0.0235  329 GLU B CA  
3654 C C   . GLU B 118 ? 0.3014 0.3108 0.2610 -0.0115 0.0039  0.0219  329 GLU B C   
3655 O O   . GLU B 118 ? 0.3005 0.3059 0.2596 -0.0121 0.0045  0.0210  329 GLU B O   
3656 C CB  . GLU B 118 ? 0.3359 0.3458 0.2991 -0.0090 0.0039  0.0274  329 GLU B CB  
3657 C CG  . GLU B 118 ? 0.3936 0.4004 0.3603 -0.0078 0.0047  0.0290  329 GLU B CG  
3658 C CD  . GLU B 118 ? 0.4825 0.4902 0.4496 -0.0055 0.0042  0.0333  329 GLU B CD  
3659 O OE1 . GLU B 118 ? 0.5006 0.5114 0.4646 -0.0050 0.0033  0.0353  329 GLU B OE1 
3660 O OE2 . GLU B 118 ? 0.5570 0.5618 0.5273 -0.0040 0.0050  0.0346  329 GLU B OE2 
3661 N N   . LYS B 119 ? 0.2828 0.2965 0.2407 -0.0117 0.0033  0.0212  330 LYS B N   
3662 C CA  . LYS B 119 ? 0.2672 0.2806 0.2227 -0.0125 0.0037  0.0193  330 LYS B CA  
3663 C C   . LYS B 119 ? 0.2603 0.2700 0.2144 -0.0133 0.0042  0.0161  330 LYS B C   
3664 O O   . LYS B 119 ? 0.2286 0.2352 0.1814 -0.0133 0.0044  0.0150  330 LYS B O   
3665 C CB  . LYS B 119 ? 0.2665 0.2855 0.2203 -0.0128 0.0034  0.0191  330 LYS B CB  
3666 C CG  . LYS B 119 ? 0.2917 0.3134 0.2449 -0.0123 0.0031  0.0225  330 LYS B CG  
3667 C CD  . LYS B 119 ? 0.3323 0.3515 0.2858 -0.0126 0.0042  0.0235  330 LYS B CD  
3668 C CE  . LYS B 119 ? 0.3449 0.3601 0.3004 -0.0121 0.0047  0.0259  330 LYS B CE  
3669 N NZ  . LYS B 119 ? 0.2935 0.3072 0.2492 -0.0129 0.0061  0.0269  330 LYS B NZ  
3670 N N   . ILE B 120 ? 0.2608 0.2709 0.2154 -0.0139 0.0044  0.0147  331 ILE B N   
3671 C CA  . ILE B 120 ? 0.2737 0.2786 0.2264 -0.0150 0.0054  0.0120  331 ILE B CA  
3672 C C   . ILE B 120 ? 0.2586 0.2576 0.2110 -0.0148 0.0056  0.0127  331 ILE B C   
3673 O O   . ILE B 120 ? 0.2557 0.2499 0.2050 -0.0149 0.0058  0.0117  331 ILE B O   
3674 C CB  . ILE B 120 ? 0.2798 0.2865 0.2334 -0.0163 0.0063  0.0097  331 ILE B CB  
3675 C CG1 . ILE B 120 ? 0.3181 0.3302 0.2709 -0.0172 0.0063  0.0077  331 ILE B CG1 
3676 C CG2 . ILE B 120 ? 0.3117 0.3114 0.2626 -0.0179 0.0080  0.0072  331 ILE B CG2 
3677 C CD1 . ILE B 120 ? 0.3039 0.3228 0.2598 -0.0178 0.0061  0.0062  331 ILE B CD1 
3678 N N   . GLN B 121 ? 0.2612 0.2604 0.2164 -0.0144 0.0055  0.0144  332 GLN B N   
3679 C CA  . GLN B 121 ? 0.2718 0.2660 0.2268 -0.0146 0.0058  0.0148  332 GLN B CA  
3680 C C   . GLN B 121 ? 0.2707 0.2640 0.2243 -0.0140 0.0050  0.0153  332 GLN B C   
3681 O O   . GLN B 121 ? 0.2729 0.2619 0.2242 -0.0142 0.0047  0.0144  332 GLN B O   
3682 C CB  . GLN B 121 ? 0.2807 0.2756 0.2395 -0.0142 0.0062  0.0166  332 GLN B CB  
3683 C CG  . GLN B 121 ? 0.3372 0.3322 0.2983 -0.0147 0.0071  0.0155  332 GLN B CG  
3684 C CD  . GLN B 121 ? 0.3886 0.3835 0.3539 -0.0139 0.0077  0.0172  332 GLN B CD  
3685 O OE1 . GLN B 121 ? 0.4028 0.3978 0.3693 -0.0129 0.0076  0.0197  332 GLN B OE1 
3686 N NE2 . GLN B 121 ? 0.4669 0.4612 0.4347 -0.0144 0.0089  0.0155  332 GLN B NE2 
3687 N N   . LEU B 122 ? 0.2635 0.2610 0.2183 -0.0133 0.0045  0.0166  333 LEU B N   
3688 C CA  . LEU B 122 ? 0.2628 0.2606 0.2173 -0.0128 0.0039  0.0164  333 LEU B CA  
3689 C C   . LEU B 122 ? 0.2448 0.2405 0.1963 -0.0122 0.0034  0.0144  333 LEU B C   
3690 O O   . LEU B 122 ? 0.2405 0.2339 0.1911 -0.0115 0.0026  0.0137  333 LEU B O   
3691 C CB  . LEU B 122 ? 0.2683 0.2710 0.2244 -0.0126 0.0042  0.0179  333 LEU B CB  
3692 C CG  . LEU B 122 ? 0.2858 0.2907 0.2426 -0.0124 0.0041  0.0171  333 LEU B CG  
3693 C CD1 . LEU B 122 ? 0.3307 0.3337 0.2888 -0.0125 0.0037  0.0165  333 LEU B CD1 
3694 C CD2 . LEU B 122 ? 0.3104 0.3195 0.2681 -0.0130 0.0050  0.0189  333 LEU B CD2 
3695 N N   . LEU B 123 ? 0.2319 0.2284 0.1819 -0.0124 0.0039  0.0133  334 LEU B N   
3696 C CA  . LEU B 123 ? 0.2229 0.2160 0.1698 -0.0118 0.0039  0.0114  334 LEU B CA  
3697 C C   . LEU B 123 ? 0.2281 0.2139 0.1712 -0.0119 0.0039  0.0107  334 LEU B C   
3698 O O   . LEU B 123 ? 0.2166 0.1985 0.1571 -0.0106 0.0031  0.0102  334 LEU B O   
3699 C CB  . LEU B 123 ? 0.2330 0.2283 0.1790 -0.0125 0.0050  0.0099  334 LEU B CB  
3700 C CG  . LEU B 123 ? 0.2283 0.2297 0.1760 -0.0124 0.0051  0.0099  334 LEU B CG  
3701 C CD1 . LEU B 123 ? 0.2494 0.2524 0.1954 -0.0136 0.0064  0.0076  334 LEU B CD1 
3702 C CD2 . LEU B 123 ? 0.2563 0.2576 0.2048 -0.0109 0.0046  0.0095  334 LEU B CD2 
3703 N N   . GLU B 124 ? 0.2349 0.2189 0.1778 -0.0135 0.0047  0.0108  335 GLU B N   
3704 C CA  . GLU B 124 ? 0.2513 0.2281 0.1900 -0.0142 0.0052  0.0101  335 GLU B CA  
3705 C C   . GLU B 124 ? 0.2500 0.2252 0.1883 -0.0132 0.0035  0.0111  335 GLU B C   
3706 O O   . GLU B 124 ? 0.2533 0.2231 0.1870 -0.0124 0.0027  0.0108  335 GLU B O   
3707 C CB  . GLU B 124 ? 0.2504 0.2267 0.1899 -0.0163 0.0068  0.0094  335 GLU B CB  
3708 C CG  . GLU B 124 ? 0.2528 0.2308 0.1921 -0.0175 0.0084  0.0075  335 GLU B CG  
3709 C CD  . GLU B 124 ? 0.2721 0.2509 0.2130 -0.0195 0.0100  0.0061  335 GLU B CD  
3710 O OE1 . GLU B 124 ? 0.2378 0.2181 0.1820 -0.0195 0.0099  0.0070  335 GLU B OE1 
3711 O OE2 . GLU B 124 ? 0.3154 0.2935 0.2547 -0.0212 0.0118  0.0036  335 GLU B OE2 
3712 N N   . ALA B 125 ? 0.2448 0.2247 0.1876 -0.0131 0.0030  0.0122  336 ALA B N   
3713 C CA  . ALA B 125 ? 0.2391 0.2188 0.1823 -0.0126 0.0016  0.0125  336 ALA B CA  
3714 C C   . ALA B 125 ? 0.2367 0.2175 0.1792 -0.0104 -0.0003 0.0120  336 ALA B C   
3715 O O   . ALA B 125 ? 0.2358 0.2140 0.1756 -0.0093 -0.0020 0.0116  336 ALA B O   
3716 C CB  . ALA B 125 ? 0.2276 0.2114 0.1758 -0.0135 0.0022  0.0134  336 ALA B CB  
3717 N N   . LEU B 126 ? 0.2257 0.2104 0.1705 -0.0095 -0.0001 0.0119  337 LEU B N   
3718 C CA  . LEU B 126 ? 0.2291 0.2152 0.1741 -0.0071 -0.0016 0.0111  337 LEU B CA  
3719 C C   . LEU B 126 ? 0.2376 0.2168 0.1769 -0.0055 -0.0024 0.0106  337 LEU B C   
3720 O O   . LEU B 126 ? 0.2231 0.2014 0.1614 -0.0030 -0.0045 0.0102  337 LEU B O   
3721 C CB  . LEU B 126 ? 0.2328 0.2238 0.1808 -0.0069 -0.0006 0.0106  337 LEU B CB  
3722 C CG  . LEU B 126 ? 0.2226 0.2200 0.1754 -0.0081 0.0001  0.0113  337 LEU B CG  
3723 C CD1 . LEU B 126 ? 0.2154 0.2168 0.1694 -0.0086 0.0015  0.0112  337 LEU B CD1 
3724 C CD2 . LEU B 126 ? 0.2308 0.2314 0.1866 -0.0071 -0.0013 0.0103  337 LEU B CD2 
3725 N N   . GLY B 127 ? 0.2441 0.2183 0.1796 -0.0068 -0.0006 0.0105  338 GLY B N   
3726 C CA  . GLY B 127 ? 0.2644 0.2302 0.1933 -0.0059 -0.0004 0.0102  338 GLY B CA  
3727 C C   . GLY B 127 ? 0.2768 0.2378 0.2013 -0.0053 -0.0022 0.0109  338 GLY B C   
3728 O O   . GLY B 127 ? 0.2772 0.2337 0.1975 -0.0026 -0.0040 0.0113  338 GLY B O   
3729 N N   . ASP B 128 ? 0.2894 0.2516 0.2149 -0.0077 -0.0018 0.0112  339 ASP B N   
3730 C CA  . ASP B 128 ? 0.3014 0.2595 0.2225 -0.0078 -0.0033 0.0116  339 ASP B CA  
3731 C C   . ASP B 128 ? 0.3004 0.2633 0.2240 -0.0054 -0.0066 0.0116  339 ASP B C   
3732 O O   . ASP B 128 ? 0.3030 0.2624 0.2217 -0.0041 -0.0088 0.0119  339 ASP B O   
3733 C CB  . ASP B 128 ? 0.2992 0.2569 0.2209 -0.0113 -0.0013 0.0113  339 ASP B CB  
3734 C CG  . ASP B 128 ? 0.3435 0.2951 0.2609 -0.0135 0.0016  0.0107  339 ASP B CG  
3735 O OD1 . ASP B 128 ? 0.4005 0.3470 0.3134 -0.0125 0.0021  0.0106  339 ASP B OD1 
3736 O OD2 . ASP B 128 ? 0.3991 0.3506 0.3178 -0.0163 0.0036  0.0100  339 ASP B OD2 
3737 N N   . ILE B 129 ? 0.2870 0.2581 0.2180 -0.0049 -0.0069 0.0112  340 ILE B N   
3738 C CA  . ILE B 129 ? 0.2805 0.2572 0.2150 -0.0030 -0.0096 0.0104  340 ILE B CA  
3739 C C   . ILE B 129 ? 0.2954 0.2707 0.2279 0.0012  -0.0119 0.0103  340 ILE B C   
3740 O O   . ILE B 129 ? 0.3061 0.2825 0.2377 0.0037  -0.0151 0.0100  340 ILE B O   
3741 C CB  . ILE B 129 ? 0.2728 0.2582 0.2155 -0.0043 -0.0085 0.0097  340 ILE B CB  
3742 C CG1 . ILE B 129 ? 0.2634 0.2493 0.2076 -0.0078 -0.0067 0.0100  340 ILE B CG1 
3743 C CG2 . ILE B 129 ? 0.2423 0.2346 0.1896 -0.0021 -0.0109 0.0082  340 ILE B CG2 
3744 C CD1 . ILE B 129 ? 0.2713 0.2630 0.2220 -0.0095 -0.0045 0.0101  340 ILE B CD1 
3745 N N   . GLU B 130 ? 0.3000 0.2728 0.2319 0.0021  -0.0103 0.0104  341 GLU B N   
3746 C CA  . GLU B 130 ? 0.3140 0.2842 0.2441 0.0063  -0.0119 0.0102  341 GLU B CA  
3747 C C   . GLU B 130 ? 0.3195 0.2809 0.2409 0.0081  -0.0140 0.0116  341 GLU B C   
3748 O O   . GLU B 130 ? 0.3148 0.2759 0.2350 0.0123  -0.0173 0.0118  341 GLU B O   
3749 C CB  . GLU B 130 ? 0.3125 0.2801 0.2424 0.0060  -0.0090 0.0098  341 GLU B CB  
3750 C CG  . GLU B 130 ? 0.3402 0.3048 0.2691 0.0103  -0.0099 0.0093  341 GLU B CG  
3751 C CD  . GLU B 130 ? 0.3985 0.3512 0.3182 0.0123  -0.0103 0.0108  341 GLU B CD  
3752 O OE1 . GLU B 130 ? 0.3838 0.3295 0.2971 0.0095  -0.0086 0.0117  341 GLU B OE1 
3753 O OE2 . GLU B 130 ? 0.4297 0.3798 0.3484 0.0169  -0.0122 0.0108  341 GLU B OE2 
3754 N N   . ILE B 131 ? 0.3226 0.2769 0.2378 0.0050  -0.0120 0.0125  342 ILE B N   
3755 C CA  . ILE B 131 ? 0.3326 0.2779 0.2383 0.0057  -0.0133 0.0139  342 ILE B CA  
3756 C C   . ILE B 131 ? 0.3273 0.2765 0.2328 0.0067  -0.0170 0.0140  342 ILE B C   
3757 O O   . ILE B 131 ? 0.3449 0.2908 0.2453 0.0103  -0.0204 0.0150  342 ILE B O   
3758 C CB  . ILE B 131 ? 0.3332 0.2710 0.2330 0.0012  -0.0096 0.0142  342 ILE B CB  
3759 C CG1 . ILE B 131 ? 0.3290 0.2606 0.2263 0.0008  -0.0062 0.0139  342 ILE B CG1 
3760 C CG2 . ILE B 131 ? 0.3394 0.2689 0.2293 0.0012  -0.0109 0.0154  342 ILE B CG2 
3761 C CD1 . ILE B 131 ? 0.3120 0.2414 0.2085 -0.0040 -0.0022 0.0129  342 ILE B CD1 
3762 N N   . ALA B 132 ? 0.3220 0.2782 0.2329 0.0035  -0.0164 0.0128  343 ALA B N   
3763 C CA  . ALA B 132 ? 0.3230 0.2837 0.2343 0.0033  -0.0193 0.0122  343 ALA B CA  
3764 C C   . ALA B 132 ? 0.3357 0.3032 0.2509 0.0078  -0.0237 0.0114  343 ALA B C   
3765 O O   . ALA B 132 ? 0.3406 0.3078 0.2514 0.0100  -0.0275 0.0116  343 ALA B O   
3766 C CB  . ALA B 132 ? 0.3211 0.2882 0.2390 -0.0011 -0.0170 0.0108  343 ALA B CB  
3767 N N   . ILE B 133 ? 0.3323 0.3065 0.2556 0.0093  -0.0232 0.0103  344 ILE B N   
3768 C CA  . ILE B 133 ? 0.3534 0.3358 0.2823 0.0133  -0.0270 0.0087  344 ILE B CA  
3769 C C   . ILE B 133 ? 0.3725 0.3488 0.2949 0.0189  -0.0305 0.0103  344 ILE B C   
3770 O O   . ILE B 133 ? 0.3906 0.3715 0.3137 0.0224  -0.0351 0.0096  344 ILE B O   
3771 C CB  . ILE B 133 ? 0.3418 0.3319 0.2804 0.0135  -0.0250 0.0070  344 ILE B CB  
3772 C CG1 . ILE B 133 ? 0.3505 0.3469 0.2950 0.0084  -0.0222 0.0057  344 ILE B CG1 
3773 C CG2 . ILE B 133 ? 0.3511 0.3489 0.2954 0.0182  -0.0287 0.0050  344 ILE B CG2 
3774 C CD1 . ILE B 133 ? 0.3420 0.3446 0.2942 0.0074  -0.0195 0.0044  344 ILE B CD1 
3775 N N   . LYS B 134 ? 0.3934 0.3592 0.3094 0.0198  -0.0285 0.0123  345 LYS B N   
3776 C CA  . LYS B 134 ? 0.4242 0.3816 0.3325 0.0251  -0.0313 0.0143  345 LYS B CA  
3777 C C   . LYS B 134 ? 0.4413 0.3924 0.3392 0.0250  -0.0339 0.0162  345 LYS B C   
3778 O O   . LYS B 134 ? 0.4523 0.4021 0.3461 0.0299  -0.0385 0.0173  345 LYS B O   
3779 C CB  . LYS B 134 ? 0.4323 0.3788 0.3356 0.0253  -0.0275 0.0156  345 LYS B CB  
3780 C CG  . LYS B 134 ? 0.4553 0.4054 0.3660 0.0280  -0.0263 0.0142  345 LYS B CG  
3781 C CD  . LYS B 134 ? 0.4856 0.4256 0.3917 0.0264  -0.0216 0.0148  345 LYS B CD  
3782 C CE  . LYS B 134 ? 0.5222 0.4662 0.4357 0.0285  -0.0201 0.0129  345 LYS B CE  
3783 N NZ  . LYS B 134 ? 0.5186 0.4761 0.4431 0.0259  -0.0193 0.0103  345 LYS B NZ  
3784 N N   . LEU B 135 ? 0.4468 0.3939 0.3404 0.0195  -0.0309 0.0165  346 LEU B N   
3785 C CA  . LEU B 135 ? 0.4648 0.4057 0.3481 0.0182  -0.0325 0.0179  346 LEU B CA  
3786 C C   . LEU B 135 ? 0.4730 0.4235 0.3588 0.0194  -0.0374 0.0165  346 LEU B C   
3787 O O   . LEU B 135 ? 0.4882 0.4345 0.3652 0.0218  -0.0412 0.0181  346 LEU B O   
3788 C CB  . LEU B 135 ? 0.4541 0.3904 0.3344 0.0116  -0.0276 0.0176  346 LEU B CB  
3789 C CG  . LEU B 135 ? 0.4664 0.3947 0.3349 0.0095  -0.0282 0.0188  346 LEU B CG  
3790 C CD1 . LEU B 135 ? 0.4713 0.3896 0.3339 0.0048  -0.0227 0.0193  346 LEU B CD1 
3791 C CD2 . LEU B 135 ? 0.4159 0.3530 0.2874 0.0068  -0.0301 0.0168  346 LEU B CD2 
3792 N N   . VAL B 136 ? 0.4690 0.4323 0.3663 0.0176  -0.0374 0.0136  347 VAL B N   
3793 C CA  . VAL B 136 ? 0.4847 0.4578 0.3849 0.0178  -0.0416 0.0114  347 VAL B CA  
3794 C C   . VAL B 136 ? 0.5117 0.4932 0.4173 0.0241  -0.0468 0.0104  347 VAL B C   
3795 O O   . VAL B 136 ? 0.5168 0.5086 0.4264 0.0244  -0.0505 0.0080  347 VAL B O   
3796 C CB  . VAL B 136 ? 0.4704 0.4532 0.3799 0.0123  -0.0388 0.0082  347 VAL B CB  
3797 C CG1 . VAL B 136 ? 0.4403 0.4161 0.3466 0.0065  -0.0335 0.0089  347 VAL B CG1 
3798 C CG2 . VAL B 136 ? 0.4394 0.4316 0.3611 0.0133  -0.0378 0.0062  347 VAL B CG2 
3799 N N   . LYS B 137 ? 0.5317 0.5097 0.4381 0.0289  -0.0471 0.0118  348 LYS B N   
3800 C CA  . LYS B 137 ? 0.5628 0.5478 0.4736 0.0357  -0.0525 0.0109  348 LYS B CA  
3801 C C   . LYS B 137 ? 0.5860 0.5661 0.4857 0.0398  -0.0582 0.0133  348 LYS B C   
3802 O O   . LYS B 137 ? 0.5934 0.5600 0.4803 0.0392  -0.0573 0.0168  348 LYS B O   
3803 C CB  . LYS B 137 ? 0.5642 0.5462 0.4789 0.0399  -0.0509 0.0115  348 LYS B CB  
3804 C CG  . LYS B 137 ? 0.6069 0.5970 0.5279 0.0472  -0.0562 0.0101  348 LYS B CG  
3805 C CD  . LYS B 137 ? 0.6195 0.6140 0.5510 0.0493  -0.0536 0.0081  348 LYS B CD  
3806 C CE  . LYS B 137 ? 0.6281 0.6344 0.5686 0.0558  -0.0589 0.0054  348 LYS B CE  
3807 N NZ  . LYS B 137 ? 0.6427 0.6439 0.5750 0.0631  -0.0653 0.0082  348 LYS B NZ  
3808 N N   . THR B 138 ? 0.6096 0.6011 0.5142 0.0438  -0.0641 0.0113  349 THR B N   
3809 C CA  . THR B 138 ? 0.6325 0.6228 0.5275 0.0472  -0.0703 0.0129  349 THR B CA  
3810 C C   . THR B 138 ? 0.6517 0.6426 0.5459 0.0569  -0.0768 0.0145  349 THR B C   
3811 O O   . THR B 138 ? 0.6554 0.6521 0.5599 0.0611  -0.0770 0.0129  349 THR B O   
3812 C CB  . THR B 138 ? 0.6315 0.6358 0.5317 0.0433  -0.0727 0.0088  349 THR B CB  
3813 O OG1 . THR B 138 ? 0.6458 0.6658 0.5618 0.0442  -0.0733 0.0041  349 THR B OG1 
3814 C CG2 . THR B 138 ? 0.6135 0.6148 0.5116 0.0342  -0.0670 0.0079  349 THR B CG2 
3815 N N   . SER B 142 ? 0.8115 0.8229 0.6790 0.0781  -0.1119 0.0176  353 SER B N   
3816 C CA  . SER B 142 ? 0.8260 0.8195 0.6728 0.0784  -0.1128 0.0236  353 SER B CA  
3817 C C   . SER B 142 ? 0.8243 0.8229 0.6637 0.0723  -0.1147 0.0218  353 SER B C   
3818 O O   . SER B 142 ? 0.8115 0.8242 0.6617 0.0657  -0.1128 0.0160  353 SER B O   
3819 C CB  . SER B 142 ? 0.8258 0.8004 0.6654 0.0737  -0.1041 0.0271  353 SER B CB  
3820 O OG  . SER B 142 ? 0.8216 0.7943 0.6581 0.0635  -0.0984 0.0253  353 SER B OG  
3821 N N   . PRO B 143 ? 0.8350 0.8215 0.6553 0.0740  -0.1181 0.0268  354 PRO B N   
3822 C CA  . PRO B 143 ? 0.8316 0.8238 0.6441 0.0689  -0.1209 0.0249  354 PRO B CA  
3823 C C   . PRO B 143 ? 0.8093 0.7958 0.6189 0.0573  -0.1124 0.0230  354 PRO B C   
3824 O O   . PRO B 143 ? 0.8138 0.8060 0.6193 0.0516  -0.1132 0.0203  354 PRO B O   
3825 C CB  . PRO B 143 ? 0.8584 0.8373 0.6502 0.0751  -0.1268 0.0315  354 PRO B CB  
3826 C CG  . PRO B 143 ? 0.8706 0.8295 0.6556 0.0795  -0.1230 0.0375  354 PRO B CG  
3827 C CD  . PRO B 143 ? 0.8526 0.8172 0.6566 0.0787  -0.1175 0.0341  354 PRO B CD  
3828 N N   . GLU B 144 ? 0.7804 0.7560 0.5925 0.0540  -0.1044 0.0243  355 GLU B N   
3829 C CA  . GLU B 144 ? 0.7563 0.7255 0.5666 0.0439  -0.0960 0.0228  355 GLU B CA  
3830 C C   . GLU B 144 ? 0.7094 0.6940 0.5381 0.0380  -0.0921 0.0164  355 GLU B C   
3831 O O   . GLU B 144 ? 0.6935 0.6868 0.5364 0.0412  -0.0921 0.0144  355 GLU B O   
3832 C CB  . GLU B 144 ? 0.7630 0.7145 0.5682 0.0439  -0.0896 0.0270  355 GLU B CB  
3833 C CG  . GLU B 144 ? 0.7881 0.7264 0.5822 0.0359  -0.0830 0.0281  355 GLU B CG  
3834 C CD  . GLU B 144 ? 0.8057 0.7275 0.5952 0.0360  -0.0770 0.0317  355 GLU B CD  
3835 O OE1 . GLU B 144 ? 0.8492 0.7569 0.6255 0.0315  -0.0727 0.0338  355 GLU B OE1 
3836 O OE2 . GLU B 144 ? 0.8203 0.7436 0.6195 0.0403  -0.0763 0.0319  355 GLU B OE2 
3837 N N   . HIS B 145 ? 0.6738 0.6611 0.5017 0.0295  -0.0885 0.0131  356 HIS B N   
3838 C CA  . HIS B 145 ? 0.6364 0.6356 0.4799 0.0232  -0.0838 0.0074  356 HIS B CA  
3839 C C   . HIS B 145 ? 0.6096 0.6016 0.4600 0.0215  -0.0765 0.0085  356 HIS B C   
3840 O O   . HIS B 145 ? 0.5943 0.5709 0.4353 0.0210  -0.0729 0.0125  356 HIS B O   
3841 C CB  . HIS B 145 ? 0.6328 0.6326 0.4717 0.0145  -0.0807 0.0043  356 HIS B CB  
3842 C CG  . HIS B 145 ? 0.6362 0.6487 0.4901 0.0083  -0.0767 -0.0018 356 HIS B CG  
3843 N ND1 . HIS B 145 ? 0.6299 0.6389 0.4918 0.0036  -0.0689 -0.0026 356 HIS B ND1 
3844 C CD2 . HIS B 145 ? 0.6387 0.6669 0.5006 0.0060  -0.0792 -0.0074 356 HIS B CD2 
3845 C CE1 . HIS B 145 ? 0.6187 0.6396 0.4923 -0.0011 -0.0667 -0.0080 356 HIS B CE1 
3846 N NE2 . HIS B 145 ? 0.6447 0.6775 0.5189 -0.0001 -0.0726 -0.0112 356 HIS B NE2 
3847 N N   . PRO B 146 ? 0.5821 0.5853 0.4488 0.0204  -0.0743 0.0047  357 PRO B N   
3848 C CA  . PRO B 146 ? 0.5656 0.5631 0.4387 0.0188  -0.0678 0.0057  357 PRO B CA  
3849 C C   . PRO B 146 ? 0.5536 0.5383 0.4192 0.0126  -0.0612 0.0074  357 PRO B C   
3850 O O   . PRO B 146 ? 0.5496 0.5229 0.4113 0.0137  -0.0579 0.0107  357 PRO B O   
3851 C CB  . PRO B 146 ? 0.5573 0.5697 0.4471 0.0160  -0.0659 0.0006  357 PRO B CB  
3852 C CG  . PRO B 146 ? 0.5598 0.5860 0.4541 0.0198  -0.0728 -0.0024 357 PRO B CG  
3853 C CD  . PRO B 146 ? 0.5776 0.5990 0.4572 0.0220  -0.0783 -0.0001 357 PRO B CD  
3854 N N   . LEU B 147 ? 0.5404 0.5272 0.4042 0.0061  -0.0591 0.0047  358 LEU B N   
3855 C CA  . LEU B 147 ? 0.5315 0.5078 0.3899 -0.0002 -0.0525 0.0053  358 LEU B CA  
3856 C C   . LEU B 147 ? 0.5428 0.5032 0.3852 0.0006  -0.0521 0.0097  358 LEU B C   
3857 O O   . LEU B 147 ? 0.5306 0.4812 0.3710 -0.0021 -0.0464 0.0111  358 LEU B O   
3858 C CB  . LEU B 147 ? 0.5285 0.5104 0.3880 -0.0071 -0.0506 0.0011  358 LEU B CB  
3859 C CG  . LEU B 147 ? 0.5136 0.5091 0.3888 -0.0097 -0.0490 -0.0036 358 LEU B CG  
3860 C CD1 . LEU B 147 ? 0.4727 0.4726 0.3481 -0.0165 -0.0469 -0.0079 358 LEU B CD1 
3861 C CD2 . LEU B 147 ? 0.4708 0.4645 0.3557 -0.0107 -0.0434 -0.0030 358 LEU B CD2 
3862 N N   . ASP B 148 ? 0.5546 0.5126 0.3854 0.0041  -0.0579 0.0116  359 ASP B N   
3863 C CA  . ASP B 148 ? 0.5661 0.5081 0.3801 0.0057  -0.0579 0.0163  359 ASP B CA  
3864 C C   . ASP B 148 ? 0.5591 0.4928 0.3737 0.0107  -0.0568 0.0199  359 ASP B C   
3865 O O   . ASP B 148 ? 0.5593 0.4789 0.3650 0.0093  -0.0526 0.0226  359 ASP B O   
3866 C CB  . ASP B 148 ? 0.5915 0.5338 0.3935 0.0097  -0.0654 0.0180  359 ASP B CB  
3867 C CG  . ASP B 148 ? 0.6225 0.5675 0.4177 0.0034  -0.0654 0.0152  359 ASP B CG  
3868 O OD1 . ASP B 148 ? 0.6771 0.6126 0.4652 -0.0030 -0.0595 0.0150  359 ASP B OD1 
3869 O OD2 . ASP B 148 ? 0.6431 0.6000 0.4399 0.0047  -0.0712 0.0127  359 ASP B OD2 
3870 N N   . GLN B 149 ? 0.5455 0.4885 0.3709 0.0163  -0.0603 0.0194  360 GLN B N   
3871 C CA  . GLN B 149 ? 0.5500 0.4871 0.3776 0.0216  -0.0596 0.0221  360 GLN B CA  
3872 C C   . GLN B 149 ? 0.5205 0.4538 0.3549 0.0169  -0.0518 0.0212  360 GLN B C   
3873 O O   . GLN B 149 ? 0.5215 0.4423 0.3496 0.0174  -0.0485 0.0240  360 GLN B O   
3874 C CB  . GLN B 149 ? 0.5487 0.4990 0.3875 0.0283  -0.0654 0.0208  360 GLN B CB  
3875 C CG  . GLN B 149 ? 0.5867 0.5361 0.4335 0.0331  -0.0641 0.0217  360 GLN B CG  
3876 C CD  . GLN B 149 ? 0.6346 0.5881 0.4827 0.0423  -0.0711 0.0230  360 GLN B CD  
3877 O OE1 . GLN B 149 ? 0.6697 0.6178 0.5193 0.0472  -0.0706 0.0249  360 GLN B OE1 
3878 N NE2 . GLN B 149 ? 0.6480 0.6109 0.4951 0.0448  -0.0778 0.0218  360 GLN B NE2 
3879 N N   . HIS B 150 ? 0.4948 0.4382 0.3409 0.0120  -0.0488 0.0174  361 HIS B N   
3880 C CA  . HIS B 150 ? 0.4683 0.4094 0.3209 0.0076  -0.0420 0.0165  361 HIS B CA  
3881 C C   . HIS B 150 ? 0.4714 0.3999 0.3134 0.0026  -0.0373 0.0177  361 HIS B C   
3882 O O   . HIS B 150 ? 0.4703 0.3904 0.3108 0.0017  -0.0329 0.0190  361 HIS B O   
3883 C CB  . HIS B 150 ? 0.4536 0.4069 0.3193 0.0032  -0.0399 0.0125  361 HIS B CB  
3884 C CG  . HIS B 150 ? 0.4273 0.3942 0.3040 0.0066  -0.0437 0.0103  361 HIS B CG  
3885 N ND1 . HIS B 150 ? 0.4322 0.4010 0.3106 0.0133  -0.0478 0.0116  361 HIS B ND1 
3886 C CD2 . HIS B 150 ? 0.4151 0.3942 0.3023 0.0039  -0.0435 0.0065  361 HIS B CD2 
3887 C CE1 . HIS B 150 ? 0.4431 0.4256 0.3327 0.0146  -0.0502 0.0085  361 HIS B CE1 
3888 N NE2 . HIS B 150 ? 0.4293 0.4180 0.3242 0.0087  -0.0475 0.0054  361 HIS B NE2 
3889 N N   . TYR B 151 ? 0.4634 0.3912 0.2985 -0.0011 -0.0378 0.0166  362 TYR B N   
3890 C CA  . TYR B 151 ? 0.4740 0.3903 0.2986 -0.0060 -0.0332 0.0173  362 TYR B CA  
3891 C C   . TYR B 151 ? 0.4865 0.3887 0.2997 -0.0030 -0.0327 0.0212  362 TYR B C   
3892 O O   . TYR B 151 ? 0.4679 0.3622 0.2798 -0.0059 -0.0272 0.0214  362 TYR B O   
3893 C CB  . TYR B 151 ? 0.4870 0.4035 0.3028 -0.0094 -0.0350 0.0161  362 TYR B CB  
3894 C CG  . TYR B 151 ? 0.4944 0.3994 0.2996 -0.0153 -0.0297 0.0160  362 TYR B CG  
3895 C CD1 . TYR B 151 ? 0.4862 0.3903 0.2980 -0.0205 -0.0231 0.0138  362 TYR B CD1 
3896 C CD2 . TYR B 151 ? 0.5617 0.4571 0.3501 -0.0157 -0.0314 0.0181  362 TYR B CD2 
3897 C CE1 . TYR B 151 ? 0.4945 0.3892 0.2977 -0.0261 -0.0180 0.0130  362 TYR B CE1 
3898 C CE2 . TYR B 151 ? 0.5457 0.4308 0.3243 -0.0219 -0.0260 0.0175  362 TYR B CE2 
3899 C CZ  . TYR B 151 ? 0.5015 0.3865 0.2880 -0.0270 -0.0192 0.0147  362 TYR B CZ  
3900 O OH  . TYR B 151 ? 0.4537 0.3294 0.2320 -0.0330 -0.0135 0.0135  362 TYR B OH  
3901 N N   . ARG B 152 ? 0.5169 0.4159 0.3219 0.0028  -0.0383 0.0242  363 ARG B N   
3902 C CA  . ARG B 152 ? 0.5449 0.4286 0.3368 0.0058  -0.0379 0.0283  363 ARG B CA  
3903 C C   . ARG B 152 ? 0.5411 0.4214 0.3396 0.0073  -0.0341 0.0288  363 ARG B C   
3904 O O   . ARG B 152 ? 0.5526 0.4204 0.3436 0.0049  -0.0292 0.0300  363 ARG B O   
3905 C CB  . ARG B 152 ? 0.5655 0.4481 0.3496 0.0132  -0.0454 0.0315  363 ARG B CB  
3906 C CG  . ARG B 152 ? 0.6139 0.4791 0.3836 0.0174  -0.0452 0.0364  363 ARG B CG  
3907 C CD  . ARG B 152 ? 0.6677 0.5307 0.4270 0.0246  -0.0531 0.0400  363 ARG B CD  
3908 N NE  . ARG B 152 ? 0.6942 0.5732 0.4663 0.0306  -0.0597 0.0386  363 ARG B NE  
3909 C CZ  . ARG B 152 ? 0.7141 0.5967 0.4962 0.0364  -0.0609 0.0388  363 ARG B CZ  
3910 N NH1 . ARG B 152 ? 0.7096 0.6075 0.5034 0.0413  -0.0666 0.0368  363 ARG B NH1 
3911 N NH2 . ARG B 152 ? 0.7377 0.6089 0.5184 0.0371  -0.0561 0.0406  363 ARG B NH2 
3912 N N   . ASN B 153 ? 0.5311 0.4228 0.3437 0.0107  -0.0360 0.0274  364 ASN B N   
3913 C CA  . ASN B 153 ? 0.5292 0.4194 0.3491 0.0120  -0.0327 0.0273  364 ASN B CA  
3914 C C   . ASN B 153 ? 0.5146 0.4033 0.3386 0.0054  -0.0256 0.0252  364 ASN B C   
3915 O O   . ASN B 153 ? 0.5134 0.3975 0.3395 0.0056  -0.0222 0.0254  364 ASN B O   
3916 C CB  . ASN B 153 ? 0.5251 0.4291 0.3595 0.0162  -0.0358 0.0257  364 ASN B CB  
3917 C CG  . ASN B 153 ? 0.5673 0.4731 0.3993 0.0239  -0.0426 0.0276  364 ASN B CG  
3918 O OD1 . ASN B 153 ? 0.6287 0.5232 0.4479 0.0270  -0.0446 0.0310  364 ASN B OD1 
3919 N ND2 . ASN B 153 ? 0.6019 0.5220 0.4464 0.0269  -0.0462 0.0254  364 ASN B ND2 
3920 N N   . LEU B 154 ? 0.4965 0.3889 0.3219 -0.0003 -0.0235 0.0229  365 LEU B N   
3921 C CA  . LEU B 154 ? 0.4786 0.3694 0.3077 -0.0061 -0.0171 0.0209  365 LEU B CA  
3922 C C   . LEU B 154 ? 0.4861 0.3620 0.3029 -0.0088 -0.0128 0.0221  365 LEU B C   
3923 O O   . LEU B 154 ? 0.4694 0.3432 0.2896 -0.0123 -0.0075 0.0205  365 LEU B O   
3924 C CB  . LEU B 154 ? 0.4684 0.3656 0.3013 -0.0114 -0.0156 0.0181  365 LEU B CB  
3925 C CG  . LEU B 154 ? 0.4520 0.3633 0.2980 -0.0117 -0.0172 0.0157  365 LEU B CG  
3926 C CD1 . LEU B 154 ? 0.4050 0.3184 0.2519 -0.0176 -0.0143 0.0131  365 LEU B CD1 
3927 C CD2 . LEU B 154 ? 0.4524 0.3696 0.3105 -0.0106 -0.0153 0.0151  365 LEU B CD2 
3928 N N   . HIS B 155 ? 0.4921 0.3580 0.2945 -0.0074 -0.0149 0.0247  366 HIS B N   
3929 C CA  . HIS B 155 ? 0.5074 0.3579 0.2961 -0.0106 -0.0104 0.0258  366 HIS B CA  
3930 C C   . HIS B 155 ? 0.4960 0.3470 0.2873 -0.0181 -0.0043 0.0224  366 HIS B C   
3931 O O   . HIS B 155 ? 0.4862 0.3305 0.2762 -0.0215 0.0013  0.0213  366 HIS B O   
3932 C CB  . HIS B 155 ? 0.5241 0.3654 0.3100 -0.0077 -0.0085 0.0277  366 HIS B CB  
3933 C CG  . HIS B 155 ? 0.5609 0.3989 0.3418 0.0000  -0.0141 0.0314  366 HIS B CG  
3934 N ND1 . HIS B 155 ? 0.6024 0.4512 0.3949 0.0055  -0.0184 0.0313  366 HIS B ND1 
3935 C CD2 . HIS B 155 ? 0.6053 0.4303 0.3708 0.0034  -0.0163 0.0353  366 HIS B CD2 
3936 C CE1 . HIS B 155 ? 0.5971 0.4405 0.3827 0.0122  -0.0230 0.0347  366 HIS B CE1 
3937 N NE2 . HIS B 155 ? 0.6363 0.4650 0.4052 0.0113  -0.0221 0.0375  366 HIS B NE2 
3938 N N   . CYS B 156 ? 0.4858 0.3451 0.2809 -0.0208 -0.0056 0.0204  367 CYS B N   
3939 C CA  . CYS B 156 ? 0.4780 0.3398 0.2775 -0.0273 -0.0005 0.0168  367 CYS B CA  
3940 C C   . CYS B 156 ? 0.4859 0.3507 0.2815 -0.0297 -0.0024 0.0157  367 CYS B C   
3941 O O   . CYS B 156 ? 0.4798 0.3554 0.2826 -0.0275 -0.0067 0.0151  367 CYS B O   
3942 C CB  . CYS B 156 ? 0.4631 0.3371 0.2800 -0.0274 0.0008  0.0144  367 CYS B CB  
3943 S SG  . CYS B 156 ? 0.4600 0.3362 0.2830 -0.0344 0.0073  0.0102  367 CYS B SG  
3944 N N   . ALA B 157 ? 0.4877 0.3430 0.2714 -0.0345 0.0010  0.0151  368 ALA B N   
3945 C CA  . ALA B 157 ? 0.4986 0.3555 0.2768 -0.0378 0.0000  0.0136  368 ALA B CA  
3946 C C   . ALA B 157 ? 0.4757 0.3434 0.2680 -0.0418 0.0030  0.0092  368 ALA B C   
3947 O O   . ALA B 157 ? 0.4712 0.3398 0.2715 -0.0445 0.0081  0.0070  368 ALA B O   
3948 C CB  . ALA B 157 ? 0.5107 0.3532 0.2714 -0.0424 0.0038  0.0140  368 ALA B CB  
3949 N N   . LEU B 158 ? 0.4642 0.3405 0.2597 -0.0418 -0.0004 0.0079  369 LEU B N   
3950 C CA  . LEU B 158 ? 0.4490 0.3344 0.2564 -0.0454 0.0022  0.0039  369 LEU B CA  
3951 C C   . LEU B 158 ? 0.4664 0.3520 0.2662 -0.0495 0.0017  0.0017  369 LEU B C   
3952 O O   . LEU B 158 ? 0.4649 0.3551 0.2616 -0.0470 -0.0038 0.0026  369 LEU B O   
3953 C CB  . LEU B 158 ? 0.4228 0.3205 0.2445 -0.0413 -0.0014 0.0039  369 LEU B CB  
3954 C CG  . LEU B 158 ? 0.3982 0.2976 0.2288 -0.0376 -0.0010 0.0056  369 LEU B CG  
3955 C CD1 . LEU B 158 ? 0.3686 0.2798 0.2113 -0.0338 -0.0047 0.0056  369 LEU B CD1 
3956 C CD2 . LEU B 158 ? 0.3649 0.2629 0.2020 -0.0413 0.0054  0.0034  369 LEU B CD2 
3957 N N   . ARG B 159 ? 0.4748 0.3562 0.2720 -0.0557 0.0075  -0.0015 370 ARG B N   
3958 C CA  . ARG B 159 ? 0.5004 0.3814 0.2894 -0.0602 0.0075  -0.0039 370 ARG B CA  
3959 C C   . ARG B 159 ? 0.4878 0.3753 0.2876 -0.0654 0.0123  -0.0091 370 ARG B C   
3960 O O   . ARG B 159 ? 0.4877 0.3733 0.2938 -0.0685 0.0183  -0.0115 370 ARG B O   
3961 C CB  . ARG B 159 ? 0.5203 0.3880 0.2901 -0.0633 0.0092  -0.0027 370 ARG B CB  
3962 C CG  . ARG B 159 ? 0.5484 0.4053 0.3135 -0.0638 0.0137  -0.0011 370 ARG B CG  
3963 C CD  . ARG B 159 ? 0.5905 0.4332 0.3345 -0.0662 0.0146  0.0009  370 ARG B CD  
3964 N NE  . ARG B 159 ? 0.6357 0.4705 0.3709 -0.0604 0.0108  0.0064  370 ARG B NE  
3965 C CZ  . ARG B 159 ? 0.6166 0.4432 0.3506 -0.0598 0.0143  0.0079  370 ARG B CZ  
3966 N NH1 . ARG B 159 ? 0.6106 0.4361 0.3513 -0.0645 0.0214  0.0043  370 ARG B NH1 
3967 N NH2 . ARG B 159 ? 0.6599 0.4795 0.3861 -0.0543 0.0106  0.0127  370 ARG B NH2 
3968 N N   . PRO B 160 ? 0.4902 0.3859 0.2931 -0.0661 0.0095  -0.0112 371 PRO B N   
3969 C CA  . PRO B 160 ? 0.4833 0.3850 0.2976 -0.0703 0.0140  -0.0160 371 PRO B CA  
3970 C C   . PRO B 160 ? 0.4930 0.3875 0.3003 -0.0771 0.0202  -0.0194 371 PRO B C   
3971 O O   . PRO B 160 ? 0.5140 0.4013 0.3058 -0.0792 0.0195  -0.0187 371 PRO B O   
3972 C CB  . PRO B 160 ? 0.4790 0.3896 0.2945 -0.0702 0.0095  -0.0176 371 PRO B CB  
3973 C CG  . PRO B 160 ? 0.4990 0.4099 0.3062 -0.0647 0.0020  -0.0133 371 PRO B CG  
3974 C CD  . PRO B 160 ? 0.4969 0.3959 0.2915 -0.0638 0.0027  -0.0098 371 PRO B CD  
3975 N N   . LEU B 161 ? 0.4898 0.3858 0.3081 -0.0802 0.0263  -0.0230 372 LEU B N   
3976 C CA  . LEU B 161 ? 0.4948 0.3845 0.3081 -0.0866 0.0328  -0.0269 372 LEU B CA  
3977 C C   . LEU B 161 ? 0.5061 0.4012 0.3250 -0.0911 0.0355  -0.0320 372 LEU B C   
3978 O O   . LEU B 161 ? 0.4766 0.3800 0.3079 -0.0892 0.0343  -0.0329 372 LEU B O   
3979 C CB  . LEU B 161 ? 0.4921 0.3789 0.3135 -0.0871 0.0385  -0.0279 372 LEU B CB  
3980 C CG  . LEU B 161 ? 0.4975 0.3774 0.3121 -0.0845 0.0378  -0.0241 372 LEU B CG  
3981 C CD1 . LEU B 161 ? 0.4719 0.3516 0.2970 -0.0856 0.0436  -0.0263 372 LEU B CD1 
3982 C CD2 . LEU B 161 ? 0.5240 0.3927 0.3180 -0.0877 0.0378  -0.0230 372 LEU B CD2 
3983 N N   . ASP B 162 ? 0.5192 0.4089 0.3285 -0.0974 0.0396  -0.0356 373 ASP B N   
3984 C CA  . ASP B 162 ? 0.5253 0.4188 0.3379 -0.1026 0.0428  -0.0411 373 ASP B CA  
3985 C C   . ASP B 162 ? 0.5035 0.4003 0.3336 -0.1033 0.0488  -0.0445 373 ASP B C   
3986 O O   . ASP B 162 ? 0.5121 0.4051 0.3460 -0.1035 0.0530  -0.0448 373 ASP B O   
3987 C CB  . ASP B 162 ? 0.5489 0.4347 0.3459 -0.1094 0.0463  -0.0440 373 ASP B CB  
3988 C CG  . ASP B 162 ? 0.5775 0.4670 0.3740 -0.1151 0.0486  -0.0496 373 ASP B CG  
3989 O OD1 . ASP B 162 ? 0.5774 0.4750 0.3869 -0.1144 0.0485  -0.0518 373 ASP B OD1 
3990 O OD2 . ASP B 162 ? 0.6668 0.5508 0.4493 -0.1207 0.0507  -0.0520 373 ASP B OD2 
3991 N N   . HIS B 163 ? 0.5007 0.4045 0.3416 -0.1036 0.0491  -0.0470 374 HIS B N   
3992 C CA  . HIS B 163 ? 0.5022 0.4085 0.3597 -0.1035 0.0546  -0.0497 374 HIS B CA  
3993 C C   . HIS B 163 ? 0.5124 0.4144 0.3709 -0.1097 0.0627  -0.0556 374 HIS B C   
3994 O O   . HIS B 163 ? 0.5033 0.4062 0.3750 -0.1093 0.0675  -0.0578 374 HIS B O   
3995 C CB  . HIS B 163 ? 0.4987 0.4125 0.3666 -0.1023 0.0532  -0.0507 374 HIS B CB  
3996 C CG  . HIS B 163 ? 0.5161 0.4350 0.3887 -0.0957 0.0469  -0.0455 374 HIS B CG  
3997 N ND1 . HIS B 163 ? 0.5196 0.4436 0.4058 -0.0930 0.0473  -0.0452 374 HIS B ND1 
3998 C CD2 . HIS B 163 ? 0.5138 0.4329 0.3790 -0.0914 0.0406  -0.0406 374 HIS B CD2 
3999 C CE1 . HIS B 163 ? 0.5025 0.4304 0.3897 -0.0877 0.0415  -0.0406 374 HIS B CE1 
4000 N NE2 . HIS B 163 ? 0.5219 0.4471 0.3968 -0.0865 0.0373  -0.0379 374 HIS B NE2 
4001 N N   . GLU B 164 ? 0.5320 0.4295 0.3762 -0.1154 0.0640  -0.0582 375 GLU B N   
4002 C CA  . GLU B 164 ? 0.5422 0.4348 0.3849 -0.1220 0.0718  -0.0640 375 GLU B CA  
4003 C C   . GLU B 164 ? 0.5351 0.4205 0.3699 -0.1230 0.0741  -0.0630 375 GLU B C   
4004 O O   . GLU B 164 ? 0.5345 0.4154 0.3663 -0.1287 0.0806  -0.0678 375 GLU B O   
4005 C CB  . GLU B 164 ? 0.5620 0.4538 0.3928 -0.1285 0.0725  -0.0681 375 GLU B CB  
4006 C CG  . GLU B 164 ? 0.5966 0.4959 0.4334 -0.1279 0.0697  -0.0692 375 GLU B CG  
4007 C CD  . GLU B 164 ? 0.6683 0.5678 0.4991 -0.1356 0.0733  -0.0756 375 GLU B CD  
4008 O OE1 . GLU B 164 ? 0.6925 0.5881 0.5062 -0.1398 0.0722  -0.0763 375 GLU B OE1 
4009 O OE2 . GLU B 164 ? 0.7209 0.6239 0.5638 -0.1375 0.0774  -0.0801 375 GLU B OE2 
4010 N N   . SER B 165 ? 0.5209 0.4050 0.3523 -0.1177 0.0692  -0.0572 376 SER B N   
4011 C CA  . SER B 165 ? 0.5106 0.3875 0.3344 -0.1189 0.0717  -0.0563 376 SER B CA  
4012 C C   . SER B 165 ? 0.4910 0.3697 0.3302 -0.1182 0.0772  -0.0589 376 SER B C   
4013 O O   . SER B 165 ? 0.4737 0.3590 0.3290 -0.1145 0.0771  -0.0591 376 SER B O   
4014 C CB  . SER B 165 ? 0.5219 0.3964 0.3378 -0.1134 0.0650  -0.0493 376 SER B CB  
4015 O OG  . SER B 165 ? 0.4768 0.3580 0.3069 -0.1066 0.0616  -0.0461 376 SER B OG  
4016 N N   . TYR B 166 ? 0.4832 0.3557 0.3165 -0.1217 0.0818  -0.0608 377 TYR B N   
4017 C CA  . TYR B 166 ? 0.4712 0.3453 0.3169 -0.1210 0.0866  -0.0632 377 TYR B CA  
4018 C C   . TYR B 166 ? 0.4675 0.3467 0.3237 -0.1134 0.0820  -0.0583 377 TYR B C   
4019 O O   . TYR B 166 ? 0.4529 0.3384 0.3258 -0.1104 0.0836  -0.0597 377 TYR B O   
4020 C CB  . TYR B 166 ? 0.4793 0.3449 0.3130 -0.1264 0.0914  -0.0653 377 TYR B CB  
4021 C CG  . TYR B 166 ? 0.4453 0.3136 0.2922 -0.1264 0.0967  -0.0688 377 TYR B CG  
4022 C CD1 . TYR B 166 ? 0.4098 0.2831 0.2712 -0.1284 0.1025  -0.0750 377 TYR B CD1 
4023 C CD2 . TYR B 166 ? 0.3993 0.2660 0.2453 -0.1238 0.0956  -0.0661 377 TYR B CD2 
4024 C CE1 . TYR B 166 ? 0.3988 0.2759 0.2734 -0.1279 0.1070  -0.0786 377 TYR B CE1 
4025 C CE2 . TYR B 166 ? 0.3905 0.2612 0.2494 -0.1238 0.1001  -0.0698 377 TYR B CE2 
4026 C CZ  . TYR B 166 ? 0.4026 0.2790 0.2760 -0.1256 0.1055  -0.0760 377 TYR B CZ  
4027 O OH  . TYR B 166 ? 0.4802 0.3618 0.3670 -0.1250 0.1094  -0.0797 377 TYR B OH  
4028 N N   . GLU B 167 ? 0.4826 0.3590 0.3287 -0.1100 0.0761  -0.0525 378 GLU B N   
4029 C CA  . GLU B 167 ? 0.4698 0.3502 0.3236 -0.1033 0.0718  -0.0479 378 GLU B CA  
4030 C C   . GLU B 167 ? 0.4529 0.3423 0.3216 -0.0985 0.0687  -0.0467 378 GLU B C   
4031 O O   . GLU B 167 ? 0.4387 0.3337 0.3213 -0.0945 0.0688  -0.0462 378 GLU B O   
4032 C CB  . GLU B 167 ? 0.4837 0.3587 0.3230 -0.1008 0.0661  -0.0422 378 GLU B CB  
4033 C CG  . GLU B 167 ? 0.5515 0.4154 0.3729 -0.1055 0.0687  -0.0423 378 GLU B CG  
4034 C CD  . GLU B 167 ? 0.6302 0.4886 0.4380 -0.1117 0.0708  -0.0451 378 GLU B CD  
4035 O OE1 . GLU B 167 ? 0.6809 0.5423 0.4859 -0.1106 0.0664  -0.0438 378 GLU B OE1 
4036 O OE2 . GLU B 167 ? 0.6868 0.5384 0.4867 -0.1180 0.0769  -0.0488 378 GLU B OE2 
4037 N N   . PHE B 168 ? 0.4392 0.3300 0.3047 -0.0991 0.0662  -0.0465 379 PHE B N   
4038 C CA  . PHE B 168 ? 0.4298 0.3280 0.3081 -0.0955 0.0642  -0.0459 379 PHE B CA  
4039 C C   . PHE B 168 ? 0.4284 0.3300 0.3220 -0.0961 0.0697  -0.0500 379 PHE B C   
4040 O O   . PHE B 168 ? 0.4107 0.3176 0.3172 -0.0913 0.0685  -0.0482 379 PHE B O   
4041 C CB  . PHE B 168 ? 0.4354 0.3345 0.3075 -0.0977 0.0619  -0.0466 379 PHE B CB  
4042 C CG  . PHE B 168 ? 0.4403 0.3463 0.3232 -0.0940 0.0591  -0.0452 379 PHE B CG  
4043 C CD1 . PHE B 168 ? 0.4526 0.3619 0.3333 -0.0894 0.0523  -0.0404 379 PHE B CD1 
4044 C CD2 . PHE B 168 ? 0.4592 0.3681 0.3546 -0.0951 0.0634  -0.0488 379 PHE B CD2 
4045 C CE1 . PHE B 168 ? 0.4465 0.3620 0.3371 -0.0865 0.0502  -0.0394 379 PHE B CE1 
4046 C CE2 . PHE B 168 ? 0.4597 0.3738 0.3645 -0.0920 0.0614  -0.0474 379 PHE B CE2 
4047 C CZ  . PHE B 168 ? 0.4779 0.3955 0.3802 -0.0880 0.0549  -0.0428 379 PHE B CZ  
4048 N N   . LYS B 169 ? 0.4366 0.3348 0.3287 -0.1019 0.0760  -0.0556 380 LYS B N   
4049 C CA  . LYS B 169 ? 0.4299 0.3310 0.3367 -0.1025 0.0818  -0.0602 380 LYS B CA  
4050 C C   . LYS B 169 ? 0.4128 0.3171 0.3301 -0.0982 0.0822  -0.0591 380 LYS B C   
4051 O O   . LYS B 169 ? 0.4133 0.3226 0.3451 -0.0942 0.0827  -0.0590 380 LYS B O   
4052 C CB  . LYS B 169 ? 0.4485 0.3453 0.3511 -0.1099 0.0889  -0.0669 380 LYS B CB  
4053 C CG  . LYS B 169 ? 0.4472 0.3470 0.3658 -0.1103 0.0951  -0.0721 380 LYS B CG  
4054 C CD  . LYS B 169 ? 0.4572 0.3539 0.3744 -0.1160 0.1022  -0.0783 380 LYS B CD  
4055 C CE  . LYS B 169 ? 0.4704 0.3677 0.3890 -0.1141 0.1021  -0.0772 380 LYS B CE  
4056 N NZ  . LYS B 169 ? 0.4375 0.3340 0.3602 -0.1190 0.1098  -0.0842 380 LYS B NZ  
4057 N N   . VAL B 170 ? 0.4068 0.3079 0.3163 -0.0994 0.0822  -0.0584 381 VAL B N   
4058 C CA  . VAL B 170 ? 0.4042 0.3089 0.3227 -0.0961 0.0827  -0.0581 381 VAL B CA  
4059 C C   . VAL B 170 ? 0.3844 0.2945 0.3097 -0.0887 0.0765  -0.0522 381 VAL B C   
4060 O O   . VAL B 170 ? 0.3801 0.2962 0.3192 -0.0846 0.0766  -0.0520 381 VAL B O   
4061 C CB  . VAL B 170 ? 0.4129 0.3119 0.3194 -0.0995 0.0841  -0.0585 381 VAL B CB  
4062 C CG1 . VAL B 170 ? 0.4007 0.3042 0.3164 -0.0965 0.0845  -0.0586 381 VAL B CG1 
4063 C CG2 . VAL B 170 ? 0.4353 0.3288 0.3347 -0.1072 0.0907  -0.0644 381 VAL B CG2 
4064 N N   . ILE B 171 ? 0.3809 0.2892 0.2966 -0.0870 0.0710  -0.0474 382 ILE B N   
4065 C CA  . ILE B 171 ? 0.3632 0.2763 0.2842 -0.0805 0.0653  -0.0420 382 ILE B CA  
4066 C C   . ILE B 171 ? 0.3571 0.2753 0.2903 -0.0774 0.0648  -0.0415 382 ILE B C   
4067 O O   . ILE B 171 ? 0.3412 0.2644 0.2848 -0.0725 0.0632  -0.0393 382 ILE B O   
4068 C CB  . ILE B 171 ? 0.3621 0.2721 0.2702 -0.0795 0.0599  -0.0375 382 ILE B CB  
4069 C CG1 . ILE B 171 ? 0.3679 0.2721 0.2653 -0.0816 0.0607  -0.0374 382 ILE B CG1 
4070 C CG2 . ILE B 171 ? 0.3398 0.2552 0.2540 -0.0733 0.0544  -0.0326 382 ILE B CG2 
4071 C CD1 . ILE B 171 ? 0.3634 0.2621 0.2457 -0.0815 0.0564  -0.0338 382 ILE B CD1 
4072 N N   . SER B 172 ? 0.3658 0.2824 0.2979 -0.0805 0.0668  -0.0439 383 SER B N   
4073 C CA  . SER B 172 ? 0.3691 0.2891 0.3133 -0.0784 0.0680  -0.0445 383 SER B CA  
4074 C C   . SER B 172 ? 0.3615 0.2843 0.3194 -0.0764 0.0720  -0.0468 383 SER B C   
4075 O O   . SER B 172 ? 0.3528 0.2792 0.3208 -0.0715 0.0706  -0.0443 383 SER B O   
4076 C CB  . SER B 172 ? 0.3806 0.2981 0.3220 -0.0832 0.0710  -0.0482 383 SER B CB  
4077 O OG  . SER B 172 ? 0.4176 0.3340 0.3476 -0.0844 0.0668  -0.0461 383 SER B OG  
4078 N N   . GLN B 173 ? 0.3626 0.2837 0.3207 -0.0802 0.0769  -0.0517 384 GLN B N   
4079 C CA  . GLN B 173 ? 0.3642 0.2891 0.3365 -0.0779 0.0805  -0.0545 384 GLN B CA  
4080 C C   . GLN B 173 ? 0.3536 0.2838 0.3315 -0.0723 0.0767  -0.0507 384 GLN B C   
4081 O O   . GLN B 173 ? 0.3695 0.3044 0.3601 -0.0678 0.0770  -0.0505 384 GLN B O   
4082 C CB  . GLN B 173 ? 0.3648 0.2877 0.3366 -0.0835 0.0869  -0.0612 384 GLN B CB  
4083 C CG  . GLN B 173 ? 0.3834 0.3027 0.3552 -0.0884 0.0922  -0.0663 384 GLN B CG  
4084 C CD  . GLN B 173 ? 0.3739 0.2912 0.3453 -0.0943 0.0991  -0.0734 384 GLN B CD  
4085 O OE1 . GLN B 173 ? 0.3970 0.3157 0.3689 -0.0950 0.1005  -0.0752 384 GLN B OE1 
4086 N NE2 . GLN B 173 ? 0.3632 0.2771 0.3336 -0.0991 0.1039  -0.0781 384 GLN B NE2 
4087 N N   . TYR B 174 ? 0.3525 0.2816 0.3204 -0.0727 0.0733  -0.0482 385 TYR B N   
4088 C CA  . TYR B 174 ? 0.3397 0.2738 0.3117 -0.0681 0.0699  -0.0451 385 TYR B CA  
4089 C C   . TYR B 174 ? 0.3306 0.2681 0.3078 -0.0622 0.0652  -0.0397 385 TYR B C   
4090 O O   . TYR B 174 ? 0.3261 0.2691 0.3138 -0.0574 0.0640  -0.0383 385 TYR B O   
4091 C CB  . TYR B 174 ? 0.3448 0.2751 0.3034 -0.0705 0.0680  -0.0437 385 TYR B CB  
4092 C CG  . TYR B 174 ? 0.3172 0.2515 0.2778 -0.0676 0.0656  -0.0420 385 TYR B CG  
4093 C CD1 . TYR B 174 ? 0.3327 0.2746 0.3065 -0.0640 0.0659  -0.0429 385 TYR B CD1 
4094 C CD2 . TYR B 174 ? 0.3320 0.2624 0.2809 -0.0687 0.0633  -0.0397 385 TYR B CD2 
4095 C CE1 . TYR B 174 ? 0.3401 0.2862 0.3153 -0.0619 0.0638  -0.0419 385 TYR B CE1 
4096 C CE2 . TYR B 174 ? 0.3307 0.2642 0.2809 -0.0668 0.0618  -0.0387 385 TYR B CE2 
4097 C CZ  . TYR B 174 ? 0.3148 0.2566 0.2781 -0.0636 0.0620  -0.0400 385 TYR B CZ  
4098 O OH  . TYR B 174 ? 0.3081 0.2537 0.2726 -0.0621 0.0604  -0.0394 385 TYR B OH  
4099 N N   . LEU B 175 ? 0.3310 0.2653 0.3007 -0.0628 0.0626  -0.0370 386 LEU B N   
4100 C CA  . LEU B 175 ? 0.3296 0.2665 0.3032 -0.0581 0.0587  -0.0322 386 LEU B CA  
4101 C C   . LEU B 175 ? 0.3316 0.2708 0.3182 -0.0549 0.0608  -0.0325 386 LEU B C   
4102 O O   . LEU B 175 ? 0.3210 0.2643 0.3145 -0.0497 0.0582  -0.0289 386 LEU B O   
4103 C CB  . LEU B 175 ? 0.3351 0.2686 0.2998 -0.0604 0.0569  -0.0310 386 LEU B CB  
4104 C CG  . LEU B 175 ? 0.3203 0.2560 0.2879 -0.0568 0.0534  -0.0268 386 LEU B CG  
4105 C CD1 . LEU B 175 ? 0.2863 0.2256 0.2534 -0.0523 0.0485  -0.0220 386 LEU B CD1 
4106 C CD2 . LEU B 175 ? 0.2872 0.2204 0.2462 -0.0602 0.0524  -0.0273 386 LEU B CD2 
4107 N N   . GLN B 176 ? 0.3289 0.2652 0.3185 -0.0581 0.0657  -0.0367 387 GLN B N   
4108 C CA  . GLN B 176 ? 0.3327 0.2696 0.3341 -0.0553 0.0683  -0.0372 387 GLN B CA  
4109 C C   . GLN B 176 ? 0.3273 0.2686 0.3398 -0.0517 0.0698  -0.0386 387 GLN B C   
4110 O O   . GLN B 176 ? 0.3110 0.2552 0.3323 -0.0459 0.0682  -0.0354 387 GLN B O   
4111 C CB  . GLN B 176 ? 0.3387 0.2708 0.3399 -0.0602 0.0736  -0.0419 387 GLN B CB  
4112 C CG  . GLN B 176 ? 0.3631 0.2921 0.3550 -0.0634 0.0721  -0.0409 387 GLN B CG  
4113 C CD  . GLN B 176 ? 0.3699 0.3006 0.3633 -0.0589 0.0677  -0.0352 387 GLN B CD  
4114 O OE1 . GLN B 176 ? 0.3749 0.3068 0.3774 -0.0542 0.0678  -0.0327 387 GLN B OE1 
4115 N NE2 . GLN B 176 ? 0.3620 0.2927 0.3461 -0.0604 0.0640  -0.0331 387 GLN B NE2 
4116 N N   . SER B 177 ? 0.3266 0.2688 0.3382 -0.0550 0.0725  -0.0432 388 SER B N   
4117 C CA  . SER B 177 ? 0.3297 0.2769 0.3532 -0.0524 0.0748  -0.0462 388 SER B CA  
4118 C C   . SER B 177 ? 0.3233 0.2774 0.3507 -0.0471 0.0701  -0.0426 388 SER B C   
4119 O O   . SER B 177 ? 0.3143 0.2741 0.3531 -0.0431 0.0706  -0.0438 388 SER B O   
4120 C CB  . SER B 177 ? 0.3351 0.2813 0.3567 -0.0584 0.0800  -0.0531 388 SER B CB  
4121 O OG  . SER B 177 ? 0.3317 0.2786 0.3443 -0.0609 0.0781  -0.0530 388 SER B OG  
4122 N N   . THR B 178 ? 0.3306 0.2845 0.3486 -0.0470 0.0656  -0.0385 389 THR B N   
4123 C CA  . THR B 178 ? 0.3214 0.2818 0.3422 -0.0424 0.0612  -0.0352 389 THR B CA  
4124 C C   . THR B 178 ? 0.3295 0.2904 0.3506 -0.0374 0.0566  -0.0287 389 THR B C   
4125 O O   . THR B 178 ? 0.3193 0.2844 0.3395 -0.0342 0.0524  -0.0252 389 THR B O   
4126 C CB  . THR B 178 ? 0.3239 0.2846 0.3354 -0.0458 0.0599  -0.0361 389 THR B CB  
4127 O OG1 . THR B 178 ? 0.3039 0.2587 0.3028 -0.0482 0.0578  -0.0332 389 THR B OG1 
4128 C CG2 . THR B 178 ? 0.3198 0.2796 0.3311 -0.0512 0.0653  -0.0429 389 THR B CG2 
4129 N N   . HIS B 179 ? 0.3376 0.2941 0.3601 -0.0369 0.0579  -0.0273 390 HIS B N   
4130 C CA  . HIS B 179 ? 0.3354 0.2923 0.3598 -0.0319 0.0545  -0.0214 390 HIS B CA  
4131 C C   . HIS B 179 ? 0.3443 0.3063 0.3802 -0.0257 0.0537  -0.0200 390 HIS B C   
4132 O O   . HIS B 179 ? 0.3385 0.2997 0.3829 -0.0244 0.0571  -0.0224 390 HIS B O   
4133 C CB  . HIS B 179 ? 0.3361 0.2866 0.3590 -0.0335 0.0567  -0.0208 390 HIS B CB  
4134 C CG  . HIS B 179 ? 0.3191 0.2689 0.3401 -0.0303 0.0533  -0.0150 390 HIS B CG  
4135 N ND1 . HIS B 179 ? 0.3170 0.2636 0.3300 -0.0333 0.0523  -0.0137 390 HIS B ND1 
4136 C CD2 . HIS B 179 ? 0.3015 0.2537 0.3275 -0.0246 0.0508  -0.0103 390 HIS B CD2 
4137 C CE1 . HIS B 179 ? 0.3346 0.2818 0.3480 -0.0298 0.0497  -0.0088 390 HIS B CE1 
4138 N NE2 . HIS B 179 ? 0.3092 0.2592 0.3297 -0.0245 0.0487  -0.0064 390 HIS B NE2 
4139 N N   . ALA B 180 ? 0.3444 0.3119 0.3803 -0.0217 0.0490  -0.0160 391 ALA B N   
4140 C CA  . ALA B 180 ? 0.3519 0.3254 0.3974 -0.0155 0.0472  -0.0143 391 ALA B CA  
4141 C C   . ALA B 180 ? 0.3714 0.3409 0.4221 -0.0109 0.0478  -0.0105 391 ALA B C   
4142 O O   . ALA B 180 ? 0.3806 0.3443 0.4258 -0.0119 0.0477  -0.0073 391 ALA B O   
4143 C CB  . ALA B 180 ? 0.3405 0.3203 0.3830 -0.0128 0.0419  -0.0108 391 ALA B CB  
4144 N N   . PRO B 181 ? 0.3909 0.3637 0.4524 -0.0058 0.0483  -0.0108 392 PRO B N   
4145 C CA  . PRO B 181 ? 0.4015 0.3693 0.4679 -0.0010 0.0492  -0.0070 392 PRO B CA  
4146 C C   . PRO B 181 ? 0.3972 0.3654 0.4602 0.0038  0.0446  0.0004  392 PRO B C   
4147 O O   . PRO B 181 ? 0.4031 0.3643 0.4659 0.0060  0.0457  0.0042  392 PRO B O   
4148 C CB  . PRO B 181 ? 0.4095 0.3819 0.4886 0.0036  0.0505  -0.0098 392 PRO B CB  
4149 C CG  . PRO B 181 ? 0.4037 0.3865 0.4845 0.0029  0.0481  -0.0132 392 PRO B CG  
4150 C CD  . PRO B 181 ? 0.3945 0.3754 0.4644 -0.0046 0.0486  -0.0154 392 PRO B CD  
4151 N N   . THR B 182 ? 0.3889 0.3646 0.4489 0.0051  0.0398  0.0022  393 THR B N   
4152 C CA  . THR B 182 ? 0.3904 0.3664 0.4459 0.0088  0.0356  0.0089  393 THR B CA  
4153 C C   . THR B 182 ? 0.3778 0.3485 0.4225 0.0042  0.0355  0.0109  393 THR B C   
4154 O O   . THR B 182 ? 0.3844 0.3548 0.4245 0.0063  0.0326  0.0160  393 THR B O   
4155 C CB  . THR B 182 ? 0.3939 0.3804 0.4509 0.0124  0.0305  0.0101  393 THR B CB  
4156 O OG1 . THR B 182 ? 0.4007 0.3915 0.4524 0.0074  0.0296  0.0066  393 THR B OG1 
4157 C CG2 . THR B 182 ? 0.4146 0.4078 0.4835 0.0173  0.0304  0.0075  393 THR B CG2 
4158 N N   . HIS B 183 ? 0.3541 0.3210 0.3949 -0.0020 0.0385  0.0067  394 HIS B N   
4159 C CA  . HIS B 183 ? 0.3379 0.3005 0.3696 -0.0062 0.0385  0.0078  394 HIS B CA  
4160 C C   . HIS B 183 ? 0.3362 0.2903 0.3682 -0.0086 0.0430  0.0070  394 HIS B C   
4161 O O   . HIS B 183 ? 0.3430 0.2940 0.3707 -0.0140 0.0452  0.0037  394 HIS B O   
4162 C CB  . HIS B 183 ? 0.3220 0.2875 0.3478 -0.0111 0.0376  0.0041  394 HIS B CB  
4163 C CG  . HIS B 183 ? 0.3248 0.2983 0.3505 -0.0092 0.0339  0.0044  394 HIS B CG  
4164 N ND1 . HIS B 183 ? 0.2872 0.2637 0.3109 -0.0125 0.0342  0.0001  394 HIS B ND1 
4165 C CD2 . HIS B 183 ? 0.3012 0.2800 0.3281 -0.0047 0.0301  0.0083  394 HIS B CD2 
4166 C CE1 . HIS B 183 ? 0.2970 0.2806 0.3214 -0.0103 0.0309  0.0010  394 HIS B CE1 
4167 N NE2 . HIS B 183 ? 0.2757 0.2612 0.3022 -0.0055 0.0282  0.0059  394 HIS B NE2 
4168 N N   . SER B 184 ? 0.3400 0.2900 0.3766 -0.0046 0.0444  0.0102  395 SER B N   
4169 C CA  . SER B 184 ? 0.3364 0.2782 0.3753 -0.0066 0.0495  0.0086  395 SER B CA  
4170 C C   . SER B 184 ? 0.3346 0.2708 0.3674 -0.0087 0.0503  0.0115  395 SER B C   
4171 O O   . SER B 184 ? 0.3196 0.2484 0.3539 -0.0105 0.0549  0.0105  395 SER B O   
4172 C CB  . SER B 184 ? 0.3427 0.2820 0.3906 -0.0010 0.0514  0.0100  395 SER B CB  
4173 O OG  . SER B 184 ? 0.3750 0.3124 0.4214 0.0040  0.0490  0.0166  395 SER B OG  
4174 N N   . ASP B 185 ? 0.3169 0.2567 0.3432 -0.0089 0.0462  0.0145  396 ASP B N   
4175 C CA  . ASP B 185 ? 0.3126 0.2485 0.3333 -0.0113 0.0468  0.0167  396 ASP B CA  
4176 C C   . ASP B 185 ? 0.3037 0.2385 0.3201 -0.0179 0.0487  0.0122  396 ASP B C   
4177 O O   . ASP B 185 ? 0.2971 0.2288 0.3102 -0.0206 0.0500  0.0128  396 ASP B O   
4178 C CB  . ASP B 185 ? 0.3219 0.2621 0.3379 -0.0089 0.0422  0.0214  396 ASP B CB  
4179 C CG  . ASP B 185 ? 0.3178 0.2659 0.3305 -0.0100 0.0381  0.0198  396 ASP B CG  
4180 O OD1 . ASP B 185 ? 0.3413 0.2939 0.3574 -0.0080 0.0367  0.0183  396 ASP B OD1 
4181 O OD2 . ASP B 185 ? 0.3643 0.3142 0.3711 -0.0126 0.0363  0.0199  396 ASP B OD2 
4182 N N   . TYR B 186 ? 0.2971 0.2343 0.3134 -0.0208 0.0490  0.0075  397 TYR B N   
4183 C CA  . TYR B 186 ? 0.2868 0.2227 0.2989 -0.0270 0.0508  0.0027  397 TYR B CA  
4184 C C   . TYR B 186 ? 0.2784 0.2144 0.2927 -0.0292 0.0531  -0.0023 397 TYR B C   
4185 O O   . TYR B 186 ? 0.2739 0.2126 0.2921 -0.0264 0.0524  -0.0025 397 TYR B O   
4186 C CB  . TYR B 186 ? 0.2841 0.2249 0.2887 -0.0289 0.0466  0.0029  397 TYR B CB  
4187 C CG  . TYR B 186 ? 0.2871 0.2334 0.2902 -0.0269 0.0428  0.0034  397 TYR B CG  
4188 C CD1 . TYR B 186 ? 0.3187 0.2663 0.3183 -0.0300 0.0426  -0.0005 397 TYR B CD1 
4189 C CD2 . TYR B 186 ? 0.2757 0.2255 0.2802 -0.0223 0.0397  0.0076  397 TYR B CD2 
4190 C CE1 . TYR B 186 ? 0.3013 0.2530 0.2991 -0.0288 0.0398  -0.0004 397 TYR B CE1 
4191 C CE2 . TYR B 186 ? 0.2836 0.2386 0.2868 -0.0210 0.0366  0.0074  397 TYR B CE2 
4192 C CZ  . TYR B 186 ? 0.3146 0.2702 0.3145 -0.0244 0.0369  0.0033  397 TYR B CZ  
4193 O OH  . TYR B 186 ? 0.2908 0.2506 0.2892 -0.0238 0.0346  0.0027  397 TYR B OH  
4194 N N   . THR B 187 ? 0.2802 0.2136 0.2916 -0.0346 0.0559  -0.0066 398 THR B N   
4195 C CA  . THR B 187 ? 0.2897 0.2235 0.2994 -0.0384 0.0574  -0.0118 398 THR B CA  
4196 C C   . THR B 187 ? 0.2859 0.2220 0.2861 -0.0423 0.0544  -0.0129 398 THR B C   
4197 O O   . THR B 187 ? 0.2697 0.2071 0.2663 -0.0421 0.0518  -0.0103 398 THR B O   
4198 C CB  . THR B 187 ? 0.2983 0.2267 0.3119 -0.0417 0.0635  -0.0162 398 THR B CB  
4199 O OG1 . THR B 187 ? 0.2970 0.2230 0.3069 -0.0455 0.0647  -0.0172 398 THR B OG1 
4200 C CG2 . THR B 187 ? 0.2902 0.2153 0.3137 -0.0369 0.0665  -0.0146 398 THR B CG2 
4201 N N   . MET B 188 ? 0.2846 0.2212 0.2805 -0.0455 0.0547  -0.0165 399 MET B N   
4202 C CA  . MET B 188 ? 0.2808 0.2190 0.2671 -0.0486 0.0516  -0.0173 399 MET B CA  
4203 C C   . MET B 188 ? 0.3022 0.2375 0.2844 -0.0544 0.0548  -0.0225 399 MET B C   
4204 O O   . MET B 188 ? 0.2893 0.2221 0.2745 -0.0562 0.0589  -0.0261 399 MET B O   
4205 C CB  . MET B 188 ? 0.2730 0.2137 0.2555 -0.0471 0.0485  -0.0163 399 MET B CB  
4206 C CG  . MET B 188 ? 0.2875 0.2318 0.2720 -0.0421 0.0448  -0.0115 399 MET B CG  
4207 S SD  . MET B 188 ? 0.3017 0.2489 0.2817 -0.0410 0.0416  -0.0108 399 MET B SD  
4208 C CE  . MET B 188 ? 0.3153 0.2634 0.3039 -0.0396 0.0450  -0.0132 399 MET B CE  
4209 N N   . THR B 189 ? 0.2996 0.2358 0.2748 -0.0572 0.0526  -0.0231 400 THR B N   
4210 C CA  . THR B 189 ? 0.3266 0.2610 0.2959 -0.0627 0.0544  -0.0277 400 THR B CA  
4211 C C   . THR B 189 ? 0.3266 0.2627 0.2852 -0.0636 0.0498  -0.0270 400 THR B C   
4212 O O   . THR B 189 ? 0.3347 0.2740 0.2903 -0.0612 0.0451  -0.0238 400 THR B O   
4213 C CB  . THR B 189 ? 0.3332 0.2678 0.3038 -0.0655 0.0559  -0.0295 400 THR B CB  
4214 O OG1 . THR B 189 ? 0.3562 0.2876 0.3362 -0.0648 0.0610  -0.0302 400 THR B OG1 
4215 C CG2 . THR B 189 ? 0.3444 0.2786 0.3077 -0.0716 0.0570  -0.0345 400 THR B CG2 
4216 N N   . LEU B 190 ? 0.3269 0.2603 0.2795 -0.0668 0.0513  -0.0299 401 LEU B N   
4217 C CA  . LEU B 190 ? 0.3278 0.2610 0.2691 -0.0677 0.0474  -0.0291 401 LEU B CA  
4218 C C   . LEU B 190 ? 0.3376 0.2719 0.2717 -0.0710 0.0455  -0.0309 401 LEU B C   
4219 O O   . LEU B 190 ? 0.3496 0.2818 0.2810 -0.0758 0.0488  -0.0352 401 LEU B O   
4220 C CB  . LEU B 190 ? 0.3263 0.2554 0.2632 -0.0704 0.0504  -0.0317 401 LEU B CB  
4221 C CG  . LEU B 190 ? 0.3387 0.2653 0.2627 -0.0714 0.0472  -0.0306 401 LEU B CG  
4222 C CD1 . LEU B 190 ? 0.3138 0.2431 0.2366 -0.0663 0.0417  -0.0255 401 LEU B CD1 
4223 C CD2 . LEU B 190 ? 0.3152 0.2377 0.2370 -0.0737 0.0511  -0.0330 401 LEU B CD2 
4224 N N   . LEU B 191 ? 0.3347 0.2728 0.2655 -0.0686 0.0402  -0.0280 402 LEU B N   
4225 C CA  . LEU B 191 ? 0.3491 0.2900 0.2738 -0.0712 0.0375  -0.0298 402 LEU B CA  
4226 C C   . LEU B 191 ? 0.3668 0.3055 0.2782 -0.0726 0.0343  -0.0299 402 LEU B C   
4227 O O   . LEU B 191 ? 0.3805 0.3198 0.2853 -0.0763 0.0338  -0.0328 402 LEU B O   
4228 C CB  . LEU B 191 ? 0.3468 0.2936 0.2745 -0.0677 0.0331  -0.0271 402 LEU B CB  
4229 C CG  . LEU B 191 ? 0.3533 0.3026 0.2924 -0.0663 0.0353  -0.0265 402 LEU B CG  
4230 C CD1 . LEU B 191 ? 0.3304 0.2855 0.2709 -0.0629 0.0306  -0.0237 402 LEU B CD1 
4231 C CD2 . LEU B 191 ? 0.3268 0.2757 0.2697 -0.0711 0.0400  -0.0312 402 LEU B CD2 
4232 N N   . ASP B 192 ? 0.3709 0.3069 0.2777 -0.0695 0.0321  -0.0265 403 ASP B N   
4233 C CA  . ASP B 192 ? 0.3836 0.3157 0.2769 -0.0706 0.0296  -0.0261 403 ASP B CA  
4234 C C   . ASP B 192 ? 0.3747 0.3019 0.2652 -0.0684 0.0300  -0.0234 403 ASP B C   
4235 O O   . ASP B 192 ? 0.3586 0.2872 0.2578 -0.0654 0.0309  -0.0216 403 ASP B O   
4236 C CB  . ASP B 192 ? 0.3906 0.3269 0.2777 -0.0685 0.0231  -0.0242 403 ASP B CB  
4237 C CG  . ASP B 192 ? 0.4547 0.3888 0.3288 -0.0721 0.0215  -0.0263 403 ASP B CG  
4238 O OD1 . ASP B 192 ? 0.5061 0.4336 0.3733 -0.0761 0.0252  -0.0282 403 ASP B OD1 
4239 O OD2 . ASP B 192 ? 0.4634 0.4028 0.3341 -0.0711 0.0165  -0.0262 403 ASP B OD2 
4240 N N   . LEU B 193 ? 0.3886 0.3099 0.2663 -0.0702 0.0293  -0.0232 404 LEU B N   
4241 C CA  . LEU B 193 ? 0.3931 0.3082 0.2661 -0.0699 0.0310  -0.0219 404 LEU B CA  
4242 C C   . LEU B 193 ? 0.4112 0.3211 0.2691 -0.0691 0.0269  -0.0192 404 LEU B C   
4243 O O   . LEU B 193 ? 0.4338 0.3420 0.2818 -0.0716 0.0254  -0.0203 404 LEU B O   
4244 C CB  . LEU B 193 ? 0.4014 0.3122 0.2747 -0.0751 0.0376  -0.0261 404 LEU B CB  
4245 C CG  . LEU B 193 ? 0.4067 0.3120 0.2780 -0.0761 0.0412  -0.0264 404 LEU B CG  
4246 C CD1 . LEU B 193 ? 0.4093 0.3186 0.2922 -0.0718 0.0411  -0.0246 404 LEU B CD1 
4247 C CD2 . LEU B 193 ? 0.4030 0.3051 0.2749 -0.0820 0.0481  -0.0318 404 LEU B CD2 
4248 N N   . PHE B 194 ? 0.4012 0.3086 0.2574 -0.0653 0.0251  -0.0157 405 PHE B N   
4249 C CA  . PHE B 194 ? 0.4159 0.3173 0.2586 -0.0635 0.0213  -0.0125 405 PHE B CA  
4250 C C   . PHE B 194 ? 0.4244 0.3178 0.2624 -0.0645 0.0250  -0.0120 405 PHE B C   
4251 O O   . PHE B 194 ? 0.4220 0.3176 0.2700 -0.0639 0.0279  -0.0127 405 PHE B O   
4252 C CB  . PHE B 194 ? 0.4132 0.3195 0.2587 -0.0573 0.0152  -0.0087 405 PHE B CB  
4253 C CG  . PHE B 194 ? 0.3956 0.3110 0.2475 -0.0563 0.0120  -0.0097 405 PHE B CG  
4254 C CD1 . PHE B 194 ? 0.4206 0.3374 0.2641 -0.0556 0.0071  -0.0091 405 PHE B CD1 
4255 C CD2 . PHE B 194 ? 0.3865 0.3091 0.2525 -0.0562 0.0138  -0.0112 405 PHE B CD2 
4256 C CE1 . PHE B 194 ? 0.4052 0.3312 0.2551 -0.0552 0.0044  -0.0108 405 PHE B CE1 
4257 C CE2 . PHE B 194 ? 0.3917 0.3220 0.2632 -0.0560 0.0116  -0.0125 405 PHE B CE2 
4258 C CZ  . PHE B 194 ? 0.3919 0.3244 0.2558 -0.0557 0.0070  -0.0126 405 PHE B CZ  
4259 N N   . GLU B 195 ? 0.4386 0.3226 0.2613 -0.0666 0.0252  -0.0112 406 GLU B N   
4260 C CA  . GLU B 195 ? 0.4527 0.3279 0.2691 -0.0677 0.0286  -0.0105 406 GLU B CA  
4261 C C   . GLU B 195 ? 0.4357 0.3100 0.2508 -0.0618 0.0242  -0.0060 406 GLU B C   
4262 O O   . GLU B 195 ? 0.4383 0.3136 0.2485 -0.0581 0.0185  -0.0031 406 GLU B O   
4263 C CB  . GLU B 195 ? 0.4754 0.3396 0.2742 -0.0722 0.0307  -0.0110 406 GLU B CB  
4264 C CG  . GLU B 195 ? 0.5273 0.3801 0.3156 -0.0730 0.0333  -0.0093 406 GLU B CG  
4265 C CD  . GLU B 195 ? 0.6186 0.4598 0.3883 -0.0779 0.0357  -0.0096 406 GLU B CD  
4266 O OE1 . GLU B 195 ? 0.6605 0.4924 0.4160 -0.0757 0.0331  -0.0055 406 GLU B OE1 
4267 O OE2 . GLU B 195 ? 0.6443 0.4857 0.4135 -0.0837 0.0400  -0.0139 406 GLU B OE2 
4268 N N   . VAL B 196 ? 0.4304 0.3033 0.2502 -0.0608 0.0266  -0.0057 407 VAL B N   
4269 C CA  . VAL B 196 ? 0.4206 0.2927 0.2397 -0.0553 0.0227  -0.0017 407 VAL B CA  
4270 C C   . VAL B 196 ? 0.4251 0.2844 0.2311 -0.0567 0.0254  -0.0005 407 VAL B C   
4271 O O   . VAL B 196 ? 0.4266 0.2822 0.2326 -0.0612 0.0312  -0.0034 407 VAL B O   
4272 C CB  . VAL B 196 ? 0.4120 0.2929 0.2466 -0.0526 0.0229  -0.0021 407 VAL B CB  
4273 C CG1 . VAL B 196 ? 0.3953 0.2741 0.2285 -0.0478 0.0202  0.0012  407 VAL B CG1 
4274 C CG2 . VAL B 196 ? 0.3948 0.2870 0.2412 -0.0510 0.0203  -0.0028 407 VAL B CG2 
4275 N N   . GLU B 197 ? 0.4399 0.2925 0.2349 -0.0530 0.0214  0.0035  408 GLU B N   
4276 C CA  . GLU B 197 ? 0.4733 0.3126 0.2557 -0.0537 0.0240  0.0052  408 GLU B CA  
4277 C C   . GLU B 197 ? 0.4842 0.3228 0.2675 -0.0474 0.0201  0.0090  408 GLU B C   
4278 O O   . GLU B 197 ? 0.4860 0.3215 0.2615 -0.0428 0.0148  0.0127  408 GLU B O   
4279 C CB  . GLU B 197 ? 0.5027 0.3299 0.2661 -0.0563 0.0241  0.0067  408 GLU B CB  
4280 C CG  . GLU B 197 ? 0.5390 0.3507 0.2887 -0.0581 0.0283  0.0082  408 GLU B CG  
4281 C CD  . GLU B 197 ? 0.6182 0.4169 0.3480 -0.0615 0.0294  0.0095  408 GLU B CD  
4282 O OE1 . GLU B 197 ? 0.6563 0.4405 0.3726 -0.0629 0.0327  0.0113  408 GLU B OE1 
4283 O OE2 . GLU B 197 ? 0.6715 0.4740 0.3984 -0.0629 0.0271  0.0089  408 GLU B OE2 
4284 N N   . LYS B 198 ? 0.4866 0.3290 0.2803 -0.0469 0.0225  0.0077  409 LYS B N   
4285 C CA  . LYS B 198 ? 0.4969 0.3393 0.2928 -0.0413 0.0195  0.0105  409 LYS B CA  
4286 C C   . LYS B 198 ? 0.5179 0.3447 0.2988 -0.0413 0.0216  0.0127  409 LYS B C   
4287 O O   . LYS B 198 ? 0.5336 0.3531 0.3103 -0.0463 0.0277  0.0105  409 LYS B O   
4288 C CB  . LYS B 198 ? 0.4789 0.3307 0.2900 -0.0412 0.0215  0.0081  409 LYS B CB  
4289 C CG  . LYS B 198 ? 0.4913 0.3435 0.3053 -0.0361 0.0192  0.0103  409 LYS B CG  
4290 C CD  . LYS B 198 ? 0.5177 0.3733 0.3315 -0.0300 0.0125  0.0137  409 LYS B CD  
4291 C CE  . LYS B 198 ? 0.5518 0.4058 0.3669 -0.0251 0.0109  0.0157  409 LYS B CE  
4292 N NZ  . LYS B 198 ? 0.5588 0.4152 0.3726 -0.0188 0.0043  0.0188  409 LYS B NZ  
4293 N N   . ASP B 199 ? 0.5420 0.3639 0.3154 -0.0357 0.0166  0.0170  410 ASP B N   
4294 C CA  . ASP B 199 ? 0.5824 0.3888 0.3419 -0.0341 0.0179  0.0200  410 ASP B CA  
4295 C C   . ASP B 199 ? 0.5786 0.3802 0.3406 -0.0373 0.0244  0.0176  410 ASP B C   
4296 O O   . ASP B 199 ? 0.5574 0.3678 0.3320 -0.0355 0.0242  0.0163  410 ASP B O   
4297 C CB  . ASP B 199 ? 0.5936 0.4011 0.3534 -0.0258 0.0113  0.0241  410 ASP B CB  
4298 C CG  . ASP B 199 ? 0.6482 0.4553 0.3996 -0.0221 0.0049  0.0273  410 ASP B CG  
4299 O OD1 . ASP B 199 ? 0.7350 0.5471 0.4858 -0.0254 0.0042  0.0258  410 ASP B OD1 
4300 O OD2 . ASP B 199 ? 0.7243 0.5265 0.4698 -0.0157 0.0004  0.0313  410 ASP B OD2 
4301 N N   . GLY B 200 ? 0.5915 0.3797 0.3413 -0.0426 0.0303  0.0167  411 GLY B N   
4302 C CA  . GLY B 200 ? 0.5900 0.3717 0.3399 -0.0457 0.0367  0.0144  411 GLY B CA  
4303 C C   . GLY B 200 ? 0.5787 0.3692 0.3403 -0.0520 0.0423  0.0085  411 GLY B C   
4304 O O   . GLY B 200 ? 0.5842 0.3687 0.3442 -0.0562 0.0485  0.0056  411 GLY B O   
4305 N N   . GLU B 201 ? 0.5549 0.3595 0.3284 -0.0526 0.0402  0.0064  412 GLU B N   
4306 C CA  . GLU B 201 ? 0.5406 0.3547 0.3264 -0.0576 0.0448  0.0009  412 GLU B CA  
4307 C C   . GLU B 201 ? 0.5525 0.3585 0.3305 -0.0651 0.0517  -0.0027 412 GLU B C   
4308 O O   . GLU B 201 ? 0.5465 0.3548 0.3304 -0.0696 0.0572  -0.0074 412 GLU B O   
4309 C CB  . GLU B 201 ? 0.5316 0.3616 0.3314 -0.0561 0.0410  -0.0002 412 GLU B CB  
4310 C CG  . GLU B 201 ? 0.5112 0.3532 0.3243 -0.0506 0.0364  0.0010  412 GLU B CG  
4311 C CD  . GLU B 201 ? 0.4895 0.3464 0.3177 -0.0507 0.0352  -0.0012 412 GLU B CD  
4312 O OE1 . GLU B 201 ? 0.4504 0.3091 0.2786 -0.0531 0.0356  -0.0024 412 GLU B OE1 
4313 O OE2 . GLU B 201 ? 0.4760 0.3425 0.3158 -0.0482 0.0338  -0.0017 412 GLU B OE2 
4314 N N   . LYS B 202 ? 0.5648 0.3623 0.3299 -0.0668 0.0515  -0.0010 413 LYS B N   
4315 C CA  . LYS B 202 ? 0.5897 0.3792 0.3465 -0.0744 0.0583  -0.0046 413 LYS B CA  
4316 C C   . LYS B 202 ? 0.6030 0.3792 0.3505 -0.0781 0.0648  -0.0058 413 LYS B C   
4317 O O   . LYS B 202 ? 0.6151 0.3914 0.3654 -0.0846 0.0717  -0.0112 413 LYS B O   
4318 C CB  . LYS B 202 ? 0.6038 0.3854 0.3461 -0.0750 0.0563  -0.0017 413 LYS B CB  
4319 C CG  . LYS B 202 ? 0.6460 0.4196 0.3788 -0.0831 0.0631  -0.0054 413 LYS B CG  
4320 C CD  . LYS B 202 ? 0.6953 0.4655 0.4168 -0.0832 0.0597  -0.0029 413 LYS B CD  
4321 C CE  . LYS B 202 ? 0.7220 0.4836 0.4327 -0.0916 0.0667  -0.0065 413 LYS B CE  
4322 N NZ  . LYS B 202 ? 0.7431 0.4869 0.4376 -0.0952 0.0725  -0.0057 413 LYS B NZ  
4323 N N   . GLU B 203 ? 0.6138 0.3795 0.3515 -0.0739 0.0627  -0.0011 414 GLU B N   
4324 C CA  . GLU B 203 ? 0.6427 0.3929 0.3691 -0.0772 0.0690  -0.0015 414 GLU B CA  
4325 C C   . GLU B 203 ? 0.6184 0.3763 0.3582 -0.0789 0.0727  -0.0062 414 GLU B C   
4326 O O   . GLU B 203 ? 0.6255 0.3763 0.3616 -0.0852 0.0804  -0.0103 414 GLU B O   
4327 C CB  . GLU B 203 ? 0.6636 0.4000 0.3760 -0.0711 0.0652  0.0052  414 GLU B CB  
4328 C CG  . GLU B 203 ? 0.7155 0.4402 0.4100 -0.0701 0.0624  0.0100  414 GLU B CG  
4329 C CD  . GLU B 203 ? 0.7535 0.4912 0.4540 -0.0661 0.0546  0.0118  414 GLU B CD  
4330 O OE1 . GLU B 203 ? 0.7590 0.5137 0.4771 -0.0626 0.0503  0.0106  414 GLU B OE1 
4331 O OE2 . GLU B 203 ? 0.7985 0.5288 0.4853 -0.0669 0.0531  0.0143  414 GLU B OE2 
4332 N N   . ALA B 204 ? 0.5845 0.3575 0.3400 -0.0737 0.0674  -0.0059 415 ALA B N   
4333 C CA  . ALA B 204 ? 0.5575 0.3388 0.3255 -0.0743 0.0697  -0.0097 415 ALA B CA  
4334 C C   . ALA B 204 ? 0.5341 0.3287 0.3157 -0.0795 0.0733  -0.0162 415 ALA B C   
4335 O O   . ALA B 204 ? 0.5263 0.3266 0.3163 -0.0820 0.0768  -0.0206 415 ALA B O   
4336 C CB  . ALA B 204 ? 0.5353 0.3269 0.3134 -0.0664 0.0624  -0.0064 415 ALA B CB  
4337 N N   . PHE B 205 ? 0.5275 0.3272 0.3112 -0.0811 0.0725  -0.0171 416 PHE B N   
4338 C CA  . PHE B 205 ? 0.5114 0.3257 0.3103 -0.0843 0.0745  -0.0227 416 PHE B CA  
4339 C C   . PHE B 205 ? 0.5296 0.3418 0.3292 -0.0920 0.0830  -0.0294 416 PHE B C   
4340 O O   . PHE B 205 ? 0.5294 0.3271 0.3149 -0.0972 0.0886  -0.0304 416 PHE B O   
4341 C CB  . PHE B 205 ? 0.5146 0.3320 0.3136 -0.0848 0.0726  -0.0223 416 PHE B CB  
4342 C CG  . PHE B 205 ? 0.4899 0.3229 0.3056 -0.0863 0.0735  -0.0271 416 PHE B CG  
4343 C CD1 . PHE B 205 ? 0.4459 0.2939 0.2776 -0.0815 0.0689  -0.0268 416 PHE B CD1 
4344 C CD2 . PHE B 205 ? 0.4966 0.3289 0.3118 -0.0924 0.0788  -0.0318 416 PHE B CD2 
4345 C CE1 . PHE B 205 ? 0.4284 0.2899 0.2750 -0.0822 0.0694  -0.0307 416 PHE B CE1 
4346 C CE2 . PHE B 205 ? 0.4600 0.3062 0.2910 -0.0933 0.0795  -0.0362 416 PHE B CE2 
4347 C CZ  . PHE B 205 ? 0.4599 0.3207 0.3067 -0.0879 0.0747  -0.0355 416 PHE B CZ  
4348 N N   . ARG B 206 ? 0.5230 0.3499 0.3388 -0.0928 0.0839  -0.0343 417 ARG B N   
4349 C CA  . ARG B 206 ? 0.5325 0.3609 0.3520 -0.1000 0.0916  -0.0417 417 ARG B CA  
4350 C C   . ARG B 206 ? 0.5508 0.3798 0.3704 -0.1051 0.0955  -0.0455 417 ARG B C   
4351 O O   . ARG B 206 ? 0.5355 0.3787 0.3700 -0.1059 0.0959  -0.0500 417 ARG B O   
4352 C CB  . ARG B 206 ? 0.5150 0.3604 0.3523 -0.0988 0.0906  -0.0458 417 ARG B CB  
4353 C CG  . ARG B 206 ? 0.5066 0.3509 0.3433 -0.0954 0.0884  -0.0435 417 ARG B CG  
4354 C CD  . ARG B 206 ? 0.5119 0.3408 0.3358 -0.1011 0.0957  -0.0458 417 ARG B CD  
4355 N NE  . ARG B 206 ? 0.4992 0.3330 0.3289 -0.1086 0.1030  -0.0542 417 ARG B NE  
4356 C CZ  . ARG B 206 ? 0.5151 0.3607 0.3567 -0.1104 0.1047  -0.0597 417 ARG B CZ  
4357 N NH1 . ARG B 206 ? 0.4973 0.3503 0.3453 -0.1054 0.1000  -0.0577 417 ARG B NH1 
4358 N NH2 . ARG B 206 ? 0.5163 0.3667 0.3634 -0.1175 0.1114  -0.0678 417 ARG B NH2 
4359 N N   . GLU B 207 ? 0.5900 0.4032 0.3926 -0.1085 0.0985  -0.0437 418 GLU B N   
4360 C CA  . GLU B 207 ? 0.6131 0.4246 0.4132 -0.1143 0.1032  -0.0476 418 GLU B CA  
4361 C C   . GLU B 207 ? 0.6104 0.4280 0.4194 -0.1213 0.1109  -0.0564 418 GLU B C   
4362 O O   . GLU B 207 ? 0.6226 0.4478 0.4397 -0.1243 0.1134  -0.0611 418 GLU B O   
4363 C CB  . GLU B 207 ? 0.6449 0.4364 0.4227 -0.1178 0.1062  -0.0445 418 GLU B CB  
4364 C CG  . GLU B 207 ? 0.7018 0.4861 0.4689 -0.1110 0.0986  -0.0359 418 GLU B CG  
4365 C CD  . GLU B 207 ? 0.7718 0.5409 0.5195 -0.1140 0.1002  -0.0332 418 GLU B CD  
4366 O OE1 . GLU B 207 ? 0.8505 0.6047 0.5839 -0.1201 0.1072  -0.0347 418 GLU B OE1 
4367 O OE2 . GLU B 207 ? 0.7782 0.5501 0.5245 -0.1105 0.0947  -0.0296 418 GLU B OE2 
4368 N N   . ASP B 208 ? 0.6029 0.4172 0.4107 -0.1239 0.1149  -0.0590 419 ASP B N   
4369 C CA  . ASP B 208 ? 0.6013 0.4202 0.4160 -0.1314 0.1229  -0.0679 419 ASP B CA  
4370 C C   . ASP B 208 ? 0.5772 0.4181 0.4145 -0.1298 0.1210  -0.0732 419 ASP B C   
4371 O O   . ASP B 208 ? 0.5817 0.4288 0.4265 -0.1356 0.1270  -0.0810 419 ASP B O   
4372 C CB  . ASP B 208 ? 0.6107 0.4216 0.4194 -0.1342 0.1272  -0.0694 419 ASP B CB  
4373 C CG  . ASP B 208 ? 0.6085 0.4289 0.4266 -0.1272 0.1205  -0.0664 419 ASP B CG  
4374 O OD1 . ASP B 208 ? 0.6021 0.4190 0.4154 -0.1201 0.1134  -0.0585 419 ASP B OD1 
4375 O OD2 . ASP B 208 ? 0.5843 0.4159 0.4143 -0.1290 0.1226  -0.0721 419 ASP B OD2 
4376 N N   . LEU B 209 ? 0.5489 0.4019 0.3974 -0.1218 0.1129  -0.0692 420 LEU B N   
4377 C CA  . LEU B 209 ? 0.5207 0.3940 0.3900 -0.1199 0.1110  -0.0739 420 LEU B CA  
4378 C C   . LEU B 209 ? 0.5105 0.3918 0.3887 -0.1207 0.1117  -0.0770 420 LEU B C   
4379 O O   . LEU B 209 ? 0.5013 0.3756 0.3721 -0.1197 0.1102  -0.0732 420 LEU B O   
4380 C CB  . LEU B 209 ? 0.5027 0.3859 0.3804 -0.1113 0.1023  -0.0685 420 LEU B CB  
4381 C CG  . LEU B 209 ? 0.5030 0.3828 0.3766 -0.1105 0.1019  -0.0672 420 LEU B CG  
4382 C CD1 . LEU B 209 ? 0.4819 0.3729 0.3648 -0.1023 0.0935  -0.0625 420 LEU B CD1 
4383 C CD2 . LEU B 209 ? 0.4978 0.3826 0.3770 -0.1169 0.1085  -0.0756 420 LEU B CD2 
4384 N N   . HIS B 210 ? 0.5011 0.3973 0.3956 -0.1226 0.1141  -0.0842 421 HIS B N   
4385 C CA  . HIS B 210 ? 0.5061 0.4121 0.4124 -0.1223 0.1145  -0.0876 421 HIS B CA  
4386 C C   . HIS B 210 ? 0.4960 0.4143 0.4147 -0.1135 0.1061  -0.0829 421 HIS B C   
4387 O O   . HIS B 210 ? 0.4778 0.3993 0.3978 -0.1080 0.1002  -0.0781 421 HIS B O   
4388 C CB  . HIS B 210 ? 0.5043 0.4219 0.4238 -0.1275 0.1205  -0.0977 421 HIS B CB  
4389 C CG  . HIS B 210 ? 0.5227 0.4545 0.4549 -0.1250 0.1181  -0.1003 421 HIS B CG  
4390 N ND1 . HIS B 210 ? 0.5337 0.4603 0.4586 -0.1268 0.1191  -0.0999 421 HIS B ND1 
4391 C CD2 . HIS B 210 ? 0.5231 0.4742 0.4746 -0.1210 0.1148  -0.1036 421 HIS B CD2 
4392 C CE1 . HIS B 210 ? 0.5308 0.4734 0.4699 -0.1243 0.1164  -0.1030 421 HIS B CE1 
4393 N NE2 . HIS B 210 ? 0.5079 0.4657 0.4631 -0.1205 0.1134  -0.1050 421 HIS B NE2 
4394 N N   . ASN B 211 ? 0.4880 0.4125 0.4155 -0.1124 0.1059  -0.0846 422 ASN B N   
4395 C CA  . ASN B 211 ? 0.4859 0.4221 0.4264 -0.1046 0.0990  -0.0810 422 ASN B CA  
4396 C C   . ASN B 211 ? 0.4726 0.4006 0.4028 -0.0994 0.0927  -0.0718 422 ASN B C   
4397 O O   . ASN B 211 ? 0.4666 0.4011 0.4024 -0.0929 0.0862  -0.0670 422 ASN B O   
4398 C CB  . ASN B 211 ? 0.4884 0.4402 0.4436 -0.1012 0.0962  -0.0834 422 ASN B CB  
4399 C CG  . ASN B 211 ? 0.5250 0.4904 0.4957 -0.0937 0.0904  -0.0813 422 ASN B CG  
4400 O OD1 . ASN B 211 ? 0.6064 0.5720 0.5809 -0.0923 0.0903  -0.0808 422 ASN B OD1 
4401 N ND2 . ASN B 211 ? 0.5628 0.5393 0.5420 -0.0889 0.0855  -0.0799 422 ASN B ND2 
4402 N N   . ARG B 212 ? 0.4586 0.3723 0.3735 -0.1027 0.0949  -0.0696 423 ARG B N   
4403 C CA  . ARG B 212 ? 0.4458 0.3519 0.3509 -0.0986 0.0895  -0.0619 423 ARG B CA  
4404 C C   . ARG B 212 ? 0.4289 0.3406 0.3418 -0.0951 0.0865  -0.0604 423 ARG B C   
4405 O O   . ARG B 212 ? 0.4250 0.3342 0.3372 -0.0990 0.0906  -0.0639 423 ARG B O   
4406 C CB  . ARG B 212 ? 0.4621 0.3511 0.3476 -0.1034 0.0927  -0.0604 423 ARG B CB  
4407 C CG  . ARG B 212 ? 0.4557 0.3369 0.3300 -0.0988 0.0867  -0.0524 423 ARG B CG  
4408 C CD  . ARG B 212 ? 0.4684 0.3341 0.3243 -0.1031 0.0894  -0.0509 423 ARG B CD  
4409 N NE  . ARG B 212 ? 0.4996 0.3547 0.3446 -0.1088 0.0955  -0.0536 423 ARG B NE  
4410 C CZ  . ARG B 212 ? 0.5705 0.4111 0.3988 -0.1144 0.1001  -0.0539 423 ARG B CZ  
4411 N NH1 . ARG B 212 ? 0.5813 0.4170 0.4020 -0.1153 0.0994  -0.0522 423 ARG B NH1 
4412 N NH2 . ARG B 212 ? 0.5595 0.3901 0.3782 -0.1195 0.1059  -0.0561 423 ARG B NH2 
4413 N N   . MET B 213 ? 0.4052 0.3234 0.3246 -0.0882 0.0798  -0.0553 424 MET B N   
4414 C CA  . MET B 213 ? 0.3943 0.3185 0.3225 -0.0842 0.0768  -0.0537 424 MET B CA  
4415 C C   . MET B 213 ? 0.3905 0.3093 0.3105 -0.0804 0.0712  -0.0466 424 MET B C   
4416 O O   . MET B 213 ? 0.3933 0.3088 0.3065 -0.0780 0.0677  -0.0424 424 MET B O   
4417 C CB  . MET B 213 ? 0.3808 0.3195 0.3264 -0.0792 0.0739  -0.0543 424 MET B CB  
4418 C CG  . MET B 213 ? 0.3809 0.3279 0.3373 -0.0818 0.0783  -0.0614 424 MET B CG  
4419 S SD  . MET B 213 ? 0.4365 0.4007 0.4132 -0.0749 0.0742  -0.0617 424 MET B SD  
4420 C CE  . MET B 213 ? 0.3702 0.3351 0.3543 -0.0732 0.0750  -0.0619 424 MET B CE  
4421 N N   . LEU B 214 ? 0.3792 0.2979 0.3008 -0.0797 0.0706  -0.0459 425 LEU B N   
4422 C CA  . LEU B 214 ? 0.3656 0.2810 0.2813 -0.0764 0.0656  -0.0402 425 LEU B CA  
4423 C C   . LEU B 214 ? 0.3501 0.2760 0.2794 -0.0702 0.0612  -0.0378 425 LEU B C   
4424 O O   . LEU B 214 ? 0.3476 0.2793 0.2878 -0.0694 0.0626  -0.0400 425 LEU B O   
4425 C CB  . LEU B 214 ? 0.3690 0.2786 0.2786 -0.0797 0.0677  -0.0414 425 LEU B CB  
4426 C CG  . LEU B 214 ? 0.3638 0.2695 0.2654 -0.0774 0.0629  -0.0363 425 LEU B CG  
4427 C CD1 . LEU B 214 ? 0.3745 0.2704 0.2597 -0.0784 0.0613  -0.0332 425 LEU B CD1 
4428 C CD2 . LEU B 214 ? 0.3595 0.2638 0.2609 -0.0802 0.0651  -0.0386 425 LEU B CD2 
4429 N N   . LEU B 215 ? 0.3300 0.2579 0.2587 -0.0659 0.0563  -0.0332 426 LEU B N   
4430 C CA  . LEU B 215 ? 0.3147 0.2526 0.2558 -0.0603 0.0526  -0.0309 426 LEU B CA  
4431 C C   . LEU B 215 ? 0.2926 0.2299 0.2307 -0.0563 0.0474  -0.0254 426 LEU B C   
4432 O O   . LEU B 215 ? 0.2823 0.2127 0.2092 -0.0569 0.0458  -0.0230 426 LEU B O   
4433 C CB  . LEU B 215 ? 0.3232 0.2675 0.2696 -0.0587 0.0519  -0.0317 426 LEU B CB  
4434 C CG  . LEU B 215 ? 0.3401 0.2875 0.2916 -0.0624 0.0568  -0.0378 426 LEU B CG  
4435 C CD1 . LEU B 215 ? 0.3080 0.2613 0.2626 -0.0613 0.0557  -0.0385 426 LEU B CD1 
4436 C CD2 . LEU B 215 ? 0.3535 0.3081 0.3177 -0.0614 0.0584  -0.0407 426 LEU B CD2 
4437 N N   . TRP B 216 ? 0.2725 0.2172 0.2210 -0.0520 0.0449  -0.0234 427 TRP B N   
4438 C CA  . TRP B 216 ? 0.2758 0.2211 0.2239 -0.0485 0.0407  -0.0189 427 TRP B CA  
4439 C C   . TRP B 216 ? 0.2694 0.2174 0.2162 -0.0450 0.0366  -0.0152 427 TRP B C   
4440 O O   . TRP B 216 ? 0.2588 0.2120 0.2105 -0.0436 0.0364  -0.0158 427 TRP B O   
4441 C CB  . TRP B 216 ? 0.2674 0.2185 0.2270 -0.0456 0.0405  -0.0184 427 TRP B CB  
4442 C CG  . TRP B 216 ? 0.2613 0.2102 0.2239 -0.0484 0.0446  -0.0219 427 TRP B CG  
4443 C CD1 . TRP B 216 ? 0.2700 0.2222 0.2413 -0.0490 0.0480  -0.0257 427 TRP B CD1 
4444 C CD2 . TRP B 216 ? 0.2386 0.1821 0.1957 -0.0510 0.0456  -0.0223 427 TRP B CD2 
4445 N NE1 . TRP B 216 ? 0.2485 0.1971 0.2202 -0.0519 0.0515  -0.0285 427 TRP B NE1 
4446 C CE2 . TRP B 216 ? 0.2568 0.1999 0.2193 -0.0535 0.0501  -0.0265 427 TRP B CE2 
4447 C CE3 . TRP B 216 ? 0.2666 0.2059 0.2147 -0.0516 0.0430  -0.0198 427 TRP B CE3 
4448 C CZ2 . TRP B 216 ? 0.2769 0.2154 0.2359 -0.0568 0.0525  -0.0284 427 TRP B CZ2 
4449 C CZ3 . TRP B 216 ? 0.2721 0.2074 0.2166 -0.0548 0.0449  -0.0216 427 TRP B CZ3 
4450 C CH2 . TRP B 216 ? 0.3039 0.2387 0.2536 -0.0576 0.0497  -0.0259 427 TRP B CH2 
4451 N N   . HIS B 217 ? 0.2752 0.2201 0.2156 -0.0437 0.0335  -0.0119 428 HIS B N   
4452 C CA  . HIS B 217 ? 0.2675 0.2161 0.2089 -0.0399 0.0296  -0.0084 428 HIS B CA  
4453 C C   . HIS B 217 ? 0.2707 0.2200 0.2125 -0.0378 0.0269  -0.0054 428 HIS B C   
4454 O O   . HIS B 217 ? 0.2758 0.2204 0.2110 -0.0393 0.0265  -0.0053 428 HIS B O   
4455 C CB  . HIS B 217 ? 0.2766 0.2205 0.2088 -0.0405 0.0287  -0.0077 428 HIS B CB  
4456 C CG  . HIS B 217 ? 0.2606 0.2085 0.1943 -0.0369 0.0253  -0.0048 428 HIS B CG  
4457 N ND1 . HIS B 217 ? 0.2552 0.2081 0.1933 -0.0360 0.0255  -0.0056 428 HIS B ND1 
4458 C CD2 . HIS B 217 ? 0.2588 0.2071 0.1905 -0.0342 0.0219  -0.0017 428 HIS B CD2 
4459 C CE1 . HIS B 217 ? 0.2787 0.2343 0.2168 -0.0331 0.0225  -0.0028 428 HIS B CE1 
4460 N NE2 . HIS B 217 ? 0.2816 0.2344 0.2160 -0.0319 0.0203  -0.0005 428 HIS B NE2 
4461 N N   . GLY B 218 ? 0.2593 0.2148 0.2087 -0.0345 0.0250  -0.0032 429 GLY B N   
4462 C CA  . GLY B 218 ? 0.2547 0.2116 0.2053 -0.0325 0.0227  -0.0005 429 GLY B CA  
4463 C C   . GLY B 218 ? 0.2538 0.2136 0.2031 -0.0297 0.0193  0.0023  429 GLY B C   
4464 O O   . GLY B 218 ? 0.2475 0.2101 0.1982 -0.0285 0.0189  0.0026  429 GLY B O   
4465 N N   . SER B 219 ? 0.2537 0.2130 0.2001 -0.0289 0.0171  0.0039  430 SER B N   
4466 C CA  . SER B 219 ? 0.2536 0.2156 0.1991 -0.0264 0.0142  0.0062  430 SER B CA  
4467 C C   . SER B 219 ? 0.2544 0.2182 0.2012 -0.0257 0.0127  0.0074  430 SER B C   
4468 O O   . SER B 219 ? 0.2612 0.2235 0.2082 -0.0274 0.0137  0.0063  430 SER B O   
4469 C CB  . SER B 219 ? 0.2730 0.2311 0.2107 -0.0266 0.0131  0.0058  430 SER B CB  
4470 O OG  . SER B 219 ? 0.2468 0.2080 0.1851 -0.0241 0.0112  0.0074  430 SER B OG  
4471 N N   . ARG B 220 ? 0.2516 0.2192 0.1997 -0.0234 0.0106  0.0093  431 ARG B N   
4472 C CA  . ARG B 220 ? 0.2480 0.2184 0.1981 -0.0228 0.0093  0.0102  431 ARG B CA  
4473 C C   . ARG B 220 ? 0.2476 0.2160 0.1926 -0.0235 0.0077  0.0090  431 ARG B C   
4474 O O   . ARG B 220 ? 0.2507 0.2158 0.1898 -0.0232 0.0066  0.0086  431 ARG B O   
4475 C CB  . ARG B 220 ? 0.2473 0.2222 0.1991 -0.0204 0.0077  0.0120  431 ARG B CB  
4476 C CG  . ARG B 220 ? 0.2706 0.2484 0.2274 -0.0195 0.0089  0.0136  431 ARG B CG  
4477 C CD  . ARG B 220 ? 0.2922 0.2742 0.2497 -0.0176 0.0075  0.0152  431 ARG B CD  
4478 N NE  . ARG B 220 ? 0.3285 0.3132 0.2896 -0.0166 0.0083  0.0170  431 ARG B NE  
4479 C CZ  . ARG B 220 ? 0.3336 0.3194 0.2979 -0.0163 0.0093  0.0189  431 ARG B CZ  
4480 N NH1 . ARG B 220 ? 0.3219 0.3066 0.2872 -0.0174 0.0101  0.0188  431 ARG B NH1 
4481 N NH2 . ARG B 220 ? 0.3477 0.3356 0.3143 -0.0149 0.0095  0.0209  431 ARG B NH2 
4482 N N   . MET B 221 ? 0.2500 0.2204 0.1970 -0.0244 0.0075  0.0083  432 MET B N   
4483 C CA  . MET B 221 ? 0.2621 0.2320 0.2047 -0.0251 0.0054  0.0069  432 MET B CA  
4484 C C   . MET B 221 ? 0.2579 0.2292 0.1972 -0.0223 0.0020  0.0076  432 MET B C   
4485 O O   . MET B 221 ? 0.2581 0.2275 0.1918 -0.0220 -0.0002 0.0069  432 MET B O   
4486 C CB  . MET B 221 ? 0.2660 0.2395 0.2125 -0.0267 0.0058  0.0055  432 MET B CB  
4487 C CG  . MET B 221 ? 0.3201 0.2909 0.2680 -0.0299 0.0090  0.0039  432 MET B CG  
4488 S SD  . MET B 221 ? 0.3620 0.3272 0.3015 -0.0321 0.0087  0.0019  432 MET B SD  
4489 C CE  . MET B 221 ? 0.2833 0.2520 0.2184 -0.0311 0.0042  0.0010  432 MET B CE  
4490 N N   . SER B 222 ? 0.2635 0.2381 0.2061 -0.0202 0.0015  0.0089  433 SER B N   
4491 C CA  . SER B 222 ? 0.2618 0.2379 0.2024 -0.0174 -0.0013 0.0093  433 SER B CA  
4492 C C   . SER B 222 ? 0.2583 0.2285 0.1923 -0.0164 -0.0018 0.0098  433 SER B C   
4493 O O   . SER B 222 ? 0.2721 0.2417 0.2030 -0.0139 -0.0041 0.0101  433 SER B O   
4494 C CB  . SER B 222 ? 0.2745 0.2554 0.2202 -0.0160 -0.0008 0.0104  433 SER B CB  
4495 O OG  . SER B 222 ? 0.2799 0.2592 0.2266 -0.0166 0.0014  0.0115  433 SER B OG  
4496 N N   . ASN B 223 ? 0.2481 0.2139 0.1802 -0.0183 0.0007  0.0098  434 ASN B N   
4497 C CA  . ASN B 223 ? 0.2511 0.2112 0.1776 -0.0181 0.0013  0.0099  434 ASN B CA  
4498 C C   . ASN B 223 ? 0.2630 0.2157 0.1808 -0.0192 0.0012  0.0094  434 ASN B C   
4499 O O   . ASN B 223 ? 0.2681 0.2149 0.1798 -0.0187 0.0014  0.0097  434 ASN B O   
4500 C CB  . ASN B 223 ? 0.2540 0.2146 0.1839 -0.0195 0.0043  0.0097  434 ASN B CB  
4501 C CG  . ASN B 223 ? 0.2430 0.2100 0.1792 -0.0179 0.0041  0.0108  434 ASN B CG  
4502 O OD1 . ASN B 223 ? 0.3178 0.2883 0.2557 -0.0161 0.0022  0.0114  434 ASN B OD1 
4503 N ND2 . ASN B 223 ? 0.2442 0.2131 0.1839 -0.0187 0.0060  0.0108  434 ASN B ND2 
4504 N N   . TRP B 224 ? 0.2562 0.2085 0.1728 -0.0210 0.0009  0.0085  435 TRP B N   
4505 C CA  . TRP B 224 ? 0.2661 0.2113 0.1740 -0.0230 0.0014  0.0078  435 TRP B CA  
4506 C C   . TRP B 224 ? 0.2822 0.2224 0.1813 -0.0204 -0.0016 0.0091  435 TRP B C   
4507 O O   . TRP B 224 ? 0.2907 0.2227 0.1813 -0.0215 -0.0005 0.0093  435 TRP B O   
4508 C CB  . TRP B 224 ? 0.2666 0.2132 0.1753 -0.0257 0.0019  0.0062  435 TRP B CB  
4509 C CG  . TRP B 224 ? 0.2519 0.2006 0.1676 -0.0282 0.0056  0.0051  435 TRP B CG  
4510 C CD1 . TRP B 224 ? 0.2532 0.2075 0.1770 -0.0286 0.0063  0.0046  435 TRP B CD1 
4511 C CD2 . TRP B 224 ? 0.2585 0.2035 0.1741 -0.0302 0.0091  0.0042  435 TRP B CD2 
4512 N NE1 . TRP B 224 ? 0.2542 0.2081 0.1826 -0.0304 0.0099  0.0038  435 TRP B NE1 
4513 C CE2 . TRP B 224 ? 0.2114 0.1604 0.1355 -0.0313 0.0115  0.0034  435 TRP B CE2 
4514 C CE3 . TRP B 224 ? 0.2542 0.1928 0.1633 -0.0314 0.0108  0.0037  435 TRP B CE3 
4515 C CZ2 . TRP B 224 ? 0.2741 0.2218 0.2010 -0.0330 0.0149  0.0021  435 TRP B CZ2 
4516 C CZ3 . TRP B 224 ? 0.2627 0.2005 0.1749 -0.0337 0.0146  0.0020  435 TRP B CZ3 
4517 C CH2 . TRP B 224 ? 0.2534 0.1961 0.1747 -0.0343 0.0164  0.0012  435 TRP B CH2 
4518 N N   . VAL B 225 ? 0.2775 0.2224 0.1788 -0.0169 -0.0052 0.0099  436 VAL B N   
4519 C CA  . VAL B 225 ? 0.2969 0.2372 0.1906 -0.0136 -0.0084 0.0113  436 VAL B CA  
4520 C C   . VAL B 225 ? 0.3075 0.2410 0.1974 -0.0127 -0.0065 0.0123  436 VAL B C   
4521 O O   . VAL B 225 ? 0.3202 0.2445 0.2002 -0.0124 -0.0065 0.0133  436 VAL B O   
4522 C CB  . VAL B 225 ? 0.2849 0.2325 0.1829 -0.0097 -0.0126 0.0115  436 VAL B CB  
4523 C CG1 . VAL B 225 ? 0.2971 0.2391 0.1879 -0.0053 -0.0156 0.0132  436 VAL B CG1 
4524 C CG2 . VAL B 225 ? 0.2808 0.2334 0.1797 -0.0109 -0.0147 0.0101  436 VAL B CG2 
4525 N N   . GLY B 226 ? 0.2919 0.2293 0.1889 -0.0128 -0.0044 0.0119  437 GLY B N   
4526 C CA  . GLY B 226 ? 0.2878 0.2195 0.1818 -0.0126 -0.0022 0.0122  437 GLY B CA  
4527 C C   . GLY B 226 ? 0.2929 0.2172 0.1812 -0.0165 0.0016  0.0113  437 GLY B C   
4528 O O   . GLY B 226 ? 0.3020 0.2174 0.1823 -0.0166 0.0029  0.0118  437 GLY B O   
4529 N N   . ILE B 227 ? 0.2913 0.2188 0.1838 -0.0199 0.0038  0.0099  438 ILE B N   
4530 C CA  . ILE B 227 ? 0.3011 0.2230 0.1898 -0.0240 0.0078  0.0083  438 ILE B CA  
4531 C C   . ILE B 227 ? 0.3378 0.2500 0.2148 -0.0254 0.0079  0.0086  438 ILE B C   
4532 O O   . ILE B 227 ? 0.3284 0.2319 0.1979 -0.0276 0.0110  0.0080  438 ILE B O   
4533 C CB  . ILE B 227 ? 0.3014 0.2296 0.1983 -0.0266 0.0097  0.0066  438 ILE B CB  
4534 C CG1 . ILE B 227 ? 0.2870 0.2228 0.1934 -0.0255 0.0103  0.0065  438 ILE B CG1 
4535 C CG2 . ILE B 227 ? 0.2755 0.1982 0.1685 -0.0310 0.0138  0.0044  438 ILE B CG2 
4536 C CD1 . ILE B 227 ? 0.2459 0.1888 0.1617 -0.0267 0.0114  0.0056  438 ILE B CD1 
4537 N N   . LEU B 228 ? 0.3555 0.2688 0.2301 -0.0242 0.0047  0.0095  439 LEU B N   
4538 C CA  . LEU B 228 ? 0.3805 0.2851 0.2430 -0.0253 0.0042  0.0102  439 LEU B CA  
4539 C C   . LEU B 228 ? 0.3926 0.2886 0.2455 -0.0220 0.0024  0.0126  439 LEU B C   
4540 O O   . LEU B 228 ? 0.4092 0.2944 0.2510 -0.0239 0.0045  0.0131  439 LEU B O   
4541 C CB  . LEU B 228 ? 0.3841 0.2932 0.2467 -0.0253 0.0010  0.0100  439 LEU B CB  
4542 C CG  . LEU B 228 ? 0.3736 0.2889 0.2441 -0.0291 0.0036  0.0074  439 LEU B CG  
4543 C CD1 . LEU B 228 ? 0.3536 0.2725 0.2230 -0.0293 0.0007  0.0069  439 LEU B CD1 
4544 C CD2 . LEU B 228 ? 0.4125 0.3216 0.2794 -0.0339 0.0087  0.0053  439 LEU B CD2 
4545 N N   . SER B 229 ? 0.3868 0.2872 0.2440 -0.0172 -0.0011 0.0141  440 SER B N   
4546 C CA  . SER B 229 ? 0.3978 0.2904 0.2472 -0.0132 -0.0028 0.0164  440 SER B CA  
4547 C C   . SER B 229 ? 0.3985 0.2838 0.2457 -0.0143 0.0014  0.0161  440 SER B C   
4548 O O   . SER B 229 ? 0.3921 0.2655 0.2282 -0.0137 0.0024  0.0176  440 SER B O   
4549 C CB  . SER B 229 ? 0.3958 0.2960 0.2512 -0.0076 -0.0079 0.0176  440 SER B CB  
4550 O OG  . SER B 229 ? 0.4015 0.3109 0.2688 -0.0071 -0.0071 0.0163  440 SER B OG  
4551 N N   . HIS B 230 ? 0.3953 0.2874 0.2523 -0.0160 0.0041  0.0141  441 HIS B N   
4552 C CA  . HIS B 230 ? 0.4017 0.2890 0.2580 -0.0174 0.0081  0.0130  441 HIS B CA  
4553 C C   . HIS B 230 ? 0.3998 0.2867 0.2575 -0.0231 0.0132  0.0101  441 HIS B C   
4554 O O   . HIS B 230 ? 0.4196 0.3033 0.2769 -0.0251 0.0169  0.0084  441 HIS B O   
4555 C CB  . HIS B 230 ? 0.4091 0.3049 0.2753 -0.0146 0.0071  0.0126  441 HIS B CB  
4556 C CG  . HIS B 230 ? 0.4132 0.3085 0.2784 -0.0090 0.0031  0.0147  441 HIS B CG  
4557 N ND1 . HIS B 230 ? 0.4376 0.3359 0.3023 -0.0059 -0.0016 0.0163  441 HIS B ND1 
4558 C CD2 . HIS B 230 ? 0.4645 0.3577 0.3301 -0.0060 0.0032  0.0150  441 HIS B CD2 
4559 C CE1 . HIS B 230 ? 0.4381 0.3363 0.3031 -0.0008 -0.0045 0.0176  441 HIS B CE1 
4560 N NE2 . HIS B 230 ? 0.4634 0.3580 0.3289 -0.0007 -0.0015 0.0169  441 HIS B NE2 
4561 N N   . GLY B 231 ? 0.3887 0.2796 0.2488 -0.0258 0.0135  0.0090  442 GLY B N   
4562 C CA  . GLY B 231 ? 0.3731 0.2650 0.2362 -0.0310 0.0183  0.0058  442 GLY B CA  
4563 C C   . GLY B 231 ? 0.3482 0.2514 0.2242 -0.0309 0.0187  0.0042  442 GLY B C   
4564 O O   . GLY B 231 ? 0.3317 0.2410 0.2132 -0.0273 0.0159  0.0055  442 GLY B O   
4565 N N   . LEU B 232 ? 0.3360 0.2422 0.2166 -0.0347 0.0223  0.0013  443 LEU B N   
4566 C CA  . LEU B 232 ? 0.3223 0.2385 0.2138 -0.0346 0.0229  -0.0003 443 LEU B CA  
4567 C C   . LEU B 232 ? 0.3259 0.2397 0.2157 -0.0352 0.0250  -0.0016 443 LEU B C   
4568 O O   . LEU B 232 ? 0.3101 0.2149 0.1921 -0.0380 0.0284  -0.0031 443 LEU B O   
4569 C CB  . LEU B 232 ? 0.3146 0.2350 0.2119 -0.0380 0.0257  -0.0032 443 LEU B CB  
4570 C CG  . LEU B 232 ? 0.3162 0.2395 0.2165 -0.0377 0.0242  -0.0024 443 LEU B CG  
4571 C CD1 . LEU B 232 ? 0.2532 0.1769 0.1563 -0.0416 0.0281  -0.0057 443 LEU B CD1 
4572 C CD2 . LEU B 232 ? 0.2657 0.1989 0.1756 -0.0340 0.0207  -0.0004 443 LEU B CD2 
4573 N N   . ARG B 233 ? 0.3298 0.2513 0.2264 -0.0327 0.0231  -0.0011 444 ARG B N   
4574 C CA  . ARG B 233 ? 0.3380 0.2573 0.2328 -0.0327 0.0247  -0.0023 444 ARG B CA  
4575 C C   . ARG B 233 ? 0.3326 0.2622 0.2365 -0.0338 0.0257  -0.0048 444 ARG B C   
4576 O O   . ARG B 233 ? 0.3261 0.2654 0.2383 -0.0329 0.0239  -0.0044 444 ARG B O   
4577 C CB  . ARG B 233 ? 0.3458 0.2638 0.2387 -0.0283 0.0214  0.0006  444 ARG B CB  
4578 C CG  . ARG B 233 ? 0.3637 0.2697 0.2458 -0.0267 0.0207  0.0028  444 ARG B CG  
4579 C CD  . ARG B 233 ? 0.4003 0.3096 0.2841 -0.0216 0.0157  0.0059  444 ARG B CD  
4580 N NE  . ARG B 233 ? 0.4099 0.3259 0.2985 -0.0215 0.0134  0.0066  444 ARG B NE  
4581 C CZ  . ARG B 233 ? 0.4364 0.3607 0.3316 -0.0187 0.0100  0.0080  444 ARG B CZ  
4582 N NH1 . ARG B 233 ? 0.4542 0.3819 0.3521 -0.0154 0.0079  0.0088  444 ARG B NH1 
4583 N NH2 . ARG B 233 ? 0.4223 0.3513 0.3212 -0.0197 0.0090  0.0081  444 ARG B NH2 
4584 N N   . ILE B 234 ? 0.3377 0.2649 0.2395 -0.0358 0.0286  -0.0073 445 ILE B N   
4585 C CA  . ILE B 234 ? 0.3327 0.2697 0.2420 -0.0369 0.0294  -0.0101 445 ILE B CA  
4586 C C   . ILE B 234 ? 0.3201 0.2636 0.2334 -0.0328 0.0256  -0.0075 445 ILE B C   
4587 O O   . ILE B 234 ? 0.3320 0.2699 0.2407 -0.0304 0.0244  -0.0055 445 ILE B O   
4588 C CB  . ILE B 234 ? 0.3450 0.2762 0.2496 -0.0407 0.0340  -0.0139 445 ILE B CB  
4589 C CG1 . ILE B 234 ? 0.3597 0.2838 0.2597 -0.0452 0.0384  -0.0166 445 ILE B CG1 
4590 C CG2 . ILE B 234 ? 0.3427 0.2848 0.2546 -0.0419 0.0346  -0.0172 445 ILE B CG2 
4591 C CD1 . ILE B 234 ? 0.3655 0.2990 0.2738 -0.0470 0.0387  -0.0189 445 ILE B CD1 
4592 N N   . ALA B 235 ? 0.2956 0.2507 0.2173 -0.0321 0.0238  -0.0077 446 ALA B N   
4593 C CA  . ALA B 235 ? 0.2927 0.2545 0.2182 -0.0288 0.0207  -0.0055 446 ALA B CA  
4594 C C   . ALA B 235 ? 0.2940 0.2536 0.2165 -0.0288 0.0218  -0.0068 446 ALA B C   
4595 O O   . ALA B 235 ? 0.2911 0.2473 0.2108 -0.0318 0.0251  -0.0101 446 ALA B O   
4596 C CB  . ALA B 235 ? 0.2649 0.2389 0.1989 -0.0284 0.0191  -0.0056 446 ALA B CB  
4597 N N   . HIS B 236 ? 0.2903 0.2515 0.2135 -0.0256 0.0192  -0.0044 447 HIS B N   
4598 C CA  . HIS B 236 ? 0.2957 0.2561 0.2174 -0.0250 0.0199  -0.0055 447 HIS B CA  
4599 C C   . HIS B 236 ? 0.2808 0.2470 0.2048 -0.0281 0.0224  -0.0094 447 HIS B C   
4600 O O   . HIS B 236 ? 0.2515 0.2276 0.1809 -0.0288 0.0212  -0.0099 447 HIS B O   
4601 C CB  . HIS B 236 ? 0.2889 0.2548 0.2140 -0.0215 0.0168  -0.0030 447 HIS B CB  
4602 C CG  . HIS B 236 ? 0.3346 0.2966 0.2572 -0.0200 0.0174  -0.0036 447 HIS B CG  
4603 N ND1 . HIS B 236 ? 0.3470 0.3111 0.2698 -0.0217 0.0197  -0.0067 447 HIS B ND1 
4604 C CD2 . HIS B 236 ? 0.3672 0.3231 0.2870 -0.0168 0.0162  -0.0019 447 HIS B CD2 
4605 C CE1 . HIS B 236 ? 0.3932 0.3521 0.3137 -0.0197 0.0202  -0.0068 447 HIS B CE1 
4606 N NE2 . HIS B 236 ? 0.3804 0.3345 0.2992 -0.0164 0.0179  -0.0039 447 HIS B NE2 
4607 N N   . PRO B 237 ? 0.3027 0.2626 0.2223 -0.0300 0.0257  -0.0123 448 PRO B N   
4608 C CA  . PRO B 237 ? 0.3178 0.2842 0.2398 -0.0334 0.0280  -0.0166 448 PRO B CA  
4609 C C   . PRO B 237 ? 0.3080 0.2862 0.2353 -0.0322 0.0256  -0.0164 448 PRO B C   
4610 O O   . PRO B 237 ? 0.3070 0.2943 0.2379 -0.0346 0.0260  -0.0192 448 PRO B O   
4611 C CB  . PRO B 237 ? 0.3299 0.2854 0.2455 -0.0353 0.0324  -0.0194 448 PRO B CB  
4612 C CG  . PRO B 237 ? 0.3444 0.2896 0.2552 -0.0312 0.0310  -0.0156 448 PRO B CG  
4613 C CD  . PRO B 237 ? 0.3273 0.2735 0.2392 -0.0294 0.0278  -0.0120 448 PRO B CD  
4614 N N   . GLU B 238 ? 0.3143 0.2927 0.2420 -0.0288 0.0232  -0.0134 449 GLU B N   
4615 C CA  . GLU B 238 ? 0.3223 0.3112 0.2541 -0.0279 0.0212  -0.0129 449 GLU B CA  
4616 C C   . GLU B 238 ? 0.3083 0.3059 0.2447 -0.0266 0.0178  -0.0101 449 GLU B C   
4617 O O   . GLU B 238 ? 0.3069 0.3134 0.2460 -0.0265 0.0164  -0.0097 449 GLU B O   
4618 C CB  . GLU B 238 ? 0.3298 0.3161 0.2607 -0.0250 0.0204  -0.0114 449 GLU B CB  
4619 C CG  . GLU B 238 ? 0.3826 0.3609 0.3096 -0.0256 0.0237  -0.0143 449 GLU B CG  
4620 C CD  . GLU B 238 ? 0.4346 0.4177 0.3620 -0.0293 0.0266  -0.0190 449 GLU B CD  
4621 O OE1 . GLU B 238 ? 0.4546 0.4487 0.3854 -0.0303 0.0253  -0.0195 449 GLU B OE1 
4622 O OE2 . GLU B 238 ? 0.5345 0.5102 0.4583 -0.0316 0.0305  -0.0222 449 GLU B OE2 
4623 N N   . ALA B 239 ? 0.2925 0.2874 0.2295 -0.0259 0.0169  -0.0081 450 ALA B N   
4624 C CA  . ALA B 239 ? 0.2764 0.2785 0.2178 -0.0245 0.0141  -0.0053 450 ALA B CA  
4625 C C   . ALA B 239 ? 0.2707 0.2823 0.2156 -0.0263 0.0140  -0.0075 450 ALA B C   
4626 O O   . ALA B 239 ? 0.2728 0.2844 0.2174 -0.0291 0.0162  -0.0113 450 ALA B O   
4627 C CB  . ALA B 239 ? 0.2675 0.2643 0.2090 -0.0237 0.0137  -0.0033 450 ALA B CB  
4628 N N   . PRO B 240 ? 0.2670 0.2869 0.2151 -0.0247 0.0113  -0.0050 451 PRO B N   
4629 C CA  . PRO B 240 ? 0.2729 0.3027 0.2245 -0.0256 0.0103  -0.0067 451 PRO B CA  
4630 C C   . PRO B 240 ? 0.2719 0.3020 0.2267 -0.0263 0.0108  -0.0081 451 PRO B C   
4631 O O   . PRO B 240 ? 0.2682 0.2941 0.2241 -0.0246 0.0103  -0.0055 451 PRO B O   
4632 C CB  . PRO B 240 ? 0.2632 0.2992 0.2164 -0.0228 0.0071  -0.0024 451 PRO B CB  
4633 C CG  . PRO B 240 ? 0.2713 0.3011 0.2224 -0.0211 0.0069  0.0008  451 PRO B CG  
4634 C CD  . PRO B 240 ? 0.2600 0.2809 0.2081 -0.0221 0.0093  -0.0011 451 PRO B CD  
4635 N N   . ILE B 241 ? 0.2757 0.3112 0.2324 -0.0290 0.0121  -0.0126 452 ILE B N   
4636 C CA  . ILE B 241 ? 0.2778 0.3141 0.2380 -0.0303 0.0133  -0.0152 452 ILE B CA  
4637 C C   . ILE B 241 ? 0.2789 0.3220 0.2448 -0.0270 0.0101  -0.0122 452 ILE B C   
4638 O O   . ILE B 241 ? 0.2695 0.3103 0.2383 -0.0267 0.0108  -0.0123 452 ILE B O   
4639 C CB  . ILE B 241 ? 0.2863 0.3281 0.2477 -0.0344 0.0158  -0.0216 452 ILE B CB  
4640 C CG1 . ILE B 241 ? 0.3141 0.3540 0.2783 -0.0367 0.0184  -0.0251 452 ILE B CG1 
4641 C CG2 . ILE B 241 ? 0.2696 0.3258 0.2351 -0.0338 0.0128  -0.0227 452 ILE B CG2 
4642 C CD1 . ILE B 241 ? 0.2990 0.3248 0.2580 -0.0379 0.0216  -0.0245 452 ILE B CD1 
4643 N N   . THR B 242 ? 0.2738 0.3241 0.2408 -0.0244 0.0068  -0.0092 453 THR B N   
4644 C CA  . THR B 242 ? 0.2824 0.3379 0.2540 -0.0208 0.0038  -0.0057 453 THR B CA  
4645 C C   . THR B 242 ? 0.2884 0.3356 0.2595 -0.0185 0.0036  -0.0011 453 THR B C   
4646 O O   . THR B 242 ? 0.2911 0.3402 0.2662 -0.0157 0.0021  0.0014  453 THR B O   
4647 C CB  . THR B 242 ? 0.3003 0.3650 0.2718 -0.0187 0.0003  -0.0033 453 THR B CB  
4648 O OG1 . THR B 242 ? 0.3279 0.3882 0.2940 -0.0184 0.0002  -0.0003 453 THR B OG1 
4649 C CG2 . THR B 242 ? 0.2748 0.3495 0.2477 -0.0212 0.0002  -0.0085 453 THR B CG2 
4650 N N   . GLY B 243 ? 0.2946 0.3326 0.2610 -0.0194 0.0053  -0.0003 454 GLY B N   
4651 C CA  . GLY B 243 ? 0.3009 0.3311 0.2671 -0.0181 0.0057  0.0026  454 GLY B CA  
4652 C C   . GLY B 243 ? 0.3031 0.3299 0.2720 -0.0192 0.0076  0.0004  454 GLY B C   
4653 O O   . GLY B 243 ? 0.3293 0.3511 0.2988 -0.0181 0.0078  0.0026  454 GLY B O   
4654 N N   . TYR B 244 ? 0.2929 0.3225 0.2633 -0.0218 0.0094  -0.0043 455 TYR B N   
4655 C CA  . TYR B 244 ? 0.2886 0.3134 0.2600 -0.0239 0.0122  -0.0071 455 TYR B CA  
4656 C C   . TYR B 244 ? 0.3012 0.3349 0.2799 -0.0239 0.0121  -0.0102 455 TYR B C   
4657 O O   . TYR B 244 ? 0.3145 0.3550 0.2948 -0.0259 0.0126  -0.0142 455 TYR B O   
4658 C CB  . TYR B 244 ? 0.2810 0.2984 0.2464 -0.0277 0.0154  -0.0104 455 TYR B CB  
4659 C CG  . TYR B 244 ? 0.2614 0.2706 0.2204 -0.0269 0.0150  -0.0073 455 TYR B CG  
4660 C CD1 . TYR B 244 ? 0.2411 0.2412 0.1967 -0.0267 0.0158  -0.0056 455 TYR B CD1 
4661 C CD2 . TYR B 244 ? 0.2151 0.2266 0.1718 -0.0261 0.0138  -0.0064 455 TYR B CD2 
4662 C CE1 . TYR B 244 ? 0.2282 0.2223 0.1788 -0.0255 0.0149  -0.0029 455 TYR B CE1 
4663 C CE2 . TYR B 244 ? 0.2374 0.2425 0.1894 -0.0250 0.0133  -0.0040 455 TYR B CE2 
4664 C CZ  . TYR B 244 ? 0.2410 0.2378 0.1903 -0.0245 0.0137  -0.0022 455 TYR B CZ  
4665 O OH  . TYR B 244 ? 0.2052 0.1970 0.1506 -0.0231 0.0128  -0.0001 455 TYR B OH  
4666 N N   . MET B 245 ? 0.2962 0.3303 0.2798 -0.0217 0.0115  -0.0086 456 MET B N   
4667 C CA  . MET B 245 ? 0.3084 0.3520 0.3003 -0.0205 0.0108  -0.0110 456 MET B CA  
4668 C C   . MET B 245 ? 0.2919 0.3386 0.2861 -0.0248 0.0140  -0.0179 456 MET B C   
4669 O O   . MET B 245 ? 0.2889 0.3467 0.2894 -0.0244 0.0128  -0.0210 456 MET B O   
4670 C CB  . MET B 245 ? 0.3189 0.3605 0.3156 -0.0176 0.0105  -0.0085 456 MET B CB  
4671 C CG  . MET B 245 ? 0.4012 0.4537 0.4072 -0.0142 0.0082  -0.0091 456 MET B CG  
4672 S SD  . MET B 245 ? 0.5393 0.5891 0.5519 -0.0100 0.0081  -0.0061 456 MET B SD  
4673 C CE  . MET B 245 ? 0.4915 0.5320 0.4969 -0.0081 0.0069  0.0010  456 MET B CE  
4674 N N   . PHE B 246 ? 0.2884 0.3255 0.2774 -0.0288 0.0179  -0.0203 457 PHE B N   
4675 C CA  . PHE B 246 ? 0.2871 0.3251 0.2766 -0.0337 0.0219  -0.0269 457 PHE B CA  
4676 C C   . PHE B 246 ? 0.2911 0.3202 0.2712 -0.0376 0.0247  -0.0283 457 PHE B C   
4677 O O   . PHE B 246 ? 0.3007 0.3237 0.2776 -0.0422 0.0292  -0.0325 457 PHE B O   
4678 C CB  . PHE B 246 ? 0.2985 0.3329 0.2911 -0.0354 0.0250  -0.0295 457 PHE B CB  
4679 C CG  . PHE B 246 ? 0.2920 0.3352 0.2948 -0.0316 0.0229  -0.0291 457 PHE B CG  
4680 C CD1 . PHE B 246 ? 0.2875 0.3437 0.2990 -0.0312 0.0221  -0.0334 457 PHE B CD1 
4681 C CD2 . PHE B 246 ? 0.2940 0.3328 0.2980 -0.0283 0.0217  -0.0247 457 PHE B CD2 
4682 C CE1 . PHE B 246 ? 0.3153 0.3799 0.3370 -0.0270 0.0199  -0.0330 457 PHE B CE1 
4683 C CE2 . PHE B 246 ? 0.3108 0.3568 0.3244 -0.0244 0.0200  -0.0243 457 PHE B CE2 
4684 C CZ  . PHE B 246 ? 0.3120 0.3709 0.3346 -0.0234 0.0189  -0.0282 457 PHE B CZ  
4685 N N   . GLY B 247 ? 0.2784 0.3063 0.2540 -0.0359 0.0224  -0.0248 458 GLY B N   
4686 C CA  . GLY B 247 ? 0.2754 0.2953 0.2428 -0.0388 0.0247  -0.0259 458 GLY B CA  
4687 C C   . GLY B 247 ? 0.2733 0.2798 0.2330 -0.0382 0.0254  -0.0222 458 GLY B C   
4688 O O   . GLY B 247 ? 0.2621 0.2658 0.2227 -0.0361 0.0242  -0.0191 458 GLY B O   
4689 N N   . LYS B 248 ? 0.2750 0.2736 0.2272 -0.0400 0.0274  -0.0228 459 LYS B N   
4690 C CA  . LYS B 248 ? 0.2765 0.2634 0.2212 -0.0388 0.0272  -0.0191 459 LYS B CA  
4691 C C   . LYS B 248 ? 0.2873 0.2639 0.2268 -0.0420 0.0310  -0.0209 459 LYS B C   
4692 O O   . LYS B 248 ? 0.2811 0.2489 0.2135 -0.0449 0.0344  -0.0229 459 LYS B O   
4693 C CB  . LYS B 248 ? 0.2859 0.2690 0.2253 -0.0388 0.0275  -0.0189 459 LYS B CB  
4694 C CG  . LYS B 248 ? 0.2813 0.2741 0.2248 -0.0361 0.0241  -0.0172 459 LYS B CG  
4695 C CD  . LYS B 248 ? 0.2844 0.2729 0.2228 -0.0361 0.0248  -0.0173 459 LYS B CD  
4696 C CE  . LYS B 248 ? 0.2669 0.2637 0.2083 -0.0333 0.0215  -0.0150 459 LYS B CE  
4697 N NZ  . LYS B 248 ? 0.2483 0.2420 0.1858 -0.0338 0.0227  -0.0162 459 LYS B NZ  
4698 N N   . GLY B 249 ? 0.2813 0.2589 0.2242 -0.0416 0.0307  -0.0203 460 GLY B N   
4699 C CA  . GLY B 249 ? 0.2901 0.2578 0.2276 -0.0443 0.0338  -0.0212 460 GLY B CA  
4700 C C   . GLY B 249 ? 0.2867 0.2505 0.2229 -0.0416 0.0315  -0.0170 460 GLY B C   
4701 O O   . GLY B 249 ? 0.2723 0.2396 0.2108 -0.0378 0.0277  -0.0131 460 GLY B O   
4702 N N   . ILE B 250 ? 0.2940 0.2506 0.2263 -0.0443 0.0343  -0.0183 461 ILE B N   
4703 C CA  . ILE B 250 ? 0.2738 0.2269 0.2047 -0.0429 0.0328  -0.0154 461 ILE B CA  
4704 C C   . ILE B 250 ? 0.2735 0.2335 0.2134 -0.0434 0.0338  -0.0175 461 ILE B C   
4705 O O   . ILE B 250 ? 0.2581 0.2192 0.2003 -0.0469 0.0374  -0.0221 461 ILE B O   
4706 C CB  . ILE B 250 ? 0.2996 0.2395 0.2189 -0.0452 0.0348  -0.0150 461 ILE B CB  
4707 C CG1 . ILE B 250 ? 0.3089 0.2425 0.2204 -0.0442 0.0341  -0.0132 461 ILE B CG1 
4708 C CG2 . ILE B 250 ? 0.2718 0.2093 0.1896 -0.0435 0.0326  -0.0119 461 ILE B CG2 
4709 C CD1 . ILE B 250 ? 0.3491 0.2689 0.2479 -0.0461 0.0362  -0.0127 461 ILE B CD1 
4710 N N   . TYR B 251 ? 0.2561 0.2208 0.2017 -0.0399 0.0306  -0.0145 462 TYR B N   
4711 C CA  . TYR B 251 ? 0.2437 0.2163 0.1993 -0.0388 0.0307  -0.0156 462 TYR B CA  
4712 C C   . TYR B 251 ? 0.2507 0.2185 0.2058 -0.0397 0.0321  -0.0155 462 TYR B C   
4713 O O   . TYR B 251 ? 0.2561 0.2182 0.2056 -0.0390 0.0307  -0.0126 462 TYR B O   
4714 C CB  . TYR B 251 ? 0.2517 0.2322 0.2136 -0.0341 0.0266  -0.0121 462 TYR B CB  
4715 C CG  . TYR B 251 ? 0.2462 0.2347 0.2115 -0.0330 0.0252  -0.0128 462 TYR B CG  
4716 C CD1 . TYR B 251 ? 0.2156 0.2015 0.1748 -0.0341 0.0251  -0.0130 462 TYR B CD1 
4717 C CD2 . TYR B 251 ? 0.2782 0.2769 0.2527 -0.0306 0.0236  -0.0131 462 TYR B CD2 
4718 C CE1 . TYR B 251 ? 0.2289 0.2225 0.1910 -0.0335 0.0240  -0.0141 462 TYR B CE1 
4719 C CE2 . TYR B 251 ? 0.2935 0.3003 0.2705 -0.0297 0.0219  -0.0139 462 TYR B CE2 
4720 C CZ  . TYR B 251 ? 0.2642 0.2686 0.2351 -0.0315 0.0223  -0.0145 462 TYR B CZ  
4721 O OH  . TYR B 251 ? 0.2569 0.2698 0.2302 -0.0310 0.0208  -0.0158 462 TYR B OH  
4722 N N   . PHE B 252 ? 0.2455 0.2163 0.2068 -0.0414 0.0349  -0.0192 463 PHE B N   
4723 C CA  . PHE B 252 ? 0.2516 0.2177 0.2125 -0.0430 0.0371  -0.0200 463 PHE B CA  
4724 C C   . PHE B 252 ? 0.2491 0.2227 0.2219 -0.0413 0.0378  -0.0218 463 PHE B C   
4725 O O   . PHE B 252 ? 0.2502 0.2321 0.2308 -0.0403 0.0378  -0.0240 463 PHE B O   
4726 C CB  . PHE B 252 ? 0.2517 0.2098 0.2049 -0.0485 0.0416  -0.0238 463 PHE B CB  
4727 C CG  . PHE B 252 ? 0.2602 0.2090 0.2005 -0.0500 0.0412  -0.0220 463 PHE B CG  
4728 C CD1 . PHE B 252 ? 0.2441 0.1850 0.1758 -0.0502 0.0402  -0.0193 463 PHE B CD1 
4729 C CD2 . PHE B 252 ? 0.2359 0.1839 0.1728 -0.0514 0.0421  -0.0233 463 PHE B CD2 
4730 C CE1 . PHE B 252 ? 0.2588 0.1917 0.1795 -0.0508 0.0394  -0.0174 463 PHE B CE1 
4731 C CE2 . PHE B 252 ? 0.2303 0.1689 0.1555 -0.0523 0.0420  -0.0214 463 PHE B CE2 
4732 C CZ  . PHE B 252 ? 0.2635 0.1945 0.1805 -0.0517 0.0405  -0.0183 463 PHE B CZ  
4733 N N   . ALA B 253 ? 0.2492 0.2199 0.2235 -0.0411 0.0385  -0.0210 464 ALA B N   
4734 C CA  . ALA B 253 ? 0.2653 0.2413 0.2504 -0.0394 0.0398  -0.0228 464 ALA B CA  
4735 C C   . ALA B 253 ? 0.2772 0.2484 0.2617 -0.0438 0.0448  -0.0273 464 ALA B C   
4736 O O   . ALA B 253 ? 0.2893 0.2521 0.2639 -0.0475 0.0464  -0.0276 464 ALA B O   
4737 C CB  . ALA B 253 ? 0.2609 0.2382 0.2500 -0.0350 0.0369  -0.0181 464 ALA B CB  
4738 N N   . ASP B 254 ? 0.2877 0.2645 0.2828 -0.0433 0.0471  -0.0309 465 ASP B N   
4739 C CA  . ASP B 254 ? 0.2908 0.2637 0.2873 -0.0468 0.0519  -0.0350 465 ASP B CA  
4740 C C   . ASP B 254 ? 0.2876 0.2599 0.2900 -0.0439 0.0516  -0.0330 465 ASP B C   
4741 O O   . ASP B 254 ? 0.2857 0.2549 0.2899 -0.0465 0.0556  -0.0364 465 ASP B O   
4742 C CB  . ASP B 254 ? 0.2919 0.2700 0.2958 -0.0493 0.0560  -0.0416 465 ASP B CB  
4743 C CG  . ASP B 254 ? 0.3033 0.2926 0.3207 -0.0444 0.0541  -0.0421 465 ASP B CG  
4744 O OD1 . ASP B 254 ? 0.3163 0.3082 0.3394 -0.0389 0.0509  -0.0380 465 ASP B OD1 
4745 O OD2 . ASP B 254 ? 0.3305 0.3262 0.3532 -0.0460 0.0560  -0.0471 465 ASP B OD2 
4746 N N   . MET B 255 ? 0.2797 0.2545 0.2845 -0.0388 0.0473  -0.0278 466 MET B N   
4747 C CA  . MET B 255 ? 0.2678 0.2406 0.2765 -0.0362 0.0471  -0.0252 466 MET B CA  
4748 C C   . MET B 255 ? 0.2721 0.2396 0.2718 -0.0363 0.0444  -0.0207 466 MET B C   
4749 O O   . MET B 255 ? 0.2713 0.2406 0.2677 -0.0339 0.0404  -0.0167 466 MET B O   
4750 C CB  . MET B 255 ? 0.2698 0.2496 0.2894 -0.0300 0.0447  -0.0227 466 MET B CB  
4751 C CG  . MET B 255 ? 0.2785 0.2655 0.3088 -0.0287 0.0465  -0.0271 466 MET B CG  
4752 S SD  . MET B 255 ? 0.3203 0.3048 0.3586 -0.0307 0.0525  -0.0326 466 MET B SD  
4753 C CE  . MET B 255 ? 0.2400 0.2236 0.2862 -0.0241 0.0510  -0.0277 466 MET B CE  
4754 N N   . SER B 256 ? 0.2696 0.2309 0.2658 -0.0392 0.0468  -0.0218 467 SER B N   
4755 C CA  . SER B 256 ? 0.2705 0.2272 0.2581 -0.0402 0.0447  -0.0188 467 SER B CA  
4756 C C   . SER B 256 ? 0.2692 0.2287 0.2595 -0.0355 0.0409  -0.0135 467 SER B C   
4757 O O   . SER B 256 ? 0.2748 0.2338 0.2587 -0.0351 0.0377  -0.0106 467 SER B O   
4758 C CB  . SER B 256 ? 0.2695 0.2208 0.2552 -0.0439 0.0481  -0.0213 467 SER B CB  
4759 O OG  . SER B 256 ? 0.2621 0.2143 0.2572 -0.0414 0.0498  -0.0211 467 SER B OG  
4760 N N   . SER B 257 ? 0.2662 0.2284 0.2660 -0.0318 0.0414  -0.0124 468 SER B N   
4761 C CA  . SER B 257 ? 0.2709 0.2344 0.2728 -0.0277 0.0386  -0.0074 468 SER B CA  
4762 C C   . SER B 257 ? 0.2758 0.2451 0.2775 -0.0244 0.0345  -0.0044 468 SER B C   
4763 O O   . SER B 257 ? 0.2684 0.2379 0.2671 -0.0227 0.0317  -0.0005 468 SER B O   
4764 C CB  . SER B 257 ? 0.2659 0.2291 0.2771 -0.0248 0.0407  -0.0070 468 SER B CB  
4765 O OG  . SER B 257 ? 0.2794 0.2478 0.2985 -0.0221 0.0411  -0.0086 468 SER B OG  
4766 N N   . LYS B 258 ? 0.2810 0.2550 0.2857 -0.0239 0.0344  -0.0066 469 LYS B N   
4767 C CA  . LYS B 258 ? 0.2804 0.2600 0.2837 -0.0218 0.0308  -0.0046 469 LYS B CA  
4768 C C   . LYS B 258 ? 0.2834 0.2600 0.2767 -0.0239 0.0289  -0.0031 469 LYS B C   
4769 O O   . LYS B 258 ? 0.2772 0.2560 0.2686 -0.0216 0.0258  0.0005  469 LYS B O   
4770 C CB  . LYS B 258 ? 0.2840 0.2688 0.2907 -0.0226 0.0316  -0.0085 469 LYS B CB  
4771 C CG  . LYS B 258 ? 0.2835 0.2747 0.2895 -0.0205 0.0281  -0.0069 469 LYS B CG  
4772 C CD  . LYS B 258 ? 0.2468 0.2454 0.2590 -0.0204 0.0288  -0.0109 469 LYS B CD  
4773 C CE  . LYS B 258 ? 0.2465 0.2515 0.2575 -0.0188 0.0254  -0.0095 469 LYS B CE  
4774 N NZ  . LYS B 258 ? 0.2273 0.2420 0.2461 -0.0178 0.0252  -0.0131 469 LYS B NZ  
4775 N N   . SER B 259 ? 0.2758 0.2472 0.2626 -0.0282 0.0308  -0.0058 470 SER B N   
4776 C CA  . SER B 259 ? 0.2670 0.2348 0.2443 -0.0299 0.0290  -0.0045 470 SER B CA  
4777 C C   . SER B 259 ? 0.2631 0.2285 0.2383 -0.0292 0.0276  -0.0016 470 SER B C   
4778 O O   . SER B 259 ? 0.2451 0.2111 0.2163 -0.0280 0.0247  0.0010  470 SER B O   
4779 C CB  . SER B 259 ? 0.2703 0.2328 0.2404 -0.0344 0.0314  -0.0081 470 SER B CB  
4780 O OG  . SER B 259 ? 0.2513 0.2157 0.2210 -0.0355 0.0323  -0.0104 470 SER B OG  
4781 N N   . ALA B 260 ? 0.2643 0.2271 0.2425 -0.0300 0.0299  -0.0024 471 ALA B N   
4782 C CA  . ALA B 260 ? 0.2623 0.2229 0.2385 -0.0303 0.0292  -0.0005 471 ALA B CA  
4783 C C   . ALA B 260 ? 0.2588 0.2228 0.2387 -0.0265 0.0270  0.0036  471 ALA B C   
4784 O O   . ALA B 260 ? 0.2675 0.2309 0.2447 -0.0266 0.0257  0.0053  471 ALA B O   
4785 C CB  . ALA B 260 ? 0.2438 0.2007 0.2226 -0.0326 0.0327  -0.0029 471 ALA B CB  
4786 N N   . ASN B 261 ? 0.2603 0.2279 0.2460 -0.0233 0.0267  0.0049  472 ASN B N   
4787 C CA  . ASN B 261 ? 0.2555 0.2262 0.2430 -0.0198 0.0243  0.0092  472 ASN B CA  
4788 C C   . ASN B 261 ? 0.2483 0.2212 0.2299 -0.0198 0.0212  0.0106  472 ASN B C   
4789 O O   . ASN B 261 ? 0.2436 0.2172 0.2240 -0.0187 0.0198  0.0134  472 ASN B O   
4790 C CB  . ASN B 261 ? 0.2618 0.2369 0.2557 -0.0161 0.0238  0.0103  472 ASN B CB  
4791 C CG  . ASN B 261 ? 0.2735 0.2464 0.2744 -0.0147 0.0265  0.0101  472 ASN B CG  
4792 O OD1 . ASN B 261 ? 0.2975 0.2652 0.2983 -0.0164 0.0290  0.0097  472 ASN B OD1 
4793 N ND2 . ASN B 261 ? 0.2593 0.2363 0.2664 -0.0115 0.0262  0.0101  472 ASN B ND2 
4794 N N   . TYR B 262 ? 0.2365 0.2097 0.2140 -0.0214 0.0205  0.0084  473 TYR B N   
4795 C CA  . TYR B 262 ? 0.2392 0.2134 0.2111 -0.0213 0.0180  0.0094  473 TYR B CA  
4796 C C   . TYR B 262 ? 0.2523 0.2232 0.2189 -0.0231 0.0174  0.0092  473 TYR B C   
4797 O O   . TYR B 262 ? 0.2439 0.2155 0.2061 -0.0228 0.0153  0.0098  473 TYR B O   
4798 C CB  . TYR B 262 ? 0.2448 0.2200 0.2141 -0.0222 0.0178  0.0073  473 TYR B CB  
4799 C CG  . TYR B 262 ? 0.2561 0.2371 0.2307 -0.0201 0.0174  0.0075  473 TYR B CG  
4800 C CD1 . TYR B 262 ? 0.2670 0.2527 0.2418 -0.0178 0.0150  0.0098  473 TYR B CD1 
4801 C CD2 . TYR B 262 ? 0.2491 0.2315 0.2288 -0.0204 0.0194  0.0050  473 TYR B CD2 
4802 C CE1 . TYR B 262 ? 0.2930 0.2850 0.2725 -0.0158 0.0141  0.0100  473 TYR B CE1 
4803 C CE2 . TYR B 262 ? 0.3178 0.3068 0.3029 -0.0182 0.0185  0.0049  473 TYR B CE2 
4804 C CZ  . TYR B 262 ? 0.3245 0.3184 0.3092 -0.0159 0.0157  0.0075  473 TYR B CZ  
4805 O OH  . TYR B 262 ? 0.3676 0.3687 0.3572 -0.0137 0.0145  0.0072  473 TYR B OH  
4806 N N   . CYS B 263 ? 0.2440 0.2117 0.2113 -0.0249 0.0192  0.0081  474 CYS B N   
4807 C CA  . CYS B 263 ? 0.2430 0.2093 0.2067 -0.0263 0.0183  0.0079  474 CYS B CA  
4808 C C   . CYS B 263 ? 0.2479 0.2169 0.2141 -0.0247 0.0174  0.0104  474 CYS B C   
4809 O O   . CYS B 263 ? 0.2431 0.2128 0.2067 -0.0255 0.0160  0.0102  474 CYS B O   
4810 C CB  . CYS B 263 ? 0.2541 0.2168 0.2179 -0.0292 0.0209  0.0054  474 CYS B CB  
4811 S SG  . CYS B 263 ? 0.2715 0.2299 0.2303 -0.0322 0.0226  0.0019  474 CYS B SG  
4812 N N   . PHE B 264 ? 0.2543 0.2248 0.2254 -0.0227 0.0182  0.0126  475 PHE B N   
4813 C CA  . PHE B 264 ? 0.2512 0.2230 0.2246 -0.0216 0.0183  0.0151  475 PHE B CA  
4814 C C   . PHE B 264 ? 0.2575 0.2274 0.2306 -0.0241 0.0197  0.0136  475 PHE B C   
4815 O O   . PHE B 264 ? 0.2510 0.2228 0.2233 -0.0244 0.0188  0.0142  475 PHE B O   
4816 C CB  . PHE B 264 ? 0.2494 0.2253 0.2206 -0.0199 0.0156  0.0170  475 PHE B CB  
4817 C CG  . PHE B 264 ? 0.2381 0.2166 0.2100 -0.0177 0.0145  0.0182  475 PHE B CG  
4818 C CD1 . PHE B 264 ? 0.2605 0.2406 0.2357 -0.0154 0.0147  0.0210  475 PHE B CD1 
4819 C CD2 . PHE B 264 ? 0.2386 0.2178 0.2076 -0.0180 0.0133  0.0164  475 PHE B CD2 
4820 C CE1 . PHE B 264 ? 0.2418 0.2254 0.2178 -0.0134 0.0134  0.0218  475 PHE B CE1 
4821 C CE2 . PHE B 264 ? 0.2395 0.2218 0.2096 -0.0165 0.0125  0.0168  475 PHE B CE2 
4822 C CZ  . PHE B 264 ? 0.2807 0.2659 0.2545 -0.0142 0.0124  0.0193  475 PHE B CZ  
4823 N N   . ALA B 265 ? 0.2581 0.2245 0.2323 -0.0263 0.0221  0.0113  476 ALA B N   
4824 C CA  . ALA B 265 ? 0.2609 0.2256 0.2356 -0.0291 0.0240  0.0094  476 ALA B CA  
4825 C C   . ALA B 265 ? 0.2778 0.2408 0.2570 -0.0285 0.0267  0.0115  476 ALA B C   
4826 O O   . ALA B 265 ? 0.2817 0.2441 0.2634 -0.0256 0.0270  0.0145  476 ALA B O   
4827 C CB  . ALA B 265 ? 0.2687 0.2299 0.2429 -0.0319 0.0262  0.0060  476 ALA B CB  
4828 N N   . SER B 266 ? 0.2887 0.2509 0.2685 -0.0311 0.0285  0.0101  477 SER B N   
4829 C CA  . SER B 266 ? 0.3127 0.2717 0.2959 -0.0311 0.0318  0.0120  477 SER B CA  
4830 C C   . SER B 266 ? 0.3336 0.2900 0.3182 -0.0352 0.0354  0.0087  477 SER B C   
4831 O O   . SER B 266 ? 0.3355 0.2936 0.3182 -0.0381 0.0348  0.0048  477 SER B O   
4832 C CB  . SER B 266 ? 0.3100 0.2721 0.2921 -0.0298 0.0303  0.0148  477 SER B CB  
4833 O OG  . SER B 266 ? 0.3007 0.2665 0.2814 -0.0326 0.0295  0.0120  477 SER B OG  
4834 N N   . ARG B 267 ? 0.3661 0.3182 0.3534 -0.0357 0.0392  0.0101  478 ARG B N   
4835 C CA  . ARG B 267 ? 0.3842 0.3335 0.3732 -0.0401 0.0434  0.0067  478 ARG B CA  
4836 C C   . ARG B 267 ? 0.3808 0.3362 0.3677 -0.0434 0.0415  0.0031  478 ARG B C   
4837 O O   . ARG B 267 ? 0.3782 0.3342 0.3652 -0.0473 0.0429  -0.0014 478 ARG B O   
4838 C CB  . ARG B 267 ? 0.4020 0.3456 0.3931 -0.0400 0.0477  0.0093  478 ARG B CB  
4839 C CG  . ARG B 267 ? 0.4628 0.3994 0.4564 -0.0364 0.0500  0.0130  478 ARG B CG  
4840 C CD  . ARG B 267 ? 0.5177 0.4477 0.5118 -0.0364 0.0542  0.0162  478 ARG B CD  
4841 N NE  . ARG B 267 ? 0.5560 0.4879 0.5472 -0.0332 0.0515  0.0211  478 ARG B NE  
4842 C CZ  . ARG B 267 ? 0.5904 0.5251 0.5791 -0.0352 0.0514  0.0213  478 ARG B CZ  
4843 N NH1 . ARG B 267 ? 0.5937 0.5305 0.5827 -0.0404 0.0536  0.0168  478 ARG B NH1 
4844 N NH2 . ARG B 267 ? 0.6086 0.5448 0.5945 -0.0321 0.0492  0.0259  478 ARG B NH2 
4845 N N   . LEU B 268 ? 0.3855 0.3459 0.3708 -0.0418 0.0384  0.0050  479 LEU B N   
4846 C CA  . LEU B 268 ? 0.4022 0.3693 0.3866 -0.0443 0.0364  0.0017  479 LEU B CA  
4847 C C   . LEU B 268 ? 0.3871 0.3587 0.3683 -0.0438 0.0319  -0.0005 479 LEU B C   
4848 O O   . LEU B 268 ? 0.3963 0.3726 0.3768 -0.0464 0.0305  -0.0044 479 LEU B O   
4849 C CB  . LEU B 268 ? 0.4143 0.3852 0.3985 -0.0427 0.0350  0.0040  479 LEU B CB  
4850 C CG  . LEU B 268 ? 0.4520 0.4310 0.4368 -0.0451 0.0332  0.0002  479 LEU B CG  
4851 C CD1 . LEU B 268 ? 0.4874 0.4665 0.4750 -0.0504 0.0373  -0.0044 479 LEU B CD1 
4852 C CD2 . LEU B 268 ? 0.4579 0.4408 0.4427 -0.0434 0.0319  0.0023  479 LEU B CD2 
4853 N N   . LYS B 269 ? 0.3749 0.3453 0.3539 -0.0405 0.0294  0.0019  480 LYS B N   
4854 C CA  . LYS B 269 ? 0.3602 0.3334 0.3350 -0.0399 0.0253  0.0004  480 LYS B CA  
4855 C C   . LYS B 269 ? 0.3451 0.3133 0.3189 -0.0396 0.0265  0.0005  480 LYS B C   
4856 O O   . LYS B 269 ? 0.3211 0.2882 0.2941 -0.0367 0.0253  0.0031  480 LYS B O   
4857 C CB  . LYS B 269 ? 0.3602 0.3377 0.3330 -0.0365 0.0212  0.0027  480 LYS B CB  
4858 C CG  . LYS B 269 ? 0.3925 0.3760 0.3669 -0.0375 0.0202  0.0012  480 LYS B CG  
4859 C CD  . LYS B 269 ? 0.4395 0.4269 0.4130 -0.0343 0.0170  0.0033  480 LYS B CD  
4860 C CE  . LYS B 269 ? 0.4819 0.4765 0.4566 -0.0351 0.0150  0.0004  480 LYS B CE  
4861 N NZ  . LYS B 269 ? 0.5058 0.5021 0.4847 -0.0390 0.0186  -0.0023 480 LYS B NZ  
4862 N N   . ASN B 270 ? 0.3362 0.3019 0.3105 -0.0431 0.0293  -0.0028 481 ASN B N   
4863 C CA  . ASN B 270 ? 0.3466 0.3071 0.3214 -0.0436 0.0320  -0.0034 481 ASN B CA  
4864 C C   . ASN B 270 ? 0.3342 0.2944 0.3036 -0.0447 0.0301  -0.0057 481 ASN B C   
4865 O O   . ASN B 270 ? 0.3396 0.2958 0.3095 -0.0459 0.0328  -0.0071 481 ASN B O   
4866 C CB  . ASN B 270 ? 0.3546 0.3112 0.3336 -0.0469 0.0373  -0.0058 481 ASN B CB  
4867 C CG  . ASN B 270 ? 0.3833 0.3418 0.3603 -0.0517 0.0379  -0.0108 481 ASN B CG  
4868 O OD1 . ASN B 270 ? 0.4445 0.4086 0.4186 -0.0524 0.0345  -0.0120 481 ASN B OD1 
4869 N ND2 . ASN B 270 ? 0.4188 0.3731 0.3975 -0.0549 0.0423  -0.0138 481 ASN B ND2 
4870 N N   . THR B 271 ? 0.3218 0.2858 0.2860 -0.0443 0.0258  -0.0060 482 THR B N   
4871 C CA  . THR B 271 ? 0.3130 0.2758 0.2703 -0.0449 0.0237  -0.0072 482 THR B CA  
4872 C C   . THR B 271 ? 0.3057 0.2686 0.2603 -0.0411 0.0207  -0.0040 482 THR B C   
4873 O O   . THR B 271 ? 0.3109 0.2775 0.2653 -0.0386 0.0176  -0.0021 482 THR B O   
4874 C CB  . THR B 271 ? 0.3235 0.2899 0.2756 -0.0467 0.0205  -0.0096 482 THR B CB  
4875 O OG1 . THR B 271 ? 0.3191 0.2866 0.2737 -0.0507 0.0231  -0.0132 482 THR B OG1 
4876 C CG2 . THR B 271 ? 0.3054 0.2690 0.2490 -0.0473 0.0185  -0.0104 482 THR B CG2 
4877 N N   . GLY B 272 ? 0.3001 0.2592 0.2532 -0.0409 0.0219  -0.0038 483 GLY B N   
4878 C CA  . GLY B 272 ? 0.2847 0.2433 0.2349 -0.0382 0.0199  -0.0017 483 GLY B CA  
4879 C C   . GLY B 272 ? 0.2940 0.2482 0.2367 -0.0402 0.0200  -0.0035 483 GLY B C   
4880 O O   . GLY B 272 ? 0.2976 0.2495 0.2381 -0.0436 0.0219  -0.0063 483 GLY B O   
4881 N N   . LEU B 273 ? 0.2644 0.2172 0.2031 -0.0385 0.0185  -0.0021 484 LEU B N   
4882 C CA  . LEU B 273 ? 0.2715 0.2191 0.2026 -0.0406 0.0193  -0.0036 484 LEU B CA  
4883 C C   . LEU B 273 ? 0.2681 0.2143 0.2020 -0.0402 0.0217  -0.0036 484 LEU B C   
4884 O O   . LEU B 273 ? 0.2574 0.2072 0.1973 -0.0374 0.0212  -0.0017 484 LEU B O   
4885 C CB  . LEU B 273 ? 0.2628 0.2086 0.1850 -0.0393 0.0156  -0.0023 484 LEU B CB  
4886 C CG  . LEU B 273 ? 0.2884 0.2370 0.2079 -0.0390 0.0122  -0.0023 484 LEU B CG  
4887 C CD1 . LEU B 273 ? 0.2983 0.2448 0.2095 -0.0366 0.0083  -0.0006 484 LEU B CD1 
4888 C CD2 . LEU B 273 ? 0.2935 0.2405 0.2099 -0.0431 0.0138  -0.0054 484 LEU B CD2 
4889 N N   . LEU B 274 ? 0.2755 0.2173 0.2056 -0.0432 0.0246  -0.0060 485 LEU B N   
4890 C CA  . LEU B 274 ? 0.2765 0.2172 0.2089 -0.0436 0.0273  -0.0071 485 LEU B CA  
4891 C C   . LEU B 274 ? 0.2939 0.2285 0.2161 -0.0462 0.0280  -0.0084 485 LEU B C   
4892 O O   . LEU B 274 ? 0.2924 0.2227 0.2073 -0.0492 0.0286  -0.0099 485 LEU B O   
4893 C CB  . LEU B 274 ? 0.2847 0.2260 0.2246 -0.0455 0.0315  -0.0100 485 LEU B CB  
4894 C CG  . LEU B 274 ? 0.2861 0.2323 0.2373 -0.0426 0.0321  -0.0088 485 LEU B CG  
4895 C CD1 . LEU B 274 ? 0.2591 0.2044 0.2163 -0.0446 0.0366  -0.0121 485 LEU B CD1 
4896 C CD2 . LEU B 274 ? 0.2934 0.2435 0.2481 -0.0393 0.0306  -0.0069 485 LEU B CD2 
4897 N N   . LEU B 275 ? 0.3010 0.2347 0.2220 -0.0455 0.0284  -0.0081 486 LEU B N   
4898 C CA  . LEU B 275 ? 0.3161 0.2429 0.2269 -0.0478 0.0294  -0.0090 486 LEU B CA  
4899 C C   . LEU B 275 ? 0.3106 0.2362 0.2239 -0.0511 0.0343  -0.0126 486 LEU B C   
4900 O O   . LEU B 275 ? 0.3056 0.2368 0.2287 -0.0498 0.0356  -0.0135 486 LEU B O   
4901 C CB  . LEU B 275 ? 0.3237 0.2501 0.2312 -0.0449 0.0267  -0.0063 486 LEU B CB  
4902 C CG  . LEU B 275 ? 0.3325 0.2505 0.2281 -0.0463 0.0271  -0.0061 486 LEU B CG  
4903 C CD1 . LEU B 275 ? 0.3009 0.2137 0.1860 -0.0460 0.0242  -0.0043 486 LEU B CD1 
4904 C CD2 . LEU B 275 ? 0.3018 0.2215 0.1990 -0.0432 0.0256  -0.0043 486 LEU B CD2 
4905 N N   . LEU B 276 ? 0.3127 0.2312 0.2169 -0.0552 0.0370  -0.0148 487 LEU B N   
4906 C CA  . LEU B 276 ? 0.3205 0.2367 0.2251 -0.0590 0.0421  -0.0187 487 LEU B CA  
4907 C C   . LEU B 276 ? 0.3165 0.2252 0.2098 -0.0605 0.0427  -0.0182 487 LEU B C   
4908 O O   . LEU B 276 ? 0.3213 0.2234 0.2031 -0.0606 0.0406  -0.0159 487 LEU B O   
4909 C CB  . LEU B 276 ? 0.3277 0.2409 0.2307 -0.0636 0.0460  -0.0223 487 LEU B CB  
4910 C CG  . LEU B 276 ? 0.3268 0.2467 0.2428 -0.0630 0.0477  -0.0244 487 LEU B CG  
4911 C CD1 . LEU B 276 ? 0.3342 0.2501 0.2465 -0.0676 0.0510  -0.0277 487 LEU B CD1 
4912 C CD2 . LEU B 276 ? 0.2955 0.2209 0.2227 -0.0624 0.0504  -0.0270 487 LEU B CD2 
4913 N N   . SER B 277 ? 0.3167 0.2263 0.2132 -0.0619 0.0457  -0.0205 488 SER B N   
4914 C CA  . SER B 277 ? 0.3313 0.2334 0.2179 -0.0636 0.0471  -0.0204 488 SER B CA  
4915 C C   . SER B 277 ? 0.3327 0.2337 0.2208 -0.0684 0.0531  -0.0255 488 SER B C   
4916 O O   . SER B 277 ? 0.3159 0.2250 0.2161 -0.0686 0.0550  -0.0287 488 SER B O   
4917 C CB  . SER B 277 ? 0.3251 0.2309 0.2149 -0.0593 0.0438  -0.0177 488 SER B CB  
4918 O OG  . SER B 277 ? 0.3238 0.2303 0.2116 -0.0549 0.0385  -0.0132 488 SER B OG  
4919 N N   . GLU B 278 ? 0.3580 0.2485 0.2334 -0.0722 0.0562  -0.0263 489 GLU B N   
4920 C CA  . GLU B 278 ? 0.3804 0.2695 0.2566 -0.0772 0.0623  -0.0314 489 GLU B CA  
4921 C C   . GLU B 278 ? 0.3714 0.2648 0.2527 -0.0753 0.0617  -0.0315 489 GLU B C   
4922 O O   . GLU B 278 ? 0.3812 0.2699 0.2556 -0.0728 0.0590  -0.0279 489 GLU B O   
4923 C CB  . GLU B 278 ? 0.4068 0.2818 0.2662 -0.0824 0.0662  -0.0321 489 GLU B CB  
4924 C CG  . GLU B 278 ? 0.4404 0.3117 0.2943 -0.0849 0.0671  -0.0325 489 GLU B CG  
4925 C CD  . GLU B 278 ? 0.4769 0.3347 0.3143 -0.0910 0.0719  -0.0340 489 GLU B CD  
4926 O OE1 . GLU B 278 ? 0.5316 0.3804 0.3588 -0.0920 0.0732  -0.0326 489 GLU B OE1 
4927 O OE2 . GLU B 278 ? 0.5189 0.3746 0.3532 -0.0947 0.0744  -0.0363 489 GLU B OE2 
4928 N N   . VAL B 279 ? 0.3765 0.2795 0.2705 -0.0762 0.0641  -0.0359 490 VAL B N   
4929 C CA  . VAL B 279 ? 0.3656 0.2749 0.2660 -0.0747 0.0636  -0.0369 490 VAL B CA  
4930 C C   . VAL B 279 ? 0.3729 0.2815 0.2739 -0.0807 0.0702  -0.0433 490 VAL B C   
4931 O O   . VAL B 279 ? 0.3585 0.2729 0.2678 -0.0833 0.0736  -0.0482 490 VAL B O   
4932 C CB  . VAL B 279 ? 0.3487 0.2722 0.2646 -0.0698 0.0597  -0.0363 490 VAL B CB  
4933 C CG1 . VAL B 279 ? 0.3231 0.2534 0.2444 -0.0681 0.0585  -0.0369 490 VAL B CG1 
4934 C CG2 . VAL B 279 ? 0.3482 0.2720 0.2637 -0.0647 0.0540  -0.0305 490 VAL B CG2 
4935 N N   . ALA B 280 ? 0.3743 0.2761 0.2671 -0.0827 0.0721  -0.0435 491 ALA B N   
4936 C CA  . ALA B 280 ? 0.3922 0.2924 0.2844 -0.0891 0.0789  -0.0499 491 ALA B CA  
4937 C C   . ALA B 280 ? 0.3894 0.3038 0.2959 -0.0876 0.0782  -0.0534 491 ALA B C   
4938 O O   . ALA B 280 ? 0.4018 0.3162 0.3067 -0.0865 0.0770  -0.0524 491 ALA B O   
4939 C CB  . ALA B 280 ? 0.4004 0.2852 0.2762 -0.0922 0.0819  -0.0486 491 ALA B CB  
4940 N N   . LEU B 281 ? 0.3862 0.3129 0.3066 -0.0876 0.0788  -0.0575 492 LEU B N   
4941 C CA  . LEU B 281 ? 0.3816 0.3237 0.3166 -0.0850 0.0767  -0.0601 492 LEU B CA  
4942 C C   . LEU B 281 ? 0.4013 0.3459 0.3380 -0.0906 0.0822  -0.0671 492 LEU B C   
4943 O O   . LEU B 281 ? 0.3929 0.3468 0.3364 -0.0891 0.0803  -0.0685 492 LEU B O   
4944 C CB  . LEU B 281 ? 0.3731 0.3272 0.3226 -0.0823 0.0752  -0.0619 492 LEU B CB  
4945 C CG  . LEU B 281 ? 0.3767 0.3300 0.3269 -0.0770 0.0703  -0.0559 492 LEU B CG  
4946 C CD1 . LEU B 281 ? 0.3275 0.2916 0.2923 -0.0747 0.0700  -0.0584 492 LEU B CD1 
4947 C CD2 . LEU B 281 ? 0.3852 0.3409 0.3350 -0.0710 0.0638  -0.0496 492 LEU B CD2 
4948 N N   . GLY B 282 ? 0.4193 0.3557 0.3496 -0.0975 0.0892  -0.0719 493 GLY B N   
4949 C CA  . GLY B 282 ? 0.4350 0.3756 0.3692 -0.1036 0.0953  -0.0799 493 GLY B CA  
4950 C C   . GLY B 282 ? 0.4300 0.3906 0.3837 -0.1014 0.0935  -0.0848 493 GLY B C   
4951 O O   . GLY B 282 ? 0.4309 0.3989 0.3941 -0.0979 0.0911  -0.0843 493 GLY B O   
4952 N N   . GLN B 283 ? 0.4341 0.4035 0.3938 -0.1031 0.0945  -0.0895 494 GLN B N   
4953 C CA  . GLN B 283 ? 0.4374 0.4267 0.4152 -0.1005 0.0921  -0.0940 494 GLN B CA  
4954 C C   . GLN B 283 ? 0.4340 0.4308 0.4163 -0.0922 0.0835  -0.0872 494 GLN B C   
4955 O O   . GLN B 283 ? 0.4247 0.4158 0.3986 -0.0910 0.0813  -0.0831 494 GLN B O   
4956 C CB  . GLN B 283 ? 0.4480 0.4446 0.4300 -0.1060 0.0965  -0.1022 494 GLN B CB  
4957 C CG  . GLN B 283 ? 0.4825 0.4732 0.4610 -0.1152 0.1059  -0.1102 494 GLN B CG  
4958 C CD  . GLN B 283 ? 0.5349 0.5357 0.5264 -0.1157 0.1078  -0.1156 494 GLN B CD  
4959 O OE1 . GLN B 283 ? 0.5405 0.5330 0.5277 -0.1159 0.1093  -0.1135 494 GLN B OE1 
4960 N NE2 . GLN B 283 ? 0.5613 0.5811 0.5694 -0.1154 0.1075  -0.1226 494 GLN B NE2 
4961 N N   . CYS B 284 ? 0.4230 0.4319 0.4182 -0.0866 0.0791  -0.0863 495 CYS B N   
4962 C CA  . CYS B 284 ? 0.4231 0.4393 0.4229 -0.0786 0.0711  -0.0798 495 CYS B CA  
4963 C C   . CYS B 284 ? 0.4216 0.4546 0.4330 -0.0773 0.0689  -0.0840 495 CYS B C   
4964 O O   . CYS B 284 ? 0.4170 0.4609 0.4392 -0.0796 0.0716  -0.0912 495 CYS B O   
4965 C CB  . CYS B 284 ? 0.4094 0.4289 0.4166 -0.0731 0.0677  -0.0762 495 CYS B CB  
4966 S SG  . CYS B 284 ? 0.4234 0.4257 0.4189 -0.0745 0.0699  -0.0720 495 CYS B SG  
4967 N N   . ASN B 285 ? 0.4254 0.4616 0.4350 -0.0735 0.0638  -0.0796 496 ASN B N   
4968 C CA  . ASN B 285 ? 0.4221 0.4760 0.4435 -0.0702 0.0596  -0.0818 496 ASN B CA  
4969 C C   . ASN B 285 ? 0.4176 0.4780 0.4465 -0.0620 0.0531  -0.0759 496 ASN B C   
4970 O O   . ASN B 285 ? 0.4220 0.4756 0.4445 -0.0578 0.0492  -0.0682 496 ASN B O   
4971 C CB  . ASN B 285 ? 0.4272 0.4821 0.4431 -0.0706 0.0577  -0.0807 496 ASN B CB  
4972 C CG  . ASN B 285 ? 0.4213 0.4954 0.4489 -0.0686 0.0541  -0.0845 496 ASN B CG  
4973 O OD1 . ASN B 285 ? 0.4290 0.5145 0.4671 -0.0706 0.0562  -0.0917 496 ASN B OD1 
4974 N ND2 . ASN B 285 ? 0.4359 0.5144 0.4621 -0.0643 0.0486  -0.0798 496 ASN B ND2 
4975 N N   . GLU B 286 ? 0.4109 0.4847 0.4537 -0.0597 0.0522  -0.0799 497 GLU B N   
4976 C CA  . GLU B 286 ? 0.4086 0.4881 0.4598 -0.0521 0.0472  -0.0752 497 GLU B CA  
4977 C C   . GLU B 286 ? 0.4032 0.4962 0.4609 -0.0460 0.0403  -0.0724 497 GLU B C   
4978 O O   . GLU B 286 ? 0.3996 0.5069 0.4656 -0.0466 0.0395  -0.0781 497 GLU B O   
4979 C CB  . GLU B 286 ? 0.4082 0.4942 0.4714 -0.0523 0.0502  -0.0809 497 GLU B CB  
4980 C CG  . GLU B 286 ? 0.4150 0.4888 0.4723 -0.0592 0.0577  -0.0849 497 GLU B CG  
4981 C CD  . GLU B 286 ? 0.4283 0.5075 0.4976 -0.0587 0.0605  -0.0897 497 GLU B CD  
4982 O OE1 . GLU B 286 ? 0.4464 0.5416 0.5302 -0.0553 0.0583  -0.0936 497 GLU B OE1 
4983 O OE2 . GLU B 286 ? 0.4271 0.4946 0.4911 -0.0616 0.0647  -0.0895 497 GLU B OE2 
4984 N N   . LEU B 287 ? 0.3991 0.4877 0.4526 -0.0403 0.0353  -0.0639 498 LEU B N   
4985 C CA  . LEU B 287 ? 0.3989 0.4981 0.4562 -0.0341 0.0286  -0.0598 498 LEU B CA  
4986 C C   . LEU B 287 ? 0.4043 0.5044 0.4671 -0.0265 0.0244  -0.0538 498 LEU B C   
4987 O O   . LEU B 287 ? 0.4078 0.4966 0.4672 -0.0259 0.0260  -0.0502 498 LEU B O   
4988 C CB  . LEU B 287 ? 0.3934 0.4860 0.4390 -0.0348 0.0267  -0.0551 498 LEU B CB  
4989 C CG  . LEU B 287 ? 0.3945 0.4857 0.4342 -0.0417 0.0305  -0.0604 498 LEU B CG  
4990 C CD1 . LEU B 287 ? 0.3621 0.4469 0.3912 -0.0413 0.0283  -0.0552 498 LEU B CD1 
4991 C CD2 . LEU B 287 ? 0.3749 0.4832 0.4244 -0.0434 0.0304  -0.0682 498 LEU B CD2 
4992 N N   . LEU B 288 ? 0.4134 0.5270 0.4841 -0.0209 0.0189  -0.0526 499 LEU B N   
4993 C CA  . LEU B 288 ? 0.4200 0.5362 0.4971 -0.0130 0.0148  -0.0472 499 LEU B CA  
4994 C C   . LEU B 288 ? 0.4202 0.5308 0.4893 -0.0087 0.0102  -0.0381 499 LEU B C   
4995 O O   . LEU B 288 ? 0.4357 0.5424 0.5064 -0.0033 0.0082  -0.0326 499 LEU B O   
4996 C CB  . LEU B 288 ? 0.4255 0.5598 0.5160 -0.0087 0.0112  -0.0509 499 LEU B CB  
4997 C CG  . LEU B 288 ? 0.4366 0.5775 0.5384 -0.0113 0.0155  -0.0597 499 LEU B CG  
4998 C CD1 . LEU B 288 ? 0.4414 0.6024 0.5544 -0.0101 0.0126  -0.0660 499 LEU B CD1 
4999 C CD2 . LEU B 288 ? 0.4686 0.6047 0.5772 -0.0068 0.0163  -0.0574 499 LEU B CD2 
5000 N N   . GLU B 289 ? 0.4152 0.5252 0.4757 -0.0112 0.0090  -0.0369 500 GLU B N   
5001 C CA  . GLU B 289 ? 0.4186 0.5245 0.4716 -0.0075 0.0049  -0.0290 500 GLU B CA  
5002 C C   . GLU B 289 ? 0.4063 0.5047 0.4479 -0.0125 0.0066  -0.0286 500 GLU B C   
5003 O O   . GLU B 289 ? 0.4090 0.5064 0.4486 -0.0184 0.0105  -0.0344 500 GLU B O   
5004 C CB  . GLU B 289 ? 0.4200 0.5398 0.4776 -0.0021 -0.0012 -0.0271 500 GLU B CB  
5005 C CG  . GLU B 289 ? 0.4465 0.5803 0.5081 -0.0052 -0.0017 -0.0343 500 GLU B CG  
5006 C CD  . GLU B 289 ? 0.4881 0.6367 0.5542 0.0004  -0.0083 -0.0324 500 GLU B CD  
5007 O OE1 . GLU B 289 ? 0.4879 0.6344 0.5527 0.0067  -0.0123 -0.0250 500 GLU B OE1 
5008 O OE2 . GLU B 289 ? 0.5301 0.6923 0.6007 -0.0016 -0.0094 -0.0386 500 GLU B OE2 
5009 N N   . ALA B 290 ? 0.3983 0.4913 0.4327 -0.0100 0.0039  -0.0218 501 ALA B N   
5010 C CA  . ALA B 290 ? 0.3866 0.4725 0.4105 -0.0135 0.0049  -0.0205 501 ALA B CA  
5011 C C   . ALA B 290 ? 0.3755 0.4698 0.3985 -0.0172 0.0050  -0.0257 501 ALA B C   
5012 O O   . ALA B 290 ? 0.3806 0.4882 0.4091 -0.0151 0.0017  -0.0273 501 ALA B O   
5013 C CB  . ALA B 290 ? 0.3824 0.4648 0.4010 -0.0094 0.0013  -0.0128 501 ALA B CB  
5014 N N   . ASN B 291 ? 0.3595 0.4458 0.3756 -0.0225 0.0089  -0.0283 502 ASN B N   
5015 C CA  . ASN B 291 ? 0.3527 0.4435 0.3659 -0.0267 0.0100  -0.0328 502 ASN B CA  
5016 C C   . ASN B 291 ? 0.3409 0.4181 0.3439 -0.0306 0.0136  -0.0322 502 ASN B C   
5017 O O   . ASN B 291 ? 0.3418 0.4111 0.3424 -0.0348 0.0182  -0.0356 502 ASN B O   
5018 C CB  . ASN B 291 ? 0.3526 0.4523 0.3726 -0.0306 0.0127  -0.0412 502 ASN B CB  
5019 C CG  . ASN B 291 ? 0.3734 0.4781 0.3903 -0.0353 0.0141  -0.0463 502 ASN B CG  
5020 O OD1 . ASN B 291 ? 0.3404 0.4399 0.3494 -0.0359 0.0137  -0.0436 502 ASN B OD1 
5021 N ND2 . ASN B 291 ? 0.3691 0.4840 0.3926 -0.0388 0.0161  -0.0540 502 ASN B ND2 
5022 N N   . PRO B 292 ? 0.3371 0.4116 0.3339 -0.0293 0.0115  -0.0280 503 PRO B N   
5023 C CA  . PRO B 292 ? 0.3368 0.3990 0.3244 -0.0319 0.0142  -0.0270 503 PRO B CA  
5024 C C   . PRO B 292 ? 0.3473 0.4067 0.3316 -0.0377 0.0188  -0.0332 503 PRO B C   
5025 O O   . PRO B 292 ? 0.3484 0.3955 0.3252 -0.0399 0.0217  -0.0327 503 PRO B O   
5026 C CB  . PRO B 292 ? 0.3383 0.4029 0.3224 -0.0292 0.0107  -0.0226 503 PRO B CB  
5027 C CG  . PRO B 292 ? 0.3348 0.4065 0.3242 -0.0241 0.0064  -0.0184 503 PRO B CG  
5028 C CD  . PRO B 292 ? 0.3329 0.4148 0.3307 -0.0245 0.0063  -0.0232 503 PRO B CD  
5029 N N   . LYS B 293 ? 0.3439 0.4143 0.3335 -0.0402 0.0195  -0.0392 504 LYS B N   
5030 C CA  . LYS B 293 ? 0.3560 0.4237 0.3430 -0.0465 0.0247  -0.0459 504 LYS B CA  
5031 C C   . LYS B 293 ? 0.3499 0.4148 0.3401 -0.0497 0.0288  -0.0504 504 LYS B C   
5032 O O   . LYS B 293 ? 0.3456 0.4108 0.3355 -0.0552 0.0333  -0.0570 504 LYS B O   
5033 C CB  . LYS B 293 ? 0.3630 0.4441 0.3533 -0.0485 0.0237  -0.0508 504 LYS B CB  
5034 C CG  . LYS B 293 ? 0.4164 0.4997 0.4024 -0.0462 0.0203  -0.0470 504 LYS B CG  
5035 C CD  . LYS B 293 ? 0.5026 0.6013 0.4922 -0.0481 0.0189  -0.0521 504 LYS B CD  
5036 C CE  . LYS B 293 ? 0.5218 0.6278 0.5103 -0.0438 0.0133  -0.0471 504 LYS B CE  
5037 N NZ  . LYS B 293 ? 0.5738 0.6948 0.5646 -0.0457 0.0115  -0.0518 504 LYS B NZ  
5038 N N   . ALA B 294 ? 0.3415 0.4031 0.3343 -0.0468 0.0279  -0.0471 505 ALA B N   
5039 C CA  . ALA B 294 ? 0.3355 0.3950 0.3317 -0.0498 0.0320  -0.0515 505 ALA B CA  
5040 C C   . ALA B 294 ? 0.3348 0.3817 0.3229 -0.0561 0.0384  -0.0553 505 ALA B C   
5041 O O   . ALA B 294 ? 0.3380 0.3864 0.3290 -0.0608 0.0429  -0.0618 505 ALA B O   
5042 C CB  . ALA B 294 ? 0.3293 0.3847 0.3279 -0.0459 0.0304  -0.0469 505 ALA B CB  
5043 N N   . GLU B 295 ? 0.3403 0.3749 0.3182 -0.0564 0.0391  -0.0517 506 GLU B N   
5044 C CA  . GLU B 295 ? 0.3535 0.3742 0.3224 -0.0616 0.0450  -0.0541 506 GLU B CA  
5045 C C   . GLU B 295 ? 0.3728 0.3977 0.3426 -0.0676 0.0496  -0.0620 506 GLU B C   
5046 O O   . GLU B 295 ? 0.3654 0.3821 0.3311 -0.0730 0.0556  -0.0664 506 GLU B O   
5047 C CB  . GLU B 295 ? 0.3549 0.3630 0.3135 -0.0599 0.0443  -0.0488 506 GLU B CB  
5048 C CG  . GLU B 295 ? 0.3675 0.3594 0.3155 -0.0645 0.0502  -0.0505 506 GLU B CG  
5049 C CD  . GLU B 295 ? 0.3598 0.3394 0.2983 -0.0620 0.0491  -0.0451 506 GLU B CD  
5050 O OE1 . GLU B 295 ? 0.3638 0.3474 0.3040 -0.0571 0.0440  -0.0403 506 GLU B OE1 
5051 O OE2 . GLU B 295 ? 0.3929 0.3585 0.3219 -0.0650 0.0534  -0.0457 506 GLU B OE2 
5052 N N   . GLY B 296 ? 0.3853 0.4228 0.3601 -0.0668 0.0469  -0.0638 507 GLY B N   
5053 C CA  . GLY B 296 ? 0.4077 0.4510 0.3841 -0.0726 0.0509  -0.0717 507 GLY B CA  
5054 C C   . GLY B 296 ? 0.4238 0.4778 0.4096 -0.0759 0.0533  -0.0788 507 GLY B C   
5055 O O   . GLY B 296 ? 0.4356 0.4914 0.4219 -0.0823 0.0585  -0.0864 507 GLY B O   
5056 N N   . LEU B 297 ? 0.4322 0.4931 0.4257 -0.0716 0.0497  -0.0766 508 LEU B N   
5057 C CA  . LEU B 297 ? 0.4419 0.5147 0.4463 -0.0734 0.0510  -0.0829 508 LEU B CA  
5058 C C   . LEU B 297 ? 0.4502 0.5120 0.4518 -0.0780 0.0574  -0.0859 508 LEU B C   
5059 O O   . LEU B 297 ? 0.4516 0.5221 0.4619 -0.0807 0.0599  -0.0924 508 LEU B O   
5060 C CB  . LEU B 297 ? 0.4399 0.5253 0.4542 -0.0661 0.0441  -0.0790 508 LEU B CB  
5061 C CG  . LEU B 297 ? 0.4715 0.5723 0.4911 -0.0620 0.0378  -0.0779 508 LEU B CG  
5062 C CD1 . LEU B 297 ? 0.5212 0.6156 0.5312 -0.0620 0.0367  -0.0742 508 LEU B CD1 
5063 C CD2 . LEU B 297 ? 0.4785 0.5870 0.5053 -0.0541 0.0312  -0.0721 508 LEU B CD2 
5064 N N   . LEU B 298 ? 0.4567 0.4998 0.4462 -0.0789 0.0599  -0.0814 509 LEU B N   
5065 C CA  . LEU B 298 ? 0.4632 0.4937 0.4474 -0.0833 0.0659  -0.0832 509 LEU B CA  
5066 C C   . LEU B 298 ? 0.4769 0.5086 0.4620 -0.0916 0.0734  -0.0928 509 LEU B C   
5067 O O   . LEU B 298 ? 0.4651 0.5005 0.4562 -0.0946 0.0768  -0.0980 509 LEU B O   
5068 C CB  . LEU B 298 ? 0.4699 0.4802 0.4392 -0.0832 0.0673  -0.0771 509 LEU B CB  
5069 C CG  . LEU B 298 ? 0.4552 0.4588 0.4208 -0.0768 0.0622  -0.0682 509 LEU B CG  
5070 C CD1 . LEU B 298 ? 0.4422 0.4258 0.3927 -0.0785 0.0651  -0.0645 509 LEU B CD1 
5071 C CD2 . LEU B 298 ? 0.4163 0.4244 0.3892 -0.0748 0.0611  -0.0678 509 LEU B CD2 
5072 N N   . GLN B 299 ? 0.4875 0.5152 0.4665 -0.0954 0.0762  -0.0953 510 GLN B N   
5073 C CA  . GLN B 299 ? 0.5018 0.5291 0.4802 -0.1039 0.0839  -0.1044 510 GLN B CA  
5074 C C   . GLN B 299 ? 0.5035 0.5177 0.4758 -0.1093 0.0910  -0.1069 510 GLN B C   
5075 O O   . GLN B 299 ? 0.4943 0.5165 0.4744 -0.1139 0.0950  -0.1145 510 GLN B O   
5076 C CB  . GLN B 299 ? 0.5009 0.5508 0.4946 -0.1053 0.0828  -0.1124 510 GLN B CB  
5077 C CG  . GLN B 299 ? 0.5315 0.5967 0.5317 -0.1003 0.0757  -0.1108 510 GLN B CG  
5078 C CD  . GLN B 299 ? 0.5870 0.6500 0.5813 -0.1045 0.0784  -0.1139 510 GLN B CD  
5079 O OE1 . GLN B 299 ? 0.6240 0.6690 0.6059 -0.1083 0.0836  -0.1129 510 GLN B OE1 
5080 N NE2 . GLN B 299 ? 0.5986 0.6801 0.6017 -0.1038 0.0747  -0.1177 510 GLN B NE2 
5081 N N   . GLY B 300 ? 0.5076 0.5020 0.4661 -0.1087 0.0923  -0.1006 511 GLY B N   
5082 C CA  . GLY B 300 ? 0.5185 0.4984 0.4688 -0.1142 0.0993  -0.1024 511 GLY B CA  
5083 C C   . GLY B 300 ? 0.5044 0.4845 0.4578 -0.1112 0.0972  -0.0995 511 GLY B C   
5084 O O   . GLY B 300 ? 0.5079 0.4735 0.4516 -0.1145 0.1018  -0.0988 511 GLY B O   
5085 N N   . LYS B 301 ? 0.4818 0.4780 0.4483 -0.1051 0.0906  -0.0980 512 LYS B N   
5086 C CA  . LYS B 301 ? 0.4579 0.4526 0.4261 -0.1004 0.0872  -0.0929 512 LYS B CA  
5087 C C   . LYS B 301 ? 0.4463 0.4266 0.4021 -0.0960 0.0835  -0.0834 512 LYS B C   
5088 O O   . LYS B 301 ? 0.4406 0.4166 0.3903 -0.0947 0.0819  -0.0804 512 LYS B O   
5089 C CB  . LYS B 301 ? 0.4465 0.4607 0.4310 -0.0944 0.0810  -0.0929 512 LYS B CB  
5090 C CG  . LYS B 301 ? 0.4477 0.4774 0.4460 -0.0979 0.0840  -0.1024 512 LYS B CG  
5091 C CD  . LYS B 301 ? 0.4686 0.5177 0.4825 -0.0907 0.0768  -0.1015 512 LYS B CD  
5092 C CE  . LYS B 301 ? 0.5073 0.5734 0.5367 -0.0932 0.0792  -0.1110 512 LYS B CE  
5093 N NZ  . LYS B 301 ? 0.4838 0.5700 0.5278 -0.0858 0.0715  -0.1103 512 LYS B NZ  
5094 N N   . HIS B 302 ? 0.4335 0.4065 0.3858 -0.0939 0.0825  -0.0791 513 HIS B N   
5095 C CA  . HIS B 302 ? 0.4233 0.3809 0.3623 -0.0912 0.0805  -0.0714 513 HIS B CA  
5096 C C   . HIS B 302 ? 0.3995 0.3623 0.3429 -0.0833 0.0727  -0.0643 513 HIS B C   
5097 O O   . HIS B 302 ? 0.4060 0.3586 0.3401 -0.0803 0.0700  -0.0579 513 HIS B O   
5098 C CB  . HIS B 302 ? 0.4313 0.3745 0.3601 -0.0958 0.0858  -0.0719 513 HIS B CB  
5099 C CG  . HIS B 302 ? 0.4455 0.3840 0.3707 -0.1043 0.0943  -0.0796 513 HIS B CG  
5100 N ND1 . HIS B 302 ? 0.4328 0.3815 0.3686 -0.1084 0.0983  -0.0872 513 HIS B ND1 
5101 C CD2 . HIS B 302 ? 0.4622 0.3870 0.3749 -0.1096 0.0999  -0.0810 513 HIS B CD2 
5102 C CE1 . HIS B 302 ? 0.4496 0.3913 0.3794 -0.1163 0.1062  -0.0934 513 HIS B CE1 
5103 N NE2 . HIS B 302 ? 0.4650 0.3915 0.3803 -0.1172 0.1074  -0.0896 513 HIS B NE2 
5104 N N   . SER B 303 ? 0.3683 0.3465 0.3257 -0.0799 0.0693  -0.0654 514 SER B N   
5105 C CA  . SER B 303 ? 0.3492 0.3313 0.3105 -0.0729 0.0628  -0.0589 514 SER B CA  
5106 C C   . SER B 303 ? 0.3385 0.3382 0.3147 -0.0691 0.0590  -0.0606 514 SER B C   
5107 O O   . SER B 303 ? 0.3388 0.3485 0.3232 -0.0719 0.0615  -0.0672 514 SER B O   
5108 C CB  . SER B 303 ? 0.3618 0.3365 0.3202 -0.0727 0.0636  -0.0569 514 SER B CB  
5109 O OG  . SER B 303 ? 0.3565 0.3375 0.3235 -0.0756 0.0673  -0.0628 514 SER B OG  
5110 N N   . THR B 304 ? 0.3225 0.3263 0.3020 -0.0626 0.0530  -0.0546 515 THR B N   
5111 C CA  . THR B 304 ? 0.3181 0.3371 0.3104 -0.0580 0.0488  -0.0547 515 THR B CA  
5112 C C   . THR B 304 ? 0.3228 0.3417 0.3202 -0.0547 0.0476  -0.0522 515 THR B C   
5113 O O   . THR B 304 ? 0.3159 0.3243 0.3060 -0.0539 0.0472  -0.0478 515 THR B O   
5114 C CB  . THR B 304 ? 0.3179 0.3413 0.3098 -0.0530 0.0430  -0.0493 515 THR B CB  
5115 O OG1 . THR B 304 ? 0.3104 0.3349 0.2985 -0.0561 0.0442  -0.0521 515 THR B OG1 
5116 C CG2 . THR B 304 ? 0.2805 0.3180 0.2843 -0.0477 0.0384  -0.0483 515 THR B CG2 
5117 N N   . LYS B 305 ? 0.3230 0.3539 0.3331 -0.0527 0.0469  -0.0553 516 LYS B N   
5118 C CA  . LYS B 305 ? 0.3296 0.3619 0.3463 -0.0484 0.0451  -0.0526 516 LYS B CA  
5119 C C   . LYS B 305 ? 0.3244 0.3700 0.3518 -0.0419 0.0396  -0.0505 516 LYS B C   
5120 O O   . LYS B 305 ? 0.3269 0.3854 0.3641 -0.0415 0.0392  -0.0553 516 LYS B O   
5121 C CB  . LYS B 305 ? 0.3345 0.3669 0.3566 -0.0520 0.0503  -0.0588 516 LYS B CB  
5122 C CG  . LYS B 305 ? 0.3413 0.3741 0.3703 -0.0481 0.0495  -0.0568 516 LYS B CG  
5123 C CD  . LYS B 305 ? 0.3764 0.4067 0.4084 -0.0530 0.0558  -0.0632 516 LYS B CD  
5124 C CE  . LYS B 305 ? 0.3717 0.4028 0.4115 -0.0490 0.0553  -0.0619 516 LYS B CE  
5125 N NZ  . LYS B 305 ? 0.3773 0.4097 0.4237 -0.0530 0.0612  -0.0691 516 LYS B NZ  
5126 N N   . GLY B 306 ? 0.3246 0.3673 0.3500 -0.0368 0.0354  -0.0433 517 GLY B N   
5127 C CA  . GLY B 306 ? 0.3265 0.3786 0.3608 -0.0300 0.0304  -0.0400 517 GLY B CA  
5128 C C   . GLY B 306 ? 0.3426 0.3958 0.3858 -0.0284 0.0323  -0.0418 517 GLY B C   
5129 O O   . GLY B 306 ? 0.3540 0.3970 0.3933 -0.0297 0.0348  -0.0404 517 GLY B O   
5130 N N   . LEU B 307 ? 0.3553 0.4212 0.4107 -0.0254 0.0310  -0.0451 518 LEU B N   
5131 C CA  . LEU B 307 ? 0.3666 0.4348 0.4321 -0.0237 0.0331  -0.0479 518 LEU B CA  
5132 C C   . LEU B 307 ? 0.3734 0.4404 0.4425 -0.0165 0.0293  -0.0411 518 LEU B C   
5133 O O   . LEU B 307 ? 0.3731 0.4466 0.4442 -0.0111 0.0241  -0.0368 518 LEU B O   
5134 C CB  . LEU B 307 ? 0.3772 0.4604 0.4551 -0.0235 0.0334  -0.0550 518 LEU B CB  
5135 C CG  . LEU B 307 ? 0.3776 0.4625 0.4538 -0.0313 0.0384  -0.0631 518 LEU B CG  
5136 C CD1 . LEU B 307 ? 0.3994 0.5011 0.4902 -0.0306 0.0385  -0.0706 518 LEU B CD1 
5137 C CD2 . LEU B 307 ? 0.3759 0.4479 0.4459 -0.0376 0.0451  -0.0659 518 LEU B CD2 
5138 N N   . GLY B 308 ? 0.3838 0.4416 0.4525 -0.0168 0.0323  -0.0402 519 GLY B N   
5139 C CA  . GLY B 308 ? 0.4019 0.4577 0.4750 -0.0104 0.0299  -0.0348 519 GLY B CA  
5140 C C   . GLY B 308 ? 0.4188 0.4815 0.5060 -0.0067 0.0310  -0.0383 519 GLY B C   
5141 O O   . GLY B 308 ? 0.4252 0.4931 0.5188 -0.0100 0.0346  -0.0456 519 GLY B O   
5142 N N   . LYS B 309 ? 0.4442 0.5066 0.5362 0.0003  0.0281  -0.0330 520 LYS B N   
5143 C CA  . LYS B 309 ? 0.4659 0.5335 0.5715 0.0054  0.0287  -0.0350 520 LYS B CA  
5144 C C   . LYS B 309 ? 0.4737 0.5325 0.5810 0.0018  0.0350  -0.0387 520 LYS B C   
5145 O O   . LYS B 309 ? 0.4868 0.5507 0.6058 0.0031  0.0376  -0.0438 520 LYS B O   
5146 C CB  . LYS B 309 ? 0.4761 0.5427 0.5840 0.0139  0.0242  -0.0272 520 LYS B CB  
5147 C CG  . LYS B 309 ? 0.5030 0.5822 0.6152 0.0201  0.0176  -0.0246 520 LYS B CG  
5148 C CD  . LYS B 309 ? 0.5467 0.6210 0.6547 0.0269  0.0132  -0.0151 520 LYS B CD  
5149 C CE  . LYS B 309 ? 0.5691 0.6331 0.6807 0.0304  0.0159  -0.0121 520 LYS B CE  
5150 N NZ  . LYS B 309 ? 0.5777 0.6425 0.6924 0.0395  0.0114  -0.0051 520 LYS B NZ  
5151 N N   . MET B 310 ? 0.4831 0.5292 0.5790 -0.0026 0.0374  -0.0361 521 MET B N   
5152 C CA  . MET B 310 ? 0.4920 0.5286 0.5871 -0.0066 0.0432  -0.0390 521 MET B CA  
5153 C C   . MET B 310 ? 0.4866 0.5157 0.5691 -0.0150 0.0463  -0.0411 521 MET B C   
5154 O O   . MET B 310 ? 0.4810 0.5070 0.5531 -0.0163 0.0435  -0.0371 521 MET B O   
5155 C CB  . MET B 310 ? 0.5002 0.5278 0.5939 -0.0028 0.0427  -0.0328 521 MET B CB  
5156 C CG  . MET B 310 ? 0.5401 0.5725 0.6459 0.0057  0.0405  -0.0305 521 MET B CG  
5157 S SD  . MET B 310 ? 0.6300 0.6617 0.7494 0.0065  0.0465  -0.0368 521 MET B SD  
5158 C CE  . MET B 310 ? 0.6064 0.6217 0.7179 0.0035  0.0507  -0.0338 521 MET B CE  
5159 N N   . ALA B 311 ? 0.4880 0.5141 0.5713 -0.0206 0.0521  -0.0476 522 ALA B N   
5160 C CA  . ALA B 311 ? 0.4898 0.5071 0.5602 -0.0285 0.0555  -0.0495 522 ALA B CA  
5161 C C   . ALA B 311 ? 0.4916 0.5031 0.5628 -0.0337 0.0622  -0.0553 522 ALA B C   
5162 O O   . ALA B 311 ? 0.4820 0.4983 0.5654 -0.0321 0.0650  -0.0597 522 ALA B O   
5163 C CB  . ALA B 311 ? 0.4827 0.5050 0.5493 -0.0321 0.0552  -0.0526 522 ALA B CB  
5164 N N   . PRO B 312 ? 0.4970 0.4983 0.5551 -0.0400 0.0648  -0.0554 523 PRO B N   
5165 C CA  . PRO B 312 ? 0.5065 0.5031 0.5640 -0.0461 0.0714  -0.0618 523 PRO B CA  
5166 C C   . PRO B 312 ? 0.5180 0.5224 0.5826 -0.0490 0.0749  -0.0693 523 PRO B C   
5167 O O   . PRO B 312 ? 0.5141 0.5239 0.5774 -0.0493 0.0728  -0.0697 523 PRO B O   
5168 C CB  . PRO B 312 ? 0.5061 0.4917 0.5466 -0.0520 0.0723  -0.0601 523 PRO B CB  
5169 C CG  . PRO B 312 ? 0.5006 0.4841 0.5349 -0.0477 0.0662  -0.0521 523 PRO B CG  
5170 C CD  . PRO B 312 ? 0.4959 0.4898 0.5398 -0.0414 0.0618  -0.0499 523 PRO B CD  
5171 N N   . SER B 313 ? 0.5357 0.5410 0.6084 -0.0512 0.0804  -0.0757 524 SER B N   
5172 C CA  . SER B 313 ? 0.5495 0.5624 0.6298 -0.0549 0.0849  -0.0842 524 SER B CA  
5173 C C   . SER B 313 ? 0.5630 0.5669 0.6330 -0.0644 0.0919  -0.0895 524 SER B C   
5174 O O   . SER B 313 ? 0.5737 0.5676 0.6360 -0.0672 0.0942  -0.0884 524 SER B O   
5175 C CB  . SER B 313 ? 0.5491 0.5710 0.6479 -0.0504 0.0865  -0.0885 524 SER B CB  
5176 O OG  . SER B 313 ? 0.5446 0.5586 0.6433 -0.0522 0.0910  -0.0899 524 SER B OG  
5177 N N   . SER B 314 ? 0.5702 0.5782 0.6404 -0.0695 0.0955  -0.0958 525 SER B N   
5178 C CA  . SER B 314 ? 0.5835 0.5817 0.6407 -0.0791 0.1019  -0.1001 525 SER B CA  
5179 C C   . SER B 314 ? 0.5897 0.5828 0.6481 -0.0837 0.1087  -0.1056 525 SER B C   
5180 O O   . SER B 314 ? 0.5968 0.5791 0.6411 -0.0910 0.1130  -0.1068 525 SER B O   
5181 C CB  . SER B 314 ? 0.5854 0.5891 0.6432 -0.0838 0.1049  -0.1061 525 SER B CB  
5182 O OG  . SER B 314 ? 0.5918 0.6031 0.6624 -0.0865 0.1108  -0.1153 525 SER B OG  
5183 N N   . ALA B 315 ? 0.5938 0.5942 0.6685 -0.0796 0.1099  -0.1086 526 ALA B N   
5184 C CA  . ALA B 315 ? 0.6029 0.5981 0.6792 -0.0839 0.1166  -0.1139 526 ALA B CA  
5185 C C   . ALA B 315 ? 0.6095 0.5911 0.6706 -0.0865 0.1165  -0.1090 526 ALA B C   
5186 O O   . ALA B 315 ? 0.6143 0.5889 0.6697 -0.0931 0.1227  -0.1136 526 ALA B O   
5187 C CB  . ALA B 315 ? 0.6028 0.6071 0.6992 -0.0774 0.1170  -0.1167 526 ALA B CB  
5188 N N   . HIS B 316 ? 0.6038 0.5822 0.6583 -0.0816 0.1096  -0.1002 527 HIS B N   
5189 C CA  . HIS B 316 ? 0.6081 0.5756 0.6507 -0.0829 0.1087  -0.0955 527 HIS B CA  
5190 C C   . HIS B 316 ? 0.6070 0.5653 0.6297 -0.0872 0.1068  -0.0914 527 HIS B C   
5191 O O   . HIS B 316 ? 0.6155 0.5655 0.6277 -0.0885 0.1057  -0.0878 527 HIS B O   
5192 C CB  . HIS B 316 ? 0.6049 0.5745 0.6542 -0.0745 0.1028  -0.0887 527 HIS B CB  
5193 C CG  . HIS B 316 ? 0.6194 0.5966 0.6875 -0.0689 0.1040  -0.0914 527 HIS B CG  
5194 N ND1 . HIS B 316 ? 0.6535 0.6285 0.7280 -0.0714 0.1102  -0.0971 527 HIS B ND1 
5195 C CD2 . HIS B 316 ? 0.6369 0.6236 0.7185 -0.0608 0.0998  -0.0891 527 HIS B CD2 
5196 C CE1 . HIS B 316 ? 0.6583 0.6410 0.7501 -0.0646 0.1097  -0.0981 527 HIS B CE1 
5197 N NE2 . HIS B 316 ? 0.6663 0.6561 0.7624 -0.0579 0.1032  -0.0931 527 HIS B NE2 
5198 N N   . PHE B 317 ? 0.5965 0.5562 0.6143 -0.0893 0.1063  -0.0919 528 PHE B N   
5199 C CA  . PHE B 317 ? 0.5942 0.5450 0.5936 -0.0922 0.1040  -0.0874 528 PHE B CA  
5200 C C   . PHE B 317 ? 0.5970 0.5362 0.5810 -0.1004 0.1091  -0.0899 528 PHE B C   
5201 O O   . PHE B 317 ? 0.6157 0.5542 0.6025 -0.1055 0.1157  -0.0967 528 PHE B O   
5202 C CB  . PHE B 317 ? 0.5936 0.5482 0.5921 -0.0929 0.1033  -0.0882 528 PHE B CB  
5203 C CG  . PHE B 317 ? 0.5922 0.5577 0.6026 -0.0850 0.0973  -0.0848 528 PHE B CG  
5204 C CD1 . PHE B 317 ? 0.5843 0.5554 0.6059 -0.0778 0.0932  -0.0813 528 PHE B CD1 
5205 C CD2 . PHE B 317 ? 0.6018 0.5717 0.6119 -0.0852 0.0960  -0.0854 528 PHE B CD2 
5206 C CE1 . PHE B 317 ? 0.5778 0.5585 0.6091 -0.0708 0.0877  -0.0780 528 PHE B CE1 
5207 C CE2 . PHE B 317 ? 0.5880 0.5684 0.6084 -0.0783 0.0904  -0.0825 528 PHE B CE2 
5208 C CZ  . PHE B 317 ? 0.5740 0.5598 0.6046 -0.0710 0.0861  -0.0787 528 PHE B CZ  
5209 N N   . VAL B 318 ? 0.5846 0.5151 0.5519 -0.1016 0.1058  -0.0844 529 VAL B N   
5210 C CA  . VAL B 318 ? 0.5836 0.5024 0.5335 -0.1083 0.1089  -0.0849 529 VAL B CA  
5211 C C   . VAL B 318 ? 0.5826 0.4939 0.5163 -0.1094 0.1061  -0.0803 529 VAL B C   
5212 O O   . VAL B 318 ? 0.5612 0.4768 0.4983 -0.1050 0.1019  -0.0770 529 VAL B O   
5213 C CB  . VAL B 318 ? 0.5865 0.5023 0.5340 -0.1068 0.1066  -0.0819 529 VAL B CB  
5214 C CG1 . VAL B 318 ? 0.5993 0.5040 0.5263 -0.1103 0.1049  -0.0781 529 VAL B CG1 
5215 C CG2 . VAL B 318 ? 0.5771 0.4953 0.5346 -0.1095 0.1126  -0.0885 529 VAL B CG2 
5216 N N   . THR B 319 ? 0.5844 0.4843 0.5005 -0.1153 0.1085  -0.0802 530 THR B N   
5217 C CA  . THR B 319 ? 0.5908 0.4816 0.4902 -0.1168 0.1068  -0.0762 530 THR B CA  
5218 C C   . THR B 319 ? 0.5896 0.4732 0.4756 -0.1152 0.1017  -0.0699 530 THR B C   
5219 O O   . THR B 319 ? 0.6024 0.4836 0.4851 -0.1174 0.1028  -0.0710 530 THR B O   
5220 C CB  . THR B 319 ? 0.6066 0.4889 0.4951 -0.1255 0.1147  -0.0817 530 THR B CB  
5221 O OG1 . THR B 319 ? 0.5996 0.4884 0.4986 -0.1263 0.1180  -0.0862 530 THR B OG1 
5222 C CG2 . THR B 319 ? 0.6148 0.4829 0.4804 -0.1284 0.1137  -0.0771 530 THR B CG2 
5223 N N   . LEU B 320 ? 0.5767 0.4577 0.4558 -0.1111 0.0960  -0.0636 531 LEU B N   
5224 C CA  . LEU B 320 ? 0.5724 0.4460 0.4368 -0.1100 0.0913  -0.0580 531 LEU B CA  
5225 C C   . LEU B 320 ? 0.5854 0.4496 0.4352 -0.1109 0.0907  -0.0549 531 LEU B C   
5226 O O   . LEU B 320 ? 0.5670 0.4339 0.4206 -0.1066 0.0875  -0.0520 531 LEU B O   
5227 C CB  . LEU B 320 ? 0.5574 0.4382 0.4300 -0.1027 0.0841  -0.0530 531 LEU B CB  
5228 C CG  . LEU B 320 ? 0.5494 0.4256 0.4109 -0.1021 0.0799  -0.0492 531 LEU B CG  
5229 C CD1 . LEU B 320 ? 0.5157 0.3876 0.3709 -0.1083 0.0845  -0.0535 531 LEU B CD1 
5230 C CD2 . LEU B 320 ? 0.4904 0.3754 0.3633 -0.0957 0.0742  -0.0458 531 LEU B CD2 
5231 N N   . ASN B 321 ? 0.5966 0.4492 0.4294 -0.1169 0.0945  -0.0559 532 ASN B N   
5232 C CA  . ASN B 321 ? 0.6051 0.4456 0.4208 -0.1185 0.0947  -0.0527 532 ASN B CA  
5233 C C   . ASN B 321 ? 0.5840 0.4255 0.4047 -0.1187 0.0974  -0.0544 532 ASN B C   
5234 O O   . ASN B 321 ? 0.5853 0.4215 0.3987 -0.1159 0.0945  -0.0500 532 ASN B O   
5235 C CB  . ASN B 321 ? 0.6110 0.4481 0.4174 -0.1127 0.0866  -0.0450 532 ASN B CB  
5236 C CG  . ASN B 321 ? 0.6404 0.4766 0.4405 -0.1135 0.0843  -0.0441 532 ASN B CG  
5237 O OD1 . ASN B 321 ? 0.7019 0.5360 0.4994 -0.1195 0.0896  -0.0489 532 ASN B OD1 
5238 N ND2 . ASN B 321 ? 0.6426 0.4806 0.4404 -0.1078 0.0766  -0.0385 532 ASN B ND2 
5239 N N   . GLY B 322 ? 0.5698 0.4182 0.4032 -0.1221 0.1031  -0.0612 533 GLY B N   
5240 C CA  . GLY B 322 ? 0.5524 0.4028 0.3910 -0.1231 0.1063  -0.0640 533 GLY B CA  
5241 C C   . GLY B 322 ? 0.5226 0.3874 0.3801 -0.1166 0.1019  -0.0634 533 GLY B C   
5242 O O   . GLY B 322 ? 0.5209 0.3905 0.3860 -0.1175 0.1045  -0.0669 533 GLY B O   
5243 N N   . SER B 323 ? 0.4889 0.3606 0.3538 -0.1103 0.0954  -0.0593 534 SER B N   
5244 C CA  . SER B 323 ? 0.4625 0.3473 0.3444 -0.1040 0.0912  -0.0584 534 SER B CA  
5245 C C   . SER B 323 ? 0.4508 0.3464 0.3491 -0.1032 0.0926  -0.0626 534 SER B C   
5246 O O   . SER B 323 ? 0.4466 0.3403 0.3433 -0.1044 0.0931  -0.0629 534 SER B O   
5247 C CB  . SER B 323 ? 0.4485 0.3335 0.3276 -0.0973 0.0832  -0.0508 534 SER B CB  
5248 O OG  . SER B 323 ? 0.4596 0.3366 0.3271 -0.0968 0.0817  -0.0473 534 SER B OG  
5249 N N   . THR B 324 ? 0.4459 0.3528 0.3599 -0.1012 0.0931  -0.0658 535 THR B N   
5250 C CA  . THR B 324 ? 0.4466 0.3646 0.3778 -0.0989 0.0937  -0.0693 535 THR B CA  
5251 C C   . THR B 324 ? 0.4438 0.3661 0.3805 -0.0919 0.0870  -0.0634 535 THR B C   
5252 O O   . THR B 324 ? 0.4350 0.3603 0.3727 -0.0867 0.0814  -0.0583 535 THR B O   
5253 C CB  . THR B 324 ? 0.4493 0.3790 0.3953 -0.0978 0.0951  -0.0738 535 THR B CB  
5254 O OG1 . THR B 324 ? 0.4708 0.3970 0.4127 -0.1051 0.1022  -0.0802 535 THR B OG1 
5255 C CG2 . THR B 324 ? 0.4585 0.4000 0.4231 -0.0942 0.0950  -0.0768 535 THR B CG2 
5256 N N   . VAL B 325 ? 0.4289 0.3510 0.3686 -0.0923 0.0881  -0.0644 536 VAL B N   
5257 C CA  . VAL B 325 ? 0.4155 0.3417 0.3617 -0.0864 0.0831  -0.0600 536 VAL B CA  
5258 C C   . VAL B 325 ? 0.4046 0.3414 0.3696 -0.0831 0.0842  -0.0632 536 VAL B C   
5259 O O   . VAL B 325 ? 0.4338 0.3713 0.4042 -0.0864 0.0895  -0.0688 536 VAL B O   
5260 C CB  . VAL B 325 ? 0.4200 0.3389 0.3575 -0.0890 0.0837  -0.0592 536 VAL B CB  
5261 C CG1 . VAL B 325 ? 0.4339 0.3576 0.3798 -0.0835 0.0796  -0.0557 536 VAL B CG1 
5262 C CG2 . VAL B 325 ? 0.3961 0.3048 0.3148 -0.0914 0.0818  -0.0555 536 VAL B CG2 
5263 N N   . PRO B 326 ? 0.3845 0.3298 0.3595 -0.0766 0.0795  -0.0600 537 PRO B N   
5264 C CA  . PRO B 326 ? 0.3810 0.3367 0.3735 -0.0727 0.0799  -0.0625 537 PRO B CA  
5265 C C   . PRO B 326 ? 0.3909 0.3477 0.3910 -0.0687 0.0787  -0.0605 537 PRO B C   
5266 O O   . PRO B 326 ? 0.3842 0.3467 0.3924 -0.0623 0.0743  -0.0565 537 PRO B O   
5267 C CB  . PRO B 326 ? 0.3834 0.3464 0.3803 -0.0677 0.0749  -0.0592 537 PRO B CB  
5268 C CG  . PRO B 326 ? 0.3649 0.3216 0.3496 -0.0665 0.0704  -0.0528 537 PRO B CG  
5269 C CD  . PRO B 326 ? 0.3820 0.3278 0.3521 -0.0730 0.0738  -0.0542 537 PRO B CD  
5270 N N   . LEU B 327 ? 0.3996 0.3507 0.3969 -0.0729 0.0830  -0.0636 538 LEU B N   
5271 C CA  . LEU B 327 ? 0.4095 0.3608 0.4142 -0.0701 0.0832  -0.0629 538 LEU B CA  
5272 C C   . LEU B 327 ? 0.4109 0.3715 0.4332 -0.0639 0.0825  -0.0634 538 LEU B C   
5273 O O   . LEU B 327 ? 0.4157 0.3832 0.4468 -0.0635 0.0842  -0.0675 538 LEU B O   
5274 C CB  . LEU B 327 ? 0.4113 0.3567 0.4127 -0.0764 0.0895  -0.0684 538 LEU B CB  
5275 C CG  . LEU B 327 ? 0.4074 0.3432 0.3906 -0.0824 0.0901  -0.0676 538 LEU B CG  
5276 C CD1 . LEU B 327 ? 0.4070 0.3380 0.3884 -0.0886 0.0967  -0.0736 538 LEU B CD1 
5277 C CD2 . LEU B 327 ? 0.3619 0.2949 0.3379 -0.0792 0.0840  -0.0606 538 LEU B CD2 
5278 N N   . GLY B 328 ? 0.4241 0.3847 0.4512 -0.0590 0.0798  -0.0593 539 GLY B N   
5279 C CA  . GLY B 328 ? 0.4309 0.3984 0.4736 -0.0525 0.0790  -0.0589 539 GLY B CA  
5280 C C   . GLY B 328 ? 0.4462 0.4125 0.4979 -0.0538 0.0849  -0.0644 539 GLY B C   
5281 O O   . GLY B 328 ? 0.4378 0.3994 0.4843 -0.0605 0.0901  -0.0695 539 GLY B O   
5282 N N   . PRO B 329 ? 0.4670 0.4371 0.5317 -0.0475 0.0843  -0.0631 540 PRO B N   
5283 C CA  . PRO B 329 ? 0.4723 0.4467 0.5417 -0.0396 0.0782  -0.0564 540 PRO B CA  
5284 C C   . PRO B 329 ? 0.4766 0.4612 0.5519 -0.0363 0.0750  -0.0568 540 PRO B C   
5285 O O   . PRO B 329 ? 0.4814 0.4708 0.5613 -0.0392 0.0783  -0.0632 540 PRO B O   
5286 C CB  . PRO B 329 ? 0.4763 0.4502 0.5581 -0.0346 0.0802  -0.0565 540 PRO B CB  
5287 C CG  . PRO B 329 ? 0.4770 0.4527 0.5666 -0.0381 0.0867  -0.0650 540 PRO B CG  
5288 C CD  . PRO B 329 ? 0.4728 0.4434 0.5493 -0.0474 0.0899  -0.0688 540 PRO B CD  
5289 N N   . ALA B 330 ? 0.4797 0.4678 0.5549 -0.0306 0.0689  -0.0504 541 ALA B N   
5290 C CA  . ALA B 330 ? 0.4818 0.4805 0.5630 -0.0269 0.0653  -0.0504 541 ALA B CA  
5291 C C   . ALA B 330 ? 0.4903 0.4969 0.5879 -0.0207 0.0656  -0.0525 541 ALA B C   
5292 O O   . ALA B 330 ? 0.4875 0.4904 0.5909 -0.0170 0.0667  -0.0509 541 ALA B O   
5293 C CB  . ALA B 330 ? 0.4660 0.4657 0.5410 -0.0231 0.0588  -0.0430 541 ALA B CB  
5294 N N   . SER B 331 ? 0.5039 0.5215 0.6090 -0.0194 0.0644  -0.0562 542 SER B N   
5295 C CA  . SER B 331 ? 0.5176 0.5450 0.6391 -0.0127 0.0636  -0.0582 542 SER B CA  
5296 C C   . SER B 331 ? 0.5250 0.5645 0.6500 -0.0090 0.0581  -0.0573 542 SER B C   
5297 O O   . SER B 331 ? 0.5219 0.5617 0.6370 -0.0128 0.0562  -0.0563 542 SER B O   
5298 C CB  . SER B 331 ? 0.5181 0.5480 0.6487 -0.0165 0.0702  -0.0674 542 SER B CB  
5299 O OG  . SER B 331 ? 0.5221 0.5548 0.6478 -0.0239 0.0729  -0.0732 542 SER B OG  
5300 N N   . ASP B 332 ? 0.5453 0.5948 0.6843 -0.0016 0.0556  -0.0577 543 ASP B N   
5301 C CA  . ASP B 332 ? 0.5590 0.6214 0.7022 0.0029  0.0496  -0.0565 543 ASP B CA  
5302 C C   . ASP B 332 ? 0.5690 0.6394 0.7121 -0.0037 0.0517  -0.0640 543 ASP B C   
5303 O O   . ASP B 332 ? 0.5729 0.6436 0.7202 -0.0089 0.0577  -0.0718 543 ASP B O   
5304 C CB  . ASP B 332 ? 0.5664 0.6381 0.7252 0.0124  0.0466  -0.0560 543 ASP B CB  
5305 C CG  . ASP B 332 ? 0.5857 0.6714 0.7484 0.0176  0.0396  -0.0541 543 ASP B CG  
5306 O OD1 . ASP B 332 ? 0.6036 0.7022 0.7806 0.0227  0.0379  -0.0580 543 ASP B OD1 
5307 O OD2 . ASP B 332 ? 0.6358 0.7199 0.7873 0.0167  0.0356  -0.0490 543 ASP B OD2 
5308 N N   . THR B 333 ? 0.5790 0.6552 0.7166 -0.0039 0.0472  -0.0620 544 THR B N   
5309 C CA  . THR B 333 ? 0.5879 0.6694 0.7227 -0.0110 0.0495  -0.0686 544 THR B CA  
5310 C C   . THR B 333 ? 0.6044 0.7040 0.7526 -0.0080 0.0471  -0.0739 544 THR B C   
5311 O O   . THR B 333 ? 0.6092 0.7146 0.7572 -0.0140 0.0496  -0.0806 544 THR B O   
5312 C CB  . THR B 333 ? 0.5824 0.6579 0.7014 -0.0147 0.0472  -0.0640 544 THR B CB  
5313 O OG1 . THR B 333 ? 0.5568 0.6361 0.6750 -0.0077 0.0401  -0.0566 544 THR B OG1 
5314 C CG2 . THR B 333 ? 0.5660 0.6251 0.6718 -0.0197 0.0507  -0.0612 544 THR B CG2 
5315 N N   . GLY B 334 ? 0.6246 0.7327 0.7841 0.0012  0.0422  -0.0711 545 GLY B N   
5316 C CA  . GLY B 334 ? 0.6391 0.7657 0.8116 0.0054  0.0384  -0.0753 545 GLY B CA  
5317 C C   . GLY B 334 ? 0.6514 0.7848 0.8170 0.0052  0.0330  -0.0728 545 GLY B C   
5318 O O   . GLY B 334 ? 0.6485 0.7978 0.8228 0.0063  0.0305  -0.0777 545 GLY B O   
5319 N N   . ILE B 335 ? 0.6690 0.7909 0.8195 0.0036  0.0314  -0.0655 546 ILE B N   
5320 C CA  . ILE B 335 ? 0.6825 0.8082 0.8244 0.0023  0.0273  -0.0629 546 ILE B CA  
5321 C C   . ILE B 335 ? 0.6938 0.8205 0.8339 0.0109  0.0199  -0.0536 546 ILE B C   
5322 O O   . ILE B 335 ? 0.7002 0.8141 0.8324 0.0127  0.0195  -0.0464 546 ILE B O   
5323 C CB  . ILE B 335 ? 0.6838 0.7959 0.8093 -0.0062 0.0310  -0.0621 546 ILE B CB  
5324 C CG1 . ILE B 335 ? 0.6859 0.7999 0.8121 -0.0149 0.0374  -0.0717 546 ILE B CG1 
5325 C CG2 . ILE B 335 ? 0.6753 0.7878 0.7908 -0.0055 0.0261  -0.0566 546 ILE B CG2 
5326 C CD1 . ILE B 335 ? 0.6883 0.7860 0.8000 -0.0229 0.0428  -0.0715 546 ILE B CD1 
5327 N N   . LEU B 336 ? 0.7080 0.8503 0.8558 0.0159  0.0144  -0.0543 547 LEU B N   
5328 C CA  . LEU B 336 ? 0.7215 0.8669 0.8669 0.0237  0.0070  -0.0460 547 LEU B CA  
5329 C C   . LEU B 336 ? 0.7306 0.8879 0.8728 0.0216  0.0031  -0.0479 547 LEU B C   
5330 O O   . LEU B 336 ? 0.7299 0.9006 0.8802 0.0189  0.0039  -0.0562 547 LEU B O   
5331 C CB  . LEU B 336 ? 0.7263 0.8803 0.8854 0.0335  0.0032  -0.0447 547 LEU B CB  
5332 C CG  . LEU B 336 ? 0.7325 0.8824 0.8882 0.0426  -0.0028 -0.0341 547 LEU B CG  
5333 C CD1 . LEU B 336 ? 0.7237 0.8795 0.8707 0.0437  -0.0090 -0.0295 547 LEU B CD1 
5334 C CD2 . LEU B 336 ? 0.7262 0.8564 0.8733 0.0421  0.0007  -0.0277 547 LEU B CD2 
5335 N N   . ASN B 337 ? 0.7388 0.8910 0.8692 0.0226  -0.0006 -0.0407 548 ASN B N   
5336 C CA  . ASN B 337 ? 0.7418 0.9044 0.8681 0.0213  -0.0047 -0.0413 548 ASN B CA  
5337 C C   . ASN B 337 ? 0.7516 0.9264 0.8842 0.0308  -0.0124 -0.0371 548 ASN B C   
5338 O O   . ASN B 337 ? 0.7600 0.9275 0.8886 0.0370  -0.0155 -0.0284 548 ASN B O   
5339 C CB  . ASN B 337 ? 0.7427 0.8927 0.8529 0.0173  -0.0042 -0.0359 548 ASN B CB  
5340 C CG  . ASN B 337 ? 0.7349 0.8942 0.8399 0.0161  -0.0083 -0.0359 548 ASN B CG  
5341 O OD1 . ASN B 337 ? 0.7149 0.8880 0.8259 0.0137  -0.0087 -0.0430 548 ASN B OD1 
5342 N ND2 . ASN B 337 ? 0.7250 0.8769 0.8189 0.0173  -0.0108 -0.0284 548 ASN B ND2 
5343 N N   . PRO B 338 ? 0.7578 0.9514 0.9001 0.0319  -0.0155 -0.0433 549 PRO B N   
5344 C CA  . PRO B 338 ? 0.7613 0.9678 0.9098 0.0414  -0.0235 -0.0395 549 PRO B CA  
5345 C C   . PRO B 338 ? 0.7635 0.9751 0.9018 0.0416  -0.0290 -0.0354 549 PRO B C   
5346 O O   . PRO B 338 ? 0.7675 0.9939 0.9105 0.0475  -0.0357 -0.0346 549 PRO B O   
5347 C CB  . PRO B 338 ? 0.7627 0.9878 0.9274 0.0418  -0.0236 -0.0495 549 PRO B CB  
5348 C CG  . PRO B 338 ? 0.7608 0.9861 0.9229 0.0305  -0.0173 -0.0584 549 PRO B CG  
5349 C CD  . PRO B 338 ? 0.7537 0.9576 0.9017 0.0246  -0.0118 -0.0542 549 PRO B CD  
5350 N N   . ASP B 339 ? 0.7587 0.9582 0.8833 0.0352  -0.0261 -0.0329 550 ASP B N   
5351 C CA  . ASP B 339 ? 0.7555 0.9568 0.8691 0.0345  -0.0300 -0.0288 550 ASP B CA  
5352 C C   . ASP B 339 ? 0.7506 0.9367 0.8538 0.0388  -0.0316 -0.0177 550 ASP B C   
5353 O O   . ASP B 339 ? 0.7607 0.9500 0.8645 0.0469  -0.0373 -0.0112 550 ASP B O   
5354 C CB  . ASP B 339 ? 0.7534 0.9517 0.8597 0.0243  -0.0252 -0.0344 550 ASP B CB  
5355 C CG  . ASP B 339 ? 0.7636 0.9643 0.8590 0.0228  -0.0286 -0.0314 550 ASP B CG  
5356 O OD1 . ASP B 339 ? 0.7793 0.9960 0.8780 0.0256  -0.0341 -0.0328 550 ASP B OD1 
5357 O OD2 . ASP B 339 ? 0.7768 0.9639 0.8606 0.0187  -0.0257 -0.0279 550 ASP B OD2 
5358 N N   . GLY B 340 ? 0.7314 0.9012 0.8251 0.0335  -0.0265 -0.0157 551 GLY B N   
5359 C CA  . GLY B 340 ? 0.7203 0.8751 0.8047 0.0363  -0.0268 -0.0063 551 GLY B CA  
5360 C C   . GLY B 340 ? 0.7045 0.8455 0.7911 0.0356  -0.0214 -0.0058 551 GLY B C   
5361 O O   . GLY B 340 ? 0.7036 0.8481 0.8012 0.0374  -0.0198 -0.0100 551 GLY B O   
5362 N N   . TYR B 341 ? 0.6831 0.8090 0.7592 0.0327  -0.0186 -0.0012 552 TYR B N   
5363 C CA  . TYR B 341 ? 0.6617 0.7736 0.7379 0.0316  -0.0137 -0.0001 552 TYR B CA  
5364 C C   . TYR B 341 ? 0.6358 0.7464 0.7157 0.0248  -0.0079 -0.0083 552 TYR B C   
5365 O O   . TYR B 341 ? 0.6311 0.7488 0.7109 0.0198  -0.0071 -0.0143 552 TYR B O   
5366 C CB  . TYR B 341 ? 0.6602 0.7581 0.7241 0.0297  -0.0125 0.0063  552 TYR B CB  
5367 N N   . THR B 342 ? 0.6078 0.7086 0.6904 0.0244  -0.0037 -0.0085 553 THR B N   
5368 C CA  . THR B 342 ? 0.5819 0.6786 0.6659 0.0177  0.0022  -0.0153 553 THR B CA  
5369 C C   . THR B 342 ? 0.5523 0.6327 0.6270 0.0143  0.0059  -0.0119 553 THR B C   
5370 O O   . THR B 342 ? 0.5498 0.6227 0.6230 0.0182  0.0053  -0.0061 553 THR B O   
5371 C CB  . THR B 342 ? 0.5833 0.6853 0.6808 0.0201  0.0042  -0.0202 553 THR B CB  
5372 O OG1 . THR B 342 ? 0.5941 0.7111 0.7009 0.0263  -0.0009 -0.0208 553 THR B OG1 
5373 C CG2 . THR B 342 ? 0.5920 0.6950 0.6918 0.0127  0.0097  -0.0291 553 THR B CG2 
5374 N N   . LEU B 343 ? 0.5186 0.5935 0.5866 0.0071  0.0096  -0.0155 554 LEU B N   
5375 C CA  . LEU B 343 ? 0.4979 0.5585 0.5576 0.0037  0.0130  -0.0132 554 LEU B CA  
5376 C C   . LEU B 343 ? 0.4749 0.5298 0.5407 0.0049  0.0164  -0.0139 554 LEU B C   
5377 O O   . LEU B 343 ? 0.4738 0.5339 0.5487 0.0049  0.0185  -0.0192 554 LEU B O   
5378 C CB  . LEU B 343 ? 0.4952 0.5517 0.5477 -0.0039 0.0166  -0.0177 554 LEU B CB  
5379 C CG  . LEU B 343 ? 0.5058 0.5620 0.5487 -0.0063 0.0146  -0.0161 554 LEU B CG  
5380 C CD1 . LEU B 343 ? 0.4875 0.5404 0.5254 -0.0133 0.0186  -0.0216 554 LEU B CD1 
5381 C CD2 . LEU B 343 ? 0.4905 0.5375 0.5250 -0.0050 0.0132  -0.0093 554 LEU B CD2 
5382 N N   . ASN B 344 ? 0.4481 0.4924 0.5091 0.0057  0.0172  -0.0091 555 ASN B N   
5383 C CA  . ASN B 344 ? 0.4371 0.4750 0.5032 0.0061  0.0210  -0.0102 555 ASN B CA  
5384 C C   . ASN B 344 ? 0.4126 0.4470 0.4777 -0.0006 0.0262  -0.0168 555 ASN B C   
5385 O O   . ASN B 344 ? 0.4081 0.4447 0.4817 -0.0007 0.0293  -0.0215 555 ASN B O   
5386 C CB  . ASN B 344 ? 0.4384 0.4654 0.4989 0.0075  0.0213  -0.0042 555 ASN B CB  
5387 C CG  . ASN B 344 ? 0.4579 0.4871 0.5215 0.0149  0.0174  0.0021  555 ASN B CG  
5388 O OD1 . ASN B 344 ? 0.4945 0.5297 0.5676 0.0200  0.0162  0.0015  555 ASN B OD1 
5389 N ND2 . ASN B 344 ? 0.4450 0.4695 0.5003 0.0155  0.0153  0.0078  555 ASN B ND2 
5390 N N   . TYR B 345 ? 0.3866 0.4159 0.4411 -0.0060 0.0271  -0.0172 556 TYR B N   
5391 C CA  . TYR B 345 ? 0.3747 0.3983 0.4251 -0.0127 0.0319  -0.0223 556 TYR B CA  
5392 C C   . TYR B 345 ? 0.3667 0.3925 0.4106 -0.0171 0.0318  -0.0249 556 TYR B C   
5393 O O   . TYR B 345 ? 0.3566 0.3865 0.3973 -0.0154 0.0280  -0.0220 556 TYR B O   
5394 C CB  . TYR B 345 ? 0.3736 0.3852 0.4161 -0.0151 0.0339  -0.0196 556 TYR B CB  
5395 C CG  . TYR B 345 ? 0.3826 0.3911 0.4303 -0.0106 0.0338  -0.0161 556 TYR B CG  
5396 C CD1 . TYR B 345 ? 0.4103 0.4202 0.4682 -0.0090 0.0367  -0.0193 556 TYR B CD1 
5397 C CD2 . TYR B 345 ? 0.3854 0.3894 0.4284 -0.0080 0.0313  -0.0098 556 TYR B CD2 
5398 C CE1 . TYR B 345 ? 0.4071 0.4130 0.4698 -0.0048 0.0372  -0.0161 556 TYR B CE1 
5399 C CE2 . TYR B 345 ? 0.4036 0.4037 0.4510 -0.0042 0.0319  -0.0066 556 TYR B CE2 
5400 C CZ  . TYR B 345 ? 0.4026 0.4034 0.4598 -0.0025 0.0348  -0.0097 556 TYR B CZ  
5401 O OH  . TYR B 345 ? 0.4280 0.4238 0.4894 0.0012  0.0359  -0.0067 556 TYR B OH  
5402 N N   . ASN B 346 ? 0.3562 0.3787 0.3977 -0.0229 0.0364  -0.0305 557 ASN B N   
5403 C CA  . ASN B 346 ? 0.3404 0.3636 0.3759 -0.0277 0.0375  -0.0338 557 ASN B CA  
5404 C C   . ASN B 346 ? 0.3322 0.3476 0.3552 -0.0291 0.0357  -0.0293 557 ASN B C   
5405 O O   . ASN B 346 ? 0.3436 0.3522 0.3621 -0.0278 0.0347  -0.0249 557 ASN B O   
5406 C CB  . ASN B 346 ? 0.3410 0.3595 0.3747 -0.0341 0.0435  -0.0402 557 ASN B CB  
5407 C CG  . ASN B 346 ? 0.3523 0.3800 0.3986 -0.0341 0.0461  -0.0466 557 ASN B CG  
5408 O OD1 . ASN B 346 ? 0.3647 0.4040 0.4201 -0.0305 0.0434  -0.0478 557 ASN B OD1 
5409 N ND2 . ASN B 346 ? 0.3257 0.3485 0.3723 -0.0386 0.0516  -0.0514 557 ASN B ND2 
5410 N N   . GLU B 347 ? 0.3254 0.3420 0.3431 -0.0318 0.0355  -0.0309 558 GLU B N   
5411 C CA  . GLU B 347 ? 0.3158 0.3235 0.3212 -0.0342 0.0352  -0.0281 558 GLU B CA  
5412 C C   . GLU B 347 ? 0.3055 0.3123 0.3060 -0.0392 0.0380  -0.0326 558 GLU B C   
5413 O O   . GLU B 347 ? 0.3220 0.3376 0.3287 -0.0398 0.0385  -0.0367 558 GLU B O   
5414 C CB  . GLU B 347 ? 0.3160 0.3250 0.3188 -0.0300 0.0303  -0.0221 558 GLU B CB  
5415 C CG  . GLU B 347 ? 0.3017 0.3211 0.3088 -0.0275 0.0271  -0.0219 558 GLU B CG  
5416 C CD  . GLU B 347 ? 0.3292 0.3493 0.3341 -0.0231 0.0226  -0.0156 558 GLU B CD  
5417 O OE1 . GLU B 347 ? 0.3255 0.3449 0.3242 -0.0238 0.0211  -0.0142 558 GLU B OE1 
5418 O OE2 . GLU B 347 ? 0.3108 0.3315 0.3201 -0.0192 0.0210  -0.0122 558 GLU B OE2 
5419 N N   . TYR B 348 ? 0.3010 0.2969 0.2903 -0.0429 0.0401  -0.0322 559 TYR B N   
5420 C CA  . TYR B 348 ? 0.2987 0.2903 0.2814 -0.0483 0.0438  -0.0363 559 TYR B CA  
5421 C C   . TYR B 348 ? 0.2835 0.2693 0.2562 -0.0480 0.0417  -0.0327 559 TYR B C   
5422 O O   . TYR B 348 ? 0.2728 0.2526 0.2399 -0.0459 0.0393  -0.0278 559 TYR B O   
5423 C CB  . TYR B 348 ? 0.3100 0.2916 0.2865 -0.0530 0.0486  -0.0388 559 TYR B CB  
5424 C CG  . TYR B 348 ? 0.3397 0.3255 0.3255 -0.0537 0.0514  -0.0428 559 TYR B CG  
5425 C CD1 . TYR B 348 ? 0.3489 0.3386 0.3393 -0.0579 0.0560  -0.0497 559 TYR B CD1 
5426 C CD2 . TYR B 348 ? 0.3739 0.3596 0.3639 -0.0504 0.0498  -0.0400 559 TYR B CD2 
5427 C CE1 . TYR B 348 ? 0.3908 0.3848 0.3906 -0.0584 0.0588  -0.0537 559 TYR B CE1 
5428 C CE2 . TYR B 348 ? 0.3810 0.3701 0.3800 -0.0509 0.0528  -0.0438 559 TYR B CE2 
5429 C CZ  . TYR B 348 ? 0.3798 0.3731 0.3837 -0.0548 0.0572  -0.0507 559 TYR B CZ  
5430 O OH  . TYR B 348 ? 0.4128 0.4101 0.4266 -0.0550 0.0602  -0.0549 559 TYR B OH  
5431 N N   . ILE B 349 ? 0.2677 0.2556 0.2389 -0.0502 0.0429  -0.0355 560 ILE B N   
5432 C CA  . ILE B 349 ? 0.2630 0.2450 0.2250 -0.0502 0.0416  -0.0327 560 ILE B CA  
5433 C C   . ILE B 349 ? 0.2741 0.2479 0.2276 -0.0558 0.0464  -0.0365 560 ILE B C   
5434 O O   . ILE B 349 ? 0.2885 0.2673 0.2461 -0.0592 0.0497  -0.0422 560 ILE B O   
5435 C CB  . ILE B 349 ? 0.2615 0.2541 0.2290 -0.0470 0.0378  -0.0317 560 ILE B CB  
5436 C CG1 . ILE B 349 ? 0.2485 0.2484 0.2236 -0.0414 0.0332  -0.0275 560 ILE B CG1 
5437 C CG2 . ILE B 349 ? 0.2328 0.2197 0.1918 -0.0468 0.0367  -0.0292 560 ILE B CG2 
5438 C CD1 . ILE B 349 ? 0.2163 0.2263 0.2026 -0.0403 0.0333  -0.0305 560 ILE B CD1 
5439 N N   . VAL B 350 ? 0.2797 0.2412 0.2215 -0.0565 0.0468  -0.0336 561 VAL B N   
5440 C CA  . VAL B 350 ? 0.2950 0.2472 0.2273 -0.0609 0.0509  -0.0360 561 VAL B CA  
5441 C C   . VAL B 350 ? 0.3099 0.2594 0.2371 -0.0584 0.0483  -0.0327 561 VAL B C   
5442 O O   . VAL B 350 ? 0.3002 0.2508 0.2277 -0.0537 0.0436  -0.0277 561 VAL B O   
5443 C CB  . VAL B 350 ? 0.3055 0.2435 0.2265 -0.0643 0.0544  -0.0357 561 VAL B CB  
5444 C CG1 . VAL B 350 ? 0.3071 0.2486 0.2339 -0.0669 0.0573  -0.0394 561 VAL B CG1 
5445 C CG2 . VAL B 350 ? 0.2978 0.2280 0.2111 -0.0607 0.0507  -0.0295 561 VAL B CG2 
5446 N N   . TYR B 351 ? 0.3255 0.2712 0.2483 -0.0618 0.0518  -0.0358 562 TYR B N   
5447 C CA  . TYR B 351 ? 0.3321 0.2755 0.2509 -0.0599 0.0501  -0.0337 562 TYR B CA  
5448 C C   . TYR B 351 ? 0.3516 0.2786 0.2568 -0.0612 0.0525  -0.0319 562 TYR B C   
5449 O O   . TYR B 351 ? 0.3406 0.2646 0.2423 -0.0601 0.0522  -0.0310 562 TYR B O   
5450 C CB  . TYR B 351 ? 0.3347 0.2885 0.2604 -0.0620 0.0516  -0.0387 562 TYR B CB  
5451 C CG  . TYR B 351 ? 0.3123 0.2825 0.2512 -0.0598 0.0483  -0.0399 562 TYR B CG  
5452 C CD1 . TYR B 351 ? 0.2681 0.2474 0.2125 -0.0548 0.0429  -0.0363 562 TYR B CD1 
5453 C CD2 . TYR B 351 ? 0.2737 0.2498 0.2194 -0.0624 0.0507  -0.0443 562 TYR B CD2 
5454 C CE1 . TYR B 351 ? 0.2344 0.2274 0.1896 -0.0523 0.0399  -0.0368 562 TYR B CE1 
5455 C CE2 . TYR B 351 ? 0.2803 0.2710 0.2380 -0.0596 0.0476  -0.0451 562 TYR B CE2 
5456 C CZ  . TYR B 351 ? 0.2622 0.2609 0.2242 -0.0544 0.0420  -0.0410 562 TYR B CZ  
5457 O OH  . TYR B 351 ? 0.2491 0.2614 0.2222 -0.0512 0.0387  -0.0412 562 TYR B OH  
5458 N N   . ASN B 352 ? 0.3609 0.2771 0.2580 -0.0632 0.0548  -0.0311 563 ASN B N   
5459 C CA  . ASN B 352 ? 0.3849 0.2846 0.2679 -0.0633 0.0561  -0.0282 563 ASN B CA  
5460 C C   . ASN B 352 ? 0.3878 0.2818 0.2655 -0.0612 0.0536  -0.0240 563 ASN B C   
5461 O O   . ASN B 352 ? 0.3918 0.2871 0.2712 -0.0639 0.0554  -0.0259 563 ASN B O   
5462 C CB  . ASN B 352 ? 0.4023 0.2914 0.2771 -0.0698 0.0634  -0.0326 563 ASN B CB  
5463 C CG  . ASN B 352 ? 0.4265 0.2978 0.2862 -0.0696 0.0651  -0.0295 563 ASN B CG  
5464 O OD1 . ASN B 352 ? 0.4107 0.2739 0.2626 -0.0661 0.0620  -0.0243 563 ASN B OD1 
5465 N ND2 . ASN B 352 ? 0.4346 0.2992 0.2897 -0.0737 0.0705  -0.0330 563 ASN B ND2 
5466 N N   . PRO B 353 ? 0.3970 0.2850 0.2685 -0.0567 0.0496  -0.0187 564 PRO B N   
5467 C CA  . PRO B 353 ? 0.4002 0.2830 0.2660 -0.0550 0.0471  -0.0151 564 PRO B CA  
5468 C C   . PRO B 353 ? 0.4224 0.2934 0.2774 -0.0598 0.0516  -0.0165 564 PRO B C   
5469 O O   . PRO B 353 ? 0.4317 0.3014 0.2843 -0.0597 0.0502  -0.0150 564 PRO B O   
5470 C CB  . PRO B 353 ? 0.4042 0.2808 0.2634 -0.0500 0.0430  -0.0102 564 PRO B CB  
5471 C CG  . PRO B 353 ? 0.4289 0.3068 0.2905 -0.0491 0.0439  -0.0112 564 PRO B CG  
5472 C CD  . PRO B 353 ? 0.4072 0.2939 0.2773 -0.0530 0.0473  -0.0164 564 PRO B CD  
5473 N N   . ASN B 354 ? 0.4119 0.2738 0.2599 -0.0643 0.0573  -0.0194 565 ASN B N   
5474 C CA  . ASN B 354 ? 0.4245 0.2748 0.2618 -0.0697 0.0625  -0.0212 565 ASN B CA  
5475 C C   . ASN B 354 ? 0.4151 0.2732 0.2602 -0.0743 0.0659  -0.0263 565 ASN B C   
5476 O O   . ASN B 354 ? 0.4266 0.2763 0.2637 -0.0791 0.0703  -0.0281 565 ASN B O   
5477 C CB  . ASN B 354 ? 0.4401 0.2767 0.2665 -0.0733 0.0682  -0.0227 565 ASN B CB  
5478 C CG  . ASN B 354 ? 0.4126 0.2558 0.2470 -0.0780 0.0732  -0.0291 565 ASN B CG  
5479 O OD1 . ASN B 354 ? 0.3948 0.2528 0.2427 -0.0787 0.0727  -0.0327 565 ASN B OD1 
5480 N ND2 . ASN B 354 ? 0.5059 0.3373 0.3313 -0.0815 0.0785  -0.0308 565 ASN B ND2 
5481 N N   . GLN B 355 ? 0.3841 0.2582 0.2447 -0.0728 0.0638  -0.0284 566 GLN B N   
5482 C CA  . GLN B 355 ? 0.3603 0.2427 0.2295 -0.0754 0.0655  -0.0322 566 GLN B CA  
5483 C C   . GLN B 355 ? 0.3501 0.2365 0.2225 -0.0719 0.0610  -0.0289 566 GLN B C   
5484 O O   . GLN B 355 ? 0.3352 0.2303 0.2172 -0.0728 0.0616  -0.0316 566 GLN B O   
5485 C CB  . GLN B 355 ? 0.3599 0.2567 0.2436 -0.0757 0.0661  -0.0366 566 GLN B CB  
5486 C CG  . GLN B 355 ? 0.3662 0.2592 0.2471 -0.0814 0.0724  -0.0420 566 GLN B CG  
5487 C CD  . GLN B 355 ? 0.3996 0.3073 0.2939 -0.0811 0.0719  -0.0459 566 GLN B CD  
5488 O OE1 . GLN B 355 ? 0.3960 0.3057 0.2909 -0.0787 0.0698  -0.0445 566 GLN B OE1 
5489 N NE2 . GLN B 355 ? 0.3850 0.3039 0.2906 -0.0831 0.0736  -0.0508 566 GLN B NE2 
5490 N N   . VAL B 356 ? 0.3368 0.2168 0.2011 -0.0680 0.0567  -0.0233 567 VAL B N   
5491 C CA  . VAL B 356 ? 0.3286 0.2124 0.1954 -0.0648 0.0523  -0.0203 567 VAL B CA  
5492 C C   . VAL B 356 ? 0.3458 0.2173 0.1981 -0.0650 0.0514  -0.0170 567 VAL B C   
5493 O O   . VAL B 356 ? 0.3572 0.2201 0.1998 -0.0629 0.0499  -0.0137 567 VAL B O   
5494 C CB  . VAL B 356 ? 0.3167 0.2093 0.1912 -0.0584 0.0461  -0.0165 567 VAL B CB  
5495 C CG1 . VAL B 356 ? 0.2796 0.1754 0.1562 -0.0559 0.0422  -0.0139 567 VAL B CG1 
5496 C CG2 . VAL B 356 ? 0.2836 0.1883 0.1714 -0.0576 0.0461  -0.0190 567 VAL B CG2 
5497 N N   . ARG B 357 ? 0.3587 0.2300 0.2100 -0.0670 0.0521  -0.0179 568 ARG B N   
5498 C CA  . ARG B 357 ? 0.3805 0.2430 0.2195 -0.0666 0.0500  -0.0146 568 ARG B CA  
5499 C C   . ARG B 357 ? 0.3812 0.2521 0.2274 -0.0648 0.0467  -0.0141 568 ARG B C   
5500 O O   . ARG B 357 ? 0.3714 0.2464 0.2236 -0.0681 0.0498  -0.0177 568 ARG B O   
5501 C CB  . ARG B 357 ? 0.4050 0.2557 0.2314 -0.0729 0.0558  -0.0171 568 ARG B CB  
5502 C CG  . ARG B 357 ? 0.4733 0.3130 0.2839 -0.0725 0.0536  -0.0133 568 ARG B CG  
5503 C CD  . ARG B 357 ? 0.5474 0.3762 0.3456 -0.0795 0.0596  -0.0160 568 ARG B CD  
5504 N NE  . ARG B 357 ? 0.5952 0.4166 0.3800 -0.0786 0.0562  -0.0123 568 ARG B NE  
5505 C CZ  . ARG B 357 ? 0.6552 0.4699 0.4299 -0.0836 0.0594  -0.0140 568 ARG B CZ  
5506 N NH1 . ARG B 357 ? 0.6710 0.4849 0.4475 -0.0904 0.0666  -0.0196 568 ARG B NH1 
5507 N NH2 . ARG B 357 ? 0.6448 0.4539 0.4073 -0.0821 0.0553  -0.0102 568 ARG B NH2 
5508 N N   . MET B 358 ? 0.3829 0.2560 0.2288 -0.0597 0.0408  -0.0098 569 MET B N   
5509 C CA  . MET B 358 ? 0.3853 0.2663 0.2382 -0.0577 0.0374  -0.0091 569 MET B CA  
5510 C C   . MET B 358 ? 0.4100 0.2844 0.2527 -0.0612 0.0386  -0.0097 569 MET B C   
5511 O O   . MET B 358 ? 0.4347 0.2990 0.2632 -0.0615 0.0378  -0.0075 569 MET B O   
5512 C CB  . MET B 358 ? 0.3704 0.2551 0.2246 -0.0517 0.0311  -0.0048 569 MET B CB  
5513 C CG  . MET B 358 ? 0.3715 0.2627 0.2346 -0.0481 0.0295  -0.0038 569 MET B CG  
5514 S SD  . MET B 358 ? 0.3546 0.2513 0.2207 -0.0416 0.0228  0.0004  569 MET B SD  
5515 C CE  . MET B 358 ? 0.3064 0.1911 0.1570 -0.0396 0.0206  0.0036  569 MET B CE  
5516 N N   . ARG B 359 ? 0.4069 0.2868 0.2567 -0.0636 0.0403  -0.0127 570 ARG B N   
5517 C CA  . ARG B 359 ? 0.4230 0.2974 0.2642 -0.0680 0.0425  -0.0144 570 ARG B CA  
5518 C C   . ARG B 359 ? 0.4048 0.2852 0.2499 -0.0669 0.0394  -0.0142 570 ARG B C   
5519 O O   . ARG B 359 ? 0.4158 0.2913 0.2502 -0.0686 0.0382  -0.0136 570 ARG B O   
5520 C CB  . ARG B 359 ? 0.4381 0.3112 0.2818 -0.0738 0.0495  -0.0197 570 ARG B CB  
5521 C CG  . ARG B 359 ? 0.5078 0.3704 0.3404 -0.0778 0.0540  -0.0209 570 ARG B CG  
5522 C CD  . ARG B 359 ? 0.5916 0.4413 0.4049 -0.0781 0.0523  -0.0172 570 ARG B CD  
5523 N NE  . ARG B 359 ? 0.6776 0.5250 0.4828 -0.0793 0.0504  -0.0165 570 ARG B NE  
5524 C CZ  . ARG B 359 ? 0.7252 0.5684 0.5244 -0.0853 0.0549  -0.0200 570 ARG B CZ  
5525 N NH1 . ARG B 359 ? 0.7505 0.5911 0.5511 -0.0908 0.0620  -0.0247 570 ARG B NH1 
5526 N NH2 . ARG B 359 ? 0.7552 0.5972 0.5470 -0.0861 0.0525  -0.0192 570 ARG B NH2 
5527 N N   . TYR B 360 ? 0.3764 0.2671 0.2363 -0.0646 0.0385  -0.0148 571 TYR B N   
5528 C CA  . TYR B 360 ? 0.3644 0.2606 0.2290 -0.0640 0.0363  -0.0150 571 TYR B CA  
5529 C C   . TYR B 360 ? 0.3443 0.2494 0.2196 -0.0586 0.0319  -0.0123 571 TYR B C   
5530 O O   . TYR B 360 ? 0.3168 0.2263 0.2008 -0.0562 0.0321  -0.0118 571 TYR B O   
5531 C CB  . TYR B 360 ? 0.3619 0.2603 0.2334 -0.0682 0.0414  -0.0197 571 TYR B CB  
5532 C CG  . TYR B 360 ? 0.3835 0.2738 0.2454 -0.0742 0.0466  -0.0231 571 TYR B CG  
5533 C CD1 . TYR B 360 ? 0.4089 0.2934 0.2584 -0.0774 0.0464  -0.0235 571 TYR B CD1 
5534 C CD2 . TYR B 360 ? 0.3730 0.2620 0.2383 -0.0768 0.0517  -0.0262 571 TYR B CD2 
5535 C CE1 . TYR B 360 ? 0.4300 0.3065 0.2696 -0.0835 0.0516  -0.0267 571 TYR B CE1 
5536 C CE2 . TYR B 360 ? 0.4298 0.3113 0.2863 -0.0828 0.0571  -0.0298 571 TYR B CE2 
5537 C CZ  . TYR B 360 ? 0.4362 0.3110 0.2794 -0.0863 0.0572  -0.0299 571 TYR B CZ  
5538 O OH  . TYR B 360 ? 0.4811 0.3480 0.3149 -0.0927 0.062