data_4UTX
# 
_entry.id   4UTX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UTX         
PDBE  EBI-61327    
WWPDB D_1290061327 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4UTN unspecified 'CRYSTAL STRUCTURE OF ZEBRAFISH SIRTUIN 5 IN COMPLEX WITH SUCCINYLATED CPS1-PEPTIDE'              
PDB 4UTR unspecified 'CRYSTAL STRUCTURE OF ZEBRAFISH SIRTUIN 5 IN COMPLEX WITH GLUTARYLATED CPS1-PEPTIDE'              
PDB 4UTV unspecified 'CRYSTAL STRUCTURE OF ZEBRAFISH SIRTUIN 5 IN COMPLEX WITH 3-PHENYL-SUCCINYLATED CPS1-PEPTIDE'     
PDB 4UTZ unspecified 'CRYSTAL STRUCTURE OF ZEBRAFISH SIRTUIN 5 IN COMPLEX WITH ADIPOYLATED CPS1-PEPTIDE'               
PDB 4UU7 unspecified 'CRYSTAL STRUCTURE OF ZEBRAFISH SIRTUIN 5 IN COMPLEX WITH 3-METHYL-SUCCINYLATED CPS1-PEPTIDE'     
PDB 4UU8 unspecified 'CRYSTAL STRUCTURE OF ZEBRAFISH SIRTUIN 5 IN COMPLEX WITH 3,3-DIMETHYL-SUCCINYLATED CPS1-PEPTIDE' 
PDB 4UUA unspecified 'CRYSTAL STRUCTURE OF ZEBRAFISH SIRTUIN 5 IN COMPLEX WITH 3S-Z-AMINO-SUCCINYLATED CPS1-PEPTIDE'   
PDB 4UUB unspecified 'CRYSTAL STRUCTURE OF ZEBRAFISH SIRTUIN 5 IN COMPLEX WITH 2R-BUTYL-SUCCINYLATED CPS1-PEPTIDE'     
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UTX 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-23 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pannek, M.'    1 
'Gertz, M.'     2 
'Steegborn, C.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Chemical Probing of the Human Sirtuin 5 Active Site Reveals its Substrate Acyl Specificity and Peptide-Based Inhibitors.' 
_citation.journal_abbrev            Angew.Chem.Int.Ed.Engl. 
_citation.journal_volume            53 
_citation.page_first                10728 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   GE 
_citation.journal_id_ISSN           1433-7851 
_citation.journal_id_CSD            9999 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25111069 
_citation.pdbx_database_id_DOI      10.1002/ANIE.201402679 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Roessler, C.'    1  
primary 'Nowak, T.'       2  
primary 'Pannek, M.'      3  
primary 'Gertz, M.'       4  
primary 'Nguyen, G.T.'    5  
primary 'Scharfe, M.'     6  
primary 'Born, I.'        7  
primary 'Sippl, W.'       8  
primary 'Steegborn, C.'   9  
primary 'Schutkowski, M.' 10 
# 
_cell.entry_id           4UTX 
_cell.length_a           87.490 
_cell.length_b           87.490 
_cell.length_c           313.790 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UTX 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NAD-DEPENDENT PROTEIN DEACYLASE SIRTUIN-5, MITOCHONDRIAL' 30423.785 2  3.5.1.- ? 
'CATALYTIC CORE, UNP RESIDUES 30-298' ?                                                                               
2 polymer     syn 'CARBAMOYLPHOSPHATE SYNTHETASE I'                          969.112   1  ?       ? 'UNP RESIDUES 524-531' 
'BENZOYLATED GLYCINE AT POSITION 1. 3-NITRO-PROPIONYLATED LYSINE AT POSITION 4' 
3 non-polymer syn 'ZINC ION'                                                 65.409    2  ?       ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL                                             62.068    3  ?       ? ? ? 
5 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'      238.305   1  ?       ? ? ? 
6 non-polymer syn 'DIMETHYL SULFOXIDE'                                       78.133    1  ?       ? ? ? 
7 non-polymer syn 'SODIUM ION'                                               22.990    1  ?       ? ? ? 
8 non-polymer syn '3-NITROPROPANOIC ACID'                                    119.076   1  ?       ? ? ? 
9 water       nat water                                                      18.015    34 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'SIRTUIN 5, REGULATORY PROTEIN SIR2 HOMOLOG 5' 
2 '3-NITRO-PROPIONYL-CPS1 PEPTIDE'               
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GIDPFTTRPSSDLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQDLATPEAFSRDPSLVWEFYHYRRE
VMRSKMPNPAHLAIAECEARLGQQGRSVVIITQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHKSPICPALDGK
GAPDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETLDSDILTAVERELEKCDLCLVVGTSSIVYPAAMFAPQVASR
GVPVAEFNMECTPATQRFKYHFEGPCGSTLPPALE
;
;GIDPFTTRPSSDLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQDLATPEAFSRDPSLVWEFYHYRRE
VMRSKMPNPAHLAIAECEARLGQQGRSVVIITQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHKSPICPALDGK
GAPDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETLDSDILTAVERELEKCDLCLVVGTSSIVYPAAMFAPQVASR
GVPVAEFNMECTPATQRFKYHFEGPCGSTLPPALE
;
A,B ? 
2 'polypeptide(L)' no yes '(BEZ)GVLKEYGV' XGVLKEYGV C   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ILE n 
1 3   ASP n 
1 4   PRO n 
1 5   PHE n 
1 6   THR n 
1 7   THR n 
1 8   ARG n 
1 9   PRO n 
1 10  SER n 
1 11  SER n 
1 12  ASP n 
1 13  LEU n 
1 14  THR n 
1 15  ALA n 
1 16  PHE n 
1 17  ARG n 
1 18  GLU n 
1 19  HIS n 
1 20  PHE n 
1 21  ALA n 
1 22  LYS n 
1 23  ALA n 
1 24  LYS n 
1 25  HIS n 
1 26  ILE n 
1 27  ALA n 
1 28  ILE n 
1 29  ILE n 
1 30  THR n 
1 31  GLY n 
1 32  ALA n 
1 33  GLY n 
1 34  VAL n 
1 35  SER n 
1 36  ALA n 
1 37  GLU n 
1 38  SER n 
1 39  GLY n 
1 40  VAL n 
1 41  PRO n 
1 42  THR n 
1 43  PHE n 
1 44  ARG n 
1 45  GLY n 
1 46  PRO n 
1 47  GLY n 
1 48  GLY n 
1 49  PHE n 
1 50  TRP n 
1 51  ARG n 
1 52  LYS n 
1 53  TRP n 
1 54  GLN n 
1 55  ALA n 
1 56  GLN n 
1 57  ASP n 
1 58  LEU n 
1 59  ALA n 
1 60  THR n 
1 61  PRO n 
1 62  GLU n 
1 63  ALA n 
1 64  PHE n 
1 65  SER n 
1 66  ARG n 
1 67  ASP n 
1 68  PRO n 
1 69  SER n 
1 70  LEU n 
1 71  VAL n 
1 72  TRP n 
1 73  GLU n 
1 74  PHE n 
1 75  TYR n 
1 76  HIS n 
1 77  TYR n 
1 78  ARG n 
1 79  ARG n 
1 80  GLU n 
1 81  VAL n 
1 82  MET n 
1 83  ARG n 
1 84  SER n 
1 85  LYS n 
1 86  MET n 
1 87  PRO n 
1 88  ASN n 
1 89  PRO n 
1 90  ALA n 
1 91  HIS n 
1 92  LEU n 
1 93  ALA n 
1 94  ILE n 
1 95  ALA n 
1 96  GLU n 
1 97  CYS n 
1 98  GLU n 
1 99  ALA n 
1 100 ARG n 
1 101 LEU n 
1 102 GLY n 
1 103 GLN n 
1 104 GLN n 
1 105 GLY n 
1 106 ARG n 
1 107 SER n 
1 108 VAL n 
1 109 VAL n 
1 110 ILE n 
1 111 ILE n 
1 112 THR n 
1 113 GLN n 
1 114 ASN n 
1 115 ILE n 
1 116 ASP n 
1 117 GLU n 
1 118 LEU n 
1 119 HIS n 
1 120 HIS n 
1 121 ARG n 
1 122 ALA n 
1 123 GLY n 
1 124 SER n 
1 125 LYS n 
1 126 HIS n 
1 127 VAL n 
1 128 TYR n 
1 129 GLU n 
1 130 ILE n 
1 131 HIS n 
1 132 GLY n 
1 133 SER n 
1 134 LEU n 
1 135 PHE n 
1 136 LYS n 
1 137 THR n 
1 138 ARG n 
1 139 CYS n 
1 140 MET n 
1 141 SER n 
1 142 CYS n 
1 143 GLY n 
1 144 GLU n 
1 145 VAL n 
1 146 LYS n 
1 147 ALA n 
1 148 ASN n 
1 149 HIS n 
1 150 LYS n 
1 151 SER n 
1 152 PRO n 
1 153 ILE n 
1 154 CYS n 
1 155 PRO n 
1 156 ALA n 
1 157 LEU n 
1 158 ASP n 
1 159 GLY n 
1 160 LYS n 
1 161 GLY n 
1 162 ALA n 
1 163 PRO n 
1 164 ASP n 
1 165 PRO n 
1 166 ASN n 
1 167 THR n 
1 168 LYS n 
1 169 GLU n 
1 170 ALA n 
1 171 ARG n 
1 172 ILE n 
1 173 PRO n 
1 174 VAL n 
1 175 GLU n 
1 176 LEU n 
1 177 LEU n 
1 178 PRO n 
1 179 ARG n 
1 180 CYS n 
1 181 GLU n 
1 182 ARG n 
1 183 LYS n 
1 184 SER n 
1 185 CYS n 
1 186 ASN n 
1 187 GLY n 
1 188 LEU n 
1 189 LEU n 
1 190 ARG n 
1 191 PRO n 
1 192 HIS n 
1 193 VAL n 
1 194 VAL n 
1 195 TRP n 
1 196 PHE n 
1 197 GLY n 
1 198 GLU n 
1 199 THR n 
1 200 LEU n 
1 201 ASP n 
1 202 SER n 
1 203 ASP n 
1 204 ILE n 
1 205 LEU n 
1 206 THR n 
1 207 ALA n 
1 208 VAL n 
1 209 GLU n 
1 210 ARG n 
1 211 GLU n 
1 212 LEU n 
1 213 GLU n 
1 214 LYS n 
1 215 CYS n 
1 216 ASP n 
1 217 LEU n 
1 218 CYS n 
1 219 LEU n 
1 220 VAL n 
1 221 VAL n 
1 222 GLY n 
1 223 THR n 
1 224 SER n 
1 225 SER n 
1 226 ILE n 
1 227 VAL n 
1 228 TYR n 
1 229 PRO n 
1 230 ALA n 
1 231 ALA n 
1 232 MET n 
1 233 PHE n 
1 234 ALA n 
1 235 PRO n 
1 236 GLN n 
1 237 VAL n 
1 238 ALA n 
1 239 SER n 
1 240 ARG n 
1 241 GLY n 
1 242 VAL n 
1 243 PRO n 
1 244 VAL n 
1 245 ALA n 
1 246 GLU n 
1 247 PHE n 
1 248 ASN n 
1 249 MET n 
1 250 GLU n 
1 251 CYS n 
1 252 THR n 
1 253 PRO n 
1 254 ALA n 
1 255 THR n 
1 256 GLN n 
1 257 ARG n 
1 258 PHE n 
1 259 LYS n 
1 260 TYR n 
1 261 HIS n 
1 262 PHE n 
1 263 GLU n 
1 264 GLY n 
1 265 PRO n 
1 266 CYS n 
1 267 GLY n 
1 268 SER n 
1 269 THR n 
1 270 LEU n 
1 271 PRO n 
1 272 PRO n 
1 273 ALA n 
1 274 LEU n 
1 275 GLU n 
2 1   BEZ n 
2 2   GLY n 
2 3   VAL n 
2 4   LEU n 
2 5   LYS n 
2 6   GLU n 
2 7   TYR n 
2 8   GLY n 
2 9   VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ZEBRAFISH 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'DANIO RERIO' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7955 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              CODONPLUS 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PET151 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP SIR5_DANRE   1 ? ? Q6DHI5 ? 
2 UNP Q5R209_HUMAN 2 ? ? Q5R209 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4UTX A 7 ? 275 ? Q6DHI5 30  ? 298 ? 30 298 
2 1 4UTX B 7 ? 275 ? Q6DHI5 30  ? 298 ? 30 298 
3 2 4UTX C 2 ? 9   ? Q5R209 524 ? 531 ? 1  8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4UTX GLY A 1 ? UNP Q6DHI5 ? ? 'expression tag' 24 1  
1 4UTX ILE A 2 ? UNP Q6DHI5 ? ? 'expression tag' 25 2  
1 4UTX ASP A 3 ? UNP Q6DHI5 ? ? 'expression tag' 26 3  
1 4UTX PRO A 4 ? UNP Q6DHI5 ? ? 'expression tag' 27 4  
1 4UTX PHE A 5 ? UNP Q6DHI5 ? ? 'expression tag' 28 5  
1 4UTX THR A 6 ? UNP Q6DHI5 ? ? 'expression tag' 29 6  
2 4UTX GLY B 1 ? UNP Q6DHI5 ? ? 'expression tag' 24 7  
2 4UTX ILE B 2 ? UNP Q6DHI5 ? ? 'expression tag' 25 8  
2 4UTX ASP B 3 ? UNP Q6DHI5 ? ? 'expression tag' 26 9  
2 4UTX PRO B 4 ? UNP Q6DHI5 ? ? 'expression tag' 27 10 
2 4UTX PHE B 5 ? UNP Q6DHI5 ? ? 'expression tag' 28 11 
2 4UTX THR B 6 ? UNP Q6DHI5 ? ? 'expression tag' 29 12 
3 4UTX BEZ C 1 ? UNP Q5R209 ? ? BENZOYLATION     0  13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3NP non-polymer         . '3-NITROPROPANOIC ACID'                               ?                 'C3 H5 N O4'     119.076 
ALA 'L-peptide linking' y ALANINE                                               ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                              ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?                 'C4 H7 N O4'     133.103 
BEZ non-polymer         . 'BENZOIC ACID'                                        ?                 'C7 H6 O2'       122.121 
CYS 'L-peptide linking' y CYSTEINE                                              ?                 'C3 H7 N O2 S'   121.158 
DMS non-polymer         . 'DIMETHYL SULFOXIDE'                                  ?                 'C2 H6 O S'      78.133  
EDO non-polymer         . 1,2-ETHANEDIOL                                        'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES             'C8 H18 N2 O4 S' 238.305 
GLN 'L-peptide linking' y GLUTAMINE                                             ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                               ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                             ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                 ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                            ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                               ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                            ?                 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'                                          ?                 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                         ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                               ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                             ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                                            ?                 'Zn 2'           65.409  
# 
_exptl.entry_id          4UTX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.9 
_exptl_crystal.density_percent_sol   57 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '22% PEG3350, 0.1 M HEPES PH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-07-05 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI-111 CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91705 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_wavelength             0.91705 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UTX 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            3.10 
_reflns.number_obs                   13762 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.21 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.30 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              11.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.10 
_reflns_shell.d_res_low              3.20 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           1.31 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.10 
_reflns_shell.pdbx_redundancy        10.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UTX 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     13048 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.38 
_refine.ls_d_res_high                            3.10 
_refine.ls_percent_reflns_obs                    99.88 
_refine.ls_R_factor_obs                          0.19722 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19357 
_refine.ls_R_factor_R_free                       0.26189 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  714 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.886 
_refine.B_iso_mean                               67.991 
_refine.aniso_B[1][1]                            1.41 
_refine.aniso_B[2][2]                            1.41 
_refine.aniso_B[3][3]                            -4.58 
_refine.aniso_B[1][2]                            0.71 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WITH TLS ADDED MISSING N-TERMINAL PROTEIN RESIDUES ARE DISORDERED. RESIDUES A280 TO A281 ARE DISORDERED. RESIDUES B275 TO B280 ARE DISORDERED. PROTEIN RESIDUES CYS274 OF CHAIN A AND B FORM A DISULFIDE BRIDGE
;
_refine.pdbx_starting_model                      'PDB ENTRY 2NYR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.469 
_refine.overall_SU_ML                            0.390 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             45.245 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4118 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             34 
_refine_hist.number_atoms_total               4193 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        48.38 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.019  ? 4268 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.005  0.020  ? 4042 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.704  1.963  ? 5768 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.166  3.003  ? 9318 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.310  5.000  ? 525  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.137 22.826 ? 184  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.927 15.000 ? 684  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.362 15.000 ? 34   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.082  0.200  ? 619  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.021  ? 4752 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.004  0.020  ? 973  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  4.018  5.485  ? 2115 'X-RAY DIFFRACTION' ? 
r_mcbond_other               4.018  5.484  ? 2114 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 6.421  8.211  ? 2635 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.303  5.948  ? 2151 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.100 
_refine_ls_shell.d_res_low                        3.180 
_refine_ls_shell.number_reflns_R_work             930 
_refine_ls_shell.R_factor_R_work                  0.304 
_refine_ls_shell.percent_reflns_obs               99.90 
_refine_ls_shell.R_factor_R_free                  0.414 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             42 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.756680 
_struct_ncs_oper.matrix[1][2]   -0.542700 
_struct_ncs_oper.matrix[1][3]   0.364580 
_struct_ncs_oper.matrix[2][1]   -0.524390 
_struct_ncs_oper.matrix[2][2]   0.170760 
_struct_ncs_oper.matrix[2][3]   -0.834180 
_struct_ncs_oper.matrix[3][1]   0.390450 
_struct_ncs_oper.matrix[3][2]   -0.822390 
_struct_ncs_oper.matrix[3][3]   -0.413800 
_struct_ncs_oper.vector[1]      -26.13046 
_struct_ncs_oper.vector[2]      -42.64455 
_struct_ncs_oper.vector[3]      -42.20502 
# 
_struct.entry_id                  4UTX 
_struct.title                     'Crystal structure of zebrafish Sirtuin 5 in complex with 3-nitro- propionylated CPS1-peptide' 
_struct.pdbx_descriptor           
'NAD-DEPENDENT PROTEIN DEACYLASE SIRTUIN-5, MITOCHONDRIAL (E.C.3.5.1.-), CARBAMOYLPHOSPHATE SYNTHETASE I' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UTX 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, REGULATORY ENZYME, DEACYLASE, MITOCHONDRIAL, ROSSMANN-FOLD, ZINC-BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 3 ? 
H N N 5 ? 
I N N 6 ? 
J N N 4 ? 
K N N 7 ? 
L N N 8 ? 
M N N 9 ? 
N N N 9 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 12  ? ALA A 23  ? ASP A 35  ALA A 46  1 ? 12 
HELX_P HELX_P2  2  GLY A 31  ? GLU A 37  ? GLY A 54  GLU A 60  1 ? 7  
HELX_P HELX_P3  3  GLN A 54  ? ALA A 59  ? GLN A 77  ALA A 82  1 ? 6  
HELX_P HELX_P4  4  THR A 60  ? ASP A 67  ? THR A 83  ASP A 90  1 ? 8  
HELX_P HELX_P5  5  ASP A 67  ? MET A 82  ? ASP A 90  MET A 105 1 ? 16 
HELX_P HELX_P6  6  ARG A 83  ? LYS A 85  ? ARG A 106 LYS A 108 5 ? 3  
HELX_P HELX_P7  7  ASN A 88  ? GLN A 104 ? ASN A 111 GLN A 127 1 ? 17 
HELX_P HELX_P8  8  GLU A 117 ? ALA A 122 ? GLU A 140 ALA A 145 1 ? 6  
HELX_P HELX_P9  9  CYS A 154 ? ASP A 158 ? CYS A 177 ASP A 181 5 ? 5  
HELX_P HELX_P10 10 PRO A 173 ? LEU A 177 ? PRO A 196 LEU A 200 5 ? 5  
HELX_P HELX_P11 11 ASP A 201 ? CYS A 215 ? ASP A 224 CYS A 238 1 ? 15 
HELX_P HELX_P12 12 PRO A 229 ? MET A 232 ? PRO A 252 MET A 255 5 ? 4  
HELX_P HELX_P13 13 PHE A 233 ? SER A 239 ? PHE A 256 SER A 262 1 ? 7  
HELX_P HELX_P14 14 PRO A 265 ? GLU A 275 ? PRO A 288 GLU A 298 1 ? 11 
HELX_P HELX_P15 15 ASP B 12  ? ALA B 23  ? ASP B 35  ALA B 46  1 ? 12 
HELX_P HELX_P16 16 GLY B 31  ? GLU B 37  ? GLY B 54  GLU B 60  1 ? 7  
HELX_P HELX_P17 17 GLN B 54  ? ALA B 59  ? GLN B 77  ALA B 82  1 ? 6  
HELX_P HELX_P18 18 THR B 60  ? ASP B 67  ? THR B 83  ASP B 90  1 ? 8  
HELX_P HELX_P19 19 ASP B 67  ? MET B 82  ? ASP B 90  MET B 105 1 ? 16 
HELX_P HELX_P20 20 ARG B 83  ? LYS B 85  ? ARG B 106 LYS B 108 5 ? 3  
HELX_P HELX_P21 21 ASN B 88  ? GLN B 104 ? ASN B 111 GLN B 127 1 ? 17 
HELX_P HELX_P22 22 GLU B 117 ? ALA B 122 ? GLU B 140 ALA B 145 1 ? 6  
HELX_P HELX_P23 23 CYS B 154 ? ASP B 158 ? CYS B 177 ASP B 181 5 ? 5  
HELX_P HELX_P24 24 PRO B 173 ? LEU B 177 ? PRO B 196 LEU B 200 5 ? 5  
HELX_P HELX_P25 25 ASP B 201 ? CYS B 215 ? ASP B 224 CYS B 238 1 ? 15 
HELX_P HELX_P26 26 PRO B 229 ? MET B 232 ? PRO B 252 MET B 255 5 ? 4  
HELX_P HELX_P27 27 PHE B 233 ? SER B 239 ? PHE B 256 SER B 262 1 ? 7  
HELX_P HELX_P28 28 PRO B 265 ? GLU B 275 ? PRO B 288 GLU B 298 1 ? 11 
HELX_P HELX_P29 29 LYS C 5   ? VAL C 9   ? LYS C 4   VAL C 8   5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 251 SG ? ? ? 1_555 B CYS 251 SG  ? ? A CYS 274  B CYS 274  12_554 ? ? ? ? ? ? ? 2.034 ? 
metalc1  metalc ? ? D ZN  .   ZN ? ? ? 1_555 A CYS 185 SG  ? ? A ZN  1299 A CYS 208  1_555  ? ? ? ? ? ? ? 2.330 ? 
metalc2  metalc ? ? D ZN  .   ZN ? ? ? 1_555 A CYS 139 SG  ? ? A ZN  1299 A CYS 162  1_555  ? ? ? ? ? ? ? 2.320 ? 
metalc3  metalc ? ? D ZN  .   ZN ? ? ? 1_555 A CYS 142 SG  ? ? A ZN  1299 A CYS 165  1_555  ? ? ? ? ? ? ? 2.337 ? 
metalc4  metalc ? ? D ZN  .   ZN ? ? ? 1_555 A CYS 180 SG  ? ? A ZN  1299 A CYS 203  1_555  ? ? ? ? ? ? ? 2.253 ? 
metalc5  metalc ? ? G ZN  .   ZN ? ? ? 1_555 B CYS 185 SG  ? ? B ZN  1299 B CYS 208  1_555  ? ? ? ? ? ? ? 2.299 ? 
metalc6  metalc ? ? G ZN  .   ZN ? ? ? 1_555 B CYS 142 SG  ? ? B ZN  1299 B CYS 165  1_555  ? ? ? ? ? ? ? 2.292 ? 
metalc7  metalc ? ? G ZN  .   ZN ? ? ? 1_555 B CYS 139 SG  ? ? B ZN  1299 B CYS 162  1_555  ? ? ? ? ? ? ? 2.330 ? 
metalc8  metalc ? ? G ZN  .   ZN ? ? ? 1_555 B CYS 180 SG  ? ? B ZN  1299 B CYS 203  1_555  ? ? ? ? ? ? ? 2.343 ? 
metalc9  metalc ? ? K NA  .   NA ? ? ? 1_555 B ASP 201 OD1 ? ? B NA  1303 B ASP 224  1_555  ? ? ? ? ? ? ? 2.815 ? 
metalc10 metalc ? ? K NA  .   NA ? ? ? 1_555 B ASP 203 OD2 ? ? B NA  1303 B ASP 226  12_544 ? ? ? ? ? ? ? 2.835 ? 
metalc11 metalc ? ? K NA  .   NA ? ? ? 1_555 B ASP 201 OD1 ? ? B NA  1303 B ASP 224  12_544 ? ? ? ? ? ? ? 2.813 ? 
metalc12 metalc ? ? K NA  .   NA ? ? ? 1_555 B ASP 203 OD2 ? ? B NA  1303 B ASP 226  1_555  ? ? ? ? ? ? ? 2.835 ? 
covale1  covale ? ? C BEZ 1   C  ? ? ? 1_555 C GLY 2   N   ? ? C BEZ 0    C GLY 1    1_555  ? ? ? ? ? ? ? 1.343 ? 
covale2  covale ? ? C LYS 5   NZ ? ? ? 1_555 L 3NP .   C1  ? ? C LYS 4    C 3NP 1004 1_555  ? ? ? ? ? ? ? 1.318 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 151 A . ? SER 174 A PRO 152 A ? PRO 175 A 1 -3.14 
2 TYR 228 A . ? TYR 251 A PRO 229 A ? PRO 252 A 1 4.63  
3 SER 151 B . ? SER 174 B PRO 152 B ? PRO 175 B 1 -3.76 
4 TYR 228 B . ? TYR 251 B PRO 229 B ? PRO 252 B 1 10.32 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 3 ? 
BA ? 6 ? 
BB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BA 4 5 ? parallel      
BA 5 6 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 127 ? GLU A 129 ? VAL A 150 GLU A 152 
AA 2 SER A 107 ? THR A 112 ? SER A 130 THR A 135 
AA 3 HIS A 25  ? THR A 30  ? HIS A 48  THR A 53  
AA 4 LEU A 217 ? VAL A 221 ? LEU A 240 VAL A 244 
AA 5 VAL A 244 ? ASN A 248 ? VAL A 267 ASN A 271 
AA 6 TYR A 260 ? GLU A 263 ? TYR A 283 GLU A 286 
AB 1 VAL A 145 ? ALA A 147 ? VAL A 168 ALA A 170 
AB 2 GLY A 132 ? CYS A 139 ? GLY A 155 CYS A 162 
AB 3 LEU A 189 ? VAL A 193 ? LEU A 212 VAL A 216 
BA 1 VAL B 127 ? GLU B 129 ? VAL B 150 GLU B 152 
BA 2 SER B 107 ? THR B 112 ? SER B 130 THR B 135 
BA 3 HIS B 25  ? THR B 30  ? HIS B 48  THR B 53  
BA 4 LEU B 217 ? VAL B 221 ? LEU B 240 VAL B 244 
BA 5 VAL B 244 ? ASN B 248 ? VAL B 267 ASN B 271 
BA 6 TYR B 260 ? GLU B 263 ? TYR B 283 GLU B 286 
BB 1 VAL B 145 ? ALA B 147 ? VAL B 168 ALA B 170 
BB 2 GLY B 132 ? CYS B 139 ? GLY B 155 CYS B 162 
BB 3 LEU B 189 ? VAL B 193 ? LEU B 212 VAL B 216 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N TYR A 128 ? N TYR A 151 O ILE A 110 ? O ILE A 133 
AA 2 3 N VAL A 109 ? N VAL A 132 O ILE A 26  ? O ILE A 49  
AA 3 4 N ALA A 27  ? N ALA A 50  O LEU A 217 ? O LEU A 240 
AA 4 5 N VAL A 220 ? N VAL A 243 O ALA A 245 ? O ALA A 268 
AA 5 6 N GLU A 246 ? N GLU A 269 O TYR A 260 ? O TYR A 283 
AB 1 2 N LYS A 146 ? N LYS A 169 O THR A 137 ? O THR A 160 
AB 2 3 N ARG A 138 ? N ARG A 161 O ARG A 190 ? O ARG A 213 
BA 1 2 N TYR B 128 ? N TYR B 151 O ILE B 110 ? O ILE B 133 
BA 2 3 N VAL B 109 ? N VAL B 132 O ILE B 26  ? O ILE B 49  
BA 3 4 N ALA B 27  ? N ALA B 50  O LEU B 217 ? O LEU B 240 
BA 4 5 N VAL B 220 ? N VAL B 243 O ALA B 245 ? O ALA B 268 
BA 5 6 N GLU B 246 ? N GLU B 269 O TYR B 260 ? O TYR B 283 
BB 1 2 N LYS B 146 ? N LYS B 169 O THR B 137 ? O THR B 160 
BB 2 3 N ARG B 138 ? N ARG B 161 O ARG B 190 ? O ARG B 213 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 3NP C 1004' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1299'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 1299'  
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE EPE B 1300' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE DMS B 1301' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 1300' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 1301' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO B 1302' 
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA B 1303'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ARG A 44  ? ARG A 67   . ? 1_555  ? 
2  AC1 8  TYR A 75  ? TYR A 98   . ? 1_555  ? 
3  AC1 8  ARG A 78  ? ARG A 101  . ? 1_555  ? 
4  AC1 8  VAL A 193 ? VAL A 216  . ? 1_555  ? 
5  AC1 8  VAL A 194 ? VAL A 217  . ? 1_555  ? 
6  AC1 8  PHE A 196 ? PHE A 219  . ? 1_555  ? 
7  AC1 8  EDO E .   ? EDO A 1300 . ? 1_555  ? 
8  AC1 8  LYS C 5   ? LYS C 4    . ? 1_555  ? 
9  AC2 4  CYS A 139 ? CYS A 162  . ? 1_555  ? 
10 AC2 4  CYS A 142 ? CYS A 165  . ? 1_555  ? 
11 AC2 4  CYS A 180 ? CYS A 203  . ? 1_555  ? 
12 AC2 4  CYS A 185 ? CYS A 208  . ? 1_555  ? 
13 AC3 4  CYS B 139 ? CYS B 162  . ? 1_555  ? 
14 AC3 4  CYS B 142 ? CYS B 165  . ? 1_555  ? 
15 AC3 4  CYS B 180 ? CYS B 203  . ? 1_555  ? 
16 AC3 4  CYS B 185 ? CYS B 208  . ? 1_555  ? 
17 AC4 12 THR A 206 ? THR A 229  . ? 6_554  ? 
18 AC4 12 GLU A 209 ? GLU A 232  . ? 6_554  ? 
19 AC4 12 ALA B 55  ? ALA B 78   . ? 1_555  ? 
20 AC4 12 ALA B 59  ? ALA B 82   . ? 1_555  ? 
21 AC4 12 TYR B 75  ? TYR B 98   . ? 1_555  ? 
22 AC4 12 ARG B 78  ? ARG B 101  . ? 1_555  ? 
23 AC4 12 HIS B 131 ? HIS B 154  . ? 1_555  ? 
24 AC4 12 VAL B 194 ? VAL B 217  . ? 1_555  ? 
25 AC4 12 TRP B 195 ? TRP B 218  . ? 1_555  ? 
26 AC4 12 PHE B 196 ? PHE B 219  . ? 1_555  ? 
27 AC4 12 GLU B 198 ? GLU B 221  . ? 1_555  ? 
28 AC4 12 TYR B 228 ? TYR B 251  . ? 1_555  ? 
29 AC5 4  ARG B 121 ? ARG B 144  . ? 1_555  ? 
30 AC5 4  ALA B 122 ? ALA B 145  . ? 1_555  ? 
31 AC5 4  GLY B 123 ? GLY B 146  . ? 1_555  ? 
32 AC5 4  HOH N .   ? HOH B 2011 . ? 1_555  ? 
33 AC6 4  GLN A 113 ? GLN A 136  . ? 1_555  ? 
34 AC6 4  ASN A 114 ? ASN A 137  . ? 1_555  ? 
35 AC6 4  HIS A 131 ? HIS A 154  . ? 1_555  ? 
36 AC6 4  3NP L .   ? 3NP C 1004 . ? 1_555  ? 
37 AC7 4  GLY A 222 ? GLY A 245  . ? 1_555  ? 
38 AC7 4  ASN A 248 ? ASN A 271  . ? 1_555  ? 
39 AC7 4  MET A 249 ? MET A 272  . ? 1_555  ? 
40 AC7 4  GLU A 250 ? GLU A 273  . ? 1_555  ? 
41 AC8 3  ASN B 114 ? ASN B 137  . ? 1_555  ? 
42 AC8 3  ILE B 115 ? ILE B 138  . ? 1_555  ? 
43 AC8 3  ASP B 116 ? ASP B 139  . ? 1_555  ? 
44 AC9 4  ASP B 201 ? ASP B 224  . ? 1_555  ? 
45 AC9 4  ASP B 201 ? ASP B 224  . ? 12_544 ? 
46 AC9 4  ASP B 203 ? ASP B 226  . ? 1_555  ? 
47 AC9 4  ASP B 203 ? ASP B 226  . ? 12_544 ? 
# 
_database_PDB_matrix.entry_id          4UTX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UTX 
_atom_sites.fract_transf_matrix[1][1]   0.011430 
_atom_sites.fract_transf_matrix[1][2]   0.006599 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013198 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003187 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 12  ? -7.387  -2.455  -6.524  1.00 102.35 ? 35   ASP A N   1 
ATOM   2    C  CA  . ASP A 1 12  ? -5.925  -2.612  -6.740  1.00 101.74 ? 35   ASP A CA  1 
ATOM   3    C  C   . ASP A 1 12  ? -5.459  -4.071  -6.590  1.00 99.91  ? 35   ASP A C   1 
ATOM   4    O  O   . ASP A 1 12  ? -5.382  -4.623  -5.486  1.00 89.83  ? 35   ASP A O   1 
ATOM   5    C  CB  . ASP A 1 12  ? -5.180  -1.725  -5.760  1.00 100.22 ? 35   ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 12  ? -3.755  -1.479  -6.173  1.00 95.58  ? 35   ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 12  ? -3.261  -2.130  -7.122  1.00 82.61  ? 35   ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 12  ? -3.133  -0.620  -5.527  1.00 92.94  ? 35   ASP A OD2 1 
ATOM   9    N  N   . LEU A 1 13  ? -5.164  -4.682  -7.731  1.00 99.08  ? 36   LEU A N   1 
ATOM   10   C  CA  . LEU A 1 13  ? -4.702  -6.069  -7.806  1.00 94.58  ? 36   LEU A CA  1 
ATOM   11   C  C   . LEU A 1 13  ? -3.424  -6.333  -6.991  1.00 90.87  ? 36   LEU A C   1 
ATOM   12   O  O   . LEU A 1 13  ? -3.325  -7.340  -6.306  1.00 87.71  ? 36   LEU A O   1 
ATOM   13   C  CB  . LEU A 1 13  ? -4.514  -6.445  -9.289  1.00 91.01  ? 36   LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 13  ? -3.963  -7.800  -9.735  1.00 88.76  ? 36   LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 13  ? -4.390  -8.938  -8.833  1.00 97.09  ? 36   LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 13  ? -4.414  -8.090  -11.157 1.00 85.87  ? 36   LEU A CD2 1 
ATOM   17   N  N   . THR A 1 14  ? -2.451  -5.435  -7.056  1.00 94.03  ? 37   THR A N   1 
ATOM   18   C  CA  . THR A 1 14  ? -1.164  -5.687  -6.398  1.00 95.15  ? 37   THR A CA  1 
ATOM   19   C  C   . THR A 1 14  ? -1.350  -5.706  -4.887  1.00 88.83  ? 37   THR A C   1 
ATOM   20   O  O   . THR A 1 14  ? -0.686  -6.461  -4.173  1.00 86.59  ? 37   THR A O   1 
ATOM   21   C  CB  . THR A 1 14  ? -0.104  -4.649  -6.802  1.00 92.37  ? 37   THR A CB  1 
ATOM   22   O  OG1 . THR A 1 14  ? -0.696  -3.706  -7.707  1.00 93.86  ? 37   THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 14  ? 1.129   -5.347  -7.466  1.00 86.91  ? 37   THR A CG2 1 
ATOM   24   N  N   . ALA A 1 15  ? -2.288  -4.894  -4.418  1.00 86.01  ? 38   ALA A N   1 
ATOM   25   C  CA  . ALA A 1 15  ? -2.649  -4.863  -2.999  1.00 91.95  ? 38   ALA A CA  1 
ATOM   26   C  C   . ALA A 1 15  ? -3.177  -6.219  -2.550  1.00 84.98  ? 38   ALA A C   1 
ATOM   27   O  O   . ALA A 1 15  ? -2.762  -6.782  -1.525  1.00 79.60  ? 38   ALA A O   1 
ATOM   28   C  CB  . ALA A 1 15  ? -3.697  -3.777  -2.744  1.00 95.13  ? 38   ALA A CB  1 
ATOM   29   N  N   . PHE A 1 16  ? -4.099  -6.734  -3.344  1.00 80.97  ? 39   PHE A N   1 
ATOM   30   C  CA  . PHE A 1 16  ? -4.636  -8.054  -3.113  1.00 79.32  ? 39   PHE A CA  1 
ATOM   31   C  C   . PHE A 1 16  ? -3.539  -9.143  -3.119  1.00 72.43  ? 39   PHE A C   1 
ATOM   32   O  O   . PHE A 1 16  ? -3.504  -9.997  -2.235  1.00 70.91  ? 39   PHE A O   1 
ATOM   33   C  CB  . PHE A 1 16  ? -5.713  -8.373  -4.161  1.00 79.67  ? 39   PHE A CB  1 
ATOM   34   C  CG  . PHE A 1 16  ? -6.032  -9.821  -4.251  1.00 76.40  ? 39   PHE A CG  1 
ATOM   35   C  CD1 . PHE A 1 16  ? -6.965  -10.365 -3.403  1.00 74.71  ? 39   PHE A CD1 1 
ATOM   36   C  CD2 . PHE A 1 16  ? -5.354  -10.653 -5.131  1.00 78.19  ? 39   PHE A CD2 1 
ATOM   37   C  CE1 . PHE A 1 16  ? -7.246  -11.712 -3.425  1.00 74.31  ? 39   PHE A CE1 1 
ATOM   38   C  CE2 . PHE A 1 16  ? -5.628  -12.011 -5.166  1.00 81.32  ? 39   PHE A CE2 1 
ATOM   39   C  CZ  . PHE A 1 16  ? -6.576  -12.542 -4.299  1.00 80.94  ? 39   PHE A CZ  1 
ATOM   40   N  N   . ARG A 1 17  ? -2.669  -9.129  -4.119  1.00 64.34  ? 40   ARG A N   1 
ATOM   41   C  CA  . ARG A 1 17  ? -1.662  -10.167 -4.223  1.00 65.43  ? 40   ARG A CA  1 
ATOM   42   C  C   . ARG A 1 17  ? -0.765  -10.149 -3.001  1.00 68.21  ? 40   ARG A C   1 
ATOM   43   O  O   . ARG A 1 17  ? -0.319  -11.192 -2.534  1.00 67.55  ? 40   ARG A O   1 
ATOM   44   C  CB  . ARG A 1 17  ? -0.827  -10.010 -5.478  1.00 65.74  ? 40   ARG A CB  1 
ATOM   45   C  CG  . ARG A 1 17  ? -1.642  -10.011 -6.756  1.00 67.49  ? 40   ARG A CG  1 
ATOM   46   C  CD  . ARG A 1 17  ? -0.904  -10.638 -7.918  1.00 70.28  ? 40   ARG A CD  1 
ATOM   47   N  NE  . ARG A 1 17  ? -1.154  -12.074 -8.019  1.00 71.82  ? 40   ARG A NE  1 
ATOM   48   C  CZ  . ARG A 1 17  ? -0.304  -13.041 -7.664  1.00 76.46  ? 40   ARG A CZ  1 
ATOM   49   N  NH1 . ARG A 1 17  ? 0.893   -12.768 -7.138  1.00 81.71  ? 40   ARG A NH1 1 
ATOM   50   N  NH2 . ARG A 1 17  ? -0.652  -14.309 -7.828  1.00 72.38  ? 40   ARG A NH2 1 
ATOM   51   N  N   . GLU A 1 18  ? -0.529  -8.962  -2.466  1.00 71.92  ? 41   GLU A N   1 
ATOM   52   C  CA  . GLU A 1 18  ? 0.245   -8.839  -1.250  1.00 71.86  ? 41   GLU A CA  1 
ATOM   53   C  C   . GLU A 1 18  ? -0.398  -9.577  -0.101  1.00 66.31  ? 41   GLU A C   1 
ATOM   54   O  O   . GLU A 1 18  ? 0.297   -10.113 0.744   1.00 67.70  ? 41   GLU A O   1 
ATOM   55   C  CB  . GLU A 1 18  ? 0.413   -7.383  -0.863  1.00 78.37  ? 41   GLU A CB  1 
ATOM   56   C  CG  . GLU A 1 18  ? 1.571   -6.699  -1.549  1.00 83.08  ? 41   GLU A CG  1 
ATOM   57   C  CD  . GLU A 1 18  ? 2.080   -5.549  -0.711  1.00 95.53  ? 41   GLU A CD  1 
ATOM   58   O  OE1 . GLU A 1 18  ? 1.235   -4.753  -0.222  1.00 100.02 ? 41   GLU A OE1 1 
ATOM   59   O  OE2 . GLU A 1 18  ? 3.316   -5.458  -0.516  1.00 99.91  ? 41   GLU A OE2 1 
ATOM   60   N  N   . HIS A 1 19  ? -1.719  -9.595  -0.044  1.00 61.09  ? 42   HIS A N   1 
ATOM   61   C  CA  . HIS A 1 19  ? -2.374  -10.393 0.969   1.00 63.26  ? 42   HIS A CA  1 
ATOM   62   C  C   . HIS A 1 19  ? -2.226  -11.837 0.662   1.00 63.25  ? 42   HIS A C   1 
ATOM   63   O  O   . HIS A 1 19  ? -1.869  -12.663 1.522   1.00 62.29  ? 42   HIS A O   1 
ATOM   64   C  CB  . HIS A 1 19  ? -3.842  -10.087 1.032   1.00 65.08  ? 42   HIS A CB  1 
ATOM   65   C  CG  . HIS A 1 19  ? -4.131  -8.867  1.820   1.00 70.76  ? 42   HIS A CG  1 
ATOM   66   N  ND1 . HIS A 1 19  ? -4.181  -8.867  3.197   1.00 71.61  ? 42   HIS A ND1 1 
ATOM   67   C  CD2 . HIS A 1 19  ? -4.331  -7.593  1.426   1.00 70.85  ? 42   HIS A CD2 1 
ATOM   68   C  CE1 . HIS A 1 19  ? -4.432  -7.641  3.614   1.00 72.92  ? 42   HIS A CE1 1 
ATOM   69   N  NE2 . HIS A 1 19  ? -4.534  -6.853  2.559   1.00 71.08  ? 42   HIS A NE2 1 
ATOM   70   N  N   . PHE A 1 20  ? -2.568  -12.133 -0.578  1.00 62.37  ? 43   PHE A N   1 
ATOM   71   C  CA  . PHE A 1 20  ? -2.506  -13.471 -1.086  1.00 64.98  ? 43   PHE A CA  1 
ATOM   72   C  C   . PHE A 1 20  ? -1.190  -14.109 -0.636  1.00 63.61  ? 43   PHE A C   1 
ATOM   73   O  O   . PHE A 1 20  ? -1.170  -15.227 -0.126  1.00 67.10  ? 43   PHE A O   1 
ATOM   74   C  CB  . PHE A 1 20  ? -2.635  -13.420 -2.604  1.00 64.90  ? 43   PHE A CB  1 
ATOM   75   C  CG  . PHE A 1 20  ? -2.569  -14.761 -3.268  1.00 68.07  ? 43   PHE A CG  1 
ATOM   76   C  CD1 . PHE A 1 20  ? -3.377  -15.819 -2.832  1.00 65.33  ? 43   PHE A CD1 1 
ATOM   77   C  CD2 . PHE A 1 20  ? -1.723  -14.960 -4.357  1.00 68.81  ? 43   PHE A CD2 1 
ATOM   78   C  CE1 . PHE A 1 20  ? -3.331  -17.043 -3.461  1.00 64.06  ? 43   PHE A CE1 1 
ATOM   79   C  CE2 . PHE A 1 20  ? -1.670  -16.189 -4.994  1.00 69.56  ? 43   PHE A CE2 1 
ATOM   80   C  CZ  . PHE A 1 20  ? -2.473  -17.230 -4.544  1.00 70.51  ? 43   PHE A CZ  1 
ATOM   81   N  N   . ALA A 1 21  ? -0.097  -13.383 -0.817  1.00 62.75  ? 44   ALA A N   1 
ATOM   82   C  CA  . ALA A 1 21  ? 1.222   -13.870 -0.460  1.00 59.18  ? 44   ALA A CA  1 
ATOM   83   C  C   . ALA A 1 21  ? 1.265   -14.356 0.949   1.00 58.94  ? 44   ALA A C   1 
ATOM   84   O  O   . ALA A 1 21  ? 1.867   -15.393 1.221   1.00 61.42  ? 44   ALA A O   1 
ATOM   85   C  CB  . ALA A 1 21  ? 2.232   -12.771 -0.631  1.00 59.83  ? 44   ALA A CB  1 
ATOM   86   N  N   . LYS A 1 22  ? 0.656   -13.605 1.857   1.00 58.58  ? 45   LYS A N   1 
ATOM   87   C  CA  . LYS A 1 22  ? 0.806   -13.904 3.269   1.00 61.53  ? 45   LYS A CA  1 
ATOM   88   C  C   . LYS A 1 22  ? -0.101  -15.043 3.682   1.00 56.74  ? 45   LYS A C   1 
ATOM   89   O  O   . LYS A 1 22  ? 0.264   -15.858 4.519   1.00 57.15  ? 45   LYS A O   1 
ATOM   90   C  CB  . LYS A 1 22  ? 0.525   -12.660 4.105   1.00 69.73  ? 45   LYS A CB  1 
ATOM   91   C  CG  . LYS A 1 22  ? 1.535   -11.553 3.870   1.00 78.06  ? 45   LYS A CG  1 
ATOM   92   C  CD  . LYS A 1 22  ? 1.410   -10.414 4.881   1.00 85.23  ? 45   LYS A CD  1 
ATOM   93   C  CE  . LYS A 1 22  ? 2.484   -9.360  4.657   1.00 84.80  ? 45   LYS A CE  1 
ATOM   94   N  NZ  . LYS A 1 22  ? 2.165   -8.115  5.395   1.00 86.54  ? 45   LYS A NZ  1 
ATOM   95   N  N   . ALA A 1 23  ? -1.269  -15.108 3.069   1.00 52.25  ? 46   ALA A N   1 
ATOM   96   C  CA  . ALA A 1 23  ? -2.307  -16.035 3.488   1.00 55.17  ? 46   ALA A CA  1 
ATOM   97   C  C   . ALA A 1 23  ? -1.846  -17.456 3.782   1.00 56.20  ? 46   ALA A C   1 
ATOM   98   O  O   . ALA A 1 23  ? -1.161  -18.076 2.972   1.00 58.84  ? 46   ALA A O   1 
ATOM   99   C  CB  . ALA A 1 23  ? -3.408  -16.072 2.439   1.00 56.82  ? 46   ALA A CB  1 
ATOM   100  N  N   . LYS A 1 24  ? -2.277  -17.982 4.920   1.00 55.33  ? 47   LYS A N   1 
ATOM   101  C  CA  . LYS A 1 24  ? -2.024  -19.363 5.260   1.00 56.18  ? 47   LYS A CA  1 
ATOM   102  C  C   . LYS A 1 24  ? -3.266  -20.245 5.252   1.00 56.87  ? 47   LYS A C   1 
ATOM   103  O  O   . LYS A 1 24  ? -3.176  -21.448 5.048   1.00 53.00  ? 47   LYS A O   1 
ATOM   104  C  CB  . LYS A 1 24  ? -1.267  -19.411 6.578   1.00 59.67  ? 47   LYS A CB  1 
ATOM   105  C  CG  . LYS A 1 24  ? 0.207   -19.147 6.277   1.00 70.08  ? 47   LYS A CG  1 
ATOM   106  C  CD  . LYS A 1 24  ? 1.099   -18.722 7.431   1.00 77.20  ? 47   LYS A CD  1 
ATOM   107  C  CE  . LYS A 1 24  ? 2.458   -18.382 6.831   1.00 90.53  ? 47   LYS A CE  1 
ATOM   108  N  NZ  . LYS A 1 24  ? 3.548   -18.220 7.836   1.00 102.91 ? 47   LYS A NZ  1 
ATOM   109  N  N   . HIS A 1 25  ? -4.430  -19.653 5.469   1.00 57.98  ? 48   HIS A N   1 
ATOM   110  C  CA  . HIS A 1 25  ? -5.679  -20.389 5.422   1.00 58.38  ? 48   HIS A CA  1 
ATOM   111  C  C   . HIS A 1 25  ? -6.667  -19.570 4.596   1.00 54.58  ? 48   HIS A C   1 
ATOM   112  O  O   . HIS A 1 25  ? -7.183  -18.562 5.046   1.00 52.93  ? 48   HIS A O   1 
ATOM   113  C  CB  . HIS A 1 25  ? -6.184  -20.690 6.839   1.00 62.49  ? 48   HIS A CB  1 
ATOM   114  C  CG  . HIS A 1 25  ? -5.209  -21.492 7.660   1.00 74.92  ? 48   HIS A CG  1 
ATOM   115  N  ND1 . HIS A 1 25  ? -5.316  -22.858 7.831   1.00 85.06  ? 48   HIS A ND1 1 
ATOM   116  C  CD2 . HIS A 1 25  ? -4.090  -21.124 8.332   1.00 77.87  ? 48   HIS A CD2 1 
ATOM   117  C  CE1 . HIS A 1 25  ? -4.317  -23.294 8.582   1.00 82.29  ? 48   HIS A CE1 1 
ATOM   118  N  NE2 . HIS A 1 25  ? -3.556  -22.261 8.894   1.00 79.16  ? 48   HIS A NE2 1 
ATOM   119  N  N   . ILE A 1 26  ? -6.908  -20.025 3.374   1.00 52.34  ? 49   ILE A N   1 
ATOM   120  C  CA  . ILE A 1 26  ? -7.761  -19.336 2.435   1.00 53.01  ? 49   ILE A CA  1 
ATOM   121  C  C   . ILE A 1 26  ? -9.082  -20.077 2.201   1.00 53.44  ? 49   ILE A C   1 
ATOM   122  O  O   . ILE A 1 26  ? -9.103  -21.272 1.954   1.00 56.84  ? 49   ILE A O   1 
ATOM   123  C  CB  . ILE A 1 26  ? -7.078  -19.228 1.078   1.00 53.87  ? 49   ILE A CB  1 
ATOM   124  C  CG1 . ILE A 1 26  ? -5.833  -18.410 1.217   1.00 56.18  ? 49   ILE A CG1 1 
ATOM   125  C  CG2 . ILE A 1 26  ? -8.004  -18.591 0.062   1.00 54.86  ? 49   ILE A CG2 1 
ATOM   126  C  CD1 . ILE A 1 26  ? -5.213  -18.094 -0.116  1.00 58.61  ? 49   ILE A CD1 1 
ATOM   127  N  N   . ALA A 1 27  ? -10.182 -19.351 2.228   1.00 50.54  ? 50   ALA A N   1 
ATOM   128  C  CA  . ALA A 1 27  ? -11.453 -19.954 1.972   1.00 47.83  ? 50   ALA A CA  1 
ATOM   129  C  C   . ALA A 1 27  ? -12.079 -19.271 0.791   1.00 48.57  ? 50   ALA A C   1 
ATOM   130  O  O   . ALA A 1 27  ? -12.016 -18.042 0.660   1.00 50.75  ? 50   ALA A O   1 
ATOM   131  C  CB  . ALA A 1 27  ? -12.330 -19.809 3.172   1.00 48.58  ? 50   ALA A CB  1 
ATOM   132  N  N   . ILE A 1 28  ? -12.694 -20.075 -0.061  1.00 45.95  ? 51   ILE A N   1 
ATOM   133  C  CA  . ILE A 1 28  ? -13.229 -19.607 -1.284  1.00 46.91  ? 51   ILE A CA  1 
ATOM   134  C  C   . ILE A 1 28  ? -14.644 -20.046 -1.362  1.00 45.48  ? 51   ILE A C   1 
ATOM   135  O  O   . ILE A 1 28  ? -14.930 -21.212 -1.365  1.00 52.18  ? 51   ILE A O   1 
ATOM   136  C  CB  . ILE A 1 28  ? -12.441 -20.202 -2.440  1.00 51.30  ? 51   ILE A CB  1 
ATOM   137  C  CG1 . ILE A 1 28  ? -10.962 -19.868 -2.242  1.00 55.40  ? 51   ILE A CG1 1 
ATOM   138  C  CG2 . ILE A 1 28  ? -12.937 -19.650 -3.774  1.00 50.88  ? 51   ILE A CG2 1 
ATOM   139  C  CD1 . ILE A 1 28  ? -10.079 -20.282 -3.397  1.00 59.24  ? 51   ILE A CD1 1 
ATOM   140  N  N   . ILE A 1 29  ? -15.531 -19.095 -1.426  1.00 45.41  ? 52   ILE A N   1 
ATOM   141  C  CA  . ILE A 1 29  ? -16.956 -19.357 -1.531  1.00 48.14  ? 52   ILE A CA  1 
ATOM   142  C  C   . ILE A 1 29  ? -17.347 -19.116 -2.980  1.00 44.74  ? 52   ILE A C   1 
ATOM   143  O  O   . ILE A 1 29  ? -16.977 -18.091 -3.547  1.00 40.88  ? 52   ILE A O   1 
ATOM   144  C  CB  . ILE A 1 29  ? -17.737 -18.364 -0.641  1.00 49.45  ? 52   ILE A CB  1 
ATOM   145  C  CG1 . ILE A 1 29  ? -17.384 -18.556 0.828   1.00 51.72  ? 52   ILE A CG1 1 
ATOM   146  C  CG2 . ILE A 1 29  ? -19.228 -18.462 -0.834  1.00 46.18  ? 52   ILE A CG2 1 
ATOM   147  C  CD1 . ILE A 1 29  ? -17.492 -17.255 1.595   1.00 54.17  ? 52   ILE A CD1 1 
ATOM   148  N  N   . THR A 1 30  ? -18.122 -20.026 -3.544  1.00 44.71  ? 53   THR A N   1 
ATOM   149  C  CA  . THR A 1 30  ? -18.462 -19.968 -4.942  1.00 49.60  ? 53   THR A CA  1 
ATOM   150  C  C   . THR A 1 30  ? -19.968 -20.112 -5.215  1.00 54.76  ? 53   THR A C   1 
ATOM   151  O  O   . THR A 1 30  ? -20.605 -21.037 -4.735  1.00 50.86  ? 53   THR A O   1 
ATOM   152  C  CB  . THR A 1 30  ? -17.708 -21.052 -5.745  1.00 53.69  ? 53   THR A CB  1 
ATOM   153  O  OG1 . THR A 1 30  ? -18.318 -22.362 -5.577  1.00 48.99  ? 53   THR A OG1 1 
ATOM   154  C  CG2 . THR A 1 30  ? -16.227 -21.063 -5.349  1.00 52.22  ? 53   THR A CG2 1 
ATOM   155  N  N   . GLY A 1 31  ? -20.508 -19.206 -6.043  1.00 59.16  ? 54   GLY A N   1 
ATOM   156  C  CA  . GLY A 1 31  ? -21.945 -19.174 -6.385  1.00 55.12  ? 54   GLY A CA  1 
ATOM   157  C  C   . GLY A 1 31  ? -22.139 -19.547 -7.816  1.00 48.58  ? 54   GLY A C   1 
ATOM   158  O  O   . GLY A 1 31  ? -21.197 -19.998 -8.437  1.00 48.58  ? 54   GLY A O   1 
ATOM   159  N  N   . ALA A 1 32  ? -23.328 -19.341 -8.356  1.00 45.77  ? 55   ALA A N   1 
ATOM   160  C  CA  . ALA A 1 32  ? -23.608 -19.884 -9.682  1.00 48.73  ? 55   ALA A CA  1 
ATOM   161  C  C   . ALA A 1 32  ? -22.942 -19.141 -10.828 1.00 48.43  ? 55   ALA A C   1 
ATOM   162  O  O   . ALA A 1 32  ? -22.829 -19.659 -11.933 1.00 50.66  ? 55   ALA A O   1 
ATOM   163  C  CB  . ALA A 1 32  ? -25.099 -20.042 -9.920  1.00 50.66  ? 55   ALA A CB  1 
ATOM   164  N  N   . GLY A 1 33  ? -22.421 -17.965 -10.554 1.00 51.59  ? 56   GLY A N   1 
ATOM   165  C  CA  . GLY A 1 33  ? -21.655 -17.251 -11.563 1.00 55.65  ? 56   GLY A CA  1 
ATOM   166  C  C   . GLY A 1 33  ? -20.631 -18.127 -12.266 1.00 55.00  ? 56   GLY A C   1 
ATOM   167  O  O   . GLY A 1 33  ? -20.374 -17.984 -13.478 1.00 51.72  ? 56   GLY A O   1 
ATOM   168  N  N   . VAL A 1 34  ? -20.059 -19.050 -11.508 1.00 55.79  ? 57   VAL A N   1 
ATOM   169  C  CA  . VAL A 1 34  ? -18.909 -19.796 -12.005 1.00 61.44  ? 57   VAL A CA  1 
ATOM   170  C  C   . VAL A 1 34  ? -19.372 -21.028 -12.758 1.00 57.12  ? 57   VAL A C   1 
ATOM   171  O  O   . VAL A 1 34  ? -18.750 -21.443 -13.729 1.00 58.48  ? 57   VAL A O   1 
ATOM   172  C  CB  . VAL A 1 34  ? -17.859 -20.111 -10.916 1.00 67.72  ? 57   VAL A CB  1 
ATOM   173  C  CG1 . VAL A 1 34  ? -18.160 -19.290 -9.686  1.00 70.24  ? 57   VAL A CG1 1 
ATOM   174  C  CG2 . VAL A 1 34  ? -17.754 -21.590 -10.553 1.00 69.57  ? 57   VAL A CG2 1 
ATOM   175  N  N   . SER A 1 35  ? -20.460 -21.616 -12.296 1.00 51.78  ? 58   SER A N   1 
ATOM   176  C  CA  . SER A 1 35  ? -21.025 -22.748 -12.981 1.00 52.02  ? 58   SER A CA  1 
ATOM   177  C  C   . SER A 1 35  ? -21.707 -22.276 -14.257 1.00 52.69  ? 58   SER A C   1 
ATOM   178  O  O   . SER A 1 35  ? -21.761 -23.002 -15.254 1.00 48.51  ? 58   SER A O   1 
ATOM   179  C  CB  . SER A 1 35  ? -21.976 -23.464 -12.048 1.00 50.22  ? 58   SER A CB  1 
ATOM   180  O  OG  . SER A 1 35  ? -21.186 -24.032 -11.015 1.00 48.96  ? 58   SER A OG  1 
ATOM   181  N  N   . ALA A 1 36  ? -22.193 -21.031 -14.216 1.00 53.87  ? 59   ALA A N   1 
ATOM   182  C  CA  . ALA A 1 36  ? -22.742 -20.357 -15.387 1.00 52.27  ? 59   ALA A CA  1 
ATOM   183  C  C   . ALA A 1 36  ? -21.665 -20.211 -16.455 1.00 52.92  ? 59   ALA A C   1 
ATOM   184  O  O   . ALA A 1 36  ? -21.882 -20.574 -17.585 1.00 54.45  ? 59   ALA A O   1 
ATOM   185  C  CB  . ALA A 1 36  ? -23.269 -18.996 -15.001 1.00 54.97  ? 59   ALA A CB  1 
ATOM   186  N  N   . GLU A 1 37  ? -20.487 -19.722 -16.092 1.00 51.23  ? 60   GLU A N   1 
ATOM   187  C  CA  . GLU A 1 37  ? -19.408 -19.590 -17.053 1.00 51.21  ? 60   GLU A CA  1 
ATOM   188  C  C   . GLU A 1 37  ? -18.985 -20.888 -17.737 1.00 49.71  ? 60   GLU A C   1 
ATOM   189  O  O   . GLU A 1 37  ? -18.296 -20.856 -18.727 1.00 48.35  ? 60   GLU A O   1 
ATOM   190  C  CB  . GLU A 1 37  ? -18.190 -18.957 -16.392 1.00 56.01  ? 60   GLU A CB  1 
ATOM   191  C  CG  . GLU A 1 37  ? -18.379 -17.474 -16.058 1.00 60.51  ? 60   GLU A CG  1 
ATOM   192  C  CD  . GLU A 1 37  ? -17.057 -16.769 -15.748 1.00 67.70  ? 60   GLU A CD  1 
ATOM   193  O  OE1 . GLU A 1 37  ? -16.027 -17.114 -16.398 1.00 70.75  ? 60   GLU A OE1 1 
ATOM   194  O  OE2 . GLU A 1 37  ? -17.042 -15.885 -14.855 1.00 64.46  ? 60   GLU A OE2 1 
ATOM   195  N  N   . SER A 1 38  ? -19.359 -22.033 -17.203 1.00 52.18  ? 61   SER A N   1 
ATOM   196  C  CA  . SER A 1 38  ? -19.050 -23.300 -17.858 1.00 52.41  ? 61   SER A CA  1 
ATOM   197  C  C   . SER A 1 38  ? -20.246 -23.744 -18.647 1.00 47.86  ? 61   SER A C   1 
ATOM   198  O  O   . SER A 1 38  ? -20.302 -24.863 -19.117 1.00 49.70  ? 61   SER A O   1 
ATOM   199  C  CB  . SER A 1 38  ? -18.666 -24.362 -16.831 1.00 52.89  ? 61   SER A CB  1 
ATOM   200  O  OG  . SER A 1 38  ? -17.394 -24.073 -16.300 1.00 56.00  ? 61   SER A OG  1 
ATOM   201  N  N   . GLY A 1 39  ? -21.212 -22.864 -18.775 1.00 45.35  ? 62   GLY A N   1 
ATOM   202  C  CA  . GLY A 1 39  ? -22.375 -23.124 -19.581 1.00 48.49  ? 62   GLY A CA  1 
ATOM   203  C  C   . GLY A 1 39  ? -23.403 -24.028 -18.947 1.00 50.62  ? 62   GLY A C   1 
ATOM   204  O  O   . GLY A 1 39  ? -24.006 -24.835 -19.645 1.00 52.48  ? 62   GLY A O   1 
ATOM   205  N  N   . VAL A 1 40  ? -23.616 -23.886 -17.643 1.00 51.72  ? 63   VAL A N   1 
ATOM   206  C  CA  . VAL A 1 40  ? -24.545 -24.722 -16.939 1.00 52.17  ? 63   VAL A CA  1 
ATOM   207  C  C   . VAL A 1 40  ? -25.782 -23.909 -16.632 1.00 55.44  ? 63   VAL A C   1 
ATOM   208  O  O   . VAL A 1 40  ? -25.709 -22.845 -15.992 1.00 54.58  ? 63   VAL A O   1 
ATOM   209  C  CB  . VAL A 1 40  ? -24.015 -25.215 -15.595 1.00 50.92  ? 63   VAL A CB  1 
ATOM   210  C  CG1 . VAL A 1 40  ? -25.046 -26.075 -14.916 1.00 49.61  ? 63   VAL A CG1 1 
ATOM   211  C  CG2 . VAL A 1 40  ? -22.778 -26.038 -15.785 1.00 53.70  ? 63   VAL A CG2 1 
ATOM   212  N  N   . PRO A 1 41  ? -26.940 -24.433 -17.035 1.00 59.58  ? 64   PRO A N   1 
ATOM   213  C  CA  . PRO A 1 41  ? -28.218 -23.772 -16.731 1.00 60.61  ? 64   PRO A CA  1 
ATOM   214  C  C   . PRO A 1 41  ? -28.527 -23.690 -15.237 1.00 63.09  ? 64   PRO A C   1 
ATOM   215  O  O   . PRO A 1 41  ? -28.446 -24.691 -14.558 1.00 60.17  ? 64   PRO A O   1 
ATOM   216  C  CB  . PRO A 1 41  ? -29.220 -24.708 -17.367 1.00 57.91  ? 64   PRO A CB  1 
ATOM   217  C  CG  . PRO A 1 41  ? -28.563 -26.057 -17.296 1.00 55.70  ? 64   PRO A CG  1 
ATOM   218  C  CD  . PRO A 1 41  ? -27.129 -25.791 -17.585 1.00 55.35  ? 64   PRO A CD  1 
ATOM   219  N  N   . THR A 1 42  ? -28.909 -22.528 -14.726 1.00 69.41  ? 65   THR A N   1 
ATOM   220  C  CA  . THR A 1 42  ? -29.426 -22.478 -13.349 1.00 71.23  ? 65   THR A CA  1 
ATOM   221  C  C   . THR A 1 42  ? -30.951 -22.455 -13.336 1.00 73.66  ? 65   THR A C   1 
ATOM   222  O  O   . THR A 1 42  ? -31.530 -22.662 -12.297 1.00 74.65  ? 65   THR A O   1 
ATOM   223  C  CB  . THR A 1 42  ? -28.859 -21.308 -12.480 1.00 70.84  ? 65   THR A CB  1 
ATOM   224  O  OG1 . THR A 1 42  ? -29.199 -20.033 -13.039 1.00 67.39  ? 65   THR A OG1 1 
ATOM   225  C  CG2 . THR A 1 42  ? -27.338 -21.435 -12.328 1.00 72.55  ? 65   THR A CG2 1 
ATOM   226  N  N   . PHE A 1 43  ? -31.601 -22.215 -14.476 1.00 78.02  ? 66   PHE A N   1 
ATOM   227  C  CA  . PHE A 1 43  ? -33.076 -22.205 -14.549 1.00 77.49  ? 66   PHE A CA  1 
ATOM   228  C  C   . PHE A 1 43  ? -33.786 -21.176 -13.651 1.00 76.61  ? 66   PHE A C   1 
ATOM   229  O  O   . PHE A 1 43  ? -34.836 -21.477 -13.068 1.00 64.00  ? 66   PHE A O   1 
ATOM   230  C  CB  . PHE A 1 43  ? -33.620 -23.608 -14.269 1.00 76.19  ? 66   PHE A CB  1 
ATOM   231  C  CG  . PHE A 1 43  ? -33.017 -24.669 -15.144 1.00 80.04  ? 66   PHE A CG  1 
ATOM   232  C  CD1 . PHE A 1 43  ? -33.330 -24.730 -16.496 1.00 79.43  ? 66   PHE A CD1 1 
ATOM   233  C  CD2 . PHE A 1 43  ? -32.141 -25.608 -14.619 1.00 85.02  ? 66   PHE A CD2 1 
ATOM   234  C  CE1 . PHE A 1 43  ? -32.788 -25.709 -17.307 1.00 77.55  ? 66   PHE A CE1 1 
ATOM   235  C  CE2 . PHE A 1 43  ? -31.591 -26.593 -15.421 1.00 84.42  ? 66   PHE A CE2 1 
ATOM   236  C  CZ  . PHE A 1 43  ? -31.917 -26.640 -16.768 1.00 82.51  ? 66   PHE A CZ  1 
ATOM   237  N  N   . ARG A 1 44  ? -33.200 -19.977 -13.544 1.00 85.94  ? 67   ARG A N   1 
ATOM   238  C  CA  . ARG A 1 44  ? -33.739 -18.895 -12.693 1.00 93.78  ? 67   ARG A CA  1 
ATOM   239  C  C   . ARG A 1 44  ? -33.654 -17.488 -13.333 1.00 96.15  ? 67   ARG A C   1 
ATOM   240  O  O   . ARG A 1 44  ? -32.592 -17.077 -13.806 1.00 94.36  ? 67   ARG A O   1 
ATOM   241  C  CB  . ARG A 1 44  ? -32.990 -18.902 -11.353 1.00 88.40  ? 67   ARG A CB  1 
ATOM   242  C  CG  . ARG A 1 44  ? -33.006 -20.286 -10.709 1.00 82.90  ? 67   ARG A CG  1 
ATOM   243  C  CD  . ARG A 1 44  ? -32.574 -20.407 -9.264  1.00 81.40  ? 67   ARG A CD  1 
ATOM   244  N  NE  . ARG A 1 44  ? -33.085 -19.367 -8.389  1.00 74.68  ? 67   ARG A NE  1 
ATOM   245  C  CZ  . ARG A 1 44  ? -32.814 -19.298 -7.090  1.00 66.62  ? 67   ARG A CZ  1 
ATOM   246  N  NH1 . ARG A 1 44  ? -32.066 -20.216 -6.497  1.00 65.13  ? 67   ARG A NH1 1 
ATOM   247  N  NH2 . ARG A 1 44  ? -33.313 -18.308 -6.372  1.00 68.08  ? 67   ARG A NH2 1 
ATOM   248  N  N   . GLY A 1 45  ? -34.759 -16.742 -13.316 1.00 97.86  ? 68   GLY A N   1 
ATOM   249  C  CA  . GLY A 1 45  ? -34.783 -15.431 -13.973 1.00 105.47 ? 68   GLY A CA  1 
ATOM   250  C  C   . GLY A 1 45  ? -34.965 -15.593 -15.476 1.00 112.40 ? 68   GLY A C   1 
ATOM   251  O  O   . GLY A 1 45  ? -35.272 -16.692 -15.942 1.00 122.06 ? 68   GLY A O   1 
ATOM   252  N  N   . PRO A 1 46  ? -34.723 -14.522 -16.262 1.00 115.69 ? 69   PRO A N   1 
ATOM   253  C  CA  . PRO A 1 46  ? -35.120 -14.578 -17.677 1.00 111.36 ? 69   PRO A CA  1 
ATOM   254  C  C   . PRO A 1 46  ? -34.520 -15.762 -18.479 1.00 106.91 ? 69   PRO A C   1 
ATOM   255  O  O   . PRO A 1 46  ? -33.329 -16.078 -18.379 1.00 95.39  ? 69   PRO A O   1 
ATOM   256  C  CB  . PRO A 1 46  ? -34.650 -13.219 -18.231 1.00 109.70 ? 69   PRO A CB  1 
ATOM   257  C  CG  . PRO A 1 46  ? -33.496 -12.842 -17.375 1.00 112.40 ? 69   PRO A CG  1 
ATOM   258  C  CD  . PRO A 1 46  ? -33.797 -13.402 -16.000 1.00 116.86 ? 69   PRO A CD  1 
ATOM   259  N  N   . GLY A 1 47  ? -35.383 -16.435 -19.227 1.00 103.69 ? 70   GLY A N   1 
ATOM   260  C  CA  . GLY A 1 47  ? -34.960 -17.469 -20.151 1.00 106.61 ? 70   GLY A CA  1 
ATOM   261  C  C   . GLY A 1 47  ? -34.293 -18.687 -19.532 1.00 111.97 ? 70   GLY A C   1 
ATOM   262  O  O   . GLY A 1 47  ? -33.597 -19.434 -20.227 1.00 121.15 ? 70   GLY A O   1 
ATOM   263  N  N   . GLY A 1 48  ? -34.472 -18.882 -18.228 1.00 107.00 ? 71   GLY A N   1 
ATOM   264  C  CA  . GLY A 1 48  ? -34.119 -20.145 -17.591 1.00 100.36 ? 71   GLY A CA  1 
ATOM   265  C  C   . GLY A 1 48  ? -35.392 -20.932 -17.343 1.00 97.32  ? 71   GLY A C   1 
ATOM   266  O  O   . GLY A 1 48  ? -35.899 -20.961 -16.220 1.00 98.43  ? 71   GLY A O   1 
ATOM   267  N  N   . PHE A 1 49  ? -35.937 -21.535 -18.398 1.00 88.61  ? 72   PHE A N   1 
ATOM   268  C  CA  . PHE A 1 49  ? -37.057 -22.462 -18.256 1.00 77.93  ? 72   PHE A CA  1 
ATOM   269  C  C   . PHE A 1 49  ? -36.611 -23.853 -18.561 1.00 68.14  ? 72   PHE A C   1 
ATOM   270  O  O   . PHE A 1 49  ? -35.630 -24.048 -19.227 1.00 62.27  ? 72   PHE A O   1 
ATOM   271  C  CB  . PHE A 1 49  ? -38.211 -22.090 -19.182 1.00 82.00  ? 72   PHE A CB  1 
ATOM   272  C  CG  . PHE A 1 49  ? -39.163 -21.113 -18.570 1.00 90.09  ? 72   PHE A CG  1 
ATOM   273  C  CD1 . PHE A 1 49  ? -38.880 -19.749 -18.583 1.00 94.74  ? 72   PHE A CD1 1 
ATOM   274  C  CD2 . PHE A 1 49  ? -40.323 -21.553 -17.949 1.00 91.45  ? 72   PHE A CD2 1 
ATOM   275  C  CE1 . PHE A 1 49  ? -39.746 -18.841 -18.003 1.00 94.68  ? 72   PHE A CE1 1 
ATOM   276  C  CE2 . PHE A 1 49  ? -41.193 -20.651 -17.364 1.00 93.27  ? 72   PHE A CE2 1 
ATOM   277  C  CZ  . PHE A 1 49  ? -40.901 -19.294 -17.390 1.00 97.45  ? 72   PHE A CZ  1 
ATOM   278  N  N   . TRP A 1 50  ? -37.351 -24.817 -18.052 1.00 67.02  ? 73   TRP A N   1 
ATOM   279  C  CA  . TRP A 1 50  ? -37.236 -26.185 -18.484 1.00 66.24  ? 73   TRP A CA  1 
ATOM   280  C  C   . TRP A 1 50  ? -38.643 -26.582 -18.786 1.00 72.58  ? 73   TRP A C   1 
ATOM   281  O  O   . TRP A 1 50  ? -39.486 -26.649 -17.877 1.00 71.77  ? 73   TRP A O   1 
ATOM   282  C  CB  . TRP A 1 50  ? -36.708 -27.072 -17.382 1.00 65.00  ? 73   TRP A CB  1 
ATOM   283  C  CG  . TRP A 1 50  ? -36.574 -28.540 -17.765 1.00 62.26  ? 73   TRP A CG  1 
ATOM   284  C  CD1 . TRP A 1 50  ? -35.581 -29.093 -18.511 1.00 61.58  ? 73   TRP A CD1 1 
ATOM   285  C  CD2 . TRP A 1 50  ? -37.425 -29.625 -17.371 1.00 59.70  ? 73   TRP A CD2 1 
ATOM   286  N  NE1 . TRP A 1 50  ? -35.772 -30.442 -18.631 1.00 62.98  ? 73   TRP A NE1 1 
ATOM   287  C  CE2 . TRP A 1 50  ? -36.898 -30.797 -17.941 1.00 60.89  ? 73   TRP A CE2 1 
ATOM   288  C  CE3 . TRP A 1 50  ? -38.595 -29.714 -16.618 1.00 64.95  ? 73   TRP A CE3 1 
ATOM   289  C  CZ2 . TRP A 1 50  ? -37.493 -32.054 -17.776 1.00 60.80  ? 73   TRP A CZ2 1 
ATOM   290  C  CZ3 . TRP A 1 50  ? -39.194 -30.977 -16.450 1.00 65.07  ? 73   TRP A CZ3 1 
ATOM   291  C  CH2 . TRP A 1 50  ? -38.634 -32.121 -17.026 1.00 62.52  ? 73   TRP A CH2 1 
ATOM   292  N  N   . ARG A 1 51  ? -38.907 -26.863 -20.058 1.00 77.55  ? 74   ARG A N   1 
ATOM   293  C  CA  . ARG A 1 51  ? -40.266 -27.057 -20.491 1.00 76.91  ? 74   ARG A CA  1 
ATOM   294  C  C   . ARG A 1 51  ? -41.032 -25.852 -19.924 1.00 78.31  ? 74   ARG A C   1 
ATOM   295  O  O   . ARG A 1 51  ? -40.545 -24.720 -20.040 1.00 82.95  ? 74   ARG A O   1 
ATOM   296  C  CB  . ARG A 1 51  ? -40.811 -28.417 -20.018 1.00 74.05  ? 74   ARG A CB  1 
ATOM   297  C  CG  . ARG A 1 51  ? -40.021 -29.632 -20.520 1.00 70.95  ? 74   ARG A CG  1 
ATOM   298  C  CD  . ARG A 1 51  ? -40.676 -30.955 -20.110 1.00 65.71  ? 74   ARG A CD  1 
ATOM   299  N  NE  . ARG A 1 51  ? -39.851 -32.118 -20.453 1.00 57.74  ? 74   ARG A NE  1 
ATOM   300  C  CZ  . ARG A 1 51  ? -40.034 -33.353 -19.984 1.00 56.26  ? 74   ARG A CZ  1 
ATOM   301  N  NH1 . ARG A 1 51  ? -41.032 -33.642 -19.137 1.00 56.05  ? 74   ARG A NH1 1 
ATOM   302  N  NH2 . ARG A 1 51  ? -39.212 -34.319 -20.370 1.00 57.43  ? 74   ARG A NH2 1 
ATOM   303  N  N   . LYS A 1 52  ? -42.172 -26.062 -19.272 1.00 76.35  ? 75   LYS A N   1 
ATOM   304  C  CA  . LYS A 1 52  ? -43.000 -24.932 -18.831 1.00 81.97  ? 75   LYS A CA  1 
ATOM   305  C  C   . LYS A 1 52  ? -42.526 -24.336 -17.514 1.00 84.86  ? 75   LYS A C   1 
ATOM   306  O  O   . LYS A 1 52  ? -43.045 -23.299 -17.099 1.00 84.76  ? 75   LYS A O   1 
ATOM   307  C  CB  . LYS A 1 52  ? -44.478 -25.336 -18.710 1.00 83.33  ? 75   LYS A CB  1 
ATOM   308  C  CG  . LYS A 1 52  ? -45.054 -25.885 -20.014 1.00 96.06  ? 75   LYS A CG  1 
ATOM   309  C  CD  . LYS A 1 52  ? -45.901 -27.140 -19.808 1.00 102.18 ? 75   LYS A CD  1 
ATOM   310  C  CE  . LYS A 1 52  ? -45.649 -28.174 -20.900 1.00 97.97  ? 75   LYS A CE  1 
ATOM   311  N  NZ  . LYS A 1 52  ? -46.543 -29.352 -20.755 1.00 103.22 ? 75   LYS A NZ  1 
ATOM   312  N  N   . TRP A 1 53  ? -41.536 -24.957 -16.867 1.00 82.16  ? 76   TRP A N   1 
ATOM   313  C  CA  . TRP A 1 53  ? -41.218 -24.606 -15.484 1.00 75.66  ? 76   TRP A CA  1 
ATOM   314  C  C   . TRP A 1 53  ? -39.878 -23.975 -15.232 1.00 71.01  ? 76   TRP A C   1 
ATOM   315  O  O   . TRP A 1 53  ? -38.972 -24.000 -16.059 1.00 73.10  ? 76   TRP A O   1 
ATOM   316  C  CB  . TRP A 1 53  ? -41.281 -25.851 -14.639 1.00 77.04  ? 76   TRP A CB  1 
ATOM   317  C  CG  . TRP A 1 53  ? -42.587 -26.480 -14.670 1.00 77.75  ? 76   TRP A CG  1 
ATOM   318  C  CD1 . TRP A 1 53  ? -43.674 -26.152 -13.917 1.00 73.43  ? 76   TRP A CD1 1 
ATOM   319  C  CD2 . TRP A 1 53  ? -42.976 -27.570 -15.498 1.00 79.09  ? 76   TRP A CD2 1 
ATOM   320  N  NE1 . TRP A 1 53  ? -44.723 -26.985 -14.222 1.00 69.98  ? 76   TRP A NE1 1 
ATOM   321  C  CE2 . TRP A 1 53  ? -44.325 -27.864 -15.191 1.00 74.37  ? 76   TRP A CE2 1 
ATOM   322  C  CE3 . TRP A 1 53  ? -42.315 -28.336 -16.470 1.00 88.20  ? 76   TRP A CE3 1 
ATOM   323  C  CZ2 . TRP A 1 53  ? -45.032 -28.893 -15.815 1.00 81.46  ? 76   TRP A CZ2 1 
ATOM   324  C  CZ3 . TRP A 1 53  ? -43.019 -29.370 -17.097 1.00 96.04  ? 76   TRP A CZ3 1 
ATOM   325  C  CH2 . TRP A 1 53  ? -44.369 -29.637 -16.764 1.00 91.73  ? 76   TRP A CH2 1 
ATOM   326  N  N   . GLN A 1 54  ? -39.772 -23.410 -14.044 1.00 70.68  ? 77   GLN A N   1 
ATOM   327  C  CA  . GLN A 1 54  ? -38.511 -22.962 -13.532 1.00 74.59  ? 77   GLN A CA  1 
ATOM   328  C  C   . GLN A 1 54  ? -38.189 -23.780 -12.310 1.00 67.45  ? 77   GLN A C   1 
ATOM   329  O  O   . GLN A 1 54  ? -39.035 -24.452 -11.737 1.00 60.12  ? 77   GLN A O   1 
ATOM   330  C  CB  . GLN A 1 54  ? -38.566 -21.477 -13.187 1.00 85.17  ? 77   GLN A CB  1 
ATOM   331  C  CG  . GLN A 1 54  ? -38.810 -20.588 -14.402 1.00 97.01  ? 77   GLN A CG  1 
ATOM   332  C  CD  . GLN A 1 54  ? -38.127 -19.232 -14.313 1.00 104.93 ? 77   GLN A CD  1 
ATOM   333  O  OE1 . GLN A 1 54  ? -38.217 -18.529 -13.297 1.00 103.12 ? 77   GLN A OE1 1 
ATOM   334  N  NE2 . GLN A 1 54  ? -37.429 -18.859 -15.387 1.00 110.18 ? 77   GLN A NE2 1 
ATOM   335  N  N   . ALA A 1 55  ? -36.932 -23.722 -11.929 1.00 66.34  ? 78   ALA A N   1 
ATOM   336  C  CA  . ALA A 1 55  ? -36.461 -24.357 -10.716 1.00 67.64  ? 78   ALA A CA  1 
ATOM   337  C  C   . ALA A 1 55  ? -37.443 -24.294 -9.542  1.00 68.19  ? 78   ALA A C   1 
ATOM   338  O  O   . ALA A 1 55  ? -37.824 -25.325 -8.995  1.00 64.63  ? 78   ALA A O   1 
ATOM   339  C  CB  . ALA A 1 55  ? -35.165 -23.694 -10.302 1.00 69.91  ? 78   ALA A CB  1 
ATOM   340  N  N   . GLN A 1 56  ? -37.805 -23.072 -9.144  1.00 71.93  ? 79   GLN A N   1 
ATOM   341  C  CA  . GLN A 1 56  ? -38.591 -22.823 -7.934  1.00 69.30  ? 79   GLN A CA  1 
ATOM   342  C  C   . GLN A 1 56  ? -39.796 -23.725 -7.918  1.00 67.85  ? 79   GLN A C   1 
ATOM   343  O  O   . GLN A 1 56  ? -40.200 -24.188 -6.854  1.00 71.05  ? 79   GLN A O   1 
ATOM   344  C  CB  . GLN A 1 56  ? -39.071 -21.372 -7.842  1.00 73.71  ? 79   GLN A CB  1 
ATOM   345  C  CG  . GLN A 1 56  ? -38.082 -20.268 -8.222  1.00 81.76  ? 79   GLN A CG  1 
ATOM   346  C  CD  . GLN A 1 56  ? -38.236 -19.759 -9.665  1.00 84.86  ? 79   GLN A CD  1 
ATOM   347  O  OE1 . GLN A 1 56  ? -39.358 -19.558 -10.156 1.00 83.91  ? 79   GLN A OE1 1 
ATOM   348  N  NE2 . GLN A 1 56  ? -37.099 -19.535 -10.344 1.00 83.46  ? 79   GLN A NE2 1 
ATOM   349  N  N   . ASP A 1 57  ? -40.368 -23.964 -9.096  1.00 64.85  ? 80   ASP A N   1 
ATOM   350  C  CA  . ASP A 1 57  ? -41.524 -24.836 -9.225  1.00 68.32  ? 80   ASP A CA  1 
ATOM   351  C  C   . ASP A 1 57  ? -41.129 -26.269 -8.903  1.00 68.93  ? 80   ASP A C   1 
ATOM   352  O  O   . ASP A 1 57  ? -41.820 -26.957 -8.164  1.00 78.19  ? 80   ASP A O   1 
ATOM   353  C  CB  . ASP A 1 57  ? -42.127 -24.767 -10.643 1.00 72.81  ? 80   ASP A CB  1 
ATOM   354  C  CG  . ASP A 1 57  ? -42.204 -23.339 -11.186 1.00 74.65  ? 80   ASP A CG  1 
ATOM   355  O  OD1 . ASP A 1 57  ? -42.486 -22.406 -10.392 1.00 72.25  ? 80   ASP A OD1 1 
ATOM   356  O  OD2 . ASP A 1 57  ? -41.975 -23.163 -12.407 1.00 70.32  ? 80   ASP A OD2 1 
ATOM   357  N  N   . LEU A 1 58  ? -40.009 -26.726 -9.441  1.00 69.34  ? 81   LEU A N   1 
ATOM   358  C  CA  . LEU A 1 58  ? -39.685 -28.162 -9.413  1.00 69.20  ? 81   LEU A CA  1 
ATOM   359  C  C   . LEU A 1 58  ? -38.741 -28.636 -8.317  1.00 63.26  ? 81   LEU A C   1 
ATOM   360  O  O   . LEU A 1 58  ? -38.770 -29.806 -7.936  1.00 58.03  ? 81   LEU A O   1 
ATOM   361  C  CB  . LEU A 1 58  ? -39.106 -28.563 -10.765 1.00 73.31  ? 81   LEU A CB  1 
ATOM   362  C  CG  . LEU A 1 58  ? -40.156 -28.437 -11.872 1.00 78.73  ? 81   LEU A CG  1 
ATOM   363  C  CD1 . LEU A 1 58  ? -39.533 -28.368 -13.261 1.00 83.12  ? 81   LEU A CD1 1 
ATOM   364  C  CD2 . LEU A 1 58  ? -41.121 -29.603 -11.785 1.00 81.71  ? 81   LEU A CD2 1 
ATOM   365  N  N   . ALA A 1 59  ? -37.894 -27.743 -7.830  1.00 61.36  ? 82   ALA A N   1 
ATOM   366  C  CA  . ALA A 1 59  ? -36.868 -28.112 -6.871  1.00 64.98  ? 82   ALA A CA  1 
ATOM   367  C  C   . ALA A 1 59  ? -37.389 -28.041 -5.432  1.00 68.24  ? 82   ALA A C   1 
ATOM   368  O  O   . ALA A 1 59  ? -36.788 -27.382 -4.587  1.00 73.62  ? 82   ALA A O   1 
ATOM   369  C  CB  . ALA A 1 59  ? -35.676 -27.196 -7.044  1.00 65.43  ? 82   ALA A CB  1 
ATOM   370  N  N   . THR A 1 60  ? -38.496 -28.724 -5.152  1.00 65.96  ? 83   THR A N   1 
ATOM   371  C  CA  . THR A 1 60  ? -39.126 -28.659 -3.841  1.00 63.54  ? 83   THR A CA  1 
ATOM   372  C  C   . THR A 1 60  ? -39.571 -30.049 -3.438  1.00 61.55  ? 83   THR A C   1 
ATOM   373  O  O   . THR A 1 60  ? -39.712 -30.914 -4.277  1.00 56.92  ? 83   THR A O   1 
ATOM   374  C  CB  . THR A 1 60  ? -40.356 -27.751 -3.856  1.00 62.82  ? 83   THR A CB  1 
ATOM   375  O  OG1 . THR A 1 60  ? -41.477 -28.480 -4.382  1.00 62.24  ? 83   THR A OG1 1 
ATOM   376  C  CG2 . THR A 1 60  ? -40.086 -26.504 -4.702  1.00 60.75  ? 83   THR A CG2 1 
ATOM   377  N  N   . PRO A 1 61  ? -39.804 -30.262 -2.147  1.00 62.24  ? 84   PRO A N   1 
ATOM   378  C  CA  . PRO A 1 61  ? -40.215 -31.599 -1.738  1.00 64.45  ? 84   PRO A CA  1 
ATOM   379  C  C   . PRO A 1 61  ? -41.642 -31.915 -2.123  1.00 64.46  ? 84   PRO A C   1 
ATOM   380  O  O   . PRO A 1 61  ? -41.990 -33.084 -2.263  1.00 62.72  ? 84   PRO A O   1 
ATOM   381  C  CB  . PRO A 1 61  ? -40.061 -31.592 -0.211  1.00 65.54  ? 84   PRO A CB  1 
ATOM   382  C  CG  . PRO A 1 61  ? -39.589 -30.253 0.186   1.00 62.79  ? 84   PRO A CG  1 
ATOM   383  C  CD  . PRO A 1 61  ? -39.436 -29.387 -1.024  1.00 63.25  ? 84   PRO A CD  1 
ATOM   384  N  N   . GLU A 1 62  ? -42.433 -30.863 -2.314  1.00 70.37  ? 85   GLU A N   1 
ATOM   385  C  CA  . GLU A 1 62  ? -43.843 -30.973 -2.667  1.00 75.45  ? 85   GLU A CA  1 
ATOM   386  C  C   . GLU A 1 62  ? -43.952 -31.484 -4.102  1.00 67.63  ? 85   GLU A C   1 
ATOM   387  O  O   . GLU A 1 62  ? -44.677 -32.442 -4.374  1.00 64.59  ? 85   GLU A O   1 
ATOM   388  C  CB  . GLU A 1 62  ? -44.554 -29.609 -2.551  1.00 83.28  ? 85   GLU A CB  1 
ATOM   389  C  CG  . GLU A 1 62  ? -44.668 -29.042 -1.136  1.00 87.94  ? 85   GLU A CG  1 
ATOM   390  C  CD  . GLU A 1 62  ? -43.347 -28.558 -0.539  1.00 92.17  ? 85   GLU A CD  1 
ATOM   391  O  OE1 . GLU A 1 62  ? -42.507 -28.037 -1.298  1.00 99.03  ? 85   GLU A OE1 1 
ATOM   392  O  OE2 . GLU A 1 62  ? -43.144 -28.697 0.692   1.00 90.87  ? 85   GLU A OE2 1 
ATOM   393  N  N   . ALA A 1 63  ? -43.209 -30.858 -5.011  1.00 58.86  ? 86   ALA A N   1 
ATOM   394  C  CA  . ALA A 1 63  ? -43.145 -31.339 -6.386  1.00 57.98  ? 86   ALA A CA  1 
ATOM   395  C  C   . ALA A 1 63  ? -42.745 -32.829 -6.472  1.00 54.90  ? 86   ALA A C   1 
ATOM   396  O  O   . ALA A 1 63  ? -43.332 -33.577 -7.237  1.00 55.74  ? 86   ALA A O   1 
ATOM   397  C  CB  . ALA A 1 63  ? -42.201 -30.480 -7.226  1.00 56.71  ? 86   ALA A CB  1 
ATOM   398  N  N   . PHE A 1 64  ? -41.761 -33.254 -5.688  1.00 53.84  ? 87   PHE A N   1 
ATOM   399  C  CA  . PHE A 1 64  ? -41.256 -34.623 -5.759  1.00 53.64  ? 87   PHE A CA  1 
ATOM   400  C  C   . PHE A 1 64  ? -42.307 -35.575 -5.242  1.00 56.27  ? 87   PHE A C   1 
ATOM   401  O  O   . PHE A 1 64  ? -42.592 -36.611 -5.842  1.00 56.73  ? 87   PHE A O   1 
ATOM   402  C  CB  . PHE A 1 64  ? -40.001 -34.764 -4.927  1.00 51.35  ? 87   PHE A CB  1 
ATOM   403  C  CG  . PHE A 1 64  ? -39.281 -36.060 -5.120  1.00 52.30  ? 87   PHE A CG  1 
ATOM   404  C  CD1 . PHE A 1 64  ? -38.507 -36.286 -6.255  1.00 53.19  ? 87   PHE A CD1 1 
ATOM   405  C  CD2 . PHE A 1 64  ? -39.339 -37.046 -4.156  1.00 54.37  ? 87   PHE A CD2 1 
ATOM   406  C  CE1 . PHE A 1 64  ? -37.808 -37.476 -6.423  1.00 52.91  ? 87   PHE A CE1 1 
ATOM   407  C  CE2 . PHE A 1 64  ? -38.639 -38.234 -4.316  1.00 54.71  ? 87   PHE A CE2 1 
ATOM   408  C  CZ  . PHE A 1 64  ? -37.882 -38.454 -5.452  1.00 53.65  ? 87   PHE A CZ  1 
ATOM   409  N  N   . SER A 1 65  ? -42.875 -35.196 -4.108  1.00 59.43  ? 88   SER A N   1 
ATOM   410  C  CA  . SER A 1 65  ? -43.936 -35.945 -3.483  1.00 59.01  ? 88   SER A CA  1 
ATOM   411  C  C   . SER A 1 65  ? -45.058 -36.164 -4.484  1.00 56.96  ? 88   SER A C   1 
ATOM   412  O  O   . SER A 1 65  ? -45.487 -37.296 -4.697  1.00 50.14  ? 88   SER A O   1 
ATOM   413  C  CB  . SER A 1 65  ? -44.438 -35.186 -2.262  1.00 58.15  ? 88   SER A CB  1 
ATOM   414  O  OG  . SER A 1 65  ? -45.308 -36.002 -1.537  1.00 59.54  ? 88   SER A OG  1 
ATOM   415  N  N   . ARG A 1 66  ? -45.490 -35.065 -5.105  1.00 61.26  ? 89   ARG A N   1 
ATOM   416  C  CA  . ARG A 1 66  ? -46.570 -35.065 -6.104  1.00 62.07  ? 89   ARG A CA  1 
ATOM   417  C  C   . ARG A 1 66  ? -46.249 -35.782 -7.393  1.00 59.06  ? 89   ARG A C   1 
ATOM   418  O  O   . ARG A 1 66  ? -47.092 -36.465 -7.919  1.00 57.30  ? 89   ARG A O   1 
ATOM   419  C  CB  . ARG A 1 66  ? -46.973 -33.639 -6.495  1.00 65.02  ? 89   ARG A CB  1 
ATOM   420  C  CG  . ARG A 1 66  ? -48.137 -33.602 -7.510  1.00 75.51  ? 89   ARG A CG  1 
ATOM   421  C  CD  . ARG A 1 66  ? -48.643 -32.189 -7.882  1.00 83.14  ? 89   ARG A CD  1 
ATOM   422  N  NE  . ARG A 1 66  ? -48.508 -31.339 -6.698  1.00 91.98  ? 89   ARG A NE  1 
ATOM   423  C  CZ  . ARG A 1 66  ? -47.521 -30.465 -6.485  1.00 97.26  ? 89   ARG A CZ  1 
ATOM   424  N  NH1 . ARG A 1 66  ? -46.584 -30.259 -7.411  1.00 98.37  ? 89   ARG A NH1 1 
ATOM   425  N  NH2 . ARG A 1 66  ? -47.485 -29.768 -5.339  1.00 92.55  ? 89   ARG A NH2 1 
ATOM   426  N  N   . ASP A 1 67  ? -45.055 -35.590 -7.934  1.00 58.15  ? 90   ASP A N   1 
ATOM   427  C  CA  . ASP A 1 67  ? -44.792 -36.029 -9.282  1.00 57.38  ? 90   ASP A CA  1 
ATOM   428  C  C   . ASP A 1 67  ? -43.315 -36.341 -9.433  1.00 58.95  ? 90   ASP A C   1 
ATOM   429  O  O   . ASP A 1 67  ? -42.566 -35.654 -10.134 1.00 57.56  ? 90   ASP A O   1 
ATOM   430  C  CB  . ASP A 1 67  ? -45.247 -34.962 -10.274 1.00 57.68  ? 90   ASP A CB  1 
ATOM   431  C  CG  . ASP A 1 67  ? -45.201 -35.443 -11.705 1.00 58.05  ? 90   ASP A CG  1 
ATOM   432  O  OD1 . ASP A 1 67  ? -44.788 -36.600 -11.928 1.00 56.56  ? 90   ASP A OD1 1 
ATOM   433  O  OD2 . ASP A 1 67  ? -45.588 -34.667 -12.603 1.00 60.01  ? 90   ASP A OD2 1 
ATOM   434  N  N   . PRO A 1 68  ? -42.892 -37.418 -8.796  1.00 58.28  ? 91   PRO A N   1 
ATOM   435  C  CA  . PRO A 1 68  ? -41.488 -37.797 -8.812  1.00 58.61  ? 91   PRO A CA  1 
ATOM   436  C  C   . PRO A 1 68  ? -40.897 -38.128 -10.193 1.00 54.54  ? 91   PRO A C   1 
ATOM   437  O  O   . PRO A 1 68  ? -39.707 -37.916 -10.393 1.00 56.11  ? 91   PRO A O   1 
ATOM   438  C  CB  . PRO A 1 68  ? -41.423 -39.007 -7.866  1.00 58.35  ? 91   PRO A CB  1 
ATOM   439  C  CG  . PRO A 1 68  ? -42.801 -39.492 -7.753  1.00 59.61  ? 91   PRO A CG  1 
ATOM   440  C  CD  . PRO A 1 68  ? -43.731 -38.360 -8.055  1.00 59.76  ? 91   PRO A CD  1 
ATOM   441  N  N   . SER A 1 69  ? -41.692 -38.647 -11.120 1.00 51.25  ? 92   SER A N   1 
ATOM   442  C  CA  . SER A 1 69  ? -41.189 -38.874 -12.462 1.00 50.12  ? 92   SER A CA  1 
ATOM   443  C  C   . SER A 1 69  ? -40.743 -37.541 -13.041 1.00 50.26  ? 92   SER A C   1 
ATOM   444  O  O   . SER A 1 69  ? -39.636 -37.400 -13.556 1.00 47.47  ? 92   SER A O   1 
ATOM   445  C  CB  . SER A 1 69  ? -42.257 -39.497 -13.355 1.00 48.43  ? 92   SER A CB  1 
ATOM   446  O  OG  . SER A 1 69  ? -41.909 -39.397 -14.722 1.00 48.99  ? 92   SER A OG  1 
ATOM   447  N  N   . LEU A 1 70  ? -41.610 -36.553 -12.953 1.00 52.04  ? 93   LEU A N   1 
ATOM   448  C  CA  . LEU A 1 70  ? -41.321 -35.304 -13.593 1.00 56.17  ? 93   LEU A CA  1 
ATOM   449  C  C   . LEU A 1 70  ? -40.089 -34.649 -12.942 1.00 56.75  ? 93   LEU A C   1 
ATOM   450  O  O   . LEU A 1 70  ? -39.226 -34.095 -13.620 1.00 59.31  ? 93   LEU A O   1 
ATOM   451  C  CB  . LEU A 1 70  ? -42.543 -34.369 -13.563 1.00 57.07  ? 93   LEU A CB  1 
ATOM   452  C  CG  . LEU A 1 70  ? -42.335 -33.020 -14.271 1.00 60.16  ? 93   LEU A CG  1 
ATOM   453  C  CD1 . LEU A 1 70  ? -41.892 -33.201 -15.723 1.00 63.51  ? 93   LEU A CD1 1 
ATOM   454  C  CD2 . LEU A 1 70  ? -43.578 -32.162 -14.218 1.00 59.64  ? 93   LEU A CD2 1 
ATOM   455  N  N   . VAL A 1 71  ? -39.999 -34.692 -11.627 1.00 56.60  ? 94   VAL A N   1 
ATOM   456  C  CA  . VAL A 1 71  ? -38.847 -34.076 -10.977 1.00 54.04  ? 94   VAL A CA  1 
ATOM   457  C  C   . VAL A 1 71  ? -37.571 -34.838 -11.437 1.00 50.74  ? 94   VAL A C   1 
ATOM   458  O  O   . VAL A 1 71  ? -36.623 -34.237 -11.905 1.00 48.32  ? 94   VAL A O   1 
ATOM   459  C  CB  . VAL A 1 71  ? -39.029 -34.006 -9.436  1.00 52.75  ? 94   VAL A CB  1 
ATOM   460  C  CG1 . VAL A 1 71  ? -37.813 -33.403 -8.774  1.00 53.42  ? 94   VAL A CG1 1 
ATOM   461  C  CG2 . VAL A 1 71  ? -40.223 -33.150 -9.066  1.00 50.47  ? 94   VAL A CG2 1 
ATOM   462  N  N   . TRP A 1 72  ? -37.564 -36.159 -11.345 1.00 48.91  ? 95   TRP A N   1 
ATOM   463  C  CA  . TRP A 1 72  ? -36.440 -36.922 -11.864 1.00 48.93  ? 95   TRP A CA  1 
ATOM   464  C  C   . TRP A 1 72  ? -36.167 -36.658 -13.352 1.00 49.06  ? 95   TRP A C   1 
ATOM   465  O  O   . TRP A 1 72  ? -35.020 -36.582 -13.759 1.00 45.91  ? 95   TRP A O   1 
ATOM   466  C  CB  . TRP A 1 72  ? -36.658 -38.419 -11.665 1.00 51.33  ? 95   TRP A CB  1 
ATOM   467  C  CG  . TRP A 1 72  ? -36.101 -38.926 -10.412 1.00 52.21  ? 95   TRP A CG  1 
ATOM   468  C  CD1 . TRP A 1 72  ? -36.786 -39.481 -9.389  1.00 55.35  ? 95   TRP A CD1 1 
ATOM   469  C  CD2 . TRP A 1 72  ? -34.731 -38.946 -10.039 1.00 51.77  ? 95   TRP A CD2 1 
ATOM   470  N  NE1 . TRP A 1 72  ? -35.924 -39.841 -8.384  1.00 56.53  ? 95   TRP A NE1 1 
ATOM   471  C  CE2 . TRP A 1 72  ? -34.652 -39.520 -8.768  1.00 55.77  ? 95   TRP A CE2 1 
ATOM   472  C  CE3 . TRP A 1 72  ? -33.564 -38.538 -10.658 1.00 54.58  ? 95   TRP A CE3 1 
ATOM   473  C  CZ2 . TRP A 1 72  ? -33.446 -39.679 -8.093  1.00 58.01  ? 95   TRP A CZ2 1 
ATOM   474  C  CZ3 . TRP A 1 72  ? -32.365 -38.713 -10.005 1.00 55.73  ? 95   TRP A CZ3 1 
ATOM   475  C  CH2 . TRP A 1 72  ? -32.314 -39.275 -8.730  1.00 56.67  ? 95   TRP A CH2 1 
ATOM   476  N  N   . GLU A 1 73  ? -37.199 -36.558 -14.182 1.00 50.64  ? 96   GLU A N   1 
ATOM   477  C  CA  . GLU A 1 73  ? -36.952 -36.218 -15.568 1.00 51.84  ? 96   GLU A CA  1 
ATOM   478  C  C   . GLU A 1 73  ? -36.019 -34.991 -15.584 1.00 51.28  ? 96   GLU A C   1 
ATOM   479  O  O   . GLU A 1 73  ? -34.978 -34.983 -16.240 1.00 49.87  ? 96   GLU A O   1 
ATOM   480  C  CB  . GLU A 1 73  ? -38.254 -35.926 -16.322 1.00 53.22  ? 96   GLU A CB  1 
ATOM   481  C  CG  . GLU A 1 73  ? -38.941 -37.136 -16.952 1.00 55.84  ? 96   GLU A CG  1 
ATOM   482  C  CD  . GLU A 1 73  ? -39.882 -36.758 -18.104 1.00 58.39  ? 96   GLU A CD  1 
ATOM   483  O  OE1 . GLU A 1 73  ? -41.054 -36.371 -17.830 1.00 60.53  ? 96   GLU A OE1 1 
ATOM   484  O  OE2 . GLU A 1 73  ? -39.447 -36.823 -19.284 1.00 51.42  ? 96   GLU A OE2 1 
ATOM   485  N  N   . PHE A 1 74  ? -36.423 -33.964 -14.843 1.00 53.13  ? 97   PHE A N   1 
ATOM   486  C  CA  . PHE A 1 74  ? -35.688 -32.684 -14.688 1.00 52.18  ? 97   PHE A CA  1 
ATOM   487  C  C   . PHE A 1 74  ? -34.270 -32.882 -14.252 1.00 49.78  ? 97   PHE A C   1 
ATOM   488  O  O   . PHE A 1 74  ? -33.360 -32.369 -14.880 1.00 50.64  ? 97   PHE A O   1 
ATOM   489  C  CB  . PHE A 1 74  ? -36.395 -31.849 -13.639 1.00 51.55  ? 97   PHE A CB  1 
ATOM   490  C  CG  . PHE A 1 74  ? -35.756 -30.557 -13.335 1.00 51.19  ? 97   PHE A CG  1 
ATOM   491  C  CD1 . PHE A 1 74  ? -35.384 -29.699 -14.338 1.00 54.81  ? 97   PHE A CD1 1 
ATOM   492  C  CD2 . PHE A 1 74  ? -35.642 -30.132 -12.012 1.00 51.84  ? 97   PHE A CD2 1 
ATOM   493  C  CE1 . PHE A 1 74  ? -34.852 -28.442 -14.026 1.00 57.22  ? 97   PHE A CE1 1 
ATOM   494  C  CE2 . PHE A 1 74  ? -35.131 -28.887 -11.692 1.00 52.15  ? 97   PHE A CE2 1 
ATOM   495  C  CZ  . PHE A 1 74  ? -34.744 -28.032 -12.706 1.00 55.11  ? 97   PHE A CZ  1 
ATOM   496  N  N   . TYR A 1 75  ? -34.080 -33.659 -13.198 1.00 46.77  ? 98   TYR A N   1 
ATOM   497  C  CA  . TYR A 1 75  ? -32.736 -33.913 -12.709 1.00 46.66  ? 98   TYR A CA  1 
ATOM   498  C  C   . TYR A 1 75  ? -31.913 -34.873 -13.615 1.00 46.61  ? 98   TYR A C   1 
ATOM   499  O  O   . TYR A 1 75  ? -30.698 -34.753 -13.686 1.00 45.52  ? 98   TYR A O   1 
ATOM   500  C  CB  . TYR A 1 75  ? -32.774 -34.333 -11.232 1.00 48.20  ? 98   TYR A CB  1 
ATOM   501  C  CG  . TYR A 1 75  ? -32.909 -33.140 -10.283 1.00 50.43  ? 98   TYR A CG  1 
ATOM   502  C  CD1 . TYR A 1 75  ? -31.851 -32.271 -10.052 1.00 51.98  ? 98   TYR A CD1 1 
ATOM   503  C  CD2 . TYR A 1 75  ? -34.107 -32.856 -9.650  1.00 53.37  ? 98   TYR A CD2 1 
ATOM   504  C  CE1 . TYR A 1 75  ? -31.989 -31.152 -9.217  1.00 54.28  ? 98   TYR A CE1 1 
ATOM   505  C  CE2 . TYR A 1 75  ? -34.249 -31.752 -8.805  1.00 53.86  ? 98   TYR A CE2 1 
ATOM   506  C  CZ  . TYR A 1 75  ? -33.202 -30.891 -8.595  1.00 53.76  ? 98   TYR A CZ  1 
ATOM   507  O  OH  . TYR A 1 75  ? -33.403 -29.817 -7.741  1.00 52.12  ? 98   TYR A OH  1 
ATOM   508  N  N   . HIS A 1 76  ? -32.560 -35.785 -14.341 1.00 47.65  ? 99   HIS A N   1 
ATOM   509  C  CA  . HIS A 1 76  ? -31.845 -36.597 -15.340 1.00 48.45  ? 99   HIS A CA  1 
ATOM   510  C  C   . HIS A 1 76  ? -31.223 -35.666 -16.368 1.00 46.10  ? 99   HIS A C   1 
ATOM   511  O  O   . HIS A 1 76  ? -30.060 -35.750 -16.666 1.00 43.33  ? 99   HIS A O   1 
ATOM   512  C  CB  . HIS A 1 76  ? -32.783 -37.590 -16.026 1.00 50.91  ? 99   HIS A CB  1 
ATOM   513  C  CG  . HIS A 1 76  ? -32.152 -38.373 -17.145 1.00 53.26  ? 99   HIS A CG  1 
ATOM   514  N  ND1 . HIS A 1 76  ? -30.985 -39.093 -16.994 1.00 54.69  ? 99   HIS A ND1 1 
ATOM   515  C  CD2 . HIS A 1 76  ? -32.575 -38.607 -18.415 1.00 54.85  ? 99   HIS A CD2 1 
ATOM   516  C  CE1 . HIS A 1 76  ? -30.700 -39.708 -18.131 1.00 57.45  ? 99   HIS A CE1 1 
ATOM   517  N  NE2 . HIS A 1 76  ? -31.654 -39.437 -19.007 1.00 57.21  ? 99   HIS A NE2 1 
ATOM   518  N  N   . TYR A 1 77  ? -32.008 -34.733 -16.858 1.00 46.96  ? 100  TYR A N   1 
ATOM   519  C  CA  . TYR A 1 77  ? -31.520 -33.799 -17.815 1.00 49.25  ? 100  TYR A CA  1 
ATOM   520  C  C   . TYR A 1 77  ? -30.270 -33.109 -17.308 1.00 51.53  ? 100  TYR A C   1 
ATOM   521  O  O   . TYR A 1 77  ? -29.233 -33.072 -17.979 1.00 55.67  ? 100  TYR A O   1 
ATOM   522  C  CB  . TYR A 1 77  ? -32.591 -32.774 -18.098 1.00 52.40  ? 100  TYR A CB  1 
ATOM   523  C  CG  . TYR A 1 77  ? -32.161 -31.758 -19.105 1.00 60.58  ? 100  TYR A CG  1 
ATOM   524  C  CD1 . TYR A 1 77  ? -31.954 -32.100 -20.444 1.00 60.86  ? 100  TYR A CD1 1 
ATOM   525  C  CD2 . TYR A 1 77  ? -31.950 -30.439 -18.726 1.00 71.16  ? 100  TYR A CD2 1 
ATOM   526  C  CE1 . TYR A 1 77  ? -31.549 -31.153 -21.374 1.00 63.72  ? 100  TYR A CE1 1 
ATOM   527  C  CE2 . TYR A 1 77  ? -31.548 -29.485 -19.651 1.00 74.00  ? 100  TYR A CE2 1 
ATOM   528  C  CZ  . TYR A 1 77  ? -31.348 -29.854 -20.966 1.00 67.87  ? 100  TYR A CZ  1 
ATOM   529  O  OH  . TYR A 1 77  ? -30.953 -28.897 -21.836 1.00 72.41  ? 100  TYR A OH  1 
ATOM   530  N  N   . ARG A 1 78  ? -30.372 -32.560 -16.114 1.00 52.50  ? 101  ARG A N   1 
ATOM   531  C  CA  . ARG A 1 78  ? -29.293 -31.774 -15.546 1.00 52.26  ? 101  ARG A CA  1 
ATOM   532  C  C   . ARG A 1 78  ? -28.045 -32.621 -15.337 1.00 49.31  ? 101  ARG A C   1 
ATOM   533  O  O   . ARG A 1 78  ? -26.943 -32.183 -15.641 1.00 46.66  ? 101  ARG A O   1 
ATOM   534  C  CB  . ARG A 1 78  ? -29.765 -31.144 -14.246 1.00 53.39  ? 101  ARG A CB  1 
ATOM   535  C  CG  . ARG A 1 78  ? -30.858 -30.122 -14.495 1.00 54.40  ? 101  ARG A CG  1 
ATOM   536  C  CD  . ARG A 1 78  ? -31.356 -29.506 -13.217 1.00 54.59  ? 101  ARG A CD  1 
ATOM   537  N  NE  . ARG A 1 78  ? -30.376 -28.606 -12.647 1.00 55.82  ? 101  ARG A NE  1 
ATOM   538  C  CZ  . ARG A 1 78  ? -30.475 -28.077 -11.433 1.00 59.64  ? 101  ARG A CZ  1 
ATOM   539  N  NH1 . ARG A 1 78  ? -31.508 -28.357 -10.627 1.00 60.34  ? 101  ARG A NH1 1 
ATOM   540  N  NH2 . ARG A 1 78  ? -29.524 -27.269 -11.005 1.00 62.89  ? 101  ARG A NH2 1 
ATOM   541  N  N   . ARG A 1 79  ? -28.243 -33.846 -14.875 1.00 46.98  ? 102  ARG A N   1 
ATOM   542  C  CA  . ARG A 1 79  ? -27.167 -34.811 -14.854 1.00 49.63  ? 102  ARG A CA  1 
ATOM   543  C  C   . ARG A 1 79  ? -26.485 -34.982 -16.207 1.00 53.54  ? 102  ARG A C   1 
ATOM   544  O  O   . ARG A 1 79  ? -25.251 -34.920 -16.293 1.00 51.73  ? 102  ARG A O   1 
ATOM   545  C  CB  . ARG A 1 79  ? -27.651 -36.166 -14.380 1.00 47.18  ? 102  ARG A CB  1 
ATOM   546  C  CG  . ARG A 1 79  ? -27.774 -36.242 -12.880 1.00 47.42  ? 102  ARG A CG  1 
ATOM   547  C  CD  . ARG A 1 79  ? -28.720 -37.357 -12.455 1.00 47.73  ? 102  ARG A CD  1 
ATOM   548  N  NE  . ARG A 1 79  ? -28.129 -38.664 -12.686 1.00 48.32  ? 102  ARG A NE  1 
ATOM   549  C  CZ  . ARG A 1 79  ? -27.131 -39.169 -11.972 1.00 48.69  ? 102  ARG A CZ  1 
ATOM   550  N  NH1 . ARG A 1 79  ? -26.612 -38.474 -10.979 1.00 48.47  ? 102  ARG A NH1 1 
ATOM   551  N  NH2 . ARG A 1 79  ? -26.628 -40.372 -12.264 1.00 50.11  ? 102  ARG A NH2 1 
ATOM   552  N  N   . GLU A 1 80  ? -27.274 -35.196 -17.263 1.00 56.85  ? 103  GLU A N   1 
ATOM   553  C  CA  . GLU A 1 80  ? -26.688 -35.487 -18.580 1.00 55.59  ? 103  GLU A CA  1 
ATOM   554  C  C   . GLU A 1 80  ? -26.087 -34.238 -19.211 1.00 54.60  ? 103  GLU A C   1 
ATOM   555  O  O   . GLU A 1 80  ? -24.982 -34.333 -19.792 1.00 57.30  ? 103  GLU A O   1 
ATOM   556  C  CB  . GLU A 1 80  ? -27.655 -36.179 -19.540 1.00 53.87  ? 103  GLU A CB  1 
ATOM   557  C  CG  . GLU A 1 80  ? -28.300 -37.465 -19.007 1.00 56.76  ? 103  GLU A CG  1 
ATOM   558  C  CD  . GLU A 1 80  ? -27.389 -38.679 -18.946 1.00 57.05  ? 103  GLU A CD  1 
ATOM   559  O  OE1 . GLU A 1 80  ? -27.230 -39.322 -19.996 1.00 60.63  ? 103  GLU A OE1 1 
ATOM   560  O  OE2 . GLU A 1 80  ? -26.877 -39.023 -17.855 1.00 56.12  ? 103  GLU A OE2 1 
ATOM   561  N  N   . VAL A 1 81  ? -26.706 -33.062 -19.054 1.00 48.93  ? 104  VAL A N   1 
ATOM   562  C  CA  . VAL A 1 81  ? -26.079 -31.913 -19.708 1.00 50.56  ? 104  VAL A CA  1 
ATOM   563  C  C   . VAL A 1 81  ? -24.661 -31.722 -19.226 1.00 50.13  ? 104  VAL A C   1 
ATOM   564  O  O   . VAL A 1 81  ? -23.926 -31.006 -19.880 1.00 50.91  ? 104  VAL A O   1 
ATOM   565  C  CB  . VAL A 1 81  ? -26.781 -30.534 -19.591 1.00 49.82  ? 104  VAL A CB  1 
ATOM   566  C  CG1 . VAL A 1 81  ? -28.279 -30.645 -19.813 1.00 49.97  ? 104  VAL A CG1 1 
ATOM   567  C  CG2 . VAL A 1 81  ? -26.449 -29.854 -18.280 1.00 51.95  ? 104  VAL A CG2 1 
ATOM   568  N  N   . MET A 1 82  ? -24.278 -32.334 -18.100 1.00 49.96  ? 105  MET A N   1 
ATOM   569  C  CA  . MET A 1 82  ? -22.937 -32.119 -17.533 1.00 51.04  ? 105  MET A CA  1 
ATOM   570  C  C   . MET A 1 82  ? -21.863 -32.821 -18.321 1.00 50.88  ? 105  MET A C   1 
ATOM   571  O  O   . MET A 1 82  ? -20.708 -32.377 -18.351 1.00 49.43  ? 105  MET A O   1 
ATOM   572  C  CB  . MET A 1 82  ? -22.850 -32.559 -16.080 1.00 52.09  ? 105  MET A CB  1 
ATOM   573  C  CG  . MET A 1 82  ? -23.668 -31.722 -15.119 1.00 53.65  ? 105  MET A CG  1 
ATOM   574  S  SD  . MET A 1 82  ? -23.348 -29.963 -15.291 1.00 53.72  ? 105  MET A SD  1 
ATOM   575  C  CE  . MET A 1 82  ? -21.586 -30.030 -14.932 1.00 56.54  ? 105  MET A CE  1 
ATOM   576  N  N   . ARG A 1 83  ? -22.251 -33.895 -18.997 1.00 54.17  ? 106  ARG A N   1 
ATOM   577  C  CA  . ARG A 1 83  ? -21.304 -34.679 -19.777 1.00 56.49  ? 106  ARG A CA  1 
ATOM   578  C  C   . ARG A 1 83  ? -20.579 -33.799 -20.806 1.00 53.52  ? 106  ARG A C   1 
ATOM   579  O  O   . ARG A 1 83  ? -19.450 -34.066 -21.152 1.00 49.36  ? 106  ARG A O   1 
ATOM   580  C  CB  . ARG A 1 83  ? -22.015 -35.871 -20.423 1.00 61.46  ? 106  ARG A CB  1 
ATOM   581  C  CG  . ARG A 1 83  ? -22.541 -36.838 -19.353 1.00 66.59  ? 106  ARG A CG  1 
ATOM   582  C  CD  . ARG A 1 83  ? -22.230 -38.336 -19.558 1.00 74.11  ? 106  ARG A CD  1 
ATOM   583  N  NE  . ARG A 1 83  ? -22.407 -38.875 -20.905 1.00 77.66  ? 106  ARG A NE  1 
ATOM   584  C  CZ  . ARG A 1 83  ? -23.560 -38.902 -21.583 1.00 77.97  ? 106  ARG A CZ  1 
ATOM   585  N  NH1 . ARG A 1 83  ? -24.677 -38.374 -21.075 1.00 77.95  ? 106  ARG A NH1 1 
ATOM   586  N  NH2 . ARG A 1 83  ? -23.587 -39.445 -22.795 1.00 75.04  ? 106  ARG A NH2 1 
ATOM   587  N  N   . SER A 1 84  ? -21.226 -32.727 -21.244 1.00 53.60  ? 107  SER A N   1 
ATOM   588  C  CA  . SER A 1 84  ? -20.641 -31.845 -22.212 1.00 54.28  ? 107  SER A CA  1 
ATOM   589  C  C   . SER A 1 84  ? -20.225 -30.489 -21.649 1.00 55.58  ? 107  SER A C   1 
ATOM   590  O  O   . SER A 1 84  ? -19.764 -29.657 -22.410 1.00 61.96  ? 107  SER A O   1 
ATOM   591  C  CB  . SER A 1 84  ? -21.657 -31.630 -23.321 1.00 55.30  ? 107  SER A CB  1 
ATOM   592  O  OG  . SER A 1 84  ? -22.755 -30.885 -22.831 1.00 58.06  ? 107  SER A OG  1 
ATOM   593  N  N   . LYS A 1 85  ? -20.430 -30.215 -20.363 1.00 51.95  ? 108  LYS A N   1 
ATOM   594  C  CA  . LYS A 1 85  ? -19.946 -28.970 -19.792 1.00 50.65  ? 108  LYS A CA  1 
ATOM   595  C  C   . LYS A 1 85  ? -18.716 -29.282 -18.999 1.00 49.41  ? 108  LYS A C   1 
ATOM   596  O  O   . LYS A 1 85  ? -18.763 -30.130 -18.118 1.00 47.94  ? 108  LYS A O   1 
ATOM   597  C  CB  . LYS A 1 85  ? -20.958 -28.322 -18.859 1.00 53.09  ? 108  LYS A CB  1 
ATOM   598  C  CG  . LYS A 1 85  ? -22.354 -28.177 -19.412 1.00 58.65  ? 108  LYS A CG  1 
ATOM   599  C  CD  . LYS A 1 85  ? -22.381 -27.450 -20.726 1.00 65.78  ? 108  LYS A CD  1 
ATOM   600  C  CE  . LYS A 1 85  ? -23.769 -27.460 -21.321 1.00 72.04  ? 108  LYS A CE  1 
ATOM   601  N  NZ  . LYS A 1 85  ? -23.785 -26.512 -22.463 1.00 78.04  ? 108  LYS A NZ  1 
ATOM   602  N  N   . MET A 1 86  ? -17.629 -28.561 -19.277 1.00 49.88  ? 109  MET A N   1 
ATOM   603  C  CA  . MET A 1 86  ? -16.370 -28.751 -18.586 1.00 49.51  ? 109  MET A CA  1 
ATOM   604  C  C   . MET A 1 86  ? -16.091 -27.574 -17.661 1.00 53.42  ? 109  MET A C   1 
ATOM   605  O  O   . MET A 1 86  ? -16.609 -26.467 -17.873 1.00 57.42  ? 109  MET A O   1 
ATOM   606  C  CB  . MET A 1 86  ? -15.232 -28.843 -19.575 1.00 50.04  ? 109  MET A CB  1 
ATOM   607  C  CG  . MET A 1 86  ? -15.487 -29.745 -20.751 1.00 52.44  ? 109  MET A CG  1 
ATOM   608  S  SD  . MET A 1 86  ? -16.011 -31.400 -20.275 1.00 60.94  ? 109  MET A SD  1 
ATOM   609  C  CE  . MET A 1 86  ? -14.512 -32.111 -19.610 1.00 57.78  ? 109  MET A CE  1 
ATOM   610  N  N   . PRO A 1 87  ? -15.257 -27.810 -16.636 1.00 53.02  ? 110  PRO A N   1 
ATOM   611  C  CA  . PRO A 1 87  ? -14.743 -26.775 -15.788 1.00 54.21  ? 110  PRO A CA  1 
ATOM   612  C  C   . PRO A 1 87  ? -14.104 -25.703 -16.621 1.00 56.81  ? 110  PRO A C   1 
ATOM   613  O  O   . PRO A 1 87  ? -13.420 -25.991 -17.597 1.00 58.31  ? 110  PRO A O   1 
ATOM   614  C  CB  . PRO A 1 87  ? -13.647 -27.470 -14.976 1.00 55.97  ? 110  PRO A CB  1 
ATOM   615  C  CG  . PRO A 1 87  ? -13.933 -28.913 -15.036 1.00 54.24  ? 110  PRO A CG  1 
ATOM   616  C  CD  . PRO A 1 87  ? -14.769 -29.143 -16.250 1.00 55.12  ? 110  PRO A CD  1 
ATOM   617  N  N   . ASN A 1 88  ? -14.334 -24.464 -16.234 1.00 58.19  ? 111  ASN A N   1 
ATOM   618  C  CA  . ASN A 1 88  ? -13.675 -23.343 -16.848 1.00 58.01  ? 111  ASN A CA  1 
ATOM   619  C  C   . ASN A 1 88  ? -12.379 -23.010 -16.112 1.00 55.15  ? 111  ASN A C   1 
ATOM   620  O  O   . ASN A 1 88  ? -11.980 -23.707 -15.182 1.00 51.51  ? 111  ASN A O   1 
ATOM   621  C  CB  . ASN A 1 88  ? -14.654 -22.163 -16.895 1.00 62.12  ? 111  ASN A CB  1 
ATOM   622  C  CG  . ASN A 1 88  ? -15.132 -21.745 -15.525 1.00 59.27  ? 111  ASN A CG  1 
ATOM   623  O  OD1 . ASN A 1 88  ? -14.317 -21.393 -14.663 1.00 61.84  ? 111  ASN A OD1 1 
ATOM   624  N  ND2 . ASN A 1 88  ? -16.451 -21.769 -15.318 1.00 54.69  ? 111  ASN A ND2 1 
ATOM   625  N  N   . PRO A 1 89  ? -11.695 -21.950 -16.550 1.00 58.62  ? 112  PRO A N   1 
ATOM   626  C  CA  . PRO A 1 89  ? -10.416 -21.590 -15.961 1.00 57.59  ? 112  PRO A CA  1 
ATOM   627  C  C   . PRO A 1 89  ? -10.450 -21.228 -14.505 1.00 54.07  ? 112  PRO A C   1 
ATOM   628  O  O   . PRO A 1 89  ? -9.446  -21.401 -13.845 1.00 51.00  ? 112  PRO A O   1 
ATOM   629  C  CB  . PRO A 1 89  ? -10.034 -20.363 -16.758 1.00 56.27  ? 112  PRO A CB  1 
ATOM   630  C  CG  . PRO A 1 89  ? -10.526 -20.707 -18.097 1.00 54.88  ? 112  PRO A CG  1 
ATOM   631  C  CD  . PRO A 1 89  ? -11.890 -21.229 -17.819 1.00 56.70  ? 112  PRO A CD  1 
ATOM   632  N  N   . ALA A 1 90  ? -11.577 -20.711 -14.025 1.00 52.93  ? 113  ALA A N   1 
ATOM   633  C  CA  . ALA A 1 90  ? -11.691 -20.346 -12.616 1.00 53.13  ? 113  ALA A CA  1 
ATOM   634  C  C   . ALA A 1 90  ? -11.643 -21.597 -11.773 1.00 53.55  ? 113  ALA A C   1 
ATOM   635  O  O   . ALA A 1 90  ? -10.914 -21.668 -10.774 1.00 51.71  ? 113  ALA A O   1 
ATOM   636  C  CB  . ALA A 1 90  ? -12.973 -19.569 -12.352 1.00 52.70  ? 113  ALA A CB  1 
ATOM   637  N  N   . HIS A 1 91  ? -12.416 -22.595 -12.192 1.00 53.33  ? 114  HIS A N   1 
ATOM   638  C  CA  . HIS A 1 91  ? -12.422 -23.882 -11.506 1.00 54.34  ? 114  HIS A CA  1 
ATOM   639  C  C   . HIS A 1 91  ? -11.029 -24.404 -11.296 1.00 52.59  ? 114  HIS A C   1 
ATOM   640  O  O   . HIS A 1 91  ? -10.700 -24.917 -10.212 1.00 55.00  ? 114  HIS A O   1 
ATOM   641  C  CB  . HIS A 1 91  ? -13.235 -24.899 -12.275 1.00 54.71  ? 114  HIS A CB  1 
ATOM   642  C  CG  . HIS A 1 91  ? -14.702 -24.667 -12.165 1.00 58.28  ? 114  HIS A CG  1 
ATOM   643  N  ND1 . HIS A 1 91  ? -15.467 -24.205 -13.212 1.00 58.55  ? 114  HIS A ND1 1 
ATOM   644  C  CD2 . HIS A 1 91  ? -15.542 -24.799 -11.116 1.00 62.07  ? 114  HIS A CD2 1 
ATOM   645  C  CE1 . HIS A 1 91  ? -16.718 -24.082 -12.822 1.00 61.27  ? 114  HIS A CE1 1 
ATOM   646  N  NE2 . HIS A 1 91  ? -16.791 -24.440 -11.555 1.00 66.13  ? 114  HIS A NE2 1 
ATOM   647  N  N   . LEU A 1 92  ? -10.228 -24.237 -12.337 1.00 50.52  ? 115  LEU A N   1 
ATOM   648  C  CA  . LEU A 1 92  ? -8.928  -24.860 -12.400 1.00 52.07  ? 115  LEU A CA  1 
ATOM   649  C  C   . LEU A 1 92  ? -7.988  -24.094 -11.572 1.00 53.66  ? 115  LEU A C   1 
ATOM   650  O  O   . LEU A 1 92  ? -7.323  -24.658 -10.712 1.00 55.72  ? 115  LEU A O   1 
ATOM   651  C  CB  . LEU A 1 92  ? -8.428  -24.945 -13.837 1.00 50.27  ? 115  LEU A CB  1 
ATOM   652  C  CG  . LEU A 1 92  ? -9.096  -26.178 -14.460 1.00 50.75  ? 115  LEU A CG  1 
ATOM   653  C  CD1 . LEU A 1 92  ? -9.498  -25.961 -15.900 1.00 52.81  ? 115  LEU A CD1 1 
ATOM   654  C  CD2 . LEU A 1 92  ? -8.197  -27.364 -14.318 1.00 48.81  ? 115  LEU A CD2 1 
ATOM   655  N  N   . ALA A 1 93  ? -7.957  -22.793 -11.816 1.00 55.56  ? 116  ALA A N   1 
ATOM   656  C  CA  . ALA A 1 93  ? -7.047  -21.908 -11.113 1.00 54.39  ? 116  ALA A CA  1 
ATOM   657  C  C   . ALA A 1 93  ? -7.118  -22.182 -9.609  1.00 53.96  ? 116  ALA A C   1 
ATOM   658  O  O   . ALA A 1 93  ? -6.091  -22.257 -8.928  1.00 51.50  ? 116  ALA A O   1 
ATOM   659  C  CB  . ALA A 1 93  ? -7.400  -20.462 -11.412 1.00 55.83  ? 116  ALA A CB  1 
ATOM   660  N  N   . ILE A 1 94  ? -8.346  -22.348 -9.119  1.00 51.84  ? 117  ILE A N   1 
ATOM   661  C  CA  . ILE A 1 94  ? -8.576  -22.673 -7.744  1.00 49.72  ? 117  ILE A CA  1 
ATOM   662  C  C   . ILE A 1 94  ? -7.954  -24.000 -7.432  1.00 50.95  ? 117  ILE A C   1 
ATOM   663  O  O   . ILE A 1 94  ? -7.133  -24.093 -6.515  1.00 53.59  ? 117  ILE A O   1 
ATOM   664  C  CB  . ILE A 1 94  ? -10.058 -22.747 -7.449  1.00 51.09  ? 117  ILE A CB  1 
ATOM   665  C  CG1 . ILE A 1 94  ? -10.633 -21.336 -7.473  1.00 49.53  ? 117  ILE A CG1 1 
ATOM   666  C  CG2 . ILE A 1 94  ? -10.292 -23.397 -6.093  1.00 54.39  ? 117  ILE A CG2 1 
ATOM   667  C  CD1 . ILE A 1 94  ? -12.122 -21.312 -7.640  1.00 47.34  ? 117  ILE A CD1 1 
ATOM   668  N  N   . ALA A 1 95  ? -8.307  -25.023 -8.212  1.00 49.67  ? 118  ALA A N   1 
ATOM   669  C  CA  . ALA A 1 95  ? -7.809  -26.390 -7.958  1.00 48.53  ? 118  ALA A CA  1 
ATOM   670  C  C   . ALA A 1 95  ? -6.275  -26.459 -7.928  1.00 47.61  ? 118  ALA A C   1 
ATOM   671  O  O   . ALA A 1 95  ? -5.669  -27.173 -7.107  1.00 46.18  ? 118  ALA A O   1 
ATOM   672  C  CB  . ALA A 1 95  ? -8.374  -27.368 -8.976  1.00 47.95  ? 118  ALA A CB  1 
ATOM   673  N  N   . GLU A 1 96  ? -5.642  -25.716 -8.819  1.00 47.48  ? 119  GLU A N   1 
ATOM   674  C  CA  . GLU A 1 96  ? -4.200  -25.768 -8.886  1.00 48.36  ? 119  GLU A CA  1 
ATOM   675  C  C   . GLU A 1 96  ? -3.681  -25.003 -7.705  1.00 47.84  ? 119  GLU A C   1 
ATOM   676  O  O   . GLU A 1 96  ? -2.709  -25.405 -7.096  1.00 46.22  ? 119  GLU A O   1 
ATOM   677  C  CB  . GLU A 1 96  ? -3.708  -25.289 -10.250 1.00 46.87  ? 119  GLU A CB  1 
ATOM   678  C  CG  . GLU A 1 96  ? -4.349  -26.152 -11.333 1.00 48.21  ? 119  GLU A CG  1 
ATOM   679  C  CD  . GLU A 1 96  ? -3.584  -26.202 -12.629 1.00 50.99  ? 119  GLU A CD  1 
ATOM   680  O  OE1 . GLU A 1 96  ? -2.888  -25.177 -12.898 1.00 50.76  ? 119  GLU A OE1 1 
ATOM   681  O  OE2 . GLU A 1 96  ? -3.725  -27.243 -13.368 1.00 46.69  ? 119  GLU A OE2 1 
ATOM   682  N  N   . CYS A 1 97  ? -4.386  -23.941 -7.340  1.00 48.30  ? 120  CYS A N   1 
ATOM   683  C  CA  . CYS A 1 97  ? -3.975  -23.125 -6.211  1.00 49.69  ? 120  CYS A CA  1 
ATOM   684  C  C   . CYS A 1 97  ? -3.900  -23.983 -4.958  1.00 47.46  ? 120  CYS A C   1 
ATOM   685  O  O   . CYS A 1 97  ? -2.885  -24.032 -4.255  1.00 43.32  ? 120  CYS A O   1 
ATOM   686  C  CB  . CYS A 1 97  ? -4.968  -21.971 -6.001  1.00 51.90  ? 120  CYS A CB  1 
ATOM   687  S  SG  . CYS A 1 97  ? -4.480  -20.742 -4.782  1.00 53.15  ? 120  CYS A SG  1 
ATOM   688  N  N   . GLU A 1 98  ? -5.000  -24.659 -4.692  1.00 47.36  ? 121  GLU A N   1 
ATOM   689  C  CA  . GLU A 1 98  ? -5.115  -25.495 -3.529  1.00 49.46  ? 121  GLU A CA  1 
ATOM   690  C  C   . GLU A 1 98  ? -3.942  -26.445 -3.499  1.00 53.04  ? 121  GLU A C   1 
ATOM   691  O  O   . GLU A 1 98  ? -3.276  -26.597 -2.467  1.00 55.81  ? 121  GLU A O   1 
ATOM   692  C  CB  . GLU A 1 98  ? -6.424  -26.251 -3.606  1.00 49.43  ? 121  GLU A CB  1 
ATOM   693  C  CG  . GLU A 1 98  ? -6.669  -27.338 -2.586  1.00 50.73  ? 121  GLU A CG  1 
ATOM   694  C  CD  . GLU A 1 98  ? -7.970  -28.058 -2.881  1.00 52.27  ? 121  GLU A CD  1 
ATOM   695  O  OE1 . GLU A 1 98  ? -8.775  -27.585 -3.762  1.00 54.92  ? 121  GLU A OE1 1 
ATOM   696  O  OE2 . GLU A 1 98  ? -8.170  -29.108 -2.240  1.00 50.91  ? 121  GLU A OE2 1 
ATOM   697  N  N   . ALA A 1 99  ? -3.703  -27.075 -4.642  1.00 52.84  ? 122  ALA A N   1 
ATOM   698  C  CA  . ALA A 1 99  ? -2.649  -28.050 -4.762  1.00 51.56  ? 122  ALA A CA  1 
ATOM   699  C  C   . ALA A 1 99  ? -1.327  -27.397 -4.459  1.00 51.16  ? 122  ALA A C   1 
ATOM   700  O  O   . ALA A 1 99  ? -0.623  -27.804 -3.568  1.00 56.89  ? 122  ALA A O   1 
ATOM   701  C  CB  . ALA A 1 99  ? -2.645  -28.619 -6.156  1.00 51.97  ? 122  ALA A CB  1 
ATOM   702  N  N   . ARG A 1 100 ? -0.993  -26.364 -5.194  1.00 51.26  ? 123  ARG A N   1 
ATOM   703  C  CA  . ARG A 1 100 ? 0.276   -25.706 -5.023  1.00 53.05  ? 123  ARG A CA  1 
ATOM   704  C  C   . ARG A 1 100 ? 0.483   -25.291 -3.567  1.00 53.76  ? 123  ARG A C   1 
ATOM   705  O  O   . ARG A 1 100 ? 1.523   -25.561 -2.980  1.00 55.06  ? 123  ARG A O   1 
ATOM   706  C  CB  . ARG A 1 100 ? 0.302   -24.490 -5.935  1.00 56.99  ? 123  ARG A CB  1 
ATOM   707  C  CG  . ARG A 1 100 ? 1.604   -23.739 -5.980  1.00 61.36  ? 123  ARG A CG  1 
ATOM   708  C  CD  . ARG A 1 100 ? 1.678   -22.859 -7.220  1.00 65.79  ? 123  ARG A CD  1 
ATOM   709  N  NE  . ARG A 1 100 ? 0.810   -21.699 -7.082  1.00 73.87  ? 123  ARG A NE  1 
ATOM   710  C  CZ  . ARG A 1 100 ? -0.405  -21.561 -7.621  1.00 83.31  ? 123  ARG A CZ  1 
ATOM   711  N  NH1 . ARG A 1 100 ? -0.924  -22.523 -8.405  1.00 76.21  ? 123  ARG A NH1 1 
ATOM   712  N  NH2 . ARG A 1 100 ? -1.099  -20.429 -7.369  1.00 83.46  ? 123  ARG A NH2 1 
ATOM   713  N  N   . LEU A 1 101 ? -0.504  -24.633 -2.979  1.00 53.64  ? 124  LEU A N   1 
ATOM   714  C  CA  . LEU A 1 101 ? -0.347  -24.159 -1.620  1.00 55.16  ? 124  LEU A CA  1 
ATOM   715  C  C   . LEU A 1 101 ? -0.317  -25.284 -0.635  1.00 55.34  ? 124  LEU A C   1 
ATOM   716  O  O   . LEU A 1 101 ? 0.324   -25.159 0.385   1.00 57.81  ? 124  LEU A O   1 
ATOM   717  C  CB  . LEU A 1 101 ? -1.450  -23.200 -1.230  1.00 56.90  ? 124  LEU A CB  1 
ATOM   718  C  CG  . LEU A 1 101 ? -1.069  -21.751 -1.523  1.00 59.73  ? 124  LEU A CG  1 
ATOM   719  C  CD1 . LEU A 1 101 ? -0.701  -21.563 -2.986  1.00 62.86  ? 124  LEU A CD1 1 
ATOM   720  C  CD2 . LEU A 1 101 ? -2.184  -20.774 -1.151  1.00 59.37  ? 124  LEU A CD2 1 
ATOM   721  N  N   . GLY A 1 102 ? -1.023  -26.368 -0.927  1.00 54.47  ? 125  GLY A N   1 
ATOM   722  C  CA  . GLY A 1 102 ? -1.035  -27.521 -0.046  1.00 55.65  ? 125  GLY A CA  1 
ATOM   723  C  C   . GLY A 1 102 ? 0.357   -28.001 0.211   1.00 56.72  ? 125  GLY A C   1 
ATOM   724  O  O   . GLY A 1 102 ? 0.731   -28.300 1.335   1.00 58.98  ? 125  GLY A O   1 
ATOM   725  N  N   . GLN A 1 103 ? 1.122   -28.078 -0.862  1.00 60.35  ? 126  GLN A N   1 
ATOM   726  C  CA  . GLN A 1 103 ? 2.483   -28.547 -0.815  1.00 64.39  ? 126  GLN A CA  1 
ATOM   727  C  C   . GLN A 1 103 ? 3.369   -27.660 0.044   1.00 61.97  ? 126  GLN A C   1 
ATOM   728  O  O   . GLN A 1 103 ? 4.327   -28.149 0.656   1.00 57.50  ? 126  GLN A O   1 
ATOM   729  C  CB  . GLN A 1 103 ? 3.029   -28.635 -2.254  1.00 71.58  ? 126  GLN A CB  1 
ATOM   730  C  CG  . GLN A 1 103 ? 2.496   -29.862 -3.009  1.00 73.91  ? 126  GLN A CG  1 
ATOM   731  C  CD  . GLN A 1 103 ? 3.242   -31.137 -2.598  1.00 82.91  ? 126  GLN A CD  1 
ATOM   732  O  OE1 . GLN A 1 103 ? 4.451   -31.117 -2.320  1.00 96.00  ? 126  GLN A OE1 1 
ATOM   733  N  NE2 . GLN A 1 103 ? 2.522   -32.249 -2.541  1.00 84.47  ? 126  GLN A NE2 1 
ATOM   734  N  N   . GLN A 1 104 ? 3.038   -26.361 0.072   1.00 60.71  ? 127  GLN A N   1 
ATOM   735  C  CA  . GLN A 1 104 ? 3.710   -25.375 0.933   1.00 59.19  ? 127  GLN A CA  1 
ATOM   736  C  C   . GLN A 1 104 ? 3.164   -25.382 2.360   1.00 57.92  ? 127  GLN A C   1 
ATOM   737  O  O   . GLN A 1 104 ? 3.492   -24.518 3.133   1.00 51.85  ? 127  GLN A O   1 
ATOM   738  C  CB  . GLN A 1 104 ? 3.552   -23.950 0.399   1.00 55.62  ? 127  GLN A CB  1 
ATOM   739  C  CG  . GLN A 1 104 ? 3.986   -23.735 -1.021  1.00 57.37  ? 127  GLN A CG  1 
ATOM   740  C  CD  . GLN A 1 104 ? 3.510   -22.400 -1.562  1.00 59.19  ? 127  GLN A CD  1 
ATOM   741  O  OE1 . GLN A 1 104 ? 3.153   -21.510 -0.814  1.00 53.68  ? 127  GLN A OE1 1 
ATOM   742  N  NE2 . GLN A 1 104 ? 3.463   -22.278 -2.884  1.00 65.10  ? 127  GLN A NE2 1 
ATOM   743  N  N   . GLY A 1 105 ? 2.308   -26.329 2.707   1.00 62.46  ? 128  GLY A N   1 
ATOM   744  C  CA  . GLY A 1 105 ? 1.690   -26.322 4.033   1.00 63.69  ? 128  GLY A CA  1 
ATOM   745  C  C   . GLY A 1 105 ? 0.661   -25.232 4.295   1.00 59.89  ? 128  GLY A C   1 
ATOM   746  O  O   . GLY A 1 105 ? 0.256   -25.024 5.425   1.00 57.67  ? 128  GLY A O   1 
ATOM   747  N  N   . ARG A 1 106 ? 0.198   -24.566 3.252   1.00 61.07  ? 129  ARG A N   1 
ATOM   748  C  CA  . ARG A 1 106 ? -0.895  -23.642 3.388   1.00 59.72  ? 129  ARG A CA  1 
ATOM   749  C  C   . ARG A 1 106 ? -2.162  -24.333 2.962   1.00 60.54  ? 129  ARG A C   1 
ATOM   750  O  O   . ARG A 1 106 ? -2.140  -25.376 2.315   1.00 62.16  ? 129  ARG A O   1 
ATOM   751  C  CB  . ARG A 1 106 ? -0.644  -22.423 2.540   1.00 58.42  ? 129  ARG A CB  1 
ATOM   752  C  CG  . ARG A 1 106 ? 0.703   -21.820 2.831   1.00 58.75  ? 129  ARG A CG  1 
ATOM   753  C  CD  . ARG A 1 106 ? 1.225   -21.056 1.644   1.00 61.88  ? 129  ARG A CD  1 
ATOM   754  N  NE  . ARG A 1 106 ? 0.646   -19.712 1.581   1.00 62.98  ? 129  ARG A NE  1 
ATOM   755  C  CZ  . ARG A 1 106 ? 0.637   -18.949 0.487   1.00 60.28  ? 129  ARG A CZ  1 
ATOM   756  N  NH1 . ARG A 1 106 ? 1.154   -19.383 -0.658  1.00 54.40  ? 129  ARG A NH1 1 
ATOM   757  N  NH2 . ARG A 1 106 ? 0.081   -17.748 0.540   1.00 64.78  ? 129  ARG A NH2 1 
ATOM   758  N  N   . SER A 1 107 ? -3.271  -23.732 3.325   1.00 60.70  ? 130  SER A N   1 
ATOM   759  C  CA  . SER A 1 107 ? -4.535  -24.386 3.168   1.00 64.69  ? 130  SER A CA  1 
ATOM   760  C  C   . SER A 1 107 ? -5.508  -23.568 2.307   1.00 65.22  ? 130  SER A C   1 
ATOM   761  O  O   . SER A 1 107 ? -5.506  -22.326 2.335   1.00 66.54  ? 130  SER A O   1 
ATOM   762  C  CB  . SER A 1 107 ? -5.119  -24.678 4.537   1.00 64.94  ? 130  SER A CB  1 
ATOM   763  O  OG  . SER A 1 107 ? -6.432  -24.162 4.633   1.00 69.05  ? 130  SER A OG  1 
ATOM   764  N  N   . VAL A 1 108 ? -6.288  -24.301 1.499   1.00 60.88  ? 131  VAL A N   1 
ATOM   765  C  CA  . VAL A 1 108 ? -7.291  -23.739 0.611   1.00 52.13  ? 131  VAL A CA  1 
ATOM   766  C  C   . VAL A 1 108 ? -8.502  -24.641 0.614   1.00 48.85  ? 131  VAL A C   1 
ATOM   767  O  O   . VAL A 1 108 ? -8.402  -25.803 0.273   1.00 52.07  ? 131  VAL A O   1 
ATOM   768  C  CB  . VAL A 1 108 ? -6.785  -23.610 -0.839  1.00 47.34  ? 131  VAL A CB  1 
ATOM   769  C  CG1 . VAL A 1 108 ? -7.893  -23.102 -1.719  1.00 46.37  ? 131  VAL A CG1 1 
ATOM   770  C  CG2 . VAL A 1 108 ? -5.614  -22.649 -0.914  1.00 47.60  ? 131  VAL A CG2 1 
ATOM   771  N  N   . VAL A 1 109 ? -9.636  -24.082 1.007   1.00 47.98  ? 132  VAL A N   1 
ATOM   772  C  CA  . VAL A 1 109 ? -10.883 -24.814 1.129   1.00 49.77  ? 132  VAL A CA  1 
ATOM   773  C  C   . VAL A 1 109 ? -11.960 -24.099 0.305   1.00 50.33  ? 132  VAL A C   1 
ATOM   774  O  O   . VAL A 1 109 ? -12.024 -22.869 0.267   1.00 56.02  ? 132  VAL A O   1 
ATOM   775  C  CB  . VAL A 1 109 ? -11.287 -25.023 2.625   1.00 51.30  ? 132  VAL A CB  1 
ATOM   776  C  CG1 . VAL A 1 109 ? -10.704 -23.941 3.519   1.00 53.73  ? 132  VAL A CG1 1 
ATOM   777  C  CG2 . VAL A 1 109 ? -12.792 -25.056 2.822   1.00 51.67  ? 132  VAL A CG2 1 
ATOM   778  N  N   . ILE A 1 110 ? -12.788 -24.883 -0.363  1.00 47.07  ? 133  ILE A N   1 
ATOM   779  C  CA  . ILE A 1 110 ? -13.849 -24.362 -1.140  1.00 47.43  ? 133  ILE A CA  1 
ATOM   780  C  C   . ILE A 1 110 ? -15.191 -24.664 -0.473  1.00 48.99  ? 133  ILE A C   1 
ATOM   781  O  O   . ILE A 1 110 ? -15.485 -25.775 -0.039  1.00 52.93  ? 133  ILE A O   1 
ATOM   782  C  CB  . ILE A 1 110 ? -13.828 -24.958 -2.542  1.00 49.83  ? 133  ILE A CB  1 
ATOM   783  C  CG1 . ILE A 1 110 ? -12.587 -24.505 -3.291  1.00 51.68  ? 133  ILE A CG1 1 
ATOM   784  C  CG2 . ILE A 1 110 ? -15.055 -24.514 -3.316  1.00 53.73  ? 133  ILE A CG2 1 
ATOM   785  C  CD1 . ILE A 1 110 ? -11.335 -25.263 -2.904  1.00 55.90  ? 133  ILE A CD1 1 
ATOM   786  N  N   . ILE A 1 111 ? -16.031 -23.660 -0.452  1.00 48.06  ? 134  ILE A N   1 
ATOM   787  C  CA  . ILE A 1 111 ? -17.365 -23.775 0.036   1.00 48.49  ? 134  ILE A CA  1 
ATOM   788  C  C   . ILE A 1 111 ? -18.242 -23.358 -1.117  1.00 45.75  ? 134  ILE A C   1 
ATOM   789  O  O   . ILE A 1 111 ? -18.236 -22.187 -1.493  1.00 46.73  ? 134  ILE A O   1 
ATOM   790  C  CB  . ILE A 1 111 ? -17.556 -22.743 1.147   1.00 52.84  ? 134  ILE A CB  1 
ATOM   791  C  CG1 . ILE A 1 111 ? -16.597 -23.015 2.301   1.00 52.82  ? 134  ILE A CG1 1 
ATOM   792  C  CG2 . ILE A 1 111 ? -18.994 -22.719 1.647   1.00 53.30  ? 134  ILE A CG2 1 
ATOM   793  C  CD1 . ILE A 1 111 ? -16.219 -21.743 3.013   1.00 54.17  ? 134  ILE A CD1 1 
ATOM   794  N  N   . THR A 1 112 ? -19.009 -24.282 -1.667  1.00 43.00  ? 135  THR A N   1 
ATOM   795  C  CA  . THR A 1 112 ? -19.753 -23.987 -2.880  1.00 43.27  ? 135  THR A CA  1 
ATOM   796  C  C   . THR A 1 112 ? -21.226 -24.298 -2.751  1.00 44.49  ? 135  THR A C   1 
ATOM   797  O  O   . THR A 1 112 ? -21.597 -25.329 -2.155  1.00 45.64  ? 135  THR A O   1 
ATOM   798  C  CB  . THR A 1 112 ? -19.178 -24.753 -4.091  1.00 44.68  ? 135  THR A CB  1 
ATOM   799  O  OG1 . THR A 1 112 ? -19.949 -24.463 -5.258  1.00 47.03  ? 135  THR A OG1 1 
ATOM   800  C  CG2 . THR A 1 112 ? -19.190 -26.249 -3.869  1.00 44.62  ? 135  THR A CG2 1 
ATOM   801  N  N   . GLN A 1 113 ? -22.056 -23.420 -3.334  1.00 45.54  ? 136  GLN A N   1 
ATOM   802  C  CA  . GLN A 1 113 ? -23.498 -23.649 -3.450  1.00 46.96  ? 136  GLN A CA  1 
ATOM   803  C  C   . GLN A 1 113 ? -23.860 -24.392 -4.724  1.00 45.78  ? 136  GLN A C   1 
ATOM   804  O  O   . GLN A 1 113 ? -25.020 -24.694 -4.979  1.00 44.71  ? 136  GLN A O   1 
ATOM   805  C  CB  . GLN A 1 113 ? -24.299 -22.370 -3.367  1.00 52.78  ? 136  GLN A CB  1 
ATOM   806  C  CG  . GLN A 1 113 ? -24.161 -21.420 -4.543  1.00 60.39  ? 136  GLN A CG  1 
ATOM   807  C  CD  . GLN A 1 113 ? -25.503 -20.901 -5.016  1.00 63.93  ? 136  GLN A CD  1 
ATOM   808  O  OE1 . GLN A 1 113 ? -25.687 -19.681 -5.164  1.00 72.12  ? 136  GLN A OE1 1 
ATOM   809  N  NE2 . GLN A 1 113 ? -26.455 -21.818 -5.240  1.00 62.78  ? 136  GLN A NE2 1 
ATOM   810  N  N   . ASN A 1 114 ? -22.859 -24.710 -5.524  1.00 45.28  ? 137  ASN A N   1 
ATOM   811  C  CA  . ASN A 1 114 ? -23.123 -25.362 -6.748  1.00 46.38  ? 137  ASN A CA  1 
ATOM   812  C  C   . ASN A 1 114 ? -23.198 -26.862 -6.570  1.00 48.52  ? 137  ASN A C   1 
ATOM   813  O  O   . ASN A 1 114 ? -22.616 -27.432 -5.640  1.00 47.32  ? 137  ASN A O   1 
ATOM   814  C  CB  . ASN A 1 114 ? -22.100 -24.889 -7.738  1.00 48.46  ? 137  ASN A CB  1 
ATOM   815  C  CG  . ASN A 1 114 ? -22.190 -23.380 -7.932  1.00 51.59  ? 137  ASN A CG  1 
ATOM   816  O  OD1 . ASN A 1 114 ? -23.296 -22.848 -8.143  1.00 54.81  ? 137  ASN A OD1 1 
ATOM   817  N  ND2 . ASN A 1 114 ? -21.048 -22.676 -7.838  1.00 50.57  ? 137  ASN A ND2 1 
ATOM   818  N  N   . ILE A 1 115 ? -23.975 -27.498 -7.440  1.00 49.62  ? 138  ILE A N   1 
ATOM   819  C  CA  . ILE A 1 115 ? -24.200 -28.938 -7.322  1.00 50.84  ? 138  ILE A CA  1 
ATOM   820  C  C   . ILE A 1 115 ? -23.712 -29.765 -8.517  1.00 52.69  ? 138  ILE A C   1 
ATOM   821  O  O   . ILE A 1 115 ? -24.059 -30.940 -8.665  1.00 56.58  ? 138  ILE A O   1 
ATOM   822  C  CB  . ILE A 1 115 ? -25.682 -29.231 -7.040  1.00 47.25  ? 138  ILE A CB  1 
ATOM   823  C  CG1 . ILE A 1 115 ? -26.570 -28.644 -8.115  1.00 46.46  ? 138  ILE A CG1 1 
ATOM   824  C  CG2 . ILE A 1 115 ? -26.073 -28.661 -5.691  1.00 49.53  ? 138  ILE A CG2 1 
ATOM   825  C  CD1 . ILE A 1 115 ? -27.935 -29.276 -8.123  1.00 45.75  ? 138  ILE A CD1 1 
ATOM   826  N  N   . ASP A 1 116 ? -22.899 -29.150 -9.362  1.00 52.20  ? 139  ASP A N   1 
ATOM   827  C  CA  . ASP A 1 116 ? -22.500 -29.747 -10.634 1.00 49.62  ? 139  ASP A CA  1 
ATOM   828  C  C   . ASP A 1 116 ? -21.164 -30.481 -10.517 1.00 47.98  ? 139  ASP A C   1 
ATOM   829  O  O   . ASP A 1 116 ? -20.627 -30.955 -11.501 1.00 52.20  ? 139  ASP A O   1 
ATOM   830  C  CB  . ASP A 1 116 ? -22.434 -28.662 -11.699 1.00 47.74  ? 139  ASP A CB  1 
ATOM   831  C  CG  . ASP A 1 116 ? -21.676 -27.449 -11.220 1.00 47.61  ? 139  ASP A CG  1 
ATOM   832  O  OD1 . ASP A 1 116 ? -20.558 -27.585 -10.690 1.00 43.03  ? 139  ASP A OD1 1 
ATOM   833  O  OD2 . ASP A 1 116 ? -22.215 -26.350 -11.360 1.00 49.89  ? 139  ASP A OD2 1 
ATOM   834  N  N   . GLU A 1 117 ? -20.629 -30.592 -9.316  1.00 46.40  ? 140  GLU A N   1 
ATOM   835  C  CA  . GLU A 1 117 ? -19.363 -31.280 -9.119  1.00 44.39  ? 140  GLU A CA  1 
ATOM   836  C  C   . GLU A 1 117 ? -18.193 -30.758 -9.957  1.00 45.03  ? 140  GLU A C   1 
ATOM   837  O  O   . GLU A 1 117 ? -17.158 -31.415 -9.994  1.00 44.45  ? 140  GLU A O   1 
ATOM   838  C  CB  . GLU A 1 117 ? -19.530 -32.808 -9.267  1.00 42.01  ? 140  GLU A CB  1 
ATOM   839  C  CG  . GLU A 1 117 ? -19.701 -33.467 -7.899  1.00 43.57  ? 140  GLU A CG  1 
ATOM   840  C  CD  . GLU A 1 117 ? -20.055 -34.939 -7.936  1.00 44.99  ? 140  GLU A CD  1 
ATOM   841  O  OE1 . GLU A 1 117 ? -19.774 -35.580 -8.972  1.00 43.91  ? 140  GLU A OE1 1 
ATOM   842  O  OE2 . GLU A 1 117 ? -20.606 -35.447 -6.920  1.00 47.57  ? 140  GLU A OE2 1 
ATOM   843  N  N   . LEU A 1 118 ? -18.308 -29.563 -10.557 1.00 44.29  ? 141  LEU A N   1 
ATOM   844  C  CA  . LEU A 1 118 ? -17.229 -29.049 -11.413 1.00 42.83  ? 141  LEU A CA  1 
ATOM   845  C  C   . LEU A 1 118 ? -15.974 -28.795 -10.636 1.00 44.86  ? 141  LEU A C   1 
ATOM   846  O  O   . LEU A 1 118 ? -14.901 -28.940 -11.159 1.00 47.73  ? 141  LEU A O   1 
ATOM   847  C  CB  . LEU A 1 118 ? -17.624 -27.785 -12.150 1.00 41.26  ? 141  LEU A CB  1 
ATOM   848  C  CG  . LEU A 1 118 ? -18.631 -28.060 -13.257 1.00 43.15  ? 141  LEU A CG  1 
ATOM   849  C  CD1 . LEU A 1 118 ? -19.250 -26.801 -13.855 1.00 41.66  ? 141  LEU A CD1 1 
ATOM   850  C  CD2 . LEU A 1 118 ? -17.978 -28.878 -14.364 1.00 46.69  ? 141  LEU A CD2 1 
ATOM   851  N  N   . HIS A 1 119 ? -16.078 -28.425 -9.379  1.00 49.22  ? 142  HIS A N   1 
ATOM   852  C  CA  . HIS A 1 119 ? -14.867 -28.228 -8.612  1.00 52.84  ? 142  HIS A CA  1 
ATOM   853  C  C   . HIS A 1 119 ? -14.033 -29.508 -8.506  1.00 51.95  ? 142  HIS A C   1 
ATOM   854  O  O   . HIS A 1 119 ? -12.809 -29.455 -8.471  1.00 50.23  ? 142  HIS A O   1 
ATOM   855  C  CB  . HIS A 1 119 ? -15.215 -27.665 -7.236  1.00 55.35  ? 142  HIS A CB  1 
ATOM   856  C  CG  . HIS A 1 119 ? -15.517 -26.194 -7.260  1.00 54.54  ? 142  HIS A CG  1 
ATOM   857  N  ND1 . HIS A 1 119 ? -14.593 -25.251 -7.676  1.00 55.26  ? 142  HIS A ND1 1 
ATOM   858  C  CD2 . HIS A 1 119 ? -16.624 -25.504 -6.889  1.00 50.61  ? 142  HIS A CD2 1 
ATOM   859  C  CE1 . HIS A 1 119 ? -15.134 -24.046 -7.578  1.00 50.20  ? 142  HIS A CE1 1 
ATOM   860  N  NE2 . HIS A 1 119 ? -16.349 -24.170 -7.074  1.00 47.76  ? 142  HIS A NE2 1 
ATOM   861  N  N   . HIS A 1 120 ? -14.710 -30.648 -8.471  1.00 51.94  ? 143  HIS A N   1 
ATOM   862  C  CA  . HIS A 1 120 ? -14.049 -31.929 -8.223  1.00 53.52  ? 143  HIS A CA  1 
ATOM   863  C  C   . HIS A 1 120 ? -13.452 -32.339 -9.507  1.00 50.49  ? 143  HIS A C   1 
ATOM   864  O  O   . HIS A 1 120 ? -12.322 -32.778 -9.561  1.00 52.94  ? 143  HIS A O   1 
ATOM   865  C  CB  . HIS A 1 120 ? -15.014 -32.954 -7.660  1.00 55.79  ? 143  HIS A CB  1 
ATOM   866  C  CG  . HIS A 1 120 ? -15.828 -32.398 -6.527  1.00 64.71  ? 143  HIS A CG  1 
ATOM   867  N  ND1 . HIS A 1 120 ? -15.697 -32.833 -5.222  1.00 70.32  ? 143  HIS A ND1 1 
ATOM   868  C  CD2 . HIS A 1 120 ? -16.725 -31.379 -6.492  1.00 64.36  ? 143  HIS A CD2 1 
ATOM   869  C  CE1 . HIS A 1 120 ? -16.511 -32.140 -4.444  1.00 67.77  ? 143  HIS A CE1 1 
ATOM   870  N  NE2 . HIS A 1 120 ? -17.149 -31.256 -5.193  1.00 66.69  ? 143  HIS A NE2 1 
ATOM   871  N  N   . ARG A 1 121 ? -14.188 -32.101 -10.569 1.00 48.03  ? 144  ARG A N   1 
ATOM   872  C  CA  . ARG A 1 121 ? -13.695 -32.412 -11.882 1.00 47.31  ? 144  ARG A CA  1 
ATOM   873  C  C   . ARG A 1 121 ? -12.487 -31.546 -12.264 1.00 49.05  ? 144  ARG A C   1 
ATOM   874  O  O   . ARG A 1 121 ? -11.743 -31.889 -13.185 1.00 54.61  ? 144  ARG A O   1 
ATOM   875  C  CB  . ARG A 1 121 ? -14.814 -32.255 -12.896 1.00 44.68  ? 144  ARG A CB  1 
ATOM   876  C  CG  . ARG A 1 121 ? -15.800 -33.361 -12.779 1.00 45.17  ? 144  ARG A CG  1 
ATOM   877  C  CD  . ARG A 1 121 ? -16.991 -33.150 -13.677 1.00 47.09  ? 144  ARG A CD  1 
ATOM   878  N  NE  . ARG A 1 121 ? -16.591 -32.912 -15.056 1.00 46.76  ? 144  ARG A NE  1 
ATOM   879  C  CZ  . ARG A 1 121 ? -17.438 -32.559 -16.015 1.00 47.91  ? 144  ARG A CZ  1 
ATOM   880  N  NH1 . ARG A 1 121 ? -18.746 -32.393 -15.773 1.00 52.35  ? 144  ARG A NH1 1 
ATOM   881  N  NH2 . ARG A 1 121 ? -16.979 -32.372 -17.231 1.00 48.17  ? 144  ARG A NH2 1 
ATOM   882  N  N   . ALA A 1 122 ? -12.312 -30.412 -11.600 1.00 45.92  ? 145  ALA A N   1 
ATOM   883  C  CA  . ALA A 1 122 ? -11.153 -29.593 -11.855 1.00 48.36  ? 145  ALA A CA  1 
ATOM   884  C  C   . ALA A 1 122 ? -9.992  -30.069 -11.008 1.00 48.97  ? 145  ALA A C   1 
ATOM   885  O  O   . ALA A 1 122 ? -8.865  -29.648 -11.227 1.00 46.86  ? 145  ALA A O   1 
ATOM   886  C  CB  . ALA A 1 122 ? -11.447 -28.135 -11.552 1.00 50.08  ? 145  ALA A CB  1 
ATOM   887  N  N   . GLY A 1 123 ? -10.279 -30.925 -10.028 1.00 49.63  ? 146  GLY A N   1 
ATOM   888  C  CA  . GLY A 1 123 ? -9.277  -31.423 -9.098  1.00 47.55  ? 146  GLY A CA  1 
ATOM   889  C  C   . GLY A 1 123 ? -9.223  -30.694 -7.775  1.00 47.34  ? 146  GLY A C   1 
ATOM   890  O  O   . GLY A 1 123 ? -8.198  -30.707 -7.109  1.00 45.53  ? 146  GLY A O   1 
ATOM   891  N  N   . SER A 1 124 ? -10.308 -30.051 -7.368  1.00 50.33  ? 147  SER A N   1 
ATOM   892  C  CA  . SER A 1 124 ? -10.323 -29.486 -6.035  1.00 53.22  ? 147  SER A CA  1 
ATOM   893  C  C   . SER A 1 124 ? -10.648 -30.633 -5.095  1.00 53.58  ? 147  SER A C   1 
ATOM   894  O  O   . SER A 1 124 ? -11.364 -31.553 -5.493  1.00 55.77  ? 147  SER A O   1 
ATOM   895  C  CB  . SER A 1 124 ? -11.278 -28.319 -5.920  1.00 51.24  ? 147  SER A CB  1 
ATOM   896  O  OG  . SER A 1 124 ? -10.609 -27.147 -6.330  1.00 55.56  ? 147  SER A OG  1 
ATOM   897  N  N   . LYS A 1 125 ? -10.026 -30.633 -3.912  1.00 51.81  ? 148  LYS A N   1 
ATOM   898  C  CA  . LYS A 1 125 ? -10.164 -31.716 -2.953  1.00 53.35  ? 148  LYS A CA  1 
ATOM   899  C  C   . LYS A 1 125 ? -10.982 -31.298 -1.763  1.00 51.65  ? 148  LYS A C   1 
ATOM   900  O  O   . LYS A 1 125 ? -11.945 -31.962 -1.452  1.00 51.70  ? 148  LYS A O   1 
ATOM   901  C  CB  . LYS A 1 125 ? -8.804  -32.205 -2.445  1.00 56.40  ? 148  LYS A CB  1 
ATOM   902  C  CG  . LYS A 1 125 ? -7.853  -32.665 -3.518  1.00 60.99  ? 148  LYS A CG  1 
ATOM   903  C  CD  . LYS A 1 125 ? -8.331  -33.962 -4.152  1.00 68.05  ? 148  LYS A CD  1 
ATOM   904  C  CE  . LYS A 1 125 ? -7.448  -34.385 -5.322  1.00 74.28  ? 148  LYS A CE  1 
ATOM   905  N  NZ  . LYS A 1 125 ? -8.241  -35.142 -6.341  1.00 78.17  ? 148  LYS A NZ  1 
ATOM   906  N  N   . HIS A 1 126 ? -10.564 -30.247 -1.064  1.00 53.94  ? 149  HIS A N   1 
ATOM   907  C  CA  . HIS A 1 126 ? -11.194 -29.861 0.195   1.00 57.52  ? 149  HIS A CA  1 
ATOM   908  C  C   . HIS A 1 126 ? -12.311 -28.954 -0.184  1.00 52.74  ? 149  HIS A C   1 
ATOM   909  O  O   . HIS A 1 126 ? -12.167 -27.763 -0.144  1.00 57.20  ? 149  HIS A O   1 
ATOM   910  C  CB  . HIS A 1 126 ? -10.185 -29.235 1.163   1.00 64.65  ? 149  HIS A CB  1 
ATOM   911  C  CG  . HIS A 1 126 ? -8.898  -30.032 1.243   1.00 87.11  ? 149  HIS A CG  1 
ATOM   912  N  ND1 . HIS A 1 126 ? -8.868  -31.418 1.171   1.00 89.87  ? 149  HIS A ND1 1 
ATOM   913  C  CD2 . HIS A 1 126 ? -7.595  -29.642 1.329   1.00 98.64  ? 149  HIS A CD2 1 
ATOM   914  C  CE1 . HIS A 1 126 ? -7.615  -31.842 1.226   1.00 94.75  ? 149  HIS A CE1 1 
ATOM   915  N  NE2 . HIS A 1 126 ? -6.824  -30.786 1.325   1.00 101.54 ? 149  HIS A NE2 1 
ATOM   916  N  N   . VAL A 1 127 ? -13.411 -29.556 -0.620  1.00 48.81  ? 150  VAL A N   1 
ATOM   917  C  CA  . VAL A 1 127 ? -14.595 -28.858 -1.081  1.00 47.35  ? 150  VAL A CA  1 
ATOM   918  C  C   . VAL A 1 127 ? -15.719 -29.162 -0.141  1.00 48.48  ? 150  VAL A C   1 
ATOM   919  O  O   . VAL A 1 127 ? -15.850 -30.288 0.298   1.00 55.77  ? 150  VAL A O   1 
ATOM   920  C  CB  . VAL A 1 127 ? -15.075 -29.377 -2.445  1.00 46.64  ? 150  VAL A CB  1 
ATOM   921  C  CG1 . VAL A 1 127 ? -16.318 -28.640 -2.872  1.00 46.14  ? 150  VAL A CG1 1 
ATOM   922  C  CG2 . VAL A 1 127 ? -13.989 -29.210 -3.494  1.00 49.71  ? 150  VAL A CG2 1 
ATOM   923  N  N   . TYR A 1 128 ? -16.557 -28.166 0.133   1.00 47.28  ? 151  TYR A N   1 
ATOM   924  C  CA  . TYR A 1 128 ? -17.756 -28.351 0.926   1.00 43.83  ? 151  TYR A CA  1 
ATOM   925  C  C   . TYR A 1 128 ? -18.979 -28.015 0.063   1.00 42.23  ? 151  TYR A C   1 
ATOM   926  O  O   . TYR A 1 128 ? -19.185 -26.850 -0.255  1.00 40.75  ? 151  TYR A O   1 
ATOM   927  C  CB  . TYR A 1 128 ? -17.674 -27.445 2.142   1.00 45.08  ? 151  TYR A CB  1 
ATOM   928  C  CG  . TYR A 1 128 ? -16.785 -27.945 3.264   1.00 47.36  ? 151  TYR A CG  1 
ATOM   929  C  CD1 . TYR A 1 128 ? -17.201 -28.963 4.108   1.00 49.84  ? 151  TYR A CD1 1 
ATOM   930  C  CD2 . TYR A 1 128 ? -15.528 -27.386 3.498   1.00 49.51  ? 151  TYR A CD2 1 
ATOM   931  C  CE1 . TYR A 1 128 ? -16.390 -29.420 5.151   1.00 50.69  ? 151  TYR A CE1 1 
ATOM   932  C  CE2 . TYR A 1 128 ? -14.712 -27.829 4.546   1.00 49.69  ? 151  TYR A CE2 1 
ATOM   933  C  CZ  . TYR A 1 128 ? -15.150 -28.846 5.366   1.00 50.31  ? 151  TYR A CZ  1 
ATOM   934  O  OH  . TYR A 1 128 ? -14.370 -29.273 6.406   1.00 50.55  ? 151  TYR A OH  1 
ATOM   935  N  N   . GLU A 1 129 ? -19.755 -29.028 -0.346  1.00 43.51  ? 152  GLU A N   1 
ATOM   936  C  CA  . GLU A 1 129 ? -20.942 -28.851 -1.212  1.00 46.45  ? 152  GLU A CA  1 
ATOM   937  C  C   . GLU A 1 129 ? -22.214 -28.664 -0.346  1.00 47.10  ? 152  GLU A C   1 
ATOM   938  O  O   . GLU A 1 129 ? -22.843 -29.648 0.097   1.00 45.43  ? 152  GLU A O   1 
ATOM   939  C  CB  . GLU A 1 129 ? -21.147 -30.042 -2.181  1.00 46.97  ? 152  GLU A CB  1 
ATOM   940  C  CG  . GLU A 1 129 ? -19.921 -30.555 -2.897  1.00 47.94  ? 152  GLU A CG  1 
ATOM   941  C  CD  . GLU A 1 129 ? -20.270 -31.484 -4.050  1.00 55.76  ? 152  GLU A CD  1 
ATOM   942  O  OE1 . GLU A 1 129 ? -20.577 -30.938 -5.150  1.00 69.42  ? 152  GLU A OE1 1 
ATOM   943  O  OE2 . GLU A 1 129 ? -20.250 -32.750 -3.900  1.00 55.44  ? 152  GLU A OE2 1 
ATOM   944  N  N   . ILE A 1 130 ? -22.579 -27.403 -0.123  1.00 45.17  ? 153  ILE A N   1 
ATOM   945  C  CA  . ILE A 1 130 ? -23.552 -27.078 0.896   1.00 43.67  ? 153  ILE A CA  1 
ATOM   946  C  C   . ILE A 1 130 ? -24.919 -27.124 0.338   1.00 46.48  ? 153  ILE A C   1 
ATOM   947  O  O   . ILE A 1 130 ? -25.861 -27.000 1.105   1.00 47.23  ? 153  ILE A O   1 
ATOM   948  C  CB  . ILE A 1 130 ? -23.404 -25.671 1.478   1.00 44.17  ? 153  ILE A CB  1 
ATOM   949  C  CG1 . ILE A 1 130 ? -23.887 -24.618 0.496   1.00 42.85  ? 153  ILE A CG1 1 
ATOM   950  C  CG2 . ILE A 1 130 ? -21.952 -25.373 1.871   1.00 45.75  ? 153  ILE A CG2 1 
ATOM   951  C  CD1 . ILE A 1 130 ? -24.027 -23.265 1.158   1.00 42.83  ? 153  ILE A CD1 1 
ATOM   952  N  N   . HIS A 1 131 ? -25.069 -27.292 -0.974  1.00 48.24  ? 154  HIS A N   1 
ATOM   953  C  CA  . HIS A 1 131 ? -26.395 -27.600 -1.473  1.00 49.81  ? 154  HIS A CA  1 
ATOM   954  C  C   . HIS A 1 131 ? -26.443 -29.045 -1.943  1.00 47.80  ? 154  HIS A C   1 
ATOM   955  O  O   . HIS A 1 131 ? -27.439 -29.535 -2.458  1.00 48.27  ? 154  HIS A O   1 
ATOM   956  C  CB  . HIS A 1 131 ? -26.818 -26.635 -2.569  1.00 53.71  ? 154  HIS A CB  1 
ATOM   957  C  CG  . HIS A 1 131 ? -27.274 -25.300 -2.076  1.00 55.43  ? 154  HIS A CG  1 
ATOM   958  N  ND1 . HIS A 1 131 ? -27.553 -24.262 -2.940  1.00 56.66  ? 154  HIS A ND1 1 
ATOM   959  C  CD2 . HIS A 1 131 ? -27.518 -24.832 -0.827  1.00 55.69  ? 154  HIS A CD2 1 
ATOM   960  C  CE1 . HIS A 1 131 ? -27.932 -23.208 -2.243  1.00 55.96  ? 154  HIS A CE1 1 
ATOM   961  N  NE2 . HIS A 1 131 ? -27.929 -23.529 -0.960  1.00 54.21  ? 154  HIS A NE2 1 
ATOM   962  N  N   . GLY A 1 132 ? -25.377 -29.763 -1.704  1.00 46.95  ? 155  GLY A N   1 
ATOM   963  C  CA  . GLY A 1 132 ? -25.361 -31.151 -2.116  1.00 48.66  ? 155  GLY A CA  1 
ATOM   964  C  C   . GLY A 1 132 ? -24.758 -31.287 -3.491  1.00 45.34  ? 155  GLY A C   1 
ATOM   965  O  O   . GLY A 1 132 ? -23.947 -30.442 -3.884  1.00 46.76  ? 155  GLY A O   1 
ATOM   966  N  N   . SER A 1 133 ? -25.178 -32.332 -4.194  1.00 43.32  ? 156  SER A N   1 
ATOM   967  C  CA  . SER A 1 133 ? -24.661 -32.687 -5.518  1.00 44.89  ? 156  SER A CA  1 
ATOM   968  C  C   . SER A 1 133 ? -25.635 -33.510 -6.359  1.00 44.33  ? 156  SER A C   1 
ATOM   969  O  O   . SER A 1 133 ? -26.289 -34.420 -5.863  1.00 42.51  ? 156  SER A O   1 
ATOM   970  C  CB  . SER A 1 133 ? -23.367 -33.488 -5.408  1.00 47.64  ? 156  SER A CB  1 
ATOM   971  O  OG  . SER A 1 133 ? -23.036 -34.150 -6.627  1.00 47.34  ? 156  SER A OG  1 
ATOM   972  N  N   . LEU A 1 134 ? -25.699 -33.172 -7.645  1.00 44.06  ? 157  LEU A N   1 
ATOM   973  C  CA  . LEU A 1 134 ? -26.451 -33.937 -8.629  1.00 45.71  ? 157  LEU A CA  1 
ATOM   974  C  C   . LEU A 1 134 ? -26.019 -35.391 -8.716  1.00 45.84  ? 157  LEU A C   1 
ATOM   975  O  O   . LEU A 1 134 ? -26.790 -36.233 -9.194  1.00 46.48  ? 157  LEU A O   1 
ATOM   976  C  CB  . LEU A 1 134 ? -26.249 -33.365 -10.025 1.00 46.09  ? 157  LEU A CB  1 
ATOM   977  C  CG  . LEU A 1 134 ? -26.847 -32.017 -10.341 1.00 46.70  ? 157  LEU A CG  1 
ATOM   978  C  CD1 . LEU A 1 134 ? -26.471 -31.562 -11.743 1.00 44.93  ? 157  LEU A CD1 1 
ATOM   979  C  CD2 . LEU A 1 134 ? -28.346 -32.108 -10.200 1.00 48.24  ? 157  LEU A CD2 1 
ATOM   980  N  N   . PHE A 1 135 ? -24.792 -35.706 -8.325  1.00 41.85  ? 158  PHE A N   1 
ATOM   981  C  CA  . PHE A 1 135 ? -24.339 -37.050 -8.562  1.00 41.41  ? 158  PHE A CA  1 
ATOM   982  C  C   . PHE A 1 135 ? -24.243 -37.793 -7.277  1.00 39.96  ? 158  PHE A C   1 
ATOM   983  O  O   . PHE A 1 135 ? -23.328 -38.577 -7.062  1.00 44.67  ? 158  PHE A O   1 
ATOM   984  C  CB  . PHE A 1 135 ? -23.049 -37.006 -9.351  1.00 42.87  ? 158  PHE A CB  1 
ATOM   985  C  CG  . PHE A 1 135 ? -23.209 -36.318 -10.661 1.00 44.18  ? 158  PHE A CG  1 
ATOM   986  C  CD1 . PHE A 1 135 ? -23.809 -36.977 -11.735 1.00 45.03  ? 158  PHE A CD1 1 
ATOM   987  C  CD2 . PHE A 1 135 ? -22.817 -34.989 -10.818 1.00 45.57  ? 158  PHE A CD2 1 
ATOM   988  C  CE1 . PHE A 1 135 ? -23.978 -36.343 -12.956 1.00 45.28  ? 158  PHE A CE1 1 
ATOM   989  C  CE2 . PHE A 1 135 ? -22.963 -34.357 -12.044 1.00 45.68  ? 158  PHE A CE2 1 
ATOM   990  C  CZ  . PHE A 1 135 ? -23.541 -35.039 -13.111 1.00 46.16  ? 158  PHE A CZ  1 
ATOM   991  N  N   . LYS A 1 136 ? -25.158 -37.455 -6.392  1.00 39.43  ? 159  LYS A N   1 
ATOM   992  C  CA  . LYS A 1 136 ? -25.397 -38.246 -5.237  1.00 39.91  ? 159  LYS A CA  1 
ATOM   993  C  C   . LYS A 1 136 ? -26.883 -38.424 -5.112  1.00 39.33  ? 159  LYS A C   1 
ATOM   994  O  O   . LYS A 1 136 ? -27.678 -37.603 -5.602  1.00 33.12  ? 159  LYS A O   1 
ATOM   995  C  CB  . LYS A 1 136 ? -24.846 -37.567 -4.004  1.00 42.58  ? 159  LYS A CB  1 
ATOM   996  C  CG  . LYS A 1 136 ? -23.357 -37.724 -3.896  1.00 45.76  ? 159  LYS A CG  1 
ATOM   997  C  CD  . LYS A 1 136 ? -22.802 -37.005 -2.706  1.00 49.71  ? 159  LYS A CD  1 
ATOM   998  C  CE  . LYS A 1 136 ? -21.305 -36.858 -2.878  1.00 53.63  ? 159  LYS A CE  1 
ATOM   999  N  NZ  . LYS A 1 136 ? -20.742 -36.749 -1.518  1.00 60.76  ? 159  LYS A NZ  1 
ATOM   1000 N  N   . THR A 1 137 ? -27.231 -39.559 -4.519  1.00 42.20  ? 160  THR A N   1 
ATOM   1001 C  CA  . THR A 1 137 ? -28.607 -39.920 -4.255  1.00 45.12  ? 160  THR A CA  1 
ATOM   1002 C  C   . THR A 1 137 ? -28.747 -40.157 -2.762  1.00 49.37  ? 160  THR A C   1 
ATOM   1003 O  O   . THR A 1 137 ? -27.857 -40.744 -2.114  1.00 47.67  ? 160  THR A O   1 
ATOM   1004 C  CB  . THR A 1 137 ? -29.000 -41.220 -4.997  1.00 45.65  ? 160  THR A CB  1 
ATOM   1005 O  OG1 . THR A 1 137 ? -28.306 -42.361 -4.436  1.00 48.18  ? 160  THR A OG1 1 
ATOM   1006 C  CG2 . THR A 1 137 ? -28.674 -41.126 -6.459  1.00 42.47  ? 160  THR A CG2 1 
ATOM   1007 N  N   . ARG A 1 138 ? -29.881 -39.738 -2.223  1.00 54.98  ? 161  ARG A N   1 
ATOM   1008 C  CA  . ARG A 1 138 ? -30.255 -40.127 -0.859  1.00 59.05  ? 161  ARG A CA  1 
ATOM   1009 C  C   . ARG A 1 138 ? -31.486 -41.023 -0.953  1.00 56.32  ? 161  ARG A C   1 
ATOM   1010 O  O   . ARG A 1 138 ? -32.378 -40.774 -1.772  1.00 57.39  ? 161  ARG A O   1 
ATOM   1011 C  CB  . ARG A 1 138 ? -30.549 -38.909 0.022   1.00 61.65  ? 161  ARG A CB  1 
ATOM   1012 C  CG  . ARG A 1 138 ? -31.100 -39.298 1.387   1.00 63.66  ? 161  ARG A CG  1 
ATOM   1013 C  CD  . ARG A 1 138 ? -31.405 -38.134 2.325   1.00 61.49  ? 161  ARG A CD  1 
ATOM   1014 N  NE  . ARG A 1 138 ? -32.002 -36.996 1.643   1.00 62.20  ? 161  ARG A NE  1 
ATOM   1015 C  CZ  . ARG A 1 138 ? -31.478 -35.779 1.581   1.00 65.51  ? 161  ARG A CZ  1 
ATOM   1016 N  NH1 . ARG A 1 138 ? -30.332 -35.505 2.179   1.00 69.18  ? 161  ARG A NH1 1 
ATOM   1017 N  NH2 . ARG A 1 138 ? -32.130 -34.804 0.952   1.00 67.49  ? 161  ARG A NH2 1 
ATOM   1018 N  N   . CYS A 1 139 ? -31.533 -42.049 -0.108  1.00 52.44  ? 162  CYS A N   1 
ATOM   1019 C  CA  . CYS A 1 139 ? -32.676 -42.960 -0.073  1.00 50.28  ? 162  CYS A CA  1 
ATOM   1020 C  C   . CYS A 1 139 ? -33.800 -42.434 0.806   1.00 50.25  ? 162  CYS A C   1 
ATOM   1021 O  O   . CYS A 1 139 ? -33.566 -42.034 1.960   1.00 47.78  ? 162  CYS A O   1 
ATOM   1022 C  CB  . CYS A 1 139 ? -32.269 -44.311 0.459   1.00 50.01  ? 162  CYS A CB  1 
ATOM   1023 S  SG  . CYS A 1 139 ? -33.623 -45.493 0.430   1.00 52.02  ? 162  CYS A SG  1 
ATOM   1024 N  N   . MET A 1 140 ? -35.020 -42.465 0.277   1.00 48.18  ? 163  MET A N   1 
ATOM   1025 C  CA  . MET A 1 140 ? -36.170 -42.002 1.033   1.00 49.30  ? 163  MET A CA  1 
ATOM   1026 C  C   . MET A 1 140 ? -36.447 -42.961 2.178   1.00 52.91  ? 163  MET A C   1 
ATOM   1027 O  O   . MET A 1 140 ? -36.882 -42.548 3.240   1.00 57.97  ? 163  MET A O   1 
ATOM   1028 C  CB  . MET A 1 140 ? -37.378 -41.901 0.147   1.00 47.68  ? 163  MET A CB  1 
ATOM   1029 C  CG  . MET A 1 140 ? -37.134 -40.979 -1.020  1.00 51.95  ? 163  MET A CG  1 
ATOM   1030 S  SD  . MET A 1 140 ? -37.156 -39.229 -0.571  1.00 56.12  ? 163  MET A SD  1 
ATOM   1031 C  CE  . MET A 1 140 ? -38.834 -38.786 -0.977  1.00 54.08  ? 163  MET A CE  1 
ATOM   1032 N  N   . SER A 1 141 ? -36.138 -44.238 1.977   1.00 55.15  ? 164  SER A N   1 
ATOM   1033 C  CA  . SER A 1 141 ? -36.390 -45.273 2.967   1.00 53.13  ? 164  SER A CA  1 
ATOM   1034 C  C   . SER A 1 141 ? -35.311 -45.223 4.001   1.00 52.63  ? 164  SER A C   1 
ATOM   1035 O  O   . SER A 1 141 ? -35.547 -44.791 5.092   1.00 55.55  ? 164  SER A O   1 
ATOM   1036 C  CB  . SER A 1 141 ? -36.354 -46.654 2.321   1.00 57.69  ? 164  SER A CB  1 
ATOM   1037 O  OG  . SER A 1 141 ? -37.301 -47.526 2.877   1.00 65.13  ? 164  SER A OG  1 
ATOM   1038 N  N   . CYS A 1 142 ? -34.105 -45.647 3.657   1.00 53.66  ? 165  CYS A N   1 
ATOM   1039 C  CA  . CYS A 1 142 ? -33.060 -45.813 4.660   1.00 52.48  ? 165  CYS A CA  1 
ATOM   1040 C  C   . CYS A 1 142 ? -32.185 -44.606 4.842   1.00 50.12  ? 165  CYS A C   1 
ATOM   1041 O  O   . CYS A 1 142 ? -31.333 -44.621 5.703   1.00 49.74  ? 165  CYS A O   1 
ATOM   1042 C  CB  . CYS A 1 142 ? -32.179 -47.022 4.326   1.00 56.28  ? 165  CYS A CB  1 
ATOM   1043 S  SG  . CYS A 1 142 ? -31.147 -46.901 2.838   1.00 60.40  ? 165  CYS A SG  1 
ATOM   1044 N  N   . GLY A 1 143 ? -32.349 -43.571 4.026   1.00 50.78  ? 166  GLY A N   1 
ATOM   1045 C  CA  . GLY A 1 143 ? -31.526 -42.363 4.153   1.00 49.90  ? 166  GLY A CA  1 
ATOM   1046 C  C   . GLY A 1 143 ? -30.075 -42.419 3.704   1.00 48.64  ? 166  GLY A C   1 
ATOM   1047 O  O   . GLY A 1 143 ? -29.315 -41.481 3.968   1.00 46.00  ? 166  GLY A O   1 
ATOM   1048 N  N   . GLU A 1 144 ? -29.681 -43.482 3.009   1.00 50.05  ? 167  GLU A N   1 
ATOM   1049 C  CA  . GLU A 1 144 ? -28.280 -43.647 2.605   1.00 53.04  ? 167  GLU A CA  1 
ATOM   1050 C  C   . GLU A 1 144 ? -27.866 -42.712 1.472   1.00 55.12  ? 167  GLU A C   1 
ATOM   1051 O  O   . GLU A 1 144 ? -28.583 -42.556 0.485   1.00 56.39  ? 167  GLU A O   1 
ATOM   1052 C  CB  . GLU A 1 144 ? -27.995 -45.082 2.192   1.00 56.17  ? 167  GLU A CB  1 
ATOM   1053 C  CG  . GLU A 1 144 ? -26.712 -45.282 1.388   1.00 60.92  ? 167  GLU A CG  1 
ATOM   1054 C  CD  . GLU A 1 144 ? -26.430 -46.745 1.107   1.00 66.72  ? 167  GLU A CD  1 
ATOM   1055 O  OE1 . GLU A 1 144 ? -26.004 -47.454 2.048   1.00 67.26  ? 167  GLU A OE1 1 
ATOM   1056 O  OE2 . GLU A 1 144 ? -26.680 -47.192 -0.040  1.00 69.18  ? 167  GLU A OE2 1 
ATOM   1057 N  N   . VAL A 1 145 ? -26.681 -42.115 1.614   1.00 57.59  ? 168  VAL A N   1 
ATOM   1058 C  CA  . VAL A 1 145 ? -26.128 -41.246 0.571   1.00 55.14  ? 168  VAL A CA  1 
ATOM   1059 C  C   . VAL A 1 145 ? -25.006 -41.950 -0.175  1.00 51.11  ? 168  VAL A C   1 
ATOM   1060 O  O   . VAL A 1 145 ? -24.015 -42.368 0.406   1.00 46.84  ? 168  VAL A O   1 
ATOM   1061 C  CB  . VAL A 1 145 ? -25.631 -39.906 1.139   1.00 53.70  ? 168  VAL A CB  1 
ATOM   1062 C  CG1 . VAL A 1 145 ? -24.947 -39.096 0.063   1.00 53.49  ? 168  VAL A CG1 1 
ATOM   1063 C  CG2 . VAL A 1 145 ? -26.798 -39.105 1.699   1.00 55.99  ? 168  VAL A CG2 1 
ATOM   1064 N  N   . LYS A 1 146 ? -25.183 -42.061 -1.476  1.00 51.72  ? 169  LYS A N   1 
ATOM   1065 C  CA  . LYS A 1 146 ? -24.270 -42.816 -2.288  1.00 52.67  ? 169  LYS A CA  1 
ATOM   1066 C  C   . LYS A 1 146 ? -23.955 -42.017 -3.554  1.00 52.59  ? 169  LYS A C   1 
ATOM   1067 O  O   . LYS A 1 146 ? -24.833 -41.335 -4.150  1.00 51.04  ? 169  LYS A O   1 
ATOM   1068 C  CB  . LYS A 1 146 ? -24.870 -44.205 -2.581  1.00 55.84  ? 169  LYS A CB  1 
ATOM   1069 C  CG  . LYS A 1 146 ? -24.198 -45.003 -3.699  1.00 63.86  ? 169  LYS A CG  1 
ATOM   1070 C  CD  . LYS A 1 146 ? -24.186 -46.522 -3.507  1.00 72.23  ? 169  LYS A CD  1 
ATOM   1071 C  CE  . LYS A 1 146 ? -24.234 -47.241 -4.855  1.00 80.29  ? 169  LYS A CE  1 
ATOM   1072 N  NZ  . LYS A 1 146 ? -25.250 -48.344 -4.836  1.00 84.72  ? 169  LYS A NZ  1 
ATOM   1073 N  N   . ALA A 1 147 ? -22.677 -42.070 -3.937  1.00 50.90  ? 170  ALA A N   1 
ATOM   1074 C  CA  . ALA A 1 147 ? -22.242 -41.448 -5.162  1.00 49.60  ? 170  ALA A CA  1 
ATOM   1075 C  C   . ALA A 1 147 ? -22.903 -42.166 -6.286  1.00 50.91  ? 170  ALA A C   1 
ATOM   1076 O  O   . ALA A 1 147 ? -23.170 -43.363 -6.192  1.00 55.44  ? 170  ALA A O   1 
ATOM   1077 C  CB  . ALA A 1 147 ? -20.766 -41.542 -5.308  1.00 48.23  ? 170  ALA A CB  1 
ATOM   1078 N  N   . ASN A 1 148 ? -23.219 -41.419 -7.333  1.00 51.79  ? 171  ASN A N   1 
ATOM   1079 C  CA  . ASN A 1 148 ? -23.755 -42.006 -8.535  1.00 49.47  ? 171  ASN A CA  1 
ATOM   1080 C  C   . ASN A 1 148 ? -23.643 -41.120 -9.785  1.00 48.96  ? 171  ASN A C   1 
ATOM   1081 O  O   . ASN A 1 148 ? -24.225 -40.040 -9.834  1.00 47.41  ? 171  ASN A O   1 
ATOM   1082 C  CB  . ASN A 1 148 ? -25.206 -42.369 -8.296  1.00 47.95  ? 171  ASN A CB  1 
ATOM   1083 C  CG  . ASN A 1 148 ? -25.892 -42.792 -9.562  1.00 48.42  ? 171  ASN A CG  1 
ATOM   1084 O  OD1 . ASN A 1 148 ? -25.431 -42.499 -10.681 1.00 45.24  ? 171  ASN A OD1 1 
ATOM   1085 N  ND2 . ASN A 1 148 ? -27.012 -43.467 -9.408  1.00 49.27  ? 171  ASN A ND2 1 
ATOM   1086 N  N   . HIS A 1 149 ? -22.910 -41.598 -10.791 1.00 49.51  ? 172  HIS A N   1 
ATOM   1087 C  CA  . HIS A 1 149 ? -22.730 -40.877 -12.068 1.00 49.35  ? 172  HIS A CA  1 
ATOM   1088 C  C   . HIS A 1 149 ? -23.215 -41.695 -13.283 1.00 49.43  ? 172  HIS A C   1 
ATOM   1089 O  O   . HIS A 1 149 ? -22.945 -41.331 -14.428 1.00 45.38  ? 172  HIS A O   1 
ATOM   1090 C  CB  . HIS A 1 149 ? -21.255 -40.500 -12.272 1.00 48.54  ? 172  HIS A CB  1 
ATOM   1091 C  CG  . HIS A 1 149 ? -20.656 -39.709 -11.146 1.00 48.43  ? 172  HIS A CG  1 
ATOM   1092 N  ND1 . HIS A 1 149 ? -20.150 -40.296 -10.005 1.00 48.44  ? 172  HIS A ND1 1 
ATOM   1093 C  CD2 . HIS A 1 149 ? -20.454 -38.384 -10.997 1.00 49.80  ? 172  HIS A CD2 1 
ATOM   1094 C  CE1 . HIS A 1 149 ? -19.670 -39.370 -9.199  1.00 47.65  ? 172  HIS A CE1 1 
ATOM   1095 N  NE2 . HIS A 1 149 ? -19.845 -38.200 -9.773  1.00 50.02  ? 172  HIS A NE2 1 
ATOM   1096 N  N   . LYS A 1 150 ? -23.955 -42.775 -13.008 1.00 52.72  ? 173  LYS A N   1 
ATOM   1097 C  CA  . LYS A 1 150 ? -24.547 -43.674 -14.022 1.00 52.71  ? 173  LYS A CA  1 
ATOM   1098 C  C   . LYS A 1 150 ? -25.215 -42.877 -15.133 1.00 49.90  ? 173  LYS A C   1 
ATOM   1099 O  O   . LYS A 1 150 ? -25.847 -41.866 -14.866 1.00 52.23  ? 173  LYS A O   1 
ATOM   1100 C  CB  . LYS A 1 150 ? -25.617 -44.566 -13.370 1.00 57.95  ? 173  LYS A CB  1 
ATOM   1101 C  CG  . LYS A 1 150 ? -25.215 -45.977 -12.902 1.00 63.91  ? 173  LYS A CG  1 
ATOM   1102 C  CD  . LYS A 1 150 ? -26.288 -46.546 -11.927 1.00 67.90  ? 173  LYS A CD  1 
ATOM   1103 C  CE  . LYS A 1 150 ? -26.480 -48.090 -11.936 1.00 66.63  ? 173  LYS A CE  1 
ATOM   1104 N  NZ  . LYS A 1 150 ? -25.530 -48.825 -11.045 1.00 66.67  ? 173  LYS A NZ  1 
ATOM   1105 N  N   . SER A 1 151 ? -25.109 -43.329 -16.371 1.00 46.49  ? 174  SER A N   1 
ATOM   1106 C  CA  . SER A 1 151 ? -25.795 -42.650 -17.455 1.00 43.80  ? 174  SER A CA  1 
ATOM   1107 C  C   . SER A 1 151 ? -26.465 -43.632 -18.417 1.00 44.98  ? 174  SER A C   1 
ATOM   1108 O  O   . SER A 1 151 ? -25.784 -44.311 -19.152 1.00 46.61  ? 174  SER A O   1 
ATOM   1109 C  CB  . SER A 1 151 ? -24.807 -41.797 -18.218 1.00 41.95  ? 174  SER A CB  1 
ATOM   1110 O  OG  . SER A 1 151 ? -25.464 -41.004 -19.171 1.00 40.25  ? 174  SER A OG  1 
ATOM   1111 N  N   . PRO A 1 152 ? -27.791 -43.728 -18.432 1.00 47.62  ? 175  PRO A N   1 
ATOM   1112 C  CA  . PRO A 1 152 ? -28.671 -43.010 -17.550 1.00 47.95  ? 175  PRO A CA  1 
ATOM   1113 C  C   . PRO A 1 152 ? -28.672 -43.610 -16.165 1.00 47.01  ? 175  PRO A C   1 
ATOM   1114 O  O   . PRO A 1 152 ? -28.322 -44.766 -15.983 1.00 46.66  ? 175  PRO A O   1 
ATOM   1115 C  CB  . PRO A 1 152 ? -30.029 -43.222 -18.210 1.00 48.81  ? 175  PRO A CB  1 
ATOM   1116 C  CG  . PRO A 1 152 ? -29.954 -44.615 -18.704 1.00 48.41  ? 175  PRO A CG  1 
ATOM   1117 C  CD  . PRO A 1 152 ? -28.526 -44.776 -19.161 1.00 49.48  ? 175  PRO A CD  1 
ATOM   1118 N  N   . ILE A 1 153 ? -29.080 -42.803 -15.204 1.00 49.54  ? 176  ILE A N   1 
ATOM   1119 C  CA  . ILE A 1 153 ? -29.161 -43.224 -13.812 1.00 52.00  ? 176  ILE A CA  1 
ATOM   1120 C  C   . ILE A 1 153 ? -29.983 -44.506 -13.591 1.00 54.31  ? 176  ILE A C   1 
ATOM   1121 O  O   . ILE A 1 153 ? -29.678 -45.309 -12.692 1.00 56.39  ? 176  ILE A O   1 
ATOM   1122 C  CB  . ILE A 1 153 ? -29.761 -42.094 -12.959 1.00 49.89  ? 176  ILE A CB  1 
ATOM   1123 C  CG1 . ILE A 1 153 ? -29.700 -42.491 -11.482 1.00 48.92  ? 176  ILE A CG1 1 
ATOM   1124 C  CG2 . ILE A 1 153 ? -31.180 -41.752 -13.411 1.00 48.35  ? 176  ILE A CG2 1 
ATOM   1125 C  CD1 . ILE A 1 153 ? -30.063 -41.378 -10.534 1.00 48.50  ? 176  ILE A CD1 1 
ATOM   1126 N  N   . CYS A 1 154 ? -31.017 -44.667 -14.418 1.00 54.15  ? 177  CYS A N   1 
ATOM   1127 C  CA  . CYS A 1 154 ? -31.797 -45.875 -14.498 1.00 52.40  ? 177  CYS A CA  1 
ATOM   1128 C  C   . CYS A 1 154 ? -32.363 -45.996 -15.922 1.00 53.69  ? 177  CYS A C   1 
ATOM   1129 O  O   . CYS A 1 154 ? -32.629 -44.975 -16.592 1.00 50.54  ? 177  CYS A O   1 
ATOM   1130 C  CB  . CYS A 1 154 ? -32.933 -45.840 -13.477 1.00 53.25  ? 177  CYS A CB  1 
ATOM   1131 S  SG  . CYS A 1 154 ? -34.372 -44.831 -13.943 1.00 52.66  ? 177  CYS A SG  1 
ATOM   1132 N  N   . PRO A 1 155 ? -32.594 -47.245 -16.384 1.00 54.08  ? 178  PRO A N   1 
ATOM   1133 C  CA  . PRO A 1 155 ? -33.050 -47.487 -17.754 1.00 52.28  ? 178  PRO A CA  1 
ATOM   1134 C  C   . PRO A 1 155 ? -34.312 -46.717 -18.086 1.00 53.56  ? 178  PRO A C   1 
ATOM   1135 O  O   . PRO A 1 155 ? -34.335 -45.966 -19.054 1.00 59.40  ? 178  PRO A O   1 
ATOM   1136 C  CB  . PRO A 1 155 ? -33.308 -48.987 -17.790 1.00 51.38  ? 178  PRO A CB  1 
ATOM   1137 C  CG  . PRO A 1 155 ? -32.568 -49.550 -16.624 1.00 53.00  ? 178  PRO A CG  1 
ATOM   1138 C  CD  . PRO A 1 155 ? -32.598 -48.482 -15.586 1.00 54.67  ? 178  PRO A CD  1 
ATOM   1139 N  N   . ALA A 1 156 ? -35.336 -46.865 -17.259 1.00 51.89  ? 179  ALA A N   1 
ATOM   1140 C  CA  . ALA A 1 156 ? -36.609 -46.155 -17.438 1.00 53.82  ? 179  ALA A CA  1 
ATOM   1141 C  C   . ALA A 1 156 ? -36.533 -44.689 -17.928 1.00 53.29  ? 179  ALA A C   1 
ATOM   1142 O  O   . ALA A 1 156 ? -37.465 -44.183 -18.601 1.00 51.57  ? 179  ALA A O   1 
ATOM   1143 C  CB  . ALA A 1 156 ? -37.393 -46.225 -16.133 1.00 58.14  ? 179  ALA A CB  1 
ATOM   1144 N  N   . LEU A 1 157 ? -35.431 -44.025 -17.576 1.00 54.82  ? 180  LEU A N   1 
ATOM   1145 C  CA  . LEU A 1 157 ? -35.223 -42.618 -17.878 1.00 56.55  ? 180  LEU A CA  1 
ATOM   1146 C  C   . LEU A 1 157 ? -34.379 -42.381 -19.124 1.00 58.50  ? 180  LEU A C   1 
ATOM   1147 O  O   . LEU A 1 157 ? -34.171 -41.230 -19.525 1.00 57.55  ? 180  LEU A O   1 
ATOM   1148 C  CB  . LEU A 1 157 ? -34.551 -41.932 -16.682 1.00 59.37  ? 180  LEU A CB  1 
ATOM   1149 C  CG  . LEU A 1 157 ? -35.477 -41.421 -15.569 1.00 60.56  ? 180  LEU A CG  1 
ATOM   1150 C  CD1 . LEU A 1 157 ? -34.689 -41.087 -14.316 1.00 60.76  ? 180  LEU A CD1 1 
ATOM   1151 C  CD2 . LEU A 1 157 ? -36.257 -40.197 -16.013 1.00 60.55  ? 180  LEU A CD2 1 
ATOM   1152 N  N   . ASP A 1 158 ? -33.908 -43.457 -19.752 1.00 61.50  ? 181  ASP A N   1 
ATOM   1153 C  CA  . ASP A 1 158 ? -33.001 -43.329 -20.896 1.00 61.51  ? 181  ASP A CA  1 
ATOM   1154 C  C   . ASP A 1 158 ? -33.562 -42.404 -21.990 1.00 56.16  ? 181  ASP A C   1 
ATOM   1155 O  O   . ASP A 1 158 ? -34.668 -42.579 -22.480 1.00 52.21  ? 181  ASP A O   1 
ATOM   1156 C  CB  . ASP A 1 158 ? -32.653 -44.703 -21.475 1.00 64.33  ? 181  ASP A CB  1 
ATOM   1157 C  CG  . ASP A 1 158 ? -31.338 -44.707 -22.208 1.00 67.99  ? 181  ASP A CG  1 
ATOM   1158 O  OD1 . ASP A 1 158 ? -30.569 -43.726 -22.086 1.00 74.81  ? 181  ASP A OD1 1 
ATOM   1159 O  OD2 . ASP A 1 158 ? -31.045 -45.710 -22.875 1.00 73.30  ? 181  ASP A OD2 1 
ATOM   1160 N  N   . GLY A 1 159 ? -32.803 -41.379 -22.327 1.00 56.01  ? 182  GLY A N   1 
ATOM   1161 C  CA  . GLY A 1 159 ? -33.269 -40.403 -23.274 1.00 57.72  ? 182  GLY A CA  1 
ATOM   1162 C  C   . GLY A 1 159 ? -34.549 -39.718 -22.840 1.00 59.72  ? 182  GLY A C   1 
ATOM   1163 O  O   . GLY A 1 159 ? -35.342 -39.316 -23.673 1.00 58.82  ? 182  GLY A O   1 
ATOM   1164 N  N   . LYS A 1 160 ? -34.765 -39.555 -21.545 1.00 63.30  ? 183  LYS A N   1 
ATOM   1165 C  CA  . LYS A 1 160 ? -35.891 -38.748 -21.101 1.00 63.89  ? 183  LYS A CA  1 
ATOM   1166 C  C   . LYS A 1 160 ? -35.392 -37.349 -20.700 1.00 63.08  ? 183  LYS A C   1 
ATOM   1167 O  O   . LYS A 1 160 ? -34.230 -36.974 -20.966 1.00 54.14  ? 183  LYS A O   1 
ATOM   1168 C  CB  . LYS A 1 160 ? -36.628 -39.445 -19.961 1.00 65.43  ? 183  LYS A CB  1 
ATOM   1169 C  CG  . LYS A 1 160 ? -37.073 -40.862 -20.270 1.00 69.75  ? 183  LYS A CG  1 
ATOM   1170 C  CD  . LYS A 1 160 ? -38.185 -40.884 -21.297 1.00 76.01  ? 183  LYS A CD  1 
ATOM   1171 C  CE  . LYS A 1 160 ? -38.614 -42.305 -21.645 1.00 78.67  ? 183  LYS A CE  1 
ATOM   1172 N  NZ  . LYS A 1 160 ? -39.659 -42.263 -22.708 1.00 81.04  ? 183  LYS A NZ  1 
ATOM   1173 N  N   . GLY A 1 161 ? -36.299 -36.576 -20.104 1.00 63.00  ? 184  GLY A N   1 
ATOM   1174 C  CA  . GLY A 1 161 ? -35.982 -35.258 -19.592 1.00 61.68  ? 184  GLY A CA  1 
ATOM   1175 C  C   . GLY A 1 161 ? -35.738 -34.197 -20.647 1.00 61.77  ? 184  GLY A C   1 
ATOM   1176 O  O   . GLY A 1 161 ? -35.239 -33.126 -20.333 1.00 59.15  ? 184  GLY A O   1 
ATOM   1177 N  N   . ALA A 1 162 ? -36.123 -34.449 -21.893 1.00 64.19  ? 185  ALA A N   1 
ATOM   1178 C  CA  . ALA A 1 162 ? -35.999 -33.421 -22.919 1.00 62.74  ? 185  ALA A CA  1 
ATOM   1179 C  C   . ALA A 1 162 ? -36.608 -32.110 -22.414 1.00 61.66  ? 185  ALA A C   1 
ATOM   1180 O  O   . ALA A 1 162 ? -37.640 -32.129 -21.740 1.00 64.65  ? 185  ALA A O   1 
ATOM   1181 C  CB  . ALA A 1 162 ? -36.711 -33.857 -24.177 1.00 64.69  ? 185  ALA A CB  1 
ATOM   1182 N  N   . PRO A 1 163 ? -35.983 -30.974 -22.729 1.00 59.45  ? 186  PRO A N   1 
ATOM   1183 C  CA  . PRO A 1 163 ? -36.420 -29.675 -22.221 1.00 61.74  ? 186  PRO A CA  1 
ATOM   1184 C  C   . PRO A 1 163 ? -37.381 -28.901 -23.111 1.00 67.35  ? 186  PRO A C   1 
ATOM   1185 O  O   . PRO A 1 163 ? -37.842 -27.835 -22.718 1.00 68.48  ? 186  PRO A O   1 
ATOM   1186 C  CB  . PRO A 1 163 ? -35.117 -28.913 -22.098 1.00 60.61  ? 186  PRO A CB  1 
ATOM   1187 C  CG  . PRO A 1 163 ? -34.303 -29.447 -23.220 1.00 64.25  ? 186  PRO A CG  1 
ATOM   1188 C  CD  . PRO A 1 163 ? -34.710 -30.875 -23.450 1.00 62.90  ? 186  PRO A CD  1 
ATOM   1189 N  N   . ASP A 1 164 ? -37.695 -29.414 -24.296 1.00 75.11  ? 187  ASP A N   1 
ATOM   1190 C  CA  . ASP A 1 164 ? -38.654 -28.741 -25.140 1.00 76.36  ? 187  ASP A CA  1 
ATOM   1191 C  C   . ASP A 1 164 ? -40.027 -28.600 -24.421 1.00 80.38  ? 187  ASP A C   1 
ATOM   1192 O  O   . ASP A 1 164 ? -40.585 -29.594 -23.922 1.00 71.02  ? 187  ASP A O   1 
ATOM   1193 C  CB  . ASP A 1 164 ? -38.833 -29.484 -26.452 1.00 78.36  ? 187  ASP A CB  1 
ATOM   1194 C  CG  . ASP A 1 164 ? -39.653 -28.689 -27.423 1.00 87.59  ? 187  ASP A CG  1 
ATOM   1195 O  OD1 . ASP A 1 164 ? -39.109 -27.693 -27.934 1.00 103.05 ? 187  ASP A OD1 1 
ATOM   1196 O  OD2 . ASP A 1 164 ? -40.848 -29.006 -27.646 1.00 86.56  ? 187  ASP A OD2 1 
ATOM   1197 N  N   . PRO A 1 165 ? -40.587 -27.366 -24.385 1.00 85.63  ? 188  PRO A N   1 
ATOM   1198 C  CA  . PRO A 1 165 ? -41.825 -27.105 -23.623 1.00 83.65  ? 188  PRO A CA  1 
ATOM   1199 C  C   . PRO A 1 165 ? -42.972 -28.054 -23.941 1.00 81.91  ? 188  PRO A C   1 
ATOM   1200 O  O   . PRO A 1 165 ? -43.815 -28.320 -23.081 1.00 75.19  ? 188  PRO A O   1 
ATOM   1201 C  CB  . PRO A 1 165 ? -42.186 -25.661 -24.007 1.00 86.50  ? 188  PRO A CB  1 
ATOM   1202 C  CG  . PRO A 1 165 ? -40.919 -25.043 -24.486 1.00 84.71  ? 188  PRO A CG  1 
ATOM   1203 C  CD  . PRO A 1 165 ? -40.147 -26.167 -25.130 1.00 85.58  ? 188  PRO A CD  1 
ATOM   1204 N  N   . ASN A 1 166 ? -42.999 -28.552 -25.176 1.00 86.87  ? 189  ASN A N   1 
ATOM   1205 C  CA  . ASN A 1 166 ? -44.025 -29.496 -25.608 1.00 92.17  ? 189  ASN A CA  1 
ATOM   1206 C  C   . ASN A 1 166 ? -43.549 -30.933 -25.556 1.00 83.18  ? 189  ASN A C   1 
ATOM   1207 O  O   . ASN A 1 166 ? -44.011 -31.745 -26.340 1.00 75.10  ? 189  ASN A O   1 
ATOM   1208 C  CB  . ASN A 1 166 ? -44.463 -29.210 -27.056 1.00 100.87 ? 189  ASN A CB  1 
ATOM   1209 C  CG  . ASN A 1 166 ? -45.172 -27.887 -27.210 1.00 111.81 ? 189  ASN A CG  1 
ATOM   1210 O  OD1 . ASN A 1 166 ? -46.336 -27.729 -26.808 1.00 109.57 ? 189  ASN A OD1 1 
ATOM   1211 N  ND2 . ASN A 1 166 ? -44.474 -26.917 -27.793 1.00 122.61 ? 189  ASN A ND2 1 
ATOM   1212 N  N   . THR A 1 167 ? -42.616 -31.271 -24.678 1.00 77.10  ? 190  THR A N   1 
ATOM   1213 C  CA  . THR A 1 167 ? -42.215 -32.667 -24.610 1.00 75.11  ? 190  THR A CA  1 
ATOM   1214 C  C   . THR A 1 167 ? -43.334 -33.431 -23.877 1.00 77.33  ? 190  THR A C   1 
ATOM   1215 O  O   . THR A 1 167 ? -44.068 -32.862 -23.075 1.00 79.52  ? 190  THR A O   1 
ATOM   1216 C  CB  . THR A 1 167 ? -40.816 -32.819 -23.970 1.00 73.65  ? 190  THR A CB  1 
ATOM   1217 O  OG1 . THR A 1 167 ? -39.819 -32.365 -24.892 1.00 73.75  ? 190  THR A OG1 1 
ATOM   1218 C  CG2 . THR A 1 167 ? -40.514 -34.274 -23.622 1.00 75.22  ? 190  THR A CG2 1 
ATOM   1219 N  N   . LYS A 1 168 ? -43.486 -34.715 -24.156 1.00 78.66  ? 191  LYS A N   1 
ATOM   1220 C  CA  . LYS A 1 168 ? -44.441 -35.490 -23.402 1.00 79.84  ? 191  LYS A CA  1 
ATOM   1221 C  C   . LYS A 1 168 ? -43.791 -35.952 -22.118 1.00 73.53  ? 191  LYS A C   1 
ATOM   1222 O  O   . LYS A 1 168 ? -42.659 -36.426 -22.106 1.00 61.26  ? 191  LYS A O   1 
ATOM   1223 C  CB  . LYS A 1 168 ? -44.979 -36.687 -24.191 1.00 87.95  ? 191  LYS A CB  1 
ATOM   1224 C  CG  . LYS A 1 168 ? -46.347 -36.457 -24.817 1.00 96.89  ? 191  LYS A CG  1 
ATOM   1225 C  CD  . LYS A 1 168 ? -46.923 -37.783 -25.244 1.00 104.47 ? 191  LYS A CD  1 
ATOM   1226 C  CE  . LYS A 1 168 ? -48.163 -37.595 -26.094 1.00 109.27 ? 191  LYS A CE  1 
ATOM   1227 N  NZ  . LYS A 1 168 ? -48.153 -38.621 -27.175 1.00 120.35 ? 191  LYS A NZ  1 
ATOM   1228 N  N   . GLU A 1 169 ? -44.530 -35.794 -21.029 1.00 74.90  ? 192  GLU A N   1 
ATOM   1229 C  CA  . GLU A 1 169 ? -44.170 -36.404 -19.763 1.00 72.39  ? 192  GLU A CA  1 
ATOM   1230 C  C   . GLU A 1 169 ? -43.812 -37.873 -19.959 1.00 66.53  ? 192  GLU A C   1 
ATOM   1231 O  O   . GLU A 1 169 ? -44.410 -38.550 -20.761 1.00 64.38  ? 192  GLU A O   1 
ATOM   1232 C  CB  . GLU A 1 169 ? -45.317 -36.284 -18.770 1.00 73.44  ? 192  GLU A CB  1 
ATOM   1233 C  CG  . GLU A 1 169 ? -45.411 -34.921 -18.106 1.00 81.49  ? 192  GLU A CG  1 
ATOM   1234 C  CD  . GLU A 1 169 ? -46.377 -34.943 -16.942 1.00 88.69  ? 192  GLU A CD  1 
ATOM   1235 O  OE1 . GLU A 1 169 ? -47.396 -35.654 -17.024 1.00 94.93  ? 192  GLU A OE1 1 
ATOM   1236 O  OE2 . GLU A 1 169 ? -46.105 -34.271 -15.932 1.00 101.03 ? 192  GLU A OE2 1 
ATOM   1237 N  N   . ALA A 1 170 ? -42.807 -38.335 -19.236 1.00 63.29  ? 193  ALA A N   1 
ATOM   1238 C  CA  . ALA A 1 170 ? -42.453 -39.720 -19.247 1.00 62.58  ? 193  ALA A CA  1 
ATOM   1239 C  C   . ALA A 1 170 ? -43.458 -40.471 -18.433 1.00 63.38  ? 193  ALA A C   1 
ATOM   1240 O  O   . ALA A 1 170 ? -43.816 -41.579 -18.779 1.00 63.29  ? 193  ALA A O   1 
ATOM   1241 C  CB  . ALA A 1 170 ? -41.085 -39.900 -18.645 1.00 67.25  ? 193  ALA A CB  1 
ATOM   1242 N  N   . ARG A 1 171 ? -43.896 -39.863 -17.328 1.00 67.53  ? 194  ARG A N   1 
ATOM   1243 C  CA  . ARG A 1 171 ? -44.879 -40.447 -16.428 1.00 66.15  ? 194  ARG A CA  1 
ATOM   1244 C  C   . ARG A 1 171 ? -44.412 -41.866 -16.059 1.00 61.70  ? 194  ARG A C   1 
ATOM   1245 O  O   . ARG A 1 171 ? -45.136 -42.841 -16.238 1.00 62.36  ? 194  ARG A O   1 
ATOM   1246 C  CB  . ARG A 1 171 ? -46.260 -40.374 -17.105 1.00 70.79  ? 194  ARG A CB  1 
ATOM   1247 C  CG  . ARG A 1 171 ? -47.490 -40.945 -16.392 1.00 82.15  ? 194  ARG A CG  1 
ATOM   1248 C  CD  . ARG A 1 171 ? -47.695 -40.478 -14.963 1.00 90.44  ? 194  ARG A CD  1 
ATOM   1249 N  NE  . ARG A 1 171 ? -48.147 -39.088 -14.866 1.00 101.90 ? 194  ARG A NE  1 
ATOM   1250 C  CZ  . ARG A 1 171 ? -48.480 -38.475 -13.724 1.00 100.65 ? 194  ARG A CZ  1 
ATOM   1251 N  NH1 . ARG A 1 171 ? -48.457 -39.126 -12.566 1.00 94.06  ? 194  ARG A NH1 1 
ATOM   1252 N  NH2 . ARG A 1 171 ? -48.850 -37.198 -13.744 1.00 104.18 ? 194  ARG A NH2 1 
ATOM   1253 N  N   . ILE A 1 172 ? -43.181 -41.964 -15.549 1.00 55.10  ? 195  ILE A N   1 
ATOM   1254 C  CA  . ILE A 1 172 ? -42.596 -43.232 -15.135 1.00 52.68  ? 195  ILE A CA  1 
ATOM   1255 C  C   . ILE A 1 172 ? -43.213 -43.718 -13.808 1.00 52.96  ? 195  ILE A C   1 
ATOM   1256 O  O   . ILE A 1 172 ? -43.269 -42.980 -12.851 1.00 49.43  ? 195  ILE A O   1 
ATOM   1257 C  CB  . ILE A 1 172 ? -41.051 -43.124 -14.934 1.00 52.27  ? 195  ILE A CB  1 
ATOM   1258 C  CG1 . ILE A 1 172 ? -40.341 -42.383 -16.113 1.00 51.67  ? 195  ILE A CG1 1 
ATOM   1259 C  CG2 . ILE A 1 172 ? -40.461 -44.508 -14.544 1.00 51.20  ? 195  ILE A CG2 1 
ATOM   1260 C  CD1 . ILE A 1 172 ? -38.826 -42.517 -16.136 1.00 50.35  ? 195  ILE A CD1 1 
ATOM   1261 N  N   . PRO A 1 173 ? -43.686 -44.975 -13.756 1.00 56.25  ? 196  PRO A N   1 
ATOM   1262 C  CA  . PRO A 1 173 ? -44.000 -45.614 -12.495 1.00 56.27  ? 196  PRO A CA  1 
ATOM   1263 C  C   . PRO A 1 173 ? -42.900 -45.416 -11.486 1.00 56.90  ? 196  PRO A C   1 
ATOM   1264 O  O   . PRO A 1 173 ? -41.741 -45.719 -11.776 1.00 57.90  ? 196  PRO A O   1 
ATOM   1265 C  CB  . PRO A 1 173 ? -44.071 -47.096 -12.859 1.00 55.79  ? 196  PRO A CB  1 
ATOM   1266 C  CG  . PRO A 1 173 ? -44.600 -47.074 -14.235 1.00 58.18  ? 196  PRO A CG  1 
ATOM   1267 C  CD  . PRO A 1 173 ? -44.051 -45.836 -14.892 1.00 58.24  ? 196  PRO A CD  1 
ATOM   1268 N  N   . VAL A 1 174 ? -43.287 -44.957 -10.298 1.00 57.28  ? 197  VAL A N   1 
ATOM   1269 C  CA  . VAL A 1 174 ? -42.367 -44.756 -9.188  1.00 55.25  ? 197  VAL A CA  1 
ATOM   1270 C  C   . VAL A 1 174 ? -41.510 -45.987 -8.867  1.00 55.90  ? 197  VAL A C   1 
ATOM   1271 O  O   . VAL A 1 174 ? -40.342 -45.859 -8.499  1.00 58.33  ? 197  VAL A O   1 
ATOM   1272 C  CB  . VAL A 1 174 ? -43.132 -44.316 -7.933  1.00 54.74  ? 197  VAL A CB  1 
ATOM   1273 C  CG1 . VAL A 1 174 ? -43.809 -45.493 -7.249  1.00 57.48  ? 197  VAL A CG1 1 
ATOM   1274 C  CG2 . VAL A 1 174 ? -42.199 -43.623 -6.961  1.00 56.45  ? 197  VAL A CG2 1 
ATOM   1275 N  N   . GLU A 1 175 ? -42.079 -47.178 -9.006  1.00 56.79  ? 198  GLU A N   1 
ATOM   1276 C  CA  . GLU A 1 175 ? -41.311 -48.391 -8.790  1.00 60.00  ? 198  GLU A CA  1 
ATOM   1277 C  C   . GLU A 1 175 ? -40.109 -48.470 -9.766  1.00 55.94  ? 198  GLU A C   1 
ATOM   1278 O  O   . GLU A 1 175 ? -39.050 -48.965 -9.396  1.00 53.65  ? 198  GLU A O   1 
ATOM   1279 C  CB  . GLU A 1 175 ? -42.208 -49.652 -8.781  1.00 63.93  ? 198  GLU A CB  1 
ATOM   1280 C  CG  . GLU A 1 175 ? -43.027 -49.915 -10.032 1.00 70.22  ? 198  GLU A CG  1 
ATOM   1281 C  CD  . GLU A 1 175 ? -44.429 -49.313 -9.988  1.00 77.85  ? 198  GLU A CD  1 
ATOM   1282 O  OE1 . GLU A 1 175 ? -44.624 -48.204 -9.423  1.00 74.96  ? 198  GLU A OE1 1 
ATOM   1283 O  OE2 . GLU A 1 175 ? -45.345 -49.965 -10.543 1.00 89.92  ? 198  GLU A OE2 1 
ATOM   1284 N  N   . LEU A 1 176 ? -40.251 -47.916 -10.964 1.00 52.39  ? 199  LEU A N   1 
ATOM   1285 C  CA  . LEU A 1 176 ? -39.194 -47.992 -11.974 1.00 58.24  ? 199  LEU A CA  1 
ATOM   1286 C  C   . LEU A 1 176 ? -38.162 -46.851 -11.999 1.00 62.16  ? 199  LEU A C   1 
ATOM   1287 O  O   . LEU A 1 176 ? -37.136 -46.928 -12.713 1.00 68.01  ? 199  LEU A O   1 
ATOM   1288 C  CB  . LEU A 1 176 ? -39.830 -48.087 -13.358 1.00 62.75  ? 199  LEU A CB  1 
ATOM   1289 C  CG  . LEU A 1 176 ? -40.445 -49.450 -13.721 1.00 59.60  ? 199  LEU A CG  1 
ATOM   1290 C  CD1 . LEU A 1 176 ? -41.355 -49.233 -14.921 1.00 61.75  ? 199  LEU A CD1 1 
ATOM   1291 C  CD2 . LEU A 1 176 ? -39.384 -50.496 -14.017 1.00 54.20  ? 199  LEU A CD2 1 
ATOM   1292 N  N   . LEU A 1 177 ? -38.441 -45.793 -11.248 1.00 61.91  ? 200  LEU A N   1 
ATOM   1293 C  CA  . LEU A 1 177 ? -37.465 -44.747 -10.987 1.00 58.79  ? 200  LEU A CA  1 
ATOM   1294 C  C   . LEU A 1 177 ? -36.283 -45.342 -10.183 1.00 57.79  ? 200  LEU A C   1 
ATOM   1295 O  O   . LEU A 1 177 ? -36.328 -46.510 -9.796  1.00 56.74  ? 200  LEU A O   1 
ATOM   1296 C  CB  . LEU A 1 177 ? -38.168 -43.604 -10.253 1.00 60.83  ? 200  LEU A CB  1 
ATOM   1297 C  CG  . LEU A 1 177 ? -39.149 -42.788 -11.114 1.00 65.15  ? 200  LEU A CG  1 
ATOM   1298 C  CD1 . LEU A 1 177 ? -39.949 -41.779 -10.306 1.00 64.69  ? 200  LEU A CD1 1 
ATOM   1299 C  CD2 . LEU A 1 177 ? -38.424 -42.044 -12.231 1.00 68.04  ? 200  LEU A CD2 1 
ATOM   1300 N  N   . PRO A 1 178 ? -35.212 -44.563 -9.956  1.00 55.58  ? 201  PRO A N   1 
ATOM   1301 C  CA  . PRO A 1 178 ? -34.038 -45.052 -9.233  1.00 57.45  ? 201  PRO A CA  1 
ATOM   1302 C  C   . PRO A 1 178 ? -34.341 -45.530 -7.828  1.00 58.47  ? 201  PRO A C   1 
ATOM   1303 O  O   . PRO A 1 178 ? -34.918 -44.778 -7.038  1.00 56.05  ? 201  PRO A O   1 
ATOM   1304 C  CB  . PRO A 1 178 ? -33.142 -43.823 -9.144  1.00 58.02  ? 201  PRO A CB  1 
ATOM   1305 C  CG  . PRO A 1 178 ? -33.533 -43.000 -10.302 1.00 59.38  ? 201  PRO A CG  1 
ATOM   1306 C  CD  . PRO A 1 178 ? -35.008 -43.200 -10.452 1.00 58.07  ? 201  PRO A CD  1 
ATOM   1307 N  N   . ARG A 1 179 ? -33.931 -46.758 -7.521  1.00 57.30  ? 202  ARG A N   1 
ATOM   1308 C  CA  . ARG A 1 179 ? -34.210 -47.331 -6.230  1.00 54.76  ? 202  ARG A CA  1 
ATOM   1309 C  C   . ARG A 1 179 ? -32.936 -47.689 -5.545  1.00 56.71  ? 202  ARG A C   1 
ATOM   1310 O  O   . ARG A 1 179 ? -31.907 -47.959 -6.195  1.00 59.84  ? 202  ARG A O   1 
ATOM   1311 C  CB  . ARG A 1 179 ? -35.025 -48.589 -6.389  1.00 53.53  ? 202  ARG A CB  1 
ATOM   1312 C  CG  . ARG A 1 179 ? -36.205 -48.438 -7.316  1.00 56.36  ? 202  ARG A CG  1 
ATOM   1313 C  CD  . ARG A 1 179 ? -37.237 -47.410 -6.846  1.00 57.73  ? 202  ARG A CD  1 
ATOM   1314 N  NE  . ARG A 1 179 ? -37.728 -47.720 -5.503  1.00 58.62  ? 202  ARG A NE  1 
ATOM   1315 C  CZ  . ARG A 1 179 ? -38.933 -47.424 -5.023  1.00 55.02  ? 202  ARG A CZ  1 
ATOM   1316 N  NH1 . ARG A 1 179 ? -39.851 -46.790 -5.749  1.00 53.36  ? 202  ARG A NH1 1 
ATOM   1317 N  NH2 . ARG A 1 179 ? -39.223 -47.788 -3.783  1.00 53.55  ? 202  ARG A NH2 1 
ATOM   1318 N  N   . CYS A 1 180 ? -33.042 -47.776 -4.227  1.00 55.65  ? 203  CYS A N   1 
ATOM   1319 C  CA  . CYS A 1 180 ? -31.927 -48.117 -3.346  1.00 55.89  ? 203  CYS A CA  1 
ATOM   1320 C  C   . CYS A 1 180 ? -31.464 -49.535 -3.558  1.00 56.70  ? 203  CYS A C   1 
ATOM   1321 O  O   . CYS A 1 180 ? -32.269 -50.436 -3.676  1.00 58.56  ? 203  CYS A O   1 
ATOM   1322 C  CB  . CYS A 1 180 ? -32.390 -48.019 -1.916  1.00 54.60  ? 203  CYS A CB  1 
ATOM   1323 S  SG  . CYS A 1 180 ? -31.110 -48.006 -0.673  1.00 51.79  ? 203  CYS A SG  1 
ATOM   1324 N  N   . GLU A 1 181 ? -30.167 -49.757 -3.557  1.00 57.07  ? 204  GLU A N   1 
ATOM   1325 C  CA  . GLU A 1 181 ? -29.689 -51.046 -3.946  1.00 64.26  ? 204  GLU A CA  1 
ATOM   1326 C  C   . GLU A 1 181 ? -29.514 -52.022 -2.781  1.00 72.88  ? 204  GLU A C   1 
ATOM   1327 O  O   . GLU A 1 181 ? -29.128 -53.160 -2.990  1.00 86.60  ? 204  GLU A O   1 
ATOM   1328 C  CB  . GLU A 1 181 ? -28.396 -50.886 -4.722  1.00 71.10  ? 204  GLU A CB  1 
ATOM   1329 C  CG  . GLU A 1 181 ? -28.421 -49.722 -5.705  1.00 76.91  ? 204  GLU A CG  1 
ATOM   1330 C  CD  . GLU A 1 181 ? -27.487 -49.964 -6.880  1.00 81.75  ? 204  GLU A CD  1 
ATOM   1331 O  OE1 . GLU A 1 181 ? -27.334 -51.139 -7.286  1.00 80.35  ? 204  GLU A OE1 1 
ATOM   1332 O  OE2 . GLU A 1 181 ? -26.862 -48.997 -7.373  1.00 89.51  ? 204  GLU A OE2 1 
ATOM   1333 N  N   . ARG A 1 182 ? -29.820 -51.637 -1.558  1.00 78.81  ? 205  ARG A N   1 
ATOM   1334 C  CA  . ARG A 1 182 ? -29.606 -52.567 -0.450  1.00 88.81  ? 205  ARG A CA  1 
ATOM   1335 C  C   . ARG A 1 182 ? -30.617 -53.718 -0.345  1.00 87.06  ? 205  ARG A C   1 
ATOM   1336 O  O   . ARG A 1 182 ? -30.571 -54.478 0.619   1.00 77.51  ? 205  ARG A O   1 
ATOM   1337 C  CB  . ARG A 1 182 ? -29.542 -51.813 0.872   1.00 100.35 ? 205  ARG A CB  1 
ATOM   1338 C  CG  . ARG A 1 182 ? -28.271 -51.003 1.084   1.00 100.76 ? 205  ARG A CG  1 
ATOM   1339 C  CD  . ARG A 1 182 ? -28.459 -50.058 2.268   1.00 102.78 ? 205  ARG A CD  1 
ATOM   1340 N  NE  . ARG A 1 182 ? -28.663 -50.787 3.547   1.00 103.61 ? 205  ARG A NE  1 
ATOM   1341 C  CZ  . ARG A 1 182 ? -29.807 -50.875 4.264   1.00 97.84  ? 205  ARG A CZ  1 
ATOM   1342 N  NH1 . ARG A 1 182 ? -30.954 -50.297 3.885   1.00 99.76  ? 205  ARG A NH1 1 
ATOM   1343 N  NH2 . ARG A 1 182 ? -29.808 -51.582 5.392   1.00 85.38  ? 205  ARG A NH2 1 
ATOM   1344 N  N   . LYS A 1 183 ? -31.495 -53.863 -1.336  1.00 91.79  ? 206  LYS A N   1 
ATOM   1345 C  CA  . LYS A 1 183 ? -32.283 -55.098 -1.546  1.00 95.36  ? 206  LYS A CA  1 
ATOM   1346 C  C   . LYS A 1 183 ? -33.321 -55.338 -0.480  1.00 92.42  ? 206  LYS A C   1 
ATOM   1347 O  O   . LYS A 1 183 ? -34.518 -55.358 -0.770  1.00 90.51  ? 206  LYS A O   1 
ATOM   1348 C  CB  . LYS A 1 183 ? -31.393 -56.332 -1.633  1.00 97.96  ? 206  LYS A CB  1 
ATOM   1349 C  CG  . LYS A 1 183 ? -30.402 -56.307 -2.782  1.00 104.71 ? 206  LYS A CG  1 
ATOM   1350 C  CD  . LYS A 1 183 ? -29.782 -57.683 -2.985  1.00 110.07 ? 206  LYS A CD  1 
ATOM   1351 C  CE  . LYS A 1 183 ? -28.786 -57.701 -4.133  1.00 109.09 ? 206  LYS A CE  1 
ATOM   1352 N  NZ  . LYS A 1 183 ? -28.576 -59.081 -4.656  1.00 106.05 ? 206  LYS A NZ  1 
ATOM   1353 N  N   . SER A 1 184 ? -32.856 -55.551 0.750   1.00 91.28  ? 207  SER A N   1 
ATOM   1354 C  CA  . SER A 1 184 ? -33.718 -55.461 1.924   1.00 86.53  ? 207  SER A CA  1 
ATOM   1355 C  C   . SER A 1 184 ? -34.407 -54.096 1.939   1.00 77.40  ? 207  SER A C   1 
ATOM   1356 O  O   . SER A 1 184 ? -35.460 -53.963 2.558   1.00 69.68  ? 207  SER A O   1 
ATOM   1357 C  CB  . SER A 1 184 ? -32.925 -55.684 3.233   1.00 89.13  ? 207  SER A CB  1 
ATOM   1358 O  OG  . SER A 1 184 ? -31.657 -55.042 3.194   1.00 94.76  ? 207  SER A OG  1 
ATOM   1359 N  N   . CYS A 1 185 ? -33.829 -53.095 1.260   1.00 67.90  ? 208  CYS A N   1 
ATOM   1360 C  CA  . CYS A 1 185 ? -34.409 -51.756 1.243   1.00 61.22  ? 208  CYS A CA  1 
ATOM   1361 C  C   . CYS A 1 185 ? -35.266 -51.438 0.038   1.00 56.70  ? 208  CYS A C   1 
ATOM   1362 O  O   . CYS A 1 185 ? -36.473 -51.254 0.148   1.00 56.19  ? 208  CYS A O   1 
ATOM   1363 C  CB  . CYS A 1 185 ? -33.321 -50.700 1.339   1.00 63.00  ? 208  CYS A CB  1 
ATOM   1364 S  SG  . CYS A 1 185 ? -34.088 -49.081 1.455   1.00 59.91  ? 208  CYS A SG  1 
ATOM   1365 N  N   . ASN A 1 186 ? -34.631 -51.340 -1.116  1.00 53.86  ? 209  ASN A N   1 
ATOM   1366 C  CA  . ASN A 1 186 ? -35.303 -50.856 -2.326  1.00 50.77  ? 209  ASN A CA  1 
ATOM   1367 C  C   . ASN A 1 186 ? -36.044 -49.506 -2.237  1.00 49.11  ? 209  ASN A C   1 
ATOM   1368 O  O   . ASN A 1 186 ? -36.988 -49.243 -2.993  1.00 44.95  ? 209  ASN A O   1 
ATOM   1369 C  CB  . ASN A 1 186 ? -36.252 -51.909 -2.879  1.00 48.63  ? 209  ASN A CB  1 
ATOM   1370 C  CG  . ASN A 1 186 ? -36.634 -51.617 -4.315  1.00 47.14  ? 209  ASN A CG  1 
ATOM   1371 O  OD1 . ASN A 1 186 ? -35.788 -51.357 -5.147  1.00 49.66  ? 209  ASN A OD1 1 
ATOM   1372 N  ND2 . ASN A 1 186 ? -37.900 -51.602 -4.590  1.00 47.14  ? 209  ASN A ND2 1 
ATOM   1373 N  N   . GLY A 1 187 ? -35.621 -48.657 -1.310  1.00 49.14  ? 210  GLY A N   1 
ATOM   1374 C  CA  . GLY A 1 187 ? -36.223 -47.353 -1.156  1.00 48.59  ? 210  GLY A CA  1 
ATOM   1375 C  C   . GLY A 1 187 ? -36.136 -46.582 -2.438  1.00 48.08  ? 210  GLY A C   1 
ATOM   1376 O  O   . GLY A 1 187 ? -35.327 -46.897 -3.315  1.00 48.75  ? 210  GLY A O   1 
ATOM   1377 N  N   . LEU A 1 188 ? -36.989 -45.578 -2.545  1.00 49.75  ? 211  LEU A N   1 
ATOM   1378 C  CA  . LEU A 1 188 ? -36.939 -44.665 -3.663  1.00 51.30  ? 211  LEU A CA  1 
ATOM   1379 C  C   . LEU A 1 188 ? -35.864 -43.652 -3.402  1.00 53.21  ? 211  LEU A C   1 
ATOM   1380 O  O   . LEU A 1 188 ? -35.715 -43.156 -2.269  1.00 58.62  ? 211  LEU A O   1 
ATOM   1381 C  CB  . LEU A 1 188 ? -38.261 -43.939 -3.835  1.00 55.08  ? 211  LEU A CB  1 
ATOM   1382 C  CG  . LEU A 1 188 ? -38.226 -42.743 -4.787  1.00 58.52  ? 211  LEU A CG  1 
ATOM   1383 C  CD1 . LEU A 1 188 ? -38.052 -43.256 -6.205  1.00 64.16  ? 211  LEU A CD1 1 
ATOM   1384 C  CD2 . LEU A 1 188 ? -39.470 -41.877 -4.702  1.00 56.45  ? 211  LEU A CD2 1 
ATOM   1385 N  N   . LEU A 1 189 ? -35.107 -43.336 -4.446  1.00 52.16  ? 212  LEU A N   1 
ATOM   1386 C  CA  . LEU A 1 189 ? -34.051 -42.363 -4.323  1.00 49.67  ? 212  LEU A CA  1 
ATOM   1387 C  C   . LEU A 1 189 ? -34.524 -41.018 -4.800  1.00 46.80  ? 212  LEU A C   1 
ATOM   1388 O  O   . LEU A 1 189 ? -35.361 -40.902 -5.703  1.00 44.88  ? 212  LEU A O   1 
ATOM   1389 C  CB  . LEU A 1 189 ? -32.831 -42.789 -5.120  1.00 51.53  ? 212  LEU A CB  1 
ATOM   1390 C  CG  . LEU A 1 189 ? -32.235 -44.161 -4.797  1.00 54.18  ? 212  LEU A CG  1 
ATOM   1391 C  CD1 . LEU A 1 189 ? -30.977 -44.360 -5.640  1.00 55.00  ? 212  LEU A CD1 1 
ATOM   1392 C  CD2 . LEU A 1 189 ? -31.934 -44.312 -3.317  1.00 53.17  ? 212  LEU A CD2 1 
ATOM   1393 N  N   . ARG A 1 190 ? -33.967 -40.001 -4.169  1.00 45.37  ? 213  ARG A N   1 
ATOM   1394 C  CA  . ARG A 1 190 ? -34.055 -38.645 -4.635  1.00 43.75  ? 213  ARG A CA  1 
ATOM   1395 C  C   . ARG A 1 190 ? -32.634 -38.110 -4.810  1.00 42.83  ? 213  ARG A C   1 
ATOM   1396 O  O   . ARG A 1 190 ? -31.670 -38.647 -4.216  1.00 42.61  ? 213  ARG A O   1 
ATOM   1397 C  CB  . ARG A 1 190 ? -34.766 -37.810 -3.588  1.00 45.21  ? 213  ARG A CB  1 
ATOM   1398 C  CG  . ARG A 1 190 ? -34.021 -37.722 -2.249  1.00 46.37  ? 213  ARG A CG  1 
ATOM   1399 C  CD  . ARG A 1 190 ? -34.618 -36.613 -1.380  1.00 47.62  ? 213  ARG A CD  1 
ATOM   1400 N  NE  . ARG A 1 190 ? -34.084 -35.292 -1.693  1.00 47.24  ? 213  ARG A NE  1 
ATOM   1401 C  CZ  . ARG A 1 190 ? -34.470 -34.153 -1.120  1.00 46.70  ? 213  ARG A CZ  1 
ATOM   1402 N  NH1 . ARG A 1 190 ? -35.407 -34.166 -0.205  1.00 47.62  ? 213  ARG A NH1 1 
ATOM   1403 N  NH2 . ARG A 1 190 ? -33.923 -32.993 -1.478  1.00 47.73  ? 213  ARG A NH2 1 
ATOM   1404 N  N   . PRO A 1 191 ? -32.494 -37.014 -5.564  1.00 40.83  ? 214  PRO A N   1 
ATOM   1405 C  CA  . PRO A 1 191 ? -31.212 -36.347 -5.654  1.00 39.71  ? 214  PRO A CA  1 
ATOM   1406 C  C   . PRO A 1 191 ? -30.821 -35.804 -4.312  1.00 38.15  ? 214  PRO A C   1 
ATOM   1407 O  O   . PRO A 1 191 ? -31.680 -35.336 -3.621  1.00 39.70  ? 214  PRO A O   1 
ATOM   1408 C  CB  . PRO A 1 191 ? -31.460 -35.179 -6.610  1.00 39.13  ? 214  PRO A CB  1 
ATOM   1409 C  CG  . PRO A 1 191 ? -32.770 -35.417 -7.217  1.00 40.76  ? 214  PRO A CG  1 
ATOM   1410 C  CD  . PRO A 1 191 ? -33.545 -36.248 -6.240  1.00 42.31  ? 214  PRO A CD  1 
ATOM   1411 N  N   . HIS A 1 192 ? -29.544 -35.878 -3.962  1.00 38.77  ? 215  HIS A N   1 
ATOM   1412 C  CA  . HIS A 1 192 ? -29.022 -35.386 -2.710  1.00 40.10  ? 215  HIS A CA  1 
ATOM   1413 C  C   . HIS A 1 192 ? -28.634 -33.950 -2.930  1.00 43.60  ? 215  HIS A C   1 
ATOM   1414 O  O   . HIS A 1 192 ? -27.459 -33.549 -2.934  1.00 42.05  ? 215  HIS A O   1 
ATOM   1415 C  CB  . HIS A 1 192 ? -27.832 -36.220 -2.287  1.00 41.41  ? 215  HIS A CB  1 
ATOM   1416 C  CG  . HIS A 1 192 ? -27.355 -35.951 -0.905  1.00 42.00  ? 215  HIS A CG  1 
ATOM   1417 N  ND1 . HIS A 1 192 ? -28.210 -35.838 0.165   1.00 45.22  ? 215  HIS A ND1 1 
ATOM   1418 C  CD2 . HIS A 1 192 ? -26.107 -35.849 -0.403  1.00 40.74  ? 215  HIS A CD2 1 
ATOM   1419 C  CE1 . HIS A 1 192 ? -27.504 -35.626 1.262   1.00 44.12  ? 215  HIS A CE1 1 
ATOM   1420 N  NE2 . HIS A 1 192 ? -26.227 -35.646 0.947   1.00 40.85  ? 215  HIS A NE2 1 
ATOM   1421 N  N   . VAL A 1 193 ? -29.691 -33.179 -3.124  1.00 50.05  ? 216  VAL A N   1 
ATOM   1422 C  CA  . VAL A 1 193 ? -29.642 -31.754 -3.316  1.00 54.34  ? 216  VAL A CA  1 
ATOM   1423 C  C   . VAL A 1 193 ? -30.548 -31.111 -2.275  1.00 51.01  ? 216  VAL A C   1 
ATOM   1424 O  O   . VAL A 1 193 ? -31.552 -31.689 -1.907  1.00 50.53  ? 216  VAL A O   1 
ATOM   1425 C  CB  . VAL A 1 193 ? -30.178 -31.444 -4.735  1.00 58.42  ? 216  VAL A CB  1 
ATOM   1426 C  CG1 . VAL A 1 193 ? -30.842 -30.063 -4.862  1.00 60.25  ? 216  VAL A CG1 1 
ATOM   1427 C  CG2 . VAL A 1 193 ? -29.052 -31.638 -5.747  1.00 60.42  ? 216  VAL A CG2 1 
ATOM   1428 N  N   . VAL A 1 194 ? -30.187 -29.917 -1.823  1.00 47.76  ? 217  VAL A N   1 
ATOM   1429 C  CA  . VAL A 1 194 ? -31.051 -29.141 -0.973  1.00 47.47  ? 217  VAL A CA  1 
ATOM   1430 C  C   . VAL A 1 194 ? -32.082 -28.432 -1.836  1.00 49.65  ? 217  VAL A C   1 
ATOM   1431 O  O   . VAL A 1 194 ? -31.734 -27.617 -2.700  1.00 47.64  ? 217  VAL A O   1 
ATOM   1432 C  CB  . VAL A 1 194 ? -30.288 -28.087 -0.174  1.00 47.58  ? 217  VAL A CB  1 
ATOM   1433 C  CG1 . VAL A 1 194 ? -31.229 -27.414 0.814   1.00 45.25  ? 217  VAL A CG1 1 
ATOM   1434 C  CG2 . VAL A 1 194 ? -29.124 -28.730 0.573   1.00 49.67  ? 217  VAL A CG2 1 
ATOM   1435 N  N   . TRP A 1 195 ? -33.351 -28.732 -1.560  1.00 50.81  ? 218  TRP A N   1 
ATOM   1436 C  CA  . TRP A 1 195 ? -34.438 -28.131 -2.261  1.00 54.22  ? 218  TRP A CA  1 
ATOM   1437 C  C   . TRP A 1 195 ? -34.911 -26.858 -1.564  1.00 55.96  ? 218  TRP A C   1 
ATOM   1438 O  O   . TRP A 1 195 ? -34.422 -26.518 -0.488  1.00 53.11  ? 218  TRP A O   1 
ATOM   1439 C  CB  . TRP A 1 195 ? -35.577 -29.122 -2.386  1.00 56.02  ? 218  TRP A CB  1 
ATOM   1440 C  CG  . TRP A 1 195 ? -35.369 -30.075 -3.483  1.00 59.39  ? 218  TRP A CG  1 
ATOM   1441 C  CD1 . TRP A 1 195 ? -34.696 -29.846 -4.656  1.00 65.10  ? 218  TRP A CD1 1 
ATOM   1442 C  CD2 . TRP A 1 195 ? -35.858 -31.413 -3.562  1.00 59.18  ? 218  TRP A CD2 1 
ATOM   1443 N  NE1 . TRP A 1 195 ? -34.717 -30.970 -5.447  1.00 65.47  ? 218  TRP A NE1 1 
ATOM   1444 C  CE2 . TRP A 1 195 ? -35.425 -31.946 -4.802  1.00 60.93  ? 218  TRP A CE2 1 
ATOM   1445 C  CE3 . TRP A 1 195 ? -36.622 -32.212 -2.712  1.00 56.59  ? 218  TRP A CE3 1 
ATOM   1446 C  CZ2 . TRP A 1 195 ? -35.726 -33.233 -5.203  1.00 58.20  ? 218  TRP A CZ2 1 
ATOM   1447 C  CZ3 . TRP A 1 195 ? -36.917 -33.495 -3.108  1.00 57.14  ? 218  TRP A CZ3 1 
ATOM   1448 C  CH2 . TRP A 1 195 ? -36.468 -33.998 -4.344  1.00 59.01  ? 218  TRP A CH2 1 
ATOM   1449 N  N   . PHE A 1 196 ? -35.819 -26.128 -2.221  1.00 54.01  ? 219  PHE A N   1 
ATOM   1450 C  CA  . PHE A 1 196 ? -36.455 -24.982 -1.610  1.00 51.49  ? 219  PHE A CA  1 
ATOM   1451 C  C   . PHE A 1 196 ? -37.352 -25.445 -0.462  1.00 53.88  ? 219  PHE A C   1 
ATOM   1452 O  O   . PHE A 1 196 ? -38.007 -26.493 -0.546  1.00 49.84  ? 219  PHE A O   1 
ATOM   1453 C  CB  . PHE A 1 196 ? -37.224 -24.185 -2.634  1.00 52.70  ? 219  PHE A CB  1 
ATOM   1454 C  CG  . PHE A 1 196 ? -36.340 -23.462 -3.606  1.00 58.53  ? 219  PHE A CG  1 
ATOM   1455 C  CD1 . PHE A 1 196 ? -35.543 -22.409 -3.176  1.00 62.11  ? 219  PHE A CD1 1 
ATOM   1456 C  CD2 . PHE A 1 196 ? -36.283 -23.837 -4.949  1.00 62.74  ? 219  PHE A CD2 1 
ATOM   1457 C  CE1 . PHE A 1 196 ? -34.704 -21.743 -4.057  1.00 61.62  ? 219  PHE A CE1 1 
ATOM   1458 C  CE2 . PHE A 1 196 ? -35.451 -23.174 -5.843  1.00 64.68  ? 219  PHE A CE2 1 
ATOM   1459 C  CZ  . PHE A 1 196 ? -34.658 -22.124 -5.391  1.00 64.86  ? 219  PHE A CZ  1 
ATOM   1460 N  N   . GLY A 1 197 ? -37.313 -24.676 0.632   1.00 52.10  ? 220  GLY A N   1 
ATOM   1461 C  CA  . GLY A 1 197 ? -37.908 -25.084 1.883   1.00 49.74  ? 220  GLY A CA  1 
ATOM   1462 C  C   . GLY A 1 197 ? -37.170 -26.181 2.662   1.00 54.78  ? 220  GLY A C   1 
ATOM   1463 O  O   . GLY A 1 197 ? -37.734 -26.758 3.595   1.00 59.81  ? 220  GLY A O   1 
ATOM   1464 N  N   . GLU A 1 198 ? -35.914 -26.492 2.347   1.00 56.84  ? 221  GLU A N   1 
ATOM   1465 C  CA  . GLU A 1 198 ? -35.173 -27.457 3.186   1.00 58.45  ? 221  GLU A CA  1 
ATOM   1466 C  C   . GLU A 1 198 ? -34.024 -26.792 3.958   1.00 60.43  ? 221  GLU A C   1 
ATOM   1467 O  O   . GLU A 1 198 ? -33.459 -25.782 3.511   1.00 58.40  ? 221  GLU A O   1 
ATOM   1468 C  CB  . GLU A 1 198 ? -34.632 -28.603 2.346   1.00 58.06  ? 221  GLU A CB  1 
ATOM   1469 C  CG  . GLU A 1 198 ? -35.637 -29.184 1.388   1.00 54.42  ? 221  GLU A CG  1 
ATOM   1470 C  CD  . GLU A 1 198 ? -35.221 -30.549 0.918   1.00 55.48  ? 221  GLU A CD  1 
ATOM   1471 O  OE1 . GLU A 1 198 ? -34.065 -30.744 0.472   1.00 58.60  ? 221  GLU A OE1 1 
ATOM   1472 O  OE2 . GLU A 1 198 ? -36.049 -31.453 1.031   1.00 56.17  ? 221  GLU A OE2 1 
ATOM   1473 N  N   . THR A 1 199 ? -33.643 -27.373 5.094   1.00 58.12  ? 222  THR A N   1 
ATOM   1474 C  CA  . THR A 1 199 ? -32.530 -26.816 5.833   1.00 55.80  ? 222  THR A CA  1 
ATOM   1475 C  C   . THR A 1 199 ? -31.235 -27.390 5.350   1.00 51.77  ? 222  THR A C   1 
ATOM   1476 O  O   . THR A 1 199 ? -31.183 -28.512 4.892   1.00 49.10  ? 222  THR A O   1 
ATOM   1477 C  CB  . THR A 1 199 ? -32.619 -27.112 7.325   1.00 57.63  ? 222  THR A CB  1 
ATOM   1478 O  OG1 . THR A 1 199 ? -33.004 -28.475 7.509   1.00 57.88  ? 222  THR A OG1 1 
ATOM   1479 C  CG2 . THR A 1 199 ? -33.634 -26.196 7.944   1.00 61.42  ? 222  THR A CG2 1 
ATOM   1480 N  N   . LEU A 1 200 ? -30.188 -26.581 5.465   1.00 49.84  ? 223  LEU A N   1 
ATOM   1481 C  CA  . LEU A 1 200 ? -28.836 -27.035 5.275   1.00 47.03  ? 223  LEU A CA  1 
ATOM   1482 C  C   . LEU A 1 200 ? -28.466 -28.047 6.381   1.00 51.81  ? 223  LEU A C   1 
ATOM   1483 O  O   . LEU A 1 200 ? -29.110 -28.102 7.433   1.00 56.91  ? 223  LEU A O   1 
ATOM   1484 C  CB  . LEU A 1 200 ? -27.908 -25.841 5.280   1.00 42.66  ? 223  LEU A CB  1 
ATOM   1485 C  CG  . LEU A 1 200 ? -27.773 -25.088 3.949   1.00 42.64  ? 223  LEU A CG  1 
ATOM   1486 C  CD1 . LEU A 1 200 ? -29.067 -24.859 3.230   1.00 42.17  ? 223  LEU A CD1 1 
ATOM   1487 C  CD2 . LEU A 1 200 ? -27.055 -23.758 4.133   1.00 42.74  ? 223  LEU A CD2 1 
ATOM   1488 N  N   . ASP A 1 201 ? -27.463 -28.872 6.096   1.00 53.28  ? 224  ASP A N   1 
ATOM   1489 C  CA  . ASP A 1 201 ? -26.963 -29.894 7.017   1.00 53.15  ? 224  ASP A CA  1 
ATOM   1490 C  C   . ASP A 1 201 ? -26.135 -29.203 8.058   1.00 55.16  ? 224  ASP A C   1 
ATOM   1491 O  O   . ASP A 1 201 ? -25.224 -28.475 7.706   1.00 61.44  ? 224  ASP A O   1 
ATOM   1492 C  CB  . ASP A 1 201 ? -26.090 -30.880 6.247   1.00 52.95  ? 224  ASP A CB  1 
ATOM   1493 C  CG  . ASP A 1 201 ? -25.458 -31.939 7.131   1.00 54.75  ? 224  ASP A CG  1 
ATOM   1494 O  OD1 . ASP A 1 201 ? -25.525 -31.887 8.376   1.00 60.73  ? 224  ASP A OD1 1 
ATOM   1495 O  OD2 . ASP A 1 201 ? -24.844 -32.839 6.566   1.00 56.28  ? 224  ASP A OD2 1 
ATOM   1496 N  N   . SER A 1 202 ? -26.398 -29.448 9.334   1.00 56.47  ? 225  SER A N   1 
ATOM   1497 C  CA  . SER A 1 202 ? -25.690 -28.719 10.400  1.00 59.46  ? 225  SER A CA  1 
ATOM   1498 C  C   . SER A 1 202 ? -24.265 -29.164 10.563  1.00 56.61  ? 225  SER A C   1 
ATOM   1499 O  O   . SER A 1 202 ? -23.415 -28.340 10.865  1.00 52.36  ? 225  SER A O   1 
ATOM   1500 C  CB  . SER A 1 202 ? -26.361 -28.929 11.755  1.00 64.92  ? 225  SER A CB  1 
ATOM   1501 O  OG  . SER A 1 202 ? -27.769 -28.903 11.624  1.00 69.12  ? 225  SER A OG  1 
ATOM   1502 N  N   . ASP A 1 203 ? -24.026 -30.470 10.428  1.00 57.09  ? 226  ASP A N   1 
ATOM   1503 C  CA  . ASP A 1 203 ? -22.666 -31.013 10.428  1.00 60.43  ? 226  ASP A CA  1 
ATOM   1504 C  C   . ASP A 1 203 ? -21.798 -30.219 9.462   1.00 55.53  ? 226  ASP A C   1 
ATOM   1505 O  O   . ASP A 1 203 ? -20.712 -29.742 9.822   1.00 54.09  ? 226  ASP A O   1 
ATOM   1506 C  CB  . ASP A 1 203 ? -22.648 -32.484 10.038  1.00 66.32  ? 226  ASP A CB  1 
ATOM   1507 C  CG  . ASP A 1 203 ? -23.328 -33.353 11.066  1.00 74.99  ? 226  ASP A CG  1 
ATOM   1508 O  OD1 . ASP A 1 203 ? -22.784 -33.451 12.197  1.00 79.23  ? 226  ASP A OD1 1 
ATOM   1509 O  OD2 . ASP A 1 203 ? -24.403 -33.925 10.735  1.00 75.81  ? 226  ASP A OD2 1 
ATOM   1510 N  N   . ILE A 1 204 ? -22.285 -30.052 8.240   1.00 49.83  ? 227  ILE A N   1 
ATOM   1511 C  CA  . ILE A 1 204 ? -21.536 -29.282 7.251   1.00 46.61  ? 227  ILE A CA  1 
ATOM   1512 C  C   . ILE A 1 204 ? -21.306 -27.856 7.730   1.00 47.03  ? 227  ILE A C   1 
ATOM   1513 O  O   . ILE A 1 204 ? -20.171 -27.412 7.822   1.00 46.45  ? 227  ILE A O   1 
ATOM   1514 C  CB  . ILE A 1 204 ? -22.237 -29.263 5.890   1.00 44.93  ? 227  ILE A CB  1 
ATOM   1515 C  CG1 . ILE A 1 204 ? -22.431 -30.674 5.360   1.00 44.56  ? 227  ILE A CG1 1 
ATOM   1516 C  CG2 . ILE A 1 204 ? -21.378 -28.568 4.879   1.00 45.37  ? 227  ILE A CG2 1 
ATOM   1517 C  CD1 . ILE A 1 204 ? -22.820 -30.750 3.900   1.00 43.86  ? 227  ILE A CD1 1 
ATOM   1518 N  N   . LEU A 1 205 ? -22.377 -27.151 8.085   1.00 48.51  ? 228  LEU A N   1 
ATOM   1519 C  CA  . LEU A 1 205 ? -22.251 -25.769 8.569   1.00 47.76  ? 228  LEU A CA  1 
ATOM   1520 C  C   . LEU A 1 205 ? -21.300 -25.584 9.743   1.00 46.27  ? 228  LEU A C   1 
ATOM   1521 O  O   . LEU A 1 205 ? -20.642 -24.558 9.843   1.00 46.87  ? 228  LEU A O   1 
ATOM   1522 C  CB  . LEU A 1 205 ? -23.612 -25.210 8.944   1.00 49.52  ? 228  LEU A CB  1 
ATOM   1523 C  CG  . LEU A 1 205 ? -24.593 -24.932 7.789   1.00 50.79  ? 228  LEU A CG  1 
ATOM   1524 C  CD1 . LEU A 1 205 ? -25.988 -24.583 8.319   1.00 52.28  ? 228  LEU A CD1 1 
ATOM   1525 C  CD2 . LEU A 1 205 ? -24.096 -23.820 6.887   1.00 48.43  ? 228  LEU A CD2 1 
ATOM   1526 N  N   . THR A 1 206 ? -21.214 -26.567 10.629  1.00 46.06  ? 229  THR A N   1 
ATOM   1527 C  CA  . THR A 1 206 ? -20.299 -26.456 11.755  1.00 48.49  ? 229  THR A CA  1 
ATOM   1528 C  C   . THR A 1 206 ? -18.885 -26.497 11.301  1.00 46.91  ? 229  THR A C   1 
ATOM   1529 O  O   . THR A 1 206 ? -18.009 -25.910 11.937  1.00 48.72  ? 229  THR A O   1 
ATOM   1530 C  CB  . THR A 1 206 ? -20.326 -27.658 12.700  1.00 53.01  ? 229  THR A CB  1 
ATOM   1531 O  OG1 . THR A 1 206 ? -21.652 -28.186 12.849  1.00 61.77  ? 229  THR A OG1 1 
ATOM   1532 C  CG2 . THR A 1 206 ? -19.729 -27.279 14.062  1.00 55.00  ? 229  THR A CG2 1 
ATOM   1533 N  N   . ALA A 1 207 ? -18.653 -27.311 10.280  1.00 45.26  ? 230  ALA A N   1 
ATOM   1534 C  CA  . ALA A 1 207 ? -17.337 -27.435 9.683   1.00 45.60  ? 230  ALA A CA  1 
ATOM   1535 C  C   . ALA A 1 207 ? -16.923 -26.139 9.029   1.00 45.34  ? 230  ALA A C   1 
ATOM   1536 O  O   . ALA A 1 207 ? -15.822 -25.622 9.231   1.00 46.02  ? 230  ALA A O   1 
ATOM   1537 C  CB  . ALA A 1 207 ? -17.340 -28.534 8.645   1.00 46.88  ? 230  ALA A CB  1 
ATOM   1538 N  N   . VAL A 1 208 ? -17.845 -25.606 8.255   1.00 45.26  ? 231  VAL A N   1 
ATOM   1539 C  CA  . VAL A 1 208 ? -17.578 -24.426 7.479   1.00 45.29  ? 231  VAL A CA  1 
ATOM   1540 C  C   . VAL A 1 208 ? -17.258 -23.284 8.418   1.00 44.83  ? 231  VAL A C   1 
ATOM   1541 O  O   . VAL A 1 208 ? -16.358 -22.477 8.161   1.00 39.37  ? 231  VAL A O   1 
ATOM   1542 C  CB  . VAL A 1 208 ? -18.804 -24.094 6.619   1.00 46.52  ? 231  VAL A CB  1 
ATOM   1543 C  CG1 . VAL A 1 208 ? -18.580 -22.801 5.873   1.00 46.20  ? 231  VAL A CG1 1 
ATOM   1544 C  CG2 . VAL A 1 208 ? -19.060 -25.216 5.623   1.00 47.92  ? 231  VAL A CG2 1 
ATOM   1545 N  N   . GLU A 1 209 ? -18.017 -23.242 9.510   1.00 47.14  ? 232  GLU A N   1 
ATOM   1546 C  CA  . GLU A 1 209 ? -17.783 -22.278 10.532  1.00 53.30  ? 232  GLU A CA  1 
ATOM   1547 C  C   . GLU A 1 209 ? -16.343 -22.413 11.013  1.00 55.08  ? 232  GLU A C   1 
ATOM   1548 O  O   . GLU A 1 209 ? -15.578 -21.434 11.008  1.00 52.75  ? 232  GLU A O   1 
ATOM   1549 C  CB  . GLU A 1 209 ? -18.751 -22.504 11.686  1.00 58.32  ? 232  GLU A CB  1 
ATOM   1550 C  CG  . GLU A 1 209 ? -18.659 -21.453 12.796  1.00 59.53  ? 232  GLU A CG  1 
ATOM   1551 C  CD  . GLU A 1 209 ? -19.243 -21.936 14.096  1.00 56.00  ? 232  GLU A CD  1 
ATOM   1552 O  OE1 . GLU A 1 209 ? -19.016 -23.127 14.466  1.00 56.66  ? 232  GLU A OE1 1 
ATOM   1553 O  OE2 . GLU A 1 209 ? -19.876 -21.099 14.747  1.00 51.53  ? 232  GLU A OE2 1 
ATOM   1554 N  N   . ARG A 1 210 ? -15.964 -23.620 11.426  1.00 57.64  ? 233  ARG A N   1 
ATOM   1555 C  CA  . ARG A 1 210 ? -14.607 -23.827 11.920  1.00 59.39  ? 233  ARG A CA  1 
ATOM   1556 C  C   . ARG A 1 210 ? -13.611 -23.288 10.907  1.00 58.16  ? 233  ARG A C   1 
ATOM   1557 O  O   . ARG A 1 210 ? -12.670 -22.582 11.269  1.00 58.40  ? 233  ARG A O   1 
ATOM   1558 C  CB  . ARG A 1 210 ? -14.328 -25.283 12.235  1.00 60.10  ? 233  ARG A CB  1 
ATOM   1559 C  CG  . ARG A 1 210 ? -13.012 -25.493 12.917  1.00 62.61  ? 233  ARG A CG  1 
ATOM   1560 C  CD  . ARG A 1 210 ? -12.850 -26.942 13.322  1.00 70.47  ? 233  ARG A CD  1 
ATOM   1561 N  NE  . ARG A 1 210 ? -11.559 -27.105 13.984  1.00 78.92  ? 233  ARG A NE  1 
ATOM   1562 C  CZ  . ARG A 1 210 ? -11.222 -28.105 14.785  1.00 77.30  ? 233  ARG A CZ  1 
ATOM   1563 N  NH1 . ARG A 1 210 ? -12.087 -29.079 15.046  1.00 78.10  ? 233  ARG A NH1 1 
ATOM   1564 N  NH2 . ARG A 1 210 ? -10.005 -28.120 15.325  1.00 74.88  ? 233  ARG A NH2 1 
ATOM   1565 N  N   . GLU A 1 211 ? -13.853 -23.576 9.634   1.00 57.31  ? 234  GLU A N   1 
ATOM   1566 C  CA  . GLU A 1 211 ? -12.925 -23.176 8.571   1.00 55.53  ? 234  GLU A CA  1 
ATOM   1567 C  C   . GLU A 1 211 ? -12.857 -21.677 8.379   1.00 54.96  ? 234  GLU A C   1 
ATOM   1568 O  O   . GLU A 1 211 ? -11.803 -21.124 8.166   1.00 53.08  ? 234  GLU A O   1 
ATOM   1569 C  CB  . GLU A 1 211 ? -13.323 -23.829 7.278   1.00 54.90  ? 234  GLU A CB  1 
ATOM   1570 C  CG  . GLU A 1 211 ? -13.304 -25.345 7.383   1.00 56.52  ? 234  GLU A CG  1 
ATOM   1571 C  CD  . GLU A 1 211 ? -12.008 -25.953 6.935   1.00 55.21  ? 234  GLU A CD  1 
ATOM   1572 O  OE1 . GLU A 1 211 ? -10.938 -25.323 7.131   1.00 48.31  ? 234  GLU A OE1 1 
ATOM   1573 O  OE2 . GLU A 1 211 ? -12.105 -27.056 6.345   1.00 57.80  ? 234  GLU A OE2 1 
ATOM   1574 N  N   . LEU A 1 212 ? -13.979 -20.997 8.509   1.00 58.66  ? 235  LEU A N   1 
ATOM   1575 C  CA  . LEU A 1 212 ? -13.958 -19.547 8.356   1.00 56.44  ? 235  LEU A CA  1 
ATOM   1576 C  C   . LEU A 1 212 ? -13.410 -18.839 9.564   1.00 57.60  ? 235  LEU A C   1 
ATOM   1577 O  O   . LEU A 1 212 ? -12.932 -17.713 9.469   1.00 55.19  ? 235  LEU A O   1 
ATOM   1578 C  CB  . LEU A 1 212 ? -15.352 -19.068 8.080   1.00 56.81  ? 235  LEU A CB  1 
ATOM   1579 C  CG  . LEU A 1 212 ? -15.891 -19.587 6.751   1.00 55.23  ? 235  LEU A CG  1 
ATOM   1580 C  CD1 . LEU A 1 212 ? -17.384 -19.385 6.719   1.00 53.38  ? 235  LEU A CD1 1 
ATOM   1581 C  CD2 . LEU A 1 212 ? -15.232 -18.865 5.592   1.00 54.14  ? 235  LEU A CD2 1 
ATOM   1582 N  N   . GLU A 1 213 ? -13.485 -19.503 10.709  1.00 60.54  ? 236  GLU A N   1 
ATOM   1583 C  CA  . GLU A 1 213 ? -12.899 -18.938 11.888  1.00 63.98  ? 236  GLU A CA  1 
ATOM   1584 C  C   . GLU A 1 213 ? -11.396 -18.991 11.761  1.00 64.09  ? 236  GLU A C   1 
ATOM   1585 O  O   . GLU A 1 213 ? -10.745 -18.091 12.241  1.00 63.94  ? 236  GLU A O   1 
ATOM   1586 C  CB  . GLU A 1 213 ? -13.418 -19.602 13.155  1.00 68.94  ? 236  GLU A CB  1 
ATOM   1587 C  CG  . GLU A 1 213 ? -13.106 -18.835 14.425  1.00 72.62  ? 236  GLU A CG  1 
ATOM   1588 C  CD  . GLU A 1 213 ? -13.734 -17.444 14.502  1.00 74.26  ? 236  GLU A CD  1 
ATOM   1589 O  OE1 . GLU A 1 213 ? -14.620 -17.096 13.681  1.00 68.06  ? 236  GLU A OE1 1 
ATOM   1590 O  OE2 . GLU A 1 213 ? -13.306 -16.686 15.404  1.00 82.87  ? 236  GLU A OE2 1 
ATOM   1591 N  N   . LYS A 1 214 ? -10.850 -19.993 11.067  1.00 66.33  ? 237  LYS A N   1 
ATOM   1592 C  CA  . LYS A 1 214 ? -9.382  -20.106 10.883  1.00 69.91  ? 237  LYS A CA  1 
ATOM   1593 C  C   . LYS A 1 214 ? -8.796  -19.338 9.705   1.00 61.90  ? 237  LYS A C   1 
ATOM   1594 O  O   . LYS A 1 214 ? -7.572  -19.226 9.592   1.00 63.20  ? 237  LYS A O   1 
ATOM   1595 C  CB  . LYS A 1 214 ? -8.960  -21.580 10.770  1.00 77.46  ? 237  LYS A CB  1 
ATOM   1596 C  CG  . LYS A 1 214 ? -9.353  -22.318 12.057  1.00 91.55  ? 237  LYS A CG  1 
ATOM   1597 C  CD  . LYS A 1 214 ? -8.682  -23.689 12.303  1.00 97.71  ? 237  LYS A CD  1 
ATOM   1598 C  CE  . LYS A 1 214 ? -8.198  -23.838 13.753  1.00 97.57  ? 237  LYS A CE  1 
ATOM   1599 N  NZ  . LYS A 1 214 ? -7.327  -25.031 13.941  1.00 97.14  ? 237  LYS A NZ  1 
ATOM   1600 N  N   . CYS A 1 215 ? -9.627  -18.803 8.826   1.00 54.27  ? 238  CYS A N   1 
ATOM   1601 C  CA  . CYS A 1 215 ? -9.081  -18.356 7.566   1.00 55.24  ? 238  CYS A CA  1 
ATOM   1602 C  C   . CYS A 1 215 ? -8.561  -16.955 7.704   1.00 52.89  ? 238  CYS A C   1 
ATOM   1603 O  O   . CYS A 1 215 ? -9.100  -16.205 8.478   1.00 57.45  ? 238  CYS A O   1 
ATOM   1604 C  CB  . CYS A 1 215 ? -10.107 -18.477 6.459   1.00 55.96  ? 238  CYS A CB  1 
ATOM   1605 S  SG  . CYS A 1 215 ? -11.179 -17.060 6.239   1.00 62.39  ? 238  CYS A SG  1 
ATOM   1606 N  N   . ASP A 1 216 ? -7.483  -16.626 6.999   1.00 52.66  ? 239  ASP A N   1 
ATOM   1607 C  CA  . ASP A 1 216 ? -6.928  -15.272 7.014   1.00 56.77  ? 239  ASP A CA  1 
ATOM   1608 C  C   . ASP A 1 216 ? -7.054  -14.546 5.666   1.00 61.87  ? 239  ASP A C   1 
ATOM   1609 O  O   . ASP A 1 216 ? -6.455  -13.477 5.455   1.00 67.15  ? 239  ASP A O   1 
ATOM   1610 C  CB  . ASP A 1 216 ? -5.478  -15.266 7.501   1.00 59.89  ? 239  ASP A CB  1 
ATOM   1611 C  CG  . ASP A 1 216 ? -4.569  -16.176 6.703   1.00 59.86  ? 239  ASP A CG  1 
ATOM   1612 O  OD1 . ASP A 1 216 ? -5.008  -16.684 5.635   1.00 59.07  ? 239  ASP A OD1 1 
ATOM   1613 O  OD2 . ASP A 1 216 ? -3.411  -16.379 7.167   1.00 55.28  ? 239  ASP A OD2 1 
ATOM   1614 N  N   . LEU A 1 217 ? -7.886  -15.106 4.791   1.00 62.75  ? 240  LEU A N   1 
ATOM   1615 C  CA  . LEU A 1 217 ? -8.285  -14.480 3.549   1.00 57.05  ? 240  LEU A CA  1 
ATOM   1616 C  C   . LEU A 1 217 ? -9.499  -15.220 3.018   1.00 57.59  ? 240  LEU A C   1 
ATOM   1617 O  O   . LEU A 1 217 ? -9.576  -16.441 3.102   1.00 64.79  ? 240  LEU A O   1 
ATOM   1618 C  CB  . LEU A 1 217 ? -7.174  -14.622 2.550   1.00 59.84  ? 240  LEU A CB  1 
ATOM   1619 C  CG  . LEU A 1 217 ? -7.421  -14.062 1.160   1.00 62.96  ? 240  LEU A CG  1 
ATOM   1620 C  CD1 . LEU A 1 217 ? -7.790  -12.583 1.211   1.00 65.60  ? 240  LEU A CD1 1 
ATOM   1621 C  CD2 . LEU A 1 217 ? -6.159  -14.262 0.330   1.00 63.59  ? 240  LEU A CD2 1 
ATOM   1622 N  N   . CYS A 1 218 ? -10.440 -14.497 2.441   1.00 53.76  ? 241  CYS A N   1 
ATOM   1623 C  CA  . CYS A 1 218 ? -11.677 -15.098 1.970   1.00 48.41  ? 241  CYS A CA  1 
ATOM   1624 C  C   . CYS A 1 218 ? -12.013 -14.573 0.603   1.00 47.36  ? 241  CYS A C   1 
ATOM   1625 O  O   . CYS A 1 218 ? -12.085 -13.377 0.426   1.00 48.30  ? 241  CYS A O   1 
ATOM   1626 C  CB  . CYS A 1 218 ? -12.803 -14.753 2.924   1.00 47.04  ? 241  CYS A CB  1 
ATOM   1627 S  SG  . CYS A 1 218 ? -14.459 -15.218 2.357   1.00 50.96  ? 241  CYS A SG  1 
ATOM   1628 N  N   . LEU A 1 219 ? -12.221 -15.456 -0.366  1.00 45.91  ? 242  LEU A N   1 
ATOM   1629 C  CA  . LEU A 1 219 ? -12.710 -15.048 -1.663  1.00 47.81  ? 242  LEU A CA  1 
ATOM   1630 C  C   . LEU A 1 219 ? -14.166 -15.416 -1.838  1.00 50.05  ? 242  LEU A C   1 
ATOM   1631 O  O   . LEU A 1 219 ? -14.628 -16.403 -1.321  1.00 52.13  ? 242  LEU A O   1 
ATOM   1632 C  CB  . LEU A 1 219 ? -11.901 -15.685 -2.780  1.00 51.05  ? 242  LEU A CB  1 
ATOM   1633 C  CG  . LEU A 1 219 ? -10.519 -15.084 -3.043  1.00 54.38  ? 242  LEU A CG  1 
ATOM   1634 C  CD1 . LEU A 1 219 ? -9.862  -14.563 -1.772  1.00 56.26  ? 242  LEU A CD1 1 
ATOM   1635 C  CD2 . LEU A 1 219 ? -9.600  -16.096 -3.700  1.00 55.49  ? 242  LEU A CD2 1 
ATOM   1636 N  N   . VAL A 1 220 ? -14.879 -14.611 -2.621  1.00 56.28  ? 243  VAL A N   1 
ATOM   1637 C  CA  . VAL A 1 220 ? -16.291 -14.832 -2.967  1.00 53.36  ? 243  VAL A CA  1 
ATOM   1638 C  C   . VAL A 1 220 ? -16.324 -14.748 -4.458  1.00 49.04  ? 243  VAL A C   1 
ATOM   1639 O  O   . VAL A 1 220 ? -15.884 -13.751 -5.019  1.00 53.54  ? 243  VAL A O   1 
ATOM   1640 C  CB  . VAL A 1 220 ? -17.183 -13.732 -2.382  1.00 53.78  ? 243  VAL A CB  1 
ATOM   1641 C  CG1 . VAL A 1 220 ? -18.590 -13.808 -2.957  1.00 55.19  ? 243  VAL A CG1 1 
ATOM   1642 C  CG2 . VAL A 1 220 ? -17.200 -13.849 -0.867  1.00 53.73  ? 243  VAL A CG2 1 
ATOM   1643 N  N   . VAL A 1 221 ? -16.822 -15.778 -5.111  1.00 44.35  ? 244  VAL A N   1 
ATOM   1644 C  CA  . VAL A 1 221 ? -16.601 -15.920 -6.541  1.00 43.49  ? 244  VAL A CA  1 
ATOM   1645 C  C   . VAL A 1 221 ? -17.882 -16.337 -7.234  1.00 45.18  ? 244  VAL A C   1 
ATOM   1646 O  O   . VAL A 1 221 ? -18.467 -17.358 -6.898  1.00 43.90  ? 244  VAL A O   1 
ATOM   1647 C  CB  . VAL A 1 221 ? -15.534 -16.973 -6.768  1.00 45.13  ? 244  VAL A CB  1 
ATOM   1648 C  CG1 . VAL A 1 221 ? -15.328 -17.254 -8.225  1.00 48.41  ? 244  VAL A CG1 1 
ATOM   1649 C  CG2 . VAL A 1 221 ? -14.218 -16.530 -6.161  1.00 47.61  ? 244  VAL A CG2 1 
ATOM   1650 N  N   . GLY A 1 222 ? -18.340 -15.521 -8.179  1.00 48.84  ? 245  GLY A N   1 
ATOM   1651 C  CA  . GLY A 1 222 ? -19.562 -15.809 -8.933  1.00 49.43  ? 245  GLY A CA  1 
ATOM   1652 C  C   . GLY A 1 222 ? -20.833 -15.597 -8.121  1.00 49.30  ? 245  GLY A C   1 
ATOM   1653 O  O   . GLY A 1 222 ? -21.824 -16.233 -8.381  1.00 46.90  ? 245  GLY A O   1 
ATOM   1654 N  N   . THR A 1 223 ? -20.765 -14.701 -7.139  1.00 50.28  ? 246  THR A N   1 
ATOM   1655 C  CA  . THR A 1 223 ? -21.886 -14.297 -6.296  1.00 48.73  ? 246  THR A CA  1 
ATOM   1656 C  C   . THR A 1 223 ? -21.324 -13.157 -5.445  1.00 51.16  ? 246  THR A C   1 
ATOM   1657 O  O   . THR A 1 223 ? -20.175 -12.760 -5.614  1.00 46.27  ? 246  THR A O   1 
ATOM   1658 C  CB  . THR A 1 223 ? -22.405 -15.442 -5.396  1.00 48.13  ? 246  THR A CB  1 
ATOM   1659 O  OG1 . THR A 1 223 ? -23.291 -14.933 -4.383  1.00 50.74  ? 246  THR A OG1 1 
ATOM   1660 C  CG2 . THR A 1 223 ? -21.254 -16.098 -4.674  1.00 48.03  ? 246  THR A CG2 1 
ATOM   1661 N  N   . SER A 1 224 ? -22.119 -12.669 -4.502  1.00 57.12  ? 247  SER A N   1 
ATOM   1662 C  CA  . SER A 1 224 ? -21.783 -11.480 -3.755  1.00 59.59  ? 247  SER A CA  1 
ATOM   1663 C  C   . SER A 1 224 ? -21.846 -11.760 -2.275  1.00 59.85  ? 247  SER A C   1 
ATOM   1664 O  O   . SER A 1 224 ? -22.694 -12.526 -1.838  1.00 61.55  ? 247  SER A O   1 
ATOM   1665 C  CB  . SER A 1 224 ? -22.806 -10.410 -4.098  1.00 61.26  ? 247  SER A CB  1 
ATOM   1666 O  OG  . SER A 1 224 ? -22.513 -9.230  -3.397  1.00 64.74  ? 247  SER A OG  1 
ATOM   1667 N  N   . SER A 1 225 ? -20.960 -11.127 -1.508  1.00 61.74  ? 248  SER A N   1 
ATOM   1668 C  CA  . SER A 1 225 ? -20.975 -11.198 -0.025  1.00 63.94  ? 248  SER A CA  1 
ATOM   1669 C  C   . SER A 1 225 ? -22.305 -10.807 0.559   1.00 60.67  ? 248  SER A C   1 
ATOM   1670 O  O   . SER A 1 225 ? -22.602 -11.123 1.687   1.00 60.46  ? 248  SER A O   1 
ATOM   1671 C  CB  . SER A 1 225 ? -19.964 -10.234 0.623   1.00 64.01  ? 248  SER A CB  1 
ATOM   1672 O  OG  . SER A 1 225 ? -18.632 -10.607 0.379   1.00 66.04  ? 248  SER A OG  1 
ATOM   1673 N  N   . ILE A 1 226 ? -23.077 -10.073 -0.207  1.00 65.38  ? 249  ILE A N   1 
ATOM   1674 C  CA  . ILE A 1 226 ? -24.235 -9.378  0.290   1.00 72.75  ? 249  ILE A CA  1 
ATOM   1675 C  C   . ILE A 1 226 ? -25.447 -10.313 0.290   1.00 66.41  ? 249  ILE A C   1 
ATOM   1676 O  O   . ILE A 1 226 ? -26.384 -10.082 1.020   1.00 61.48  ? 249  ILE A O   1 
ATOM   1677 C  CB  . ILE A 1 226 ? -24.530 -8.138  -0.632  1.00 78.85  ? 249  ILE A CB  1 
ATOM   1678 C  CG1 . ILE A 1 226 ? -23.330 -7.173  -0.714  1.00 81.90  ? 249  ILE A CG1 1 
ATOM   1679 C  CG2 . ILE A 1 226 ? -25.780 -7.387  -0.194  1.00 77.09  ? 249  ILE A CG2 1 
ATOM   1680 C  CD1 . ILE A 1 226 ? -23.278 -6.359  -1.992  1.00 84.56  ? 249  ILE A CD1 1 
ATOM   1681 N  N   . VAL A 1 227 ? -25.409 -11.357 -0.532  1.00 64.87  ? 250  VAL A N   1 
ATOM   1682 C  CA  . VAL A 1 227 ? -26.546 -12.199 -0.795  1.00 64.09  ? 250  VAL A CA  1 
ATOM   1683 C  C   . VAL A 1 227 ? -26.265 -13.581 -0.250  1.00 67.92  ? 250  VAL A C   1 
ATOM   1684 O  O   . VAL A 1 227 ? -25.105 -13.997 -0.097  1.00 73.03  ? 250  VAL A O   1 
ATOM   1685 C  CB  . VAL A 1 227 ? -26.777 -12.351 -2.288  1.00 66.04  ? 250  VAL A CB  1 
ATOM   1686 C  CG1 . VAL A 1 227 ? -28.214 -12.758 -2.565  1.00 68.56  ? 250  VAL A CG1 1 
ATOM   1687 C  CG2 . VAL A 1 227 ? -26.462 -11.049 -2.971  1.00 66.60  ? 250  VAL A CG2 1 
ATOM   1688 N  N   . TYR A 1 228 ? -27.335 -14.301 0.047   1.00 67.88  ? 251  TYR A N   1 
ATOM   1689 C  CA  . TYR A 1 228 ? -27.181 -15.698 0.384   1.00 66.40  ? 251  TYR A CA  1 
ATOM   1690 C  C   . TYR A 1 228 ? -26.447 -16.388 -0.753  1.00 69.21  ? 251  TYR A C   1 
ATOM   1691 O  O   . TYR A 1 228 ? -26.752 -16.131 -1.911  1.00 69.74  ? 251  TYR A O   1 
ATOM   1692 C  CB  . TYR A 1 228 ? -28.531 -16.364 0.513   1.00 64.46  ? 251  TYR A CB  1 
ATOM   1693 C  CG  . TYR A 1 228 ? -28.465 -17.873 0.671   1.00 60.75  ? 251  TYR A CG  1 
ATOM   1694 C  CD1 . TYR A 1 228 ? -28.479 -18.715 -0.427  1.00 60.93  ? 251  TYR A CD1 1 
ATOM   1695 C  CD2 . TYR A 1 228 ? -28.420 -18.458 1.934   1.00 59.11  ? 251  TYR A CD2 1 
ATOM   1696 C  CE1 . TYR A 1 228 ? -28.458 -20.102 -0.261  1.00 60.73  ? 251  TYR A CE1 1 
ATOM   1697 C  CE2 . TYR A 1 228 ? -28.381 -19.838 2.112   1.00 56.12  ? 251  TYR A CE2 1 
ATOM   1698 C  CZ  . TYR A 1 228 ? -28.399 -20.661 1.018   1.00 57.36  ? 251  TYR A CZ  1 
ATOM   1699 O  OH  . TYR A 1 228 ? -28.356 -22.034 1.200   1.00 54.98  ? 251  TYR A OH  1 
ATOM   1700 N  N   . PRO A 1 229 ? -25.517 -17.284 -0.438  1.00 67.83  ? 252  PRO A N   1 
ATOM   1701 C  CA  . PRO A 1 229 ? -25.211 -17.730 0.934   1.00 67.21  ? 252  PRO A CA  1 
ATOM   1702 C  C   . PRO A 1 229 ? -24.013 -17.045 1.568   1.00 60.42  ? 252  PRO A C   1 
ATOM   1703 O  O   . PRO A 1 229 ? -23.802 -17.168 2.785   1.00 57.26  ? 252  PRO A O   1 
ATOM   1704 C  CB  . PRO A 1 229 ? -24.879 -19.202 0.736   1.00 66.75  ? 252  PRO A CB  1 
ATOM   1705 C  CG  . PRO A 1 229 ? -24.209 -19.205 -0.597  1.00 64.47  ? 252  PRO A CG  1 
ATOM   1706 C  CD  . PRO A 1 229 ? -24.821 -18.106 -1.430  1.00 64.72  ? 252  PRO A CD  1 
ATOM   1707 N  N   . ALA A 1 230 ? -23.241 -16.334 0.759   1.00 58.03  ? 253  ALA A N   1 
ATOM   1708 C  CA  . ALA A 1 230 ? -22.101 -15.598 1.268   1.00 59.73  ? 253  ALA A CA  1 
ATOM   1709 C  C   . ALA A 1 230 ? -22.436 -14.828 2.550   1.00 61.29  ? 253  ALA A C   1 
ATOM   1710 O  O   . ALA A 1 230 ? -21.626 -14.751 3.477   1.00 59.17  ? 253  ALA A O   1 
ATOM   1711 C  CB  . ALA A 1 230 ? -21.599 -14.642 0.201   1.00 59.18  ? 253  ALA A CB  1 
ATOM   1712 N  N   . ALA A 1 231 ? -23.647 -14.283 2.594   1.00 61.47  ? 254  ALA A N   1 
ATOM   1713 C  CA  . ALA A 1 231 ? -24.044 -13.439 3.677   1.00 64.22  ? 254  ALA A CA  1 
ATOM   1714 C  C   . ALA A 1 231 ? -23.976 -14.112 5.035   1.00 70.07  ? 254  ALA A C   1 
ATOM   1715 O  O   . ALA A 1 231 ? -23.771 -13.437 6.042   1.00 91.70  ? 254  ALA A O   1 
ATOM   1716 C  CB  . ALA A 1 231 ? -25.446 -12.943 3.424   1.00 67.02  ? 254  ALA A CB  1 
ATOM   1717 N  N   . MET A 1 232 ? -24.163 -15.419 5.090   1.00 66.11  ? 255  MET A N   1 
ATOM   1718 C  CA  . MET A 1 232 ? -24.145 -16.110 6.373   1.00 71.95  ? 255  MET A CA  1 
ATOM   1719 C  C   . MET A 1 232 ? -22.821 -16.011 7.118   1.00 77.25  ? 255  MET A C   1 
ATOM   1720 O  O   . MET A 1 232 ? -22.754 -16.221 8.333   1.00 78.41  ? 255  MET A O   1 
ATOM   1721 C  CB  . MET A 1 232 ? -24.384 -17.581 6.139   1.00 78.44  ? 255  MET A CB  1 
ATOM   1722 C  CG  . MET A 1 232 ? -25.815 -17.968 5.926   1.00 80.38  ? 255  MET A CG  1 
ATOM   1723 S  SD  . MET A 1 232 ? -25.897 -19.761 6.020   1.00 82.57  ? 255  MET A SD  1 
ATOM   1724 C  CE  . MET A 1 232 ? -25.675 -20.164 4.278   1.00 82.83  ? 255  MET A CE  1 
ATOM   1725 N  N   . PHE A 1 233 ? -21.760 -15.748 6.361   1.00 82.63  ? 256  PHE A N   1 
ATOM   1726 C  CA  . PHE A 1 233 ? -20.409 -15.982 6.818   1.00 87.01  ? 256  PHE A CA  1 
ATOM   1727 C  C   . PHE A 1 233 ? -19.443 -14.824 6.711   1.00 91.93  ? 256  PHE A C   1 
ATOM   1728 O  O   . PHE A 1 233 ? -18.677 -14.595 7.635   1.00 96.67  ? 256  PHE A O   1 
ATOM   1729 C  CB  . PHE A 1 233 ? -19.784 -17.005 5.917   1.00 86.97  ? 256  PHE A CB  1 
ATOM   1730 C  CG  . PHE A 1 233 ? -20.513 -18.275 5.855   1.00 85.98  ? 256  PHE A CG  1 
ATOM   1731 C  CD1 . PHE A 1 233 ? -20.718 -19.028 7.025   1.00 86.80  ? 256  PHE A CD1 1 
ATOM   1732 C  CD2 . PHE A 1 233 ? -20.956 -18.759 4.612   1.00 84.21  ? 256  PHE A CD2 1 
ATOM   1733 C  CE1 . PHE A 1 233 ? -21.373 -20.243 6.955   1.00 92.62  ? 256  PHE A CE1 1 
ATOM   1734 C  CE2 . PHE A 1 233 ? -21.613 -19.970 4.533   1.00 83.91  ? 256  PHE A CE2 1 
ATOM   1735 C  CZ  . PHE A 1 233 ? -21.824 -20.708 5.706   1.00 93.86  ? 256  PHE A CZ  1 
ATOM   1736 N  N   . ALA A 1 234 ? -19.398 -14.189 5.534   1.00 90.33  ? 257  ALA A N   1 
ATOM   1737 C  CA  . ALA A 1 234 ? -18.482 -13.095 5.274   1.00 87.87  ? 257  ALA A CA  1 
ATOM   1738 C  C   . ALA A 1 234 ? -18.511 -12.164 6.492   1.00 91.89  ? 257  ALA A C   1 
ATOM   1739 O  O   . ALA A 1 234 ? -17.461 -11.771 6.952   1.00 104.90 ? 257  ALA A O   1 
ATOM   1740 C  CB  . ALA A 1 234 ? -18.812 -12.367 3.967   1.00 87.33  ? 257  ALA A CB  1 
ATOM   1741 N  N   . PRO A 1 235 ? -19.706 -11.869 7.057   1.00 83.83  ? 258  PRO A N   1 
ATOM   1742 C  CA  . PRO A 1 235 ? -19.774 -11.196 8.355   1.00 79.74  ? 258  PRO A CA  1 
ATOM   1743 C  C   . PRO A 1 235 ? -18.937 -11.806 9.477   1.00 76.33  ? 258  PRO A C   1 
ATOM   1744 O  O   . PRO A 1 235 ? -18.131 -11.097 10.061  1.00 73.75  ? 258  PRO A O   1 
ATOM   1745 C  CB  . PRO A 1 235 ? -21.255 -11.277 8.691   1.00 81.94  ? 258  PRO A CB  1 
ATOM   1746 C  CG  . PRO A 1 235 ? -21.903 -11.110 7.367   1.00 83.34  ? 258  PRO A CG  1 
ATOM   1747 C  CD  . PRO A 1 235 ? -21.010 -11.806 6.370   1.00 82.94  ? 258  PRO A CD  1 
ATOM   1748 N  N   . GLN A 1 236 ? -19.101 -13.093 9.762   1.00 76.89  ? 259  GLN A N   1 
ATOM   1749 C  CA  . GLN A 1 236 ? -18.233 -13.757 10.735  1.00 83.47  ? 259  GLN A CA  1 
ATOM   1750 C  C   . GLN A 1 236 ? -16.718 -13.550 10.489  1.00 81.92  ? 259  GLN A C   1 
ATOM   1751 O  O   . GLN A 1 236 ? -15.955 -13.388 11.451  1.00 83.05  ? 259  GLN A O   1 
ATOM   1752 C  CB  . GLN A 1 236 ? -18.546 -15.255 10.796  1.00 91.71  ? 259  GLN A CB  1 
ATOM   1753 C  CG  . GLN A 1 236 ? -17.390 -16.138 11.254  1.00 88.95  ? 259  GLN A CG  1 
ATOM   1754 C  CD  . GLN A 1 236 ? -17.662 -17.621 11.043  1.00 89.03  ? 259  GLN A CD  1 
ATOM   1755 O  OE1 . GLN A 1 236 ? -18.715 -18.024 10.517  1.00 95.92  ? 259  GLN A OE1 1 
ATOM   1756 N  NE2 . GLN A 1 236 ? -16.717 -18.444 11.462  1.00 84.11  ? 259  GLN A NE2 1 
ATOM   1757 N  N   . VAL A 1 237 ? -16.287 -13.558 9.223   1.00 78.06  ? 260  VAL A N   1 
ATOM   1758 C  CA  . VAL A 1 237 ? -14.864 -13.337 8.890   1.00 78.68  ? 260  VAL A CA  1 
ATOM   1759 C  C   . VAL A 1 237 ? -14.468 -11.852 8.873   1.00 72.60  ? 260  VAL A C   1 
ATOM   1760 O  O   . VAL A 1 237 ? -13.424 -11.498 9.395   1.00 70.88  ? 260  VAL A O   1 
ATOM   1761 C  CB  . VAL A 1 237 ? -14.384 -13.981 7.555   1.00 79.11  ? 260  VAL A CB  1 
ATOM   1762 C  CG1 . VAL A 1 237 ? -15.028 -15.332 7.310   1.00 79.61  ? 260  VAL A CG1 1 
ATOM   1763 C  CG2 . VAL A 1 237 ? -14.611 -13.062 6.374   1.00 80.78  ? 260  VAL A CG2 1 
ATOM   1764 N  N   . ALA A 1 238 ? -15.318 -10.994 8.317   1.00 67.66  ? 261  ALA A N   1 
ATOM   1765 C  CA  . ALA A 1 238 ? -15.002 -9.577  8.156   1.00 67.52  ? 261  ALA A CA  1 
ATOM   1766 C  C   . ALA A 1 238 ? -14.856 -8.922  9.533   1.00 66.71  ? 261  ALA A C   1 
ATOM   1767 O  O   . ALA A 1 238 ? -13.918 -8.171  9.802   1.00 67.21  ? 261  ALA A O   1 
ATOM   1768 C  CB  . ALA A 1 238 ? -16.098 -8.879  7.358   1.00 67.26  ? 261  ALA A CB  1 
ATOM   1769 N  N   . SER A 1 239 ? -15.782 -9.248  10.414  1.00 66.95  ? 262  SER A N   1 
ATOM   1770 C  CA  . SER A 1 239 ? -15.748 -8.810  11.788  1.00 70.40  ? 262  SER A CA  1 
ATOM   1771 C  C   . SER A 1 239 ? -14.486 -9.239  12.527  1.00 71.23  ? 262  SER A C   1 
ATOM   1772 O  O   . SER A 1 239 ? -14.100 -8.616  13.498  1.00 77.60  ? 262  SER A O   1 
ATOM   1773 C  CB  . SER A 1 239 ? -16.968 -9.376  12.501  1.00 74.72  ? 262  SER A CB  1 
ATOM   1774 O  OG  . SER A 1 239 ? -16.978 -10.784 12.370  1.00 76.04  ? 262  SER A OG  1 
ATOM   1775 N  N   . ARG A 1 240 ? -13.833 -10.302 12.086  1.00 77.56  ? 263  ARG A N   1 
ATOM   1776 C  CA  . ARG A 1 240 ? -12.490 -10.581 12.601  1.00 78.12  ? 263  ARG A CA  1 
ATOM   1777 C  C   . ARG A 1 240 ? -11.423 -9.686  11.962  1.00 68.83  ? 263  ARG A C   1 
ATOM   1778 O  O   . ARG A 1 240 ? -10.264 -9.766  12.327  1.00 65.41  ? 263  ARG A O   1 
ATOM   1779 C  CB  . ARG A 1 240 ? -12.089 -12.031 12.378  1.00 77.60  ? 263  ARG A CB  1 
ATOM   1780 C  CG  . ARG A 1 240 ? -13.142 -13.070 12.707  1.00 79.93  ? 263  ARG A CG  1 
ATOM   1781 C  CD  . ARG A 1 240 ? -12.451 -14.326 13.244  1.00 85.78  ? 263  ARG A CD  1 
ATOM   1782 N  NE  . ARG A 1 240 ? -11.247 -14.630 12.466  1.00 82.43  ? 263  ARG A NE  1 
ATOM   1783 C  CZ  . ARG A 1 240 ? -11.249 -15.137 11.241  1.00 80.10  ? 263  ARG A CZ  1 
ATOM   1784 N  NH1 . ARG A 1 240 ? -12.383 -15.454 10.618  1.00 81.78  ? 263  ARG A NH1 1 
ATOM   1785 N  NH2 . ARG A 1 240 ? -10.101 -15.343 10.642  1.00 76.90  ? 263  ARG A NH2 1 
ATOM   1786 N  N   . GLY A 1 241 ? -11.824 -8.848  11.019  1.00 60.68  ? 264  GLY A N   1 
ATOM   1787 C  CA  . GLY A 1 241 ? -10.897 -8.046  10.273  1.00 64.16  ? 264  GLY A CA  1 
ATOM   1788 C  C   . GLY A 1 241 ? -10.172 -8.729  9.115   1.00 67.47  ? 264  GLY A C   1 
ATOM   1789 O  O   . GLY A 1 241 ? -9.129  -8.250  8.670   1.00 70.80  ? 264  GLY A O   1 
ATOM   1790 N  N   . VAL A 1 242 ? -10.695 -9.834  8.602   1.00 67.73  ? 265  VAL A N   1 
ATOM   1791 C  CA  . VAL A 1 242 ? -10.012 -10.542 7.492   1.00 63.81  ? 265  VAL A CA  1 
ATOM   1792 C  C   . VAL A 1 242 ? -10.436 -10.002 6.122   1.00 57.06  ? 265  VAL A C   1 
ATOM   1793 O  O   . VAL A 1 242 ? -11.637 -9.783  5.886   1.00 63.18  ? 265  VAL A O   1 
ATOM   1794 C  CB  . VAL A 1 242 ? -10.342 -12.043 7.535   1.00 67.57  ? 265  VAL A CB  1 
ATOM   1795 C  CG1 . VAL A 1 242 ? -9.572  -12.802 6.481   1.00 66.16  ? 265  VAL A CG1 1 
ATOM   1796 C  CG2 . VAL A 1 242 ? -10.053 -12.622 8.910   1.00 69.48  ? 265  VAL A CG2 1 
ATOM   1797 N  N   . PRO A 1 243 ? -9.480  -9.817  5.203   1.00 47.52  ? 266  PRO A N   1 
ATOM   1798 C  CA  . PRO A 1 243 ? -9.856  -9.294  3.879   1.00 48.21  ? 266  PRO A CA  1 
ATOM   1799 C  C   . PRO A 1 243 ? -10.787 -10.201 3.043   1.00 47.69  ? 266  PRO A C   1 
ATOM   1800 O  O   . PRO A 1 243 ? -10.695 -11.404 3.072   1.00 46.58  ? 266  PRO A O   1 
ATOM   1801 C  CB  . PRO A 1 243 ? -8.508  -9.119  3.149   1.00 46.05  ? 266  PRO A CB  1 
ATOM   1802 C  CG  . PRO A 1 243 ? -7.451  -9.398  4.144   1.00 45.63  ? 266  PRO A CG  1 
ATOM   1803 C  CD  . PRO A 1 243 ? -8.064  -10.192 5.258   1.00 47.12  ? 266  PRO A CD  1 
ATOM   1804 N  N   . VAL A 1 244 ? -11.665 -9.598  2.273   1.00 49.82  ? 267  VAL A N   1 
ATOM   1805 C  CA  . VAL A 1 244 ? -12.611 -10.346 1.470   1.00 53.39  ? 267  VAL A CA  1 
ATOM   1806 C  C   . VAL A 1 244 ? -12.543 -9.777  0.087   1.00 53.40  ? 267  VAL A C   1 
ATOM   1807 O  O   . VAL A 1 244 ? -12.489 -8.579  -0.064  1.00 56.39  ? 267  VAL A O   1 
ATOM   1808 C  CB  . VAL A 1 244 ? -14.051 -10.202 2.009   1.00 56.33  ? 267  VAL A CB  1 
ATOM   1809 C  CG1 . VAL A 1 244 ? -15.102 -10.469 0.936   1.00 54.57  ? 267  VAL A CG1 1 
ATOM   1810 C  CG2 . VAL A 1 244 ? -14.246 -11.115 3.205   1.00 59.04  ? 267  VAL A CG2 1 
ATOM   1811 N  N   . ALA A 1 245 ? -12.571 -10.646 -0.913  1.00 56.57  ? 268  ALA A N   1 
ATOM   1812 C  CA  . ALA A 1 245 ? -12.345 -10.262 -2.290  1.00 58.85  ? 268  ALA A CA  1 
ATOM   1813 C  C   . ALA A 1 245 ? -13.419 -10.845 -3.157  1.00 56.33  ? 268  ALA A C   1 
ATOM   1814 O  O   . ALA A 1 245 ? -13.489 -12.041 -3.264  1.00 64.42  ? 268  ALA A O   1 
ATOM   1815 C  CB  . ALA A 1 245 ? -10.986 -10.782 -2.737  1.00 60.06  ? 268  ALA A CB  1 
ATOM   1816 N  N   . GLU A 1 246 ? -14.230 -10.021 -3.808  1.00 54.67  ? 269  GLU A N   1 
ATOM   1817 C  CA  . GLU A 1 246 ? -15.277 -10.552 -4.652  1.00 55.04  ? 269  GLU A CA  1 
ATOM   1818 C  C   . GLU A 1 246 ? -14.790 -10.646 -6.097  1.00 55.83  ? 269  GLU A C   1 
ATOM   1819 O  O   . GLU A 1 246 ? -13.958 -9.874  -6.526  1.00 55.66  ? 269  GLU A O   1 
ATOM   1820 C  CB  . GLU A 1 246 ? -16.516 -9.704  -4.564  1.00 57.76  ? 269  GLU A CB  1 
ATOM   1821 C  CG  . GLU A 1 246 ? -16.980 -9.469  -3.139  1.00 61.44  ? 269  GLU A CG  1 
ATOM   1822 C  CD  . GLU A 1 246 ? -18.446 -9.106  -3.042  1.00 64.76  ? 269  GLU A CD  1 
ATOM   1823 O  OE1 . GLU A 1 246 ? -18.955 -8.355  -3.916  1.00 72.41  ? 269  GLU A OE1 1 
ATOM   1824 O  OE2 . GLU A 1 246 ? -19.086 -9.587  -2.087  1.00 60.52  ? 269  GLU A OE2 1 
ATOM   1825 N  N   . PHE A 1 247 ? -15.250 -11.663 -6.810  1.00 57.43  ? 270  PHE A N   1 
ATOM   1826 C  CA  . PHE A 1 247 ? -14.972 -11.823 -8.222  1.00 57.09  ? 270  PHE A CA  1 
ATOM   1827 C  C   . PHE A 1 247 ? -16.289 -12.219 -8.845  1.00 60.62  ? 270  PHE A C   1 
ATOM   1828 O  O   . PHE A 1 247 ? -16.720 -13.363 -8.758  1.00 60.46  ? 270  PHE A O   1 
ATOM   1829 C  CB  . PHE A 1 247 ? -13.961 -12.925 -8.472  1.00 55.05  ? 270  PHE A CB  1 
ATOM   1830 C  CG  . PHE A 1 247 ? -12.597 -12.655 -7.922  1.00 54.05  ? 270  PHE A CG  1 
ATOM   1831 C  CD1 . PHE A 1 247 ? -12.351 -12.746 -6.561  1.00 55.89  ? 270  PHE A CD1 1 
ATOM   1832 C  CD2 . PHE A 1 247 ? -11.529 -12.390 -8.774  1.00 53.92  ? 270  PHE A CD2 1 
ATOM   1833 C  CE1 . PHE A 1 247 ? -11.079 -12.538 -6.056  1.00 57.33  ? 270  PHE A CE1 1 
ATOM   1834 C  CE2 . PHE A 1 247 ? -10.250 -12.173 -8.274  1.00 55.53  ? 270  PHE A CE2 1 
ATOM   1835 C  CZ  . PHE A 1 247 ? -10.026 -12.240 -6.912  1.00 56.33  ? 270  PHE A CZ  1 
ATOM   1836 N  N   . ASN A 1 248 ? -16.960 -11.249 -9.426  1.00 68.41  ? 271  ASN A N   1 
ATOM   1837 C  CA  . ASN A 1 248 ? -18.250 -11.495 -10.025 1.00 75.06  ? 271  ASN A CA  1 
ATOM   1838 C  C   . ASN A 1 248 ? -18.448 -10.408 -11.060 1.00 75.05  ? 271  ASN A C   1 
ATOM   1839 O  O   . ASN A 1 248 ? -17.532 -9.634  -11.321 1.00 64.44  ? 271  ASN A O   1 
ATOM   1840 C  CB  . ASN A 1 248 ? -19.370 -11.505 -8.964  1.00 76.13  ? 271  ASN A CB  1 
ATOM   1841 C  CG  . ASN A 1 248 ? -19.462 -10.199 -8.183  1.00 78.28  ? 271  ASN A CG  1 
ATOM   1842 O  OD1 . ASN A 1 248 ? -19.260 -9.115  -8.731  1.00 74.02  ? 271  ASN A OD1 1 
ATOM   1843 N  ND2 . ASN A 1 248 ? -19.785 -10.298 -6.898  1.00 82.48  ? 271  ASN A ND2 1 
ATOM   1844 N  N   . MET A 1 249 ? -19.629 -10.389 -11.666 1.00 78.55  ? 272  MET A N   1 
ATOM   1845 C  CA  . MET A 1 249 ? -19.964 -9.402  -12.638 1.00 76.78  ? 272  MET A CA  1 
ATOM   1846 C  C   . MET A 1 249 ? -20.987 -8.414  -12.165 1.00 77.79  ? 272  MET A C   1 
ATOM   1847 O  O   . MET A 1 249 ? -21.508 -7.640  -12.953 1.00 75.06  ? 272  MET A O   1 
ATOM   1848 C  CB  . MET A 1 249 ? -20.439 -10.127 -13.876 1.00 75.13  ? 272  MET A CB  1 
ATOM   1849 C  CG  . MET A 1 249 ? -19.366 -11.071 -14.394 1.00 75.38  ? 272  MET A CG  1 
ATOM   1850 S  SD  . MET A 1 249 ? -19.185 -11.072 -16.188 1.00 77.36  ? 272  MET A SD  1 
ATOM   1851 C  CE  . MET A 1 249 ? -18.782 -9.347  -16.509 1.00 76.09  ? 272  MET A CE  1 
ATOM   1852 N  N   . GLU A 1 250 ? -21.248 -8.412  -10.868 1.00 87.17  ? 273  GLU A N   1 
ATOM   1853 C  CA  . GLU A 1 250 ? -22.070 -7.360  -10.295 1.00 93.68  ? 273  GLU A CA  1 
ATOM   1854 C  C   . GLU A 1 250 ? -21.231 -6.058  -10.287 1.00 100.77 ? 273  GLU A C   1 
ATOM   1855 O  O   . GLU A 1 250 ? -20.001 -6.083  -10.487 1.00 94.74  ? 273  GLU A O   1 
ATOM   1856 C  CB  . GLU A 1 250 ? -22.701 -7.802  -8.953  1.00 90.36  ? 273  GLU A CB  1 
ATOM   1857 C  CG  . GLU A 1 250 ? -23.618 -9.011  -9.208  1.00 95.85  ? 273  GLU A CG  1 
ATOM   1858 C  CD  . GLU A 1 250 ? -24.049 -9.763  -7.962  1.00 100.90 ? 273  GLU A CD  1 
ATOM   1859 O  OE1 . GLU A 1 250 ? -24.211 -9.119  -6.897  1.00 104.36 ? 273  GLU A OE1 1 
ATOM   1860 O  OE2 . GLU A 1 250 ? -24.231 -11.006 -8.057  1.00 93.33  ? 273  GLU A OE2 1 
ATOM   1861 N  N   . CYS A 1 251 ? -21.919 -4.922  -10.177 1.00 102.34 ? 274  CYS A N   1 
ATOM   1862 C  CA  . CYS A 1 251 ? -21.298 -3.606  -10.415 1.00 91.39  ? 274  CYS A CA  1 
ATOM   1863 C  C   . CYS A 1 251 ? -21.015 -2.975  -9.089  1.00 85.32  ? 274  CYS A C   1 
ATOM   1864 O  O   . CYS A 1 251 ? -21.790 -3.152  -8.183  1.00 76.50  ? 274  CYS A O   1 
ATOM   1865 C  CB  . CYS A 1 251 ? -22.209 -2.716  -11.276 1.00 85.25  ? 274  CYS A CB  1 
ATOM   1866 S  SG  . CYS A 1 251 ? -23.448 -1.683  -10.438 1.00 82.41  ? 274  CYS A SG  1 
ATOM   1867 N  N   . THR A 1 252 ? -19.903 -2.264  -8.961  1.00 93.43  ? 275  THR A N   1 
ATOM   1868 C  CA  . THR A 1 252 ? -19.641 -1.485  -7.745  1.00 106.79 ? 275  THR A CA  1 
ATOM   1869 C  C   . THR A 1 252 ? -19.904 0.006   -8.066  1.00 108.19 ? 275  THR A C   1 
ATOM   1870 O  O   . THR A 1 252 ? -19.410 0.503   -9.072  1.00 100.09 ? 275  THR A O   1 
ATOM   1871 C  CB  . THR A 1 252 ? -18.199 -1.732  -7.194  1.00 112.34 ? 275  THR A CB  1 
ATOM   1872 O  OG1 . THR A 1 252 ? -18.109 -3.041  -6.592  1.00 98.24  ? 275  THR A OG1 1 
ATOM   1873 C  CG2 . THR A 1 252 ? -17.796 -0.675  -6.143  1.00 117.37 ? 275  THR A CG2 1 
ATOM   1874 N  N   . PRO A 1 253 ? -20.706 0.708   -7.229  1.00 116.54 ? 276  PRO A N   1 
ATOM   1875 C  CA  . PRO A 1 253 ? -20.898 2.148   -7.452  1.00 115.53 ? 276  PRO A CA  1 
ATOM   1876 C  C   . PRO A 1 253 ? -19.592 2.953   -7.336  1.00 121.07 ? 276  PRO A C   1 
ATOM   1877 O  O   . PRO A 1 253 ? -18.677 2.560   -6.595  1.00 123.56 ? 276  PRO A O   1 
ATOM   1878 C  CB  . PRO A 1 253 ? -21.889 2.565   -6.351  1.00 114.09 ? 276  PRO A CB  1 
ATOM   1879 C  CG  . PRO A 1 253 ? -22.479 1.309   -5.807  1.00 114.00 ? 276  PRO A CG  1 
ATOM   1880 C  CD  . PRO A 1 253 ? -21.513 0.202   -6.098  1.00 120.23 ? 276  PRO A CD  1 
ATOM   1881 N  N   . ALA A 1 254 ? -19.545 4.078   -8.059  1.00 127.20 ? 277  ALA A N   1 
ATOM   1882 C  CA  . ALA A 1 254 ? -18.355 4.950   -8.200  1.00 124.07 ? 277  ALA A CA  1 
ATOM   1883 C  C   . ALA A 1 254 ? -17.576 5.189   -6.891  1.00 119.25 ? 277  ALA A C   1 
ATOM   1884 O  O   . ALA A 1 254 ? -16.380 4.848   -6.769  1.00 106.28 ? 277  ALA A O   1 
ATOM   1885 C  CB  . ALA A 1 254 ? -18.774 6.287   -8.827  1.00 121.04 ? 277  ALA A CB  1 
ATOM   1886 N  N   . THR A 1 255 ? -18.275 5.780   -5.928  1.00 113.18 ? 278  THR A N   1 
ATOM   1887 C  CA  . THR A 1 255 ? -17.766 5.972   -4.578  1.00 109.28 ? 278  THR A CA  1 
ATOM   1888 C  C   . THR A 1 255 ? -17.672 4.630   -3.817  1.00 108.22 ? 278  THR A C   1 
ATOM   1889 O  O   . THR A 1 255 ? -18.532 4.317   -2.996  1.00 102.37 ? 278  THR A O   1 
ATOM   1890 C  CB  . THR A 1 255 ? -18.670 6.971   -3.835  1.00 106.36 ? 278  THR A CB  1 
ATOM   1891 O  OG1 . THR A 1 255 ? -19.932 7.042   -4.523  1.00 94.48  ? 278  THR A OG1 1 
ATOM   1892 C  CG2 . THR A 1 255 ? -18.023 8.363   -3.813  1.00 108.01 ? 278  THR A CG2 1 
ATOM   1893 N  N   . GLN A 1 256 ? -16.624 3.859   -4.138  1.00 105.74 ? 279  GLN A N   1 
ATOM   1894 C  CA  . GLN A 1 256 ? -16.243 2.606   -3.469  1.00 96.14  ? 279  GLN A CA  1 
ATOM   1895 C  C   . GLN A 1 256 ? -15.136 1.935   -4.258  1.00 87.16  ? 279  GLN A C   1 
ATOM   1896 O  O   . GLN A 1 256 ? -14.224 2.607   -4.752  1.00 78.24  ? 279  GLN A O   1 
ATOM   1897 C  CB  . GLN A 1 256 ? -17.428 1.662   -3.347  1.00 104.71 ? 279  GLN A CB  1 
ATOM   1898 C  CG  . GLN A 1 256 ? -18.077 1.693   -1.977  1.00 115.27 ? 279  GLN A CG  1 
ATOM   1899 C  CD  . GLN A 1 256 ? -19.586 1.623   -2.056  1.00 129.25 ? 279  GLN A CD  1 
ATOM   1900 O  OE1 . GLN A 1 256 ? -20.151 1.231   -3.086  1.00 138.45 ? 279  GLN A OE1 1 
ATOM   1901 N  NE2 . GLN A 1 256 ? -20.254 2.016   -0.971  1.00 135.08 ? 279  GLN A NE2 1 
ATOM   1902 N  N   . LYS A 1 259 ? -14.384 -5.785  0.393   1.00 82.20  ? 282  LYS A N   1 
ATOM   1903 C  CA  . LYS A 1 259 ? -13.213 -4.913  0.543   1.00 83.88  ? 282  LYS A CA  1 
ATOM   1904 C  C   . LYS A 1 259 ? -12.535 -4.676  -0.809  1.00 83.76  ? 282  LYS A C   1 
ATOM   1905 O  O   . LYS A 1 259 ? -12.415 -3.529  -1.239  1.00 97.74  ? 282  LYS A O   1 
ATOM   1906 C  CB  . LYS A 1 259 ? -12.249 -5.469  1.583   1.00 77.85  ? 282  LYS A CB  1 
ATOM   1907 C  CG  . LYS A 1 259 ? -12.769 -5.179  2.962   1.00 79.59  ? 282  LYS A CG  1 
ATOM   1908 C  CD  . LYS A 1 259 ? -12.090 -6.020  3.999   1.00 83.40  ? 282  LYS A CD  1 
ATOM   1909 C  CE  . LYS A 1 259 ? -12.682 -5.699  5.366   1.00 87.33  ? 282  LYS A CE  1 
ATOM   1910 N  NZ  . LYS A 1 259 ? -11.643 -5.680  6.432   1.00 86.57  ? 282  LYS A NZ  1 
ATOM   1911 N  N   . TYR A 1 260 ? -12.141 -5.749  -1.486  1.00 79.02  ? 283  TYR A N   1 
ATOM   1912 C  CA  . TYR A 1 260 ? -11.754 -5.682  -2.907  1.00 78.65  ? 283  TYR A CA  1 
ATOM   1913 C  C   . TYR A 1 260 ? -12.898 -6.249  -3.740  1.00 71.32  ? 283  TYR A C   1 
ATOM   1914 O  O   . TYR A 1 260 ? -13.705 -7.001  -3.233  1.00 67.01  ? 283  TYR A O   1 
ATOM   1915 C  CB  . TYR A 1 260 ? -10.486 -6.477  -3.223  1.00 77.73  ? 283  TYR A CB  1 
ATOM   1916 C  CG  . TYR A 1 260 ? -9.338  -6.334  -2.243  1.00 80.46  ? 283  TYR A CG  1 
ATOM   1917 C  CD1 . TYR A 1 260 ? -9.475  -6.720  -0.925  1.00 81.75  ? 283  TYR A CD1 1 
ATOM   1918 C  CD2 . TYR A 1 260 ? -8.087  -5.848  -2.654  1.00 84.80  ? 283  TYR A CD2 1 
ATOM   1919 C  CE1 . TYR A 1 260 ? -8.423  -6.610  -0.031  1.00 85.29  ? 283  TYR A CE1 1 
ATOM   1920 C  CE2 . TYR A 1 260 ? -7.028  -5.742  -1.767  1.00 82.60  ? 283  TYR A CE2 1 
ATOM   1921 C  CZ  . TYR A 1 260 ? -7.207  -6.127  -0.461  1.00 82.42  ? 283  TYR A CZ  1 
ATOM   1922 O  OH  . TYR A 1 260 ? -6.177  -6.017  0.421   1.00 81.47  ? 283  TYR A OH  1 
ATOM   1923 N  N   . HIS A 1 261 ? -12.960 -5.867  -5.011  1.00 69.69  ? 284  HIS A N   1 
ATOM   1924 C  CA  . HIS A 1 261 ? -14.009 -6.325  -5.930  1.00 70.81  ? 284  HIS A CA  1 
ATOM   1925 C  C   . HIS A 1 261 ? -13.480 -6.268  -7.356  1.00 69.67  ? 284  HIS A C   1 
ATOM   1926 O  O   . HIS A 1 261 ? -13.090 -5.217  -7.831  1.00 77.49  ? 284  HIS A O   1 
ATOM   1927 C  CB  . HIS A 1 261 ? -15.273 -5.470  -5.825  1.00 73.40  ? 284  HIS A CB  1 
ATOM   1928 C  CG  . HIS A 1 261 ? -16.464 -6.054  -6.518  1.00 82.45  ? 284  HIS A CG  1 
ATOM   1929 N  ND1 . HIS A 1 261 ? -16.452 -6.411  -7.850  1.00 84.80  ? 284  HIS A ND1 1 
ATOM   1930 C  CD2 . HIS A 1 261 ? -17.705 -6.360  -6.058  1.00 87.82  ? 284  HIS A CD2 1 
ATOM   1931 C  CE1 . HIS A 1 261 ? -17.629 -6.914  -8.179  1.00 90.96  ? 284  HIS A CE1 1 
ATOM   1932 N  NE2 . HIS A 1 261 ? -18.406 -6.902  -7.109  1.00 88.58  ? 284  HIS A NE2 1 
ATOM   1933 N  N   . PHE A 1 262 ? -13.473 -7.404  -8.038  1.00 69.20  ? 285  PHE A N   1 
ATOM   1934 C  CA  . PHE A 1 262 ? -12.821 -7.520  -9.321  1.00 66.10  ? 285  PHE A CA  1 
ATOM   1935 C  C   . PHE A 1 262 ? -13.891 -7.898  -10.307 1.00 69.85  ? 285  PHE A C   1 
ATOM   1936 O  O   . PHE A 1 262 ? -14.254 -9.082  -10.466 1.00 69.94  ? 285  PHE A O   1 
ATOM   1937 C  CB  . PHE A 1 262 ? -11.692 -8.538  -9.260  1.00 67.35  ? 285  PHE A CB  1 
ATOM   1938 C  CG  . PHE A 1 262 ? -10.531 -8.112  -8.389  1.00 70.43  ? 285  PHE A CG  1 
ATOM   1939 C  CD1 . PHE A 1 262 ? -9.598  -7.191  -8.853  1.00 76.86  ? 285  PHE A CD1 1 
ATOM   1940 C  CD2 . PHE A 1 262 ? -10.357 -8.642  -7.119  1.00 73.53  ? 285  PHE A CD2 1 
ATOM   1941 C  CE1 . PHE A 1 262 ? -8.524  -6.790  -8.061  1.00 80.32  ? 285  PHE A CE1 1 
ATOM   1942 C  CE2 . PHE A 1 262 ? -9.279  -8.259  -6.324  1.00 79.09  ? 285  PHE A CE2 1 
ATOM   1943 C  CZ  . PHE A 1 262 ? -8.362  -7.330  -6.795  1.00 81.17  ? 285  PHE A CZ  1 
ATOM   1944 N  N   . GLU A 1 263 ? -14.419 -6.856  -10.950 1.00 79.66  ? 286  GLU A N   1 
ATOM   1945 C  CA  . GLU A 1 263 ? -15.590 -6.977  -11.827 1.00 80.52  ? 286  GLU A CA  1 
ATOM   1946 C  C   . GLU A 1 263 ? -15.138 -7.734  -13.059 1.00 76.37  ? 286  GLU A C   1 
ATOM   1947 O  O   . GLU A 1 263 ? -14.039 -7.512  -13.544 1.00 69.81  ? 286  GLU A O   1 
ATOM   1948 C  CB  . GLU A 1 263 ? -16.183 -5.599  -12.193 1.00 81.23  ? 286  GLU A CB  1 
ATOM   1949 C  CG  . GLU A 1 263 ? -17.560 -5.645  -12.870 1.00 86.28  ? 286  GLU A CG  1 
ATOM   1950 C  CD  . GLU A 1 263 ? -18.370 -4.378  -12.693 1.00 87.73  ? 286  GLU A CD  1 
ATOM   1951 O  OE1 . GLU A 1 263 ? -17.807 -3.322  -12.369 1.00 95.55  ? 286  GLU A OE1 1 
ATOM   1952 O  OE2 . GLU A 1 263 ? -19.584 -4.428  -12.901 1.00 87.43  ? 286  GLU A OE2 1 
ATOM   1953 N  N   . GLY A 1 264 ? -15.951 -8.677  -13.519 1.00 79.12  ? 287  GLY A N   1 
ATOM   1954 C  CA  . GLY A 1 264 ? -15.607 -9.469  -14.691 1.00 81.61  ? 287  GLY A CA  1 
ATOM   1955 C  C   . GLY A 1 264 ? -15.814 -10.953 -14.495 1.00 82.12  ? 287  GLY A C   1 
ATOM   1956 O  O   . GLY A 1 264 ? -15.908 -11.419 -13.343 1.00 81.73  ? 287  GLY A O   1 
ATOM   1957 N  N   . PRO A 1 265 ? -15.869 -11.704 -15.625 1.00 77.80  ? 288  PRO A N   1 
ATOM   1958 C  CA  . PRO A 1 265 ? -15.988 -13.154 -15.589 1.00 76.24  ? 288  PRO A CA  1 
ATOM   1959 C  C   . PRO A 1 265 ? -14.805 -13.796 -14.851 1.00 80.30  ? 288  PRO A C   1 
ATOM   1960 O  O   . PRO A 1 265 ? -13.635 -13.518 -15.161 1.00 74.55  ? 288  PRO A O   1 
ATOM   1961 C  CB  . PRO A 1 265 ? -15.998 -13.551 -17.068 1.00 68.85  ? 288  PRO A CB  1 
ATOM   1962 C  CG  . PRO A 1 265 ? -15.295 -12.458 -17.759 1.00 66.78  ? 288  PRO A CG  1 
ATOM   1963 C  CD  . PRO A 1 265 ? -15.681 -11.222 -17.006 1.00 70.20  ? 288  PRO A CD  1 
ATOM   1964 N  N   . CYS A 1 266 ? -15.152 -14.623 -13.869 1.00 75.19  ? 289  CYS A N   1 
ATOM   1965 C  CA  . CYS A 1 266 ? -14.208 -15.316 -13.027 1.00 73.50  ? 289  CYS A CA  1 
ATOM   1966 C  C   . CYS A 1 266 ? -13.135 -15.994 -13.848 1.00 71.35  ? 289  CYS A C   1 
ATOM   1967 O  O   . CYS A 1 266 ? -11.945 -15.950 -13.510 1.00 68.96  ? 289  CYS A O   1 
ATOM   1968 C  CB  . CYS A 1 266 ? -14.961 -16.372 -12.232 1.00 75.71  ? 289  CYS A CB  1 
ATOM   1969 S  SG  . CYS A 1 266 ? -16.429 -15.743 -11.394 1.00 72.94  ? 289  CYS A SG  1 
ATOM   1970 N  N   . GLY A 1 267 ? -13.578 -16.648 -14.918 1.00 69.39  ? 290  GLY A N   1 
ATOM   1971 C  CA  . GLY A 1 267 ? -12.691 -17.261 -15.903 1.00 70.52  ? 290  GLY A CA  1 
ATOM   1972 C  C   . GLY A 1 267 ? -11.506 -16.389 -16.230 1.00 66.47  ? 290  GLY A C   1 
ATOM   1973 O  O   . GLY A 1 267 ? -10.407 -16.915 -16.347 1.00 61.98  ? 290  GLY A O   1 
ATOM   1974 N  N   . SER A 1 268 ? -11.728 -15.070 -16.350 1.00 67.11  ? 291  SER A N   1 
ATOM   1975 C  CA  . SER A 1 268 ? -10.674 -14.103 -16.714 1.00 68.34  ? 291  SER A CA  1 
ATOM   1976 C  C   . SER A 1 268 ? -10.003 -13.441 -15.543 1.00 66.35  ? 291  SER A C   1 
ATOM   1977 O  O   . SER A 1 268 ? -8.785  -13.285 -15.519 1.00 63.46  ? 291  SER A O   1 
ATOM   1978 C  CB  . SER A 1 268 ? -11.259 -12.982 -17.550 1.00 70.40  ? 291  SER A CB  1 
ATOM   1979 O  OG  . SER A 1 268 ? -12.078 -13.496 -18.570 1.00 79.94  ? 291  SER A OG  1 
ATOM   1980 N  N   . THR A 1 269 ? -10.810 -13.022 -14.584 1.00 64.58  ? 292  THR A N   1 
ATOM   1981 C  CA  . THR A 1 269 ? -10.309 -12.241 -13.476 1.00 64.53  ? 292  THR A CA  1 
ATOM   1982 C  C   . THR A 1 269 ? -9.467  -13.103 -12.551 1.00 64.68  ? 292  THR A C   1 
ATOM   1983 O  O   . THR A 1 269 ? -8.428  -12.699 -12.072 1.00 62.86  ? 292  THR A O   1 
ATOM   1984 C  CB  . THR A 1 269 ? -11.476 -11.610 -12.695 1.00 67.15  ? 292  THR A CB  1 
ATOM   1985 O  OG1 . THR A 1 269 ? -12.199 -12.622 -11.993 1.00 75.76  ? 292  THR A OG1 1 
ATOM   1986 C  CG2 . THR A 1 269 ? -12.437 -10.934 -13.643 1.00 67.46  ? 292  THR A CG2 1 
ATOM   1987 N  N   . LEU A 1 270 ? -9.907  -14.321 -12.317 1.00 71.49  ? 293  LEU A N   1 
ATOM   1988 C  CA  . LEU A 1 270 ? -9.393  -15.075 -11.196 1.00 70.34  ? 293  LEU A CA  1 
ATOM   1989 C  C   . LEU A 1 270 ? -8.006  -15.674 -11.412 1.00 64.47  ? 293  LEU A C   1 
ATOM   1990 O  O   . LEU A 1 270 ? -7.144  -15.541 -10.556 1.00 62.46  ? 293  LEU A O   1 
ATOM   1991 C  CB  . LEU A 1 270 ? -10.412 -16.140 -10.805 1.00 71.68  ? 293  LEU A CB  1 
ATOM   1992 C  CG  . LEU A 1 270 ? -10.194 -16.807 -9.449  1.00 72.24  ? 293  LEU A CG  1 
ATOM   1993 C  CD1 . LEU A 1 270 ? -10.194 -15.840 -8.279  1.00 70.21  ? 293  LEU A CD1 1 
ATOM   1994 C  CD2 . LEU A 1 270 ? -11.273 -17.855 -9.276  1.00 74.54  ? 293  LEU A CD2 1 
ATOM   1995 N  N   . PRO A 1 271 ? -7.773  -16.326 -12.555 1.00 61.51  ? 294  PRO A N   1 
ATOM   1996 C  CA  . PRO A 1 271 ? -6.470  -17.016 -12.702 1.00 64.19  ? 294  PRO A CA  1 
ATOM   1997 C  C   . PRO A 1 271 ? -5.207  -16.119 -12.551 1.00 73.35  ? 294  PRO A C   1 
ATOM   1998 O  O   . PRO A 1 271 ? -4.252  -16.526 -11.875 1.00 77.61  ? 294  PRO A O   1 
ATOM   1999 C  CB  . PRO A 1 271 ? -6.548  -17.634 -14.101 1.00 59.88  ? 294  PRO A CB  1 
ATOM   2000 C  CG  . PRO A 1 271 ? -7.994  -17.720 -14.395 1.00 58.87  ? 294  PRO A CG  1 
ATOM   2001 C  CD  . PRO A 1 271 ? -8.653  -16.557 -13.705 1.00 58.21  ? 294  PRO A CD  1 
ATOM   2002 N  N   . PRO A 1 272 ? -5.213  -14.900 -13.148 1.00 76.90  ? 295  PRO A N   1 
ATOM   2003 C  CA  . PRO A 1 272 ? -4.151  -13.955 -12.863 1.00 70.08  ? 295  PRO A CA  1 
ATOM   2004 C  C   . PRO A 1 272 ? -4.028  -13.693 -11.382 1.00 68.40  ? 295  PRO A C   1 
ATOM   2005 O  O   . PRO A 1 272 ? -2.912  -13.638 -10.880 1.00 71.69  ? 295  PRO A O   1 
ATOM   2006 C  CB  . PRO A 1 272 ? -4.618  -12.675 -13.550 1.00 71.71  ? 295  PRO A CB  1 
ATOM   2007 C  CG  . PRO A 1 272 ? -5.494  -13.132 -14.641 1.00 75.72  ? 295  PRO A CG  1 
ATOM   2008 C  CD  . PRO A 1 272 ? -6.192  -14.338 -14.101 1.00 79.28  ? 295  PRO A CD  1 
ATOM   2009 N  N   . ALA A 1 273 ? -5.161  -13.524 -10.689 1.00 64.00  ? 296  ALA A N   1 
ATOM   2010 C  CA  . ALA A 1 273 ? -5.150  -13.227 -9.247  1.00 62.50  ? 296  ALA A CA  1 
ATOM   2011 C  C   . ALA A 1 273 ? -4.402  -14.290 -8.430  1.00 64.59  ? 296  ALA A C   1 
ATOM   2012 O  O   . ALA A 1 273 ? -3.662  -13.949 -7.500  1.00 70.25  ? 296  ALA A O   1 
ATOM   2013 C  CB  . ALA A 1 273 ? -6.563  -13.063 -8.712  1.00 59.40  ? 296  ALA A CB  1 
ATOM   2014 N  N   . LEU A 1 274 ? -4.585  -15.559 -8.795  1.00 58.07  ? 297  LEU A N   1 
ATOM   2015 C  CA  . LEU A 1 274 ? -4.048  -16.671 -8.029  1.00 57.54  ? 297  LEU A CA  1 
ATOM   2016 C  C   . LEU A 1 274 ? -2.652  -17.195 -8.473  1.00 62.22  ? 297  LEU A C   1 
ATOM   2017 O  O   . LEU A 1 274 ? -2.033  -18.004 -7.784  1.00 62.24  ? 297  LEU A O   1 
ATOM   2018 C  CB  . LEU A 1 274 ? -5.088  -17.791 -8.041  1.00 56.65  ? 297  LEU A CB  1 
ATOM   2019 C  CG  . LEU A 1 274 ? -6.482  -17.448 -7.470  1.00 55.45  ? 297  LEU A CG  1 
ATOM   2020 C  CD1 . LEU A 1 274 ? -7.389  -18.667 -7.553  1.00 56.12  ? 297  LEU A CD1 1 
ATOM   2021 C  CD2 . LEU A 1 274 ? -6.396  -16.974 -6.035  1.00 54.29  ? 297  LEU A CD2 1 
ATOM   2022 N  N   . GLU A 1 275 ? -2.179  -16.742 -9.629  1.00 69.92  ? 298  GLU A N   1 
ATOM   2023 C  CA  . GLU A 1 275 ? -0.858  -17.091 -10.186 1.00 71.06  ? 298  GLU A CA  1 
ATOM   2024 C  C   . GLU A 1 275 ? 0.311   -17.026 -9.186  1.00 73.18  ? 298  GLU A C   1 
ATOM   2025 O  O   . GLU A 1 275 ? 0.305   -16.206 -8.280  1.00 72.09  ? 298  GLU A O   1 
ATOM   2026 C  CB  . GLU A 1 275 ? -0.614  -16.161 -11.394 1.00 73.58  ? 298  GLU A CB  1 
ATOM   2027 C  CG  . GLU A 1 275 ? 0.738   -16.196 -12.066 1.00 75.56  ? 298  GLU A CG  1 
ATOM   2028 C  CD  . GLU A 1 275 ? 0.886   -15.031 -13.022 1.00 78.74  ? 298  GLU A CD  1 
ATOM   2029 O  OE1 . GLU A 1 275 ? -0.138  -14.415 -13.410 1.00 78.96  ? 298  GLU A OE1 1 
ATOM   2030 O  OE2 . GLU A 1 275 ? 2.035   -14.719 -13.370 1.00 83.44  ? 298  GLU A OE2 1 
ATOM   2031 O  OXT . GLU A 1 275 ? 1.283   -17.799 -9.217  1.00 77.11  ? 298  GLU A OXT 1 
ATOM   2032 N  N   . SER B 1 10  ? -18.040 -35.011 -44.452 1.00 109.39 ? 33   SER B N   1 
ATOM   2033 C  CA  . SER B 1 10  ? -19.285 -34.947 -43.616 1.00 110.34 ? 33   SER B CA  1 
ATOM   2034 C  C   . SER B 1 10  ? -19.154 -33.951 -42.437 1.00 114.76 ? 33   SER B C   1 
ATOM   2035 O  O   . SER B 1 10  ? -18.132 -33.904 -41.738 1.00 111.53 ? 33   SER B O   1 
ATOM   2036 C  CB  . SER B 1 10  ? -19.660 -36.361 -43.118 1.00 108.00 ? 33   SER B CB  1 
ATOM   2037 O  OG  . SER B 1 10  ? -20.863 -36.385 -42.357 1.00 103.34 ? 33   SER B OG  1 
ATOM   2038 N  N   . SER B 1 11  ? -20.192 -33.141 -42.238 1.00 115.75 ? 34   SER B N   1 
ATOM   2039 C  CA  . SER B 1 11  ? -20.311 -32.332 -41.030 1.00 113.30 ? 34   SER B CA  1 
ATOM   2040 C  C   . SER B 1 11  ? -21.430 -32.917 -40.150 1.00 113.44 ? 34   SER B C   1 
ATOM   2041 O  O   . SER B 1 11  ? -22.040 -32.206 -39.343 1.00 113.53 ? 34   SER B O   1 
ATOM   2042 C  CB  . SER B 1 11  ? -20.572 -30.871 -41.393 1.00 109.73 ? 34   SER B CB  1 
ATOM   2043 O  OG  . SER B 1 11  ? -19.946 -30.024 -40.452 1.00 108.56 ? 34   SER B OG  1 
ATOM   2044 N  N   . ASP B 1 12  ? -21.668 -34.226 -40.295 1.00 108.21 ? 35   ASP B N   1 
ATOM   2045 C  CA  . ASP B 1 12  ? -22.734 -34.916 -39.573 1.00 100.51 ? 35   ASP B CA  1 
ATOM   2046 C  C   . ASP B 1 12  ? -22.245 -35.505 -38.246 1.00 94.56  ? 35   ASP B C   1 
ATOM   2047 O  O   . ASP B 1 12  ? -21.608 -36.576 -38.206 1.00 91.38  ? 35   ASP B O   1 
ATOM   2048 C  CB  . ASP B 1 12  ? -23.348 -36.019 -40.434 1.00 98.93  ? 35   ASP B CB  1 
ATOM   2049 C  CG  . ASP B 1 12  ? -24.721 -36.431 -39.959 1.00 94.91  ? 35   ASP B CG  1 
ATOM   2050 O  OD1 . ASP B 1 12  ? -25.159 -36.032 -38.849 1.00 83.59  ? 35   ASP B OD1 1 
ATOM   2051 O  OD2 . ASP B 1 12  ? -25.365 -37.166 -40.729 1.00 102.59 ? 35   ASP B OD2 1 
ATOM   2052 N  N   . LEU B 1 13  ? -22.590 -34.802 -37.169 1.00 83.16  ? 36   LEU B N   1 
ATOM   2053 C  CA  . LEU B 1 13  ? -22.220 -35.189 -35.818 1.00 77.38  ? 36   LEU B CA  1 
ATOM   2054 C  C   . LEU B 1 13  ? -22.718 -36.586 -35.403 1.00 79.77  ? 36   LEU B C   1 
ATOM   2055 O  O   . LEU B 1 13  ? -21.971 -37.378 -34.826 1.00 74.06  ? 36   LEU B O   1 
ATOM   2056 C  CB  . LEU B 1 13  ? -22.731 -34.123 -34.858 1.00 74.64  ? 36   LEU B CB  1 
ATOM   2057 C  CG  . LEU B 1 13  ? -22.553 -34.255 -33.338 1.00 73.01  ? 36   LEU B CG  1 
ATOM   2058 C  CD1 . LEU B 1 13  ? -21.279 -34.948 -32.928 1.00 70.82  ? 36   LEU B CD1 1 
ATOM   2059 C  CD2 . LEU B 1 13  ? -22.609 -32.873 -32.702 1.00 72.34  ? 36   LEU B CD2 1 
ATOM   2060 N  N   . THR B 1 14  ? -23.961 -36.918 -35.733 1.00 85.59  ? 37   THR B N   1 
ATOM   2061 C  CA  . THR B 1 14  ? -24.527 -38.193 -35.293 1.00 86.88  ? 37   THR B CA  1 
ATOM   2062 C  C   . THR B 1 14  ? -23.779 -39.364 -35.956 1.00 83.32  ? 37   THR B C   1 
ATOM   2063 O  O   . THR B 1 14  ? -23.587 -40.432 -35.350 1.00 81.74  ? 37   THR B O   1 
ATOM   2064 C  CB  . THR B 1 14  ? -26.051 -38.270 -35.574 1.00 87.34  ? 37   THR B CB  1 
ATOM   2065 O  OG1 . THR B 1 14  ? -26.483 -37.089 -36.267 1.00 86.30  ? 37   THR B OG1 1 
ATOM   2066 C  CG2 . THR B 1 14  ? -26.835 -38.454 -34.248 1.00 82.90  ? 37   THR B CG2 1 
ATOM   2067 N  N   . ALA B 1 15  ? -23.354 -39.151 -37.197 1.00 80.29  ? 38   ALA B N   1 
ATOM   2068 C  CA  . ALA B 1 15  ? -22.566 -40.151 -37.916 1.00 81.27  ? 38   ALA B CA  1 
ATOM   2069 C  C   . ALA B 1 15  ? -21.250 -40.448 -37.176 1.00 79.34  ? 38   ALA B C   1 
ATOM   2070 O  O   . ALA B 1 15  ? -20.848 -41.609 -36.968 1.00 68.07  ? 38   ALA B O   1 
ATOM   2071 C  CB  . ALA B 1 15  ? -22.282 -39.653 -39.324 1.00 82.11  ? 38   ALA B CB  1 
ATOM   2072 N  N   . PHE B 1 16  ? -20.578 -39.365 -36.800 1.00 76.94  ? 39   PHE B N   1 
ATOM   2073 C  CA  . PHE B 1 16  ? -19.352 -39.463 -36.054 1.00 73.42  ? 39   PHE B CA  1 
ATOM   2074 C  C   . PHE B 1 16  ? -19.537 -40.156 -34.717 1.00 72.94  ? 39   PHE B C   1 
ATOM   2075 O  O   . PHE B 1 16  ? -18.755 -41.028 -34.358 1.00 77.03  ? 39   PHE B O   1 
ATOM   2076 C  CB  . PHE B 1 16  ? -18.794 -38.090 -35.786 1.00 73.23  ? 39   PHE B CB  1 
ATOM   2077 C  CG  . PHE B 1 16  ? -17.788 -38.091 -34.690 1.00 69.95  ? 39   PHE B CG  1 
ATOM   2078 C  CD1 . PHE B 1 16  ? -16.490 -38.453 -34.939 1.00 65.42  ? 39   PHE B CD1 1 
ATOM   2079 C  CD2 . PHE B 1 16  ? -18.156 -37.769 -33.408 1.00 72.29  ? 39   PHE B CD2 1 
ATOM   2080 C  CE1 . PHE B 1 16  ? -15.550 -38.464 -33.935 1.00 64.39  ? 39   PHE B CE1 1 
ATOM   2081 C  CE2 . PHE B 1 16  ? -17.227 -37.780 -32.388 1.00 73.53  ? 39   PHE B CE2 1 
ATOM   2082 C  CZ  . PHE B 1 16  ? -15.924 -38.137 -32.651 1.00 68.51  ? 39   PHE B CZ  1 
ATOM   2083 N  N   . ARG B 1 17  ? -20.577 -39.782 -33.977 1.00 73.54  ? 40   ARG B N   1 
ATOM   2084 C  CA  . ARG B 1 17  ? -20.809 -40.396 -32.670 1.00 73.88  ? 40   ARG B CA  1 
ATOM   2085 C  C   . ARG B 1 17  ? -20.990 -41.892 -32.825 1.00 74.76  ? 40   ARG B C   1 
ATOM   2086 O  O   . ARG B 1 17  ? -20.586 -42.670 -31.962 1.00 69.05  ? 40   ARG B O   1 
ATOM   2087 C  CB  . ARG B 1 17  ? -22.037 -39.804 -31.964 1.00 76.79  ? 40   ARG B CB  1 
ATOM   2088 C  CG  . ARG B 1 17  ? -21.970 -38.303 -31.769 1.00 78.77  ? 40   ARG B CG  1 
ATOM   2089 C  CD  . ARG B 1 17  ? -22.643 -37.835 -30.490 1.00 78.98  ? 40   ARG B CD  1 
ATOM   2090 N  NE  . ARG B 1 17  ? -21.708 -37.819 -29.365 1.00 80.54  ? 40   ARG B NE  1 
ATOM   2091 C  CZ  . ARG B 1 17  ? -21.648 -38.712 -28.381 1.00 78.72  ? 40   ARG B CZ  1 
ATOM   2092 N  NH1 . ARG B 1 17  ? -22.477 -39.736 -28.321 1.00 84.78  ? 40   ARG B NH1 1 
ATOM   2093 N  NH2 . ARG B 1 17  ? -20.737 -38.569 -27.438 1.00 77.85  ? 40   ARG B NH2 1 
ATOM   2094 N  N   . GLU B 1 18  ? -21.631 -42.296 -33.922 1.00 78.84  ? 41   GLU B N   1 
ATOM   2095 C  CA  . GLU B 1 18  ? -21.846 -43.710 -34.184 1.00 78.20  ? 41   GLU B CA  1 
ATOM   2096 C  C   . GLU B 1 18  ? -20.530 -44.450 -34.273 1.00 71.36  ? 41   GLU B C   1 
ATOM   2097 O  O   . GLU B 1 18  ? -20.442 -45.601 -33.872 1.00 73.47  ? 41   GLU B O   1 
ATOM   2098 C  CB  . GLU B 1 18  ? -22.641 -43.921 -35.461 1.00 84.44  ? 41   GLU B CB  1 
ATOM   2099 C  CG  . GLU B 1 18  ? -24.144 -43.854 -35.287 1.00 88.75  ? 41   GLU B CG  1 
ATOM   2100 C  CD  . GLU B 1 18  ? -24.854 -44.648 -36.369 1.00 93.77  ? 41   GLU B CD  1 
ATOM   2101 O  OE1 . GLU B 1 18  ? -24.491 -44.486 -37.552 1.00 92.36  ? 41   GLU B OE1 1 
ATOM   2102 O  OE2 . GLU B 1 18  ? -25.746 -45.460 -36.035 1.00 98.46  ? 41   GLU B OE2 1 
ATOM   2103 N  N   . HIS B 1 19  ? -19.510 -43.805 -34.809 1.00 66.10  ? 42   HIS B N   1 
ATOM   2104 C  CA  . HIS B 1 19  ? -18.194 -44.427 -34.831 1.00 66.17  ? 42   HIS B CA  1 
ATOM   2105 C  C   . HIS B 1 19  ? -17.604 -44.466 -33.477 1.00 63.97  ? 42   HIS B C   1 
ATOM   2106 O  O   . HIS B 1 19  ? -17.098 -45.507 -33.013 1.00 63.05  ? 42   HIS B O   1 
ATOM   2107 C  CB  . HIS B 1 19  ? -17.251 -43.642 -35.707 1.00 67.17  ? 42   HIS B CB  1 
ATOM   2108 C  CG  . HIS B 1 19  ? -17.412 -43.961 -37.137 1.00 70.15  ? 42   HIS B CG  1 
ATOM   2109 N  ND1 . HIS B 1 19  ? -16.868 -45.094 -37.696 1.00 70.68  ? 42   HIS B ND1 1 
ATOM   2110 C  CD2 . HIS B 1 19  ? -18.133 -43.352 -38.101 1.00 69.90  ? 42   HIS B CD2 1 
ATOM   2111 C  CE1 . HIS B 1 19  ? -17.225 -45.148 -38.965 1.00 76.32  ? 42   HIS B CE1 1 
ATOM   2112 N  NE2 . HIS B 1 19  ? -17.992 -44.104 -39.234 1.00 72.09  ? 42   HIS B NE2 1 
ATOM   2113 N  N   . PHE B 1 20  ? -17.673 -43.292 -32.863 1.00 65.00  ? 43   PHE B N   1 
ATOM   2114 C  CA  . PHE B 1 20  ? -17.203 -43.070 -31.514 1.00 65.54  ? 43   PHE B CA  1 
ATOM   2115 C  C   . PHE B 1 20  ? -17.669 -44.215 -30.603 1.00 68.60  ? 43   PHE B C   1 
ATOM   2116 O  O   . PHE B 1 20  ? -16.863 -44.849 -29.917 1.00 64.41  ? 43   PHE B O   1 
ATOM   2117 C  CB  . PHE B 1 20  ? -17.710 -41.698 -31.034 1.00 64.86  ? 43   PHE B CB  1 
ATOM   2118 C  CG  . PHE B 1 20  ? -17.297 -41.346 -29.641 1.00 63.02  ? 43   PHE B CG  1 
ATOM   2119 C  CD1 . PHE B 1 20  ? -15.970 -41.469 -29.250 1.00 59.49  ? 43   PHE B CD1 1 
ATOM   2120 C  CD2 . PHE B 1 20  ? -18.236 -40.891 -28.726 1.00 62.16  ? 43   PHE B CD2 1 
ATOM   2121 C  CE1 . PHE B 1 20  ? -15.587 -41.165 -27.968 1.00 57.86  ? 43   PHE B CE1 1 
ATOM   2122 C  CE2 . PHE B 1 20  ? -17.854 -40.592 -27.441 1.00 62.88  ? 43   PHE B CE2 1 
ATOM   2123 C  CZ  . PHE B 1 20  ? -16.525 -40.731 -27.060 1.00 59.64  ? 43   PHE B CZ  1 
ATOM   2124 N  N   . ALA B 1 21  ? -18.961 -44.527 -30.686 1.00 66.77  ? 44   ALA B N   1 
ATOM   2125 C  CA  . ALA B 1 21  ? -19.528 -45.617 -29.938 1.00 64.63  ? 44   ALA B CA  1 
ATOM   2126 C  C   . ALA B 1 21  ? -18.749 -46.924 -30.076 1.00 68.14  ? 44   ALA B C   1 
ATOM   2127 O  O   . ALA B 1 21  ? -18.529 -47.608 -29.099 1.00 65.28  ? 44   ALA B O   1 
ATOM   2128 C  CB  . ALA B 1 21  ? -20.949 -45.834 -30.381 1.00 65.11  ? 44   ALA B CB  1 
ATOM   2129 N  N   . LYS B 1 22  ? -18.352 -47.276 -31.295 1.00 79.25  ? 45   LYS B N   1 
ATOM   2130 C  CA  . LYS B 1 22  ? -17.745 -48.584 -31.558 1.00 79.91  ? 45   LYS B CA  1 
ATOM   2131 C  C   . LYS B 1 22  ? -16.293 -48.592 -31.171 1.00 79.33  ? 45   LYS B C   1 
ATOM   2132 O  O   . LYS B 1 22  ? -15.802 -49.586 -30.667 1.00 86.40  ? 45   LYS B O   1 
ATOM   2133 C  CB  . LYS B 1 22  ? -17.926 -48.967 -33.014 1.00 81.53  ? 45   LYS B CB  1 
ATOM   2134 C  CG  . LYS B 1 22  ? -19.403 -49.127 -33.339 1.00 88.06  ? 45   LYS B CG  1 
ATOM   2135 C  CD  . LYS B 1 22  ? -19.662 -49.741 -34.702 1.00 95.34  ? 45   LYS B CD  1 
ATOM   2136 C  CE  . LYS B 1 22  ? -21.159 -49.949 -34.910 1.00 99.61  ? 45   LYS B CE  1 
ATOM   2137 N  NZ  . LYS B 1 22  ? -21.462 -50.251 -36.330 1.00 103.90 ? 45   LYS B NZ  1 
ATOM   2138 N  N   . ALA B 1 23  ? -15.626 -47.463 -31.346 1.00 75.73  ? 46   ALA B N   1 
ATOM   2139 C  CA  . ALA B 1 23  ? -14.180 -47.382 -31.135 1.00 75.60  ? 46   ALA B CA  1 
ATOM   2140 C  C   . ALA B 1 23  ? -13.635 -48.048 -29.872 1.00 70.99  ? 46   ALA B C   1 
ATOM   2141 O  O   . ALA B 1 23  ? -14.141 -47.837 -28.788 1.00 66.99  ? 46   ALA B O   1 
ATOM   2142 C  CB  . ALA B 1 23  ? -13.750 -45.934 -31.146 1.00 76.12  ? 46   ALA B CB  1 
ATOM   2143 N  N   . LYS B 1 24  ? -12.581 -48.842 -30.036 1.00 74.27  ? 47   LYS B N   1 
ATOM   2144 C  CA  . LYS B 1 24  ? -11.889 -49.480 -28.921 1.00 77.02  ? 47   LYS B CA  1 
ATOM   2145 C  C   . LYS B 1 24  ? -10.479 -48.968 -28.689 1.00 73.37  ? 47   LYS B C   1 
ATOM   2146 O  O   . LYS B 1 24  ? -9.983  -49.016 -27.563 1.00 68.09  ? 47   LYS B O   1 
ATOM   2147 C  CB  . LYS B 1 24  ? -11.950 -51.012 -29.079 1.00 86.57  ? 47   LYS B CB  1 
ATOM   2148 C  CG  . LYS B 1 24  ? -13.316 -51.488 -28.567 1.00 100.64 ? 47   LYS B CG  1 
ATOM   2149 C  CD  . LYS B 1 24  ? -13.844 -52.859 -28.953 1.00 103.52 ? 47   LYS B CD  1 
ATOM   2150 C  CE  . LYS B 1 24  ? -15.283 -52.964 -28.417 1.00 101.31 ? 47   LYS B CE  1 
ATOM   2151 N  NZ  . LYS B 1 24  ? -15.841 -54.338 -28.453 1.00 105.05 ? 47   LYS B NZ  1 
ATOM   2152 N  N   . HIS B 1 25  ? -9.852  -48.431 -29.729 1.00 76.34  ? 48   HIS B N   1 
ATOM   2153 C  CA  . HIS B 1 25  ? -8.553  -47.792 -29.586 1.00 80.25  ? 48   HIS B CA  1 
ATOM   2154 C  C   . HIS B 1 25  ? -8.569  -46.471 -30.342 1.00 77.78  ? 48   HIS B C   1 
ATOM   2155 O  O   . HIS B 1 25  ? -8.581  -46.437 -31.583 1.00 78.98  ? 48   HIS B O   1 
ATOM   2156 C  CB  . HIS B 1 25  ? -7.452  -48.703 -30.093 1.00 85.74  ? 48   HIS B CB  1 
ATOM   2157 C  CG  . HIS B 1 25  ? -7.356  -50.009 -29.360 1.00 98.72  ? 48   HIS B CG  1 
ATOM   2158 N  ND1 . HIS B 1 25  ? -6.407  -50.251 -28.385 1.00 104.99 ? 48   HIS B ND1 1 
ATOM   2159 C  CD2 . HIS B 1 25  ? -8.075  -51.154 -29.479 1.00 100.89 ? 48   HIS B CD2 1 
ATOM   2160 C  CE1 . HIS B 1 25  ? -6.552  -51.484 -27.930 1.00 102.42 ? 48   HIS B CE1 1 
ATOM   2161 N  NE2 . HIS B 1 25  ? -7.553  -52.054 -28.580 1.00 100.69 ? 48   HIS B NE2 1 
ATOM   2162 N  N   . ILE B 1 26  ? -8.627  -45.379 -29.583 1.00 70.08  ? 49   ILE B N   1 
ATOM   2163 C  CA  . ILE B 1 26  ? -8.758  -44.053 -30.164 1.00 62.81  ? 49   ILE B CA  1 
ATOM   2164 C  C   . ILE B 1 26  ? -7.524  -43.244 -30.001 1.00 57.62  ? 49   ILE B C   1 
ATOM   2165 O  O   . ILE B 1 26  ? -6.954  -43.190 -28.922 1.00 58.32  ? 49   ILE B O   1 
ATOM   2166 C  CB  . ILE B 1 26  ? -9.847  -43.281 -29.473 1.00 63.71  ? 49   ILE B CB  1 
ATOM   2167 C  CG1 . ILE B 1 26  ? -11.177 -43.976 -29.706 1.00 66.06  ? 49   ILE B CG1 1 
ATOM   2168 C  CG2 . ILE B 1 26  ? -9.905  -41.845 -29.998 1.00 63.87  ? 49   ILE B CG2 1 
ATOM   2169 C  CD1 . ILE B 1 26  ? -12.334 -43.156 -29.187 1.00 67.93  ? 49   ILE B CD1 1 
ATOM   2170 N  N   . ALA B 1 27  ? -7.104  -42.598 -31.077 1.00 53.97  ? 50   ALA B N   1 
ATOM   2171 C  CA  . ALA B 1 27  ? -5.910  -41.780 -31.020 1.00 52.36  ? 50   ALA B CA  1 
ATOM   2172 C  C   . ALA B 1 27  ? -6.274  -40.344 -31.374 1.00 50.45  ? 50   ALA B C   1 
ATOM   2173 O  O   . ALA B 1 27  ? -7.012  -40.093 -32.329 1.00 47.46  ? 50   ALA B O   1 
ATOM   2174 C  CB  . ALA B 1 27  ? -4.850  -42.312 -31.961 1.00 50.77  ? 50   ALA B CB  1 
ATOM   2175 N  N   . ILE B 1 28  ? -5.731  -39.420 -30.592 1.00 45.89  ? 51   ILE B N   1 
ATOM   2176 C  CA  . ILE B 1 28  ? -6.055  -38.060 -30.712 1.00 43.92  ? 51   ILE B CA  1 
ATOM   2177 C  C   . ILE B 1 28  ? -4.773  -37.333 -30.891 1.00 43.74  ? 51   ILE B C   1 
ATOM   2178 O  O   . ILE B 1 28  ? -3.921  -37.355 -30.046 1.00 47.36  ? 51   ILE B O   1 
ATOM   2179 C  CB  . ILE B 1 28  ? -6.728  -37.601 -29.448 1.00 47.06  ? 51   ILE B CB  1 
ATOM   2180 C  CG1 . ILE B 1 28  ? -7.932  -38.500 -29.205 1.00 51.24  ? 51   ILE B CG1 1 
ATOM   2181 C  CG2 . ILE B 1 28  ? -7.178  -36.152 -29.571 1.00 47.98  ? 51   ILE B CG2 1 
ATOM   2182 C  CD1 . ILE B 1 28  ? -8.808  -38.074 -28.040 1.00 53.32  ? 51   ILE B CD1 1 
ATOM   2183 N  N   . ILE B 1 29  ? -4.647  -36.671 -32.017 1.00 45.34  ? 52   ILE B N   1 
ATOM   2184 C  CA  . ILE B 1 29  ? -3.482  -35.873 -32.339 1.00 44.61  ? 52   ILE B CA  1 
ATOM   2185 C  C   . ILE B 1 29  ? -3.884  -34.419 -32.101 1.00 46.76  ? 52   ILE B C   1 
ATOM   2186 O  O   . ILE B 1 29  ? -4.965  -33.983 -32.564 1.00 46.06  ? 52   ILE B O   1 
ATOM   2187 C  CB  . ILE B 1 29  ? -3.141  -36.051 -33.829 1.00 44.35  ? 52   ILE B CB  1 
ATOM   2188 C  CG1 . ILE B 1 29  ? -2.726  -37.484 -34.129 1.00 43.22  ? 52   ILE B CG1 1 
ATOM   2189 C  CG2 . ILE B 1 29  ? -2.064  -35.097 -34.280 1.00 44.25  ? 52   ILE B CG2 1 
ATOM   2190 C  CD1 . ILE B 1 29  ? -3.080  -37.863 -35.551 1.00 43.48  ? 52   ILE B CD1 1 
ATOM   2191 N  N   . THR B 1 30  ? -3.022  -33.663 -31.409 1.00 46.24  ? 53   THR B N   1 
ATOM   2192 C  CA  . THR B 1 30  ? -3.346  -32.280 -31.032 1.00 44.83  ? 53   THR B CA  1 
ATOM   2193 C  C   . THR B 1 30  ? -2.270  -31.285 -31.420 1.00 43.60  ? 53   THR B C   1 
ATOM   2194 O  O   . THR B 1 30  ? -1.108  -31.473 -31.098 1.00 45.27  ? 53   THR B O   1 
ATOM   2195 C  CB  . THR B 1 30  ? -3.613  -32.153 -29.521 1.00 43.65  ? 53   THR B CB  1 
ATOM   2196 O  OG1 . THR B 1 30  ? -2.369  -32.177 -28.787 1.00 41.44  ? 53   THR B OG1 1 
ATOM   2197 C  CG2 . THR B 1 30  ? -4.545  -33.273 -29.080 1.00 43.96  ? 53   THR B CG2 1 
ATOM   2198 N  N   . GLY B 1 31  ? -2.682  -30.208 -32.075 1.00 44.72  ? 54   GLY B N   1 
ATOM   2199 C  CA  . GLY B 1 31  ? -1.773  -29.189 -32.569 1.00 47.87  ? 54   GLY B CA  1 
ATOM   2200 C  C   . GLY B 1 31  ? -1.930  -27.941 -31.765 1.00 50.66  ? 54   GLY B C   1 
ATOM   2201 O  O   . GLY B 1 31  ? -2.610  -27.965 -30.747 1.00 52.16  ? 54   GLY B O   1 
ATOM   2202 N  N   . ALA B 1 32  ? -1.333  -26.837 -32.222 1.00 51.88  ? 55   ALA B N   1 
ATOM   2203 C  CA  . ALA B 1 32  ? -1.291  -25.639 -31.379 1.00 50.07  ? 55   ALA B CA  1 
ATOM   2204 C  C   . ALA B 1 32  ? -2.640  -24.935 -31.244 1.00 48.84  ? 55   ALA B C   1 
ATOM   2205 O  O   . ALA B 1 32  ? -2.822  -24.114 -30.345 1.00 49.40  ? 55   ALA B O   1 
ATOM   2206 C  CB  . ALA B 1 32  ? -0.195  -24.684 -31.815 1.00 49.66  ? 55   ALA B CB  1 
ATOM   2207 N  N   . GLY B 1 33  ? -3.601  -25.282 -32.092 1.00 48.23  ? 56   GLY B N   1 
ATOM   2208 C  CA  . GLY B 1 33  ? -4.939  -24.725 -31.968 1.00 51.09  ? 56   GLY B CA  1 
ATOM   2209 C  C   . GLY B 1 33  ? -5.455  -24.779 -30.549 1.00 51.08  ? 56   GLY B C   1 
ATOM   2210 O  O   . GLY B 1 33  ? -6.154  -23.879 -30.074 1.00 51.01  ? 56   GLY B O   1 
ATOM   2211 N  N   . VAL B 1 34  ? -5.052  -25.833 -29.867 1.00 52.53  ? 57   VAL B N   1 
ATOM   2212 C  CA  . VAL B 1 34  ? -5.583  -26.166 -28.575 1.00 54.95  ? 57   VAL B CA  1 
ATOM   2213 C  C   . VAL B 1 34  ? -4.848  -25.394 -27.481 1.00 52.56  ? 57   VAL B C   1 
ATOM   2214 O  O   . VAL B 1 34  ? -5.451  -24.968 -26.499 1.00 53.03  ? 57   VAL B O   1 
ATOM   2215 C  CB  . VAL B 1 34  ? -5.394  -27.684 -28.297 1.00 54.03  ? 57   VAL B CB  1 
ATOM   2216 C  CG1 . VAL B 1 34  ? -6.364  -28.155 -27.247 1.00 54.88  ? 57   VAL B CG1 1 
ATOM   2217 C  CG2 . VAL B 1 34  ? -5.572  -28.503 -29.563 1.00 55.25  ? 57   VAL B CG2 1 
ATOM   2218 N  N   . SER B 1 35  ? -3.543  -25.258 -27.639 1.00 49.76  ? 58   SER B N   1 
ATOM   2219 C  CA  . SER B 1 35  ? -2.756  -24.530 -26.688 1.00 51.60  ? 58   SER B CA  1 
ATOM   2220 C  C   . SER B 1 35  ? -3.024  -23.049 -26.870 1.00 52.03  ? 58   SER B C   1 
ATOM   2221 O  O   . SER B 1 35  ? -2.934  -22.250 -25.916 1.00 49.76  ? 58   SER B O   1 
ATOM   2222 C  CB  . SER B 1 35  ? -1.291  -24.880 -26.863 1.00 51.58  ? 58   SER B CB  1 
ATOM   2223 O  OG  . SER B 1 35  ? -1.148  -26.215 -26.464 1.00 58.13  ? 58   SER B OG  1 
ATOM   2224 N  N   . ALA B 1 36  ? -3.372  -22.700 -28.100 1.00 53.06  ? 59   ALA B N   1 
ATOM   2225 C  CA  . ALA B 1 36  ? -3.792  -21.348 -28.424 1.00 55.93  ? 59   ALA B CA  1 
ATOM   2226 C  C   . ALA B 1 36  ? -5.047  -20.988 -27.649 1.00 54.61  ? 59   ALA B C   1 
ATOM   2227 O  O   . ALA B 1 36  ? -5.078  -19.965 -26.975 1.00 54.61  ? 59   ALA B O   1 
ATOM   2228 C  CB  . ALA B 1 36  ? -4.048  -21.215 -29.922 1.00 54.28  ? 59   ALA B CB  1 
ATOM   2229 N  N   . GLU B 1 37  ? -6.062  -21.847 -27.719 1.00 51.40  ? 60   GLU B N   1 
ATOM   2230 C  CA  . GLU B 1 37  ? -7.298  -21.601 -27.006 1.00 50.16  ? 60   GLU B CA  1 
ATOM   2231 C  C   . GLU B 1 37  ? -7.129  -21.415 -25.487 1.00 50.92  ? 60   GLU B C   1 
ATOM   2232 O  O   . GLU B 1 37  ? -8.043  -20.938 -24.840 1.00 53.72  ? 60   GLU B O   1 
ATOM   2233 C  CB  . GLU B 1 37  ? -8.317  -22.710 -27.280 1.00 50.38  ? 60   GLU B CB  1 
ATOM   2234 C  CG  . GLU B 1 37  ? -8.890  -22.702 -28.692 1.00 52.48  ? 60   GLU B CG  1 
ATOM   2235 C  CD  . GLU B 1 37  ? -10.178 -23.509 -28.823 1.00 57.55  ? 60   GLU B CD  1 
ATOM   2236 O  OE1 . GLU B 1 37  ? -11.005 -23.523 -27.868 1.00 60.79  ? 60   GLU B OE1 1 
ATOM   2237 O  OE2 . GLU B 1 37  ? -10.369 -24.151 -29.886 1.00 59.63  ? 60   GLU B OE2 1 
ATOM   2238 N  N   . SER B 1 38  ? -5.983  -21.785 -24.917 1.00 48.42  ? 61   SER B N   1 
ATOM   2239 C  CA  . SER B 1 38  ? -5.732  -21.577 -23.503 1.00 46.25  ? 61   SER B CA  1 
ATOM   2240 C  C   . SER B 1 38  ? -4.863  -20.343 -23.310 1.00 46.34  ? 61   SER B C   1 
ATOM   2241 O  O   . SER B 1 38  ? -4.390  -20.073 -22.218 1.00 45.70  ? 61   SER B O   1 
ATOM   2242 C  CB  . SER B 1 38  ? -5.056  -22.813 -22.897 1.00 45.27  ? 61   SER B CB  1 
ATOM   2243 O  OG  . SER B 1 38  ? -5.964  -23.898 -22.821 1.00 44.95  ? 61   SER B OG  1 
ATOM   2244 N  N   . GLY B 1 39  ? -4.637  -19.611 -24.387 1.00 46.71  ? 62   GLY B N   1 
ATOM   2245 C  CA  . GLY B 1 39  ? -3.909  -18.360 -24.328 1.00 48.50  ? 62   GLY B CA  1 
ATOM   2246 C  C   . GLY B 1 39  ? -2.417  -18.487 -24.226 1.00 50.27  ? 62   GLY B C   1 
ATOM   2247 O  O   . GLY B 1 39  ? -1.778  -17.732 -23.524 1.00 54.05  ? 62   GLY B O   1 
ATOM   2248 N  N   . VAL B 1 40  ? -1.837  -19.441 -24.920 1.00 54.10  ? 63   VAL B N   1 
ATOM   2249 C  CA  . VAL B 1 40  ? -0.404  -19.630 -24.793 1.00 54.29  ? 63   VAL B CA  1 
ATOM   2250 C  C   . VAL B 1 40  ? 0.275   -18.965 -25.956 1.00 59.47  ? 63   VAL B C   1 
ATOM   2251 O  O   . VAL B 1 40  ? -0.103  -19.237 -27.089 1.00 64.14  ? 63   VAL B O   1 
ATOM   2252 C  CB  . VAL B 1 40  ? -0.039  -21.114 -24.748 1.00 52.31  ? 63   VAL B CB  1 
ATOM   2253 C  CG1 . VAL B 1 40  ? 1.450   -21.260 -24.671 1.00 55.50  ? 63   VAL B CG1 1 
ATOM   2254 C  CG2 . VAL B 1 40  ? -0.623  -21.780 -23.527 1.00 51.14  ? 63   VAL B CG2 1 
ATOM   2255 N  N   . PRO B 1 41  ? 1.309   -18.131 -25.689 1.00 64.82  ? 64   PRO B N   1 
ATOM   2256 C  CA  . PRO B 1 41  ? 2.083   -17.510 -26.787 1.00 70.53  ? 64   PRO B CA  1 
ATOM   2257 C  C   . PRO B 1 41  ? 2.818   -18.521 -27.631 1.00 72.82  ? 64   PRO B C   1 
ATOM   2258 O  O   . PRO B 1 41  ? 3.519   -19.383 -27.094 1.00 67.51  ? 64   PRO B O   1 
ATOM   2259 C  CB  . PRO B 1 41  ? 3.146   -16.690 -26.052 1.00 67.82  ? 64   PRO B CB  1 
ATOM   2260 C  CG  . PRO B 1 41  ? 3.350   -17.426 -24.767 1.00 62.93  ? 64   PRO B CG  1 
ATOM   2261 C  CD  . PRO B 1 41  ? 1.974   -17.904 -24.389 1.00 61.22  ? 64   PRO B CD  1 
ATOM   2262 N  N   . THR B 1 42  ? 2.674   -18.434 -28.936 1.00 79.23  ? 65   THR B N   1 
ATOM   2263 C  CA  . THR B 1 42  ? 3.458   -19.329 -29.745 1.00 86.93  ? 65   THR B CA  1 
ATOM   2264 C  C   . THR B 1 42  ? 4.654   -18.593 -30.315 1.00 86.92  ? 65   THR B C   1 
ATOM   2265 O  O   . THR B 1 42  ? 5.559   -19.231 -30.819 1.00 87.30  ? 65   THR B O   1 
ATOM   2266 C  CB  . THR B 1 42  ? 2.632   -20.019 -30.852 1.00 93.66  ? 65   THR B CB  1 
ATOM   2267 O  OG1 . THR B 1 42  ? 2.042   -19.035 -31.710 1.00 97.85  ? 65   THR B OG1 1 
ATOM   2268 C  CG2 . THR B 1 42  ? 1.536   -20.930 -30.252 1.00 93.41  ? 65   THR B CG2 1 
ATOM   2269 N  N   . PHE B 1 43  ? 4.680   -17.267 -30.234 1.00 89.11  ? 66   PHE B N   1 
ATOM   2270 C  CA  . PHE B 1 43  ? 5.819   -16.493 -30.777 1.00 89.67  ? 66   PHE B CA  1 
ATOM   2271 C  C   . PHE B 1 43  ? 6.125   -16.713 -32.276 1.00 93.99  ? 66   PHE B C   1 
ATOM   2272 O  O   . PHE B 1 43  ? 7.298   -16.730 -32.676 1.00 91.90  ? 66   PHE B O   1 
ATOM   2273 C  CB  . PHE B 1 43  ? 7.086   -16.759 -29.967 1.00 77.74  ? 66   PHE B CB  1 
ATOM   2274 C  CG  . PHE B 1 43  ? 6.900   -16.563 -28.507 1.00 77.21  ? 66   PHE B CG  1 
ATOM   2275 C  CD1 . PHE B 1 43  ? 6.683   -15.293 -27.995 1.00 81.33  ? 66   PHE B CD1 1 
ATOM   2276 C  CD2 . PHE B 1 43  ? 6.912   -17.636 -27.643 1.00 76.08  ? 66   PHE B CD2 1 
ATOM   2277 C  CE1 . PHE B 1 43  ? 6.499   -15.102 -26.639 1.00 80.19  ? 66   PHE B CE1 1 
ATOM   2278 C  CE2 . PHE B 1 43  ? 6.727   -17.457 -26.289 1.00 74.48  ? 66   PHE B CE2 1 
ATOM   2279 C  CZ  . PHE B 1 43  ? 6.522   -16.189 -25.783 1.00 76.81  ? 66   PHE B CZ  1 
ATOM   2280 N  N   . ARG B 1 44  ? 5.067   -16.817 -33.090 1.00 97.77  ? 67   ARG B N   1 
ATOM   2281 C  CA  . ARG B 1 44  ? 5.173   -16.934 -34.544 1.00 96.86  ? 67   ARG B CA  1 
ATOM   2282 C  C   . ARG B 1 44  ? 4.451   -15.781 -35.233 1.00 99.71  ? 67   ARG B C   1 
ATOM   2283 O  O   . ARG B 1 44  ? 5.132   -14.960 -35.839 1.00 97.01  ? 67   ARG B O   1 
ATOM   2284 C  CB  . ARG B 1 44  ? 4.648   -18.276 -35.058 1.00 96.21  ? 67   ARG B CB  1 
ATOM   2285 C  CG  . ARG B 1 44  ? 5.430   -19.464 -34.573 1.00 91.62  ? 67   ARG B CG  1 
ATOM   2286 C  CD  . ARG B 1 44  ? 5.100   -20.611 -35.499 1.00 96.70  ? 67   ARG B CD  1 
ATOM   2287 N  NE  . ARG B 1 44  ? 5.787   -21.845 -35.127 1.00 103.09 ? 67   ARG B NE  1 
ATOM   2288 C  CZ  . ARG B 1 44  ? 5.706   -22.988 -35.813 1.00 97.43  ? 67   ARG B CZ  1 
ATOM   2289 N  NH1 . ARG B 1 44  ? 4.978   -23.051 -36.917 1.00 105.39 ? 67   ARG B NH1 1 
ATOM   2290 N  NH2 . ARG B 1 44  ? 6.353   -24.073 -35.397 1.00 86.42  ? 67   ARG B NH2 1 
ATOM   2291 N  N   . GLY B 1 45  ? 3.110   -15.701 -35.139 1.00 103.06 ? 68   GLY B N   1 
ATOM   2292 C  CA  . GLY B 1 45  ? 2.337   -14.676 -35.866 1.00 111.50 ? 68   GLY B CA  1 
ATOM   2293 C  C   . GLY B 1 45  ? 3.056   -13.339 -35.744 1.00 126.68 ? 68   GLY B C   1 
ATOM   2294 O  O   . GLY B 1 45  ? 3.962   -13.209 -34.915 1.00 147.01 ? 68   GLY B O   1 
ATOM   2295 N  N   . PRO B 1 46  ? 2.685   -12.335 -36.565 1.00 119.32 ? 69   PRO B N   1 
ATOM   2296 C  CA  . PRO B 1 46  ? 3.500   -11.103 -36.604 1.00 112.06 ? 69   PRO B CA  1 
ATOM   2297 C  C   . PRO B 1 46  ? 3.728   -10.488 -35.211 1.00 118.65 ? 69   PRO B C   1 
ATOM   2298 O  O   . PRO B 1 46  ? 4.857   -10.138 -34.881 1.00 127.55 ? 69   PRO B O   1 
ATOM   2299 C  CB  . PRO B 1 46  ? 2.685   -10.158 -37.481 1.00 105.69 ? 69   PRO B CB  1 
ATOM   2300 C  CG  . PRO B 1 46  ? 1.284   -10.638 -37.341 1.00 112.85 ? 69   PRO B CG  1 
ATOM   2301 C  CD  . PRO B 1 46  ? 1.357   -12.137 -37.164 1.00 112.15 ? 69   PRO B CD  1 
ATOM   2302 N  N   . GLY B 1 47  ? 2.681   -10.399 -34.390 1.00 109.34 ? 70   GLY B N   1 
ATOM   2303 C  CA  . GLY B 1 47  ? 2.801   -9.890  -33.027 1.00 104.36 ? 70   GLY B CA  1 
ATOM   2304 C  C   . GLY B 1 47  ? 3.167   -10.948 -31.999 1.00 102.31 ? 70   GLY B C   1 
ATOM   2305 O  O   . GLY B 1 47  ? 2.829   -10.815 -30.817 1.00 105.10 ? 70   GLY B O   1 
ATOM   2306 N  N   . GLY B 1 48  ? 3.838   -12.006 -32.435 1.00 97.26  ? 71   GLY B N   1 
ATOM   2307 C  CA  . GLY B 1 48  ? 4.467   -12.950 -31.518 1.00 98.61  ? 71   GLY B CA  1 
ATOM   2308 C  C   . GLY B 1 48  ? 5.964   -12.671 -31.479 1.00 99.00  ? 71   GLY B C   1 
ATOM   2309 O  O   . GLY B 1 48  ? 6.752   -13.390 -32.106 1.00 108.22 ? 71   GLY B O   1 
ATOM   2310 N  N   . PHE B 1 49  ? 6.359   -11.604 -30.777 1.00 92.73  ? 72   PHE B N   1 
ATOM   2311 C  CA  . PHE B 1 49  ? 7.773   -11.337 -30.490 1.00 85.67  ? 72   PHE B CA  1 
ATOM   2312 C  C   . PHE B 1 49  ? 8.076   -11.549 -29.041 1.00 78.97  ? 72   PHE B C   1 
ATOM   2313 O  O   . PHE B 1 49  ? 7.185   -11.547 -28.217 1.00 86.44  ? 72   PHE B O   1 
ATOM   2314 C  CB  . PHE B 1 49  ? 8.152   -9.928  -30.850 1.00 85.84  ? 72   PHE B CB  1 
ATOM   2315 C  CG  . PHE B 1 49  ? 8.585   -9.793  -32.265 1.00 94.08  ? 72   PHE B CG  1 
ATOM   2316 C  CD1 . PHE B 1 49  ? 7.636   -9.679  -33.282 1.00 99.89  ? 72   PHE B CD1 1 
ATOM   2317 C  CD2 . PHE B 1 49  ? 9.932   -9.820  -32.599 1.00 91.35  ? 72   PHE B CD2 1 
ATOM   2318 C  CE1 . PHE B 1 49  ? 8.031   -9.559  -34.611 1.00 102.55 ? 72   PHE B CE1 1 
ATOM   2319 C  CE2 . PHE B 1 49  ? 10.333  -9.703  -33.926 1.00 97.66  ? 72   PHE B CE2 1 
ATOM   2320 C  CZ  . PHE B 1 49  ? 9.383   -9.572  -34.933 1.00 101.70 ? 72   PHE B CZ  1 
ATOM   2321 N  N   . TRP B 1 50  ? 9.330   -11.824 -28.746 1.00 74.35  ? 73   TRP B N   1 
ATOM   2322 C  CA  . TRP B 1 50  ? 9.808   -11.847 -27.381 1.00 76.86  ? 73   TRP B CA  1 
ATOM   2323 C  C   . TRP B 1 50  ? 10.995  -10.958 -27.421 1.00 86.33  ? 73   TRP B C   1 
ATOM   2324 O  O   . TRP B 1 50  ? 11.987  -11.289 -28.083 1.00 102.27 ? 73   TRP B O   1 
ATOM   2325 C  CB  . TRP B 1 50  ? 10.247  -13.228 -26.949 1.00 74.33  ? 73   TRP B CB  1 
ATOM   2326 C  CG  . TRP B 1 50  ? 10.785  -13.287 -25.548 1.00 76.60  ? 73   TRP B CG  1 
ATOM   2327 C  CD1 . TRP B 1 50  ? 10.049  -13.311 -24.395 1.00 83.94  ? 73   TRP B CD1 1 
ATOM   2328 C  CD2 . TRP B 1 50  ? 12.159  -13.373 -25.140 1.00 76.35  ? 73   TRP B CD2 1 
ATOM   2329 N  NE1 . TRP B 1 50  ? 10.875  -13.402 -23.299 1.00 82.90  ? 73   TRP B NE1 1 
ATOM   2330 C  CE2 . TRP B 1 50  ? 12.175  -13.444 -23.727 1.00 78.98  ? 73   TRP B CE2 1 
ATOM   2331 C  CE3 . TRP B 1 50  ? 13.374  -13.411 -25.825 1.00 76.94  ? 73   TRP B CE3 1 
ATOM   2332 C  CZ2 . TRP B 1 50  ? 13.360  -13.545 -22.990 1.00 77.60  ? 73   TRP B CZ2 1 
ATOM   2333 C  CZ3 . TRP B 1 50  ? 14.559  -13.512 -25.087 1.00 77.81  ? 73   TRP B CZ3 1 
ATOM   2334 C  CH2 . TRP B 1 50  ? 14.538  -13.578 -23.685 1.00 78.01  ? 73   TRP B CH2 1 
ATOM   2335 N  N   . ARG B 1 51  ? 10.895  -9.814  -26.760 1.00 91.20  ? 74   ARG B N   1 
ATOM   2336 C  CA  . ARG B 1 51  ? 11.888  -8.786  -26.928 1.00 95.93  ? 74   ARG B CA  1 
ATOM   2337 C  C   . ARG B 1 51  ? 12.040  -8.602  -28.456 1.00 99.94  ? 74   ARG B C   1 
ATOM   2338 O  O   . ARG B 1 51  ? 11.028  -8.519  -29.157 1.00 103.03 ? 74   ARG B O   1 
ATOM   2339 C  CB  . ARG B 1 51  ? 13.202  -9.178  -26.216 1.00 96.20  ? 74   ARG B CB  1 
ATOM   2340 C  CG  . ARG B 1 51  ? 13.067  -9.423  -24.713 1.00 90.08  ? 74   ARG B CG  1 
ATOM   2341 C  CD  . ARG B 1 51  ? 14.417  -9.709  -24.059 1.00 83.97  ? 74   ARG B CD  1 
ATOM   2342 N  NE  . ARG B 1 51  ? 14.292  -10.080 -22.650 1.00 80.30  ? 74   ARG B NE  1 
ATOM   2343 C  CZ  . ARG B 1 51  ? 15.262  -10.619 -21.899 1.00 79.97  ? 74   ARG B CZ  1 
ATOM   2344 N  NH1 . ARG B 1 51  ? 16.482  -10.872 -22.402 1.00 75.58  ? 74   ARG B NH1 1 
ATOM   2345 N  NH2 . ARG B 1 51  ? 14.999  -10.913 -20.624 1.00 75.90  ? 74   ARG B NH2 1 
ATOM   2346 N  N   . LYS B 1 52  ? 13.265  -8.609  -28.984 1.00 102.81 ? 75   LYS B N   1 
ATOM   2347 C  CA  . LYS B 1 52  ? 13.464  -8.337  -30.404 1.00 109.99 ? 75   LYS B CA  1 
ATOM   2348 C  C   . LYS B 1 52  ? 13.253  -9.572  -31.283 1.00 114.37 ? 75   LYS B C   1 
ATOM   2349 O  O   . LYS B 1 52  ? 13.244  -9.443  -32.504 1.00 133.81 ? 75   LYS B O   1 
ATOM   2350 C  CB  . LYS B 1 52  ? 14.863  -7.758  -30.656 1.00 109.39 ? 75   LYS B CB  1 
ATOM   2351 C  CG  . LYS B 1 52  ? 15.143  -6.490  -29.860 1.00 111.00 ? 75   LYS B CG  1 
ATOM   2352 C  CD  . LYS B 1 52  ? 16.541  -6.499  -29.245 1.00 112.02 ? 75   LYS B CD  1 
ATOM   2353 C  CE  . LYS B 1 52  ? 16.530  -5.930  -27.830 1.00 109.35 ? 75   LYS B CE  1 
ATOM   2354 N  NZ  . LYS B 1 52  ? 17.893  -5.836  -27.248 1.00 107.44 ? 75   LYS B NZ  1 
ATOM   2355 N  N   . TRP B 1 53  ? 13.048  -10.751 -30.688 1.00 109.81 ? 76   TRP B N   1 
ATOM   2356 C  CA  . TRP B 1 53  ? 13.082  -12.019 -31.442 1.00 99.60  ? 76   TRP B CA  1 
ATOM   2357 C  C   . TRP B 1 53  ? 11.781  -12.791 -31.564 1.00 89.67  ? 76   TRP B C   1 
ATOM   2358 O  O   . TRP B 1 53  ? 10.807  -12.548 -30.862 1.00 77.35  ? 76   TRP B O   1 
ATOM   2359 C  CB  . TRP B 1 53  ? 14.084  -12.953 -30.807 1.00 102.13 ? 76   TRP B CB  1 
ATOM   2360 C  CG  . TRP B 1 53  ? 15.425  -12.382 -30.762 1.00 109.22 ? 76   TRP B CG  1 
ATOM   2361 C  CD1 . TRP B 1 53  ? 16.347  -12.390 -31.757 1.00 114.13 ? 76   TRP B CD1 1 
ATOM   2362 C  CD2 . TRP B 1 53  ? 16.018  -11.702 -29.662 1.00 120.45 ? 76   TRP B CD2 1 
ATOM   2363 N  NE1 . TRP B 1 53  ? 17.495  -11.765 -31.342 1.00 117.08 ? 76   TRP B NE1 1 
ATOM   2364 C  CE2 . TRP B 1 53  ? 17.317  -11.331 -30.055 1.00 123.21 ? 76   TRP B CE2 1 
ATOM   2365 C  CE3 . TRP B 1 53  ? 15.575  -11.369 -28.377 1.00 129.86 ? 76   TRP B CE3 1 
ATOM   2366 C  CZ2 . TRP B 1 53  ? 18.181  -10.644 -29.214 1.00 130.44 ? 76   TRP B CZ2 1 
ATOM   2367 C  CZ3 . TRP B 1 53  ? 16.435  -10.687 -27.538 1.00 135.07 ? 76   TRP B CZ3 1 
ATOM   2368 C  CH2 . TRP B 1 53  ? 17.727  -10.332 -27.961 1.00 139.24 ? 76   TRP B CH2 1 
ATOM   2369 N  N   . GLN B 1 54  ? 11.805  -13.738 -32.491 1.00 87.99  ? 77   GLN B N   1 
ATOM   2370 C  CA  . GLN B 1 54  ? 10.758  -14.725 -32.607 1.00 90.22  ? 77   GLN B CA  1 
ATOM   2371 C  C   . GLN B 1 54  ? 11.364  -16.088 -32.352 1.00 91.91  ? 77   GLN B C   1 
ATOM   2372 O  O   . GLN B 1 54  ? 12.588  -16.253 -32.353 1.00 99.70  ? 77   GLN B O   1 
ATOM   2373 C  CB  . GLN B 1 54  ? 10.132  -14.687 -33.994 1.00 88.58  ? 77   GLN B CB  1 
ATOM   2374 C  CG  . GLN B 1 54  ? 9.419   -13.378 -34.293 1.00 89.04  ? 77   GLN B CG  1 
ATOM   2375 C  CD  . GLN B 1 54  ? 8.182   -13.559 -35.163 1.00 89.26  ? 77   GLN B CD  1 
ATOM   2376 O  OE1 . GLN B 1 54  ? 8.221   -14.255 -36.181 1.00 97.72  ? 77   GLN B OE1 1 
ATOM   2377 N  NE2 . GLN B 1 54  ? 7.079   -12.929 -34.769 1.00 83.62  ? 77   GLN B NE2 1 
ATOM   2378 N  N   . ALA B 1 55  ? 10.492  -17.055 -32.114 1.00 85.14  ? 78   ALA B N   1 
ATOM   2379 C  CA  . ALA B 1 55  ? 10.879  -18.438 -31.932 1.00 83.23  ? 78   ALA B CA  1 
ATOM   2380 C  C   . ALA B 1 55  ? 12.008  -18.906 -32.843 1.00 91.92  ? 78   ALA B C   1 
ATOM   2381 O  O   . ALA B 1 55  ? 13.052  -19.358 -32.358 1.00 92.58  ? 78   ALA B O   1 
ATOM   2382 C  CB  . ALA B 1 55  ? 9.676   -19.296 -32.185 1.00 87.31  ? 78   ALA B CB  1 
ATOM   2383 N  N   . GLN B 1 56  ? 11.796  -18.784 -34.158 1.00 92.33  ? 79   GLN B N   1 
ATOM   2384 C  CA  . GLN B 1 56  ? 12.738  -19.318 -35.153 1.00 90.91  ? 79   GLN B CA  1 
ATOM   2385 C  C   . GLN B 1 56  ? 14.153  -18.915 -34.873 1.00 89.41  ? 79   GLN B C   1 
ATOM   2386 O  O   . GLN B 1 56  ? 15.068  -19.701 -35.104 1.00 96.32  ? 79   GLN B O   1 
ATOM   2387 C  CB  . GLN B 1 56  ? 12.430  -18.868 -36.579 1.00 95.41  ? 79   GLN B CB  1 
ATOM   2388 C  CG  . GLN B 1 56  ? 12.153  -17.391 -36.788 1.00 94.02  ? 79   GLN B CG  1 
ATOM   2389 C  CD  . GLN B 1 56  ? 10.651  -17.082 -36.843 1.00 101.96 ? 79   GLN B CD  1 
ATOM   2390 O  OE1 . GLN B 1 56  ? 9.870   -17.352 -35.904 1.00 89.81  ? 79   GLN B OE1 1 
ATOM   2391 N  NE2 . GLN B 1 56  ? 10.234  -16.518 -37.962 1.00 113.30 ? 79   GLN B NE2 1 
ATOM   2392 N  N   . ASP B 1 57  ? 14.315  -17.681 -34.401 1.00 84.05  ? 80   ASP B N   1 
ATOM   2393 C  CA  . ASP B 1 57  ? 15.621  -17.150 -34.036 1.00 81.03  ? 80   ASP B CA  1 
ATOM   2394 C  C   . ASP B 1 57  ? 16.168  -17.923 -32.839 1.00 78.56  ? 80   ASP B C   1 
ATOM   2395 O  O   . ASP B 1 57  ? 17.304  -18.363 -32.867 1.00 76.71  ? 80   ASP B O   1 
ATOM   2396 C  CB  . ASP B 1 57  ? 15.554  -15.651 -33.702 1.00 80.85  ? 80   ASP B CB  1 
ATOM   2397 C  CG  . ASP B 1 57  ? 14.689  -14.859 -34.683 1.00 91.14  ? 80   ASP B CG  1 
ATOM   2398 O  OD1 . ASP B 1 57  ? 14.697  -15.174 -35.896 1.00 97.76  ? 80   ASP B OD1 1 
ATOM   2399 O  OD2 . ASP B 1 57  ? 13.963  -13.937 -34.231 1.00 93.43  ? 80   ASP B OD2 1 
ATOM   2400 N  N   . LEU B 1 58  ? 15.344  -18.147 -31.819 1.00 77.70  ? 81   LEU B N   1 
ATOM   2401 C  CA  . LEU B 1 58  ? 15.843  -18.647 -30.529 1.00 82.08  ? 81   LEU B CA  1 
ATOM   2402 C  C   . LEU B 1 58  ? 15.739  -20.148 -30.242 1.00 80.27  ? 81   LEU B C   1 
ATOM   2403 O  O   . LEU B 1 58  ? 16.523  -20.700 -29.452 1.00 73.14  ? 81   LEU B O   1 
ATOM   2404 C  CB  . LEU B 1 58  ? 15.148  -17.884 -29.412 1.00 85.82  ? 81   LEU B CB  1 
ATOM   2405 C  CG  . LEU B 1 58  ? 15.512  -16.402 -29.445 1.00 93.08  ? 81   LEU B CG  1 
ATOM   2406 C  CD1 . LEU B 1 58  ? 14.531  -15.527 -28.681 1.00 94.11  ? 81   LEU B CD1 1 
ATOM   2407 C  CD2 . LEU B 1 58  ? 16.915  -16.224 -28.898 1.00 97.90  ? 81   LEU B CD2 1 
ATOM   2408 N  N   . ALA B 1 59  ? 14.793  -20.808 -30.893 1.00 79.05  ? 82   ALA B N   1 
ATOM   2409 C  CA  . ALA B 1 59  ? 14.530  -22.215 -30.637 1.00 74.28  ? 82   ALA B CA  1 
ATOM   2410 C  C   . ALA B 1 59  ? 15.365  -23.144 -31.509 1.00 68.40  ? 82   ALA B C   1 
ATOM   2411 O  O   . ALA B 1 59  ? 14.824  -24.016 -32.192 1.00 66.15  ? 82   ALA B O   1 
ATOM   2412 C  CB  . ALA B 1 59  ? 13.057  -22.478 -30.856 1.00 75.66  ? 82   ALA B CB  1 
ATOM   2413 N  N   . THR B 1 60  ? 16.679  -22.963 -31.480 1.00 64.49  ? 83   THR B N   1 
ATOM   2414 C  CA  . THR B 1 60  ? 17.567  -23.725 -32.351 1.00 64.12  ? 83   THR B CA  1 
ATOM   2415 C  C   . THR B 1 60  ? 18.802  -24.090 -31.576 1.00 62.01  ? 83   THR B C   1 
ATOM   2416 O  O   . THR B 1 60  ? 19.079  -23.501 -30.534 1.00 67.09  ? 83   THR B O   1 
ATOM   2417 C  CB  . THR B 1 60  ? 18.024  -22.910 -33.542 1.00 66.32  ? 83   THR B CB  1 
ATOM   2418 O  OG1 . THR B 1 60  ? 19.089  -22.044 -33.121 1.00 69.85  ? 83   THR B OG1 1 
ATOM   2419 C  CG2 . THR B 1 60  ? 16.858  -22.085 -34.101 1.00 68.29  ? 83   THR B CG2 1 
ATOM   2420 N  N   . PRO B 1 61  ? 19.549  -25.076 -32.065 1.00 58.07  ? 84   PRO B N   1 
ATOM   2421 C  CA  . PRO B 1 61  ? 20.704  -25.481 -31.269 1.00 60.23  ? 84   PRO B CA  1 
ATOM   2422 C  C   . PRO B 1 61  ? 21.828  -24.456 -31.367 1.00 66.46  ? 84   PRO B C   1 
ATOM   2423 O  O   . PRO B 1 61  ? 22.708  -24.405 -30.496 1.00 67.15  ? 84   PRO B O   1 
ATOM   2424 C  CB  . PRO B 1 61  ? 21.115  -26.836 -31.870 1.00 57.25  ? 84   PRO B CB  1 
ATOM   2425 C  CG  . PRO B 1 61  ? 20.169  -27.153 -32.957 1.00 55.78  ? 84   PRO B CG  1 
ATOM   2426 C  CD  . PRO B 1 61  ? 19.175  -26.046 -33.101 1.00 56.72  ? 84   PRO B CD  1 
ATOM   2427 N  N   . GLU B 1 62  ? 21.791  -23.669 -32.443 1.00 73.43  ? 85   GLU B N   1 
ATOM   2428 C  CA  . GLU B 1 62  ? 22.818  -22.672 -32.746 1.00 76.63  ? 85   GLU B CA  1 
ATOM   2429 C  C   . GLU B 1 62  ? 22.696  -21.548 -31.743 1.00 73.60  ? 85   GLU B C   1 
ATOM   2430 O  O   . GLU B 1 62  ? 23.676  -21.144 -31.133 1.00 81.23  ? 85   GLU B O   1 
ATOM   2431 C  CB  . GLU B 1 62  ? 22.672  -22.127 -34.189 1.00 76.96  ? 85   GLU B CB  1 
ATOM   2432 C  CG  . GLU B 1 62  ? 22.969  -23.135 -35.306 1.00 77.47  ? 85   GLU B CG  1 
ATOM   2433 C  CD  . GLU B 1 62  ? 21.932  -24.246 -35.435 1.00 78.72  ? 85   GLU B CD  1 
ATOM   2434 O  OE1 . GLU B 1 62  ? 20.731  -23.970 -35.207 1.00 88.36  ? 85   GLU B OE1 1 
ATOM   2435 O  OE2 . GLU B 1 62  ? 22.292  -25.394 -35.779 1.00 73.07  ? 85   GLU B OE2 1 
ATOM   2436 N  N   . ALA B 1 63  ? 21.483  -21.060 -31.555 1.00 72.06  ? 86   ALA B N   1 
ATOM   2437 C  CA  . ALA B 1 63  ? 21.243  -20.026 -30.556 1.00 74.04  ? 86   ALA B CA  1 
ATOM   2438 C  C   . ALA B 1 63  ? 21.729  -20.441 -29.164 1.00 75.73  ? 86   ALA B C   1 
ATOM   2439 O  O   . ALA B 1 63  ? 22.336  -19.639 -28.449 1.00 76.38  ? 86   ALA B O   1 
ATOM   2440 C  CB  . ALA B 1 63  ? 19.772  -19.667 -30.521 1.00 73.13  ? 86   ALA B CB  1 
ATOM   2441 N  N   . PHE B 1 64  ? 21.491  -21.695 -28.786 1.00 75.88  ? 87   PHE B N   1 
ATOM   2442 C  CA  . PHE B 1 64  ? 21.843  -22.158 -27.446 1.00 78.06  ? 87   PHE B CA  1 
ATOM   2443 C  C   . PHE B 1 64  ? 23.337  -22.247 -27.288 1.00 84.11  ? 87   PHE B C   1 
ATOM   2444 O  O   . PHE B 1 64  ? 23.921  -21.790 -26.288 1.00 88.39  ? 87   PHE B O   1 
ATOM   2445 C  CB  . PHE B 1 64  ? 21.263  -23.524 -27.205 1.00 77.09  ? 87   PHE B CB  1 
ATOM   2446 C  CG  . PHE B 1 64  ? 21.377  -23.990 -25.782 1.00 82.03  ? 87   PHE B CG  1 
ATOM   2447 C  CD1 . PHE B 1 64  ? 20.524  -23.476 -24.809 1.00 87.19  ? 87   PHE B CD1 1 
ATOM   2448 C  CD2 . PHE B 1 64  ? 22.299  -24.979 -25.413 1.00 80.11  ? 87   PHE B CD2 1 
ATOM   2449 C  CE1 . PHE B 1 64  ? 20.601  -23.925 -23.494 1.00 91.77  ? 87   PHE B CE1 1 
ATOM   2450 C  CE2 . PHE B 1 64  ? 22.369  -25.437 -24.103 1.00 79.01  ? 87   PHE B CE2 1 
ATOM   2451 C  CZ  . PHE B 1 64  ? 21.522  -24.906 -23.142 1.00 86.04  ? 87   PHE B CZ  1 
ATOM   2452 N  N   . SER B 1 65  ? 23.945  -22.846 -28.301 1.00 91.54  ? 88   SER B N   1 
ATOM   2453 C  CA  . SER B 1 65  ? 25.387  -22.949 -28.383 1.00 92.03  ? 88   SER B CA  1 
ATOM   2454 C  C   . SER B 1 65  ? 26.027  -21.576 -28.206 1.00 89.65  ? 88   SER B C   1 
ATOM   2455 O  O   . SER B 1 65  ? 26.911  -21.395 -27.360 1.00 87.36  ? 88   SER B O   1 
ATOM   2456 C  CB  . SER B 1 65  ? 25.768  -23.535 -29.729 1.00 90.60  ? 88   SER B CB  1 
ATOM   2457 O  OG  . SER B 1 65  ? 27.141  -23.808 -29.728 1.00 96.99  ? 88   SER B OG  1 
ATOM   2458 N  N   . ARG B 1 66  ? 25.520  -20.615 -28.983 1.00 88.64  ? 89   ARG B N   1 
ATOM   2459 C  CA  . ARG B 1 66  ? 26.012  -19.232 -28.987 1.00 88.06  ? 89   ARG B CA  1 
ATOM   2460 C  C   . ARG B 1 66  ? 25.697  -18.432 -27.714 1.00 84.21  ? 89   ARG B C   1 
ATOM   2461 O  O   . ARG B 1 66  ? 26.548  -17.711 -27.224 1.00 94.57  ? 89   ARG B O   1 
ATOM   2462 C  CB  . ARG B 1 66  ? 25.579  -18.506 -30.289 1.00 88.99  ? 89   ARG B CB  1 
ATOM   2463 C  CG  . ARG B 1 66  ? 26.264  -19.157 -31.512 1.00 100.16 ? 89   ARG B CG  1 
ATOM   2464 C  CD  . ARG B 1 66  ? 25.558  -19.080 -32.848 1.00 103.13 ? 89   ARG B CD  1 
ATOM   2465 N  NE  . ARG B 1 66  ? 25.793  -17.798 -33.488 1.00 94.57  ? 89   ARG B NE  1 
ATOM   2466 C  CZ  . ARG B 1 66  ? 25.041  -16.727 -33.295 1.00 95.88  ? 89   ARG B CZ  1 
ATOM   2467 N  NH1 . ARG B 1 66  ? 23.980  -16.783 -32.502 1.00 103.43 ? 89   ARG B NH1 1 
ATOM   2468 N  NH2 . ARG B 1 66  ? 25.347  -15.590 -33.902 1.00 98.57  ? 89   ARG B NH2 1 
ATOM   2469 N  N   . ASP B 1 67  ? 24.521  -18.585 -27.137 1.00 79.52  ? 90   ASP B N   1 
ATOM   2470 C  CA  . ASP B 1 67  ? 24.117  -17.664 -26.079 1.00 78.57  ? 90   ASP B CA  1 
ATOM   2471 C  C   . ASP B 1 67  ? 23.112  -18.337 -25.166 1.00 73.75  ? 90   ASP B C   1 
ATOM   2472 O  O   . ASP B 1 67  ? 21.910  -18.022 -25.175 1.00 68.36  ? 90   ASP B O   1 
ATOM   2473 C  CB  . ASP B 1 67  ? 23.547  -16.385 -26.710 1.00 80.75  ? 90   ASP B CB  1 
ATOM   2474 C  CG  . ASP B 1 67  ? 23.261  -15.307 -25.694 1.00 83.69  ? 90   ASP B CG  1 
ATOM   2475 O  OD1 . ASP B 1 67  ? 23.473  -15.573 -24.486 1.00 95.09  ? 90   ASP B OD1 1 
ATOM   2476 O  OD2 . ASP B 1 67  ? 22.808  -14.206 -26.100 1.00 77.43  ? 90   ASP B OD2 1 
ATOM   2477 N  N   . PRO B 1 68  ? 23.597  -19.292 -24.386 1.00 73.68  ? 91   PRO B N   1 
ATOM   2478 C  CA  . PRO B 1 68  ? 22.706  -20.122 -23.571 1.00 83.41  ? 91   PRO B CA  1 
ATOM   2479 C  C   . PRO B 1 68  ? 21.942  -19.365 -22.488 1.00 89.63  ? 91   PRO B C   1 
ATOM   2480 O  O   . PRO B 1 68  ? 20.833  -19.759 -22.141 1.00 95.65  ? 91   PRO B O   1 
ATOM   2481 C  CB  . PRO B 1 68  ? 23.630  -21.187 -22.969 1.00 79.42  ? 91   PRO B CB  1 
ATOM   2482 C  CG  . PRO B 1 68  ? 24.996  -20.656 -23.143 1.00 77.86  ? 91   PRO B CG  1 
ATOM   2483 C  CD  . PRO B 1 68  ? 24.994  -19.713 -24.309 1.00 73.75  ? 91   PRO B CD  1 
ATOM   2484 N  N   . SER B 1 69  ? 22.498  -18.279 -21.978 1.00 92.11  ? 92   SER B N   1 
ATOM   2485 C  CA  . SER B 1 69  ? 21.742  -17.464 -21.040 1.00 100.17 ? 92   SER B CA  1 
ATOM   2486 C  C   . SER B 1 69  ? 20.486  -16.940 -21.726 1.00 99.15  ? 92   SER B C   1 
ATOM   2487 O  O   . SER B 1 69  ? 19.380  -17.055 -21.198 1.00 102.58 ? 92   SER B O   1 
ATOM   2488 C  CB  . SER B 1 69  ? 22.571  -16.280 -20.536 1.00 107.75 ? 92   SER B CB  1 
ATOM   2489 O  OG  . SER B 1 69  ? 21.754  -15.298 -19.903 1.00 108.44 ? 92   SER B OG  1 
ATOM   2490 N  N   . LEU B 1 70  ? 20.650  -16.347 -22.901 1.00 96.01  ? 93   LEU B N   1 
ATOM   2491 C  CA  . LEU B 1 70  ? 19.516  -15.708 -23.557 1.00 91.21  ? 93   LEU B CA  1 
ATOM   2492 C  C   . LEU B 1 70  ? 18.448  -16.747 -23.920 1.00 92.32  ? 93   LEU B C   1 
ATOM   2493 O  O   . LEU B 1 70  ? 17.247  -16.514 -23.741 1.00 89.10  ? 93   LEU B O   1 
ATOM   2494 C  CB  . LEU B 1 70  ? 19.955  -14.921 -24.793 1.00 86.21  ? 93   LEU B CB  1 
ATOM   2495 C  CG  . LEU B 1 70  ? 18.822  -14.166 -25.512 1.00 81.09  ? 93   LEU B CG  1 
ATOM   2496 C  CD1 . LEU B 1 70  ? 18.084  -13.220 -24.576 1.00 83.43  ? 93   LEU B CD1 1 
ATOM   2497 C  CD2 . LEU B 1 70  ? 19.333  -13.398 -26.720 1.00 78.80  ? 93   LEU B CD2 1 
ATOM   2498 N  N   . VAL B 1 71  ? 18.874  -17.909 -24.395 1.00 87.71  ? 94   VAL B N   1 
ATOM   2499 C  CA  . VAL B 1 71  ? 17.902  -18.931 -24.732 1.00 84.32  ? 94   VAL B CA  1 
ATOM   2500 C  C   . VAL B 1 71  ? 17.181  -19.341 -23.446 1.00 80.80  ? 94   VAL B C   1 
ATOM   2501 O  O   . VAL B 1 71  ? 15.954  -19.306 -23.393 1.00 79.38  ? 94   VAL B O   1 
ATOM   2502 C  CB  . VAL B 1 71  ? 18.536  -20.123 -25.496 1.00 87.81  ? 94   VAL B CB  1 
ATOM   2503 C  CG1 . VAL B 1 71  ? 17.502  -21.194 -25.802 1.00 92.72  ? 94   VAL B CG1 1 
ATOM   2504 C  CG2 . VAL B 1 71  ? 19.117  -19.645 -26.813 1.00 85.46  ? 94   VAL B CG2 1 
ATOM   2505 N  N   . TRP B 1 72  ? 17.921  -19.685 -22.396 1.00 79.22  ? 95   TRP B N   1 
ATOM   2506 C  CA  . TRP B 1 72  ? 17.278  -19.989 -21.109 1.00 77.94  ? 95   TRP B CA  1 
ATOM   2507 C  C   . TRP B 1 72  ? 16.390  -18.852 -20.584 1.00 78.63  ? 95   TRP B C   1 
ATOM   2508 O  O   . TRP B 1 72  ? 15.318  -19.098 -20.061 1.00 79.98  ? 95   TRP B O   1 
ATOM   2509 C  CB  . TRP B 1 72  ? 18.310  -20.348 -20.055 1.00 77.71  ? 95   TRP B CB  1 
ATOM   2510 C  CG  . TRP B 1 72  ? 18.614  -21.797 -19.983 1.00 77.44  ? 95   TRP B CG  1 
ATOM   2511 C  CD1 . TRP B 1 72  ? 19.807  -22.417 -20.239 1.00 75.59  ? 95   TRP B CD1 1 
ATOM   2512 C  CD2 . TRP B 1 72  ? 17.707  -22.815 -19.611 1.00 80.16  ? 95   TRP B CD2 1 
ATOM   2513 N  NE1 . TRP B 1 72  ? 19.701  -23.772 -20.033 1.00 72.98  ? 95   TRP B NE1 1 
ATOM   2514 C  CE2 . TRP B 1 72  ? 18.417  -24.049 -19.657 1.00 76.82  ? 95   TRP B CE2 1 
ATOM   2515 C  CE3 . TRP B 1 72  ? 16.344  -22.816 -19.257 1.00 79.39  ? 95   TRP B CE3 1 
ATOM   2516 C  CZ2 . TRP B 1 72  ? 17.810  -25.272 -19.357 1.00 76.93  ? 95   TRP B CZ2 1 
ATOM   2517 C  CZ3 . TRP B 1 72  ? 15.737  -24.033 -18.945 1.00 76.79  ? 95   TRP B CZ3 1 
ATOM   2518 C  CH2 . TRP B 1 72  ? 16.478  -25.246 -18.992 1.00 78.78  ? 95   TRP B CH2 1 
ATOM   2519 N  N   . GLU B 1 73  ? 16.808  -17.602 -20.722 1.00 81.45  ? 96   GLU B N   1 
ATOM   2520 C  CA  . GLU B 1 73  ? 15.923  -16.493 -20.327 1.00 84.75  ? 96   GLU B CA  1 
ATOM   2521 C  C   . GLU B 1 73  ? 14.556  -16.685 -20.974 1.00 79.40  ? 96   GLU B C   1 
ATOM   2522 O  O   . GLU B 1 73  ? 13.524  -16.703 -20.305 1.00 71.33  ? 96   GLU B O   1 
ATOM   2523 C  CB  . GLU B 1 73  ? 16.502  -15.125 -20.731 1.00 95.24  ? 96   GLU B CB  1 
ATOM   2524 C  CG  . GLU B 1 73  ? 17.463  -14.478 -19.722 1.00 98.94  ? 96   GLU B CG  1 
ATOM   2525 C  CD  . GLU B 1 73  ? 17.586  -12.964 -19.910 1.00 95.74  ? 96   GLU B CD  1 
ATOM   2526 O  OE1 . GLU B 1 73  ? 18.383  -12.506 -20.766 1.00 88.94  ? 96   GLU B OE1 1 
ATOM   2527 O  OE2 . GLU B 1 73  ? 16.894  -12.225 -19.181 1.00 97.74  ? 96   GLU B OE2 1 
ATOM   2528 N  N   . PHE B 1 74  ? 14.590  -16.878 -22.290 1.00 84.08  ? 97   PHE B N   1 
ATOM   2529 C  CA  . PHE B 1 74  ? 13.399  -17.153 -23.132 1.00 78.79  ? 97   PHE B CA  1 
ATOM   2530 C  C   . PHE B 1 74  ? 12.557  -18.295 -22.601 1.00 71.02  ? 97   PHE B C   1 
ATOM   2531 O  O   . PHE B 1 74  ? 11.360  -18.158 -22.451 1.00 64.74  ? 97   PHE B O   1 
ATOM   2532 C  CB  . PHE B 1 74  ? 13.876  -17.501 -24.544 1.00 75.19  ? 97   PHE B CB  1 
ATOM   2533 C  CG  . PHE B 1 74  ? 12.787  -17.815 -25.535 1.00 73.87  ? 97   PHE B CG  1 
ATOM   2534 C  CD1 . PHE B 1 74  ? 11.660  -17.001 -25.676 1.00 76.41  ? 97   PHE B CD1 1 
ATOM   2535 C  CD2 . PHE B 1 74  ? 12.935  -18.893 -26.396 1.00 71.48  ? 97   PHE B CD2 1 
ATOM   2536 C  CE1 . PHE B 1 74  ? 10.672  -17.283 -26.637 1.00 71.44  ? 97   PHE B CE1 1 
ATOM   2537 C  CE2 . PHE B 1 74  ? 11.961  -19.180 -27.341 1.00 72.43  ? 97   PHE B CE2 1 
ATOM   2538 C  CZ  . PHE B 1 74  ? 10.825  -18.369 -27.462 1.00 69.01  ? 97   PHE B CZ  1 
ATOM   2539 N  N   . TYR B 1 75  ? 13.200  -19.428 -22.337 1.00 67.42  ? 98   TYR B N   1 
ATOM   2540 C  CA  . TYR B 1 75  ? 12.491  -20.601 -21.868 1.00 64.83  ? 98   TYR B CA  1 
ATOM   2541 C  C   . TYR B 1 75  ? 12.035  -20.463 -20.401 1.00 67.20  ? 98   TYR B C   1 
ATOM   2542 O  O   . TYR B 1 75  ? 11.010  -21.017 -20.034 1.00 70.01  ? 98   TYR B O   1 
ATOM   2543 C  CB  . TYR B 1 75  ? 13.308  -21.883 -22.170 1.00 64.40  ? 98   TYR B CB  1 
ATOM   2544 C  CG  . TYR B 1 75  ? 13.161  -22.323 -23.623 1.00 67.60  ? 98   TYR B CG  1 
ATOM   2545 C  CD1 . TYR B 1 75  ? 13.854  -21.705 -24.668 1.00 67.67  ? 98   TYR B CD1 1 
ATOM   2546 C  CD2 . TYR B 1 75  ? 12.275  -23.337 -23.952 1.00 71.55  ? 98   TYR B CD2 1 
ATOM   2547 C  CE1 . TYR B 1 75  ? 13.666  -22.113 -25.992 1.00 69.86  ? 98   TYR B CE1 1 
ATOM   2548 C  CE2 . TYR B 1 75  ? 12.077  -23.750 -25.261 1.00 71.00  ? 98   TYR B CE2 1 
ATOM   2549 C  CZ  . TYR B 1 75  ? 12.763  -23.147 -26.282 1.00 70.52  ? 98   TYR B CZ  1 
ATOM   2550 O  OH  . TYR B 1 75  ? 12.514  -23.617 -27.562 1.00 61.23  ? 98   TYR B OH  1 
ATOM   2551 N  N   . HIS B 1 76  ? 12.757  -19.699 -19.575 1.00 73.79  ? 99   HIS B N   1 
ATOM   2552 C  CA  . HIS B 1 76  ? 12.303  -19.403 -18.201 1.00 72.42  ? 99   HIS B CA  1 
ATOM   2553 C  C   . HIS B 1 76  ? 10.972  -18.690 -18.328 1.00 70.29  ? 99   HIS B C   1 
ATOM   2554 O  O   . HIS B 1 76  ? 10.005  -19.055 -17.687 1.00 71.01  ? 99   HIS B O   1 
ATOM   2555 C  CB  . HIS B 1 76  ? 13.329  -18.549 -17.427 1.00 75.54  ? 99   HIS B CB  1 
ATOM   2556 C  CG  . HIS B 1 76  ? 12.876  -18.097 -16.062 1.00 79.19  ? 99   HIS B CG  1 
ATOM   2557 N  ND1 . HIS B 1 76  ? 12.424  -18.969 -15.095 1.00 83.04  ? 99   HIS B ND1 1 
ATOM   2558 C  CD2 . HIS B 1 76  ? 12.847  -16.864 -15.496 1.00 80.84  ? 99   HIS B CD2 1 
ATOM   2559 C  CE1 . HIS B 1 76  ? 12.106  -18.290 -14.004 1.00 85.88  ? 99   HIS B CE1 1 
ATOM   2560 N  NE2 . HIS B 1 76  ? 12.357  -17.010 -14.220 1.00 85.07  ? 99   HIS B NE2 1 
ATOM   2561 N  N   . TYR B 1 77  ? 10.901  -17.699 -19.199 1.00 68.17  ? 100  TYR B N   1 
ATOM   2562 C  CA  . TYR B 1 77  ? 9.657   -16.956 -19.377 1.00 68.76  ? 100  TYR B CA  1 
ATOM   2563 C  C   . TYR B 1 77  ? 8.473   -17.848 -19.702 1.00 67.27  ? 100  TYR B C   1 
ATOM   2564 O  O   . TYR B 1 77  ? 7.414   -17.812 -19.053 1.00 69.83  ? 100  TYR B O   1 
ATOM   2565 C  CB  . TYR B 1 77  ? 9.835   -15.958 -20.488 1.00 69.08  ? 100  TYR B CB  1 
ATOM   2566 C  CG  . TYR B 1 77  ? 8.602   -15.163 -20.742 1.00 68.64  ? 100  TYR B CG  1 
ATOM   2567 C  CD1 . TYR B 1 77  ? 8.144   -14.234 -19.802 1.00 70.36  ? 100  TYR B CD1 1 
ATOM   2568 C  CD2 . TYR B 1 77  ? 7.900   -15.318 -21.916 1.00 67.19  ? 100  TYR B CD2 1 
ATOM   2569 C  CE1 . TYR B 1 77  ? 7.011   -13.487 -20.046 1.00 67.94  ? 100  TYR B CE1 1 
ATOM   2570 C  CE2 . TYR B 1 77  ? 6.775   -14.571 -22.170 1.00 68.63  ? 100  TYR B CE2 1 
ATOM   2571 C  CZ  . TYR B 1 77  ? 6.342   -13.669 -21.236 1.00 66.28  ? 100  TYR B CZ  1 
ATOM   2572 O  OH  . TYR B 1 77  ? 5.232   -12.961 -21.525 1.00 64.33  ? 100  TYR B OH  1 
ATOM   2573 N  N   . ARG B 1 78  ? 8.696   -18.701 -20.681 1.00 64.49  ? 101  ARG B N   1 
ATOM   2574 C  CA  . ARG B 1 78  ? 7.660   -19.572 -21.163 1.00 61.49  ? 101  ARG B CA  1 
ATOM   2575 C  C   . ARG B 1 78  ? 7.225   -20.535 -20.085 1.00 56.81  ? 101  ARG B C   1 
ATOM   2576 O  O   . ARG B 1 78  ? 6.017   -20.779 -19.915 1.00 59.07  ? 101  ARG B O   1 
ATOM   2577 C  CB  . ARG B 1 78  ? 8.147   -20.300 -22.412 1.00 64.53  ? 101  ARG B CB  1 
ATOM   2578 C  CG  . ARG B 1 78  ? 8.366   -19.325 -23.562 1.00 67.80  ? 101  ARG B CG  1 
ATOM   2579 C  CD  . ARG B 1 78  ? 8.865   -20.009 -24.806 1.00 70.36  ? 101  ARG B CD  1 
ATOM   2580 N  NE  . ARG B 1 78  ? 7.822   -20.809 -25.431 1.00 72.34  ? 101  ARG B NE  1 
ATOM   2581 C  CZ  . ARG B 1 78  ? 8.028   -21.674 -26.415 1.00 69.94  ? 101  ARG B CZ  1 
ATOM   2582 N  NH1 . ARG B 1 78  ? 9.247   -21.883 -26.898 1.00 72.98  ? 101  ARG B NH1 1 
ATOM   2583 N  NH2 . ARG B 1 78  ? 7.006   -22.348 -26.905 1.00 68.62  ? 101  ARG B NH2 1 
ATOM   2584 N  N   . ARG B 1 79  ? 8.191   -21.083 -19.361 1.00 50.15  ? 102  ARG B N   1 
ATOM   2585 C  CA  . ARG B 1 79  ? 7.865   -21.865 -18.180 1.00 55.86  ? 102  ARG B CA  1 
ATOM   2586 C  C   . ARG B 1 79  ? 6.936   -21.122 -17.209 1.00 60.29  ? 102  ARG B C   1 
ATOM   2587 O  O   . ARG B 1 79  ? 5.920   -21.671 -16.775 1.00 61.97  ? 102  ARG B O   1 
ATOM   2588 C  CB  . ARG B 1 79  ? 9.131   -22.292 -17.448 1.00 56.99  ? 102  ARG B CB  1 
ATOM   2589 C  CG  . ARG B 1 79  ? 9.816   -23.491 -18.078 1.00 57.16  ? 102  ARG B CG  1 
ATOM   2590 C  CD  . ARG B 1 79  ? 11.285  -23.573 -17.680 1.00 57.42  ? 102  ARG B CD  1 
ATOM   2591 N  NE  . ARG B 1 79  ? 11.452  -23.942 -16.276 1.00 58.95  ? 102  ARG B NE  1 
ATOM   2592 C  CZ  . ARG B 1 79  ? 11.210  -25.154 -15.793 1.00 61.83  ? 102  ARG B CZ  1 
ATOM   2593 N  NH1 . ARG B 1 79  ? 10.792  -26.116 -16.600 1.00 64.68  ? 102  ARG B NH1 1 
ATOM   2594 N  NH2 . ARG B 1 79  ? 11.375  -25.418 -14.502 1.00 65.42  ? 102  ARG B NH2 1 
ATOM   2595 N  N   . GLU B 1 80  ? 7.272   -19.879 -16.882 1.00 64.11  ? 103  GLU B N   1 
ATOM   2596 C  CA  . GLU B 1 80  ? 6.515   -19.150 -15.879 1.00 67.44  ? 103  GLU B CA  1 
ATOM   2597 C  C   . GLU B 1 80  ? 5.148   -18.699 -16.442 1.00 63.00  ? 103  GLU B C   1 
ATOM   2598 O  O   . GLU B 1 80  ? 4.136   -18.790 -15.710 1.00 62.00  ? 103  GLU B O   1 
ATOM   2599 C  CB  . GLU B 1 80  ? 7.323   -17.981 -15.243 1.00 72.92  ? 103  GLU B CB  1 
ATOM   2600 C  CG  . GLU B 1 80  ? 8.699   -18.334 -14.644 1.00 78.94  ? 103  GLU B CG  1 
ATOM   2601 C  CD  . GLU B 1 80  ? 8.670   -19.094 -13.324 1.00 84.58  ? 103  GLU B CD  1 
ATOM   2602 O  OE1 . GLU B 1 80  ? 8.513   -18.442 -12.281 1.00 97.80  ? 103  GLU B OE1 1 
ATOM   2603 O  OE2 . GLU B 1 80  ? 8.861   -20.334 -13.313 1.00 85.15  ? 103  GLU B OE2 1 
ATOM   2604 N  N   . VAL B 1 81  ? 5.052   -18.262 -17.703 1.00 54.71  ? 104  VAL B N   1 
ATOM   2605 C  CA  . VAL B 1 81  ? 3.710   -17.798 -18.136 1.00 55.67  ? 104  VAL B CA  1 
ATOM   2606 C  C   . VAL B 1 81  ? 2.658   -18.881 -17.991 1.00 56.88  ? 104  VAL B C   1 
ATOM   2607 O  O   . VAL B 1 81  ? 1.473   -18.590 -18.100 1.00 53.42  ? 104  VAL B O   1 
ATOM   2608 C  CB  . VAL B 1 81  ? 3.583   -17.288 -19.579 1.00 56.74  ? 104  VAL B CB  1 
ATOM   2609 C  CG1 . VAL B 1 81  ? 4.733   -16.362 -19.936 1.00 58.43  ? 104  VAL B CG1 1 
ATOM   2610 C  CG2 . VAL B 1 81  ? 3.452   -18.444 -20.574 1.00 62.23  ? 104  VAL B CG2 1 
ATOM   2611 N  N   . MET B 1 82  ? 3.091   -20.130 -17.801 1.00 61.95  ? 105  MET B N   1 
ATOM   2612 C  CA  . MET B 1 82  ? 2.149   -21.248 -17.717 1.00 64.93  ? 105  MET B CA  1 
ATOM   2613 C  C   . MET B 1 82  ? 1.377   -21.208 -16.408 1.00 66.82  ? 105  MET B C   1 
ATOM   2614 O  O   . MET B 1 82  ? 0.233   -21.688 -16.344 1.00 64.02  ? 105  MET B O   1 
ATOM   2615 C  CB  . MET B 1 82  ? 2.860   -22.618 -17.905 1.00 64.47  ? 105  MET B CB  1 
ATOM   2616 C  CG  . MET B 1 82  ? 3.388   -22.867 -19.305 1.00 62.98  ? 105  MET B CG  1 
ATOM   2617 S  SD  . MET B 1 82  ? 2.132   -22.565 -20.568 1.00 67.31  ? 105  MET B SD  1 
ATOM   2618 C  CE  . MET B 1 82  ? 0.940   -23.766 -20.011 1.00 66.95  ? 105  MET B CE  1 
ATOM   2619 N  N   . ARG B 1 83  ? 1.997   -20.627 -15.384 1.00 67.67  ? 106  ARG B N   1 
ATOM   2620 C  CA  . ARG B 1 83  ? 1.362   -20.505 -14.088 1.00 71.63  ? 106  ARG B CA  1 
ATOM   2621 C  C   . ARG B 1 83  ? -0.037  -19.879 -14.214 1.00 70.85  ? 106  ARG B C   1 
ATOM   2622 O  O   . ARG B 1 83  ? -0.917  -20.167 -13.414 1.00 74.63  ? 106  ARG B O   1 
ATOM   2623 C  CB  . ARG B 1 83  ? 2.208   -19.627 -13.182 1.00 80.64  ? 106  ARG B CB  1 
ATOM   2624 C  CG  . ARG B 1 83  ? 3.656   -20.006 -12.949 1.00 87.37  ? 106  ARG B CG  1 
ATOM   2625 C  CD  . ARG B 1 83  ? 4.396   -18.780 -12.405 1.00 90.96  ? 106  ARG B CD  1 
ATOM   2626 N  NE  . ARG B 1 83  ? 5.135   -19.062 -11.181 1.00 94.97  ? 106  ARG B NE  1 
ATOM   2627 C  CZ  . ARG B 1 83  ? 4.572   -19.399 -10.019 1.00 101.33 ? 106  ARG B CZ  1 
ATOM   2628 N  NH1 . ARG B 1 83  ? 3.250   -19.507 -9.882  1.00 95.04  ? 106  ARG B NH1 1 
ATOM   2629 N  NH2 . ARG B 1 83  ? 5.353   -19.640 -8.971  1.00 109.59 ? 106  ARG B NH2 1 
ATOM   2630 N  N   . SER B 1 84  ? -0.245  -19.021 -15.213 1.00 68.21  ? 107  SER B N   1 
ATOM   2631 C  CA  . SER B 1 84  ? -1.516  -18.326 -15.397 1.00 64.34  ? 107  SER B CA  1 
ATOM   2632 C  C   . SER B 1 84  ? -2.344  -18.810 -16.586 1.00 58.87  ? 107  SER B C   1 
ATOM   2633 O  O   . SER B 1 84  ? -3.409  -18.285 -16.813 1.00 61.82  ? 107  SER B O   1 
ATOM   2634 C  CB  . SER B 1 84  ? -1.253  -16.824 -15.557 1.00 63.17  ? 107  SER B CB  1 
ATOM   2635 O  OG  . SER B 1 84  ? -0.581  -16.566 -16.768 1.00 57.36  ? 107  SER B OG  1 
ATOM   2636 N  N   . LYS B 1 85  ? -1.864  -19.772 -17.358 1.00 55.66  ? 108  LYS B N   1 
ATOM   2637 C  CA  . LYS B 1 85  ? -2.677  -20.342 -18.434 1.00 54.42  ? 108  LYS B CA  1 
ATOM   2638 C  C   . LYS B 1 85  ? -3.158  -21.708 -18.024 1.00 52.65  ? 108  LYS B C   1 
ATOM   2639 O  O   . LYS B 1 85  ? -2.353  -22.546 -17.629 1.00 46.99  ? 108  LYS B O   1 
ATOM   2640 C  CB  . LYS B 1 85  ? -1.891  -20.512 -19.721 1.00 55.76  ? 108  LYS B CB  1 
ATOM   2641 C  CG  . LYS B 1 85  ? -1.086  -19.317 -20.159 1.00 60.26  ? 108  LYS B CG  1 
ATOM   2642 C  CD  . LYS B 1 85  ? -1.935  -18.084 -20.287 1.00 64.35  ? 108  LYS B CD  1 
ATOM   2643 C  CE  . LYS B 1 85  ? -1.064  -16.893 -20.603 1.00 69.28  ? 108  LYS B CE  1 
ATOM   2644 N  NZ  . LYS B 1 85  ? -1.961  -15.772 -20.976 1.00 76.69  ? 108  LYS B NZ  1 
ATOM   2645 N  N   . MET B 1 86  ? -4.472  -21.915 -18.109 1.00 54.26  ? 109  MET B N   1 
ATOM   2646 C  CA  . MET B 1 86  ? -5.098  -23.165 -17.684 1.00 53.39  ? 109  MET B CA  1 
ATOM   2647 C  C   . MET B 1 86  ? -5.589  -23.925 -18.892 1.00 49.89  ? 109  MET B C   1 
ATOM   2648 O  O   . MET B 1 86  ? -5.869  -23.329 -19.932 1.00 50.54  ? 109  MET B O   1 
ATOM   2649 C  CB  . MET B 1 86  ? -6.314  -22.899 -16.776 1.00 57.30  ? 109  MET B CB  1 
ATOM   2650 C  CG  . MET B 1 86  ? -6.108  -21.866 -15.679 1.00 61.39  ? 109  MET B CG  1 
ATOM   2651 S  SD  . MET B 1 86  ? -4.646  -22.213 -14.679 1.00 70.52  ? 109  MET B SD  1 
ATOM   2652 C  CE  . MET B 1 86  ? -5.145  -23.641 -13.753 1.00 72.97  ? 109  MET B CE  1 
ATOM   2653 N  N   . PRO B 1 87  ? -5.734  -25.240 -18.747 1.00 47.62  ? 110  PRO B N   1 
ATOM   2654 C  CA  . PRO B 1 87  ? -6.361  -26.090 -19.748 1.00 48.20  ? 110  PRO B CA  1 
ATOM   2655 C  C   . PRO B 1 87  ? -7.735  -25.598 -20.086 1.00 47.50  ? 110  PRO B C   1 
ATOM   2656 O  O   . PRO B 1 87  ? -8.456  -25.168 -19.211 1.00 55.59  ? 110  PRO B O   1 
ATOM   2657 C  CB  . PRO B 1 87  ? -6.509  -27.442 -19.040 1.00 49.25  ? 110  PRO B CB  1 
ATOM   2658 C  CG  . PRO B 1 87  ? -5.536  -27.427 -17.927 1.00 49.62  ? 110  PRO B CG  1 
ATOM   2659 C  CD  . PRO B 1 87  ? -5.241  -25.996 -17.587 1.00 49.56  ? 110  PRO B CD  1 
ATOM   2660 N  N   . ASN B 1 88  ? -8.096  -25.638 -21.342 1.00 46.89  ? 111  ASN B N   1 
ATOM   2661 C  CA  . ASN B 1 88  ? -9.445  -25.291 -21.745 1.00 47.69  ? 111  ASN B CA  1 
ATOM   2662 C  C   . ASN B 1 88  ? -10.325 -26.548 -21.793 1.00 48.35  ? 111  ASN B C   1 
ATOM   2663 O  O   . ASN B 1 88  ? -9.878  -27.642 -21.408 1.00 47.90  ? 111  ASN B O   1 
ATOM   2664 C  CB  . ASN B 1 88  ? -9.389  -24.562 -23.081 1.00 47.12  ? 111  ASN B CB  1 
ATOM   2665 C  CG  . ASN B 1 88  ? -8.738  -25.388 -24.159 1.00 49.51  ? 111  ASN B CG  1 
ATOM   2666 O  OD1 . ASN B 1 88  ? -9.203  -26.508 -24.473 1.00 51.94  ? 111  ASN B OD1 1 
ATOM   2667 N  ND2 . ASN B 1 88  ? -7.633  -24.876 -24.712 1.00 47.61  ? 111  ASN B ND2 1 
ATOM   2668 N  N   . PRO B 1 89  ? -11.589 -26.394 -22.227 1.00 45.80  ? 112  PRO B N   1 
ATOM   2669 C  CA  . PRO B 1 89  ? -12.530 -27.500 -22.198 1.00 45.17  ? 112  PRO B CA  1 
ATOM   2670 C  C   . PRO B 1 89  ? -12.184 -28.631 -23.072 1.00 48.00  ? 112  PRO B C   1 
ATOM   2671 O  O   . PRO B 1 89  ? -12.580 -29.748 -22.781 1.00 50.79  ? 112  PRO B O   1 
ATOM   2672 C  CB  . PRO B 1 89  ? -13.798 -26.871 -22.698 1.00 43.55  ? 112  PRO B CB  1 
ATOM   2673 C  CG  . PRO B 1 89  ? -13.721 -25.536 -22.089 1.00 44.00  ? 112  PRO B CG  1 
ATOM   2674 C  CD  . PRO B 1 89  ? -12.305 -25.120 -22.337 1.00 44.33  ? 112  PRO B CD  1 
ATOM   2675 N  N   . ALA B 1 90  ? -11.443 -28.368 -24.135 1.00 51.79  ? 113  ALA B N   1 
ATOM   2676 C  CA  . ALA B 1 90  ? -11.017 -29.455 -25.014 1.00 56.24  ? 113  ALA B CA  1 
ATOM   2677 C  C   . ALA B 1 90  ? -10.014 -30.371 -24.298 1.00 53.92  ? 113  ALA B C   1 
ATOM   2678 O  O   . ALA B 1 90  ? -10.152 -31.608 -24.323 1.00 50.29  ? 113  ALA B O   1 
ATOM   2679 C  CB  . ALA B 1 90  ? -10.403 -28.899 -26.280 1.00 60.88  ? 113  ALA B CB  1 
ATOM   2680 N  N   . HIS B 1 91  ? -9.028  -29.752 -23.653 1.00 50.12  ? 114  HIS B N   1 
ATOM   2681 C  CA  . HIS B 1 91  ? -8.067  -30.498 -22.865 1.00 51.48  ? 114  HIS B CA  1 
ATOM   2682 C  C   . HIS B 1 91  ? -8.763  -31.475 -21.946 1.00 50.89  ? 114  HIS B C   1 
ATOM   2683 O  O   . HIS B 1 91  ? -8.321  -32.642 -21.797 1.00 57.69  ? 114  HIS B O   1 
ATOM   2684 C  CB  . HIS B 1 91  ? -7.179  -29.565 -22.048 1.00 50.45  ? 114  HIS B CB  1 
ATOM   2685 C  CG  . HIS B 1 91  ? -6.143  -28.863 -22.873 1.00 52.49  ? 114  HIS B CG  1 
ATOM   2686 N  ND1 . HIS B 1 91  ? -6.197  -27.512 -23.140 1.00 53.35  ? 114  HIS B ND1 1 
ATOM   2687 C  CD2 . HIS B 1 91  ? -5.032  -29.326 -23.502 1.00 51.64  ? 114  HIS B CD2 1 
ATOM   2688 C  CE1 . HIS B 1 91  ? -5.158  -27.166 -23.885 1.00 54.13  ? 114  HIS B CE1 1 
ATOM   2689 N  NE2 . HIS B 1 91  ? -4.427  -28.247 -24.111 1.00 53.06  ? 114  HIS B NE2 1 
ATOM   2690 N  N   . LEU B 1 92  ? -9.849  -30.994 -21.347 1.00 46.02  ? 115  LEU B N   1 
ATOM   2691 C  CA  . LEU B 1 92  ? -10.507 -31.710 -20.295 1.00 45.24  ? 115  LEU B CA  1 
ATOM   2692 C  C   . LEU B 1 92  ? -11.317 -32.802 -20.866 1.00 44.85  ? 115  LEU B C   1 
ATOM   2693 O  O   . LEU B 1 92  ? -11.211 -33.953 -20.439 1.00 45.32  ? 115  LEU B O   1 
ATOM   2694 C  CB  . LEU B 1 92  ? -11.378 -30.770 -19.481 1.00 46.09  ? 115  LEU B CB  1 
ATOM   2695 C  CG  . LEU B 1 92  ? -10.465 -30.063 -18.484 1.00 47.57  ? 115  LEU B CG  1 
ATOM   2696 C  CD1 . LEU B 1 92  ? -10.837 -28.617 -18.262 1.00 48.53  ? 115  LEU B CD1 1 
ATOM   2697 C  CD2 . LEU B 1 92  ? -10.457 -30.825 -17.175 1.00 48.02  ? 115  LEU B CD2 1 
ATOM   2698 N  N   . ALA B 1 93  ? -12.125 -32.443 -21.851 1.00 45.34  ? 116  ALA B N   1 
ATOM   2699 C  CA  . ALA B 1 93  ? -13.043 -33.389 -22.487 1.00 44.81  ? 116  ALA B CA  1 
ATOM   2700 C  C   . ALA B 1 93  ? -12.297 -34.651 -22.866 1.00 45.85  ? 116  ALA B C   1 
ATOM   2701 O  O   . ALA B 1 93  ? -12.756 -35.785 -22.624 1.00 46.48  ? 116  ALA B O   1 
ATOM   2702 C  CB  . ALA B 1 93  ? -13.697 -32.760 -23.700 1.00 42.90  ? 116  ALA B CB  1 
ATOM   2703 N  N   . ILE B 1 94  ? -11.109 -34.440 -23.402 1.00 46.46  ? 117  ILE B N   1 
ATOM   2704 C  CA  . ILE B 1 94  ? -10.239 -35.541 -23.720 1.00 48.77  ? 117  ILE B CA  1 
ATOM   2705 C  C   . ILE B 1 94  ? -9.871  -36.334 -22.476 1.00 51.86  ? 117  ILE B C   1 
ATOM   2706 O  O   . ILE B 1 94  ? -10.088 -37.547 -22.435 1.00 54.45  ? 117  ILE B O   1 
ATOM   2707 C  CB  . ILE B 1 94  ? -8.974  -35.038 -24.398 1.00 47.75  ? 117  ILE B CB  1 
ATOM   2708 C  CG1 . ILE B 1 94  ? -9.340  -34.513 -25.791 1.00 45.86  ? 117  ILE B CG1 1 
ATOM   2709 C  CG2 . ILE B 1 94  ? -7.939  -36.146 -24.475 1.00 46.76  ? 117  ILE B CG2 1 
ATOM   2710 C  CD1 . ILE B 1 94  ? -8.293  -33.589 -26.349 1.00 44.63  ? 117  ILE B CD1 1 
ATOM   2711 N  N   . ALA B 1 95  ? -9.337  -35.640 -21.470 1.00 53.62  ? 118  ALA B N   1 
ATOM   2712 C  CA  . ALA B 1 95  ? -8.877  -36.288 -20.229 1.00 52.69  ? 118  ALA B CA  1 
ATOM   2713 C  C   . ALA B 1 95  ? -9.977  -37.104 -19.549 1.00 50.79  ? 118  ALA B C   1 
ATOM   2714 O  O   . ALA B 1 95  ? -9.753  -38.215 -19.053 1.00 48.53  ? 118  ALA B O   1 
ATOM   2715 C  CB  . ALA B 1 95  ? -8.317  -35.248 -19.272 1.00 51.83  ? 118  ALA B CB  1 
ATOM   2716 N  N   . GLU B 1 96  ? -11.182 -36.573 -19.571 1.00 50.43  ? 119  GLU B N   1 
ATOM   2717 C  CA  . GLU B 1 96  ? -12.268 -37.275 -18.965 1.00 53.02  ? 119  GLU B CA  1 
ATOM   2718 C  C   . GLU B 1 96  ? -12.636 -38.442 -19.873 1.00 54.38  ? 119  GLU B C   1 
ATOM   2719 O  O   . GLU B 1 96  ? -12.942 -39.535 -19.406 1.00 55.60  ? 119  GLU B O   1 
ATOM   2720 C  CB  . GLU B 1 96  ? -13.420 -36.313 -18.659 1.00 52.83  ? 119  GLU B CB  1 
ATOM   2721 C  CG  . GLU B 1 96  ? -12.924 -35.169 -17.776 1.00 55.09  ? 119  GLU B CG  1 
ATOM   2722 C  CD  . GLU B 1 96  ? -14.021 -34.458 -16.985 1.00 56.49  ? 119  GLU B CD  1 
ATOM   2723 O  OE1 . GLU B 1 96  ? -15.156 -34.605 -17.447 1.00 53.93  ? 119  GLU B OE1 1 
ATOM   2724 O  OE2 . GLU B 1 96  ? -13.753 -33.746 -15.946 1.00 54.04  ? 119  GLU B OE2 1 
ATOM   2725 N  N   . CYS B 1 97  ? -12.534 -38.240 -21.171 1.00 56.21  ? 120  CYS B N   1 
ATOM   2726 C  CA  . CYS B 1 97  ? -12.852 -39.312 -22.103 1.00 58.90  ? 120  CYS B CA  1 
ATOM   2727 C  C   . CYS B 1 97  ? -11.971 -40.530 -21.856 1.00 56.37  ? 120  CYS B C   1 
ATOM   2728 O  O   . CYS B 1 97  ? -12.460 -41.671 -21.687 1.00 54.30  ? 120  CYS B O   1 
ATOM   2729 C  CB  . CYS B 1 97  ? -12.665 -38.838 -23.542 1.00 59.27  ? 120  CYS B CB  1 
ATOM   2730 S  SG  . CYS B 1 97  ? -13.342 -39.995 -24.751 1.00 54.78  ? 120  CYS B SG  1 
ATOM   2731 N  N   . GLU B 1 98  ? -10.669 -40.271 -21.851 1.00 50.60  ? 121  GLU B N   1 
ATOM   2732 C  CA  . GLU B 1 98  ? -9.687  -41.312 -21.657 1.00 50.00  ? 121  GLU B CA  1 
ATOM   2733 C  C   . GLU B 1 98  ? -10.038 -42.073 -20.412 1.00 52.84  ? 121  GLU B C   1 
ATOM   2734 O  O   . GLU B 1 98  ? -10.102 -43.309 -20.419 1.00 60.56  ? 121  GLU B O   1 
ATOM   2735 C  CB  . GLU B 1 98  ? -8.344  -40.677 -21.517 1.00 49.39  ? 121  GLU B CB  1 
ATOM   2736 C  CG  . GLU B 1 98  ? -7.207  -41.566 -21.118 1.00 51.25  ? 121  GLU B CG  1 
ATOM   2737 C  CD  . GLU B 1 98  ? -5.949  -40.732 -20.906 1.00 60.66  ? 121  GLU B CD  1 
ATOM   2738 O  OE1 . GLU B 1 98  ? -5.936  -39.491 -21.269 1.00 65.92  ? 121  GLU B OE1 1 
ATOM   2739 O  OE2 . GLU B 1 98  ? -4.973  -41.312 -20.376 1.00 59.98  ? 121  GLU B OE2 1 
ATOM   2740 N  N   . ALA B 1 99  ? -10.345 -41.325 -19.356 1.00 53.69  ? 122  ALA B N   1 
ATOM   2741 C  CA  . ALA B 1 99  ? -10.716 -41.908 -18.066 1.00 50.85  ? 122  ALA B CA  1 
ATOM   2742 C  C   . ALA B 1 99  ? -11.961 -42.772 -18.178 1.00 48.37  ? 122  ALA B C   1 
ATOM   2743 O  O   . ALA B 1 99  ? -11.946 -43.943 -17.877 1.00 49.36  ? 122  ALA B O   1 
ATOM   2744 C  CB  . ALA B 1 99  ? -10.928 -40.807 -17.052 1.00 50.83  ? 122  ALA B CB  1 
ATOM   2745 N  N   . ARG B 1 100 ? -13.032 -42.199 -18.674 1.00 48.05  ? 123  ARG B N   1 
ATOM   2746 C  CA  . ARG B 1 100 ? -14.283 -42.924 -18.807 1.00 49.00  ? 123  ARG B CA  1 
ATOM   2747 C  C   . ARG B 1 100 ? -14.120 -44.191 -19.624 1.00 47.61  ? 123  ARG B C   1 
ATOM   2748 O  O   . ARG B 1 100 ? -14.535 -45.265 -19.217 1.00 44.44  ? 123  ARG B O   1 
ATOM   2749 C  CB  . ARG B 1 100 ? -15.284 -42.000 -19.451 1.00 53.51  ? 123  ARG B CB  1 
ATOM   2750 C  CG  . ARG B 1 100 ? -16.678 -42.538 -19.545 1.00 59.27  ? 123  ARG B CG  1 
ATOM   2751 C  CD  . ARG B 1 100 ? -17.677 -41.406 -19.757 1.00 63.93  ? 123  ARG B CD  1 
ATOM   2752 N  NE  . ARG B 1 100 ? -17.564 -40.920 -21.113 1.00 66.99  ? 123  ARG B NE  1 
ATOM   2753 C  CZ  . ARG B 1 100 ? -16.933 -39.814 -21.473 1.00 76.58  ? 123  ARG B CZ  1 
ATOM   2754 N  NH1 . ARG B 1 100 ? -16.349 -38.994 -20.567 1.00 76.05  ? 123  ARG B NH1 1 
ATOM   2755 N  NH2 . ARG B 1 100 ? -16.892 -39.531 -22.772 1.00 83.05  ? 123  ARG B NH2 1 
ATOM   2756 N  N   . LEU B 1 101 ? -13.461 -44.068 -20.758 1.00 50.24  ? 124  LEU B N   1 
ATOM   2757 C  CA  . LEU B 1 101 ? -13.295 -45.220 -21.621 1.00 57.03  ? 124  LEU B CA  1 
ATOM   2758 C  C   . LEU B 1 101 ? -12.369 -46.225 -21.026 1.00 59.28  ? 124  LEU B C   1 
ATOM   2759 O  O   . LEU B 1 101 ? -12.514 -47.407 -21.278 1.00 58.86  ? 124  LEU B O   1 
ATOM   2760 C  CB  . LEU B 1 101 ? -12.795 -44.834 -23.008 1.00 60.73  ? 124  LEU B CB  1 
ATOM   2761 C  CG  . LEU B 1 101 ? -13.975 -44.610 -23.964 1.00 64.13  ? 124  LEU B CG  1 
ATOM   2762 C  CD1 . LEU B 1 101 ? -14.931 -43.557 -23.419 1.00 68.78  ? 124  LEU B CD1 1 
ATOM   2763 C  CD2 . LEU B 1 101 ? -13.510 -44.215 -25.354 1.00 63.66  ? 124  LEU B CD2 1 
ATOM   2764 N  N   . GLY B 1 102 ? -11.417 -45.767 -20.229 1.00 62.88  ? 125  GLY B N   1 
ATOM   2765 C  CA  . GLY B 1 102 ? -10.504 -46.681 -19.528 1.00 63.66  ? 125  GLY B CA  1 
ATOM   2766 C  C   . GLY B 1 102 ? -11.223 -47.681 -18.631 1.00 61.31  ? 125  GLY B C   1 
ATOM   2767 O  O   . GLY B 1 102 ? -10.930 -48.872 -18.646 1.00 56.43  ? 125  GLY B O   1 
ATOM   2768 N  N   . GLN B 1 103 ? -12.206 -47.190 -17.898 1.00 62.17  ? 126  GLN B N   1 
ATOM   2769 C  CA  . GLN B 1 103 ? -13.057 -48.052 -17.078 1.00 67.13  ? 126  GLN B CA  1 
ATOM   2770 C  C   . GLN B 1 103 ? -13.821 -49.104 -17.891 1.00 65.62  ? 126  GLN B C   1 
ATOM   2771 O  O   . GLN B 1 103 ? -14.072 -50.222 -17.427 1.00 66.72  ? 126  GLN B O   1 
ATOM   2772 C  CB  . GLN B 1 103 ? -14.039 -47.214 -16.288 1.00 68.48  ? 126  GLN B CB  1 
ATOM   2773 C  CG  . GLN B 1 103 ? -13.455 -46.687 -15.007 1.00 71.69  ? 126  GLN B CG  1 
ATOM   2774 C  CD  . GLN B 1 103 ? -14.273 -45.534 -14.417 1.00 82.21  ? 126  GLN B CD  1 
ATOM   2775 O  OE1 . GLN B 1 103 ? -15.044 -44.838 -15.110 1.00 84.65  ? 126  GLN B OE1 1 
ATOM   2776 N  NE2 . GLN B 1 103 ? -14.118 -45.335 -13.121 1.00 85.58  ? 126  GLN B NE2 1 
ATOM   2777 N  N   . GLN B 1 104 ? -14.176 -48.744 -19.107 1.00 64.09  ? 127  GLN B N   1 
ATOM   2778 C  CA  . GLN B 1 104 ? -14.816 -49.684 -19.997 1.00 65.25  ? 127  GLN B CA  1 
ATOM   2779 C  C   . GLN B 1 104 ? -13.818 -50.568 -20.715 1.00 63.29  ? 127  GLN B C   1 
ATOM   2780 O  O   . GLN B 1 104 ? -14.195 -51.268 -21.637 1.00 63.61  ? 127  GLN B O   1 
ATOM   2781 C  CB  . GLN B 1 104 ? -15.619 -48.950 -21.056 1.00 69.03  ? 127  GLN B CB  1 
ATOM   2782 C  CG  . GLN B 1 104 ? -16.603 -47.929 -20.511 1.00 75.14  ? 127  GLN B CG  1 
ATOM   2783 C  CD  . GLN B 1 104 ? -17.116 -47.013 -21.595 1.00 77.87  ? 127  GLN B CD  1 
ATOM   2784 O  OE1 . GLN B 1 104 ? -17.042 -47.364 -22.771 1.00 89.57  ? 127  GLN B OE1 1 
ATOM   2785 N  NE2 . GLN B 1 104 ? -17.640 -45.849 -21.218 1.00 75.24  ? 127  GLN B NE2 1 
ATOM   2786 N  N   . GLY B 1 105 ? -12.546 -50.545 -20.332 1.00 62.35  ? 128  GLY B N   1 
ATOM   2787 C  CA  . GLY B 1 105 ? -11.525 -51.319 -21.058 1.00 62.04  ? 128  GLY B CA  1 
ATOM   2788 C  C   . GLY B 1 105 ? -11.148 -50.815 -22.457 1.00 61.98  ? 128  GLY B C   1 
ATOM   2789 O  O   . GLY B 1 105 ? -10.493 -51.514 -23.196 1.00 64.88  ? 128  GLY B O   1 
ATOM   2790 N  N   . ARG B 1 106 ? -11.561 -49.616 -22.844 1.00 60.78  ? 129  ARG B N   1 
ATOM   2791 C  CA  . ARG B 1 106 ? -11.180 -49.064 -24.131 1.00 60.02  ? 129  ARG B CA  1 
ATOM   2792 C  C   . ARG B 1 106 ? -10.049 -48.109 -23.901 1.00 64.43  ? 129  ARG B C   1 
ATOM   2793 O  O   . ARG B 1 106 ? -9.775  -47.693 -22.773 1.00 70.97  ? 129  ARG B O   1 
ATOM   2794 C  CB  . ARG B 1 106 ? -12.346 -48.335 -24.766 1.00 59.41  ? 129  ARG B CB  1 
ATOM   2795 C  CG  . ARG B 1 106 ? -13.584 -49.211 -24.868 1.00 59.73  ? 129  ARG B CG  1 
ATOM   2796 C  CD  . ARG B 1 106 ? -14.866 -48.397 -24.859 1.00 57.67  ? 129  ARG B CD  1 
ATOM   2797 N  NE  . ARG B 1 106 ? -15.163 -47.866 -26.177 1.00 55.88  ? 129  ARG B NE  1 
ATOM   2798 C  CZ  . ARG B 1 106 ? -15.972 -46.845 -26.414 1.00 55.06  ? 129  ARG B CZ  1 
ATOM   2799 N  NH1 . ARG B 1 106 ? -16.565 -46.214 -25.420 1.00 57.19  ? 129  ARG B NH1 1 
ATOM   2800 N  NH2 . ARG B 1 106 ? -16.178 -46.433 -27.654 1.00 56.05  ? 129  ARG B NH2 1 
ATOM   2801 N  N   . SER B 1 107 ? -9.395  -47.748 -24.991 1.00 63.81  ? 130  SER B N   1 
ATOM   2802 C  CA  . SER B 1 107 ? -8.168  -47.019 -24.907 1.00 59.38  ? 130  SER B CA  1 
ATOM   2803 C  C   . SER B 1 107 ? -8.270  -45.687 -25.652 1.00 57.19  ? 130  SER B C   1 
ATOM   2804 O  O   . SER B 1 107 ? -8.907  -45.565 -26.707 1.00 54.28  ? 130  SER B O   1 
ATOM   2805 C  CB  . SER B 1 107 ? -7.037  -47.897 -25.421 1.00 60.85  ? 130  SER B CB  1 
ATOM   2806 O  OG  . SER B 1 107 ? -6.295  -47.233 -26.412 1.00 67.81  ? 130  SER B OG  1 
ATOM   2807 N  N   . VAL B 1 108 ? -7.611  -44.695 -25.072 1.00 55.11  ? 131  VAL B N   1 
ATOM   2808 C  CA  . VAL B 1 108 ? -7.503  -43.377 -25.641 1.00 52.80  ? 131  VAL B CA  1 
ATOM   2809 C  C   . VAL B 1 108 ? -6.083  -42.885 -25.394 1.00 56.33  ? 131  VAL B C   1 
ATOM   2810 O  O   . VAL B 1 108 ? -5.649  -42.773 -24.238 1.00 58.75  ? 131  VAL B O   1 
ATOM   2811 C  CB  . VAL B 1 108 ? -8.490  -42.405 -24.997 1.00 50.11  ? 131  VAL B CB  1 
ATOM   2812 C  CG1 . VAL B 1 108 ? -8.260  -40.997 -25.510 1.00 47.82  ? 131  VAL B CG1 1 
ATOM   2813 C  CG2 . VAL B 1 108 ? -9.914  -42.837 -25.275 1.00 49.30  ? 131  VAL B CG2 1 
ATOM   2814 N  N   . VAL B 1 109 ? -5.384  -42.561 -26.485 1.00 57.11  ? 132  VAL B N   1 
ATOM   2815 C  CA  . VAL B 1 109 ? -4.013  -42.082 -26.431 1.00 55.92  ? 132  VAL B CA  1 
ATOM   2816 C  C   . VAL B 1 109 ? -3.916  -40.720 -27.138 1.00 55.89  ? 132  VAL B C   1 
ATOM   2817 O  O   . VAL B 1 109 ? -4.555  -40.471 -28.161 1.00 53.35  ? 132  VAL B O   1 
ATOM   2818 C  CB  . VAL B 1 109 ? -3.035  -43.129 -27.002 1.00 58.14  ? 132  VAL B CB  1 
ATOM   2819 C  CG1 . VAL B 1 109 ? -3.726  -44.018 -28.008 1.00 61.54  ? 132  VAL B CG1 1 
ATOM   2820 C  CG2 . VAL B 1 109 ? -1.815  -42.499 -27.662 1.00 60.61  ? 132  VAL B CG2 1 
ATOM   2821 N  N   . ILE B 1 110 ? -3.124  -39.831 -26.547 1.00 55.90  ? 133  ILE B N   1 
ATOM   2822 C  CA  . ILE B 1 110 ? -2.898  -38.520 -27.088 1.00 55.58  ? 133  ILE B CA  1 
ATOM   2823 C  C   . ILE B 1 110 ? -1.477  -38.392 -27.621 1.00 54.26  ? 133  ILE B C   1 
ATOM   2824 O  O   . ILE B 1 110 ? -0.502  -38.782 -26.985 1.00 56.68  ? 133  ILE B O   1 
ATOM   2825 C  CB  . ILE B 1 110 ? -3.117  -37.441 -26.027 1.00 59.88  ? 133  ILE B CB  1 
ATOM   2826 C  CG1 . ILE B 1 110 ? -4.583  -37.419 -25.585 1.00 64.35  ? 133  ILE B CG1 1 
ATOM   2827 C  CG2 . ILE B 1 110 ? -2.732  -36.087 -26.588 1.00 59.44  ? 133  ILE B CG2 1 
ATOM   2828 C  CD1 . ILE B 1 110 ? -4.967  -38.515 -24.601 1.00 69.31  ? 133  ILE B CD1 1 
ATOM   2829 N  N   . ILE B 1 111 ? -1.391  -37.855 -28.822 1.00 51.71  ? 134  ILE B N   1 
ATOM   2830 C  CA  . ILE B 1 111 ? -0.152  -37.590 -29.487 1.00 48.58  ? 134  ILE B CA  1 
ATOM   2831 C  C   . ILE B 1 111 ? -0.182  -36.098 -29.712 1.00 48.93  ? 134  ILE B C   1 
ATOM   2832 O  O   . ILE B 1 111 ? -0.987  -35.618 -30.519 1.00 45.38  ? 134  ILE B O   1 
ATOM   2833 C  CB  . ILE B 1 111 ? -0.166  -38.258 -30.854 1.00 48.10  ? 134  ILE B CB  1 
ATOM   2834 C  CG1 . ILE B 1 111 ? -0.279  -39.754 -30.699 1.00 52.43  ? 134  ILE B CG1 1 
ATOM   2835 C  CG2 . ILE B 1 111 ? 1.075   -37.937 -31.636 1.00 47.62  ? 134  ILE B CG2 1 
ATOM   2836 C  CD1 . ILE B 1 111 ? -0.977  -40.394 -31.886 1.00 54.69  ? 134  ILE B CD1 1 
ATOM   2837 N  N   . THR B 1 112 ? 0.681   -35.361 -29.015 1.00 47.56  ? 135  THR B N   1 
ATOM   2838 C  CA  . THR B 1 112 ? 0.626   -33.899 -29.050 1.00 46.19  ? 135  THR B CA  1 
ATOM   2839 C  C   . THR B 1 112 ? 1.956   -33.283 -29.464 1.00 51.63  ? 135  THR B C   1 
ATOM   2840 O  O   . THR B 1 112 ? 3.013   -33.752 -29.014 1.00 55.60  ? 135  THR B O   1 
ATOM   2841 C  CB  . THR B 1 112 ? 0.171   -33.292 -27.700 1.00 40.58  ? 135  THR B CB  1 
ATOM   2842 O  OG1 . THR B 1 112 ? 0.158   -31.870 -27.800 1.00 36.90  ? 135  THR B OG1 1 
ATOM   2843 C  CG2 . THR B 1 112 ? 1.077   -33.685 -26.583 1.00 39.46  ? 135  THR B CG2 1 
ATOM   2844 N  N   . GLN B 1 113 ? 1.873   -32.221 -30.295 1.00 54.56  ? 136  GLN B N   1 
ATOM   2845 C  CA  . GLN B 1 113 ? 3.015   -31.377 -30.673 1.00 55.19  ? 136  GLN B CA  1 
ATOM   2846 C  C   . GLN B 1 113 ? 3.233   -30.267 -29.675 1.00 52.71  ? 136  GLN B C   1 
ATOM   2847 O  O   . GLN B 1 113 ? 4.183   -29.502 -29.804 1.00 53.89  ? 136  GLN B O   1 
ATOM   2848 C  CB  . GLN B 1 113 ? 2.815   -30.686 -32.035 1.00 62.74  ? 136  GLN B CB  1 
ATOM   2849 C  CG  . GLN B 1 113 ? 1.644   -31.183 -32.866 1.00 72.24  ? 136  GLN B CG  1 
ATOM   2850 C  CD  . GLN B 1 113 ? 1.265   -30.280 -34.033 1.00 83.68  ? 136  GLN B CD  1 
ATOM   2851 O  OE1 . GLN B 1 113 ? 0.914   -30.770 -35.136 1.00 82.23  ? 136  GLN B OE1 1 
ATOM   2852 N  NE2 . GLN B 1 113 ? 1.272   -28.955 -33.789 1.00 90.77  ? 136  GLN B NE2 1 
ATOM   2853 N  N   . ASN B 1 114 ? 2.367   -30.162 -28.681 1.00 48.98  ? 137  ASN B N   1 
ATOM   2854 C  CA  . ASN B 1 114 ? 2.463   -29.061 -27.774 1.00 50.12  ? 137  ASN B CA  1 
ATOM   2855 C  C   . ASN B 1 114 ? 3.407   -29.383 -26.641 1.00 54.47  ? 137  ASN B C   1 
ATOM   2856 O  O   . ASN B 1 114 ? 3.654   -30.569 -26.337 1.00 59.89  ? 137  ASN B O   1 
ATOM   2857 C  CB  . ASN B 1 114 ? 1.075   -28.678 -27.356 1.00 50.13  ? 137  ASN B CB  1 
ATOM   2858 C  CG  . ASN B 1 114 ? 0.223   -28.279 -28.566 1.00 54.39  ? 137  ASN B CG  1 
ATOM   2859 O  OD1 . ASN B 1 114 ? 0.675   -27.510 -29.433 1.00 56.79  ? 137  ASN B OD1 1 
ATOM   2860 N  ND2 . ASN B 1 114 ? -0.977  -28.849 -28.676 1.00 54.73  ? 137  ASN B ND2 1 
ATOM   2861 N  N   . ILE B 1 115 ? 4.032   -28.341 -26.087 1.00 52.51  ? 138  ILE B N   1 
ATOM   2862 C  CA  . ILE B 1 115 ? 5.070   -28.556 -25.067 1.00 48.51  ? 138  ILE B CA  1 
ATOM   2863 C  C   . ILE B 1 115 ? 4.748   -27.928 -23.726 1.00 47.54  ? 138  ILE B C   1 
ATOM   2864 O  O   . ILE B 1 115 ? 5.597   -27.844 -22.841 1.00 47.65  ? 138  ILE B O   1 
ATOM   2865 C  CB  . ILE B 1 115 ? 6.462   -28.078 -25.544 1.00 46.42  ? 138  ILE B CB  1 
ATOM   2866 C  CG1 . ILE B 1 115 ? 6.442   -26.615 -25.922 1.00 43.07  ? 138  ILE B CG1 1 
ATOM   2867 C  CG2 . ILE B 1 115 ? 6.949   -28.927 -26.717 1.00 47.53  ? 138  ILE B CG2 1 
ATOM   2868 C  CD1 . ILE B 1 115 ? 7.823   -26.025 -25.925 1.00 41.44  ? 138  ILE B CD1 1 
ATOM   2869 N  N   . ASP B 1 116 ? 3.496   -27.546 -23.566 1.00 47.74  ? 139  ASP B N   1 
ATOM   2870 C  CA  . ASP B 1 116 ? 3.054   -26.825 -22.395 1.00 46.20  ? 139  ASP B CA  1 
ATOM   2871 C  C   . ASP B 1 116 ? 2.482   -27.741 -21.310 1.00 44.75  ? 139  ASP B C   1 
ATOM   2872 O  O   . ASP B 1 116 ? 1.975   -27.269 -20.298 1.00 47.43  ? 139  ASP B O   1 
ATOM   2873 C  CB  . ASP B 1 116 ? 2.027   -25.779 -22.829 1.00 48.50  ? 139  ASP B CB  1 
ATOM   2874 C  CG  . ASP B 1 116 ? 0.963   -26.343 -23.731 1.00 51.11  ? 139  ASP B CG  1 
ATOM   2875 O  OD1 . ASP B 1 116 ? 0.383   -27.406 -23.375 1.00 53.52  ? 139  ASP B OD1 1 
ATOM   2876 O  OD2 . ASP B 1 116 ? 0.733   -25.736 -24.802 1.00 53.84  ? 139  ASP B OD2 1 
ATOM   2877 N  N   . GLU B 1 117 ? 2.560   -29.053 -21.503 1.00 46.21  ? 140  GLU B N   1 
ATOM   2878 C  CA  . GLU B 1 117 ? 2.040   -30.011 -20.518 1.00 48.58  ? 140  GLU B CA  1 
ATOM   2879 C  C   . GLU B 1 117 ? 0.574   -29.822 -20.113 1.00 49.25  ? 140  GLU B C   1 
ATOM   2880 O  O   . GLU B 1 117 ? 0.144   -30.377 -19.118 1.00 49.28  ? 140  GLU B O   1 
ATOM   2881 C  CB  . GLU B 1 117 ? 2.949   -30.067 -19.272 1.00 49.86  ? 140  GLU B CB  1 
ATOM   2882 C  CG  . GLU B 1 117 ? 3.910   -31.236 -19.387 1.00 55.06  ? 140  GLU B CG  1 
ATOM   2883 C  CD  . GLU B 1 117 ? 4.989   -31.304 -18.337 1.00 57.98  ? 140  GLU B CD  1 
ATOM   2884 O  OE1 . GLU B 1 117 ? 4.742   -30.722 -17.267 1.00 56.11  ? 140  GLU B OE1 1 
ATOM   2885 O  OE2 . GLU B 1 117 ? 6.042   -31.993 -18.588 1.00 60.72  ? 140  GLU B OE2 1 
ATOM   2886 N  N   . LEU B 1 118 ? -0.207  -29.072 -20.894 1.00 50.71  ? 141  LEU B N   1 
ATOM   2887 C  CA  . LEU B 1 118 ? -1.606  -28.822 -20.548 1.00 47.91  ? 141  LEU B CA  1 
ATOM   2888 C  C   . LEU B 1 118 ? -2.418  -30.083 -20.570 1.00 47.46  ? 141  LEU B C   1 
ATOM   2889 O  O   . LEU B 1 118 ? -3.343  -30.206 -19.800 1.00 54.84  ? 141  LEU B O   1 
ATOM   2890 C  CB  . LEU B 1 118 ? -2.248  -27.780 -21.467 1.00 49.72  ? 141  LEU B CB  1 
ATOM   2891 C  CG  . LEU B 1 118 ? -1.750  -26.347 -21.186 1.00 53.51  ? 141  LEU B CG  1 
ATOM   2892 C  CD1 . LEU B 1 118 ? -2.174  -25.340 -22.240 1.00 55.28  ? 141  LEU B CD1 1 
ATOM   2893 C  CD2 . LEU B 1 118 ? -2.222  -25.871 -19.813 1.00 54.93  ? 141  LEU B CD2 1 
ATOM   2894 N  N   . HIS B 1 119 ? -2.081  -31.050 -21.408 1.00 47.05  ? 142  HIS B N   1 
ATOM   2895 C  CA  . HIS B 1 119 ? -2.821  -32.315 -21.375 1.00 48.29  ? 142  HIS B CA  1 
ATOM   2896 C  C   . HIS B 1 119 ? -2.715  -33.016 -20.014 1.00 48.78  ? 142  HIS B C   1 
ATOM   2897 O  O   . HIS B 1 119 ? -3.643  -33.656 -19.555 1.00 49.01  ? 142  HIS B O   1 
ATOM   2898 C  CB  . HIS B 1 119 ? -2.354  -33.227 -22.505 1.00 47.55  ? 142  HIS B CB  1 
ATOM   2899 C  CG  . HIS B 1 119 ? -2.930  -32.851 -23.827 1.00 49.46  ? 142  HIS B CG  1 
ATOM   2900 N  ND1 . HIS B 1 119 ? -4.292  -32.816 -24.053 1.00 54.26  ? 142  HIS B ND1 1 
ATOM   2901 C  CD2 . HIS B 1 119 ? -2.347  -32.449 -24.979 1.00 47.37  ? 142  HIS B CD2 1 
ATOM   2902 C  CE1 . HIS B 1 119 ? -4.517  -32.418 -25.295 1.00 50.35  ? 142  HIS B CE1 1 
ATOM   2903 N  NE2 . HIS B 1 119 ? -3.356  -32.192 -25.878 1.00 47.91  ? 142  HIS B NE2 1 
ATOM   2904 N  N   . HIS B 1 120 ? -1.574  -32.850 -19.371 1.00 50.68  ? 143  HIS B N   1 
ATOM   2905 C  CA  . HIS B 1 120 ? -1.252  -33.526 -18.156 1.00 55.66  ? 143  HIS B CA  1 
ATOM   2906 C  C   . HIS B 1 120 ? -2.018  -32.820 -17.063 1.00 51.62  ? 143  HIS B C   1 
ATOM   2907 O  O   . HIS B 1 120 ? -2.621  -33.436 -16.178 1.00 54.26  ? 143  HIS B O   1 
ATOM   2908 C  CB  . HIS B 1 120 ? 0.304   -33.451 -17.962 1.00 67.65  ? 143  HIS B CB  1 
ATOM   2909 C  CG  . HIS B 1 120 ? 0.801   -33.887 -16.601 1.00 80.15  ? 143  HIS B CG  1 
ATOM   2910 N  ND1 . HIS B 1 120 ? 0.939   -35.217 -16.238 1.00 81.11  ? 143  HIS B ND1 1 
ATOM   2911 C  CD2 . HIS B 1 120 ? 1.198   -33.164 -15.522 1.00 81.74  ? 143  HIS B CD2 1 
ATOM   2912 C  CE1 . HIS B 1 120 ? 1.382   -35.292 -14.995 1.00 83.69  ? 143  HIS B CE1 1 
ATOM   2913 N  NE2 . HIS B 1 120 ? 1.541   -34.059 -14.537 1.00 87.27  ? 143  HIS B NE2 1 
ATOM   2914 N  N   . ARG B 1 121 ? -2.010  -31.507 -17.144 1.00 48.95  ? 144  ARG B N   1 
ATOM   2915 C  CA  . ARG B 1 121 ? -2.689  -30.689 -16.172 1.00 46.43  ? 144  ARG B CA  1 
ATOM   2916 C  C   . ARG B 1 121 ? -4.195  -30.852 -16.255 1.00 45.15  ? 144  ARG B C   1 
ATOM   2917 O  O   . ARG B 1 121 ? -4.907  -30.538 -15.313 1.00 45.97  ? 144  ARG B O   1 
ATOM   2918 C  CB  . ARG B 1 121 ? -2.276  -29.242 -16.341 1.00 45.70  ? 144  ARG B CB  1 
ATOM   2919 C  CG  . ARG B 1 121 ? -0.870  -29.004 -15.827 1.00 48.31  ? 144  ARG B CG  1 
ATOM   2920 C  CD  . ARG B 1 121 ? -0.391  -27.607 -16.108 1.00 51.82  ? 144  ARG B CD  1 
ATOM   2921 N  NE  . ARG B 1 121 ? -1.326  -26.617 -15.591 1.00 55.14  ? 144  ARG B NE  1 
ATOM   2922 C  CZ  . ARG B 1 121 ? -1.271  -25.315 -15.867 1.00 61.77  ? 144  ARG B CZ  1 
ATOM   2923 N  NH1 . ARG B 1 121 ? -0.289  -24.841 -16.622 1.00 64.60  ? 144  ARG B NH1 1 
ATOM   2924 N  NH2 . ARG B 1 121 ? -2.204  -24.484 -15.385 1.00 62.59  ? 144  ARG B NH2 1 
ATOM   2925 N  N   . ALA B 1 122 ? -4.682  -31.382 -17.359 1.00 44.15  ? 145  ALA B N   1 
ATOM   2926 C  CA  . ALA B 1 122 ? -6.093  -31.678 -17.460 1.00 45.11  ? 145  ALA B CA  1 
ATOM   2927 C  C   . ALA B 1 122 ? -6.385  -33.052 -16.934 1.00 43.68  ? 145  ALA B C   1 
ATOM   2928 O  O   . ALA B 1 122 ? -7.527  -33.391 -16.744 1.00 46.68  ? 145  ALA B O   1 
ATOM   2929 C  CB  . ALA B 1 122 ? -6.546  -31.568 -18.903 1.00 48.17  ? 145  ALA B CB  1 
ATOM   2930 N  N   . GLY B 1 123 ? -5.350  -33.847 -16.717 1.00 45.46  ? 146  GLY B N   1 
ATOM   2931 C  CA  . GLY B 1 123 ? -5.490  -35.233 -16.245 1.00 48.96  ? 146  GLY B CA  1 
ATOM   2932 C  C   . GLY B 1 123 ? -5.402  -36.311 -17.315 1.00 50.16  ? 146  GLY B C   1 
ATOM   2933 O  O   . GLY B 1 123 ? -5.933  -37.397 -17.150 1.00 50.35  ? 146  GLY B O   1 
ATOM   2934 N  N   . SER B 1 124 ? -4.782  -36.019 -18.445 1.00 54.37  ? 147  SER B N   1 
ATOM   2935 C  CA  . SER B 1 124 ? -4.611  -37.059 -19.429 1.00 57.78  ? 147  SER B CA  1 
ATOM   2936 C  C   . SER B 1 124 ? -3.389  -37.837 -18.949 1.00 60.34  ? 147  SER B C   1 
ATOM   2937 O  O   . SER B 1 124 ? -2.498  -37.243 -18.348 1.00 54.03  ? 147  SER B O   1 
ATOM   2938 C  CB  . SER B 1 124 ? -4.489  -36.483 -20.838 1.00 58.59  ? 147  SER B CB  1 
ATOM   2939 O  OG  . SER B 1 124 ? -5.786  -36.319 -21.387 1.00 59.32  ? 147  SER B OG  1 
ATOM   2940 N  N   . LYS B 1 125 ? -3.394  -39.156 -19.166 1.00 62.64  ? 148  LYS B N   1 
ATOM   2941 C  CA  . LYS B 1 125 ? -2.332  -40.039 -18.702 1.00 64.41  ? 148  LYS B CA  1 
ATOM   2942 C  C   . LYS B 1 125 ? -1.495  -40.578 -19.839 1.00 64.15  ? 148  LYS B C   1 
ATOM   2943 O  O   . LYS B 1 125 ? -0.298  -40.405 -19.821 1.00 57.53  ? 148  LYS B O   1 
ATOM   2944 C  CB  . LYS B 1 125 ? -2.922  -41.227 -17.962 1.00 74.76  ? 148  LYS B CB  1 
ATOM   2945 C  CG  . LYS B 1 125 ? -3.820  -40.877 -16.783 1.00 81.35  ? 148  LYS B CG  1 
ATOM   2946 C  CD  . LYS B 1 125 ? -3.021  -40.270 -15.632 1.00 83.58  ? 148  LYS B CD  1 
ATOM   2947 C  CE  . LYS B 1 125 ? -3.913  -39.824 -14.483 1.00 84.14  ? 148  LYS B CE  1 
ATOM   2948 N  NZ  . LYS B 1 125 ? -3.305  -38.660 -13.774 1.00 87.21  ? 148  LYS B NZ  1 
ATOM   2949 N  N   . HIS B 1 126 ? -2.125  -41.238 -20.819 1.00 67.37  ? 149  HIS B N   1 
ATOM   2950 C  CA  . HIS B 1 126 ? -1.407  -41.853 -21.933 1.00 68.06  ? 149  HIS B CA  1 
ATOM   2951 C  C   . HIS B 1 126 ? -1.226  -40.783 -22.992 1.00 62.34  ? 149  HIS B C   1 
ATOM   2952 O  O   . HIS B 1 126 ? -1.925  -40.742 -23.987 1.00 60.28  ? 149  HIS B O   1 
ATOM   2953 C  CB  . HIS B 1 126 ? -2.142  -43.058 -22.552 1.00 79.87  ? 149  HIS B CB  1 
ATOM   2954 C  CG  . HIS B 1 126 ? -2.778  -43.994 -21.576 1.00 93.26  ? 149  HIS B CG  1 
ATOM   2955 N  ND1 . HIS B 1 126 ? -4.121  -44.309 -21.634 1.00 97.41  ? 149  HIS B ND1 1 
ATOM   2956 C  CD2 . HIS B 1 126 ? -2.261  -44.725 -20.562 1.00 99.91  ? 149  HIS B CD2 1 
ATOM   2957 C  CE1 . HIS B 1 126 ? -4.411  -45.173 -20.679 1.00 99.07  ? 149  HIS B CE1 1 
ATOM   2958 N  NE2 . HIS B 1 126 ? -3.300  -45.439 -20.013 1.00 105.77 ? 149  HIS B NE2 1 
ATOM   2959 N  N   . VAL B 1 127 ? -0.257  -39.920 -22.760 1.00 59.98  ? 150  VAL B N   1 
ATOM   2960 C  CA  . VAL B 1 127 ? 0.090   -38.837 -23.666 1.00 56.40  ? 150  VAL B CA  1 
ATOM   2961 C  C   . VAL B 1 127 ? 1.469   -39.056 -24.261 1.00 59.18  ? 150  VAL B C   1 
ATOM   2962 O  O   . VAL B 1 127 ? 2.375   -39.503 -23.563 1.00 65.79  ? 150  VAL B O   1 
ATOM   2963 C  CB  . VAL B 1 127 ? 0.218   -37.537 -22.897 1.00 52.35  ? 150  VAL B CB  1 
ATOM   2964 C  CG1 . VAL B 1 127 ? 0.597   -36.407 -23.845 1.00 49.85  ? 150  VAL B CG1 1 
ATOM   2965 C  CG2 . VAL B 1 127 ? -1.080  -37.235 -22.166 1.00 52.71  ? 150  VAL B CG2 1 
ATOM   2966 N  N   . TYR B 1 128 ? 1.641   -38.706 -25.528 1.00 56.18  ? 151  TYR B N   1 
ATOM   2967 C  CA  . TYR B 1 128 ? 2.935   -38.757 -26.173 1.00 52.89  ? 151  TYR B CA  1 
ATOM   2968 C  C   . TYR B 1 128 ? 3.331   -37.345 -26.604 1.00 48.17  ? 151  TYR B C   1 
ATOM   2969 O  O   . TYR B 1 128 ? 2.743   -36.818 -27.532 1.00 46.47  ? 151  TYR B O   1 
ATOM   2970 C  CB  . TYR B 1 128 ? 2.857   -39.687 -27.388 1.00 56.32  ? 151  TYR B CB  1 
ATOM   2971 C  CG  . TYR B 1 128 ? 2.887   -41.177 -27.061 1.00 60.34  ? 151  TYR B CG  1 
ATOM   2972 C  CD1 . TYR B 1 128 ? 4.079   -41.809 -26.706 1.00 58.98  ? 151  TYR B CD1 1 
ATOM   2973 C  CD2 . TYR B 1 128 ? 1.734   -41.959 -27.138 1.00 61.63  ? 151  TYR B CD2 1 
ATOM   2974 C  CE1 . TYR B 1 128 ? 4.127   -43.164 -26.426 1.00 59.58  ? 151  TYR B CE1 1 
ATOM   2975 C  CE2 . TYR B 1 128 ? 1.774   -43.313 -26.856 1.00 63.13  ? 151  TYR B CE2 1 
ATOM   2976 C  CZ  . TYR B 1 128 ? 2.978   -43.911 -26.498 1.00 64.15  ? 151  TYR B CZ  1 
ATOM   2977 O  OH  . TYR B 1 128 ? 3.045   -45.255 -26.179 1.00 68.49  ? 151  TYR B OH  1 
ATOM   2978 N  N   . GLU B 1 129 ? 4.310   -36.745 -25.926 1.00 45.50  ? 152  GLU B N   1 
ATOM   2979 C  CA  . GLU B 1 129 ? 4.762   -35.391 -26.221 1.00 46.05  ? 152  GLU B CA  1 
ATOM   2980 C  C   . GLU B 1 129 ? 5.898   -35.491 -27.187 1.00 46.84  ? 152  GLU B C   1 
ATOM   2981 O  O   . GLU B 1 129 ? 7.066   -35.696 -26.816 1.00 46.74  ? 152  GLU B O   1 
ATOM   2982 C  CB  . GLU B 1 129 ? 5.242   -34.645 -24.968 1.00 48.19  ? 152  GLU B CB  1 
ATOM   2983 C  CG  . GLU B 1 129 ? 4.352   -34.757 -23.745 1.00 48.57  ? 152  GLU B CG  1 
ATOM   2984 C  CD  . GLU B 1 129 ? 4.713   -33.743 -22.673 1.00 49.65  ? 152  GLU B CD  1 
ATOM   2985 O  OE1 . GLU B 1 129 ? 4.268   -32.581 -22.822 1.00 52.32  ? 152  GLU B OE1 1 
ATOM   2986 O  OE2 . GLU B 1 129 ? 5.427   -34.110 -21.704 1.00 49.46  ? 152  GLU B OE2 1 
ATOM   2987 N  N   . ILE B 1 130 ? 5.576   -35.306 -28.448 1.00 49.66  ? 153  ILE B N   1 
ATOM   2988 C  CA  . ILE B 1 130 ? 6.537   -35.607 -29.504 1.00 49.66  ? 153  ILE B CA  1 
ATOM   2989 C  C   . ILE B 1 130 ? 7.468   -34.467 -29.779 1.00 49.36  ? 153  ILE B C   1 
ATOM   2990 O  O   . ILE B 1 130 ? 8.377   -34.623 -30.554 1.00 50.23  ? 153  ILE B O   1 
ATOM   2991 C  CB  . ILE B 1 130 ? 5.867   -35.951 -30.850 1.00 48.74  ? 153  ILE B CB  1 
ATOM   2992 C  CG1 . ILE B 1 130 ? 5.311   -34.703 -31.549 1.00 49.95  ? 153  ILE B CG1 1 
ATOM   2993 C  CG2 . ILE B 1 130 ? 4.778   -36.994 -30.672 1.00 46.81  ? 153  ILE B CG2 1 
ATOM   2994 C  CD1 . ILE B 1 130 ? 4.933   -34.972 -32.992 1.00 51.52  ? 153  ILE B CD1 1 
ATOM   2995 N  N   . HIS B 1 131 ? 7.196   -33.296 -29.239 1.00 50.99  ? 154  HIS B N   1 
ATOM   2996 C  CA  . HIS B 1 131 ? 8.169   -32.254 -29.374 1.00 49.14  ? 154  HIS B CA  1 
ATOM   2997 C  C   . HIS B 1 131 ? 8.818   -32.040 -28.035 1.00 48.67  ? 154  HIS B C   1 
ATOM   2998 O  O   . HIS B 1 131 ? 9.630   -31.143 -27.831 1.00 41.94  ? 154  HIS B O   1 
ATOM   2999 C  CB  . HIS B 1 131 ? 7.502   -31.018 -29.959 1.00 51.86  ? 154  HIS B CB  1 
ATOM   3000 C  CG  . HIS B 1 131 ? 7.127   -31.186 -31.407 1.00 50.43  ? 154  HIS B CG  1 
ATOM   3001 N  ND1 . HIS B 1 131 ? 6.107   -30.484 -32.014 1.00 54.81  ? 154  HIS B ND1 1 
ATOM   3002 C  CD2 . HIS B 1 131 ? 7.625   -32.004 -32.362 1.00 50.86  ? 154  HIS B CD2 1 
ATOM   3003 C  CE1 . HIS B 1 131 ? 6.013   -30.843 -33.287 1.00 54.19  ? 154  HIS B CE1 1 
ATOM   3004 N  NE2 . HIS B 1 131 ? 6.926   -31.764 -33.527 1.00 53.24  ? 154  HIS B NE2 1 
ATOM   3005 N  N   . GLY B 1 132 ? 8.477   -32.908 -27.106 1.00 53.46  ? 155  GLY B N   1 
ATOM   3006 C  CA  . GLY B 1 132 ? 9.055   -32.797 -25.807 1.00 56.98  ? 155  GLY B CA  1 
ATOM   3007 C  C   . GLY B 1 132 ? 8.194   -31.908 -24.974 1.00 55.86  ? 155  GLY B C   1 
ATOM   3008 O  O   . GLY B 1 132 ? 6.957   -31.854 -25.196 1.00 51.81  ? 155  GLY B O   1 
ATOM   3009 N  N   . SER B 1 133 ? 8.861   -31.244 -24.017 1.00 54.72  ? 156  SER B N   1 
ATOM   3010 C  CA  . SER B 1 133 ? 8.189   -30.478 -22.966 1.00 58.17  ? 156  SER B CA  1 
ATOM   3011 C  C   . SER B 1 133 ? 9.069   -29.413 -22.330 1.00 58.05  ? 156  SER B C   1 
ATOM   3012 O  O   . SER B 1 133 ? 10.242  -29.652 -22.035 1.00 66.05  ? 156  SER B O   1 
ATOM   3013 C  CB  . SER B 1 133 ? 7.682   -31.415 -21.850 1.00 58.13  ? 156  SER B CB  1 
ATOM   3014 O  OG  . SER B 1 133 ? 7.329   -30.700 -20.676 1.00 57.12  ? 156  SER B OG  1 
ATOM   3015 N  N   . LEU B 1 134 ? 8.453   -28.266 -22.063 1.00 54.28  ? 157  LEU B N   1 
ATOM   3016 C  CA  . LEU B 1 134 ? 9.067   -27.217 -21.278 1.00 52.75  ? 157  LEU B CA  1 
ATOM   3017 C  C   . LEU B 1 134 ? 9.471   -27.659 -19.869 1.00 54.74  ? 157  LEU B C   1 
ATOM   3018 O  O   . LEU B 1 134 ? 10.290  -27.030 -19.249 1.00 51.30  ? 157  LEU B O   1 
ATOM   3019 C  CB  . LEU B 1 134 ? 8.091   -26.062 -21.102 1.00 52.29  ? 157  LEU B CB  1 
ATOM   3020 C  CG  . LEU B 1 134 ? 7.702   -25.235 -22.322 1.00 51.56  ? 157  LEU B CG  1 
ATOM   3021 C  CD1 . LEU B 1 134 ? 6.682   -24.174 -21.962 1.00 50.53  ? 157  LEU B CD1 1 
ATOM   3022 C  CD2 . LEU B 1 134 ? 8.941   -24.564 -22.867 1.00 53.08  ? 157  LEU B CD2 1 
ATOM   3023 N  N   . PHE B 1 135 ? 8.876   -28.702 -19.326 1.00 56.92  ? 158  PHE B N   1 
ATOM   3024 C  CA  . PHE B 1 135 ? 9.141   -29.018 -17.950 1.00 58.68  ? 158  PHE B CA  1 
ATOM   3025 C  C   . PHE B 1 135 ? 9.879   -30.317 -17.902 1.00 61.77  ? 158  PHE B C   1 
ATOM   3026 O  O   . PHE B 1 135 ? 9.680   -31.148 -16.999 1.00 66.85  ? 158  PHE B O   1 
ATOM   3027 C  CB  . PHE B 1 135 ? 7.843   -29.025 -17.152 1.00 61.53  ? 158  PHE B CB  1 
ATOM   3028 C  CG  . PHE B 1 135 ? 7.112   -27.707 -17.208 1.00 64.33  ? 158  PHE B CG  1 
ATOM   3029 C  CD1 . PHE B 1 135 ? 7.533   -26.636 -16.429 1.00 66.77  ? 158  PHE B CD1 1 
ATOM   3030 C  CD2 . PHE B 1 135 ? 6.049   -27.514 -18.079 1.00 64.06  ? 158  PHE B CD2 1 
ATOM   3031 C  CE1 . PHE B 1 135 ? 6.901   -25.398 -16.517 1.00 65.82  ? 158  PHE B CE1 1 
ATOM   3032 C  CE2 . PHE B 1 135 ? 5.399   -26.284 -18.155 1.00 65.64  ? 158  PHE B CE2 1 
ATOM   3033 C  CZ  . PHE B 1 135 ? 5.831   -25.222 -17.378 1.00 65.05  ? 158  PHE B CZ  1 
ATOM   3034 N  N   . LYS B 1 136 ? 10.763  -30.480 -18.885 1.00 58.98  ? 159  LYS B N   1 
ATOM   3035 C  CA  . LYS B 1 136 ? 11.822  -31.481 -18.799 1.00 60.28  ? 159  LYS B CA  1 
ATOM   3036 C  C   . LYS B 1 136 ? 13.130  -30.855 -19.197 1.00 57.22  ? 159  LYS B C   1 
ATOM   3037 O  O   . LYS B 1 136 ? 13.147  -29.901 -19.987 1.00 53.96  ? 159  LYS B O   1 
ATOM   3038 C  CB  . LYS B 1 136 ? 11.501  -32.682 -19.684 1.00 60.30  ? 159  LYS B CB  1 
ATOM   3039 C  CG  . LYS B 1 136 ? 10.464  -33.588 -19.060 1.00 59.24  ? 159  LYS B CG  1 
ATOM   3040 C  CD  . LYS B 1 136 ? 10.092  -34.728 -19.975 1.00 58.08  ? 159  LYS B CD  1 
ATOM   3041 C  CE  . LYS B 1 136 ? 8.807   -35.350 -19.470 1.00 60.36  ? 159  LYS B CE  1 
ATOM   3042 N  NZ  . LYS B 1 136 ? 8.773   -36.741 -19.951 1.00 59.83  ? 159  LYS B NZ  1 
ATOM   3043 N  N   . THR B 1 137 ? 14.207  -31.392 -18.633 1.00 60.97  ? 160  THR B N   1 
ATOM   3044 C  CA  . THR B 1 137 ? 15.576  -30.994 -18.980 1.00 68.84  ? 160  THR B CA  1 
ATOM   3045 C  C   . THR B 1 137 ? 16.372  -32.208 -19.494 1.00 74.28  ? 160  THR B C   1 
ATOM   3046 O  O   . THR B 1 137 ? 16.210  -33.333 -18.981 1.00 80.00  ? 160  THR B O   1 
ATOM   3047 C  CB  . THR B 1 137 ? 16.323  -30.430 -17.758 1.00 67.20  ? 160  THR B CB  1 
ATOM   3048 O  OG1 . THR B 1 137 ? 16.580  -31.479 -16.813 1.00 68.68  ? 160  THR B OG1 1 
ATOM   3049 C  CG2 . THR B 1 137 ? 15.508  -29.368 -17.101 1.00 66.36  ? 160  THR B CG2 1 
ATOM   3050 N  N   . ARG B 1 138 ? 17.199  -31.992 -20.517 1.00 73.70  ? 161  ARG B N   1 
ATOM   3051 C  CA  . ARG B 1 138 ? 18.157  -33.013 -20.939 1.00 78.87  ? 161  ARG B CA  1 
ATOM   3052 C  C   . ARG B 1 138 ? 19.542  -32.502 -20.614 1.00 78.20  ? 161  ARG B C   1 
ATOM   3053 O  O   . ARG B 1 138 ? 19.801  -31.305 -20.788 1.00 69.87  ? 161  ARG B O   1 
ATOM   3054 C  CB  . ARG B 1 138 ? 18.044  -33.347 -22.434 1.00 83.51  ? 161  ARG B CB  1 
ATOM   3055 C  CG  . ARG B 1 138 ? 19.151  -34.285 -22.909 1.00 89.59  ? 161  ARG B CG  1 
ATOM   3056 C  CD  . ARG B 1 138 ? 19.113  -34.667 -24.393 1.00 93.00  ? 161  ARG B CD  1 
ATOM   3057 N  NE  . ARG B 1 138 ? 18.723  -33.569 -25.273 1.00 84.40  ? 161  ARG B NE  1 
ATOM   3058 C  CZ  . ARG B 1 138 ? 17.642  -33.575 -26.046 1.00 83.81  ? 161  ARG B CZ  1 
ATOM   3059 N  NH1 . ARG B 1 138 ? 16.842  -34.634 -26.109 1.00 78.26  ? 161  ARG B NH1 1 
ATOM   3060 N  NH2 . ARG B 1 138 ? 17.365  -32.519 -26.779 1.00 85.91  ? 161  ARG B NH2 1 
ATOM   3061 N  N   . CYS B 1 139 ? 20.415  -33.400 -20.136 1.00 80.73  ? 162  CYS B N   1 
ATOM   3062 C  CA  . CYS B 1 139 ? 21.787  -33.032 -19.807 1.00 85.54  ? 162  CYS B CA  1 
ATOM   3063 C  C   . CYS B 1 139 ? 22.662  -33.082 -21.032 1.00 81.76  ? 162  CYS B C   1 
ATOM   3064 O  O   . CYS B 1 139 ? 22.690  -34.087 -21.750 1.00 75.85  ? 162  CYS B O   1 
ATOM   3065 C  CB  . CYS B 1 139 ? 22.395  -33.965 -18.767 1.00 93.28  ? 162  CYS B CB  1 
ATOM   3066 S  SG  . CYS B 1 139 ? 24.084  -33.484 -18.276 1.00 91.16  ? 162  CYS B SG  1 
ATOM   3067 N  N   . MET B 1 140 ? 23.424  -32.016 -21.239 1.00 77.75  ? 163  MET B N   1 
ATOM   3068 C  CA  . MET B 1 140 ? 24.312  -31.962 -22.386 1.00 78.08  ? 163  MET B CA  1 
ATOM   3069 C  C   . MET B 1 140 ? 25.440  -32.990 -22.204 1.00 82.95  ? 163  MET B C   1 
ATOM   3070 O  O   . MET B 1 140 ? 25.951  -33.561 -23.162 1.00 77.50  ? 163  MET B O   1 
ATOM   3071 C  CB  . MET B 1 140 ? 24.877  -30.566 -22.542 1.00 77.11  ? 163  MET B CB  1 
ATOM   3072 C  CG  . MET B 1 140 ? 23.808  -29.507 -22.694 1.00 77.05  ? 163  MET B CG  1 
ATOM   3073 S  SD  . MET B 1 140 ? 23.070  -29.503 -24.327 1.00 79.42  ? 163  MET B SD  1 
ATOM   3074 C  CE  . MET B 1 140 ? 24.000  -28.192 -25.134 1.00 78.71  ? 163  MET B CE  1 
ATOM   3075 N  N   . SER B 1 141 ? 25.814  -33.231 -20.958 1.00 86.89  ? 164  SER B N   1 
ATOM   3076 C  CA  . SER B 1 141 ? 26.913  -34.110 -20.664 1.00 84.83  ? 164  SER B CA  1 
ATOM   3077 C  C   . SER B 1 141 ? 26.458  -35.540 -20.668 1.00 84.61  ? 164  SER B C   1 
ATOM   3078 O  O   . SER B 1 141 ? 26.838  -36.253 -21.559 1.00 79.80  ? 164  SER B O   1 
ATOM   3079 C  CB  . SER B 1 141 ? 27.517  -33.693 -19.356 1.00 89.19  ? 164  SER B CB  1 
ATOM   3080 O  OG  . SER B 1 141 ? 27.938  -32.349 -19.495 1.00 94.55  ? 164  SER B OG  1 
ATOM   3081 N  N   . CYS B 1 142 ? 25.616  -35.956 -19.722 1.00 87.18  ? 165  CYS B N   1 
ATOM   3082 C  CA  . CYS B 1 142 ? 25.239  -37.370 -19.626 1.00 86.78  ? 165  CYS B CA  1 
ATOM   3083 C  C   . CYS B 1 142 ? 23.978  -37.724 -20.392 1.00 89.29  ? 165  CYS B C   1 
ATOM   3084 O  O   . CYS B 1 142 ? 23.633  -38.886 -20.458 1.00 89.88  ? 165  CYS B O   1 
ATOM   3085 C  CB  . CYS B 1 142 ? 25.079  -37.808 -18.164 1.00 91.48  ? 165  CYS B CB  1 
ATOM   3086 S  SG  . CYS B 1 142 ? 23.702  -37.099 -17.241 1.00 90.74  ? 165  CYS B SG  1 
ATOM   3087 N  N   . GLY B 1 143 ? 23.277  -36.744 -20.955 1.00 94.19  ? 166  GLY B N   1 
ATOM   3088 C  CA  . GLY B 1 143 ? 22.040  -37.029 -21.706 1.00 95.90  ? 166  GLY B CA  1 
ATOM   3089 C  C   . GLY B 1 143 ? 20.785  -37.421 -20.921 1.00 94.20  ? 166  GLY B C   1 
ATOM   3090 O  O   . GLY B 1 143 ? 19.795  -37.842 -21.516 1.00 83.83  ? 166  GLY B O   1 
ATOM   3091 N  N   . GLU B 1 144 ? 20.805  -37.259 -19.600 1.00 96.29  ? 167  GLU B N   1 
ATOM   3092 C  CA  . GLU B 1 144 ? 19.680  -37.680 -18.766 1.00 93.44  ? 167  GLU B CA  1 
ATOM   3093 C  C   . GLU B 1 144 ? 18.493  -36.749 -18.902 1.00 91.56  ? 167  GLU B C   1 
ATOM   3094 O  O   . GLU B 1 144 ? 18.626  -35.523 -18.867 1.00 93.93  ? 167  GLU B O   1 
ATOM   3095 C  CB  . GLU B 1 144 ? 20.101  -37.741 -17.299 1.00 93.57  ? 167  GLU B CB  1 
ATOM   3096 C  CG  . GLU B 1 144 ? 18.967  -37.741 -16.288 1.00 88.49  ? 167  GLU B CG  1 
ATOM   3097 C  CD  . GLU B 1 144 ? 19.490  -37.862 -14.866 1.00 86.27  ? 167  GLU B CD  1 
ATOM   3098 O  OE1 . GLU B 1 144 ? 19.934  -38.979 -14.484 1.00 79.84  ? 167  GLU B OE1 1 
ATOM   3099 O  OE2 . GLU B 1 144 ? 19.463  -36.838 -14.141 1.00 84.68  ? 167  GLU B OE2 1 
ATOM   3100 N  N   . VAL B 1 145 ? 17.321  -37.340 -19.029 1.00 90.47  ? 168  VAL B N   1 
ATOM   3101 C  CA  . VAL B 1 145 ? 16.099  -36.561 -19.112 1.00 94.66  ? 168  VAL B CA  1 
ATOM   3102 C  C   . VAL B 1 145 ? 15.349  -36.649 -17.806 1.00 97.31  ? 168  VAL B C   1 
ATOM   3103 O  O   . VAL B 1 145 ? 14.991  -37.739 -17.341 1.00 105.38 ? 168  VAL B O   1 
ATOM   3104 C  CB  . VAL B 1 145 ? 15.196  -37.027 -20.261 1.00 100.03 ? 168  VAL B CB  1 
ATOM   3105 C  CG1 . VAL B 1 145 ? 13.848  -36.322 -20.201 1.00 104.42 ? 168  VAL B CG1 1 
ATOM   3106 C  CG2 . VAL B 1 145 ? 15.866  -36.734 -21.596 1.00 100.10 ? 168  VAL B CG2 1 
ATOM   3107 N  N   . LYS B 1 146 ? 15.084  -35.492 -17.223 1.00 93.36  ? 169  LYS B N   1 
ATOM   3108 C  CA  . LYS B 1 146 ? 14.466  -35.439 -15.919 1.00 89.25  ? 169  LYS B CA  1 
ATOM   3109 C  C   . LYS B 1 146 ? 13.339  -34.407 -15.934 1.00 83.25  ? 169  LYS B C   1 
ATOM   3110 O  O   . LYS B 1 146 ? 13.451  -33.303 -16.525 1.00 72.57  ? 169  LYS B O   1 
ATOM   3111 C  CB  . LYS B 1 146 ? 15.553  -35.166 -14.864 1.00 95.35  ? 169  LYS B CB  1 
ATOM   3112 C  CG  . LYS B 1 146 ? 15.081  -34.775 -13.472 1.00 101.08 ? 169  LYS B CG  1 
ATOM   3113 C  CD  . LYS B 1 146 ? 15.973  -35.382 -12.377 1.00 104.08 ? 169  LYS B CD  1 
ATOM   3114 C  CE  . LYS B 1 146 ? 17.490  -35.120 -12.529 1.00 108.95 ? 169  LYS B CE  1 
ATOM   3115 N  NZ  . LYS B 1 146 ? 17.925  -33.690 -12.410 1.00 114.59 ? 169  LYS B NZ  1 
ATOM   3116 N  N   . ALA B 1 147 ? 12.237  -34.784 -15.293 1.00 77.80  ? 170  ALA B N   1 
ATOM   3117 C  CA  . ALA B 1 147 ? 11.147  -33.854 -15.100 1.00 75.96  ? 170  ALA B CA  1 
ATOM   3118 C  C   . ALA B 1 147 ? 11.674  -32.680 -14.287 1.00 74.76  ? 170  ALA B C   1 
ATOM   3119 O  O   . ALA B 1 147 ? 12.540  -32.859 -13.424 1.00 75.21  ? 170  ALA B O   1 
ATOM   3120 C  CB  . ALA B 1 147 ? 10.004  -34.524 -14.370 1.00 75.01  ? 170  ALA B CB  1 
ATOM   3121 N  N   . ASN B 1 148 ? 11.138  -31.493 -14.548 1.00 71.18  ? 171  ASN B N   1 
ATOM   3122 C  CA  . ASN B 1 148 ? 11.419  -30.338 -13.719 1.00 68.49  ? 171  ASN B CA  1 
ATOM   3123 C  C   . ASN B 1 148 ? 10.399  -29.199 -13.866 1.00 70.89  ? 171  ASN B C   1 
ATOM   3124 O  O   . ASN B 1 148 ? 10.247  -28.650 -14.950 1.00 71.08  ? 171  ASN B O   1 
ATOM   3125 C  CB  . ASN B 1 148 ? 12.796  -29.843 -14.046 1.00 71.39  ? 171  ASN B CB  1 
ATOM   3126 C  CG  . ASN B 1 148 ? 13.089  -28.516 -13.406 1.00 77.31  ? 171  ASN B CG  1 
ATOM   3127 O  OD1 . ASN B 1 148 ? 12.177  -27.782 -13.019 1.00 84.00  ? 171  ASN B OD1 1 
ATOM   3128 N  ND2 . ASN B 1 148 ? 14.364  -28.194 -13.294 1.00 81.24  ? 171  ASN B ND2 1 
ATOM   3129 N  N   . HIS B 1 149 ? 9.722   -28.840 -12.765 1.00 75.03  ? 172  HIS B N   1 
ATOM   3130 C  CA  . HIS B 1 149 ? 8.735   -27.730 -12.736 1.00 73.24  ? 172  HIS B CA  1 
ATOM   3131 C  C   . HIS B 1 149 ? 9.109   -26.617 -11.743 1.00 72.66  ? 172  HIS B C   1 
ATOM   3132 O  O   . HIS B 1 149 ? 8.301   -25.733 -11.457 1.00 76.53  ? 172  HIS B O   1 
ATOM   3133 C  CB  . HIS B 1 149 ? 7.343   -28.269 -12.372 1.00 70.84  ? 172  HIS B CB  1 
ATOM   3134 C  CG  . HIS B 1 149 ? 6.850   -29.355 -13.272 1.00 70.99  ? 172  HIS B CG  1 
ATOM   3135 N  ND1 . HIS B 1 149 ? 7.192   -30.679 -13.103 1.00 77.41  ? 172  HIS B ND1 1 
ATOM   3136 C  CD2 . HIS B 1 149 ? 6.025   -29.319 -14.341 1.00 77.82  ? 172  HIS B CD2 1 
ATOM   3137 C  CE1 . HIS B 1 149 ? 6.616   -31.413 -14.040 1.00 78.12  ? 172  HIS B CE1 1 
ATOM   3138 N  NE2 . HIS B 1 149 ? 5.898   -30.612 -14.802 1.00 82.10  ? 172  HIS B NE2 1 
ATOM   3139 N  N   . LYS B 1 150 ? 10.328  -26.687 -11.223 1.00 73.03  ? 173  LYS B N   1 
ATOM   3140 C  CA  . LYS B 1 150 ? 10.906  -25.733 -10.272 1.00 79.49  ? 173  LYS B CA  1 
ATOM   3141 C  C   . LYS B 1 150 ? 10.657  -24.272 -10.688 1.00 80.21  ? 173  LYS B C   1 
ATOM   3142 O  O   . LYS B 1 150 ? 10.686  -23.956 -11.862 1.00 81.46  ? 173  LYS B O   1 
ATOM   3143 C  CB  . LYS B 1 150 ? 12.412  -26.052 -10.236 1.00 90.12  ? 173  LYS B CB  1 
ATOM   3144 C  CG  . LYS B 1 150 ? 13.335  -25.361 -9.235  1.00 91.64  ? 173  LYS B CG  1 
ATOM   3145 C  CD  . LYS B 1 150 ? 14.305  -26.383 -8.626  1.00 91.84  ? 173  LYS B CD  1 
ATOM   3146 C  CE  . LYS B 1 150 ? 13.547  -27.592 -8.096  1.00 95.02  ? 173  LYS B CE  1 
ATOM   3147 N  NZ  . LYS B 1 150 ? 14.265  -28.310 -7.013  1.00 99.95  ? 173  LYS B NZ  1 
ATOM   3148 N  N   . SER B 1 151 ? 10.355  -23.389 -9.744  1.00 82.29  ? 174  SER B N   1 
ATOM   3149 C  CA  . SER B 1 151 ? 10.129  -21.987 -10.089 1.00 83.74  ? 174  SER B CA  1 
ATOM   3150 C  C   . SER B 1 151 ? 10.824  -21.064 -9.099  1.00 94.03  ? 174  SER B C   1 
ATOM   3151 O  O   . SER B 1 151 ? 10.402  -20.993 -7.948  1.00 97.40  ? 174  SER B O   1 
ATOM   3152 C  CB  . SER B 1 151 ? 8.646   -21.677 -10.102 1.00 77.98  ? 174  SER B CB  1 
ATOM   3153 O  OG  . SER B 1 151 ? 8.435   -20.341 -10.536 1.00 74.70  ? 174  SER B OG  1 
ATOM   3154 N  N   . PRO B 1 152 ? 11.885  -20.362 -9.512  1.00 102.56 ? 175  PRO B N   1 
ATOM   3155 C  CA  . PRO B 1 152 ? 12.479  -20.472 -10.828 1.00 98.12  ? 175  PRO B CA  1 
ATOM   3156 C  C   . PRO B 1 152 ? 13.294  -21.737 -10.911 1.00 92.87  ? 175  PRO B C   1 
ATOM   3157 O  O   . PRO B 1 152 ? 13.701  -22.297 -9.897  1.00 84.14  ? 175  PRO B O   1 
ATOM   3158 C  CB  . PRO B 1 152 ? 13.402  -19.270 -10.878 1.00 103.49 ? 175  PRO B CB  1 
ATOM   3159 C  CG  . PRO B 1 152 ? 13.902  -19.175 -9.473  1.00 108.97 ? 175  PRO B CG  1 
ATOM   3160 C  CD  . PRO B 1 152 ? 12.744  -19.584 -8.602  1.00 104.84 ? 175  PRO B CD  1 
ATOM   3161 N  N   . ILE B 1 153 ? 13.515  -22.177 -12.133 1.00 98.12  ? 176  ILE B N   1 
ATOM   3162 C  CA  . ILE B 1 153 ? 14.282  -23.386 -12.397 1.00 100.38 ? 176  ILE B CA  1 
ATOM   3163 C  C   . ILE B 1 153 ? 15.645  -23.384 -11.702 1.00 101.97 ? 176  ILE B C   1 
ATOM   3164 O  O   . ILE B 1 153 ? 16.159  -24.444 -11.322 1.00 103.80 ? 176  ILE B O   1 
ATOM   3165 C  CB  . ILE B 1 153 ? 14.463  -23.582 -13.919 1.00 101.42 ? 176  ILE B CB  1 
ATOM   3166 C  CG1 . ILE B 1 153 ? 15.155  -24.928 -14.194 1.00 100.08 ? 176  ILE B CG1 1 
ATOM   3167 C  CG2 . ILE B 1 153 ? 15.214  -22.397 -14.546 1.00 97.31  ? 176  ILE B CG2 1 
ATOM   3168 C  CD1 . ILE B 1 153 ? 15.182  -25.315 -15.657 1.00 99.13  ? 176  ILE B CD1 1 
ATOM   3169 N  N   . CYS B 1 154 ? 16.228  -22.191 -11.600 1.00 99.61  ? 177  CYS B N   1 
ATOM   3170 C  CA  . CYS B 1 154 ? 17.456  -21.954 -10.874 1.00 99.71  ? 177  CYS B CA  1 
ATOM   3171 C  C   . CYS B 1 154 ? 17.466  -20.496 -10.379 1.00 96.27  ? 177  CYS B C   1 
ATOM   3172 O  O   . CYS B 1 154 ? 16.914  -19.595 -11.046 1.00 78.07  ? 177  CYS B O   1 
ATOM   3173 C  CB  . CYS B 1 154 ? 18.681  -22.220 -11.773 1.00 104.07 ? 177  CYS B CB  1 
ATOM   3174 S  SG  . CYS B 1 154 ? 19.111  -20.878 -12.934 1.00 103.12 ? 177  CYS B SG  1 
ATOM   3175 N  N   . PRO B 1 155 ? 18.127  -20.254 -9.234  1.00 98.82  ? 178  PRO B N   1 
ATOM   3176 C  CA  . PRO B 1 155 ? 18.140  -18.921 -8.631  1.00 102.90 ? 178  PRO B CA  1 
ATOM   3177 C  C   . PRO B 1 155 ? 18.605  -17.833 -9.601  1.00 107.61 ? 178  PRO B C   1 
ATOM   3178 O  O   . PRO B 1 155 ? 17.884  -16.852 -9.806  1.00 114.67 ? 178  PRO B O   1 
ATOM   3179 C  CB  . PRO B 1 155 ? 19.124  -19.061 -7.466  1.00 102.75 ? 178  PRO B CB  1 
ATOM   3180 C  CG  . PRO B 1 155 ? 19.253  -20.527 -7.227  1.00 102.53 ? 178  PRO B CG  1 
ATOM   3181 C  CD  . PRO B 1 155 ? 19.071  -21.163 -8.562  1.00 99.49  ? 178  PRO B CD  1 
ATOM   3182 N  N   . ALA B 1 156 ? 19.770  -18.030 -10.218 1.00 102.08 ? 179  ALA B N   1 
ATOM   3183 C  CA  . ALA B 1 156 ? 20.334  -17.086 -11.206 1.00 98.71  ? 179  ALA B CA  1 
ATOM   3184 C  C   . ALA B 1 156 ? 19.313  -16.418 -12.169 1.00 106.68 ? 179  ALA B C   1 
ATOM   3185 O  O   . ALA B 1 156 ? 19.511  -15.274 -12.639 1.00 90.46  ? 179  ALA B O   1 
ATOM   3186 C  CB  . ALA B 1 156 ? 21.407  -17.800 -12.008 1.00 90.82  ? 179  ALA B CB  1 
ATOM   3187 N  N   . LEU B 1 157 ? 18.230  -17.150 -12.455 1.00 114.43 ? 180  LEU B N   1 
ATOM   3188 C  CA  . LEU B 1 157 ? 17.211  -16.727 -13.411 1.00 108.41 ? 180  LEU B CA  1 
ATOM   3189 C  C   . LEU B 1 157 ? 16.003  -16.063 -12.761 1.00 100.98 ? 180  LEU B C   1 
ATOM   3190 O  O   . LEU B 1 157 ? 15.083  -15.633 -13.461 1.00 99.35  ? 180  LEU B O   1 
ATOM   3191 C  CB  . LEU B 1 157 ? 16.753  -17.935 -14.245 1.00 106.11 ? 180  LEU B CB  1 
ATOM   3192 C  CG  . LEU B 1 157 ? 17.599  -18.279 -15.481 1.00 99.88  ? 180  LEU B CG  1 
ATOM   3193 C  CD1 . LEU B 1 157 ? 17.265  -19.670 -15.993 1.00 103.94 ? 180  LEU B CD1 1 
ATOM   3194 C  CD2 . LEU B 1 157 ? 17.386  -17.268 -16.592 1.00 94.90  ? 180  LEU B CD2 1 
ATOM   3195 N  N   . ASP B 1 158 ? 15.997  -15.970 -11.437 1.00 96.53  ? 181  ASP B N   1 
ATOM   3196 C  CA  . ASP B 1 158 ? 14.805  -15.489 -10.731 1.00 96.82  ? 181  ASP B CA  1 
ATOM   3197 C  C   . ASP B 1 158 ? 14.357  -14.111 -11.233 1.00 88.16  ? 181  ASP B C   1 
ATOM   3198 O  O   . ASP B 1 158 ? 15.133  -13.175 -11.280 1.00 80.28  ? 181  ASP B O   1 
ATOM   3199 C  CB  . ASP B 1 158 ? 15.022  -15.475 -9.207  1.00 99.82  ? 181  ASP B CB  1 
ATOM   3200 C  CG  . ASP B 1 158 ? 13.707  -15.577 -8.414  1.00 97.82  ? 181  ASP B CG  1 
ATOM   3201 O  OD1 . ASP B 1 158 ? 12.670  -15.918 -9.003  1.00 93.78  ? 181  ASP B OD1 1 
ATOM   3202 O  OD2 . ASP B 1 158 ? 13.714  -15.330 -7.194  1.00 97.45  ? 181  ASP B OD2 1 
ATOM   3203 N  N   . GLY B 1 159 ? 13.096  -14.014 -11.633 1.00 87.00  ? 182  GLY B N   1 
ATOM   3204 C  CA  . GLY B 1 159 ? 12.581  -12.792 -12.184 1.00 84.77  ? 182  GLY B CA  1 
ATOM   3205 C  C   . GLY B 1 159 ? 13.345  -12.360 -13.417 1.00 87.46  ? 182  GLY B C   1 
ATOM   3206 O  O   . GLY B 1 159 ? 13.439  -11.180 -13.687 1.00 84.27  ? 182  GLY B O   1 
ATOM   3207 N  N   . LYS B 1 160 ? 13.907  -13.296 -14.178 1.00 91.47  ? 183  LYS B N   1 
ATOM   3208 C  CA  . LYS B 1 160 ? 14.522  -12.934 -15.454 1.00 94.34  ? 183  LYS B CA  1 
ATOM   3209 C  C   . LYS B 1 160 ? 13.548  -13.252 -16.596 1.00 97.17  ? 183  LYS B C   1 
ATOM   3210 O  O   . LYS B 1 160 ? 12.369  -13.574 -16.356 1.00 105.93 ? 183  LYS B O   1 
ATOM   3211 C  CB  . LYS B 1 160 ? 15.868  -13.647 -15.651 1.00 94.63  ? 183  LYS B CB  1 
ATOM   3212 C  CG  . LYS B 1 160 ? 16.856  -13.425 -14.522 1.00 101.08 ? 183  LYS B CG  1 
ATOM   3213 C  CD  . LYS B 1 160 ? 17.352  -11.992 -14.488 1.00 106.43 ? 183  LYS B CD  1 
ATOM   3214 C  CE  . LYS B 1 160 ? 18.307  -11.760 -13.326 1.00 109.29 ? 183  LYS B CE  1 
ATOM   3215 N  NZ  . LYS B 1 160 ? 18.719  -10.329 -13.290 1.00 111.05 ? 183  LYS B NZ  1 
ATOM   3216 N  N   . GLY B 1 161 ? 14.036  -13.121 -17.832 1.00 91.33  ? 184  GLY B N   1 
ATOM   3217 C  CA  . GLY B 1 161 ? 13.269  -13.445 -19.022 1.00 86.86  ? 184  GLY B CA  1 
ATOM   3218 C  C   . GLY B 1 161 ? 12.157  -12.470 -19.368 1.00 84.78  ? 184  GLY B C   1 
ATOM   3219 O  O   . GLY B 1 161 ? 11.286  -12.784 -20.171 1.00 85.77  ? 184  GLY B O   1 
ATOM   3220 N  N   . ALA B 1 162 ? 12.158  -11.291 -18.769 1.00 84.12  ? 185  ALA B N   1 
ATOM   3221 C  CA  . ALA B 1 162 ? 11.138  -10.309 -19.098 1.00 85.04  ? 185  ALA B CA  1 
ATOM   3222 C  C   . ALA B 1 162 ? 11.081  -10.159 -20.604 1.00 81.39  ? 185  ALA B C   1 
ATOM   3223 O  O   . ALA B 1 162 ? 12.120  -10.177 -21.261 1.00 75.55  ? 185  ALA B O   1 
ATOM   3224 C  CB  . ALA B 1 162 ? 11.462  -8.972  -18.460 1.00 89.62  ? 185  ALA B CB  1 
ATOM   3225 N  N   . PRO B 1 163 ? 9.874   -10.003 -21.156 1.00 83.28  ? 186  PRO B N   1 
ATOM   3226 C  CA  . PRO B 1 163 ? 9.693   -9.888  -22.593 1.00 88.93  ? 186  PRO B CA  1 
ATOM   3227 C  C   . PRO B 1 163 ? 9.715   -8.457  -23.193 1.00 95.56  ? 186  PRO B C   1 
ATOM   3228 O  O   . PRO B 1 163 ? 9.630   -8.321  -24.423 1.00 98.48  ? 186  PRO B O   1 
ATOM   3229 C  CB  . PRO B 1 163 ? 8.324   -10.527 -22.800 1.00 84.12  ? 186  PRO B CB  1 
ATOM   3230 C  CG  . PRO B 1 163 ? 7.577   -10.145 -21.581 1.00 83.92  ? 186  PRO B CG  1 
ATOM   3231 C  CD  . PRO B 1 163 ? 8.578   -10.041 -20.463 1.00 85.99  ? 186  PRO B CD  1 
ATOM   3232 N  N   . ASP B 1 164 ? 9.842   -7.413  -22.372 1.00 96.87  ? 187  ASP B N   1 
ATOM   3233 C  CA  . ASP B 1 164 ? 9.945   -6.062  -22.919 1.00 96.96  ? 187  ASP B CA  1 
ATOM   3234 C  C   . ASP B 1 164 ? 11.162  -5.928  -23.865 1.00 92.76  ? 187  ASP B C   1 
ATOM   3235 O  O   . ASP B 1 164 ? 12.288  -6.291  -23.479 1.00 92.35  ? 187  ASP B O   1 
ATOM   3236 C  CB  . ASP B 1 164 ? 10.043  -5.030  -21.809 1.00 102.21 ? 187  ASP B CB  1 
ATOM   3237 C  CG  . ASP B 1 164 ? 9.932   -3.620  -22.345 1.00 110.93 ? 187  ASP B CG  1 
ATOM   3238 O  OD1 . ASP B 1 164 ? 8.805   -3.260  -22.744 1.00 117.94 ? 187  ASP B OD1 1 
ATOM   3239 O  OD2 . ASP B 1 164 ? 10.955  -2.895  -22.407 1.00 104.71 ? 187  ASP B OD2 1 
ATOM   3240 N  N   . PRO B 1 165 ? 10.949  -5.393  -25.097 1.00 85.26  ? 188  PRO B N   1 
ATOM   3241 C  CA  . PRO B 1 165 ? 12.030  -5.345  -26.101 1.00 83.10  ? 188  PRO B CA  1 
ATOM   3242 C  C   . PRO B 1 165 ? 13.339  -4.692  -25.613 1.00 83.30  ? 188  PRO B C   1 
ATOM   3243 O  O   . PRO B 1 165 ? 14.433  -5.041  -26.078 1.00 76.85  ? 188  PRO B O   1 
ATOM   3244 C  CB  . PRO B 1 165 ? 11.410  -4.542  -27.260 1.00 80.93  ? 188  PRO B CB  1 
ATOM   3245 C  CG  . PRO B 1 165 ? 9.942   -4.648  -27.086 1.00 79.13  ? 188  PRO B CG  1 
ATOM   3246 C  CD  . PRO B 1 165 ? 9.719   -4.744  -25.599 1.00 82.58  ? 188  PRO B CD  1 
ATOM   3247 N  N   . ASN B 1 166 ? 13.216  -3.765  -24.675 1.00 87.10  ? 189  ASN B N   1 
ATOM   3248 C  CA  . ASN B 1 166 ? 14.372  -3.107  -24.097 1.00 89.30  ? 189  ASN B CA  1 
ATOM   3249 C  C   . ASN B 1 166 ? 14.755  -3.684  -22.762 1.00 87.03  ? 189  ASN B C   1 
ATOM   3250 O  O   . ASN B 1 166 ? 15.272  -2.964  -21.936 1.00 82.60  ? 189  ASN B O   1 
ATOM   3251 C  CB  . ASN B 1 166 ? 14.088  -1.618  -23.921 1.00 91.38  ? 189  ASN B CB  1 
ATOM   3252 C  CG  . ASN B 1 166 ? 13.875  -0.908  -25.245 1.00 99.64  ? 189  ASN B CG  1 
ATOM   3253 O  OD1 . ASN B 1 166 ? 14.830  -0.643  -25.999 1.00 98.24  ? 189  ASN B OD1 1 
ATOM   3254 N  ND2 . ASN B 1 166 ? 12.617  -0.569  -25.527 1.00 99.21  ? 189  ASN B ND2 1 
ATOM   3255 N  N   . THR B 1 167 ? 14.512  -4.968  -22.522 1.00 91.70  ? 190  THR B N   1 
ATOM   3256 C  CA  . THR B 1 167 ? 14.959  -5.553  -21.257 1.00 94.51  ? 190  THR B CA  1 
ATOM   3257 C  C   . THR B 1 167 ? 16.458  -5.807  -21.359 1.00 92.92  ? 190  THR B C   1 
ATOM   3258 O  O   . THR B 1 167 ? 17.003  -5.964  -22.454 1.00 90.87  ? 190  THR B O   1 
ATOM   3259 C  CB  . THR B 1 167 ? 14.176  -6.827  -20.893 1.00 98.51  ? 190  THR B CB  1 
ATOM   3260 O  OG1 . THR B 1 167 ? 12.833  -6.476  -20.511 1.00 95.59  ? 190  THR B OG1 1 
ATOM   3261 C  CG2 . THR B 1 167 ? 14.843  -7.572  -19.736 1.00 97.54  ? 190  THR B CG2 1 
ATOM   3262 N  N   . LYS B 1 168 ? 17.151  -5.752  -20.236 1.00 96.06  ? 191  LYS B N   1 
ATOM   3263 C  CA  . LYS B 1 168 ? 18.579  -6.007  -20.286 1.00 102.64 ? 191  LYS B CA  1 
ATOM   3264 C  C   . LYS B 1 168 ? 18.811  -7.474  -20.266 1.00 96.17  ? 191  LYS B C   1 
ATOM   3265 O  O   . LYS B 1 168 ? 18.200  -8.170  -19.467 1.00 96.97  ? 191  LYS B O   1 
ATOM   3266 C  CB  . LYS B 1 168 ? 19.329  -5.333  -19.134 1.00 113.57 ? 191  LYS B CB  1 
ATOM   3267 C  CG  . LYS B 1 168 ? 20.085  -4.098  -19.643 1.00 122.90 ? 191  LYS B CG  1 
ATOM   3268 C  CD  . LYS B 1 168 ? 20.306  -2.977  -18.634 1.00 124.03 ? 191  LYS B CD  1 
ATOM   3269 C  CE  . LYS B 1 168 ? 20.667  -1.683  -19.347 1.00 122.11 ? 191  LYS B CE  1 
ATOM   3270 N  NZ  . LYS B 1 168 ? 19.984  -0.546  -18.684 1.00 122.47 ? 191  LYS B NZ  1 
ATOM   3271 N  N   . GLU B 1 169 ? 19.681  -7.939  -21.157 1.00 92.01  ? 192  GLU B N   1 
ATOM   3272 C  CA  . GLU B 1 169 ? 20.161  -9.310  -21.092 1.00 96.33  ? 192  GLU B CA  1 
ATOM   3273 C  C   . GLU B 1 169 ? 20.624  -9.633  -19.678 1.00 93.14  ? 192  GLU B C   1 
ATOM   3274 O  O   . GLU B 1 169 ? 21.187  -8.806  -18.999 1.00 92.03  ? 192  GLU B O   1 
ATOM   3275 C  CB  . GLU B 1 169 ? 21.308  -9.535  -22.066 1.00 99.48  ? 192  GLU B CB  1 
ATOM   3276 C  CG  . GLU B 1 169 ? 20.850  -9.747  -23.500 1.00 103.69 ? 192  GLU B CG  1 
ATOM   3277 C  CD  . GLU B 1 169 ? 21.993  -10.169 -24.402 1.00 106.82 ? 192  GLU B CD  1 
ATOM   3278 O  OE1 . GLU B 1 169 ? 23.091  -9.580  -24.253 1.00 110.58 ? 192  GLU B OE1 1 
ATOM   3279 O  OE2 . GLU B 1 169 ? 21.808  -11.088 -25.229 1.00 91.30  ? 192  GLU B OE2 1 
ATOM   3280 N  N   . ALA B 1 170 ? 20.344  -10.840 -19.225 1.00 99.83  ? 193  ALA B N   1 
ATOM   3281 C  CA  . ALA B 1 170 ? 20.790  -11.300 -17.917 1.00 105.16 ? 193  ALA B CA  1 
ATOM   3282 C  C   . ALA B 1 170 ? 22.266  -11.648 -17.989 1.00 106.56 ? 193  ALA B C   1 
ATOM   3283 O  O   . ALA B 1 170 ? 22.993  -11.431 -17.033 1.00 110.77 ? 193  ALA B O   1 
ATOM   3284 C  CB  . ALA B 1 170 ? 19.998  -12.522 -17.493 1.00 106.93 ? 193  ALA B CB  1 
ATOM   3285 N  N   . ARG B 1 171 ? 22.683  -12.208 -19.123 1.00 109.48 ? 194  ARG B N   1 
ATOM   3286 C  CA  . ARG B 1 171 ? 24.075  -12.617 -19.347 1.00 108.08 ? 194  ARG B CA  1 
ATOM   3287 C  C   . ARG B 1 171 ? 24.588  -13.438 -18.157 1.00 93.67  ? 194  ARG B C   1 
ATOM   3288 O  O   . ARG B 1 171 ? 25.586  -13.119 -17.556 1.00 90.54  ? 194  ARG B O   1 
ATOM   3289 C  CB  . ARG B 1 171 ? 24.974  -11.399 -19.621 1.00 117.83 ? 194  ARG B CB  1 
ATOM   3290 C  CG  . ARG B 1 171 ? 24.548  -10.563 -20.818 1.00 116.99 ? 194  ARG B CG  1 
ATOM   3291 C  CD  . ARG B 1 171 ? 25.745  -9.975  -21.568 1.00 116.53 ? 194  ARG B CD  1 
ATOM   3292 N  NE  . ARG B 1 171 ? 25.684  -10.240 -23.006 1.00 121.25 ? 194  ARG B NE  1 
ATOM   3293 C  CZ  . ARG B 1 171 ? 26.612  -9.855  -23.887 1.00 124.19 ? 194  ARG B CZ  1 
ATOM   3294 N  NH1 . ARG B 1 171 ? 27.679  -9.150  -23.504 1.00 123.79 ? 194  ARG B NH1 1 
ATOM   3295 N  NH2 . ARG B 1 171 ? 26.470  -10.163 -25.173 1.00 120.99 ? 194  ARG B NH2 1 
ATOM   3296 N  N   . ILE B 1 172 ? 23.861  -14.486 -17.819 1.00 92.68  ? 195  ILE B N   1 
ATOM   3297 C  CA  . ILE B 1 172 ? 24.239  -15.371 -16.728 1.00 96.28  ? 195  ILE B CA  1 
ATOM   3298 C  C   . ILE B 1 172 ? 25.407  -16.252 -17.127 1.00 101.16 ? 195  ILE B C   1 
ATOM   3299 O  O   . ILE B 1 172 ? 25.394  -16.868 -18.190 1.00 98.23  ? 195  ILE B O   1 
ATOM   3300 C  CB  . ILE B 1 172 ? 23.088  -16.311 -16.345 1.00 110.19 ? 195  ILE B CB  1 
ATOM   3301 C  CG1 . ILE B 1 172 ? 21.866  -15.495 -15.949 1.00 124.68 ? 195  ILE B CG1 1 
ATOM   3302 C  CG2 . ILE B 1 172 ? 23.459  -17.232 -15.193 1.00 108.99 ? 195  ILE B CG2 1 
ATOM   3303 C  CD1 . ILE B 1 172 ? 22.042  -14.535 -14.787 1.00 134.94 ? 195  ILE B CD1 1 
ATOM   3304 N  N   . PRO B 1 173 ? 26.430  -16.326 -16.275 1.00 116.20 ? 196  PRO B N   1 
ATOM   3305 C  CA  . PRO B 1 173 ? 27.481  -17.320 -16.427 1.00 113.60 ? 196  PRO B CA  1 
ATOM   3306 C  C   . PRO B 1 173 ? 26.906  -18.692 -16.619 1.00 105.69 ? 196  PRO B C   1 
ATOM   3307 O  O   . PRO B 1 173 ? 26.043  -19.102 -15.846 1.00 103.76 ? 196  PRO B O   1 
ATOM   3308 C  CB  . PRO B 1 173 ? 28.189  -17.270 -15.081 1.00 119.65 ? 196  PRO B CB  1 
ATOM   3309 C  CG  . PRO B 1 173 ? 28.087  -15.843 -14.695 1.00 126.08 ? 196  PRO B CG  1 
ATOM   3310 C  CD  . PRO B 1 173 ? 26.768  -15.344 -15.232 1.00 127.06 ? 196  PRO B CD  1 
ATOM   3311 N  N   . VAL B 1 174 ? 27.394  -19.385 -17.639 1.00 107.48 ? 197  VAL B N   1 
ATOM   3312 C  CA  . VAL B 1 174 ? 26.965  -20.752 -17.961 1.00 111.11 ? 197  VAL B CA  1 
ATOM   3313 C  C   . VAL B 1 174 ? 27.070  -21.714 -16.775 1.00 110.12 ? 197  VAL B C   1 
ATOM   3314 O  O   . VAL B 1 174 ? 26.235  -22.601 -16.615 1.00 106.73 ? 197  VAL B O   1 
ATOM   3315 C  CB  . VAL B 1 174 ? 27.773  -21.323 -19.150 1.00 107.93 ? 197  VAL B CB  1 
ATOM   3316 C  CG1 . VAL B 1 174 ? 29.158  -21.760 -18.714 1.00 110.38 ? 197  VAL B CG1 1 
ATOM   3317 C  CG2 . VAL B 1 174 ? 27.032  -22.477 -19.797 1.00 105.23 ? 197  VAL B CG2 1 
ATOM   3318 N  N   . GLU B 1 175 ? 28.076  -21.519 -15.936 1.00 109.12 ? 198  GLU B N   1 
ATOM   3319 C  CA  . GLU B 1 175 ? 28.178  -22.301 -14.726 1.00 113.89 ? 198  GLU B CA  1 
ATOM   3320 C  C   . GLU B 1 175 ? 26.925  -22.158 -13.853 1.00 114.11 ? 198  GLU B C   1 
ATOM   3321 O  O   . GLU B 1 175 ? 26.518  -23.116 -13.211 1.00 106.99 ? 198  GLU B O   1 
ATOM   3322 C  CB  . GLU B 1 175 ? 29.392  -21.871 -13.896 1.00 111.52 ? 198  GLU B CB  1 
ATOM   3323 C  CG  . GLU B 1 175 ? 30.763  -22.038 -14.541 1.00 112.10 ? 198  GLU B CG  1 
ATOM   3324 C  CD  . GLU B 1 175 ? 31.254  -20.803 -15.272 1.00 114.61 ? 198  GLU B CD  1 
ATOM   3325 O  OE1 . GLU B 1 175 ? 30.413  -20.059 -15.815 1.00 121.12 ? 198  GLU B OE1 1 
ATOM   3326 O  OE2 . GLU B 1 175 ? 32.485  -20.582 -15.318 1.00 110.45 ? 198  GLU B OE2 1 
ATOM   3327 N  N   . LEU B 1 176 ? 26.325  -20.968 -13.824 1.00 116.02 ? 199  LEU B N   1 
ATOM   3328 C  CA  . LEU B 1 176 ? 25.178  -20.682 -12.936 1.00 114.67 ? 199  LEU B CA  1 
ATOM   3329 C  C   . LEU B 1 176 ? 23.781  -20.984 -13.503 1.00 114.97 ? 199  LEU B C   1 
ATOM   3330 O  O   . LEU B 1 176 ? 22.773  -20.942 -12.771 1.00 102.78 ? 199  LEU B O   1 
ATOM   3331 C  CB  . LEU B 1 176 ? 25.221  -19.224 -12.509 1.00 109.98 ? 199  LEU B CB  1 
ATOM   3332 C  CG  . LEU B 1 176 ? 26.263  -18.880 -11.453 1.00 104.79 ? 199  LEU B CG  1 
ATOM   3333 C  CD1 . LEU B 1 176 ? 26.430  -17.367 -11.443 1.00 102.25 ? 199  LEU B CD1 1 
ATOM   3334 C  CD2 . LEU B 1 176 ? 25.885  -19.412 -10.073 1.00 96.83  ? 199  LEU B CD2 1 
ATOM   3335 N  N   . LEU B 1 177 ? 23.729  -21.267 -14.802 1.00 114.17 ? 200  LEU B N   1 
ATOM   3336 C  CA  . LEU B 1 177 ? 22.528  -21.786 -15.436 1.00 106.34 ? 200  LEU B CA  1 
ATOM   3337 C  C   . LEU B 1 177 ? 22.237  -23.185 -14.872 1.00 102.42 ? 200  LEU B C   1 
ATOM   3338 O  O   . LEU B 1 177 ? 23.035  -23.725 -14.099 1.00 106.60 ? 200  LEU B O   1 
ATOM   3339 C  CB  . LEU B 1 177 ? 22.723  -21.808 -16.955 1.00 103.38 ? 200  LEU B CB  1 
ATOM   3340 C  CG  . LEU B 1 177 ? 22.739  -20.416 -17.613 1.00 106.99 ? 200  LEU B CG  1 
ATOM   3341 C  CD1 . LEU B 1 177 ? 23.116  -20.477 -19.088 1.00 104.85 ? 200  LEU B CD1 1 
ATOM   3342 C  CD2 . LEU B 1 177 ? 21.398  -19.709 -17.474 1.00 109.48 ? 200  LEU B CD2 1 
ATOM   3343 N  N   . PRO B 1 178 ? 21.075  -23.758 -15.212 1.00 94.64  ? 201  PRO B N   1 
ATOM   3344 C  CA  . PRO B 1 178 ? 20.689  -25.063 -14.660 1.00 93.98  ? 201  PRO B CA  1 
ATOM   3345 C  C   . PRO B 1 178 ? 21.684  -26.175 -14.974 1.00 93.45  ? 201  PRO B C   1 
ATOM   3346 O  O   . PRO B 1 178 ? 22.009  -26.385 -16.147 1.00 92.64  ? 201  PRO B O   1 
ATOM   3347 C  CB  . PRO B 1 178 ? 19.371  -25.360 -15.371 1.00 95.71  ? 201  PRO B CB  1 
ATOM   3348 C  CG  . PRO B 1 178 ? 18.816  -24.014 -15.699 1.00 96.04  ? 201  PRO B CG  1 
ATOM   3349 C  CD  . PRO B 1 178 ? 20.000  -23.166 -16.028 1.00 93.26  ? 201  PRO B CD  1 
ATOM   3350 N  N   . ARG B 1 179 ? 22.137  -26.895 -13.944 1.00 91.61  ? 202  ARG B N   1 
ATOM   3351 C  CA  . ARG B 1 179 ? 23.129  -27.967 -14.110 1.00 89.40  ? 202  ARG B CA  1 
ATOM   3352 C  C   . ARG B 1 179 ? 22.616  -29.293 -13.610 1.00 86.28  ? 202  ARG B C   1 
ATOM   3353 O  O   . ARG B 1 179 ? 21.731  -29.341 -12.762 1.00 85.21  ? 202  ARG B O   1 
ATOM   3354 C  CB  . ARG B 1 179 ? 24.381  -27.661 -13.325 1.00 95.68  ? 202  ARG B CB  1 
ATOM   3355 C  CG  . ARG B 1 179 ? 24.873  -26.239 -13.491 1.00 102.09 ? 202  ARG B CG  1 
ATOM   3356 C  CD  . ARG B 1 179 ? 25.285  -25.896 -14.915 1.00 100.85 ? 202  ARG B CD  1 
ATOM   3357 N  NE  . ARG B 1 179 ? 26.312  -26.818 -15.403 1.00 101.36 ? 202  ARG B NE  1 
ATOM   3358 C  CZ  . ARG B 1 179 ? 27.260  -26.523 -16.291 1.00 98.00  ? 202  ARG B CZ  1 
ATOM   3359 N  NH1 . ARG B 1 179 ? 27.373  -25.305 -16.836 1.00 93.57  ? 202  ARG B NH1 1 
ATOM   3360 N  NH2 . ARG B 1 179 ? 28.108  -27.484 -16.635 1.00 93.19  ? 202  ARG B NH2 1 
ATOM   3361 N  N   . CYS B 1 180 ? 23.208  -30.356 -14.145 1.00 89.89  ? 203  CYS B N   1 
ATOM   3362 C  CA  . CYS B 1 180 ? 22.828  -31.734 -13.850 1.00 98.30  ? 203  CYS B CA  1 
ATOM   3363 C  C   . CYS B 1 180 ? 23.156  -32.064 -12.418 1.00 105.06 ? 203  CYS B C   1 
ATOM   3364 O  O   . CYS B 1 180 ? 24.227  -31.729 -11.928 1.00 118.47 ? 203  CYS B O   1 
ATOM   3365 C  CB  . CYS B 1 180 ? 23.626  -32.674 -14.726 1.00 95.66  ? 203  CYS B CB  1 
ATOM   3366 S  SG  . CYS B 1 180 ? 23.053  -34.373 -14.752 1.00 100.79 ? 203  CYS B SG  1 
ATOM   3367 N  N   . GLU B 1 181 ? 22.260  -32.756 -11.750 1.00 108.05 ? 204  GLU B N   1 
ATOM   3368 C  CA  . GLU B 1 181 ? 22.388  -32.887 -10.318 1.00 108.87 ? 204  GLU B CA  1 
ATOM   3369 C  C   . GLU B 1 181 ? 23.064  -34.188 -9.885  1.00 108.26 ? 204  GLU B C   1 
ATOM   3370 O  O   . GLU B 1 181 ? 23.172  -34.451 -8.698  1.00 105.93 ? 204  GLU B O   1 
ATOM   3371 C  CB  . GLU B 1 181 ? 21.012  -32.669 -9.670  1.00 108.83 ? 204  GLU B CB  1 
ATOM   3372 C  CG  . GLU B 1 181 ? 20.203  -31.566 -10.373 1.00 110.30 ? 204  GLU B CG  1 
ATOM   3373 C  CD  . GLU B 1 181 ? 19.512  -30.566 -9.469  1.00 103.78 ? 204  GLU B CD  1 
ATOM   3374 O  OE1 . GLU B 1 181 ? 19.614  -30.688 -8.230  1.00 97.40  ? 204  GLU B OE1 1 
ATOM   3375 O  OE2 . GLU B 1 181 ? 18.917  -29.616 -10.033 1.00 91.49  ? 204  GLU B OE2 1 
ATOM   3376 N  N   . ARG B 1 182 ? 23.557  -34.982 -10.832 1.00 110.64 ? 205  ARG B N   1 
ATOM   3377 C  CA  . ARG B 1 182 ? 24.263  -36.202 -10.476 1.00 114.17 ? 205  ARG B CA  1 
ATOM   3378 C  C   . ARG B 1 182 ? 25.669  -35.732 -10.213 1.00 129.68 ? 205  ARG B C   1 
ATOM   3379 O  O   . ARG B 1 182 ? 26.314  -35.211 -11.127 1.00 139.92 ? 205  ARG B O   1 
ATOM   3380 C  CB  . ARG B 1 182 ? 24.235  -37.207 -11.612 1.00 106.92 ? 205  ARG B CB  1 
ATOM   3381 C  CG  . ARG B 1 182 ? 22.852  -37.766 -11.836 1.00 103.39 ? 205  ARG B CG  1 
ATOM   3382 C  CD  . ARG B 1 182 ? 22.737  -38.448 -13.183 1.00 105.21 ? 205  ARG B CD  1 
ATOM   3383 N  NE  . ARG B 1 182 ? 23.179  -39.832 -13.161 1.00 108.72 ? 205  ARG B NE  1 
ATOM   3384 C  CZ  . ARG B 1 182 ? 23.263  -40.593 -14.244 1.00 98.47  ? 205  ARG B CZ  1 
ATOM   3385 N  NH1 . ARG B 1 182 ? 22.981  -40.099 -15.439 1.00 95.42  ? 205  ARG B NH1 1 
ATOM   3386 N  NH2 . ARG B 1 182 ? 23.653  -41.846 -14.135 1.00 96.25  ? 205  ARG B NH2 1 
ATOM   3387 N  N   . LYS B 1 183 ? 26.144  -35.908 -8.976  1.00 137.69 ? 206  LYS B N   1 
ATOM   3388 C  CA  . LYS B 1 183 ? 27.389  -35.242 -8.496  1.00 133.13 ? 206  LYS B CA  1 
ATOM   3389 C  C   . LYS B 1 183 ? 28.561  -35.494 -9.453  1.00 128.07 ? 206  LYS B C   1 
ATOM   3390 O  O   . LYS B 1 183 ? 29.278  -34.565 -9.847  1.00 114.50 ? 206  LYS B O   1 
ATOM   3391 C  CB  . LYS B 1 183 ? 27.753  -35.671 -7.054  1.00 125.48 ? 206  LYS B CB  1 
ATOM   3392 C  CG  . LYS B 1 183 ? 26.801  -35.177 -5.969  1.00 120.34 ? 206  LYS B CG  1 
ATOM   3393 C  CD  . LYS B 1 183 ? 27.401  -35.338 -4.573  1.00 116.13 ? 206  LYS B CD  1 
ATOM   3394 C  CE  . LYS B 1 183 ? 26.479  -34.804 -3.476  1.00 111.71 ? 206  LYS B CE  1 
ATOM   3395 N  NZ  . LYS B 1 183 ? 27.219  -34.460 -2.229  1.00 103.85 ? 206  LYS B NZ  1 
ATOM   3396 N  N   . SER B 1 184 ? 28.707  -36.754 -9.857  1.00 125.50 ? 207  SER B N   1 
ATOM   3397 C  CA  . SER B 1 184 ? 29.719  -37.159 -10.827 1.00 120.88 ? 207  SER B CA  1 
ATOM   3398 C  C   . SER B 1 184 ? 29.634  -36.357 -12.126 1.00 127.64 ? 207  SER B C   1 
ATOM   3399 O  O   . SER B 1 184 ? 30.621  -36.240 -12.846 1.00 126.14 ? 207  SER B O   1 
ATOM   3400 C  CB  . SER B 1 184 ? 29.580  -38.663 -11.133 1.00 113.67 ? 207  SER B CB  1 
ATOM   3401 O  OG  . SER B 1 184 ? 28.215  -39.050 -11.258 1.00 95.13  ? 207  SER B OG  1 
ATOM   3402 N  N   . CYS B 1 185 ? 28.455  -35.804 -12.422 1.00 138.02 ? 208  CYS B N   1 
ATOM   3403 C  CA  . CYS B 1 185 ? 28.197  -35.182 -13.719 1.00 133.37 ? 208  CYS B CA  1 
ATOM   3404 C  C   . CYS B 1 185 ? 28.335  -33.658 -13.801 1.00 123.90 ? 208  CYS B C   1 
ATOM   3405 O  O   . CYS B 1 185 ? 29.219  -33.128 -14.483 1.00 118.66 ? 208  CYS B O   1 
ATOM   3406 C  CB  . CYS B 1 185 ? 26.799  -35.555 -14.206 1.00 131.73 ? 208  CYS B CB  1 
ATOM   3407 S  SG  . CYS B 1 185 ? 26.590  -34.919 -15.874 1.00 149.22 ? 208  CYS B SG  1 
ATOM   3408 N  N   . ASN B 1 186 ? 27.412  -32.958 -13.161 1.00 115.43 ? 209  ASN B N   1 
ATOM   3409 C  CA  . ASN B 1 186 ? 27.316  -31.505 -13.293 1.00 116.17 ? 209  ASN B CA  1 
ATOM   3410 C  C   . ASN B 1 186 ? 27.234  -30.934 -14.742 1.00 116.42 ? 209  ASN B C   1 
ATOM   3411 O  O   . ASN B 1 186 ? 27.555  -29.759 -14.991 1.00 112.44 ? 209  ASN B O   1 
ATOM   3412 C  CB  . ASN B 1 186 ? 28.460  -30.846 -12.528 1.00 112.48 ? 209  ASN B CB  1 
ATOM   3413 C  CG  . ASN B 1 186 ? 28.132  -29.429 -12.127 1.00 110.09 ? 209  ASN B CG  1 
ATOM   3414 O  OD1 . ASN B 1 186 ? 27.162  -29.184 -11.420 1.00 105.47 ? 209  ASN B OD1 1 
ATOM   3415 N  ND2 . ASN B 1 186 ? 28.912  -28.484 -12.610 1.00 111.28 ? 209  ASN B ND2 1 
ATOM   3416 N  N   . GLY B 1 187 ? 26.725  -31.730 -15.678 1.00 112.77 ? 210  GLY B N   1 
ATOM   3417 C  CA  . GLY B 1 187 ? 26.508  -31.245 -17.028 1.00 107.72 ? 210  GLY B CA  1 
ATOM   3418 C  C   . GLY B 1 187 ? 25.590  -30.036 -17.080 1.00 113.21 ? 210  GLY B C   1 
ATOM   3419 O  O   . GLY B 1 187 ? 24.827  -29.776 -16.142 1.00 131.87 ? 210  GLY B O   1 
ATOM   3420 N  N   . LEU B 1 188 ? 25.677  -29.273 -18.170 1.00 111.01 ? 211  LEU B N   1 
ATOM   3421 C  CA  . LEU B 1 188 ? 24.738  -28.166 -18.436 1.00 98.24  ? 211  LEU B CA  1 
ATOM   3422 C  C   . LEU B 1 188 ? 23.448  -28.752 -18.993 1.00 95.98  ? 211  LEU B C   1 
ATOM   3423 O  O   . LEU B 1 188 ? 23.466  -29.677 -19.812 1.00 87.31  ? 211  LEU B O   1 
ATOM   3424 C  CB  . LEU B 1 188 ? 25.300  -27.164 -19.443 1.00 85.91  ? 211  LEU B CB  1 
ATOM   3425 C  CG  . LEU B 1 188 ? 24.292  -26.153 -19.981 1.00 81.85  ? 211  LEU B CG  1 
ATOM   3426 C  CD1 . LEU B 1 188 ? 23.918  -25.166 -18.902 1.00 79.50  ? 211  LEU B CD1 1 
ATOM   3427 C  CD2 . LEU B 1 188 ? 24.826  -25.414 -21.192 1.00 86.04  ? 211  LEU B CD2 1 
ATOM   3428 N  N   . LEU B 1 189 ? 22.332  -28.200 -18.541 1.00 92.60  ? 212  LEU B N   1 
ATOM   3429 C  CA  . LEU B 1 189 ? 21.051  -28.635 -19.010 1.00 86.44  ? 212  LEU B CA  1 
ATOM   3430 C  C   . LEU B 1 189 ? 20.525  -27.713 -20.095 1.00 76.43  ? 212  LEU B C   1 
ATOM   3431 O  O   . LEU B 1 189 ? 20.791  -26.516 -20.112 1.00 66.07  ? 212  LEU B O   1 
ATOM   3432 C  CB  . LEU B 1 189 ? 20.061  -28.677 -17.847 1.00 97.92  ? 212  LEU B CB  1 
ATOM   3433 C  CG  . LEU B 1 189 ? 20.426  -29.542 -16.629 1.00 103.15 ? 212  LEU B CG  1 
ATOM   3434 C  CD1 . LEU B 1 189 ? 19.273  -29.532 -15.632 1.00 95.93  ? 212  LEU B CD1 1 
ATOM   3435 C  CD2 . LEU B 1 189 ? 20.796  -30.973 -17.028 1.00 104.07 ? 212  LEU B CD2 1 
ATOM   3436 N  N   . ARG B 1 190 ? 19.765  -28.323 -20.992 1.00 75.26  ? 213  ARG B N   1 
ATOM   3437 C  CA  . ARG B 1 190 ? 18.940  -27.628 -21.963 1.00 72.66  ? 213  ARG B CA  1 
ATOM   3438 C  C   . ARG B 1 190 ? 17.499  -28.121 -21.821 1.00 69.56  ? 213  ARG B C   1 
ATOM   3439 O  O   . ARG B 1 190 ? 17.254  -29.206 -21.248 1.00 66.36  ? 213  ARG B O   1 
ATOM   3440 C  CB  . ARG B 1 190 ? 19.407  -27.961 -23.374 1.00 72.03  ? 213  ARG B CB  1 
ATOM   3441 C  CG  . ARG B 1 190 ? 19.259  -29.431 -23.759 1.00 67.72  ? 213  ARG B CG  1 
ATOM   3442 C  CD  . ARG B 1 190 ? 19.409  -29.602 -25.266 1.00 68.67  ? 213  ARG B CD  1 
ATOM   3443 N  NE  . ARG B 1 190 ? 18.148  -29.380 -25.990 1.00 73.05  ? 213  ARG B NE  1 
ATOM   3444 C  CZ  . ARG B 1 190 ? 17.993  -29.455 -27.315 1.00 70.82  ? 213  ARG B CZ  1 
ATOM   3445 N  NH1 . ARG B 1 190 ? 19.031  -29.716 -28.080 1.00 68.73  ? 213  ARG B NH1 1 
ATOM   3446 N  NH2 . ARG B 1 190 ? 16.795  -29.274 -27.886 1.00 69.21  ? 213  ARG B NH2 1 
ATOM   3447 N  N   . PRO B 1 191 ? 16.544  -27.339 -22.359 1.00 63.03  ? 214  PRO B N   1 
ATOM   3448 C  CA  . PRO B 1 191 ? 15.173  -27.785 -22.337 1.00 60.64  ? 214  PRO B CA  1 
ATOM   3449 C  C   . PRO B 1 191 ? 15.073  -29.003 -23.207 1.00 63.19  ? 214  PRO B C   1 
ATOM   3450 O  O   . PRO B 1 191 ? 15.713  -29.044 -24.229 1.00 63.66  ? 214  PRO B O   1 
ATOM   3451 C  CB  . PRO B 1 191 ? 14.398  -26.625 -22.975 1.00 58.64  ? 214  PRO B CB  1 
ATOM   3452 C  CG  . PRO B 1 191 ? 15.313  -25.478 -23.021 1.00 59.29  ? 214  PRO B CG  1 
ATOM   3453 C  CD  . PRO B 1 191 ? 16.693  -26.051 -23.051 1.00 62.12  ? 214  PRO B CD  1 
ATOM   3454 N  N   . HIS B 1 192 ? 14.241  -29.962 -22.813 1.00 66.85  ? 215  HIS B N   1 
ATOM   3455 C  CA  . HIS B 1 192 ? 13.984  -31.175 -23.588 1.00 60.34  ? 215  HIS B CA  1 
ATOM   3456 C  C   . HIS B 1 192 ? 12.813  -30.887 -24.512 1.00 60.42  ? 215  HIS B C   1 
ATOM   3457 O  O   . HIS B 1 192 ? 11.701  -31.420 -24.365 1.00 55.58  ? 215  HIS B O   1 
ATOM   3458 C  CB  . HIS B 1 192 ? 13.663  -32.317 -22.647 1.00 56.39  ? 215  HIS B CB  1 
ATOM   3459 C  CG  . HIS B 1 192 ? 13.656  -33.658 -23.298 1.00 54.25  ? 215  HIS B CG  1 
ATOM   3460 N  ND1 . HIS B 1 192 ? 14.623  -34.066 -24.189 1.00 56.19  ? 215  HIS B ND1 1 
ATOM   3461 C  CD2 . HIS B 1 192 ? 12.830  -34.713 -23.131 1.00 54.24  ? 215  HIS B CD2 1 
ATOM   3462 C  CE1 . HIS B 1 192 ? 14.380  -35.316 -24.551 1.00 57.23  ? 215  HIS B CE1 1 
ATOM   3463 N  NE2 . HIS B 1 192 ? 13.296  -35.731 -23.925 1.00 53.34  ? 215  HIS B NE2 1 
ATOM   3464 N  N   . VAL B 1 193 ? 13.095  -29.998 -25.455 1.00 59.49  ? 216  VAL B N   1 
ATOM   3465 C  CA  . VAL B 1 193 ? 12.187  -29.703 -26.532 1.00 61.05  ? 216  VAL B CA  1 
ATOM   3466 C  C   . VAL B 1 193 ? 12.916  -30.085 -27.775 1.00 62.31  ? 216  VAL B C   1 
ATOM   3467 O  O   . VAL B 1 193 ? 14.169  -30.107 -27.806 1.00 68.17  ? 216  VAL B O   1 
ATOM   3468 C  CB  . VAL B 1 193 ? 11.766  -28.220 -26.626 1.00 60.57  ? 216  VAL B CB  1 
ATOM   3469 C  CG1 . VAL B 1 193 ? 11.274  -27.730 -25.270 1.00 63.27  ? 216  VAL B CG1 1 
ATOM   3470 C  CG2 . VAL B 1 193 ? 12.890  -27.354 -27.160 1.00 60.77  ? 216  VAL B CG2 1 
ATOM   3471 N  N   . VAL B 1 194 ? 12.131  -30.351 -28.808 1.00 58.58  ? 217  VAL B N   1 
ATOM   3472 C  CA  . VAL B 1 194 ? 12.663  -30.451 -30.154 1.00 53.94  ? 217  VAL B CA  1 
ATOM   3473 C  C   . VAL B 1 194 ? 12.720  -29.054 -30.784 1.00 55.55  ? 217  VAL B C   1 
ATOM   3474 O  O   . VAL B 1 194 ? 11.703  -28.354 -30.905 1.00 54.70  ? 217  VAL B O   1 
ATOM   3475 C  CB  . VAL B 1 194 ? 11.813  -31.364 -31.010 1.00 49.45  ? 217  VAL B CB  1 
ATOM   3476 C  CG1 . VAL B 1 194 ? 12.458  -31.543 -32.350 1.00 49.93  ? 217  VAL B CG1 1 
ATOM   3477 C  CG2 . VAL B 1 194 ? 11.616  -32.697 -30.316 1.00 48.33  ? 217  VAL B CG2 1 
ATOM   3478 N  N   . TRP B 1 195 ? 13.932  -28.642 -31.134 1.00 58.09  ? 218  TRP B N   1 
ATOM   3479 C  CA  . TRP B 1 195 ? 14.172  -27.323 -31.688 1.00 60.42  ? 218  TRP B CA  1 
ATOM   3480 C  C   . TRP B 1 195 ? 14.001  -27.395 -33.165 1.00 60.05  ? 218  TRP B C   1 
ATOM   3481 O  O   . TRP B 1 195 ? 13.806  -28.483 -33.702 1.00 63.01  ? 218  TRP B O   1 
ATOM   3482 C  CB  . TRP B 1 195 ? 15.578  -26.832 -31.300 1.00 63.95  ? 218  TRP B CB  1 
ATOM   3483 C  CG  . TRP B 1 195 ? 15.593  -26.175 -29.960 1.00 69.48  ? 218  TRP B CG  1 
ATOM   3484 C  CD1 . TRP B 1 195 ? 14.568  -25.490 -29.377 1.00 71.47  ? 218  TRP B CD1 1 
ATOM   3485 C  CD2 . TRP B 1 195 ? 16.682  -26.120 -29.034 1.00 76.74  ? 218  TRP B CD2 1 
ATOM   3486 N  NE1 . TRP B 1 195 ? 14.939  -25.036 -28.142 1.00 75.98  ? 218  TRP B NE1 1 
ATOM   3487 C  CE2 . TRP B 1 195 ? 16.234  -25.403 -27.904 1.00 78.18  ? 218  TRP B CE2 1 
ATOM   3488 C  CE3 . TRP B 1 195 ? 17.987  -26.616 -29.042 1.00 80.46  ? 218  TRP B CE3 1 
ATOM   3489 C  CZ2 . TRP B 1 195 ? 17.037  -25.179 -26.788 1.00 77.01  ? 218  TRP B CZ2 1 
ATOM   3490 C  CZ3 . TRP B 1 195 ? 18.784  -26.393 -27.933 1.00 80.33  ? 218  TRP B CZ3 1 
ATOM   3491 C  CH2 . TRP B 1 195 ? 18.299  -25.684 -26.818 1.00 79.52  ? 218  TRP B CH2 1 
ATOM   3492 N  N   . PHE B 1 196 ? 14.090  -26.240 -33.821 1.00 61.76  ? 219  PHE B N   1 
ATOM   3493 C  CA  . PHE B 1 196 ? 14.142  -26.193 -35.273 1.00 59.71  ? 219  PHE B CA  1 
ATOM   3494 C  C   . PHE B 1 196 ? 15.419  -26.843 -35.768 1.00 61.60  ? 219  PHE B C   1 
ATOM   3495 O  O   . PHE B 1 196 ? 16.520  -26.659 -35.191 1.00 58.51  ? 219  PHE B O   1 
ATOM   3496 C  CB  . PHE B 1 196 ? 14.032  -24.773 -35.786 1.00 56.98  ? 219  PHE B CB  1 
ATOM   3497 C  CG  . PHE B 1 196 ? 12.668  -24.212 -35.645 1.00 57.10  ? 219  PHE B CG  1 
ATOM   3498 C  CD1 . PHE B 1 196 ? 11.621  -24.693 -36.426 1.00 58.34  ? 219  PHE B CD1 1 
ATOM   3499 C  CD2 . PHE B 1 196 ? 12.409  -23.213 -34.730 1.00 62.26  ? 219  PHE B CD2 1 
ATOM   3500 C  CE1 . PHE B 1 196 ? 10.337  -24.187 -36.310 1.00 56.57  ? 219  PHE B CE1 1 
ATOM   3501 C  CE2 . PHE B 1 196 ? 11.127  -22.700 -34.606 1.00 64.08  ? 219  PHE B CE2 1 
ATOM   3502 C  CZ  . PHE B 1 196 ? 10.088  -23.194 -35.392 1.00 60.42  ? 219  PHE B CZ  1 
ATOM   3503 N  N   . GLY B 1 197 ? 15.243  -27.607 -36.842 1.00 65.12  ? 220  GLY B N   1 
ATOM   3504 C  CA  . GLY B 1 197 ? 16.300  -28.448 -37.364 1.00 69.79  ? 220  GLY B CA  1 
ATOM   3505 C  C   . GLY B 1 197 ? 16.592  -29.732 -36.586 1.00 66.40  ? 220  GLY B C   1 
ATOM   3506 O  O   . GLY B 1 197 ? 17.605  -30.380 -36.853 1.00 65.93  ? 220  GLY B O   1 
ATOM   3507 N  N   . GLU B 1 198 ? 15.757  -30.121 -35.624 1.00 62.19  ? 221  GLU B N   1 
ATOM   3508 C  CA  . GLU B 1 198 ? 16.039  -31.369 -34.915 1.00 63.31  ? 221  GLU B CA  1 
ATOM   3509 C  C   . GLU B 1 198 ? 15.074  -32.491 -35.282 1.00 61.14  ? 221  GLU B C   1 
ATOM   3510 O  O   . GLU B 1 198 ? 13.935  -32.264 -35.631 1.00 53.23  ? 221  GLU B O   1 
ATOM   3511 C  CB  . GLU B 1 198 ? 16.101  -31.178 -33.407 1.00 64.14  ? 221  GLU B CB  1 
ATOM   3512 C  CG  . GLU B 1 198 ? 16.920  -30.004 -32.916 1.00 67.52  ? 221  GLU B CG  1 
ATOM   3513 C  CD  . GLU B 1 198 ? 17.242  -30.138 -31.440 1.00 69.11  ? 221  GLU B CD  1 
ATOM   3514 O  OE1 . GLU B 1 198 ? 16.340  -30.380 -30.628 1.00 74.92  ? 221  GLU B OE1 1 
ATOM   3515 O  OE2 . GLU B 1 198 ? 18.397  -29.958 -31.066 1.00 73.12  ? 221  GLU B OE2 1 
ATOM   3516 N  N   . THR B 1 199 ? 15.598  -33.704 -35.271 1.00 64.56  ? 222  THR B N   1 
ATOM   3517 C  CA  . THR B 1 199 ? 14.817  -34.853 -35.601 1.00 67.81  ? 222  THR B CA  1 
ATOM   3518 C  C   . THR B 1 199 ? 14.090  -35.273 -34.363 1.00 64.76  ? 222  THR B C   1 
ATOM   3519 O  O   . THR B 1 199 ? 14.560  -35.085 -33.240 1.00 63.26  ? 222  THR B O   1 
ATOM   3520 C  CB  . THR B 1 199 ? 15.685  -36.058 -36.024 1.00 75.36  ? 222  THR B CB  1 
ATOM   3521 O  OG1 . THR B 1 199 ? 16.847  -36.139 -35.178 1.00 74.64  ? 222  THR B OG1 1 
ATOM   3522 C  CG2 . THR B 1 199 ? 16.099  -35.934 -37.476 1.00 73.95  ? 222  THR B CG2 1 
ATOM   3523 N  N   . LEU B 1 200 ? 12.961  -35.903 -34.583 1.00 62.40  ? 223  LEU B N   1 
ATOM   3524 C  CA  . LEU B 1 200 ? 12.225  -36.533 -33.513 1.00 63.66  ? 223  LEU B CA  1 
ATOM   3525 C  C   . LEU B 1 200 ? 12.961  -37.766 -32.975 1.00 63.78  ? 223  LEU B C   1 
ATOM   3526 O  O   . LEU B 1 200 ? 13.837  -38.311 -33.671 1.00 60.74  ? 223  LEU B O   1 
ATOM   3527 C  CB  . LEU B 1 200 ? 10.845  -36.889 -34.030 1.00 64.83  ? 223  LEU B CB  1 
ATOM   3528 C  CG  . LEU B 1 200 ? 9.806   -35.755 -34.037 1.00 65.58  ? 223  LEU B CG  1 
ATOM   3529 C  CD1 . LEU B 1 200 ? 10.347  -34.419 -34.502 1.00 65.32  ? 223  LEU B CD1 1 
ATOM   3530 C  CD2 . LEU B 1 200 ? 8.602   -36.135 -34.897 1.00 70.05  ? 223  LEU B CD2 1 
ATOM   3531 N  N   . ASP B 1 201 ? 12.599  -38.145 -31.730 1.00 65.16  ? 224  ASP B N   1 
ATOM   3532 C  CA  . ASP B 1 201 ? 13.133  -39.299 -30.955 1.00 67.29  ? 224  ASP B CA  1 
ATOM   3533 C  C   . ASP B 1 201 ? 12.520  -40.567 -31.534 1.00 66.14  ? 224  ASP B C   1 
ATOM   3534 O  O   . ASP B 1 201 ? 11.306  -40.649 -31.650 1.00 67.56  ? 224  ASP B O   1 
ATOM   3535 C  CB  . ASP B 1 201 ? 12.736  -39.164 -29.458 1.00 70.73  ? 224  ASP B CB  1 
ATOM   3536 C  CG  . ASP B 1 201 ? 13.483  -40.149 -28.515 1.00 78.08  ? 224  ASP B CG  1 
ATOM   3537 O  OD1 . ASP B 1 201 ? 14.715  -39.977 -28.337 1.00 83.41  ? 224  ASP B OD1 1 
ATOM   3538 O  OD2 . ASP B 1 201 ? 12.861  -41.053 -27.876 1.00 78.67  ? 224  ASP B OD2 1 
ATOM   3539 N  N   . SER B 1 202 ? 13.335  -41.542 -31.934 1.00 69.74  ? 225  SER B N   1 
ATOM   3540 C  CA  . SER B 1 202 ? 12.814  -42.719 -32.672 1.00 67.99  ? 225  SER B CA  1 
ATOM   3541 C  C   . SER B 1 202 ? 12.089  -43.690 -31.758 1.00 64.00  ? 225  SER B C   1 
ATOM   3542 O  O   . SER B 1 202 ? 11.110  -44.287 -32.180 1.00 64.57  ? 225  SER B O   1 
ATOM   3543 C  CB  . SER B 1 202 ? 13.899  -43.415 -33.465 1.00 67.81  ? 225  SER B CB  1 
ATOM   3544 O  OG  . SER B 1 202 ? 14.959  -43.762 -32.602 1.00 76.19  ? 225  SER B OG  1 
ATOM   3545 N  N   . ASP B 1 203 ? 12.531  -43.800 -30.510 1.00 63.17  ? 226  ASP B N   1 
ATOM   3546 C  CA  . ASP B 1 203 ? 11.797  -44.551 -29.488 1.00 70.58  ? 226  ASP B CA  1 
ATOM   3547 C  C   . ASP B 1 203 ? 10.319  -44.136 -29.461 1.00 72.89  ? 226  ASP B C   1 
ATOM   3548 O  O   . ASP B 1 203 ? 9.395   -44.972 -29.535 1.00 74.91  ? 226  ASP B O   1 
ATOM   3549 C  CB  . ASP B 1 203 ? 12.372  -44.299 -28.069 1.00 75.48  ? 226  ASP B CB  1 
ATOM   3550 C  CG  . ASP B 1 203 ? 13.855  -44.618 -27.949 1.00 73.29  ? 226  ASP B CG  1 
ATOM   3551 O  OD1 . ASP B 1 203 ? 14.229  -45.711 -28.428 1.00 65.28  ? 226  ASP B OD1 1 
ATOM   3552 O  OD2 . ASP B 1 203 ? 14.615  -43.775 -27.374 1.00 69.75  ? 226  ASP B OD2 1 
ATOM   3553 N  N   . ILE B 1 204 ? 10.103  -42.828 -29.344 1.00 70.07  ? 227  ILE B N   1 
ATOM   3554 C  CA  . ILE B 1 204 ? 8.750   -42.280 -29.305 1.00 64.09  ? 227  ILE B CA  1 
ATOM   3555 C  C   . ILE B 1 204 ? 8.008   -42.642 -30.597 1.00 65.30  ? 227  ILE B C   1 
ATOM   3556 O  O   . ILE B 1 204 ? 6.941   -43.233 -30.552 1.00 67.30  ? 227  ILE B O   1 
ATOM   3557 C  CB  . ILE B 1 204 ? 8.746   -40.762 -29.095 1.00 60.15  ? 227  ILE B CB  1 
ATOM   3558 C  CG1 . ILE B 1 204 ? 9.450   -40.407 -27.802 1.00 63.45  ? 227  ILE B CG1 1 
ATOM   3559 C  CG2 . ILE B 1 204 ? 7.340   -40.256 -28.953 1.00 59.36  ? 227  ILE B CG2 1 
ATOM   3560 C  CD1 . ILE B 1 204 ? 9.262   -38.975 -27.368 1.00 65.54  ? 227  ILE B CD1 1 
ATOM   3561 N  N   . LEU B 1 205 ? 8.579   -42.315 -31.749 1.00 65.14  ? 228  LEU B N   1 
ATOM   3562 C  CA  . LEU B 1 205 ? 7.918   -42.604 -33.023 1.00 64.40  ? 228  LEU B CA  1 
ATOM   3563 C  C   . LEU B 1 205 ? 7.535   -44.063 -33.219 1.00 67.14  ? 228  LEU B C   1 
ATOM   3564 O  O   . LEU B 1 205 ? 6.507   -44.350 -33.849 1.00 65.83  ? 228  LEU B O   1 
ATOM   3565 C  CB  . LEU B 1 205 ? 8.792   -42.169 -34.185 1.00 61.38  ? 228  LEU B CB  1 
ATOM   3566 C  CG  . LEU B 1 205 ? 8.917   -40.665 -34.379 1.00 62.43  ? 228  LEU B CG  1 
ATOM   3567 C  CD1 . LEU B 1 205 ? 9.967   -40.320 -35.423 1.00 65.72  ? 228  LEU B CD1 1 
ATOM   3568 C  CD2 . LEU B 1 205 ? 7.591   -40.052 -34.782 1.00 63.84  ? 228  LEU B CD2 1 
ATOM   3569 N  N   . THR B 1 206 ? 8.358   -44.976 -32.710 1.00 68.82  ? 229  THR B N   1 
ATOM   3570 C  CA  . THR B 1 206 ? 8.081   -46.398 -32.892 1.00 76.74  ? 229  THR B CA  1 
ATOM   3571 C  C   . THR B 1 206 ? 6.901   -46.783 -32.030 1.00 73.58  ? 229  THR B C   1 
ATOM   3572 O  O   . THR B 1 206 ? 6.098   -47.643 -32.415 1.00 86.75  ? 229  THR B O   1 
ATOM   3573 C  CB  . THR B 1 206 ? 9.299   -47.272 -32.601 1.00 80.85  ? 229  THR B CB  1 
ATOM   3574 O  OG1 . THR B 1 206 ? 10.064  -46.624 -31.590 1.00 90.75  ? 229  THR B OG1 1 
ATOM   3575 C  CG2 . THR B 1 206 ? 10.151  -47.453 -33.887 1.00 81.17  ? 229  THR B CG2 1 
ATOM   3576 N  N   . ALA B 1 207 ? 6.743   -46.094 -30.912 1.00 64.84  ? 230  ALA B N   1 
ATOM   3577 C  CA  . ALA B 1 207 ? 5.555   -46.272 -30.086 1.00 63.32  ? 230  ALA B CA  1 
ATOM   3578 C  C   . ALA B 1 207 ? 4.292   -45.771 -30.766 1.00 62.41  ? 230  ALA B C   1 
ATOM   3579 O  O   . ALA B 1 207 ? 3.247   -46.441 -30.804 1.00 59.36  ? 230  ALA B O   1 
ATOM   3580 C  CB  . ALA B 1 207 ? 5.732   -45.534 -28.782 1.00 63.61  ? 230  ALA B CB  1 
ATOM   3581 N  N   . VAL B 1 208 ? 4.399   -44.560 -31.280 1.00 63.64  ? 231  VAL B N   1 
ATOM   3582 C  CA  . VAL B 1 208 ? 3.261   -43.874 -31.842 1.00 63.93  ? 231  VAL B CA  1 
ATOM   3583 C  C   . VAL B 1 208 ? 2.771   -44.703 -33.015 1.00 66.61  ? 231  VAL B C   1 
ATOM   3584 O  O   . VAL B 1 208 ? 1.552   -44.862 -33.221 1.00 64.69  ? 231  VAL B O   1 
ATOM   3585 C  CB  . VAL B 1 208 ? 3.648   -42.458 -32.280 1.00 61.05  ? 231  VAL B CB  1 
ATOM   3586 C  CG1 . VAL B 1 208 ? 2.500   -41.767 -32.981 1.00 59.33  ? 231  VAL B CG1 1 
ATOM   3587 C  CG2 . VAL B 1 208 ? 4.051   -41.630 -31.074 1.00 61.04  ? 231  VAL B CG2 1 
ATOM   3588 N  N   . GLU B 1 209 ? 3.730   -45.255 -33.757 1.00 65.45  ? 232  GLU B N   1 
ATOM   3589 C  CA  . GLU B 1 209 ? 3.407   -46.159 -34.838 1.00 69.40  ? 232  GLU B CA  1 
ATOM   3590 C  C   . GLU B 1 209 ? 2.576   -47.321 -34.301 1.00 65.88  ? 232  GLU B C   1 
ATOM   3591 O  O   . GLU B 1 209 ? 1.471   -47.587 -34.788 1.00 59.90  ? 232  GLU B O   1 
ATOM   3592 C  CB  . GLU B 1 209 ? 4.682   -46.658 -35.531 1.00 76.89  ? 232  GLU B CB  1 
ATOM   3593 C  CG  . GLU B 1 209 ? 4.425   -47.459 -36.828 1.00 81.06  ? 232  GLU B CG  1 
ATOM   3594 C  CD  . GLU B 1 209 ? 5.687   -48.067 -37.451 1.00 76.02  ? 232  GLU B CD  1 
ATOM   3595 O  OE1 . GLU B 1 209 ? 6.795   -47.600 -37.144 1.00 76.30  ? 232  GLU B OE1 1 
ATOM   3596 O  OE2 . GLU B 1 209 ? 5.578   -48.990 -38.268 1.00 73.33  ? 232  GLU B OE2 1 
ATOM   3597 N  N   . ARG B 1 210 ? 3.101   -47.993 -33.284 1.00 65.47  ? 233  ARG B N   1 
ATOM   3598 C  CA  . ARG B 1 210 ? 2.385   -49.123 -32.697 1.00 69.43  ? 233  ARG B CA  1 
ATOM   3599 C  C   . ARG B 1 210 ? 0.965   -48.726 -32.384 1.00 67.92  ? 233  ARG B C   1 
ATOM   3600 O  O   . ARG B 1 210 ? 0.019   -49.449 -32.707 1.00 70.09  ? 233  ARG B O   1 
ATOM   3601 C  CB  . ARG B 1 210 ? 3.077   -49.645 -31.434 1.00 71.96  ? 233  ARG B CB  1 
ATOM   3602 C  CG  . ARG B 1 210 ? 4.134   -50.662 -31.772 1.00 78.96  ? 233  ARG B CG  1 
ATOM   3603 C  CD  . ARG B 1 210 ? 4.964   -51.005 -30.562 1.00 82.32  ? 233  ARG B CD  1 
ATOM   3604 N  NE  . ARG B 1 210 ? 6.044   -51.890 -30.963 1.00 84.43  ? 233  ARG B NE  1 
ATOM   3605 C  CZ  . ARG B 1 210 ? 7.121   -52.148 -30.234 1.00 82.83  ? 233  ARG B CZ  1 
ATOM   3606 N  NH1 . ARG B 1 210 ? 7.294   -51.591 -29.042 1.00 83.99  ? 233  ARG B NH1 1 
ATOM   3607 N  NH2 . ARG B 1 210 ? 8.036   -52.970 -30.712 1.00 82.03  ? 233  ARG B NH2 1 
ATOM   3608 N  N   . GLU B 1 211 ? 0.822   -47.544 -31.793 1.00 62.27  ? 234  GLU B N   1 
ATOM   3609 C  CA  . GLU B 1 211 ? -0.481  -47.067 -31.369 1.00 57.78  ? 234  GLU B CA  1 
ATOM   3610 C  C   . GLU B 1 211 ? -1.394  -46.778 -32.544 1.00 61.75  ? 234  GLU B C   1 
ATOM   3611 O  O   . GLU B 1 211 ? -2.595  -47.037 -32.487 1.00 63.51  ? 234  GLU B O   1 
ATOM   3612 C  CB  . GLU B 1 211 ? -0.329  -45.834 -30.530 1.00 52.05  ? 234  GLU B CB  1 
ATOM   3613 C  CG  . GLU B 1 211 ? 0.488   -46.109 -29.310 1.00 49.62  ? 234  GLU B CG  1 
ATOM   3614 C  CD  . GLU B 1 211 ? -0.358  -46.441 -28.124 1.00 49.61  ? 234  GLU B CD  1 
ATOM   3615 O  OE1 . GLU B 1 211 ? -1.419  -47.083 -28.266 1.00 50.17  ? 234  GLU B OE1 1 
ATOM   3616 O  OE2 . GLU B 1 211 ? 0.072   -46.060 -27.025 1.00 50.60  ? 234  GLU B OE2 1 
ATOM   3617 N  N   . LEU B 1 212 ? -0.854  -46.233 -33.614 1.00 60.99  ? 235  LEU B N   1 
ATOM   3618 C  CA  . LEU B 1 212 ? -1.709  -45.930 -34.734 1.00 63.03  ? 235  LEU B CA  1 
ATOM   3619 C  C   . LEU B 1 212 ? -2.047  -47.173 -35.535 1.00 64.49  ? 235  LEU B C   1 
ATOM   3620 O  O   . LEU B 1 212 ? -3.033  -47.192 -36.265 1.00 62.25  ? 235  LEU B O   1 
ATOM   3621 C  CB  . LEU B 1 212 ? -1.037  -44.899 -35.597 1.00 62.30  ? 235  LEU B CB  1 
ATOM   3622 C  CG  . LEU B 1 212 ? -0.873  -43.556 -34.896 1.00 60.17  ? 235  LEU B CG  1 
ATOM   3623 C  CD1 . LEU B 1 212 ? 0.127   -42.734 -35.663 1.00 59.62  ? 235  LEU B CD1 1 
ATOM   3624 C  CD2 . LEU B 1 212 ? -2.193  -42.809 -34.810 1.00 62.49  ? 235  LEU B CD2 1 
ATOM   3625 N  N   . GLU B 1 213 ? -1.213  -48.195 -35.408 1.00 70.72  ? 236  GLU B N   1 
ATOM   3626 C  CA  . GLU B 1 213 ? -1.498  -49.505 -35.976 1.00 75.16  ? 236  GLU B CA  1 
ATOM   3627 C  C   . GLU B 1 213 ? -2.742  -50.048 -35.350 1.00 75.33  ? 236  GLU B C   1 
ATOM   3628 O  O   . GLU B 1 213 ? -3.565  -50.653 -36.037 1.00 78.69  ? 236  GLU B O   1 
ATOM   3629 C  CB  . GLU B 1 213 ? -0.398  -50.515 -35.621 1.00 79.22  ? 236  GLU B CB  1 
ATOM   3630 C  CG  . GLU B 1 213 ? 0.701   -50.704 -36.646 1.00 86.30  ? 236  GLU B CG  1 
ATOM   3631 C  CD  . GLU B 1 213 ? 1.884   -51.509 -36.110 1.00 90.80  ? 236  GLU B CD  1 
ATOM   3632 O  OE1 . GLU B 1 213 ? 1.787   -52.101 -34.998 1.00 84.20  ? 236  GLU B OE1 1 
ATOM   3633 O  OE2 . GLU B 1 213 ? 2.924   -51.530 -36.817 1.00 89.01  ? 236  GLU B OE2 1 
ATOM   3634 N  N   . LYS B 1 214 ? -2.848  -49.871 -34.032 1.00 74.37  ? 237  LYS B N   1 
ATOM   3635 C  CA  . LYS B 1 214 ? -3.943  -50.460 -33.252 1.00 76.21  ? 237  LYS B CA  1 
ATOM   3636 C  C   . LYS B 1 214 ? -5.246  -49.646 -33.300 1.00 70.73  ? 237  LYS B C   1 
ATOM   3637 O  O   . LYS B 1 214 ? -6.268  -50.131 -32.886 1.00 69.07  ? 237  LYS B O   1 
ATOM   3638 C  CB  . LYS B 1 214 ? -3.547  -50.688 -31.765 1.00 81.34  ? 237  LYS B CB  1 
ATOM   3639 C  CG  . LYS B 1 214 ? -2.303  -51.525 -31.503 1.00 91.79  ? 237  LYS B CG  1 
ATOM   3640 C  CD  . LYS B 1 214 ? -1.863  -51.432 -30.056 1.00 99.54  ? 237  LYS B CD  1 
ATOM   3641 C  CE  . LYS B 1 214 ? -0.497  -52.097 -29.942 1.00 104.50 ? 237  LYS B CE  1 
ATOM   3642 N  NZ  . LYS B 1 214 ? -0.041  -52.202 -28.538 1.00 101.18 ? 237  LYS B NZ  1 
ATOM   3643 N  N   . CYS B 1 215 ? -5.235  -48.420 -33.793 1.00 68.67  ? 238  CYS B N   1 
ATOM   3644 C  CA  . CYS B 1 215 ? -6.360  -47.558 -33.503 1.00 67.73  ? 238  CYS B CA  1 
ATOM   3645 C  C   . CYS B 1 215 ? -7.432  -47.798 -34.515 1.00 63.36  ? 238  CYS B C   1 
ATOM   3646 O  O   . CYS B 1 215 ? -7.141  -48.082 -35.658 1.00 57.44  ? 238  CYS B O   1 
ATOM   3647 C  CB  . CYS B 1 215 ? -5.943  -46.072 -33.411 1.00 70.47  ? 238  CYS B CB  1 
ATOM   3648 S  SG  . CYS B 1 215 ? -5.968  -45.083 -34.920 1.00 72.34  ? 238  CYS B SG  1 
ATOM   3649 N  N   . ASP B 1 216 ? -8.675  -47.670 -34.086 1.00 65.60  ? 239  ASP B N   1 
ATOM   3650 C  CA  . ASP B 1 216 ? -9.798  -47.780 -35.010 1.00 70.45  ? 239  ASP B CA  1 
ATOM   3651 C  C   . ASP B 1 216 ? -10.604 -46.476 -35.159 1.00 68.16  ? 239  ASP B C   1 
ATOM   3652 O  O   . ASP B 1 216 ? -11.706 -46.468 -35.727 1.00 67.66  ? 239  ASP B O   1 
ATOM   3653 C  CB  . ASP B 1 216 ? -10.701 -48.952 -34.605 1.00 79.04  ? 239  ASP B CB  1 
ATOM   3654 C  CG  . ASP B 1 216 ? -11.147 -48.895 -33.145 1.00 78.59  ? 239  ASP B CG  1 
ATOM   3655 O  OD1 . ASP B 1 216 ? -10.969 -47.846 -32.498 1.00 81.06  ? 239  ASP B OD1 1 
ATOM   3656 O  OD2 . ASP B 1 216 ? -11.688 -49.910 -32.653 1.00 79.21  ? 239  ASP B OD2 1 
ATOM   3657 N  N   . LEU B 1 217 ? -10.031 -45.381 -34.667 1.00 63.56  ? 240  LEU B N   1 
ATOM   3658 C  CA  . LEU B 1 217 ? -10.578 -44.037 -34.853 1.00 59.78  ? 240  LEU B CA  1 
ATOM   3659 C  C   . LEU B 1 217 ? -9.513  -43.021 -34.516 1.00 59.77  ? 240  LEU B C   1 
ATOM   3660 O  O   . LEU B 1 217 ? -8.740  -43.238 -33.577 1.00 64.89  ? 240  LEU B O   1 
ATOM   3661 C  CB  . LEU B 1 217 ? -11.720 -43.816 -33.903 1.00 58.17  ? 240  LEU B CB  1 
ATOM   3662 C  CG  . LEU B 1 217 ? -12.400 -42.452 -33.934 1.00 56.30  ? 240  LEU B CG  1 
ATOM   3663 C  CD1 . LEU B 1 217 ? -12.934 -42.094 -35.309 1.00 54.53  ? 240  LEU B CD1 1 
ATOM   3664 C  CD2 . LEU B 1 217 ? -13.531 -42.477 -32.922 1.00 57.12  ? 240  LEU B CD2 1 
ATOM   3665 N  N   . CYS B 1 218 ? -9.466  -41.924 -35.268 1.00 57.19  ? 241  CYS B N   1 
ATOM   3666 C  CA  . CYS B 1 218 ? -8.422  -40.938 -35.106 1.00 57.73  ? 241  CYS B CA  1 
ATOM   3667 C  C   . CYS B 1 218 ? -8.998  -39.544 -35.142 1.00 54.74  ? 241  CYS B C   1 
ATOM   3668 O  O   . CYS B 1 218 ? -9.674  -39.189 -36.086 1.00 55.26  ? 241  CYS B O   1 
ATOM   3669 C  CB  . CYS B 1 218 ? -7.397  -41.085 -36.238 1.00 59.32  ? 241  CYS B CB  1 
ATOM   3670 S  SG  . CYS B 1 218 ? -6.166  -39.760 -36.280 1.00 59.99  ? 241  CYS B SG  1 
ATOM   3671 N  N   . LEU B 1 219 ? -8.714  -38.752 -34.122 1.00 53.17  ? 242  LEU B N   1 
ATOM   3672 C  CA  . LEU B 1 219 ? -9.096  -37.336 -34.126 1.00 54.25  ? 242  LEU B CA  1 
ATOM   3673 C  C   . LEU B 1 219 ? -7.895  -36.435 -34.308 1.00 53.42  ? 242  LEU B C   1 
ATOM   3674 O  O   . LEU B 1 219 ? -6.781  -36.774 -33.890 1.00 57.08  ? 242  LEU B O   1 
ATOM   3675 C  CB  . LEU B 1 219 ? -9.763  -36.955 -32.813 1.00 56.13  ? 242  LEU B CB  1 
ATOM   3676 C  CG  . LEU B 1 219 ? -11.219 -37.415 -32.654 1.00 57.03  ? 242  LEU B CG  1 
ATOM   3677 C  CD1 . LEU B 1 219 ? -11.507 -38.743 -33.332 1.00 57.22  ? 242  LEU B CD1 1 
ATOM   3678 C  CD2 . LEU B 1 219 ? -11.564 -37.506 -31.181 1.00 56.39  ? 242  LEU B CD2 1 
ATOM   3679 N  N   . VAL B 1 220 ? -8.129  -35.308 -34.960 1.00 48.08  ? 243  VAL B N   1 
ATOM   3680 C  CA  . VAL B 1 220 ? -7.095  -34.350 -35.222 1.00 45.42  ? 243  VAL B CA  1 
ATOM   3681 C  C   . VAL B 1 220 ? -7.689  -33.083 -34.711 1.00 43.58  ? 243  VAL B C   1 
ATOM   3682 O  O   . VAL B 1 220 ? -8.765  -32.707 -35.129 1.00 41.66  ? 243  VAL B O   1 
ATOM   3683 C  CB  . VAL B 1 220 ? -6.813  -34.214 -36.722 1.00 46.08  ? 243  VAL B CB  1 
ATOM   3684 C  CG1 . VAL B 1 220 ? -5.931  -33.000 -36.992 1.00 47.04  ? 243  VAL B CG1 1 
ATOM   3685 C  CG2 . VAL B 1 220 ? -6.143  -35.481 -37.232 1.00 47.54  ? 243  VAL B CG2 1 
ATOM   3686 N  N   . VAL B 1 221 ? -6.978  -32.427 -33.812 1.00 41.51  ? 244  VAL B N   1 
ATOM   3687 C  CA  . VAL B 1 221 ? -7.562  -31.392 -33.047 1.00 40.30  ? 244  VAL B CA  1 
ATOM   3688 C  C   . VAL B 1 221 ? -6.614  -30.217 -32.978 1.00 40.81  ? 244  VAL B C   1 
ATOM   3689 O  O   . VAL B 1 221 ? -5.529  -30.311 -32.443 1.00 38.41  ? 244  VAL B O   1 
ATOM   3690 C  CB  . VAL B 1 221 ? -7.846  -31.919 -31.635 1.00 40.85  ? 244  VAL B CB  1 
ATOM   3691 C  CG1 . VAL B 1 221 ? -8.407  -30.834 -30.736 1.00 42.90  ? 244  VAL B CG1 1 
ATOM   3692 C  CG2 . VAL B 1 221 ? -8.851  -33.036 -31.699 1.00 41.23  ? 244  VAL B CG2 1 
ATOM   3693 N  N   . GLY B 1 222 ? -7.075  -29.072 -33.454 1.00 44.65  ? 245  GLY B N   1 
ATOM   3694 C  CA  . GLY B 1 222 ? -6.317  -27.825 -33.338 1.00 45.54  ? 245  GLY B CA  1 
ATOM   3695 C  C   . GLY B 1 222 ? -5.224  -27.780 -34.343 1.00 46.17  ? 245  GLY B C   1 
ATOM   3696 O  O   . GLY B 1 222 ? -4.232  -27.134 -34.112 1.00 48.52  ? 245  GLY B O   1 
ATOM   3697 N  N   . THR B 1 223 ? -5.424  -28.491 -35.455 1.00 49.57  ? 246  THR B N   1 
ATOM   3698 C  CA  . THR B 1 223 ? -4.515  -28.539 -36.593 1.00 49.99  ? 246  THR B CA  1 
ATOM   3699 C  C   . THR B 1 223 ? -5.234  -29.387 -37.623 1.00 51.35  ? 246  THR B C   1 
ATOM   3700 O  O   . THR B 1 223 ? -6.366  -29.785 -37.420 1.00 53.47  ? 246  THR B O   1 
ATOM   3701 C  CB  . THR B 1 223 ? -3.173  -29.182 -36.235 1.00 51.07  ? 246  THR B CB  1 
ATOM   3702 O  OG1 . THR B 1 223 ? -2.430  -29.445 -37.422 1.00 54.84  ? 246  THR B OG1 1 
ATOM   3703 C  CG2 . THR B 1 223 ? -3.370  -30.504 -35.521 1.00 53.26  ? 246  THR B CG2 1 
ATOM   3704 N  N   . SER B 1 224 ? -4.568  -29.680 -38.721 1.00 54.40  ? 247  SER B N   1 
ATOM   3705 C  CA  . SER B 1 224 ? -5.194  -30.309 -39.865 1.00 55.59  ? 247  SER B CA  1 
ATOM   3706 C  C   . SER B 1 224 ? -4.399  -31.530 -40.260 1.00 54.72  ? 247  SER B C   1 
ATOM   3707 O  O   . SER B 1 224 ? -3.185  -31.512 -40.175 1.00 55.54  ? 247  SER B O   1 
ATOM   3708 C  CB  . SER B 1 224 ? -5.187  -29.316 -41.008 1.00 56.92  ? 247  SER B CB  1 
ATOM   3709 O  OG  . SER B 1 224 ? -5.776  -29.884 -42.133 1.00 60.12  ? 247  SER B OG  1 
ATOM   3710 N  N   . SER B 1 225 ? -5.086  -32.573 -40.724 1.00 57.39  ? 248  SER B N   1 
ATOM   3711 C  CA  . SER B 1 225 ? -4.438  -33.794 -41.230 1.00 58.83  ? 248  SER B CA  1 
ATOM   3712 C  C   . SER B 1 225 ? -3.417  -33.534 -42.295 1.00 59.31  ? 248  SER B C   1 
ATOM   3713 O  O   . SER B 1 225 ? -2.581  -34.388 -42.522 1.00 57.75  ? 248  SER B O   1 
ATOM   3714 C  CB  . SER B 1 225 ? -5.444  -34.738 -41.888 1.00 63.55  ? 248  SER B CB  1 
ATOM   3715 O  OG  . SER B 1 225 ? -6.328  -35.306 -40.959 1.00 71.77  ? 248  SER B OG  1 
ATOM   3716 N  N   . ILE B 1 226 ? -3.505  -32.386 -42.979 1.00 60.46  ? 249  ILE B N   1 
ATOM   3717 C  CA  . ILE B 1 226 ? -2.709  -32.170 -44.197 1.00 58.57  ? 249  ILE B CA  1 
ATOM   3718 C  C   . ILE B 1 226 ? -1.426  -31.405 -43.923 1.00 55.99  ? 249  ILE B C   1 
ATOM   3719 O  O   . ILE B 1 226 ? -0.601  -31.307 -44.800 1.00 53.27  ? 249  ILE B O   1 
ATOM   3720 C  CB  . ILE B 1 226 ? -3.488  -31.447 -45.320 1.00 61.93  ? 249  ILE B CB  1 
ATOM   3721 C  CG1 . ILE B 1 226 ? -4.067  -30.130 -44.823 1.00 66.32  ? 249  ILE B CG1 1 
ATOM   3722 C  CG2 . ILE B 1 226 ? -4.592  -32.326 -45.878 1.00 62.16  ? 249  ILE B CG2 1 
ATOM   3723 C  CD1 . ILE B 1 226 ? -4.270  -29.112 -45.922 1.00 69.87  ? 249  ILE B CD1 1 
ATOM   3724 N  N   . VAL B 1 227 ? -1.259  -30.868 -42.716 1.00 58.85  ? 250  VAL B N   1 
ATOM   3725 C  CA  . VAL B 1 227 ? -0.085  -30.046 -42.393 1.00 60.15  ? 250  VAL B CA  1 
ATOM   3726 C  C   . VAL B 1 227 ? 0.883   -30.783 -41.483 1.00 58.26  ? 250  VAL B C   1 
ATOM   3727 O  O   . VAL B 1 227 ? 0.469   -31.600 -40.680 1.00 50.85  ? 250  VAL B O   1 
ATOM   3728 C  CB  . VAL B 1 227 ? -0.499  -28.724 -41.730 1.00 61.29  ? 250  VAL B CB  1 
ATOM   3729 C  CG1 . VAL B 1 227 ? 0.593   -27.674 -41.896 1.00 63.68  ? 250  VAL B CG1 1 
ATOM   3730 C  CG2 . VAL B 1 227 ? -1.768  -28.206 -42.366 1.00 64.76  ? 250  VAL B CG2 1 
ATOM   3731 N  N   . TYR B 1 228 ? 2.177   -30.488 -41.643 1.00 65.67  ? 251  TYR B N   1 
ATOM   3732 C  CA  . TYR B 1 228 ? 3.267   -31.116 -40.869 1.00 70.84  ? 251  TYR B CA  1 
ATOM   3733 C  C   . TYR B 1 228 ? 3.201   -30.453 -39.531 1.00 70.27  ? 251  TYR B C   1 
ATOM   3734 O  O   . TYR B 1 228 ? 3.098   -29.241 -39.465 1.00 73.26  ? 251  TYR B O   1 
ATOM   3735 C  CB  . TYR B 1 228 ? 4.626   -30.866 -41.534 1.00 73.91  ? 251  TYR B CB  1 
ATOM   3736 C  CG  . TYR B 1 228 ? 5.869   -31.366 -40.808 1.00 81.77  ? 251  TYR B CG  1 
ATOM   3737 C  CD1 . TYR B 1 228 ? 6.374   -32.634 -41.041 1.00 88.12  ? 251  TYR B CD1 1 
ATOM   3738 C  CD2 . TYR B 1 228 ? 6.592   -30.536 -39.944 1.00 90.03  ? 251  TYR B CD2 1 
ATOM   3739 C  CE1 . TYR B 1 228 ? 7.543   -33.076 -40.411 1.00 90.28  ? 251  TYR B CE1 1 
ATOM   3740 C  CE2 . TYR B 1 228 ? 7.758   -30.968 -39.307 1.00 91.58  ? 251  TYR B CE2 1 
ATOM   3741 C  CZ  . TYR B 1 228 ? 8.236   -32.245 -39.547 1.00 91.68  ? 251  TYR B CZ  1 
ATOM   3742 O  OH  . TYR B 1 228 ? 9.391   -32.709 -38.932 1.00 84.55  ? 251  TYR B OH  1 
ATOM   3743 N  N   . PRO B 1 229 ? 3.245   -31.211 -38.453 1.00 74.12  ? 252  PRO B N   1 
ATOM   3744 C  CA  . PRO B 1 229 ? 3.561   -32.625 -38.413 1.00 73.42  ? 252  PRO B CA  1 
ATOM   3745 C  C   . PRO B 1 229 ? 2.336   -33.587 -38.377 1.00 68.03  ? 252  PRO B C   1 
ATOM   3746 O  O   . PRO B 1 229 ? 2.510   -34.789 -38.561 1.00 66.85  ? 252  PRO B O   1 
ATOM   3747 C  CB  . PRO B 1 229 ? 4.314   -32.719 -37.097 1.00 77.19  ? 252  PRO B CB  1 
ATOM   3748 C  CG  . PRO B 1 229 ? 3.535   -31.786 -36.221 1.00 81.05  ? 252  PRO B CG  1 
ATOM   3749 C  CD  . PRO B 1 229 ? 3.016   -30.676 -37.105 1.00 79.47  ? 252  PRO B CD  1 
ATOM   3750 N  N   . ALA B 1 230 ? 1.129   -33.087 -38.143 1.00 58.68  ? 253  ALA B N   1 
ATOM   3751 C  CA  . ALA B 1 230 ? -0.048  -33.936 -38.183 1.00 56.63  ? 253  ALA B CA  1 
ATOM   3752 C  C   . ALA B 1 230 ? -0.083  -34.865 -39.416 1.00 57.91  ? 253  ALA B C   1 
ATOM   3753 O  O   . ALA B 1 230 ? -0.553  -36.009 -39.351 1.00 58.50  ? 253  ALA B O   1 
ATOM   3754 C  CB  . ALA B 1 230 ? -1.296  -33.073 -38.151 1.00 58.66  ? 253  ALA B CB  1 
ATOM   3755 N  N   . ALA B 1 231 ? 0.422   -34.372 -40.545 1.00 57.66  ? 254  ALA B N   1 
ATOM   3756 C  CA  . ALA B 1 231 ? 0.424   -35.134 -41.803 1.00 53.96  ? 254  ALA B CA  1 
ATOM   3757 C  C   . ALA B 1 231 ? 1.108   -36.474 -41.691 1.00 54.44  ? 254  ALA B C   1 
ATOM   3758 O  O   . ALA B 1 231 ? 0.756   -37.417 -42.395 1.00 59.46  ? 254  ALA B O   1 
ATOM   3759 C  CB  . ALA B 1 231 ? 1.053   -34.323 -42.914 1.00 50.53  ? 254  ALA B CB  1 
ATOM   3760 N  N   . MET B 1 232 ? 2.075   -36.573 -40.792 1.00 57.20  ? 255  MET B N   1 
ATOM   3761 C  CA  . MET B 1 232 ? 2.780   -37.831 -40.576 1.00 61.71  ? 255  MET B CA  1 
ATOM   3762 C  C   . MET B 1 232 ? 1.925   -38.988 -40.109 1.00 59.90  ? 255  MET B C   1 
ATOM   3763 O  O   . MET B 1 232 ? 2.307   -40.146 -40.263 1.00 60.63  ? 255  MET B O   1 
ATOM   3764 C  CB  . MET B 1 232 ? 3.859   -37.650 -39.532 1.00 64.94  ? 255  MET B CB  1 
ATOM   3765 C  CG  . MET B 1 232 ? 5.134   -37.014 -40.052 1.00 69.14  ? 255  MET B CG  1 
ATOM   3766 S  SD  . MET B 1 232 ? 6.462   -37.206 -38.846 1.00 66.07  ? 255  MET B SD  1 
ATOM   3767 C  CE  . MET B 1 232 ? 6.186   -35.734 -37.876 1.00 71.74  ? 255  MET B CE  1 
ATOM   3768 N  N   . PHE B 1 233 ? 0.777   -38.680 -39.542 1.00 57.44  ? 256  PHE B N   1 
ATOM   3769 C  CA  . PHE B 1 233 ? 0.026   -39.677 -38.827 1.00 58.40  ? 256  PHE B CA  1 
ATOM   3770 C  C   . PHE B 1 233 ? -1.317  -39.957 -39.482 1.00 61.41  ? 256  PHE B C   1 
ATOM   3771 O  O   . PHE B 1 233 ? -1.603  -41.080 -39.935 1.00 62.25  ? 256  PHE B O   1 
ATOM   3772 C  CB  . PHE B 1 233 ? -0.126  -39.171 -37.404 1.00 55.28  ? 256  PHE B CB  1 
ATOM   3773 C  CG  . PHE B 1 233 ? 1.183   -38.855 -36.748 1.00 54.52  ? 256  PHE B CG  1 
ATOM   3774 C  CD1 . PHE B 1 233 ? 2.121   -39.859 -36.542 1.00 57.76  ? 256  PHE B CD1 1 
ATOM   3775 C  CD2 . PHE B 1 233 ? 1.501   -37.564 -36.348 1.00 57.40  ? 256  PHE B CD2 1 
ATOM   3776 C  CE1 . PHE B 1 233 ? 3.349   -39.601 -35.935 1.00 58.59  ? 256  PHE B CE1 1 
ATOM   3777 C  CE2 . PHE B 1 233 ? 2.730   -37.279 -35.733 1.00 60.26  ? 256  PHE B CE2 1 
ATOM   3778 C  CZ  . PHE B 1 233 ? 3.662   -38.303 -35.527 1.00 61.07  ? 256  PHE B CZ  1 
ATOM   3779 N  N   . ALA B 1 234 ? -2.136  -38.919 -39.555 1.00 64.35  ? 257  ALA B N   1 
ATOM   3780 C  CA  . ALA B 1 234 ? -3.531  -39.106 -39.935 1.00 62.55  ? 257  ALA B CA  1 
ATOM   3781 C  C   . ALA B 1 234 ? -3.689  -39.780 -41.327 1.00 59.54  ? 257  ALA B C   1 
ATOM   3782 O  O   . ALA B 1 234 ? -4.457  -40.729 -41.467 1.00 60.38  ? 257  ALA B O   1 
ATOM   3783 C  CB  . ALA B 1 234 ? -4.300  -37.786 -39.797 1.00 59.27  ? 257  ALA B CB  1 
ATOM   3784 N  N   . PRO B 1 235 ? -2.947  -39.317 -42.346 1.00 58.42  ? 258  PRO B N   1 
ATOM   3785 C  CA  . PRO B 1 235 ? -2.845  -40.070 -43.586 1.00 59.96  ? 258  PRO B CA  1 
ATOM   3786 C  C   . PRO B 1 235 ? -2.533  -41.593 -43.440 1.00 63.94  ? 258  PRO B C   1 
ATOM   3787 O  O   . PRO B 1 235 ? -3.219  -42.403 -44.054 1.00 66.88  ? 258  PRO B O   1 
ATOM   3788 C  CB  . PRO B 1 235 ? -1.723  -39.333 -44.309 1.00 58.33  ? 258  PRO B CB  1 
ATOM   3789 C  CG  . PRO B 1 235 ? -1.962  -37.919 -43.942 1.00 54.96  ? 258  PRO B CG  1 
ATOM   3790 C  CD  . PRO B 1 235 ? -2.418  -37.952 -42.514 1.00 56.79  ? 258  PRO B CD  1 
ATOM   3791 N  N   . GLN B 1 236 ? -1.491  -41.980 -42.697 1.00 67.86  ? 259  GLN B N   1 
ATOM   3792 C  CA  . GLN B 1 236 ? -1.176  -43.424 -42.474 1.00 69.89  ? 259  GLN B CA  1 
ATOM   3793 C  C   . GLN B 1 236 ? -2.363  -44.208 -42.013 1.00 69.40  ? 259  GLN B C   1 
ATOM   3794 O  O   . GLN B 1 236 ? -2.540  -45.353 -42.375 1.00 73.36  ? 259  GLN B O   1 
ATOM   3795 C  CB  . GLN B 1 236 ? -0.091  -43.667 -41.407 1.00 76.10  ? 259  GLN B CB  1 
ATOM   3796 C  CG  . GLN B 1 236 ? 1.279   -43.052 -41.743 1.00 82.37  ? 259  GLN B CG  1 
ATOM   3797 C  CD  . GLN B 1 236 ? 2.389   -44.053 -42.067 1.00 84.61  ? 259  GLN B CD  1 
ATOM   3798 O  OE1 . GLN B 1 236 ? 2.205   -45.270 -42.044 1.00 93.57  ? 259  GLN B OE1 1 
ATOM   3799 N  NE2 . GLN B 1 236 ? 3.567   -43.521 -42.363 1.00 82.35  ? 259  GLN B NE2 1 
ATOM   3800 N  N   . VAL B 1 237 ? -3.146  -43.604 -41.147 1.00 69.30  ? 260  VAL B N   1 
ATOM   3801 C  CA  . VAL B 1 237 ? -4.323  -44.264 -40.636 1.00 63.94  ? 260  VAL B CA  1 
ATOM   3802 C  C   . VAL B 1 237 ? -5.478  -44.229 -41.608 1.00 55.54  ? 260  VAL B C   1 
ATOM   3803 O  O   . VAL B 1 237 ? -6.191  -45.188 -41.751 1.00 53.16  ? 260  VAL B O   1 
ATOM   3804 C  CB  . VAL B 1 237 ? -4.742  -43.553 -39.364 1.00 66.82  ? 260  VAL B CB  1 
ATOM   3805 C  CG1 . VAL B 1 237 ? -6.163  -43.903 -38.997 1.00 68.96  ? 260  VAL B CG1 1 
ATOM   3806 C  CG2 . VAL B 1 237 ? -3.775  -43.923 -38.259 1.00 71.54  ? 260  VAL B CG2 1 
ATOM   3807 N  N   . ALA B 1 238 ? -5.709  -43.081 -42.211 1.00 54.03  ? 261  ALA B N   1 
ATOM   3808 C  CA  . ALA B 1 238 ? -6.899  -42.874 -43.038 1.00 54.83  ? 261  ALA B CA  1 
ATOM   3809 C  C   . ALA B 1 238 ? -6.867  -43.795 -44.244 1.00 57.16  ? 261  ALA B C   1 
ATOM   3810 O  O   . ALA B 1 238 ? -7.851  -44.429 -44.622 1.00 54.03  ? 261  ALA B O   1 
ATOM   3811 C  CB  . ALA B 1 238 ? -6.996  -41.411 -43.461 1.00 52.55  ? 261  ALA B CB  1 
ATOM   3812 N  N   . SER B 1 239 ? -5.684  -43.873 -44.823 1.00 61.99  ? 262  SER B N   1 
ATOM   3813 C  CA  . SER B 1 239 ? -5.416  -44.758 -45.922 1.00 59.94  ? 262  SER B CA  1 
ATOM   3814 C  C   . SER B 1 239 ? -5.666  -46.226 -45.546 1.00 62.06  ? 262  SER B C   1 
ATOM   3815 O  O   . SER B 1 239 ? -5.928  -47.011 -46.433 1.00 69.51  ? 262  SER B O   1 
ATOM   3816 C  CB  . SER B 1 239 ? -3.972  -44.560 -46.325 1.00 56.18  ? 262  SER B CB  1 
ATOM   3817 O  OG  . SER B 1 239 ? -3.143  -44.764 -45.201 1.00 52.70  ? 262  SER B OG  1 
ATOM   3818 N  N   . ARG B 1 240 ? -5.561  -46.603 -44.261 1.00 61.32  ? 263  ARG B N   1 
ATOM   3819 C  CA  . ARG B 1 240 ? -6.002  -47.943 -43.804 1.00 60.94  ? 263  ARG B CA  1 
ATOM   3820 C  C   . ARG B 1 240 ? -7.507  -48.022 -43.778 1.00 59.23  ? 263  ARG B C   1 
ATOM   3821 O  O   . ARG B 1 240 ? -8.050  -49.073 -43.475 1.00 57.57  ? 263  ARG B O   1 
ATOM   3822 C  CB  . ARG B 1 240 ? -5.502  -48.338 -42.411 1.00 63.61  ? 263  ARG B CB  1 
ATOM   3823 C  CG  . ARG B 1 240 ? -4.027  -48.072 -42.157 1.00 71.08  ? 263  ARG B CG  1 
ATOM   3824 C  CD  . ARG B 1 240 ? -3.389  -49.032 -41.170 1.00 74.46  ? 263  ARG B CD  1 
ATOM   3825 N  NE  . ARG B 1 240 ? -3.716  -48.811 -39.753 1.00 73.46  ? 263  ARG B NE  1 
ATOM   3826 C  CZ  . ARG B 1 240 ? -4.775  -49.322 -39.120 1.00 74.79  ? 263  ARG B CZ  1 
ATOM   3827 N  NH1 . ARG B 1 240 ? -5.667  -50.059 -39.758 1.00 74.41  ? 263  ARG B NH1 1 
ATOM   3828 N  NH2 . ARG B 1 240 ? -4.953  -49.081 -37.827 1.00 77.63  ? 263  ARG B NH2 1 
ATOM   3829 N  N   . GLY B 1 241 ? -8.179  -46.920 -44.088 1.00 58.24  ? 264  GLY B N   1 
ATOM   3830 C  CA  . GLY B 1 241 ? -9.612  -46.869 -44.030 1.00 61.62  ? 264  GLY B CA  1 
ATOM   3831 C  C   . GLY B 1 241 ? -10.186 -46.643 -42.636 1.00 65.64  ? 264  GLY B C   1 
ATOM   3832 O  O   . GLY B 1 241 ? -11.363 -46.914 -42.403 1.00 74.38  ? 264  GLY B O   1 
ATOM   3833 N  N   . VAL B 1 242 ? -9.395  -46.122 -41.705 1.00 65.37  ? 265  VAL B N   1 
ATOM   3834 C  CA  . VAL B 1 242 ? -9.913  -45.762 -40.390 1.00 64.41  ? 265  VAL B CA  1 
ATOM   3835 C  C   . VAL B 1 242 ? -10.446 -44.321 -40.453 1.00 64.49  ? 265  VAL B C   1 
ATOM   3836 O  O   . VAL B 1 242 ? -9.821  -43.439 -41.044 1.00 57.33  ? 265  VAL B O   1 
ATOM   3837 C  CB  . VAL B 1 242 ? -8.811  -45.820 -39.326 1.00 68.06  ? 265  VAL B CB  1 
ATOM   3838 C  CG1 . VAL B 1 242 ? -9.372  -45.545 -37.935 1.00 68.36  ? 265  VAL B CG1 1 
ATOM   3839 C  CG2 . VAL B 1 242 ? -8.069  -47.159 -39.368 1.00 68.58  ? 265  VAL B CG2 1 
ATOM   3840 N  N   . PRO B 1 243 ? -11.599 -44.063 -39.829 1.00 66.16  ? 266  PRO B N   1 
ATOM   3841 C  CA  . PRO B 1 243 ? -12.166 -42.704 -39.895 1.00 64.99  ? 266  PRO B CA  1 
ATOM   3842 C  C   . PRO B 1 243 ? -11.323 -41.638 -39.186 1.00 63.54  ? 266  PRO B C   1 
ATOM   3843 O  O   . PRO B 1 243 ? -10.711 -41.886 -38.162 1.00 58.77  ? 266  PRO B O   1 
ATOM   3844 C  CB  . PRO B 1 243 ? -13.526 -42.835 -39.198 1.00 66.47  ? 266  PRO B CB  1 
ATOM   3845 C  CG  . PRO B 1 243 ? -13.732 -44.283 -38.956 1.00 70.63  ? 266  PRO B CG  1 
ATOM   3846 C  CD  . PRO B 1 243 ? -12.394 -44.962 -38.988 1.00 67.65  ? 266  PRO B CD  1 
ATOM   3847 N  N   . VAL B 1 244 ? -11.322 -40.443 -39.737 1.00 64.23  ? 267  VAL B N   1 
ATOM   3848 C  CA  . VAL B 1 244 ? -10.549 -39.370 -39.194 1.00 62.02  ? 267  VAL B CA  1 
ATOM   3849 C  C   . VAL B 1 244 ? -11.472 -38.186 -39.096 1.00 62.83  ? 267  VAL B C   1 
ATOM   3850 O  O   . VAL B 1 244 ? -12.210 -37.896 -40.034 1.00 65.43  ? 267  VAL B O   1 
ATOM   3851 C  CB  . VAL B 1 244 ? -9.373  -39.036 -40.127 1.00 63.70  ? 267  VAL B CB  1 
ATOM   3852 C  CG1 . VAL B 1 244 ? -8.877  -37.599 -39.924 1.00 64.94  ? 267  VAL B CG1 1 
ATOM   3853 C  CG2 . VAL B 1 244 ? -8.248  -40.038 -39.917 1.00 60.96  ? 267  VAL B CG2 1 
ATOM   3854 N  N   . ALA B 1 245 ? -11.386 -37.472 -37.979 1.00 64.56  ? 268  ALA B N   1 
ATOM   3855 C  CA  . ALA B 1 245 ? -12.309 -36.376 -37.665 1.00 62.71  ? 268  ALA B CA  1 
ATOM   3856 C  C   . ALA B 1 245 ? -11.540 -35.148 -37.259 1.00 59.20  ? 268  ALA B C   1 
ATOM   3857 O  O   . ALA B 1 245 ? -10.808 -35.197 -36.278 1.00 60.23  ? 268  ALA B O   1 
ATOM   3858 C  CB  . ALA B 1 245 ? -13.176 -36.808 -36.514 1.00 65.98  ? 268  ALA B CB  1 
ATOM   3859 N  N   . GLU B 1 246 ? -11.653 -34.058 -37.997 1.00 56.99  ? 269  GLU B N   1 
ATOM   3860 C  CA  . GLU B 1 246 ? -10.860 -32.903 -37.644 1.00 60.90  ? 269  GLU B CA  1 
ATOM   3861 C  C   . GLU B 1 246 ? -11.691 -31.982 -36.778 1.00 58.83  ? 269  GLU B C   1 
ATOM   3862 O  O   . GLU B 1 246 ? -12.893 -31.887 -36.961 1.00 58.58  ? 269  GLU B O   1 
ATOM   3863 C  CB  . GLU B 1 246 ? -10.366 -32.180 -38.888 1.00 70.59  ? 269  GLU B CB  1 
ATOM   3864 C  CG  . GLU B 1 246 ? -9.613  -33.061 -39.869 1.00 80.82  ? 269  GLU B CG  1 
ATOM   3865 C  CD  . GLU B 1 246 ? -8.819  -32.247 -40.879 1.00 89.07  ? 269  GLU B CD  1 
ATOM   3866 O  OE1 . GLU B 1 246 ? -9.067  -31.022 -40.981 1.00 99.20  ? 269  GLU B OE1 1 
ATOM   3867 O  OE2 . GLU B 1 246 ? -7.945  -32.819 -41.562 1.00 90.07  ? 269  GLU B OE2 1 
ATOM   3868 N  N   . PHE B 1 247 ? -11.042 -31.297 -35.841 1.00 56.23  ? 270  PHE B N   1 
ATOM   3869 C  CA  . PHE B 1 247 ? -11.671 -30.244 -35.066 1.00 57.56  ? 270  PHE B CA  1 
ATOM   3870 C  C   . PHE B 1 247 ? -10.699 -29.089 -35.031 1.00 60.49  ? 270  PHE B C   1 
ATOM   3871 O  O   . PHE B 1 247 ? -9.702  -29.125 -34.318 1.00 55.18  ? 270  PHE B O   1 
ATOM   3872 C  CB  . PHE B 1 247 ? -11.919 -30.707 -33.647 1.00 60.23  ? 270  PHE B CB  1 
ATOM   3873 C  CG  . PHE B 1 247 ? -12.873 -31.866 -33.534 1.00 58.45  ? 270  PHE B CG  1 
ATOM   3874 C  CD1 . PHE B 1 247 ? -12.497 -33.142 -33.915 1.00 54.67  ? 270  PHE B CD1 1 
ATOM   3875 C  CD2 . PHE B 1 247 ? -14.145 -31.679 -33.006 1.00 59.57  ? 270  PHE B CD2 1 
ATOM   3876 C  CE1 . PHE B 1 247 ? -13.370 -34.204 -33.789 1.00 54.58  ? 270  PHE B CE1 1 
ATOM   3877 C  CE2 . PHE B 1 247 ? -15.026 -32.738 -32.884 1.00 57.15  ? 270  PHE B CE2 1 
ATOM   3878 C  CZ  . PHE B 1 247 ? -14.640 -34.006 -33.274 1.00 55.14  ? 270  PHE B CZ  1 
ATOM   3879 N  N   . ASN B 1 248 ? -10.965 -28.074 -35.835 1.00 65.26  ? 271  ASN B N   1 
ATOM   3880 C  CA  . ASN B 1 248 ? -10.095 -26.916 -35.879 1.00 66.00  ? 271  ASN B CA  1 
ATOM   3881 C  C   . ASN B 1 248 ? -10.939 -25.767 -36.371 1.00 67.92  ? 271  ASN B C   1 
ATOM   3882 O  O   . ASN B 1 248 ? -12.139 -25.938 -36.605 1.00 64.52  ? 271  ASN B O   1 
ATOM   3883 C  CB  . ASN B 1 248 ? -8.863  -27.181 -36.755 1.00 68.17  ? 271  ASN B CB  1 
ATOM   3884 C  CG  . ASN B 1 248 ? -9.223  -27.564 -38.184 1.00 75.77  ? 271  ASN B CG  1 
ATOM   3885 O  OD1 . ASN B 1 248 ? -10.127 -26.984 -38.782 1.00 82.06  ? 271  ASN B OD1 1 
ATOM   3886 N  ND2 . ASN B 1 248 ? -8.503  -28.541 -38.745 1.00 78.01  ? 271  ASN B ND2 1 
ATOM   3887 N  N   . MET B 1 249 ? -10.331 -24.601 -36.510 1.00 72.47  ? 272  MET B N   1 
ATOM   3888 C  CA  . MET B 1 249 ? -11.048 -23.471 -37.040 1.00 80.35  ? 272  MET B CA  1 
ATOM   3889 C  C   . MET B 1 249 ? -10.206 -22.824 -38.128 1.00 92.31  ? 272  MET B C   1 
ATOM   3890 O  O   . MET B 1 249 ? -9.709  -21.725 -37.943 1.00 93.92  ? 272  MET B O   1 
ATOM   3891 C  CB  . MET B 1 249 ? -11.456 -22.502 -35.949 1.00 77.89  ? 272  MET B CB  1 
ATOM   3892 C  CG  . MET B 1 249 ? -10.396 -22.080 -34.981 1.00 74.75  ? 272  MET B CG  1 
ATOM   3893 S  SD  . MET B 1 249 ? -11.137 -20.925 -33.794 1.00 78.86  ? 272  MET B SD  1 
ATOM   3894 C  CE  . MET B 1 249 ? -12.662 -20.332 -34.566 1.00 77.12  ? 272  MET B CE  1 
ATOM   3895 N  N   . GLU B 1 250 ? -10.066 -23.530 -39.262 1.00 105.63 ? 273  GLU B N   1 
ATOM   3896 C  CA  . GLU B 1 250 ? -9.080  -23.200 -40.305 1.00 115.49 ? 273  GLU B CA  1 
ATOM   3897 C  C   . GLU B 1 250 ? -9.496  -23.267 -41.812 1.00 116.40 ? 273  GLU B C   1 
ATOM   3898 O  O   . GLU B 1 250 ? -8.682  -22.950 -42.703 1.00 101.50 ? 273  GLU B O   1 
ATOM   3899 C  CB  . GLU B 1 250 ? -7.859  -24.085 -40.031 1.00 119.25 ? 273  GLU B CB  1 
ATOM   3900 C  CG  . GLU B 1 250 ? -6.971  -23.540 -38.899 1.00 118.86 ? 273  GLU B CG  1 
ATOM   3901 C  CD  . GLU B 1 250 ? -5.984  -24.548 -38.322 1.00 116.48 ? 273  GLU B CD  1 
ATOM   3902 O  OE1 . GLU B 1 250 ? -5.530  -25.456 -39.055 1.00 114.92 ? 273  GLU B OE1 1 
ATOM   3903 O  OE2 . GLU B 1 250 ? -5.654  -24.414 -37.122 1.00 103.82 ? 273  GLU B OE2 1 
ATOM   3904 N  N   . CYS B 1 251 ? -10.743 -23.662 -42.082 1.00 120.91 ? 274  CYS B N   1 
ATOM   3905 C  CA  . CYS B 1 251 ? -11.363 -23.583 -43.420 1.00 118.22 ? 274  CYS B CA  1 
ATOM   3906 C  C   . CYS B 1 251 ? -10.625 -24.399 -44.489 1.00 105.95 ? 274  CYS B C   1 
ATOM   3907 O  O   . CYS B 1 251 ? -11.105 -25.439 -44.934 1.00 93.39  ? 274  CYS B O   1 
ATOM   3908 C  CB  . CYS B 1 251 ? -11.470 -22.094 -43.848 1.00 127.30 ? 274  CYS B CB  1 
ATOM   3909 S  SG  . CYS B 1 251 ? -11.939 -20.924 -42.541 1.00 128.97 ? 274  CYS B SG  1 
ATOM   3910 N  N   . PHE B 1 258 ? -10.837 -33.860 -43.754 1.00 102.72 ? 281  PHE B N   1 
ATOM   3911 C  CA  . PHE B 1 258 ? -10.950 -35.237 -44.261 1.00 110.92 ? 281  PHE B CA  1 
ATOM   3912 C  C   . PHE B 1 258 ? -12.367 -35.807 -44.042 1.00 105.01 ? 281  PHE B C   1 
ATOM   3913 O  O   . PHE B 1 258 ? -13.334 -35.056 -44.110 1.00 102.85 ? 281  PHE B O   1 
ATOM   3914 C  CB  . PHE B 1 258 ? -9.864  -36.110 -43.614 1.00 114.34 ? 281  PHE B CB  1 
ATOM   3915 C  CG  . PHE B 1 258 ? -8.590  -36.221 -44.421 1.00 115.28 ? 281  PHE B CG  1 
ATOM   3916 C  CD1 . PHE B 1 258 ? -8.223  -35.242 -45.360 1.00 112.73 ? 281  PHE B CD1 1 
ATOM   3917 C  CD2 . PHE B 1 258 ? -7.732  -37.299 -44.209 1.00 108.80 ? 281  PHE B CD2 1 
ATOM   3918 C  CE1 . PHE B 1 258 ? -7.046  -35.360 -46.077 1.00 107.87 ? 281  PHE B CE1 1 
ATOM   3919 C  CE2 . PHE B 1 258 ? -6.550  -37.415 -44.918 1.00 107.35 ? 281  PHE B CE2 1 
ATOM   3920 C  CZ  . PHE B 1 258 ? -6.208  -36.446 -45.850 1.00 110.26 ? 281  PHE B CZ  1 
ATOM   3921 N  N   . LYS B 1 259 ? -12.494 -37.109 -43.782 1.00 98.42  ? 282  LYS B N   1 
ATOM   3922 C  CA  . LYS B 1 259 ? -13.802 -37.783 -43.682 1.00 96.48  ? 282  LYS B CA  1 
ATOM   3923 C  C   . LYS B 1 259 ? -14.902 -36.973 -42.983 1.00 99.10  ? 282  LYS B C   1 
ATOM   3924 O  O   . LYS B 1 259 ? -15.949 -36.709 -43.599 1.00 97.85  ? 282  LYS B O   1 
ATOM   3925 C  CB  . LYS B 1 259 ? -13.622 -39.157 -43.034 1.00 94.30  ? 282  LYS B CB  1 
ATOM   3926 C  CG  . LYS B 1 259 ? -12.798 -40.053 -43.943 1.00 96.92  ? 282  LYS B CG  1 
ATOM   3927 C  CD  . LYS B 1 259 ? -11.655 -40.779 -43.263 1.00 95.70  ? 282  LYS B CD  1 
ATOM   3928 C  CE  . LYS B 1 259 ? -10.797 -41.455 -44.327 1.00 96.36  ? 282  LYS B CE  1 
ATOM   3929 N  NZ  . LYS B 1 259 ? -10.295 -42.788 -43.884 1.00 95.84  ? 282  LYS B NZ  1 
ATOM   3930 N  N   . TYR B 1 260 ? -14.673 -36.587 -41.714 1.00 97.23  ? 283  TYR B N   1 
ATOM   3931 C  CA  . TYR B 1 260 ? -15.485 -35.540 -41.026 1.00 83.70  ? 283  TYR B CA  1 
ATOM   3932 C  C   . TYR B 1 260 ? -14.653 -34.326 -40.655 1.00 73.37  ? 283  TYR B C   1 
ATOM   3933 O  O   . TYR B 1 260 ? -13.444 -34.410 -40.506 1.00 72.81  ? 283  TYR B O   1 
ATOM   3934 C  CB  . TYR B 1 260 ? -16.124 -36.038 -39.732 1.00 79.93  ? 283  TYR B CB  1 
ATOM   3935 C  CG  . TYR B 1 260 ? -16.674 -37.429 -39.788 1.00 79.48  ? 283  TYR B CG  1 
ATOM   3936 C  CD1 . TYR B 1 260 ? -17.986 -37.688 -40.171 1.00 77.20  ? 283  TYR B CD1 1 
ATOM   3937 C  CD2 . TYR B 1 260 ? -15.870 -38.495 -39.423 1.00 76.94  ? 283  TYR B CD2 1 
ATOM   3938 C  CE1 . TYR B 1 260 ? -18.458 -38.984 -40.197 1.00 74.48  ? 283  TYR B CE1 1 
ATOM   3939 C  CE2 . TYR B 1 260 ? -16.333 -39.781 -39.441 1.00 76.20  ? 283  TYR B CE2 1 
ATOM   3940 C  CZ  . TYR B 1 260 ? -17.621 -40.017 -39.821 1.00 75.60  ? 283  TYR B CZ  1 
ATOM   3941 O  OH  . TYR B 1 260 ? -18.032 -41.315 -39.811 1.00 80.40  ? 283  TYR B OH  1 
ATOM   3942 N  N   . HIS B 1 261 ? -15.330 -33.206 -40.470 1.00 68.13  ? 284  HIS B N   1 
ATOM   3943 C  CA  . HIS B 1 261 ? -14.690 -31.967 -40.053 1.00 63.41  ? 284  HIS B CA  1 
ATOM   3944 C  C   . HIS B 1 261 ? -15.662 -31.140 -39.253 1.00 65.12  ? 284  HIS B C   1 
ATOM   3945 O  O   . HIS B 1 261 ? -16.824 -30.986 -39.641 1.00 69.86  ? 284  HIS B O   1 
ATOM   3946 C  CB  . HIS B 1 261 ? -14.327 -31.169 -41.272 1.00 61.72  ? 284  HIS B CB  1 
ATOM   3947 C  CG  . HIS B 1 261 ? -13.771 -29.833 -40.948 1.00 57.92  ? 284  HIS B CG  1 
ATOM   3948 N  ND1 . HIS B 1 261 ? -12.416 -29.577 -40.913 1.00 60.41  ? 284  HIS B ND1 1 
ATOM   3949 C  CD2 . HIS B 1 261 ? -14.389 -28.680 -40.626 1.00 54.97  ? 284  HIS B CD2 1 
ATOM   3950 C  CE1 . HIS B 1 261 ? -12.222 -28.312 -40.591 1.00 58.19  ? 284  HIS B CE1 1 
ATOM   3951 N  NE2 . HIS B 1 261 ? -13.405 -27.749 -40.407 1.00 58.27  ? 284  HIS B NE2 1 
ATOM   3952 N  N   . PHE B 1 262 ? -15.194 -30.578 -38.154 1.00 63.11  ? 285  PHE B N   1 
ATOM   3953 C  CA  . PHE B 1 262 ? -16.064 -29.802 -37.292 1.00 64.04  ? 285  PHE B CA  1 
ATOM   3954 C  C   . PHE B 1 262 ? -15.433 -28.439 -37.003 1.00 63.77  ? 285  PHE B C   1 
ATOM   3955 O  O   . PHE B 1 262 ? -14.553 -28.292 -36.126 1.00 58.81  ? 285  PHE B O   1 
ATOM   3956 C  CB  . PHE B 1 262 ? -16.323 -30.597 -36.019 1.00 66.38  ? 285  PHE B CB  1 
ATOM   3957 C  CG  . PHE B 1 262 ? -17.085 -31.873 -36.244 1.00 68.83  ? 285  PHE B CG  1 
ATOM   3958 C  CD1 . PHE B 1 262 ? -18.467 -31.850 -36.439 1.00 75.93  ? 285  PHE B CD1 1 
ATOM   3959 C  CD2 . PHE B 1 262 ? -16.431 -33.095 -36.262 1.00 70.14  ? 285  PHE B CD2 1 
ATOM   3960 C  CE1 . PHE B 1 262 ? -19.180 -33.024 -36.654 1.00 80.79  ? 285  PHE B CE1 1 
ATOM   3961 C  CE2 . PHE B 1 262 ? -17.134 -34.274 -36.472 1.00 77.23  ? 285  PHE B CE2 1 
ATOM   3962 C  CZ  . PHE B 1 262 ? -18.510 -34.243 -36.672 1.00 82.18  ? 285  PHE B CZ  1 
ATOM   3963 N  N   . GLU B 1 263 ? -15.874 -27.454 -37.786 1.00 69.15  ? 286  GLU B N   1 
ATOM   3964 C  CA  . GLU B 1 263 ? -15.263 -26.125 -37.782 1.00 70.90  ? 286  GLU B CA  1 
ATOM   3965 C  C   . GLU B 1 263 ? -15.628 -25.458 -36.493 1.00 64.81  ? 286  GLU B C   1 
ATOM   3966 O  O   . GLU B 1 263 ? -16.744 -25.599 -36.040 1.00 61.06  ? 286  GLU B O   1 
ATOM   3967 C  CB  . GLU B 1 263 ? -15.713 -25.255 -38.974 1.00 74.60  ? 286  GLU B CB  1 
ATOM   3968 C  CG  . GLU B 1 263 ? -14.842 -23.997 -39.119 1.00 82.76  ? 286  GLU B CG  1 
ATOM   3969 C  CD  . GLU B 1 263 ? -13.630 -24.160 -40.057 1.00 87.67  ? 286  GLU B CD  1 
ATOM   3970 O  OE1 . GLU B 1 263 ? -13.754 -24.805 -41.128 1.00 102.94 ? 286  GLU B OE1 1 
ATOM   3971 O  OE2 . GLU B 1 263 ? -12.534 -23.632 -39.744 1.00 78.83  ? 286  GLU B OE2 1 
ATOM   3972 N  N   . GLY B 1 264 ? -14.676 -24.762 -35.889 1.00 63.73  ? 287  GLY B N   1 
ATOM   3973 C  CA  . GLY B 1 264 ? -14.939 -24.078 -34.641 1.00 63.18  ? 287  GLY B CA  1 
ATOM   3974 C  C   . GLY B 1 264 ? -13.895 -24.352 -33.594 1.00 63.08  ? 287  GLY B C   1 
ATOM   3975 O  O   . GLY B 1 264 ? -13.135 -25.327 -33.709 1.00 63.30  ? 287  GLY B O   1 
ATOM   3976 N  N   . PRO B 1 265 ? -13.864 -23.500 -32.553 1.00 64.47  ? 288  PRO B N   1 
ATOM   3977 C  CA  . PRO B 1 265 ? -12.944 -23.677 -31.437 1.00 61.70  ? 288  PRO B CA  1 
ATOM   3978 C  C   . PRO B 1 265 ? -13.185 -25.003 -30.746 1.00 56.24  ? 288  PRO B C   1 
ATOM   3979 O  O   . PRO B 1 265 ? -14.322 -25.340 -30.378 1.00 52.28  ? 288  PRO B O   1 
ATOM   3980 C  CB  . PRO B 1 265 ? -13.277 -22.505 -30.503 1.00 62.25  ? 288  PRO B CB  1 
ATOM   3981 C  CG  . PRO B 1 265 ? -14.669 -22.148 -30.836 1.00 62.08  ? 288  PRO B CG  1 
ATOM   3982 C  CD  . PRO B 1 265 ? -14.786 -22.379 -32.312 1.00 62.86  ? 288  PRO B CD  1 
ATOM   3983 N  N   . CYS B 1 266 ? -12.107 -25.750 -30.602 1.00 54.92  ? 289  CYS B N   1 
ATOM   3984 C  CA  . CYS B 1 266 ? -12.129 -27.064 -29.979 1.00 58.85  ? 289  CYS B CA  1 
ATOM   3985 C  C   . CYS B 1 266 ? -12.855 -27.058 -28.637 1.00 58.31  ? 289  CYS B C   1 
ATOM   3986 O  O   . CYS B 1 266 ? -13.643 -27.976 -28.337 1.00 54.23  ? 289  CYS B O   1 
ATOM   3987 C  CB  . CYS B 1 266 ? -10.694 -27.508 -29.759 1.00 63.38  ? 289  CYS B CB  1 
ATOM   3988 S  SG  . CYS B 1 266 ? -9.707  -27.399 -31.266 1.00 62.59  ? 289  CYS B SG  1 
ATOM   3989 N  N   . GLY B 1 267 ? -12.563 -26.020 -27.843 1.00 57.20  ? 290  GLY B N   1 
ATOM   3990 C  CA  . GLY B 1 267 ? -13.261 -25.754 -26.600 1.00 52.66  ? 290  GLY B CA  1 
ATOM   3991 C  C   . GLY B 1 267 ? -14.751 -26.027 -26.706 1.00 53.42  ? 290  GLY B C   1 
ATOM   3992 O  O   . GLY B 1 267 ? -15.319 -26.611 -25.812 1.00 54.79  ? 290  GLY B O   1 
ATOM   3993 N  N   . SER B 1 268 ? -15.376 -25.605 -27.807 1.00 52.67  ? 291  SER B N   1 
ATOM   3994 C  CA  . SER B 1 268 ? -16.828 -25.741 -28.033 1.00 51.74  ? 291  SER B CA  1 
ATOM   3995 C  C   . SER B 1 268 ? -17.247 -26.978 -28.814 1.00 51.59  ? 291  SER B C   1 
ATOM   3996 O  O   . SER B 1 268 ? -18.243 -27.602 -28.498 1.00 53.60  ? 291  SER B O   1 
ATOM   3997 C  CB  . SER B 1 268 ? -17.329 -24.560 -28.839 1.00 54.19  ? 291  SER B CB  1 
ATOM   3998 O  OG  . SER B 1 268 ? -16.789 -23.371 -28.326 1.00 59.81  ? 291  SER B OG  1 
ATOM   3999 N  N   . THR B 1 269 ? -16.507 -27.309 -29.861 1.00 49.96  ? 292  THR B N   1 
ATOM   4000 C  CA  . THR B 1 269 ? -16.904 -28.380 -30.752 1.00 49.06  ? 292  THR B CA  1 
ATOM   4001 C  C   . THR B 1 269 ? -16.675 -29.727 -30.098 1.00 48.19  ? 292  THR B C   1 
ATOM   4002 O  O   . THR B 1 269 ? -17.492 -30.624 -30.194 1.00 48.31  ? 292  THR B O   1 
ATOM   4003 C  CB  . THR B 1 269 ? -16.105 -28.303 -32.035 1.00 52.46  ? 292  THR B CB  1 
ATOM   4004 O  OG1 . THR B 1 269 ? -14.737 -28.641 -31.786 1.00 61.28  ? 292  THR B OG1 1 
ATOM   4005 C  CG2 . THR B 1 269 ? -16.123 -26.877 -32.579 1.00 56.41  ? 292  THR B CG2 1 
ATOM   4006 N  N   . LEU B 1 270 ? -15.580 -29.856 -29.366 1.00 45.89  ? 293  LEU B N   1 
ATOM   4007 C  CA  . LEU B 1 270 ? -15.131 -31.165 -28.977 1.00 44.50  ? 293  LEU B CA  1 
ATOM   4008 C  C   . LEU B 1 270 ? -15.906 -31.809 -27.836 1.00 45.34  ? 293  LEU B C   1 
ATOM   4009 O  O   . LEU B 1 270 ? -16.299 -32.956 -27.916 1.00 45.36  ? 293  LEU B O   1 
ATOM   4010 C  CB  . LEU B 1 270 ? -13.660 -31.102 -28.658 1.00 44.51  ? 293  LEU B CB  1 
ATOM   4011 C  CG  . LEU B 1 270 ? -12.938 -32.452 -28.543 1.00 45.62  ? 293  LEU B CG  1 
ATOM   4012 C  CD1 . LEU B 1 270 ? -13.013 -33.316 -29.791 1.00 43.95  ? 293  LEU B CD1 1 
ATOM   4013 C  CD2 . LEU B 1 270 ? -11.485 -32.167 -28.172 1.00 47.16  ? 293  LEU B CD2 1 
ATOM   4014 N  N   . PRO B 1 271 ? -16.126 -31.074 -26.761 1.00 48.12  ? 294  PRO B N   1 
ATOM   4015 C  CA  . PRO B 1 271 ? -16.778 -31.750 -25.651 1.00 49.60  ? 294  PRO B CA  1 
ATOM   4016 C  C   . PRO B 1 271 ? -18.121 -32.436 -25.989 1.00 51.22  ? 294  PRO B C   1 
ATOM   4017 O  O   . PRO B 1 271 ? -18.370 -33.563 -25.518 1.00 50.56  ? 294  PRO B O   1 
ATOM   4018 C  CB  . PRO B 1 271 ? -16.949 -30.626 -24.611 1.00 49.44  ? 294  PRO B CB  1 
ATOM   4019 C  CG  . PRO B 1 271 ? -15.926 -29.597 -24.968 1.00 49.19  ? 294  PRO B CG  1 
ATOM   4020 C  CD  . PRO B 1 271 ? -15.807 -29.664 -26.459 1.00 49.23  ? 294  PRO B CD  1 
ATOM   4021 N  N   . PRO B 1 272 ? -18.995 -31.765 -26.760 1.00 52.36  ? 295  PRO B N   1 
ATOM   4022 C  CA  . PRO B 1 272 ? -20.220 -32.426 -27.176 1.00 52.71  ? 295  PRO B CA  1 
ATOM   4023 C  C   . PRO B 1 272 ? -19.911 -33.675 -27.928 1.00 55.35  ? 295  PRO B C   1 
ATOM   4024 O  O   . PRO B 1 272 ? -20.571 -34.675 -27.735 1.00 57.47  ? 295  PRO B O   1 
ATOM   4025 C  CB  . PRO B 1 272 ? -20.861 -31.416 -28.119 1.00 52.59  ? 295  PRO B CB  1 
ATOM   4026 C  CG  . PRO B 1 272 ? -20.387 -30.101 -27.642 1.00 52.50  ? 295  PRO B CG  1 
ATOM   4027 C  CD  . PRO B 1 272 ? -18.995 -30.344 -27.141 1.00 53.62  ? 295  PRO B CD  1 
ATOM   4028 N  N   . ALA B 1 273 ? -18.902 -33.620 -28.780 1.00 58.87  ? 296  ALA B N   1 
ATOM   4029 C  CA  . ALA B 1 273 ? -18.536 -34.797 -29.563 1.00 63.56  ? 296  ALA B CA  1 
ATOM   4030 C  C   . ALA B 1 273 ? -18.204 -36.026 -28.723 1.00 66.04  ? 296  ALA B C   1 
ATOM   4031 O  O   . ALA B 1 273 ? -18.579 -37.150 -29.084 1.00 69.64  ? 296  ALA B O   1 
ATOM   4032 C  CB  . ALA B 1 273 ? -17.360 -34.472 -30.463 1.00 65.50  ? 296  ALA B CB  1 
ATOM   4033 N  N   . LEU B 1 274 ? -17.499 -35.807 -27.611 1.00 68.31  ? 297  LEU B N   1 
ATOM   4034 C  CA  . LEU B 1 274 ? -16.971 -36.896 -26.786 1.00 68.42  ? 297  LEU B CA  1 
ATOM   4035 C  C   . LEU B 1 274 ? -17.864 -37.320 -25.621 1.00 70.30  ? 297  LEU B C   1 
ATOM   4036 O  O   . LEU B 1 274 ? -17.631 -38.373 -25.006 1.00 68.47  ? 297  LEU B O   1 
ATOM   4037 C  CB  . LEU B 1 274 ? -15.606 -36.503 -26.245 1.00 68.79  ? 297  LEU B CB  1 
ATOM   4038 C  CG  . LEU B 1 274 ? -14.544 -36.212 -27.290 1.00 70.77  ? 297  LEU B CG  1 
ATOM   4039 C  CD1 . LEU B 1 274 ? -13.244 -35.815 -26.609 1.00 71.35  ? 297  LEU B CD1 1 
ATOM   4040 C  CD2 . LEU B 1 274 ? -14.316 -37.408 -28.201 1.00 69.22  ? 297  LEU B CD2 1 
ATOM   4041 N  N   . GLU B 1 275 ? -18.883 -36.520 -25.318 1.00 72.09  ? 298  GLU B N   1 
ATOM   4042 C  CA  . GLU B 1 275 ? -19.763 -36.828 -24.196 1.00 76.80  ? 298  GLU B CA  1 
ATOM   4043 C  C   . GLU B 1 275 ? -20.360 -38.228 -24.233 1.00 74.53  ? 298  GLU B C   1 
ATOM   4044 O  O   . GLU B 1 275 ? -20.524 -38.885 -25.259 1.00 81.30  ? 298  GLU B O   1 
ATOM   4045 C  CB  . GLU B 1 275 ? -20.880 -35.796 -24.055 1.00 80.71  ? 298  GLU B CB  1 
ATOM   4046 C  CG  . GLU B 1 275 ? -21.831 -35.661 -25.226 1.00 82.70  ? 298  GLU B CG  1 
ATOM   4047 C  CD  . GLU B 1 275 ? -23.201 -35.256 -24.783 1.00 85.98  ? 298  GLU B CD  1 
ATOM   4048 O  OE1 . GLU B 1 275 ? -23.851 -36.160 -24.252 1.00 96.63  ? 298  GLU B OE1 1 
ATOM   4049 O  OE2 . GLU B 1 275 ? -23.627 -34.083 -24.950 1.00 89.17  ? 298  GLU B OE2 1 
ATOM   4050 O  OXT . GLU B 1 275 ? -20.727 -38.734 -23.194 1.00 74.82  ? 298  GLU B OXT 1 
HETATM 4051 C  C   . BEZ C 2 1   ? -32.958 -26.087 12.462  1.00 65.57  ? 0    BEZ C C   1 
HETATM 4052 O  O1  . BEZ C 2 1   ? -32.613 -27.247 12.279  1.00 64.83  ? 0    BEZ C O1  1 
HETATM 4053 C  C1  . BEZ C 2 1   ? -33.854 -25.783 13.500  1.00 66.75  ? 0    BEZ C C1  1 
HETATM 4054 C  C2  . BEZ C 2 1   ? -34.993 -24.974 13.288  1.00 67.85  ? 0    BEZ C C2  1 
HETATM 4055 C  C3  . BEZ C 2 1   ? -35.897 -24.710 14.308  1.00 61.86  ? 0    BEZ C C3  1 
HETATM 4056 C  C4  . BEZ C 2 1   ? -35.647 -25.284 15.547  1.00 65.40  ? 0    BEZ C C4  1 
HETATM 4057 C  C5  . BEZ C 2 1   ? -34.532 -26.105 15.764  1.00 66.43  ? 0    BEZ C C5  1 
HETATM 4058 C  C6  . BEZ C 2 1   ? -33.631 -26.356 14.743  1.00 63.48  ? 0    BEZ C C6  1 
ATOM   4059 N  N   . GLY C 2 2   ? -32.583 -25.103 11.629  1.00 66.20  ? 1    GLY C N   1 
ATOM   4060 C  CA  . GLY C 2 2   ? -31.672 -25.354 10.472  1.00 63.40  ? 1    GLY C CA  1 
ATOM   4061 C  C   . GLY C 2 2   ? -31.968 -24.208 9.553   1.00 60.05  ? 1    GLY C C   1 
ATOM   4062 O  O   . GLY C 2 2   ? -33.062 -23.604 9.556   1.00 60.88  ? 1    GLY C O   1 
ATOM   4063 N  N   . VAL C 2 3   ? -30.966 -23.885 8.765   1.00 56.04  ? 2    VAL C N   1 
ATOM   4064 C  CA  . VAL C 2 3   ? -31.040 -22.746 7.882   1.00 55.07  ? 2    VAL C CA  1 
ATOM   4065 C  C   . VAL C 2 3   ? -31.893 -23.083 6.636   1.00 58.55  ? 2    VAL C C   1 
ATOM   4066 O  O   . VAL C 2 3   ? -31.528 -23.936 5.819   1.00 49.89  ? 2    VAL C O   1 
ATOM   4067 C  CB  . VAL C 2 3   ? -29.623 -22.334 7.451   1.00 53.25  ? 2    VAL C CB  1 
ATOM   4068 C  CG1 . VAL C 2 3   ? -29.682 -21.135 6.516   1.00 56.76  ? 2    VAL C CG1 1 
ATOM   4069 C  CG2 . VAL C 2 3   ? -28.738 -22.072 8.667   1.00 51.28  ? 2    VAL C CG2 1 
ATOM   4070 N  N   . LEU C 2 4   ? -33.042 -22.427 6.495   1.00 64.63  ? 3    LEU C N   1 
ATOM   4071 C  CA  . LEU C 2 4   ? -33.771 -22.484 5.228   1.00 65.10  ? 3    LEU C CA  1 
ATOM   4072 C  C   . LEU C 2 4   ? -32.844 -21.935 4.138   1.00 64.32  ? 3    LEU C C   1 
ATOM   4073 O  O   . LEU C 2 4   ? -32.075 -21.018 4.388   1.00 61.56  ? 3    LEU C O   1 
ATOM   4074 C  CB  . LEU C 2 4   ? -35.071 -21.661 5.272   1.00 68.94  ? 3    LEU C CB  1 
ATOM   4075 C  CG  . LEU C 2 4   ? -36.289 -22.207 6.040   1.00 72.27  ? 3    LEU C CG  1 
ATOM   4076 C  CD1 . LEU C 2 4   ? -37.563 -21.562 5.506   1.00 78.37  ? 3    LEU C CD1 1 
ATOM   4077 C  CD2 . LEU C 2 4   ? -36.404 -23.721 5.948   1.00 69.13  ? 3    LEU C CD2 1 
ATOM   4078 N  N   . LYS C 2 5   ? -32.902 -22.515 2.941   1.00 66.34  ? 4    LYS C N   1 
ATOM   4079 C  CA  . LYS C 2 5   ? -32.003 -22.144 1.868   1.00 63.83  ? 4    LYS C CA  1 
ATOM   4080 C  C   . LYS C 2 5   ? -32.589 -20.892 1.217   1.00 67.70  ? 4    LYS C C   1 
ATOM   4081 O  O   . LYS C 2 5   ? -33.803 -20.734 1.109   1.00 72.42  ? 4    LYS C O   1 
ATOM   4082 C  CB  . LYS C 2 5   ? -31.689 -23.324 0.975   1.00 65.30  ? 4    LYS C CB  1 
ATOM   4083 C  CG  . LYS C 2 5   ? -32.532 -23.325 -0.262  1.00 70.57  ? 4    LYS C CG  1 
ATOM   4084 C  CD  . LYS C 2 5   ? -31.688 -24.161 -1.242  1.00 74.32  ? 4    LYS C CD  1 
ATOM   4085 C  CE  . LYS C 2 5   ? -32.402 -23.925 -2.536  1.00 79.16  ? 4    LYS C CE  1 
ATOM   4086 N  NZ  . LYS C 2 5   ? -31.807 -24.853 -3.494  1.00 84.53  ? 4    LYS C NZ  1 
ATOM   4087 N  N   . GLU C 2 6   ? -31.696 -19.985 0.844   1.00 69.59  ? 5    GLU C N   1 
ATOM   4088 C  CA  . GLU C 2 6   ? -32.036 -18.590 0.487   1.00 73.62  ? 5    GLU C CA  1 
ATOM   4089 C  C   . GLU C 2 6   ? -32.863 -17.807 1.546   1.00 73.15  ? 5    GLU C C   1 
ATOM   4090 O  O   . GLU C 2 6   ? -33.418 -16.724 1.282   1.00 74.26  ? 5    GLU C O   1 
ATOM   4091 C  CB  . GLU C 2 6   ? -32.597 -18.538 -0.939  1.00 68.91  ? 5    GLU C CB  1 
ATOM   4092 C  CG  . GLU C 2 6   ? -31.442 -18.704 -1.919  1.00 68.57  ? 5    GLU C CG  1 
ATOM   4093 C  CD  . GLU C 2 6   ? -31.859 -18.990 -3.336  1.00 71.70  ? 5    GLU C CD  1 
ATOM   4094 O  OE1 . GLU C 2 6   ? -32.929 -18.473 -3.731  1.00 71.59  ? 5    GLU C OE1 1 
ATOM   4095 O  OE2 . GLU C 2 6   ? -31.102 -19.716 -4.051  1.00 62.87  ? 5    GLU C OE2 1 
ATOM   4096 N  N   . TYR C 2 7   ? -32.831 -18.345 2.764   1.00 67.27  ? 6    TYR C N   1 
ATOM   4097 C  CA  . TYR C 2 7   ? -33.502 -17.804 3.919   1.00 62.29  ? 6    TYR C CA  1 
ATOM   4098 C  C   . TYR C 2 7   ? -35.007 -17.968 3.818   1.00 70.52  ? 6    TYR C C   1 
ATOM   4099 O  O   . TYR C 2 7   ? -35.755 -17.120 4.329   1.00 94.09  ? 6    TYR C O   1 
ATOM   4100 C  CB  . TYR C 2 7   ? -33.106 -16.340 4.122   1.00 58.47  ? 6    TYR C CB  1 
ATOM   4101 C  CG  . TYR C 2 7   ? -31.597 -16.114 4.300   1.00 53.94  ? 6    TYR C CG  1 
ATOM   4102 C  CD1 . TYR C 2 7   ? -30.889 -16.784 5.294   1.00 52.81  ? 6    TYR C CD1 1 
ATOM   4103 C  CD2 . TYR C 2 7   ? -30.899 -15.203 3.513   1.00 46.69  ? 6    TYR C CD2 1 
ATOM   4104 C  CE1 . TYR C 2 7   ? -29.534 -16.572 5.476   1.00 49.13  ? 6    TYR C CE1 1 
ATOM   4105 C  CE2 . TYR C 2 7   ? -29.555 -14.978 3.698   1.00 43.17  ? 6    TYR C CE2 1 
ATOM   4106 C  CZ  . TYR C 2 7   ? -28.871 -15.672 4.674   1.00 45.14  ? 6    TYR C CZ  1 
ATOM   4107 O  OH  . TYR C 2 7   ? -27.514 -15.489 4.881   1.00 42.87  ? 6    TYR C OH  1 
ATOM   4108 N  N   . GLY C 2 8   ? -35.453 -19.058 3.180   1.00 65.90  ? 7    GLY C N   1 
ATOM   4109 C  CA  . GLY C 2 8   ? -36.881 -19.272 2.892   1.00 60.95  ? 7    GLY C CA  1 
ATOM   4110 C  C   . GLY C 2 8   ? -37.427 -18.411 1.752   1.00 59.45  ? 7    GLY C C   1 
ATOM   4111 O  O   . GLY C 2 8   ? -38.388 -18.794 1.115   1.00 64.90  ? 7    GLY C O   1 
ATOM   4112 N  N   . VAL C 2 9   ? -36.772 -17.292 1.453   1.00 62.61  ? 8    VAL C N   1 
ATOM   4113 C  CA  . VAL C 2 9   ? -37.368 -16.140 0.720   1.00 72.45  ? 8    VAL C CA  1 
ATOM   4114 C  C   . VAL C 2 9   ? -38.178 -16.544 -0.497  1.00 71.90  ? 8    VAL C C   1 
ATOM   4115 O  O   . VAL C 2 9   ? -37.585 -16.911 -1.501  1.00 77.04  ? 8    VAL C O   1 
ATOM   4116 C  CB  . VAL C 2 9   ? -36.257 -15.091 0.314   1.00 69.04  ? 8    VAL C CB  1 
ATOM   4117 C  CG1 . VAL C 2 9   ? -36.527 -14.408 -1.035  1.00 62.31  ? 8    VAL C CG1 1 
ATOM   4118 C  CG2 . VAL C 2 9   ? -36.053 -14.066 1.439   1.00 62.35  ? 8    VAL C CG2 1 
HETATM 4119 ZN ZN  . ZN  D 3 .   ? -32.498 -47.438 1.008   1.00 51.90  ? 1299 ZN  A ZN  1 
HETATM 4120 C  C1  . EDO E 4 .   ? -26.900 -23.547 -8.313  1.00 58.21  ? 1300 EDO A C1  1 
HETATM 4121 O  O1  . EDO E 4 .   ? -26.173 -23.786 -9.547  1.00 55.05  ? 1300 EDO A O1  1 
HETATM 4122 C  C2  . EDO E 4 .   ? -27.570 -24.812 -7.734  1.00 52.57  ? 1300 EDO A C2  1 
HETATM 4123 O  O2  . EDO E 4 .   ? -28.026 -24.587 -6.379  1.00 48.54  ? 1300 EDO A O2  1 
HETATM 4124 C  C1  . EDO F 4 .   ? -22.390 -12.319 -10.714 1.00 74.56  ? 1301 EDO A C1  1 
HETATM 4125 O  O1  . EDO F 4 .   ? -21.505 -13.208 -11.443 1.00 69.05  ? 1301 EDO A O1  1 
HETATM 4126 C  C2  . EDO F 4 .   ? -23.838 -12.804 -10.761 1.00 78.56  ? 1301 EDO A C2  1 
HETATM 4127 O  O2  . EDO F 4 .   ? -23.966 -13.939 -9.902  1.00 70.44  ? 1301 EDO A O2  1 
HETATM 4128 ZN ZN  . ZN  G 3 .   ? 24.397  -35.025 -16.557 1.00 92.58  ? 1299 ZN  B ZN  1 
HETATM 4129 N  N1  . EPE H 5 .   ? 8.927   -26.184 -33.321 1.00 64.32  ? 1300 EPE B N1  1 
HETATM 4130 C  C2  . EPE H 5 .   ? 7.953   -27.193 -33.709 1.00 62.72  ? 1300 EPE B C2  1 
HETATM 4131 C  C3  . EPE H 5 .   ? 8.573   -28.530 -33.381 1.00 65.57  ? 1300 EPE B C3  1 
HETATM 4132 N  N4  . EPE H 5 .   ? 9.620   -28.875 -34.354 1.00 60.53  ? 1300 EPE B N4  1 
HETATM 4133 C  C5  . EPE H 5 .   ? 10.334  -27.659 -34.748 1.00 60.07  ? 1300 EPE B C5  1 
HETATM 4134 C  C6  . EPE H 5 .   ? 10.312  -26.662 -33.593 1.00 64.74  ? 1300 EPE B C6  1 
HETATM 4135 C  C7  . EPE H 5 .   ? 8.982   -29.602 -35.462 1.00 66.30  ? 1300 EPE B C7  1 
HETATM 4136 C  C8  . EPE H 5 .   ? 9.980   -30.563 -36.084 1.00 74.44  ? 1300 EPE B C8  1 
HETATM 4137 O  O8  . EPE H 5 .   ? 11.320  -30.119 -35.826 1.00 78.69  ? 1300 EPE B O8  1 
HETATM 4138 C  C9  . EPE H 5 .   ? 8.736   -25.774 -31.912 1.00 62.36  ? 1300 EPE B C9  1 
HETATM 4139 C  C10 . EPE H 5 .   ? 9.282   -24.342 -31.929 1.00 62.97  ? 1300 EPE B C10 1 
HETATM 4140 S  S   . EPE H 5 .   ? 8.902   -23.301 -30.661 1.00 66.22  ? 1300 EPE B S   1 
HETATM 4141 O  O1S . EPE H 5 .   ? 7.572   -22.702 -30.933 1.00 54.75  ? 1300 EPE B O1S 1 
HETATM 4142 O  O2S . EPE H 5 .   ? 9.736   -22.100 -30.813 1.00 77.12  ? 1300 EPE B O2S 1 
HETATM 4143 O  O3S . EPE H 5 .   ? 9.271   -23.838 -29.285 1.00 50.40  ? 1300 EPE B O3S 1 
HETATM 4144 S  S   . DMS I 6 .   ? -7.401  -33.036 -12.648 1.00 60.06  ? 1301 DMS B S   1 
HETATM 4145 O  O   . DMS I 6 .   ? -8.568  -33.906 -12.281 1.00 57.96  ? 1301 DMS B O   1 
HETATM 4146 C  C1  . DMS I 6 .   ? -7.850  -32.189 -14.065 1.00 52.95  ? 1301 DMS B C1  1 
HETATM 4147 C  C2  . DMS I 6 .   ? -5.947  -33.873 -13.030 1.00 54.61  ? 1301 DMS B C2  1 
HETATM 4148 C  C1  . EDO J 4 .   ? 3.207   -25.866 -30.065 1.00 63.00  ? 1302 EDO B C1  1 
HETATM 4149 O  O1  . EDO J 4 .   ? 4.589   -25.829 -30.494 1.00 56.53  ? 1302 EDO B O1  1 
HETATM 4150 C  C2  . EDO J 4 .   ? 2.834   -24.948 -28.860 1.00 64.05  ? 1302 EDO B C2  1 
HETATM 4151 O  O2  . EDO J 4 .   ? 3.170   -25.480 -27.550 1.00 56.16  ? 1302 EDO B O2  1 
HETATM 4152 NA NA  . NA  K 7 .   ? 15.689  -41.455 -26.148 0.50 65.57  ? 1303 NA  B NA  1 
HETATM 4153 O  O2  . 3NP L 8 .   ? -31.591 -23.332 -5.144  1.00 80.83  ? 1004 3NP C O2  1 
HETATM 4154 O  O4  . 3NP L 8 .   ? -31.506 -26.047 -8.595  1.00 90.39  ? 1004 3NP C O4  1 
HETATM 4155 O  O3  . 3NP L 8 .   ? -31.853 -28.014 -7.441  1.00 86.90  ? 1004 3NP C O3  1 
HETATM 4156 C  C1  . 3NP L 8 .   ? -31.442 -24.468 -4.701  1.00 87.66  ? 1004 3NP C C1  1 
HETATM 4157 C  C2  . 3NP L 8 .   ? -30.932 -25.586 -5.560  1.00 94.78  ? 1004 3NP C C2  1 
HETATM 4158 C  C3  . 3NP L 8 .   ? -32.239 -25.865 -6.274  1.00 95.60  ? 1004 3NP C C3  1 
HETATM 4159 N  N1  . 3NP L 8 .   ? -31.853 -26.651 -7.457  1.00 94.48  ? 1004 3NP C N1  1 
HETATM 4160 O  O   . HOH M 9 .   ? -3.484  -11.038 5.369   1.00 28.14  ? 2001 HOH A O   1 
HETATM 4161 O  O   . HOH M 9 .   ? 3.171   -17.293 4.348   1.00 26.11  ? 2002 HOH A O   1 
HETATM 4162 O  O   . HOH M 9 .   ? -31.177 -21.443 -16.957 1.00 47.38  ? 2003 HOH A O   1 
HETATM 4163 O  O   . HOH M 9 .   ? -43.846 -32.857 1.535   1.00 37.47  ? 2004 HOH A O   1 
HETATM 4164 O  O   . HOH M 9 .   ? -45.064 -29.694 -10.116 1.00 30.89  ? 2005 HOH A O   1 
HETATM 4165 O  O   . HOH M 9 .   ? -19.082 -33.327 2.954   1.00 39.62  ? 2006 HOH A O   1 
HETATM 4166 O  O   . HOH M 9 .   ? -27.696 -32.118 2.111   1.00 20.76  ? 2007 HOH A O   1 
HETATM 4167 O  O   . HOH M 9 .   ? -29.704 -40.820 -21.651 1.00 16.83  ? 2008 HOH A O   1 
HETATM 4168 O  O   . HOH M 9 .   ? -1.827  -28.032 4.348   1.00 29.27  ? 2009 HOH A O   1 
HETATM 4169 O  O   . HOH M 9 .   ? -20.269 -37.218 -15.266 1.00 40.26  ? 2010 HOH A O   1 
HETATM 4170 O  O   . HOH M 9 .   ? -9.991  -33.726 1.512   1.00 49.37  ? 2011 HOH A O   1 
HETATM 4171 O  O   . HOH M 9 .   ? -16.207 -32.459 3.032   1.00 30.88  ? 2012 HOH A O   1 
HETATM 4172 O  O   . HOH M 9 .   ? -13.809 -31.648 2.751   1.00 27.57  ? 2013 HOH A O   1 
HETATM 4173 O  O   . HOH M 9 .   ? -26.974 -44.182 -5.936  1.00 25.15  ? 2014 HOH A O   1 
HETATM 4174 O  O   . HOH M 9 .   ? -35.008 -37.685 2.913   1.00 38.58  ? 2015 HOH A O   1 
HETATM 4175 O  O   . HOH M 9 .   ? -29.839 -33.004 4.136   1.00 23.49  ? 2016 HOH A O   1 
HETATM 4176 O  O   . HOH M 9 .   ? -34.122 -39.748 3.952   1.00 27.91  ? 2017 HOH A O   1 
HETATM 4177 O  O   . HOH M 9 .   ? -34.742 -41.731 6.046   1.00 42.96  ? 2018 HOH A O   1 
HETATM 4178 O  O   . HOH M 9 .   ? -32.072 -35.466 -22.743 1.00 40.82  ? 2019 HOH A O   1 
HETATM 4179 O  O   . HOH M 9 .   ? -39.810 -26.839 -31.408 1.00 33.70  ? 2020 HOH A O   1 
HETATM 4180 O  O   . HOH M 9 .   ? -30.404 -47.567 -8.905  1.00 34.62  ? 2021 HOH A O   1 
HETATM 4181 O  O   . HOH M 9 .   ? -31.002 -29.962 8.787   1.00 33.16  ? 2022 HOH A O   1 
HETATM 4182 O  O   . HOH M 9 .   ? -28.458 -30.970 9.639   1.00 27.41  ? 2023 HOH A O   1 
HETATM 4183 O  O   . HOH N 9 .   ? -19.950 -48.304 -37.676 1.00 32.86  ? 2001 HOH B O   1 
HETATM 4184 O  O   . HOH N 9 .   ? 21.196  -15.060 -31.182 1.00 49.47  ? 2002 HOH B O   1 
HETATM 4185 O  O   . HOH N 9 .   ? 10.617  -16.164 -11.226 1.00 26.00  ? 2003 HOH B O   1 
HETATM 4186 O  O   . HOH N 9 .   ? -2.853  -15.264 -18.198 1.00 43.54  ? 2004 HOH B O   1 
HETATM 4187 O  O   . HOH N 9 .   ? -15.182 -37.614 -15.450 1.00 38.25  ? 2005 HOH B O   1 
HETATM 4188 O  O   . HOH N 9 .   ? -2.064  -33.446 -12.552 1.00 31.44  ? 2006 HOH B O   1 
HETATM 4189 O  O   . HOH N 9 .   ? 16.833  -36.932 -27.936 1.00 49.66  ? 2007 HOH B O   1 
HETATM 4190 O  O   . HOH N 9 .   ? 9.023   -13.109 -16.044 1.00 30.24  ? 2008 HOH B O   1 
HETATM 4191 O  O   . HOH N 9 .   ? -1.501  -46.963 -39.574 1.00 41.89  ? 2009 HOH B O   1 
HETATM 4192 O  O   . HOH N 9 .   ? -14.920 -47.977 -35.255 1.00 28.06  ? 2010 HOH B O   1 
HETATM 4193 O  O   . HOH N 9 .   ? -10.404 -36.032 -10.976 1.00 31.22  ? 2011 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 12  ? 1.2371 1.3183 1.3333 0.0109  0.0003  -0.0936 35  ASP A N   
2    C CA  . ASP A 12  ? 1.2288 1.3086 1.3283 0.0103  0.0009  -0.0945 35  ASP A CA  
3    C C   . ASP A 12  ? 1.2038 1.2840 1.3081 0.0096  0.0009  -0.0949 35  ASP A C   
4    O O   . ASP A 12  ? 1.0754 1.1558 1.1817 0.0099  -0.0002 -0.0939 35  ASP A O   
5    C CB  . ASP A 12  ? 1.2099 1.2887 1.3093 0.0111  0.0000  -0.0937 35  ASP A CB  
6    C CG  . ASP A 12  ? 1.1508 1.2281 1.2524 0.0106  0.0007  -0.0947 35  ASP A CG  
7    O OD1 . ASP A 12  ? 0.9859 1.0631 1.0898 0.0096  0.0018  -0.0961 35  ASP A OD1 
8    O OD2 . ASP A 12  ? 1.1179 1.1942 1.2190 0.0112  0.0001  -0.0942 35  ASP A OD2 
9    N N   . LEU A 13  ? 1.1927 1.2730 1.2987 0.0086  0.0022  -0.0963 36  LEU A N   
10   C CA  . LEU A 13  ? 1.1342 1.2146 1.2446 0.0078  0.0025  -0.0970 36  LEU A CA  
11   C C   . LEU A 13  ? 1.0863 1.1657 1.2006 0.0078  0.0018  -0.0968 36  LEU A C   
12   O O   . LEU A 13  ? 1.0451 1.1248 1.1625 0.0077  0.0011  -0.0964 36  LEU A O   
13   C CB  . LEU A 13  ? 1.0887 1.1692 1.1999 0.0068  0.0042  -0.0987 36  LEU A CB  
14   C CG  . LEU A 13  ? 1.0586 1.1393 1.1743 0.0058  0.0049  -0.0998 36  LEU A CG  
15   C CD1 . LEU A 13  ? 1.1631 1.2446 1.2811 0.0059  0.0038  -0.0989 36  LEU A CD1 
16   C CD2 . LEU A 13  ? 1.0222 1.1035 1.1370 0.0049  0.0064  -0.1011 36  LEU A CD2 
17   N N   . THR A 14  ? 1.1267 1.2048 1.2409 0.0080  0.0021  -0.0972 37  THR A N   
18   C CA  . THR A 14  ? 1.1400 1.2170 1.2581 0.0079  0.0016  -0.0973 37  THR A CA  
19   C C   . THR A 14  ? 1.0599 1.1370 1.1782 0.0088  -0.0001 -0.0956 37  THR A C   
20   O O   . THR A 14  ? 1.0304 1.1071 1.1524 0.0087  -0.0008 -0.0953 37  THR A O   
21   C CB  . THR A 14  ? 1.1054 1.1810 1.2230 0.0079  0.0023  -0.0980 37  THR A CB  
22   O OG1 . THR A 14  ? 1.1256 1.2013 1.2390 0.0080  0.0032  -0.0984 37  THR A OG1 
23   C CG2 . THR A 14  ? 1.0351 1.1100 1.1571 0.0069  0.0033  -0.0996 37  THR A CG2 
24   N N   . ALA A 15  ? 1.0254 1.1029 1.1396 0.0096  -0.0008 -0.0944 38  ALA A N   
25   C CA  . ALA A 15  ? 1.1006 1.1784 1.2144 0.0104  -0.0024 -0.0928 38  ALA A CA  
26   C C   . ALA A 15  ? 1.0113 1.0901 1.1275 0.0101  -0.0031 -0.0923 38  ALA A C   
27   O O   . ALA A 15  ? 0.9423 1.0209 1.0612 0.0102  -0.0042 -0.0915 38  ALA A O   
28   C CB  . ALA A 15  ? 1.1424 1.2207 1.2513 0.0113  -0.0029 -0.0918 38  ALA A CB  
29   N N   . PHE A 16  ? 0.9604 1.0404 1.0756 0.0097  -0.0023 -0.0928 39  PHE A N   
30   C CA  . PHE A 16  ? 0.9384 1.0194 1.0557 0.0092  -0.0027 -0.0925 39  PHE A CA  
31   C C   . PHE A 16  ? 0.8497 0.9301 0.9722 0.0085  -0.0026 -0.0933 39  PHE A C   
32   O O   . PHE A 16  ? 0.8295 0.9101 0.9546 0.0085  -0.0036 -0.0925 39  PHE A O   
33   C CB  . PHE A 16  ? 0.9431 1.0254 1.0585 0.0088  -0.0017 -0.0931 39  PHE A CB  
34   C CG  . PHE A 16  ? 0.9004 0.9836 1.0186 0.0081  -0.0017 -0.0934 39  PHE A CG  
35   C CD1 . PHE A 16  ? 0.8788 0.9630 0.9965 0.0084  -0.0028 -0.0921 39  PHE A CD1 
36   C CD2 . PHE A 16  ? 0.9221 1.0049 1.0436 0.0072  -0.0006 -0.0948 39  PHE A CD2 
37   C CE1 . PHE A 16  ? 0.8726 0.9576 0.9930 0.0078  -0.0029 -0.0922 39  PHE A CE1 
38   C CE2 . PHE A 16  ? 0.9606 1.0443 1.0849 0.0066  -0.0007 -0.0950 39  PHE A CE2 
39   C CZ  . PHE A 16  ? 0.9556 1.0403 1.0794 0.0069  -0.0018 -0.0937 39  PHE A CZ  
40   N N   . ARG A 17  ? 0.7469 0.8265 0.8711 0.0079  -0.0013 -0.0948 40  ARG A N   
41   C CA  . ARG A 17  ? 0.7592 0.8384 0.8884 0.0071  -0.0010 -0.0957 40  ARG A CA  
42   C C   . ARG A 17  ? 0.7938 0.8720 0.9255 0.0076  -0.0024 -0.0948 40  ARG A C   
43   O O   . ARG A 17  ? 0.7842 0.8623 0.9198 0.0072  -0.0029 -0.0947 40  ARG A O   
44   C CB  . ARG A 17  ? 0.7629 0.8414 0.8933 0.0064  0.0005  -0.0975 40  ARG A CB  
45   C CG  . ARG A 17  ? 0.7856 0.8650 0.9137 0.0059  0.0019  -0.0984 40  ARG A CG  
46   C CD  . ARG A 17  ? 0.8200 0.8991 0.9510 0.0049  0.0034  -0.1003 40  ARG A CD  
47   N NE  . ARG A 17  ? 0.8382 0.9182 0.9724 0.0042  0.0034  -0.1006 40  ARG A NE  
48   C CZ  . ARG A 17  ? 0.8955 0.9750 1.0344 0.0038  0.0031  -0.1010 40  ARG A CZ  
49   N NH1 . ARG A 17  ? 0.9616 1.0400 1.1030 0.0040  0.0026  -0.1010 40  ARG A NH1 
50   N NH2 . ARG A 17  ? 0.8428 0.9231 0.9842 0.0033  0.0031  -0.1013 40  ARG A NH2 
51   N N   . GLU A 18  ? 0.8419 0.9194 0.9713 0.0083  -0.0029 -0.0941 41  GLU A N   
52   C CA  . GLU A 18  ? 0.8409 0.9174 0.9721 0.0088  -0.0042 -0.0931 41  GLU A CA  
53   C C   . GLU A 18  ? 0.7701 0.8474 0.9020 0.0090  -0.0057 -0.0917 41  GLU A C   
54   O O   . GLU A 18  ? 0.7867 0.8634 0.9219 0.0090  -0.0067 -0.0912 41  GLU A O   
55   C CB  . GLU A 18  ? 0.9246 1.0004 1.0525 0.0096  -0.0045 -0.0925 41  GLU A CB  
56   C CG  . GLU A 18  ? 0.9845 1.0590 1.1132 0.0094  -0.0035 -0.0937 41  GLU A CG  
57   C CD  . GLU A 18  ? 1.1429 1.2164 1.2701 0.0102  -0.0043 -0.0929 41  GLU A CD  
58   O OE1 . GLU A 18  ? 1.2010 1.2749 1.3243 0.0109  -0.0050 -0.0917 41  GLU A OE1 
59   O OE2 . GLU A 18  ? 1.1979 1.2702 1.3279 0.0100  -0.0044 -0.0933 41  GLU A OE2 
60   N N   . HIS A 19  ? 0.7045 0.7830 0.8333 0.0093  -0.0060 -0.0909 42  HIS A N   
61   C CA  . HIS A 19  ? 0.7316 0.8109 0.8611 0.0094  -0.0073 -0.0897 42  HIS A CA  
62   C C   . HIS A 19  ? 0.7300 0.8097 0.8634 0.0086  -0.0071 -0.0903 42  HIS A C   
63   O O   . HIS A 19  ? 0.7169 0.7963 0.8534 0.0084  -0.0082 -0.0897 42  HIS A O   
64   C CB  . HIS A 19  ? 0.7555 0.8362 0.8808 0.0098  -0.0075 -0.0888 42  HIS A CB  
65   C CG  . HIS A 19  ? 0.8287 0.9092 0.9505 0.0108  -0.0083 -0.0877 42  HIS A CG  
66   N ND1 . HIS A 19  ? 0.8395 0.9199 0.9614 0.0113  -0.0099 -0.0862 42  HIS A ND1 
67   C CD2 . HIS A 19  ? 0.8311 0.9114 0.9492 0.0113  -0.0078 -0.0878 42  HIS A CD2 
68   C CE1 . HIS A 19  ? 0.8572 0.9375 0.9757 0.0121  -0.0103 -0.0855 42  HIS A CE1 
69   N NE2 . HIS A 19  ? 0.8347 0.9149 0.9508 0.0121  -0.0090 -0.0864 42  HIS A NE2 
70   N N   . PHE A 20  ? 0.7187 0.7990 0.8519 0.0080  -0.0057 -0.0916 43  PHE A N   
71   C CA  . PHE A 20  ? 0.7505 0.8312 0.8871 0.0071  -0.0052 -0.0924 43  PHE A CA  
72   C C   . PHE A 20  ? 0.7318 0.8114 0.8733 0.0068  -0.0057 -0.0927 43  PHE A C   
73   O O   . PHE A 20  ? 0.7749 0.8548 0.9195 0.0065  -0.0065 -0.0923 43  PHE A O   
74   C CB  . PHE A 20  ? 0.7496 0.8307 0.8854 0.0065  -0.0034 -0.0940 43  PHE A CB  
75   C CG  . PHE A 20  ? 0.7885 0.8701 0.9278 0.0056  -0.0027 -0.0951 43  PHE A CG  
76   C CD1 . PHE A 20  ? 0.7532 0.8358 0.8933 0.0054  -0.0035 -0.0943 43  PHE A CD1 
77   C CD2 . PHE A 20  ? 0.7972 0.8782 0.9388 0.0049  -0.0013 -0.0968 43  PHE A CD2 
78   C CE1 . PHE A 20  ? 0.7359 0.8189 0.8791 0.0046  -0.0028 -0.0953 43  PHE A CE1 
79   C CE2 . PHE A 20  ? 0.8055 0.8869 0.9502 0.0040  -0.0006 -0.0978 43  PHE A CE2 
80   C CZ  . PHE A 20  ? 0.8169 0.8993 0.9625 0.0039  -0.0014 -0.0971 43  PHE A CZ  
81   N N   . ALA A 21  ? 0.7211 0.7995 0.8634 0.0069  -0.0053 -0.0933 44  ALA A N   
82   C CA  . ALA A 21  ? 0.6748 0.7521 0.8217 0.0066  -0.0056 -0.0938 44  ALA A CA  
83   C C   . ALA A 21  ? 0.6713 0.7483 0.8198 0.0069  -0.0075 -0.0922 44  ALA A C   
84   O O   . ALA A 21  ? 0.7013 0.7781 0.8542 0.0064  -0.0079 -0.0924 44  ALA A O   
85   C CB  . ALA A 21  ? 0.6835 0.7595 0.8300 0.0069  -0.0052 -0.0943 44  ALA A CB  
86   N N   . LYS A 22  ? 0.6678 0.7450 0.8130 0.0077  -0.0085 -0.0907 45  LYS A N   
87   C CA  . LYS A 22  ? 0.7047 0.7816 0.8512 0.0080  -0.0103 -0.0892 45  LYS A CA  
88   C C   . LYS A 22  ? 0.6434 0.7215 0.7908 0.0077  -0.0111 -0.0885 45  LYS A C   
89   O O   . LYS A 22  ? 0.6478 0.7255 0.7981 0.0075  -0.0123 -0.0878 45  LYS A O   
90   C CB  . LYS A 22  ? 0.8099 0.8866 0.9527 0.0089  -0.0111 -0.0879 45  LYS A CB  
91   C CG  . LYS A 22  ? 0.9159 0.9914 1.0583 0.0093  -0.0106 -0.0885 45  LYS A CG  
92   C CD  . LYS A 22  ? 1.0080 1.0830 1.1473 0.0102  -0.0117 -0.0872 45  LYS A CD  
93   C CE  . LYS A 22  ? 1.0030 1.0767 1.1422 0.0104  -0.0112 -0.0878 45  LYS A CE  
94   N NZ  . LYS A 22  ? 1.0264 1.1000 1.1617 0.0113  -0.0119 -0.0866 45  LYS A NZ  
95   N N   . ALA A 23  ? 0.5870 0.6664 0.7315 0.0077  -0.0104 -0.0886 46  ALA A N   
96   C CA  . ALA A 23  ? 0.6238 0.7043 0.7681 0.0075  -0.0112 -0.0877 46  ALA A CA  
97   C C   . ALA A 23  ? 0.6353 0.7156 0.7844 0.0068  -0.0118 -0.0878 46  ALA A C   
98   O O   . ALA A 23  ? 0.6677 0.7477 0.8201 0.0061  -0.0109 -0.0892 46  ALA A O   
99   C CB  . ALA A 23  ? 0.6451 0.7269 0.7867 0.0072  -0.0099 -0.0884 46  ALA A CB  
100  N N   . LYS A 24  ? 0.6240 0.7047 0.7735 0.0069  -0.0133 -0.0864 47  LYS A N   
101  C CA  . LYS A 24  ? 0.6333 0.7140 0.7870 0.0062  -0.0141 -0.0863 47  LYS A CA  
102  C C   . LYS A 24  ? 0.6420 0.7241 0.7947 0.0059  -0.0143 -0.0858 47  LYS A C   
103  O O   . LYS A 24  ? 0.5918 0.6740 0.7478 0.0052  -0.0143 -0.0862 47  LYS A O   
104  C CB  . LYS A 24  ? 0.6772 0.7568 0.8329 0.0065  -0.0157 -0.0851 47  LYS A CB  
105  C CG  . LYS A 24  ? 0.8086 0.8867 0.9674 0.0064  -0.0153 -0.0861 47  LYS A CG  
106  C CD  . LYS A 24  ? 0.8988 0.9756 1.0588 0.0068  -0.0167 -0.0851 47  LYS A CD  
107  C CE  . LYS A 24  ? 1.0671 1.1426 1.2297 0.0067  -0.0158 -0.0865 47  LYS A CE  
108  N NZ  . LYS A 24  ? 1.2236 1.2978 1.3887 0.0069  -0.0171 -0.0858 47  LYS A NZ  
109  N N   . HIS A 25  ? 0.6571 0.7402 0.8054 0.0064  -0.0144 -0.0849 48  HIS A N   
110  C CA  . HIS A 25  ? 0.6621 0.7467 0.8092 0.0061  -0.0146 -0.0844 48  HIS A CA  
111  C C   . HIS A 25  ? 0.6152 0.7008 0.7577 0.0064  -0.0134 -0.0848 48  HIS A C   
112  O O   . HIS A 25  ? 0.5954 0.6813 0.7342 0.0071  -0.0137 -0.0840 48  HIS A O   
113  C CB  . HIS A 25  ? 0.7143 0.7992 0.8608 0.0063  -0.0164 -0.0826 48  HIS A CB  
114  C CG  . HIS A 25  ? 0.8705 0.9544 1.0215 0.0059  -0.0176 -0.0822 48  HIS A CG  
115  N ND1 . HIS A 25  ? 0.9979 1.0820 1.1519 0.0052  -0.0182 -0.0820 48  HIS A ND1 
116  C CD2 . HIS A 25  ? 0.9077 0.9902 1.0606 0.0062  -0.0184 -0.0818 48  HIS A CD2 
117  C CE1 . HIS A 25  ? 0.9620 1.0449 1.1197 0.0050  -0.0193 -0.0816 48  HIS A CE1 
118  N NE2 . HIS A 25  ? 0.9229 1.0047 1.0799 0.0056  -0.0195 -0.0815 48  HIS A NE2 
119  N N   . ILE A 26  ? 0.5864 0.6726 0.7294 0.0059  -0.0120 -0.0862 49  ILE A N   
120  C CA  . ILE A 26  ? 0.5959 0.6830 0.7351 0.0061  -0.0107 -0.0868 49  ILE A CA  
121  C C   . ILE A 26  ? 0.6013 0.6900 0.7391 0.0058  -0.0107 -0.0865 49  ILE A C   
122  O O   . ILE A 26  ? 0.6433 0.7324 0.7840 0.0051  -0.0106 -0.0869 49  ILE A O   
123  C CB  . ILE A 26  ? 0.6065 0.6931 0.7470 0.0057  -0.0090 -0.0886 49  ILE A CB  
124  C CG1 . ILE A 26  ? 0.6360 0.7211 0.7774 0.0060  -0.0090 -0.0889 49  ILE A CG1 
125  C CG2 . ILE A 26  ? 0.6201 0.7077 0.7566 0.0058  -0.0078 -0.0892 49  ILE A CG2 
126  C CD1 . ILE A 26  ? 0.6668 0.7514 0.8087 0.0056  -0.0073 -0.0907 49  ILE A CD1 
127  N N   . ALA A 27  ? 0.5657 0.6555 0.6991 0.0063  -0.0106 -0.0859 50  ALA A N   
128  C CA  . ALA A 27  ? 0.5314 0.6226 0.6632 0.0060  -0.0105 -0.0857 50  ALA A CA  
129  C C   . ALA A 27  ? 0.5416 0.6336 0.6702 0.0062  -0.0090 -0.0866 50  ALA A C   
130  O O   . ALA A 27  ? 0.5702 0.6618 0.6960 0.0068  -0.0087 -0.0866 50  ALA A O   
131  C CB  . ALA A 27  ? 0.5413 0.6334 0.6708 0.0065  -0.0119 -0.0840 50  ALA A CB  
132  N N   . ILE A 28  ? 0.5080 0.6009 0.6370 0.0055  -0.0082 -0.0874 51  ILE A N   
133  C CA  . ILE A 28  ? 0.5207 0.6142 0.6471 0.0055  -0.0067 -0.0884 51  ILE A CA  
134  C C   . ILE A 28  ? 0.5028 0.5979 0.6270 0.0054  -0.0068 -0.0879 51  ILE A C   
135  O O   . ILE A 28  ? 0.5868 0.6825 0.7130 0.0048  -0.0070 -0.0879 51  ILE A O   
136  C CB  . ILE A 28  ? 0.5756 0.6685 0.7051 0.0047  -0.0054 -0.0901 51  ILE A CB  
137  C CG1 . ILE A 28  ? 0.6271 0.7183 0.7593 0.0047  -0.0054 -0.0905 51  ILE A CG1 
138  C CG2 . ILE A 28  ? 0.5709 0.6643 0.6977 0.0046  -0.0038 -0.0912 51  ILE A CG2 
139  C CD1 . ILE A 28  ? 0.6749 0.7655 0.8101 0.0040  -0.0040 -0.0923 51  ILE A CD1 
140  N N   . ILE A 29  ? 0.5031 0.5990 0.6230 0.0060  -0.0067 -0.0875 52  ILE A N   
141  C CA  . ILE A 29  ? 0.5381 0.6356 0.6553 0.0060  -0.0067 -0.0870 52  ILE A CA  
142  C C   . ILE A 29  ? 0.4954 0.5934 0.6110 0.0058  -0.0051 -0.0884 52  ILE A C   
143  O O   . ILE A 29  ? 0.4473 0.5445 0.5611 0.0061  -0.0044 -0.0890 52  ILE A O   
144  C CB  . ILE A 29  ? 0.5557 0.6538 0.6691 0.0070  -0.0077 -0.0857 52  ILE A CB  
145  C CG1 . ILE A 29  ? 0.5841 0.6818 0.6989 0.0072  -0.0093 -0.0844 52  ILE A CG1 
146  C CG2 . ILE A 29  ? 0.5148 0.6146 0.6251 0.0070  -0.0076 -0.0854 52  ILE A CG2 
147  C CD1 . ILE A 29  ? 0.6163 0.7137 0.7279 0.0082  -0.0100 -0.0834 52  ILE A CD1 
148  N N   . THR A 30  ? 0.4946 0.5937 0.6104 0.0052  -0.0046 -0.0887 53  THR A N   
149  C CA  . THR A 30  ? 0.5568 0.6562 0.6714 0.0048  -0.0031 -0.0900 53  THR A CA  
150  C C   . THR A 30  ? 0.6226 0.7238 0.7342 0.0048  -0.0030 -0.0897 53  THR A C   
151  O O   . THR A 30  ? 0.5726 0.6747 0.6850 0.0045  -0.0037 -0.0890 53  THR A O   
152  C CB  . THR A 30  ? 0.6074 0.7064 0.7261 0.0038  -0.0022 -0.0913 53  THR A CB  
153  O OG1 . THR A 30  ? 0.5470 0.6470 0.6674 0.0032  -0.0026 -0.0911 53  THR A OG1 
154  C CG2 . THR A 30  ? 0.5881 0.6855 0.7103 0.0037  -0.0025 -0.0916 53  THR A CG2 
155  N N   . GLY A 31  ? 0.6793 0.7809 0.7874 0.0051  -0.0021 -0.0902 54  GLY A N   
156  C CA  . GLY A 31  ? 0.6287 0.7318 0.7335 0.0052  -0.0019 -0.0899 54  GLY A CA  
157  C C   . GLY A 31  ? 0.5458 0.6492 0.6506 0.0045  -0.0004 -0.0913 54  GLY A C   
158  O O   . GLY A 31  ? 0.5451 0.6477 0.6529 0.0038  0.0003  -0.0924 54  GLY A O   
159  N N   . ALA A 32  ? 0.5108 0.6155 0.6125 0.0046  0.0000  -0.0913 55  ALA A N   
160  C CA  . ALA A 32  ? 0.5481 0.6533 0.6500 0.0038  0.0012  -0.0926 55  ALA A CA  
161  C C   . ALA A 32  ? 0.5449 0.6491 0.6462 0.0035  0.0026  -0.0939 55  ALA A C   
162  O O   . ALA A 32  ? 0.5727 0.6769 0.6750 0.0027  0.0038  -0.0951 55  ALA A O   
163  C CB  . ALA A 32  ? 0.5730 0.6798 0.6720 0.0038  0.0012  -0.0922 55  ALA A CB  
164  N N   . GLY A 33  ? 0.5858 0.6889 0.6855 0.0042  0.0023  -0.0936 56  GLY A N   
165  C CA  . GLY A 33  ? 0.6377 0.7398 0.7370 0.0040  0.0035  -0.0948 56  GLY A CA  
166  C C   . GLY A 33  ? 0.6284 0.7297 0.7317 0.0030  0.0045  -0.0962 56  GLY A C   
167  O O   . GLY A 33  ? 0.5871 0.6880 0.6901 0.0024  0.0058  -0.0975 56  GLY A O   
168  N N   . VAL A 34  ? 0.6372 0.7383 0.7442 0.0028  0.0038  -0.0958 57  VAL A N   
169  C CA  . VAL A 34  ? 0.7077 0.8079 0.8189 0.0019  0.0046  -0.0970 57  VAL A CA  
170  C C   . VAL A 34  ? 0.6521 0.7532 0.7649 0.0010  0.0053  -0.0978 57  VAL A C   
171  O O   . VAL A 34  ? 0.6688 0.7695 0.7837 0.0002  0.0065  -0.0992 57  VAL A O   
172  C CB  . VAL A 34  ? 0.7864 0.8855 0.9010 0.0021  0.0035  -0.0965 57  VAL A CB  
173  C CG1 . VAL A 34  ? 0.8191 0.9182 0.9315 0.0031  0.0021  -0.0949 57  VAL A CG1 
174  C CG2 . VAL A 34  ? 0.8084 0.9079 0.9270 0.0015  0.0031  -0.0964 57  VAL A CG2 
175  N N   . SER A 35  ? 0.5843 0.6867 0.6963 0.0011  0.0046  -0.0969 58  SER A N   
176  C CA  . SER A 35  ? 0.5866 0.6900 0.6998 0.0003  0.0053  -0.0976 58  SER A CA  
177  C C   . SER A 35  ? 0.5959 0.6999 0.7060 0.0000  0.0065  -0.0985 58  SER A C   
178  O O   . SER A 35  ? 0.5425 0.6468 0.6538 -0.0008 0.0076  -0.0996 58  SER A O   
179  C CB  . SER A 35  ? 0.5634 0.6681 0.6765 0.0005  0.0040  -0.0963 58  SER A CB  
180  O OG  . SER A 35  ? 0.5465 0.6504 0.6630 0.0005  0.0030  -0.0957 58  SER A OG  
181  N N   . ALA A 36  ? 0.6122 0.7162 0.7182 0.0008  0.0064  -0.0979 59  ALA A N   
182  C CA  . ALA A 36  ? 0.5930 0.6973 0.6957 0.0006  0.0075  -0.0987 59  ALA A CA  
183  C C   . ALA A 36  ? 0.6010 0.7042 0.7053 0.0000  0.0089  -0.1003 59  ALA A C   
184  O O   . ALA A 36  ? 0.6203 0.7239 0.7245 -0.0008 0.0101  -0.1014 59  ALA A O   
185  C CB  . ALA A 36  ? 0.6285 0.7328 0.7271 0.0016  0.0069  -0.0978 59  ALA A CB  
186  N N   . GLU A 37  ? 0.5796 0.6813 0.6854 0.0001  0.0087  -0.1004 60  GLU A N   
187  C CA  . GLU A 37  ? 0.5792 0.6799 0.6866 -0.0005 0.0100  -0.1019 60  GLU A CA  
188  C C   . GLU A 37  ? 0.5588 0.6596 0.6700 -0.0016 0.0109  -0.1031 60  GLU A C   
189  O O   . GLU A 37  ? 0.5416 0.6417 0.6538 -0.0024 0.0122  -0.1045 60  GLU A O   
190  C CB  . GLU A 37  ? 0.6400 0.7391 0.7488 -0.0001 0.0095  -0.1017 60  GLU A CB  
191  C CG  . GLU A 37  ? 0.6984 0.7971 0.8033 0.0008  0.0090  -0.1009 60  GLU A CG  
192  C CD  . GLU A 37  ? 0.7896 0.8867 0.8958 0.0010  0.0090  -0.1011 60  GLU A CD  
193  O OE1 . GLU A 37  ? 0.8275 0.9238 0.9366 0.0003  0.0100  -0.1024 60  GLU A OE1 
194  O OE2 . GLU A 37  ? 0.7492 0.8459 0.8537 0.0020  0.0080  -0.1000 60  GLU A OE2 
195  N N   . SER A 38  ? 0.5891 0.6907 0.7026 -0.0018 0.0103  -0.1027 61  SER A N   
196  C CA  . SER A 38  ? 0.5907 0.6926 0.7077 -0.0029 0.0112  -0.1038 61  SER A CA  
197  C C   . SER A 38  ? 0.5333 0.6365 0.6484 -0.0033 0.0118  -0.1041 61  SER A C   
198  O O   . SER A 38  ? 0.5557 0.6594 0.6732 -0.0041 0.0123  -0.1048 61  SER A O   
199  C CB  . SER A 38  ? 0.5955 0.6973 0.7165 -0.0029 0.0101  -0.1032 61  SER A CB  
200  O OG  . SER A 38  ? 0.6346 0.7350 0.7581 -0.0027 0.0097  -0.1033 61  SER A OG  
201  N N   . GLY A 39  ? 0.5028 0.6066 0.6135 -0.0028 0.0117  -0.1035 62  GLY A N   
202  C CA  . GLY A 39  ? 0.5429 0.6480 0.6512 -0.0031 0.0123  -0.1037 62  GLY A CA  
203  C C   . GLY A 39  ? 0.5694 0.6759 0.6780 -0.0030 0.0114  -0.1028 62  GLY A C   
204  O O   . GLY A 39  ? 0.5926 0.6999 0.7014 -0.0037 0.0121  -0.1034 62  GLY A O   
205  N N   . VAL A 40  ? 0.5833 0.6899 0.6916 -0.0022 0.0099  -0.1013 63  VAL A N   
206  C CA  . VAL A 40  ? 0.5885 0.6964 0.6971 -0.0020 0.0090  -0.1003 63  VAL A CA  
207  C C   . VAL A 40  ? 0.6312 0.7400 0.7353 -0.0012 0.0084  -0.0992 63  VAL A C   
208  O O   . VAL A 40  ? 0.6211 0.7295 0.7231 -0.0003 0.0076  -0.0984 63  VAL A O   
209  C CB  . VAL A 40  ? 0.5719 0.6794 0.6834 -0.0017 0.0076  -0.0993 63  VAL A CB  
210  C CG1 . VAL A 40  ? 0.5549 0.6637 0.6664 -0.0016 0.0067  -0.0983 63  VAL A CG1 
211  C CG2 . VAL A 40  ? 0.6058 0.7123 0.7220 -0.0024 0.0081  -0.1003 63  VAL A CG2 
212  N N   . PRO A 41  ? 0.6836 0.7939 0.7863 -0.0015 0.0086  -0.0992 64  PRO A N   
213  C CA  . PRO A 41  ? 0.6976 0.8090 0.7962 -0.0008 0.0079  -0.0981 64  PRO A CA  
214  C C   . PRO A 41  ? 0.7289 0.8407 0.8272 0.0000  0.0063  -0.0965 64  PRO A C   
215  O O   . PRO A 41  ? 0.6910 0.8030 0.7920 -0.0002 0.0056  -0.0961 64  PRO A O   
216  C CB  . PRO A 41  ? 0.6630 0.7758 0.7613 -0.0014 0.0085  -0.0985 64  PRO A CB  
217  C CG  . PRO A 41  ? 0.6335 0.7461 0.7364 -0.0022 0.0086  -0.0990 64  PRO A CG  
218  C CD  . PRO A 41  ? 0.6289 0.7399 0.7341 -0.0025 0.0092  -0.0999 64  PRO A CD  
219  N N   . THR A 42  ? 0.8101 0.9219 0.9051 0.0009  0.0056  -0.0957 65  THR A N   
220  C CA  . THR A 42  ? 0.8332 0.9456 0.9276 0.0017  0.0041  -0.0941 65  THR A CA  
221  C C   . THR A 42  ? 0.8644 0.9786 0.9557 0.0020  0.0038  -0.0935 65  THR A C   
222  O O   . THR A 42  ? 0.8768 0.9918 0.9677 0.0024  0.0027  -0.0923 65  THR A O   
223  C CB  . THR A 42  ? 0.8289 0.9404 0.9222 0.0027  0.0033  -0.0934 65  THR A CB  
224  O OG1 . THR A 42  ? 0.7865 0.8979 0.8761 0.0032  0.0037  -0.0935 65  THR A OG1 
225  C CG2 . THR A 42  ? 0.8500 0.9598 0.9467 0.0024  0.0034  -0.0938 65  THR A CG2 
226  N N   . PHE A 43  ? 0.9202 1.0350 1.0092 0.0017  0.0048  -0.0943 66  PHE A N   
227  C CA  . PHE A 43  ? 0.9139 1.0303 0.9999 0.0020  0.0046  -0.0938 66  PHE A CA  
228  C C   . PHE A 43  ? 0.9037 1.0207 0.9864 0.0031  0.0035  -0.0925 66  PHE A C   
229  O O   . PHE A 43  ? 0.7439 0.8623 0.8254 0.0034  0.0028  -0.0917 66  PHE A O   
230  C CB  . PHE A 43  ? 0.8964 1.0140 0.9845 0.0014  0.0043  -0.0935 66  PHE A CB  
231  C CG  . PHE A 43  ? 0.9442 1.0614 1.0355 0.0003  0.0054  -0.0947 66  PHE A CG  
232  C CD1 . PHE A 43  ? 0.9367 1.0542 1.0270 -0.0002 0.0067  -0.0959 66  PHE A CD1 
233  C CD2 . PHE A 43  ? 1.0062 1.1227 1.1015 -0.0001 0.0051  -0.0947 66  PHE A CD2 
234  C CE1 . PHE A 43  ? 0.9120 1.0291 1.0052 -0.0013 0.0077  -0.0970 66  PHE A CE1 
235  C CE2 . PHE A 43  ? 0.9977 1.1138 1.0961 -0.0011 0.0060  -0.0959 66  PHE A CE2 
236  C CZ  . PHE A 43  ? 0.9737 1.0902 1.0711 -0.0017 0.0074  -0.0970 66  PHE A CZ  
237  N N   . ARG A 44  ? 1.0226 1.1385 1.1039 0.0037  0.0034  -0.0925 67  ARG A N   
238  C CA  . ARG A 44  ? 1.1228 1.2390 1.2011 0.0049  0.0024  -0.0914 67  ARG A CA  
239  C C   . ARG A 44  ? 1.1541 1.2696 1.2293 0.0054  0.0029  -0.0918 67  ARG A C   
240  O O   . ARG A 44  ? 1.1316 1.2456 1.2077 0.0052  0.0035  -0.0925 67  ARG A O   
241  C CB  . ARG A 44  ? 1.0544 1.1698 1.1346 0.0053  0.0013  -0.0905 67  ARG A CB  
242  C CG  . ARG A 44  ? 0.9834 1.0995 1.0668 0.0047  0.0007  -0.0901 67  ARG A CG  
243  C CD  . ARG A 44  ? 0.9640 1.0797 1.0489 0.0051  -0.0005 -0.0889 67  ARG A CD  
244  N NE  . ARG A 44  ? 0.8797 0.9958 0.9617 0.0062  -0.0015 -0.0879 67  ARG A NE  
245  C CZ  . ARG A 44  ? 0.7775 0.8934 0.8603 0.0066  -0.0027 -0.0868 67  ARG A CZ  
246  N NH1 . ARG A 44  ? 0.7576 0.8730 0.8440 0.0061  -0.0031 -0.0866 67  ARG A NH1 
247  N NH2 . ARG A 44  ? 0.7968 0.9131 0.8768 0.0075  -0.0035 -0.0859 67  ARG A NH2 
248  N N   . GLY A 45  ? 1.1766 1.2931 1.2482 0.0061  0.0025  -0.0913 68  GLY A N   
249  C CA  . GLY A 45  ? 1.2743 1.3901 1.3428 0.0065  0.0030  -0.0917 68  GLY A CA  
250  C C   . GLY A 45  ? 1.3623 1.4782 1.4301 0.0058  0.0043  -0.0929 68  GLY A C   
251  O O   . GLY A 45  ? 1.4839 1.6005 1.5532 0.0050  0.0048  -0.0934 68  GLY A O   
252  N N   . PRO A 46  ? 1.4051 1.5200 1.4706 0.0059  0.0049  -0.0935 69  PRO A N   
253  C CA  . PRO A 46  ? 1.3505 1.4656 1.4147 0.0052  0.0061  -0.0945 69  PRO A CA  
254  C C   . PRO A 46  ? 1.2932 1.4081 1.3606 0.0040  0.0072  -0.0956 69  PRO A C   
255  O O   . PRO A 46  ? 1.1467 1.2604 1.2171 0.0036  0.0075  -0.0960 69  PRO A O   
256  C CB  . PRO A 46  ? 1.3308 1.4446 1.3927 0.0056  0.0064  -0.0949 69  PRO A CB  
257  C CG  . PRO A 46  ? 1.3648 1.4773 1.4284 0.0060  0.0059  -0.0946 69  PRO A CG  
258  C CD  . PRO A 46  ? 1.4206 1.5339 1.4855 0.0065  0.0047  -0.0934 69  PRO A CD  
259  N N   . GLY A 47  ? 1.2522 1.3682 1.3191 0.0034  0.0078  -0.0960 70  GLY A N   
260  C CA  . GLY A 47  ? 1.2884 1.4043 1.3578 0.0022  0.0089  -0.0972 70  GLY A CA  
261  C C   . GLY A 47  ? 1.3550 1.4707 1.4286 0.0017  0.0087  -0.0971 70  GLY A C   
262  O O   . GLY A 47  ? 1.4705 1.5857 1.5467 0.0007  0.0097  -0.0982 70  GLY A O   
263  N N   . GLY A 48  ? 1.2915 1.4078 1.3659 0.0023  0.0075  -0.0960 71  GLY A N   
264  C CA  . GLY A 48  ? 1.2062 1.3227 1.2843 0.0019  0.0072  -0.0958 71  GLY A CA  
265  C C   . GLY A 48  ? 1.1673 1.2856 1.2448 0.0018  0.0067  -0.0952 71  GLY A C   
266  O O   . GLY A 48  ? 1.1811 1.3002 1.2583 0.0024  0.0055  -0.0940 71  GLY A O   
267  N N   . PHE A 49  ? 1.0568 1.1759 1.1341 0.0010  0.0077  -0.0960 72  PHE A N   
268  C CA  . PHE A 49  ? 0.9210 1.0417 0.9982 0.0008  0.0074  -0.0956 72  PHE A CA  
269  C C   . PHE A 49  ? 0.7957 0.9164 0.8766 -0.0002 0.0080  -0.0963 72  PHE A C   
270  O O   . PHE A 49  ? 0.7211 0.8407 0.8041 -0.0008 0.0089  -0.0973 72  PHE A O   
271  C CB  . PHE A 49  ? 0.9733 1.0951 1.0471 0.0008  0.0079  -0.0959 72  PHE A CB  
272  C CG  . PHE A 49  ? 1.0767 1.1993 1.1470 0.0019  0.0070  -0.0949 72  PHE A CG  
273  C CD1 . PHE A 49  ? 1.1367 1.2583 1.2045 0.0026  0.0069  -0.0948 72  PHE A CD1 
274  C CD2 . PHE A 49  ? 1.0937 1.2179 1.1630 0.0021  0.0062  -0.0940 72  PHE A CD2 
275  C CE1 . PHE A 49  ? 1.1367 1.2591 1.2014 0.0036  0.0060  -0.0939 72  PHE A CE1 
276  C CE2 . PHE A 49  ? 1.1175 1.2426 1.1837 0.0031  0.0053  -0.0932 72  PHE A CE2 
277  C CZ  . PHE A 49  ? 1.1715 1.2956 1.2354 0.0039  0.0052  -0.0931 72  PHE A CZ  
278  N N   . TRP A 50  ? 0.7808 0.9028 0.8626 -0.0003 0.0074  -0.0957 73  TRP A N   
279  C CA  . TRP A 50  ? 0.7699 0.8922 0.8547 -0.0013 0.0080  -0.0964 73  TRP A CA  
280  C C   . TRP A 50  ? 0.8502 0.9743 0.9330 -0.0015 0.0080  -0.0961 73  TRP A C   
281  O O   . TRP A 50  ? 0.8400 0.9652 0.9217 -0.0009 0.0070  -0.0950 73  TRP A O   
282  C CB  . TRP A 50  ? 0.7530 0.8751 0.8413 -0.0014 0.0071  -0.0957 73  TRP A CB  
283  C CG  . TRP A 50  ? 0.7171 0.8395 0.8087 -0.0025 0.0076  -0.0963 73  TRP A CG  
284  C CD1 . TRP A 50  ? 0.7078 0.8292 0.8024 -0.0033 0.0086  -0.0975 73  TRP A CD1 
285  C CD2 . TRP A 50  ? 0.6840 0.8078 0.7764 -0.0028 0.0071  -0.0958 73  TRP A CD2 
286  N NE1 . TRP A 50  ? 0.7246 0.8466 0.8217 -0.0041 0.0087  -0.0978 73  TRP A NE1 
287  C CE2 . TRP A 50  ? 0.6980 0.8215 0.7939 -0.0038 0.0078  -0.0967 73  TRP A CE2 
288  C CE3 . TRP A 50  ? 0.7506 0.8759 0.8412 -0.0024 0.0061  -0.0946 73  TRP A CE3 
289  C CZ2 . TRP A 50  ? 0.6960 0.8206 0.7935 -0.0044 0.0076  -0.0965 73  TRP A CZ2 
290  C CZ3 . TRP A 50  ? 0.7512 0.8776 0.8433 -0.0030 0.0059  -0.0944 73  TRP A CZ3 
291  C CH2 . TRP A 50  ? 0.7179 0.8439 0.8134 -0.0040 0.0066  -0.0954 73  TRP A CH2 
292  N N   . ARG A 51  ? 0.9132 1.0376 0.9955 -0.0022 0.0092  -0.0972 74  ARG A N   
293  C CA  . ARG A 51  ? 0.9054 1.0313 0.9853 -0.0023 0.0094  -0.0971 74  ARG A CA  
294  C C   . ARG A 51  ? 0.9243 1.0507 1.0004 -0.0012 0.0085  -0.0961 74  ARG A C   
295  O O   . ARG A 51  ? 0.9838 1.1093 1.0584 -0.0006 0.0086  -0.0962 74  ARG A O   
296  C CB  . ARG A 51  ? 0.8681 0.9953 0.9501 -0.0028 0.0089  -0.0967 74  ARG A CB  
297  C CG  . ARG A 51  ? 0.8277 0.9543 0.9137 -0.0039 0.0097  -0.0977 74  ARG A CG  
298  C CD  . ARG A 51  ? 0.7603 0.8881 0.8480 -0.0043 0.0093  -0.0972 74  ARG A CD  
299  N NE  . ARG A 51  ? 0.6583 0.7855 0.7500 -0.0053 0.0099  -0.0981 74  ARG A NE  
300  C CZ  . ARG A 51  ? 0.6384 0.7662 0.7327 -0.0058 0.0094  -0.0978 74  ARG A CZ  
301  N NH1 . ARG A 51  ? 0.6357 0.7649 0.7289 -0.0054 0.0084  -0.0966 74  ARG A NH1 
302  N NH2 . ARG A 51  ? 0.6523 0.7795 0.7503 -0.0067 0.0100  -0.0987 74  ARG A NH2 
303  N N   . LYS A 52  ? 0.8993 1.0273 0.9740 -0.0008 0.0076  -0.0952 75  LYS A N   
304  C CA  . LYS A 52  ? 0.9715 1.1002 1.0426 0.0002  0.0069  -0.0944 75  LYS A CA  
305  C C   . LYS A 52  ? 1.0083 1.1364 1.0795 0.0011  0.0057  -0.0933 75  LYS A C   
306  O O   . LYS A 52  ? 1.0079 1.1363 1.0763 0.0020  0.0051  -0.0927 75  LYS A O   
307  C CB  . LYS A 52  ? 0.9887 1.1194 1.0579 0.0003  0.0065  -0.0938 75  LYS A CB  
308  C CG  . LYS A 52  ? 1.1498 1.2812 1.2185 -0.0005 0.0076  -0.0948 75  LYS A CG  
309  C CD  . LYS A 52  ? 1.2265 1.3594 1.2963 -0.0010 0.0074  -0.0945 75  LYS A CD  
310  C CE  . LYS A 52  ? 1.1726 1.3053 1.2445 -0.0022 0.0087  -0.0957 75  LYS A CE  
311  N NZ  . LYS A 52  ? 1.2382 1.3725 1.3109 -0.0027 0.0085  -0.0954 75  LYS A NZ  
312  N N   . TRP A 53  ? 0.9733 1.1005 1.0479 0.0008  0.0054  -0.0932 76  TRP A N   
313  C CA  . TRP A 53  ? 0.8908 1.0177 0.9659 0.0016  0.0041  -0.0921 76  TRP A CA  
314  C C   . TRP A 53  ? 0.8321 0.9572 0.9085 0.0018  0.0041  -0.0922 76  TRP A C   
315  O O   . TRP A 53  ? 0.8586 0.9825 0.9364 0.0013  0.0051  -0.0932 76  TRP A O   
316  C CB  . TRP A 53  ? 0.9072 1.0348 0.9851 0.0011  0.0034  -0.0914 76  TRP A CB  
317  C CG  . TRP A 53  ? 0.9159 1.0453 0.9926 0.0010  0.0033  -0.0911 76  TRP A CG  
318  C CD1 . TRP A 53  ? 0.8616 0.9924 0.9358 0.0016  0.0024  -0.0901 76  TRP A CD1 
319  C CD2 . TRP A 53  ? 0.9323 1.0624 1.0101 0.0000  0.0041  -0.0918 76  TRP A CD2 
320  N NE1 . TRP A 53  ? 0.8175 0.9498 0.8913 0.0011  0.0025  -0.0902 76  TRP A NE1 
321  C CE2 . TRP A 53  ? 0.8726 1.0045 0.9486 0.0001  0.0036  -0.0912 76  TRP A CE2 
322  C CE3 . TRP A 53  ? 1.0471 1.1765 1.1274 -0.0009 0.0052  -0.0930 76  TRP A CE3 
323  C CZ2 . TRP A 53  ? 0.9618 1.0948 1.0384 -0.0005 0.0041  -0.0916 76  TRP A CZ2 
324  C CZ3 . TRP A 53  ? 1.1459 1.2764 1.2268 -0.0017 0.0057  -0.0934 76  TRP A CZ3 
325  C CH2 . TRP A 53  ? 1.0912 1.2235 1.1702 -0.0015 0.0052  -0.0927 76  TRP A CH2 
326  N N   . GLN A 54  ? 0.8282 0.9531 0.9040 0.0027  0.0029  -0.0911 77  GLN A N   
327  C CA  . GLN A 54  ? 0.8777 1.0010 0.9552 0.0029  0.0027  -0.0910 77  GLN A CA  
328  C C   . GLN A 54  ? 0.7863 0.9097 0.8665 0.0028  0.0016  -0.0902 77  GLN A C   
329  O O   . GLN A 54  ? 0.6930 0.8177 0.7732 0.0028  0.0010  -0.0895 77  GLN A O   
330  C CB  . GLN A 54  ? 1.0129 1.1358 1.0873 0.0040  0.0022  -0.0906 77  GLN A CB  
331  C CG  . GLN A 54  ? 1.1638 1.2865 1.2354 0.0041  0.0032  -0.0914 77  GLN A CG  
332  C CD  . GLN A 54  ? 1.2651 1.3865 1.3353 0.0048  0.0031  -0.0914 77  GLN A CD  
333  O OE1 . GLN A 54  ? 1.2426 1.3640 1.3115 0.0057  0.0020  -0.0904 77  GLN A OE1 
334  N NE2 . GLN A 54  ? 1.3319 1.4521 1.4021 0.0044  0.0041  -0.0925 77  GLN A NE2 
335  N N   . ALA A 55  ? 0.7720 0.8939 0.8547 0.0028  0.0015  -0.0902 78  ALA A N   
336  C CA  . ALA A 55  ? 0.7877 0.9093 0.8730 0.0028  0.0004  -0.0894 78  ALA A CA  
337  C C   . ALA A 55  ? 0.7948 0.9177 0.8784 0.0034  -0.0008 -0.0880 78  ALA A C   
338  O O   . ALA A 55  ? 0.7489 0.8726 0.8340 0.0030  -0.0014 -0.0875 78  ALA A O   
339  C CB  . ALA A 55  ? 0.8166 0.9365 0.9032 0.0032  0.0001  -0.0893 78  ALA A CB  
340  N N   . GLN A 56  ? 0.8431 0.9662 0.9236 0.0043  -0.0013 -0.0874 79  GLN A N   
341  C CA  . GLN A 56  ? 0.8100 0.9341 0.8888 0.0050  -0.0025 -0.0862 79  GLN A CA  
342  C C   . GLN A 56  ? 0.7912 0.9172 0.8696 0.0046  -0.0027 -0.0859 79  GLN A C   
343  O O   . GLN A 56  ? 0.8313 0.9581 0.9101 0.0046  -0.0037 -0.0849 79  GLN A O   
344  C CB  . GLN A 56  ? 0.8671 0.9914 0.9421 0.0060  -0.0028 -0.0859 79  GLN A CB  
345  C CG  . GLN A 56  ? 0.9698 1.0924 1.0443 0.0065  -0.0023 -0.0864 79  GLN A CG  
346  C CD  . GLN A 56  ? 1.0096 1.1321 1.0824 0.0063  -0.0011 -0.0875 79  GLN A CD  
347  O OE1 . GLN A 56  ? 0.9981 1.1218 1.0682 0.0065  -0.0008 -0.0876 79  GLN A OE1 
348  N NE2 . GLN A 56  ? 0.9920 1.1129 1.0662 0.0060  -0.0003 -0.0884 79  GLN A NE2 
349  N N   . ASP A 57  ? 0.7532 0.8799 0.8307 0.0042  -0.0016 -0.0868 80  ASP A N   
350  C CA  . ASP A 57  ? 0.7967 0.9251 0.8737 0.0037  -0.0016 -0.0866 80  ASP A CA  
351  C C   . ASP A 57  ? 0.8033 0.9315 0.8840 0.0028  -0.0018 -0.0865 80  ASP A C   
352  O O   . ASP A 57  ? 0.9202 1.0496 1.0011 0.0027  -0.0026 -0.0857 80  ASP A O   
353  C CB  . ASP A 57  ? 0.8540 0.9829 0.9293 0.0034  -0.0004 -0.0877 80  ASP A CB  
354  C CG  . ASP A 57  ? 0.8785 1.0070 0.9507 0.0042  0.0000  -0.0880 80  ASP A CG  
355  O OD1 . ASP A 57  ? 0.8488 0.9775 0.9189 0.0051  -0.0009 -0.0872 80  ASP A OD1 
356  O OD2 . ASP A 57  ? 0.8239 0.9518 0.8958 0.0038  0.0010  -0.0891 80  ASP A OD2 
357  N N   . LEU A 58  ? 0.8080 0.9349 0.8917 0.0022  -0.0012 -0.0873 81  LEU A N   
358  C CA  . LEU A 58  ? 0.8050 0.9319 0.8923 0.0013  -0.0012 -0.0875 81  LEU A CA  
359  C C   . LEU A 58  ? 0.7291 0.8549 0.8194 0.0012  -0.0021 -0.0868 81  LEU A C   
360  O O   . LEU A 58  ? 0.6620 0.7881 0.7547 0.0005  -0.0026 -0.0865 81  LEU A O   
361  C CB  . LEU A 58  ? 0.8568 0.9829 0.9457 0.0005  0.0001  -0.0889 81  LEU A CB  
362  C CG  . LEU A 58  ? 0.9259 1.0532 1.0121 0.0004  0.0011  -0.0896 81  LEU A CG  
363  C CD1 . LEU A 58  ? 0.9816 1.1079 1.0685 -0.0001 0.0025  -0.0911 81  LEU A CD1 
364  C CD2 . LEU A 58  ? 0.9629 1.0917 1.0497 -0.0001 0.0009  -0.0893 81  LEU A CD2 
365  N N   . ALA A 59  ? 0.7054 0.8300 0.7957 0.0018  -0.0025 -0.0866 82  ALA A N   
366  C CA  . ALA A 59  ? 0.7507 0.8741 0.8439 0.0017  -0.0034 -0.0860 82  ALA A CA  
367  C C   . ALA A 59  ? 0.7921 0.9163 0.8844 0.0021  -0.0049 -0.0845 82  ALA A C   
368  O O   . ALA A 59  ? 0.8605 0.9838 0.9528 0.0027  -0.0057 -0.0839 82  ALA A O   
369  C CB  . ALA A 59  ? 0.7568 0.8785 0.8505 0.0021  -0.0031 -0.0865 82  ALA A CB  
370  N N   . THR A 60  ? 0.7629 0.8887 0.8545 0.0019  -0.0053 -0.0840 83  THR A N   
371  C CA  . THR A 60  ? 0.7324 0.8591 0.8227 0.0022  -0.0066 -0.0826 83  THR A CA  
372  C C   . THR A 60  ? 0.7062 0.8337 0.7984 0.0014  -0.0071 -0.0822 83  THR A C   
373  O O   . THR A 60  ? 0.6470 0.7748 0.7407 0.0007  -0.0064 -0.0829 83  THR A O   
374  C CB  . THR A 60  ? 0.7241 0.8523 0.8102 0.0030  -0.0066 -0.0823 83  THR A CB  
375  O OG1 . THR A 60  ? 0.7165 0.8463 0.8018 0.0025  -0.0062 -0.0825 83  THR A OG1 
376  C CG2 . THR A 60  ? 0.6988 0.8263 0.7828 0.0036  -0.0058 -0.0831 83  THR A CG2 
377  N N   . PRO A 61  ? 0.7148 0.8428 0.8072 0.0015  -0.0085 -0.0809 84  PRO A N   
378  C CA  . PRO A 61  ? 0.7419 0.8707 0.8362 0.0007  -0.0090 -0.0804 84  PRO A CA  
379  C C   . PRO A 61  ? 0.7421 0.8728 0.8340 0.0005  -0.0087 -0.0804 84  PRO A C   
380  O O   . PRO A 61  ? 0.7193 0.8507 0.8129 -0.0002 -0.0087 -0.0805 84  PRO A O   
381  C CB  . PRO A 61  ? 0.7556 0.8842 0.8502 0.0009  -0.0106 -0.0790 84  PRO A CB  
382  C CG  . PRO A 61  ? 0.7216 0.8495 0.8145 0.0018  -0.0108 -0.0788 84  PRO A CG  
383  C CD  . PRO A 61  ? 0.7281 0.8555 0.8195 0.0022  -0.0095 -0.0800 84  PRO A CD  
384  N N   . GLU A 62  ? 0.8179 0.9496 0.9062 0.0013  -0.0084 -0.0805 85  GLU A N   
385  C CA  . GLU A 62  ? 0.8824 1.0160 0.9682 0.0013  -0.0082 -0.0805 85  GLU A CA  
386  C C   . GLU A 62  ? 0.7831 0.9168 0.8695 0.0007  -0.0068 -0.0817 85  GLU A C   
387  O O   . GLU A 62  ? 0.7442 0.8790 0.8310 0.0000  -0.0066 -0.0818 85  GLU A O   
388  C CB  . GLU A 62  ? 0.9826 1.1171 1.0644 0.0023  -0.0082 -0.0803 85  GLU A CB  
389  C CG  . GLU A 62  ? 1.0419 1.1766 1.1225 0.0029  -0.0095 -0.0790 85  GLU A CG  
390  C CD  . GLU A 62  ? 1.0957 1.2284 1.1779 0.0032  -0.0100 -0.0787 85  GLU A CD  
391  O OE1 . GLU A 62  ? 1.1828 1.3143 1.2656 0.0034  -0.0092 -0.0796 85  GLU A OE1 
392  O OE2 . GLU A 62  ? 1.0789 1.2116 1.1619 0.0032  -0.0112 -0.0777 85  GLU A OE2 
393  N N   . ALA A 63  ? 0.6724 0.8049 0.7590 0.0009  -0.0058 -0.0827 86  ALA A N   
394  C CA  . ALA A 63  ? 0.6610 0.7934 0.7485 0.0003  -0.0045 -0.0840 86  ALA A CA  
395  C C   . ALA A 63  ? 0.6208 0.7529 0.7120 -0.0006 -0.0045 -0.0842 86  ALA A C   
396  O O   . ALA A 63  ? 0.6311 0.7641 0.7225 -0.0013 -0.0038 -0.0848 86  ALA A O   
397  C CB  . ALA A 63  ? 0.6454 0.7763 0.7329 0.0006  -0.0036 -0.0849 86  ALA A CB  
398  N N   . PHE A 64  ? 0.6068 0.7377 0.7009 -0.0009 -0.0052 -0.0837 87  PHE A N   
399  C CA  . PHE A 64  ? 0.6032 0.7336 0.7011 -0.0018 -0.0053 -0.0840 87  PHE A CA  
400  C C   . PHE A 64  ? 0.6361 0.7681 0.7338 -0.0023 -0.0059 -0.0832 87  PHE A C   
401  O O   . PHE A 64  ? 0.6412 0.7736 0.7404 -0.0031 -0.0054 -0.0837 87  PHE A O   
402  C CB  . PHE A 64  ? 0.5737 0.7025 0.6746 -0.0019 -0.0061 -0.0835 87  PHE A CB  
403  C CG  . PHE A 64  ? 0.5846 0.7126 0.6897 -0.0028 -0.0060 -0.0840 87  PHE A CG  
404  C CD1 . PHE A 64  ? 0.5956 0.7226 0.7027 -0.0032 -0.0048 -0.0853 87  PHE A CD1 
405  C CD2 . PHE A 64  ? 0.6102 0.7384 0.7172 -0.0033 -0.0072 -0.0830 87  PHE A CD2 
406  C CE1 . PHE A 64  ? 0.5910 0.7172 0.7021 -0.0040 -0.0047 -0.0858 87  PHE A CE1 
407  C CE2 . PHE A 64  ? 0.6134 0.7407 0.7244 -0.0041 -0.0071 -0.0834 87  PHE A CE2 
408  C CZ  . PHE A 64  ? 0.5996 0.7260 0.7127 -0.0045 -0.0059 -0.0848 87  PHE A CZ  
409  N N   . SER A 65  ? 0.6764 0.8092 0.7723 -0.0018 -0.0071 -0.0820 88  SER A N   
410  C CA  . SER A 65  ? 0.6708 0.8052 0.7661 -0.0022 -0.0078 -0.0812 88  SER A CA  
411  C C   . SER A 65  ? 0.6449 0.7808 0.7383 -0.0024 -0.0068 -0.0818 88  SER A C   
412  O O   . SER A 65  ? 0.5579 0.6945 0.6526 -0.0032 -0.0068 -0.0819 88  SER A O   
413  C CB  . SER A 65  ? 0.6604 0.7954 0.7532 -0.0015 -0.0090 -0.0799 88  SER A CB  
414  O OG  . SER A 65  ? 0.6777 0.8140 0.7703 -0.0020 -0.0098 -0.0790 88  SER A OG  
415  N N   . ARG A 66  ? 0.7003 0.8366 0.7906 -0.0017 -0.0061 -0.0823 89  ARG A N   
416  C CA  . ARG A 66  ? 0.7109 0.8485 0.7990 -0.0018 -0.0052 -0.0829 89  ARG A CA  
417  C C   . ARG A 66  ? 0.6722 0.8094 0.7622 -0.0026 -0.0040 -0.0842 89  ARG A C   
418  O O   . ARG A 66  ? 0.6497 0.7881 0.7393 -0.0031 -0.0035 -0.0845 89  ARG A O   
419  C CB  . ARG A 66  ? 0.7492 0.8872 0.8337 -0.0009 -0.0048 -0.0832 89  ARG A CB  
420  C CG  . ARG A 66  ? 0.8824 1.0219 0.9645 -0.0009 -0.0039 -0.0838 89  ARG A CG  
421  C CD  . ARG A 66  ? 0.9801 1.1200 1.0585 0.0000  -0.0035 -0.0840 89  ARG A CD  
422  N NE  . ARG A 66  ? 1.0926 1.2323 1.1698 0.0007  -0.0046 -0.0830 89  ARG A NE  
423  C CZ  . ARG A 66  ? 1.1599 1.2981 1.2373 0.0013  -0.0047 -0.0831 89  ARG A CZ  
424  N NH1 . ARG A 66  ? 1.1740 1.3108 1.2526 0.0012  -0.0038 -0.0840 89  ARG A NH1 
425  N NH2 . ARG A 66  ? 1.1007 1.2388 1.1770 0.0020  -0.0058 -0.0821 89  ARG A NH2 
426  N N   . ASP A 67  ? 0.6607 0.7962 0.7526 -0.0026 -0.0033 -0.0850 90  ASP A N   
427  C CA  . ASP A 67  ? 0.6506 0.7857 0.7437 -0.0032 -0.0020 -0.0863 90  ASP A CA  
428  C C   . ASP A 67  ? 0.6699 0.8031 0.7666 -0.0036 -0.0018 -0.0869 90  ASP A C   
429  O O   . ASP A 67  ? 0.6526 0.7847 0.7494 -0.0034 -0.0009 -0.0878 90  ASP A O   
430  C CB  . ASP A 67  ? 0.6554 0.7909 0.7453 -0.0027 -0.0010 -0.0871 90  ASP A CB  
431  C CG  . ASP A 67  ? 0.6599 0.7952 0.7505 -0.0034 0.0003  -0.0884 90  ASP A CG  
432  O OD1 . ASP A 67  ? 0.6400 0.7750 0.7338 -0.0043 0.0005  -0.0888 90  ASP A OD1 
433  O OD2 . ASP A 67  ? 0.6853 0.8210 0.7735 -0.0031 0.0012  -0.0891 90  ASP A OD2 
434  N N   . PRO A 68  ? 0.6605 0.7933 0.7604 -0.0042 -0.0025 -0.0865 91  PRO A N   
435  C CA  . PRO A 68  ? 0.6640 0.7951 0.7676 -0.0045 -0.0024 -0.0870 91  PRO A CA  
436  C C   . PRO A 68  ? 0.6122 0.7425 0.7176 -0.0051 -0.0009 -0.0885 91  PRO A C   
437  O O   . PRO A 68  ? 0.6318 0.7606 0.7393 -0.0051 -0.0006 -0.0891 91  PRO A O   
438  C CB  . PRO A 68  ? 0.6598 0.7909 0.7662 -0.0051 -0.0035 -0.0861 91  PRO A CB  
439  C CG  . PRO A 68  ? 0.6758 0.8088 0.7802 -0.0054 -0.0038 -0.0856 91  PRO A CG  
440  C CD  . PRO A 68  ? 0.6787 0.8128 0.7789 -0.0046 -0.0034 -0.0856 91  PRO A CD  
441  N N   . SER A 69  ? 0.5703 0.7017 0.6750 -0.0056 0.0000  -0.0892 92  SER A N   
442  C CA  . SER A 69  ? 0.5558 0.6866 0.6618 -0.0062 0.0013  -0.0907 92  SER A CA  
443  C C   . SER A 69  ? 0.5586 0.6885 0.6625 -0.0056 0.0021  -0.0913 92  SER A C   
444  O O   . SER A 69  ? 0.5231 0.6516 0.6289 -0.0058 0.0027  -0.0923 92  SER A O   
445  C CB  . SER A 69  ? 0.5343 0.6665 0.6391 -0.0068 0.0021  -0.0913 92  SER A CB  
446  O OG  . SER A 69  ? 0.5415 0.6732 0.6466 -0.0072 0.0036  -0.0928 92  SER A OG  
447  N N   . LEU A 70  ? 0.5821 0.7130 0.6821 -0.0048 0.0019  -0.0909 93  LEU A N   
448  C CA  . LEU A 70  ? 0.6353 0.7655 0.7331 -0.0043 0.0027  -0.0915 93  LEU A CA  
449  C C   . LEU A 70  ? 0.6428 0.7714 0.7419 -0.0038 0.0022  -0.0912 93  LEU A C   
450  O O   . LEU A 70  ? 0.6754 0.8028 0.7750 -0.0038 0.0030  -0.0921 93  LEU A O   
451  C CB  . LEU A 70  ? 0.6477 0.7793 0.7411 -0.0036 0.0025  -0.0909 93  LEU A CB  
452  C CG  . LEU A 70  ? 0.6880 0.8189 0.7788 -0.0030 0.0032  -0.0915 93  LEU A CG  
453  C CD1 . LEU A 70  ? 0.7303 0.8607 0.8220 -0.0037 0.0048  -0.0930 93  LEU A CD1 
454  C CD2 . LEU A 70  ? 0.6824 0.8147 0.7689 -0.0022 0.0030  -0.0910 93  LEU A CD2 
455  N N   . VAL A 71  ? 0.6407 0.7692 0.7405 -0.0034 0.0008  -0.0900 94  VAL A N   
456  C CA  . VAL A 71  ? 0.6084 0.7354 0.7094 -0.0029 0.0003  -0.0897 94  VAL A CA  
457  C C   . VAL A 71  ? 0.5657 0.6913 0.6709 -0.0037 0.0008  -0.0907 94  VAL A C   
458  O O   . VAL A 71  ? 0.5352 0.6595 0.6410 -0.0036 0.0015  -0.0914 94  VAL A O   
459  C CB  . VAL A 71  ? 0.5921 0.7193 0.6928 -0.0024 -0.0013 -0.0881 94  VAL A CB  
460  C CG1 . VAL A 71  ? 0.6007 0.7263 0.7028 -0.0020 -0.0018 -0.0879 94  VAL A CG1 
461  C CG2 . VAL A 71  ? 0.5641 0.6928 0.6607 -0.0017 -0.0017 -0.0873 94  VAL A CG2 
462  N N   . TRP A 72  ? 0.5415 0.6672 0.6496 -0.0045 0.0007  -0.0907 95  TRP A N   
463  C CA  . TRP A 72  ? 0.5408 0.6653 0.6529 -0.0052 0.0013  -0.0918 95  TRP A CA  
464  C C   . TRP A 72  ? 0.5427 0.6668 0.6545 -0.0056 0.0030  -0.0933 95  TRP A C   
465  O O   . TRP A 72  ? 0.5025 0.6253 0.6165 -0.0058 0.0035  -0.0942 95  TRP A O   
466  C CB  . TRP A 72  ? 0.5701 0.6951 0.6850 -0.0060 0.0009  -0.0916 95  TRP A CB  
467  C CG  . TRP A 72  ? 0.5805 0.7049 0.6981 -0.0060 -0.0004 -0.0906 95  TRP A CG  
468  C CD1 . TRP A 72  ? 0.6201 0.7454 0.7375 -0.0061 -0.0017 -0.0893 95  TRP A CD1 
469  C CD2 . TRP A 72  ? 0.5745 0.6971 0.6952 -0.0060 -0.0007 -0.0908 95  TRP A CD2 
470  N NE1 . TRP A 72  ? 0.6345 0.7586 0.7546 -0.0061 -0.0028 -0.0886 95  TRP A NE1 
471  C CE2 . TRP A 72  ? 0.6247 0.7473 0.7470 -0.0061 -0.0022 -0.0895 95  TRP A CE2 
472  C CE3 . TRP A 72  ? 0.6100 0.7312 0.7323 -0.0060 0.0000  -0.0919 95  TRP A CE3 
473  C CZ2 . TRP A 72  ? 0.6525 0.7735 0.7780 -0.0061 -0.0030 -0.0893 95  TRP A CZ2 
474  C CZ3 . TRP A 72  ? 0.6240 0.7438 0.7496 -0.0060 -0.0006 -0.0917 95  TRP A CZ3 
475  C CH2 . TRP A 72  ? 0.6354 0.7550 0.7625 -0.0060 -0.0021 -0.0904 95  TRP A CH2 
476  N N   . GLU A 73  ? 0.5631 0.6885 0.6723 -0.0057 0.0037  -0.0937 96  GLU A N   
477  C CA  . GLU A 73  ? 0.5786 0.7037 0.6872 -0.0060 0.0053  -0.0952 96  GLU A CA  
478  C C   . GLU A 73  ? 0.5722 0.6959 0.6801 -0.0054 0.0055  -0.0954 96  GLU A C   
479  O O   . GLU A 73  ? 0.5541 0.6766 0.6640 -0.0058 0.0063  -0.0965 96  GLU A O   
480  C CB  . GLU A 73  ? 0.5968 0.7233 0.7017 -0.0060 0.0059  -0.0954 96  GLU A CB  
481  C CG  . GLU A 73  ? 0.6294 0.7570 0.7353 -0.0069 0.0065  -0.0959 96  GLU A CG  
482  C CD  . GLU A 73  ? 0.6623 0.7910 0.7651 -0.0070 0.0076  -0.0966 96  GLU A CD  
483  O OE1 . GLU A 73  ? 0.6901 0.8200 0.7896 -0.0065 0.0071  -0.0958 96  GLU A OE1 
484  O OE2 . GLU A 73  ? 0.5740 0.7022 0.6775 -0.0076 0.0089  -0.0979 96  GLU A OE2 
485  N N   . PHE A 74  ? 0.5966 0.7205 0.7015 -0.0045 0.0047  -0.0944 97  PHE A N   
486  C CA  . PHE A 74  ? 0.5854 0.7081 0.6890 -0.0037 0.0046  -0.0944 97  PHE A CA  
487  C C   . PHE A 74  ? 0.5543 0.6754 0.6616 -0.0039 0.0044  -0.0945 97  PHE A C   
488  O O   . PHE A 74  ? 0.5654 0.6853 0.6733 -0.0039 0.0052  -0.0955 97  PHE A O   
489  C CB  . PHE A 74  ? 0.5782 0.7016 0.6788 -0.0027 0.0034  -0.0929 97  PHE A CB  
490  C CG  . PHE A 74  ? 0.5745 0.6968 0.6737 -0.0019 0.0032  -0.0927 97  PHE A CG  
491  C CD1 . PHE A 74  ? 0.6210 0.7425 0.7188 -0.0019 0.0043  -0.0937 97  PHE A CD1 
492  C CD2 . PHE A 74  ? 0.5829 0.7050 0.6818 -0.0012 0.0019  -0.0915 97  PHE A CD2 
493  C CE1 . PHE A 74  ? 0.6524 0.7730 0.7487 -0.0011 0.0041  -0.0935 97  PHE A CE1 
494  C CE2 . PHE A 74  ? 0.5876 0.7088 0.6849 -0.0004 0.0016  -0.0912 97  PHE A CE2 
495  C CZ  . PHE A 74  ? 0.6258 0.7462 0.7218 -0.0003 0.0027  -0.0922 97  PHE A CZ  
496  N N   . TYR A 75  ? 0.5154 0.6365 0.6251 -0.0039 0.0032  -0.0937 98  TYR A N   
497  C CA  . TYR A 75  ? 0.5133 0.6328 0.6266 -0.0041 0.0028  -0.0938 98  TYR A CA  
498  C C   . TYR A 75  ? 0.5116 0.6304 0.6287 -0.0050 0.0039  -0.0952 98  TYR A C   
499  O O   . TYR A 75  ? 0.4975 0.6148 0.6170 -0.0051 0.0041  -0.0958 98  TYR A O   
500  C CB  . TYR A 75  ? 0.5323 0.6519 0.6469 -0.0038 0.0012  -0.0923 98  TYR A CB  
501  C CG  . TYR A 75  ? 0.5616 0.6810 0.6733 -0.0027 0.0002  -0.0911 98  TYR A CG  
502  C CD1 . TYR A 75  ? 0.5815 0.6995 0.6937 -0.0023 0.0001  -0.0912 98  TYR A CD1 
503  C CD2 . TYR A 75  ? 0.5993 0.7202 0.7080 -0.0023 -0.0005 -0.0900 98  TYR A CD2 
504  C CE1 . TYR A 75  ? 0.6115 0.7295 0.7211 -0.0013 -0.0006 -0.0902 98  TYR A CE1 
505  C CE2 . TYR A 75  ? 0.6064 0.7273 0.7125 -0.0013 -0.0013 -0.0890 98  TYR A CE2 
506  C CZ  . TYR A 75  ? 0.6056 0.7249 0.7121 -0.0008 -0.0014 -0.0891 98  TYR A CZ  
507  O OH  . TYR A 75  ? 0.5857 0.7051 0.6895 0.0000  -0.0023 -0.0881 98  TYR A OH  
508  N N   . HIS A 76  ? 0.5243 0.6441 0.6419 -0.0058 0.0045  -0.0958 99  HIS A N   
509  C CA  . HIS A 76  ? 0.5336 0.6527 0.6544 -0.0067 0.0057  -0.0973 99  HIS A CA  
510  C C   . HIS A 76  ? 0.5044 0.6227 0.6242 -0.0067 0.0070  -0.0985 99  HIS A C   
511  O O   . HIS A 76  ? 0.4689 0.5859 0.5914 -0.0070 0.0075  -0.0994 99  HIS A O   
512  C CB  . HIS A 76  ? 0.5643 0.6848 0.6852 -0.0075 0.0063  -0.0977 99  HIS A CB  
513  C CG  . HIS A 76  ? 0.5933 0.7133 0.7171 -0.0084 0.0076  -0.0994 99  HIS A CG  
514  N ND1 . HIS A 76  ? 0.6102 0.7291 0.7384 -0.0089 0.0075  -0.0999 99  HIS A ND1 
515  C CD2 . HIS A 76  ? 0.6135 0.7341 0.7364 -0.0091 0.0090  -0.1006 99  HIS A CD2 
516  C CE1 . HIS A 76  ? 0.6446 0.7633 0.7746 -0.0098 0.0089  -0.1014 99  HIS A CE1 
517  N NE2 . HIS A 76  ? 0.6422 0.7621 0.7692 -0.0099 0.0098  -0.1018 99  HIS A NE2 
518  N N   . TYR A 77  ? 0.5164 0.6354 0.6321 -0.0063 0.0075  -0.0985 100 TYR A N   
519  C CA  . TYR A 77  ? 0.5462 0.6645 0.6605 -0.0063 0.0087  -0.0996 100 TYR A CA  
520  C C   . TYR A 77  ? 0.5751 0.6918 0.6908 -0.0058 0.0083  -0.0995 100 TYR A C   
521  O O   . TYR A 77  ? 0.6273 0.7428 0.7449 -0.0063 0.0093  -0.1007 100 TYR A O   
522  C CB  . TYR A 77  ? 0.5874 0.7066 0.6969 -0.0057 0.0088  -0.0991 100 TYR A CB  
523  C CG  . TYR A 77  ? 0.6918 0.8102 0.7995 -0.0057 0.0100  -0.1002 100 TYR A CG  
524  C CD1 . TYR A 77  ? 0.6952 0.8135 0.8036 -0.0066 0.0115  -0.1017 100 TYR A CD1 
525  C CD2 . TYR A 77  ? 0.8269 0.9446 0.9321 -0.0048 0.0096  -0.0996 100 TYR A CD2 
526  C CE1 . TYR A 77  ? 0.7323 0.8498 0.8389 -0.0066 0.0126  -0.1026 100 TYR A CE1 
527  C CE2 . TYR A 77  ? 0.8637 0.9806 0.9672 -0.0048 0.0106  -0.1006 100 TYR A CE2 
528  C CZ  . TYR A 77  ? 0.7859 0.9028 0.8901 -0.0057 0.0121  -0.1020 100 TYR A CZ  
529  O OH  . TYR A 77  ? 0.8442 0.9603 0.9466 -0.0058 0.0131  -0.1029 100 TYR A OH  
530  N N   . ARG A 78  ? 0.5878 0.7044 0.7023 -0.0049 0.0070  -0.0981 101 ARG A N   
531  C CA  . ARG A 78  ? 0.5851 0.7002 0.7004 -0.0044 0.0066  -0.0979 101 ARG A CA  
532  C C   . ARG A 78  ? 0.5464 0.6604 0.6666 -0.0049 0.0065  -0.0985 101 ARG A C   
533  O O   . ARG A 78  ? 0.5128 0.6255 0.6344 -0.0050 0.0070  -0.0992 101 ARG A O   
534  C CB  . ARG A 78  ? 0.6000 0.7154 0.7131 -0.0034 0.0051  -0.0962 101 ARG A CB  
535  C CG  . ARG A 78  ? 0.6140 0.7305 0.7224 -0.0028 0.0052  -0.0958 101 ARG A CG  
536  C CD  . ARG A 78  ? 0.6169 0.7338 0.7232 -0.0019 0.0037  -0.0943 101 ARG A CD  
537  N NE  . ARG A 78  ? 0.6329 0.7483 0.7394 -0.0012 0.0033  -0.0940 101 ARG A NE  
538  C CZ  . ARG A 78  ? 0.6817 0.7971 0.7871 -0.0004 0.0020  -0.0927 101 ARG A CZ  
539  N NH1 . ARG A 78  ? 0.6905 0.8072 0.7946 -0.0002 0.0010  -0.0915 101 ARG A NH1 
540  N NH2 . ARG A 78  ? 0.7232 0.8373 0.8289 0.0000  0.0017  -0.0925 101 ARG A NH2 
541  N N   . ARG A 79  ? 0.5158 0.6303 0.6386 -0.0054 0.0059  -0.0981 102 ARG A N   
542  C CA  . ARG A 79  ? 0.5481 0.6616 0.6757 -0.0060 0.0059  -0.0988 102 ARG A CA  
543  C C   . ARG A 79  ? 0.5973 0.7103 0.7265 -0.0068 0.0076  -0.1006 102 ARG A C   
544  O O   . ARG A 79  ? 0.5739 0.6855 0.7058 -0.0070 0.0079  -0.1014 102 ARG A O   
545  C CB  . ARG A 79  ? 0.5161 0.6304 0.6459 -0.0065 0.0052  -0.0983 102 ARG A CB  
546  C CG  . ARG A 79  ? 0.5191 0.6334 0.6491 -0.0060 0.0034  -0.0966 102 ARG A CG  
547  C CD  . ARG A 79  ? 0.5225 0.6380 0.6530 -0.0063 0.0027  -0.0958 102 ARG A CD  
548  N NE  . ARG A 79  ? 0.5286 0.6437 0.6636 -0.0072 0.0028  -0.0966 102 ARG A NE  
549  C CZ  . ARG A 79  ? 0.5324 0.6463 0.6711 -0.0073 0.0020  -0.0963 102 ARG A CZ  
550  N NH1 . ARG A 79  ? 0.5300 0.6431 0.6684 -0.0066 0.0009  -0.0954 102 ARG A NH1 
551  N NH2 . ARG A 79  ? 0.5491 0.6627 0.6919 -0.0081 0.0022  -0.0971 102 ARG A NH2 
552  N N   . GLU A 80  ? 0.6395 0.7535 0.7670 -0.0073 0.0087  -0.1014 103 GLU A N   
553  C CA  . GLU A 80  ? 0.6231 0.7367 0.7523 -0.0082 0.0103  -0.1032 103 GLU A CA  
554  C C   . GLU A 80  ? 0.6115 0.7241 0.7387 -0.0079 0.0112  -0.1040 103 GLU A C   
555  O O   . GLU A 80  ? 0.6451 0.7567 0.7750 -0.0084 0.0121  -0.1052 103 GLU A O   
556  C CB  . GLU A 80  ? 0.6012 0.7160 0.7294 -0.0089 0.0112  -0.1039 103 GLU A CB  
557  C CG  . GLU A 80  ? 0.6368 0.7526 0.7669 -0.0092 0.0104  -0.1032 103 GLU A CG  
558  C CD  . GLU A 80  ? 0.6390 0.7541 0.7742 -0.0099 0.0104  -0.1039 103 GLU A CD  
559  O OE1 . GLU A 80  ? 0.6838 0.7990 0.8206 -0.0108 0.0117  -0.1053 103 GLU A OE1 
560  O OE2 . GLU A 80  ? 0.6266 0.7411 0.7642 -0.0097 0.0091  -0.1031 103 GLU A OE2 
561  N N   . VAL A 81  ? 0.5410 0.6539 0.6640 -0.0071 0.0110  -0.1032 104 VAL A N   
562  C CA  . VAL A 81  ? 0.5624 0.6744 0.6839 -0.0070 0.0118  -0.1040 104 VAL A CA  
563  C C   . VAL A 81  ? 0.5566 0.6670 0.6810 -0.0068 0.0116  -0.1042 104 VAL A C   
564  O O   . VAL A 81  ? 0.5669 0.6764 0.6910 -0.0070 0.0125  -0.1051 104 VAL A O   
565  C CB  . VAL A 81  ? 0.5547 0.6670 0.6712 -0.0061 0.0116  -0.1031 104 VAL A CB  
566  C CG1 . VAL A 81  ? 0.5571 0.6709 0.6704 -0.0060 0.0115  -0.1026 104 VAL A CG1 
567  C CG2 . VAL A 81  ? 0.5820 0.6936 0.6981 -0.0051 0.0102  -0.1018 104 VAL A CG2 
568  N N   . MET A 82  ? 0.5536 0.6637 0.6808 -0.0066 0.0103  -0.1033 105 MET A N   
569  C CA  . MET A 82  ? 0.5669 0.6755 0.6969 -0.0064 0.0099  -0.1034 105 MET A CA  
570  C C   . MET A 82  ? 0.5637 0.6715 0.6978 -0.0073 0.0110  -0.1051 105 MET A C   
571  O O   . MET A 82  ? 0.5452 0.6518 0.6809 -0.0073 0.0113  -0.1057 105 MET A O   
572  C CB  . MET A 82  ? 0.5795 0.6880 0.7113 -0.0059 0.0082  -0.1020 105 MET A CB  
573  C CG  . MET A 82  ? 0.6003 0.7094 0.7285 -0.0049 0.0070  -0.1003 105 MET A CG  
574  S SD  . MET A 82  ? 0.6028 0.7110 0.7273 -0.0041 0.0073  -0.1003 105 MET A SD  
575  C CE  . MET A 82  ? 0.6375 0.7439 0.7665 -0.0042 0.0072  -0.1008 105 MET A CE  
576  N N   . ARG A 83  ? 0.6046 0.7132 0.7402 -0.0082 0.0117  -0.1058 106 ARG A N   
577  C CA  . ARG A 83  ? 0.6329 0.7409 0.7725 -0.0091 0.0127  -0.1075 106 ARG A CA  
578  C C   . ARG A 83  ? 0.5958 0.7029 0.7345 -0.0094 0.0142  -0.1089 106 ARG A C   
579  O O   . ARG A 83  ? 0.5424 0.6486 0.6844 -0.0099 0.0148  -0.1101 106 ARG A O   
580  C CB  . ARG A 83  ? 0.6951 0.8042 0.8358 -0.0100 0.0133  -0.1081 106 ARG A CB  
581  C CG  . ARG A 83  ? 0.7593 0.8690 0.9015 -0.0098 0.0119  -0.1068 106 ARG A CG  
582  C CD  . ARG A 83  ? 0.8531 0.9629 0.9999 -0.0107 0.0120  -0.1076 106 ARG A CD  
583  N NE  . ARG A 83  ? 0.8977 1.0080 1.0449 -0.0116 0.0136  -0.1092 106 ARG A NE  
584  C CZ  . ARG A 83  ? 0.9022 1.0138 1.0464 -0.0119 0.0143  -0.1092 106 ARG A CZ  
585  N NH1 . ARG A 83  ? 0.9030 1.0155 1.0433 -0.0112 0.0135  -0.1078 106 ARG A NH1 
586  N NH2 . ARG A 83  ? 0.8646 0.9766 1.0097 -0.0128 0.0157  -0.1108 106 ARG A NH2 
587  N N   . SER A 84  ? 0.5982 0.7057 0.7325 -0.0090 0.0146  -0.1087 107 SER A N   
588  C CA  . SER A 84  ? 0.6074 0.7142 0.7404 -0.0093 0.0159  -0.1099 107 SER A CA  
589  C C   . SER A 84  ? 0.6249 0.7308 0.7557 -0.0084 0.0154  -0.1091 107 SER A C   
590  O O   . SER A 84  ? 0.7065 0.8118 0.8359 -0.0085 0.0164  -0.1100 107 SER A O   
591  C CB  . SER A 84  ? 0.6212 0.7290 0.7507 -0.0097 0.0170  -0.1104 107 SER A CB  
592  O OG  . SER A 84  ? 0.6574 0.7659 0.7826 -0.0088 0.0162  -0.1090 107 SER A OG  
593  N N   . LYS A 85  ? 0.5792 0.6850 0.7093 -0.0074 0.0138  -0.1075 108 LYS A N   
594  C CA  . LYS A 85  ? 0.5637 0.6686 0.6921 -0.0066 0.0132  -0.1068 108 LYS A CA  
595  C C   . LYS A 85  ? 0.5470 0.6507 0.6794 -0.0065 0.0125  -0.1068 108 LYS A C   
596  O O   . LYS A 85  ? 0.5275 0.6315 0.6623 -0.0064 0.0115  -0.1060 108 LYS A O   
597  C CB  . LYS A 85  ? 0.5956 0.7012 0.7203 -0.0055 0.0119  -0.1051 108 LYS A CB  
598  C CG  . LYS A 85  ? 0.6669 0.7738 0.7878 -0.0055 0.0123  -0.1048 108 LYS A CG  
599  C CD  . LYS A 85  ? 0.7580 0.8648 0.8764 -0.0060 0.0138  -0.1060 108 LYS A CD  
600  C CE  . LYS A 85  ? 0.8380 0.9462 0.9530 -0.0061 0.0141  -0.1059 108 LYS A CE  
601  N NZ  . LYS A 85  ? 0.9150 1.0228 1.0271 -0.0063 0.0154  -0.1068 108 LYS A NZ  
602  N N   . MET A 86  ? 0.5531 0.6556 0.6862 -0.0065 0.0131  -0.1076 109 MET A N   
603  C CA  . MET A 86  ? 0.5476 0.6489 0.6844 -0.0064 0.0125  -0.1076 109 MET A CA  
604  C C   . MET A 86  ? 0.5980 0.6985 0.7329 -0.0053 0.0115  -0.1064 109 MET A C   
605  O O   . MET A 86  ? 0.6501 0.7507 0.7808 -0.0048 0.0117  -0.1061 109 MET A O   
606  C CB  . MET A 86  ? 0.5538 0.6542 0.6933 -0.0072 0.0140  -0.1095 109 MET A CB  
607  C CG  . MET A 86  ? 0.5835 0.6846 0.7242 -0.0083 0.0154  -0.1109 109 MET A CG  
608  S SD  . MET A 86  ? 0.6898 0.7919 0.8337 -0.0087 0.0146  -0.1105 109 MET A SD  
609  C CE  . MET A 86  ? 0.6482 0.7490 0.7981 -0.0088 0.0140  -0.1109 109 MET A CE  
610  N N   . PRO A 87  ? 0.5923 0.6920 0.7302 -0.0050 0.0104  -0.1059 110 PRO A N   
611  C CA  . PRO A 87  ? 0.6080 0.7068 0.7448 -0.0041 0.0096  -0.1049 110 PRO A CA  
612  C C   . PRO A 87  ? 0.6417 0.7396 0.7769 -0.0042 0.0107  -0.1060 110 PRO A C   
613  O O   . PRO A 87  ? 0.6602 0.7577 0.7974 -0.0050 0.0121  -0.1076 110 PRO A O   
614  C CB  . PRO A 87  ? 0.6290 0.7268 0.7705 -0.0042 0.0087  -0.1049 110 PRO A CB  
615  C CG  . PRO A 87  ? 0.6058 0.7043 0.7504 -0.0049 0.0086  -0.1051 110 PRO A CG  
616  C CD  . PRO A 87  ? 0.6173 0.7169 0.7600 -0.0055 0.0100  -0.1061 110 PRO A CD  
617  N N   . ASN A 88  ? 0.6605 0.7582 0.7922 -0.0034 0.0103  -0.1051 111 ASN A N   
618  C CA  . ASN A 88  ? 0.6591 0.7558 0.7892 -0.0033 0.0112  -0.1059 111 ASN A CA  
619  C C   . ASN A 88  ? 0.6224 0.7177 0.7550 -0.0030 0.0106  -0.1058 111 ASN A C   
620  O O   . ASN A 88  ? 0.5754 0.6704 0.7112 -0.0028 0.0095  -0.1051 111 ASN A O   
621  C CB  . ASN A 88  ? 0.7128 0.8099 0.8375 -0.0026 0.0110  -0.1050 111 ASN A CB  
622  C CG  . ASN A 88  ? 0.6771 0.7744 0.8003 -0.0015 0.0093  -0.1032 111 ASN A CG  
623  O OD1 . ASN A 88  ? 0.7096 0.8059 0.8341 -0.0010 0.0085  -0.1026 111 ASN A OD1 
624  N ND2 . ASN A 88  ? 0.6197 0.7183 0.7400 -0.0012 0.0088  -0.1022 111 ASN A ND2 
625  N N   . PRO A 89  ? 0.6672 0.7615 0.7985 -0.0029 0.0112  -0.1064 112 PRO A N   
626  C CA  . PRO A 89  ? 0.6538 0.7467 0.7875 -0.0026 0.0108  -0.1064 112 PRO A CA  
627  C C   . PRO A 89  ? 0.6094 0.7021 0.7427 -0.0016 0.0091  -0.1047 112 PRO A C   
628  O O   . PRO A 89  ? 0.5698 0.6615 0.7062 -0.0015 0.0085  -0.1046 112 PRO A O   
629  C CB  . PRO A 89  ? 0.6383 0.7305 0.7693 -0.0026 0.0119  -0.1072 112 PRO A CB  
630  C CG  . PRO A 89  ? 0.6207 0.7136 0.7509 -0.0035 0.0134  -0.1085 112 PRO A CG  
631  C CD  . PRO A 89  ? 0.6439 0.7382 0.7723 -0.0033 0.0127  -0.1075 112 PRO A CD  
632  N N   . ALA A 90  ? 0.5960 0.6894 0.7254 -0.0009 0.0083  -0.1033 113 ALA A N   
633  C CA  . ALA A 90  ? 0.5989 0.6921 0.7277 0.0000  0.0066  -0.1016 113 ALA A CA  
634  C C   . ALA A 90  ? 0.6029 0.6965 0.7353 0.0000  0.0056  -0.1010 113 ALA A C   
635  O O   . ALA A 90  ? 0.5790 0.6718 0.7137 0.0002  0.0045  -0.1003 113 ALA A O   
636  C CB  . ALA A 90  ? 0.5948 0.6889 0.7187 0.0008  0.0061  -0.1004 113 ALA A CB  
637  N N   . HIS A 91  ? 0.5996 0.6943 0.7325 -0.0006 0.0059  -0.1013 114 HIS A N   
638  C CA  . HIS A 91  ? 0.6110 0.7061 0.7475 -0.0009 0.0050  -0.1008 114 HIS A CA  
639  C C   . HIS A 91  ? 0.5876 0.6814 0.7289 -0.0012 0.0049  -0.1015 114 HIS A C   
640  O O   . HIS A 91  ? 0.6174 0.7109 0.7612 -0.0010 0.0035  -0.1005 114 HIS A O   
641  C CB  . HIS A 91  ? 0.6152 0.7114 0.7520 -0.0016 0.0057  -0.1014 114 HIS A CB  
642  C CG  . HIS A 91  ? 0.6612 0.7588 0.7940 -0.0012 0.0053  -0.1004 114 HIS A CG  
643  N ND1 . HIS A 91  ? 0.6656 0.7639 0.7950 -0.0014 0.0065  -0.1010 114 HIS A ND1 
644  C CD2 . HIS A 91  ? 0.7095 0.8078 0.8410 -0.0007 0.0039  -0.0988 114 HIS A CD2 
645  C CE1 . HIS A 91  ? 0.7006 0.8001 0.8270 -0.0009 0.0058  -0.0999 114 HIS A CE1 
646  N NE2 . HIS A 91  ? 0.7619 0.8614 0.8894 -0.0005 0.0043  -0.0986 114 HIS A NE2 
647  N N   . LEU A 92  ? 0.5612 0.6544 0.7037 -0.0018 0.0063  -0.1031 115 LEU A N   
648  C CA  . LEU A 92  ? 0.5796 0.6718 0.7269 -0.0023 0.0065  -0.1041 115 LEU A CA  
649  C C   . LEU A 92  ? 0.5999 0.6908 0.7478 -0.0017 0.0057  -0.1035 115 LEU A C   
650  O O   . LEU A 92  ? 0.6251 0.7155 0.7765 -0.0016 0.0047  -0.1031 115 LEU A O   
651  C CB  . LEU A 92  ? 0.5565 0.6485 0.7048 -0.0032 0.0084  -0.1061 115 LEU A CB  
652  C CG  . LEU A 92  ? 0.5618 0.6549 0.7115 -0.0040 0.0090  -0.1068 115 LEU A CG  
653  C CD1 . LEU A 92  ? 0.5884 0.6821 0.7360 -0.0047 0.0107  -0.1081 115 LEU A CD1 
654  C CD2 . LEU A 92  ? 0.5356 0.6282 0.6908 -0.0046 0.0088  -0.1075 115 LEU A CD2 
655  N N   . ALA A 93  ? 0.6253 0.7159 0.7698 -0.0012 0.0062  -0.1035 116 ALA A N   
656  C CA  . ALA A 93  ? 0.6108 0.7001 0.7555 -0.0006 0.0055  -0.1030 116 ALA A CA  
657  C C   . ALA A 93  ? 0.6050 0.6942 0.7507 0.0000  0.0036  -0.1013 116 ALA A C   
658  O O   . ALA A 93  ? 0.5733 0.6614 0.7219 0.0001  0.0029  -0.1012 116 ALA A O   
659  C CB  . ALA A 93  ? 0.6306 0.7198 0.7705 -0.0001 0.0059  -0.1028 116 ALA A CB  
660  N N   . ILE A 94  ? 0.5787 0.6690 0.7218 0.0003  0.0028  -0.1001 117 ILE A N   
661  C CA  . ILE A 94  ? 0.5516 0.6420 0.6954 0.0008  0.0010  -0.0984 117 ILE A CA  
662  C C   . ILE A 94  ? 0.5655 0.6556 0.7144 0.0002  0.0006  -0.0987 117 ILE A C   
663  O O   . ILE A 94  ? 0.5985 0.6877 0.7499 0.0005  -0.0004 -0.0981 117 ILE A O   
664  C CB  . ILE A 94  ? 0.5696 0.6614 0.7101 0.0011  0.0005  -0.0973 117 ILE A CB  
665  C CG1 . ILE A 94  ? 0.5515 0.6434 0.6869 0.0019  0.0006  -0.0967 117 ILE A CG1 
666  C CG2 . ILE A 94  ? 0.6108 0.7028 0.7527 0.0014  -0.0012 -0.0958 117 ILE A CG2 
667  C CD1 . ILE A 94  ? 0.5244 0.6179 0.6563 0.0020  0.0006  -0.0961 117 ILE A CD1 
668  N N   . ALA A 95  ? 0.5486 0.6395 0.6991 -0.0005 0.0013  -0.0996 118 ALA A N   
669  C CA  . ALA A 95  ? 0.5326 0.6233 0.6880 -0.0011 0.0009  -0.0999 118 ALA A CA  
670  C C   . ALA A 95  ? 0.5200 0.6093 0.6796 -0.0013 0.0010  -0.1008 118 ALA A C   
671  O O   . ALA A 95  ? 0.5009 0.5896 0.6641 -0.0013 0.0000  -0.1004 118 ALA A O   
672  C CB  . ALA A 95  ? 0.5246 0.6163 0.6809 -0.0019 0.0020  -0.1010 118 ALA A CB  
673  N N   . GLU A 96  ? 0.5187 0.6074 0.6777 -0.0014 0.0023  -0.1021 119 GLU A N   
674  C CA  . GLU A 96  ? 0.5290 0.6164 0.6918 -0.0017 0.0026  -0.1031 119 GLU A CA  
675  C C   . GLU A 96  ? 0.5229 0.6094 0.6854 -0.0008 0.0013  -0.1018 119 GLU A C   
676  O O   . GLU A 96  ? 0.5014 0.5870 0.6676 -0.0009 0.0005  -0.1018 119 GLU A O   
677  C CB  . GLU A 96  ? 0.5104 0.5976 0.6729 -0.0022 0.0045  -0.1050 119 GLU A CB  
678  C CG  . GLU A 96  ? 0.5268 0.6151 0.6896 -0.0031 0.0057  -0.1061 119 GLU A CG  
679  C CD  . GLU A 96  ? 0.5616 0.6495 0.7262 -0.0039 0.0075  -0.1082 119 GLU A CD  
680  O OE1 . GLU A 96  ? 0.5593 0.6463 0.7228 -0.0037 0.0081  -0.1087 119 GLU A OE1 
681  O OE2 . GLU A 96  ? 0.5061 0.5947 0.6730 -0.0047 0.0084  -0.1093 119 GLU A OE2 
682  N N   . CYS A 97  ? 0.5302 0.6169 0.6880 -0.0001 0.0009  -0.1007 120 CYS A N   
683  C CA  . CYS A 97  ? 0.5483 0.6342 0.7052 0.0006  -0.0003 -0.0994 120 CYS A CA  
684  C C   . CYS A 97  ? 0.5192 0.6050 0.6789 0.0008  -0.0021 -0.0982 120 CYS A C   
685  O O   . CYS A 97  ? 0.4662 0.5508 0.6288 0.0009  -0.0029 -0.0979 120 CYS A O   
686  C CB  . CYS A 97  ? 0.5780 0.6644 0.7294 0.0014  -0.0005 -0.0984 120 CYS A CB  
687  S SG  . CYS A 97  ? 0.5947 0.6802 0.7445 0.0024  -0.0018 -0.0969 120 CYS A SG  
688  N N   . GLU A 98  ? 0.5179 0.6049 0.6767 0.0007  -0.0026 -0.0973 121 GLU A N   
689  C CA  . GLU A 98  ? 0.5438 0.6307 0.7046 0.0007  -0.0043 -0.0960 121 GLU A CA  
690  C C   . GLU A 98  ? 0.5876 0.6736 0.7540 0.0002  -0.0045 -0.0969 121 GLU A C   
691  O O   . GLU A 98  ? 0.6221 0.7073 0.7908 0.0004  -0.0058 -0.0960 121 GLU A O   
692  C CB  . GLU A 98  ? 0.5433 0.6317 0.7027 0.0005  -0.0044 -0.0955 121 GLU A CB  
693  C CG  . GLU A 98  ? 0.5591 0.6477 0.7208 0.0003  -0.0060 -0.0944 121 GLU A CG  
694  C CD  . GLU A 98  ? 0.5785 0.6686 0.7387 0.0000  -0.0059 -0.0941 121 GLU A CD  
695  O OE1 . GLU A 98  ? 0.6129 0.7039 0.7697 0.0000  -0.0047 -0.0946 121 GLU A OE1 
696  O OE2 . GLU A 98  ? 0.5605 0.6508 0.7229 -0.0002 -0.0069 -0.0934 121 GLU A OE2 
697  N N   . ALA A 99  ? 0.5843 0.6705 0.7528 -0.0005 -0.0031 -0.0985 122 ALA A N   
698  C CA  . ALA A 99  ? 0.5665 0.6520 0.7404 -0.0011 -0.0030 -0.0996 122 ALA A CA  
699  C C   . ALA A 99  ? 0.5613 0.6453 0.7371 -0.0008 -0.0032 -0.0999 122 ALA A C   
700  O O   . ALA A 99  ? 0.6331 0.7163 0.8120 -0.0007 -0.0045 -0.0993 122 ALA A O   
701  C CB  . ALA A 99  ? 0.5710 0.6570 0.7463 -0.0019 -0.0013 -0.1014 122 ALA A CB  
702  N N   . ARG A 100 ? 0.5633 0.6470 0.7370 -0.0007 -0.0020 -0.1008 123 ARG A N   
703  C CA  . ARG A 100 ? 0.5859 0.6683 0.7613 -0.0005 -0.0019 -0.1012 123 ARG A CA  
704  C C   . ARG A 100 ? 0.5953 0.6769 0.7703 0.0002  -0.0038 -0.0994 123 ARG A C   
705  O O   . ARG A 100 ? 0.6109 0.6915 0.7896 0.0002  -0.0046 -0.0994 123 ARG A O   
706  C CB  . ARG A 100 ? 0.6370 0.7194 0.8090 -0.0003 -0.0005 -0.1021 123 ARG A CB  
707  C CG  . ARG A 100 ? 0.6923 0.7733 0.8656 -0.0002 -0.0001 -0.1028 123 ARG A CG  
708  C CD  . ARG A 100 ? 0.7493 0.8303 0.9201 -0.0004 0.0016  -0.1042 123 ARG A CD  
709  N NE  . ARG A 100 ? 0.8532 0.9347 1.0186 0.0002  0.0015  -0.1031 123 ARG A NE  
710  C CZ  . ARG A 100 ? 0.9737 1.0563 1.1354 0.0002  0.0021  -0.1030 123 ARG A CZ  
711  N NH1 . ARG A 100 ? 0.8831 0.9666 1.0459 -0.0005 0.0029  -0.1038 123 ARG A NH1 
712  N NH2 . ARG A 100 ? 0.9771 1.0599 1.1339 0.0009  0.0018  -0.1020 123 ARG A NH2 
713  N N   . LEU A 101 ? 0.5950 0.6773 0.7657 0.0009  -0.0045 -0.0979 124 LEU A N   
714  C CA  . LEU A 101 ? 0.6147 0.6964 0.7847 0.0016  -0.0062 -0.0963 124 LEU A CA  
715  C C   . LEU A 101 ? 0.6159 0.6975 0.7891 0.0014  -0.0078 -0.0953 124 LEU A C   
716  O O   . LEU A 101 ? 0.6470 0.7276 0.8216 0.0017  -0.0091 -0.0943 124 LEU A O   
717  C CB  . LEU A 101 ? 0.6383 0.7207 0.8029 0.0023  -0.0066 -0.0949 124 LEU A CB  
718  C CG  . LEU A 101 ? 0.6753 0.7571 0.8370 0.0028  -0.0058 -0.0952 124 LEU A CG  
719  C CD1 . LEU A 101 ? 0.7148 0.7966 0.8767 0.0023  -0.0039 -0.0972 124 LEU A CD1 
720  C CD2 . LEU A 101 ? 0.6723 0.7548 0.8286 0.0036  -0.0062 -0.0940 124 LEU A CD2 
721  N N   . GLY A 102 ? 0.6042 0.6867 0.7784 0.0008  -0.0077 -0.0954 125 GLY A N   
722  C CA  . GLY A 102 ? 0.6181 0.7006 0.7955 0.0006  -0.0092 -0.0945 125 GLY A CA  
723  C C   . GLY A 102 ? 0.6305 0.7116 0.8129 0.0003  -0.0096 -0.0951 125 GLY A C   
724  O O   . GLY A 102 ? 0.6587 0.7392 0.8430 0.0005  -0.0113 -0.0939 125 GLY A O   
725  N N   . GLN A 103 ? 0.6758 0.7566 0.8605 0.0000  -0.0082 -0.0970 126 GLN A N   
726  C CA  . GLN A 103 ? 0.7256 0.8052 0.9154 -0.0003 -0.0083 -0.0979 126 GLN A CA  
727  C C   . GLN A 103 ? 0.6954 0.7738 0.8853 0.0002  -0.0092 -0.0971 126 GLN A C   
728  O O   . GLN A 103 ? 0.6377 0.7151 0.8316 0.0001  -0.0102 -0.0971 126 GLN A O   
729  C CB  . GLN A 103 ? 0.8161 0.8958 1.0075 -0.0009 -0.0063 -0.1001 126 GLN A CB  
730  C CG  . GLN A 103 ? 0.8447 0.9253 1.0380 -0.0017 -0.0056 -0.1010 126 GLN A CG  
731  C CD  . GLN A 103 ? 0.9570 1.0370 1.1560 -0.0022 -0.0066 -0.1013 126 GLN A CD  
732  O OE1 . GLN A 103 ? 1.1220 1.2008 1.3245 -0.0021 -0.0069 -0.1017 126 GLN A OE1 
733  N NE2 . GLN A 103 ? 0.9762 1.0569 1.1763 -0.0026 -0.0070 -0.1010 126 GLN A NE2 
734  N N   . GLN A 104 ? 0.6810 0.7594 0.8663 0.0008  -0.0089 -0.0966 127 GLN A N   
735  C CA  . GLN A 104 ? 0.6622 0.7396 0.8468 0.0015  -0.0098 -0.0958 127 GLN A CA  
736  C C   . GLN A 104 ? 0.6467 0.7241 0.8298 0.0020  -0.0118 -0.0936 127 GLN A C   
737  O O   . GLN A 104 ? 0.5705 0.6472 0.7522 0.0026  -0.0126 -0.0926 127 GLN A O   
738  C CB  . GLN A 104 ? 0.6185 0.6959 0.7986 0.0020  -0.0087 -0.0961 127 GLN A CB  
739  C CG  . GLN A 104 ? 0.6405 0.7180 0.8211 0.0015  -0.0066 -0.0981 127 GLN A CG  
740  C CD  . GLN A 104 ? 0.6652 0.7430 0.8408 0.0020  -0.0056 -0.0982 127 GLN A CD  
741  O OE1 . GLN A 104 ? 0.5964 0.6741 0.7687 0.0027  -0.0064 -0.0968 127 GLN A OE1 
742  N NE2 . GLN A 104 ? 0.7401 0.8182 0.9150 0.0015  -0.0038 -0.0998 127 GLN A NE2 
743  N N   . GLY A 105 ? 0.7039 0.7821 0.8872 0.0017  -0.0125 -0.0928 128 GLY A N   
744  C CA  . GLY A 105 ? 0.7199 0.7983 0.9015 0.0022  -0.0144 -0.0907 128 GLY A CA  
745  C C   . GLY A 105 ? 0.6734 0.7526 0.8493 0.0028  -0.0144 -0.0896 128 GLY A C   
746  O O   . GLY A 105 ? 0.6458 0.7250 0.8201 0.0032  -0.0158 -0.0880 128 GLY A O   
747  N N   . ARG A 106 ? 0.6892 0.7691 0.8621 0.0029  -0.0128 -0.0906 129 ARG A N   
748  C CA  . ARG A 106 ? 0.6735 0.7543 0.8411 0.0035  -0.0127 -0.0897 129 ARG A CA  
749  C C   . ARG A 106 ? 0.6839 0.7661 0.8499 0.0031  -0.0124 -0.0896 129 ARG A C   
750  O O   . ARG A 106 ? 0.7034 0.7859 0.8722 0.0024  -0.0118 -0.0906 129 ARG A O   
751  C CB  . ARG A 106 ? 0.6580 0.7385 0.8230 0.0038  -0.0113 -0.0907 129 ARG A CB  
752  C CG  . ARG A 106 ? 0.6620 0.7410 0.8289 0.0041  -0.0115 -0.0910 129 ARG A CG  
753  C CD  . ARG A 106 ? 0.7021 0.7807 0.8683 0.0040  -0.0097 -0.0926 129 ARG A CD  
754  N NE  . ARG A 106 ? 0.7176 0.7966 0.8788 0.0047  -0.0093 -0.0921 129 ARG A NE  
755  C CZ  . ARG A 106 ? 0.6841 0.7631 0.8430 0.0047  -0.0078 -0.0933 129 ARG A CZ  
756  N NH1 . ARG A 106 ? 0.6089 0.6878 0.7702 0.0040  -0.0063 -0.0950 129 ARG A NH1 
757  N NH2 . ARG A 106 ? 0.7425 0.8217 0.8969 0.0053  -0.0076 -0.0927 129 ARG A NH2 
758  N N   . SER A 107 ? 0.6871 0.7703 0.8487 0.0036  -0.0127 -0.0885 130 SER A N   
759  C CA  . SER A 107 ? 0.7378 0.8224 0.8978 0.0034  -0.0127 -0.0881 130 SER A CA  
760  C C   . SER A 107 ? 0.7457 0.8313 0.9011 0.0036  -0.0114 -0.0885 130 SER A C   
761  O O   . SER A 107 ? 0.7635 0.8489 0.9157 0.0043  -0.0111 -0.0883 130 SER A O   
762  C CB  . SER A 107 ? 0.7411 0.8260 0.9003 0.0036  -0.0145 -0.0862 130 SER A CB  
763  O OG  . SER A 107 ? 0.7942 0.8804 0.9488 0.0040  -0.0145 -0.0854 130 SER A OG  
764  N N   . VAL A 108 ? 0.6903 0.7771 0.8456 0.0031  -0.0106 -0.0892 131 VAL A N   
765  C CA  . VAL A 108 ? 0.5805 0.6684 0.7317 0.0032  -0.0093 -0.0897 131 VAL A CA  
766  C C   . VAL A 108 ? 0.5387 0.6280 0.6891 0.0029  -0.0096 -0.0892 131 VAL A C   
767  O O   . VAL A 108 ? 0.5784 0.6678 0.7320 0.0022  -0.0094 -0.0898 131 VAL A O   
768  C CB  . VAL A 108 ? 0.5196 0.6072 0.6716 0.0028  -0.0075 -0.0916 131 VAL A CB  
769  C CG1 . VAL A 108 ? 0.5084 0.5972 0.6562 0.0029  -0.0063 -0.0920 131 VAL A CG1 
770  C CG2 . VAL A 108 ? 0.5232 0.6094 0.6757 0.0031  -0.0071 -0.0921 131 VAL A CG2 
771  N N   . VAL A 109 ? 0.5288 0.6191 0.6751 0.0034  -0.0100 -0.0881 132 VAL A N   
772  C CA  . VAL A 109 ? 0.5514 0.6432 0.6964 0.0031  -0.0103 -0.0874 132 VAL A CA  
773  C C   . VAL A 109 ? 0.5595 0.6525 0.7001 0.0034  -0.0092 -0.0878 132 VAL A C   
774  O O   . VAL A 109 ? 0.6327 0.7255 0.7701 0.0041  -0.0090 -0.0877 132 VAL A O   
775  C CB  . VAL A 109 ? 0.5708 0.6628 0.7154 0.0034  -0.0122 -0.0856 132 VAL A CB  
776  C CG1 . VAL A 109 ? 0.6023 0.6933 0.7456 0.0042  -0.0131 -0.0847 132 VAL A CG1 
777  C CG2 . VAL A 109 ? 0.5762 0.6698 0.7172 0.0036  -0.0125 -0.0847 132 VAL A CG2 
778  N N   . ILE A 110 ? 0.5179 0.6120 0.6583 0.0029  -0.0086 -0.0882 133 ILE A N   
779  C CA  . ILE A 110 ? 0.5235 0.6187 0.6599 0.0030  -0.0076 -0.0886 133 ILE A CA  
780  C C   . ILE A 110 ? 0.5435 0.6402 0.6776 0.0032  -0.0085 -0.0873 133 ILE A C   
781  O O   . ILE A 110 ? 0.5926 0.6897 0.7287 0.0027  -0.0093 -0.0868 133 ILE A O   
782  C CB  . ILE A 110 ? 0.5533 0.6488 0.6911 0.0023  -0.0060 -0.0902 133 ILE A CB  
783  C CG1 . ILE A 110 ? 0.5765 0.6708 0.7161 0.0021  -0.0050 -0.0916 133 ILE A CG1 
784  C CG2 . ILE A 110 ? 0.6036 0.7004 0.7373 0.0024  -0.0051 -0.0904 133 ILE A CG2 
785  C CD1 . ILE A 110 ? 0.6288 0.7218 0.7734 0.0017  -0.0055 -0.0919 133 ILE A CD1 
786  N N   . ILE A 111 ? 0.5330 0.6304 0.6627 0.0038  -0.0084 -0.0868 134 ILE A N   
787  C CA  . ILE A 111 ? 0.5388 0.6376 0.6657 0.0040  -0.0091 -0.0857 134 ILE A CA  
788  C C   . ILE A 111 ? 0.5049 0.6048 0.6286 0.0041  -0.0078 -0.0865 134 ILE A C   
789  O O   . ILE A 111 ? 0.5183 0.6179 0.6393 0.0046  -0.0072 -0.0868 134 ILE A O   
790  C CB  . ILE A 111 ? 0.5949 0.6936 0.7190 0.0049  -0.0102 -0.0843 134 ILE A CB  
791  C CG1 . ILE A 111 ? 0.5940 0.6916 0.7211 0.0049  -0.0116 -0.0835 134 ILE A CG1 
792  C CG2 . ILE A 111 ? 0.6012 0.7016 0.7221 0.0052  -0.0109 -0.0832 134 ILE A CG2 
793  C CD1 . ILE A 111 ? 0.6120 0.7089 0.7370 0.0058  -0.0122 -0.0828 134 ILE A CD1 
794  N N   . THR A 112 ? 0.4695 0.5705 0.5936 0.0035  -0.0073 -0.0869 135 THR A N   
795  C CA  . THR A 112 ? 0.4734 0.5753 0.5950 0.0034  -0.0059 -0.0878 135 THR A CA  
796  C C   . THR A 112 ? 0.4892 0.5928 0.6082 0.0034  -0.0062 -0.0871 135 THR A C   
797  O O   . THR A 112 ? 0.5030 0.6072 0.6236 0.0030  -0.0070 -0.0864 135 THR A O   
798  C CB  . THR A 112 ? 0.4905 0.5920 0.6150 0.0025  -0.0046 -0.0894 135 THR A CB  
799  O OG1 . THR A 112 ? 0.5209 0.6233 0.6427 0.0024  -0.0033 -0.0903 135 THR A OG1 
800  C CG2 . THR A 112 ? 0.4884 0.5902 0.6164 0.0017  -0.0050 -0.0894 135 THR A CG2 
801  N N   . GLN A 113 ? 0.5036 0.6080 0.6186 0.0038  -0.0055 -0.0873 136 GLN A N   
802  C CA  . GLN A 113 ? 0.5219 0.6280 0.6342 0.0038  -0.0055 -0.0869 136 GLN A CA  
803  C C   . GLN A 113 ? 0.5066 0.6133 0.6195 0.0031  -0.0042 -0.0881 136 GLN A C   
804  O O   . GLN A 113 ? 0.4931 0.6013 0.6042 0.0029  -0.0041 -0.0880 136 GLN A O   
805  C CB  . GLN A 113 ? 0.5969 0.7037 0.7046 0.0047  -0.0056 -0.0864 136 GLN A CB  
806  C CG  . GLN A 113 ? 0.6942 0.8005 0.7998 0.0049  -0.0043 -0.0875 136 GLN A CG  
807  C CD  . GLN A 113 ? 0.7399 0.8477 0.8415 0.0052  -0.0039 -0.0874 136 GLN A CD  
808  O OE1 . GLN A 113 ? 0.8447 0.9523 0.9431 0.0059  -0.0037 -0.0874 136 GLN A OE1 
809  N NE2 . GLN A 113 ? 0.7248 0.8340 0.8263 0.0047  -0.0038 -0.0874 136 GLN A NE2 
810  N N   . ASN A 114 ? 0.4997 0.6054 0.6154 0.0025  -0.0033 -0.0894 137 ASN A N   
811  C CA  . ASN A 114 ? 0.5131 0.6193 0.6295 0.0018  -0.0020 -0.0906 137 ASN A CA  
812  C C   . ASN A 114 ? 0.5390 0.6457 0.6588 0.0010  -0.0023 -0.0906 137 ASN A C   
813  O O   . ASN A 114 ? 0.5231 0.6292 0.6457 0.0009  -0.0034 -0.0899 137 ASN A O   
814  C CB  . ASN A 114 ? 0.5396 0.6446 0.6570 0.0015  -0.0007 -0.0920 137 ASN A CB  
815  C CG  . ASN A 114 ? 0.5806 0.6853 0.6943 0.0023  -0.0004 -0.0920 137 ASN A CG  
816  O OD1 . ASN A 114 ? 0.6222 0.7280 0.7321 0.0027  -0.0003 -0.0916 137 ASN A OD1 
817  N ND2 . ASN A 114 ? 0.5679 0.6711 0.6824 0.0026  -0.0004 -0.0923 137 ASN A ND2 
818  N N   . ILE A 115 ? 0.5527 0.6605 0.6721 0.0004  -0.0015 -0.0912 138 ILE A N   
819  C CA  . ILE A 115 ? 0.5671 0.6754 0.6893 -0.0002 -0.0018 -0.0912 138 ILE A CA  
820  C C   . ILE A 115 ? 0.5896 0.6977 0.7147 -0.0012 -0.0005 -0.0928 138 ILE A C   
821  O O   . ILE A 115 ? 0.6380 0.7467 0.7650 -0.0018 -0.0005 -0.0930 138 ILE A O   
822  C CB  . ILE A 115 ? 0.5218 0.6319 0.6414 -0.0002 -0.0023 -0.0903 138 ILE A CB  
823  C CG1 . ILE A 115 ? 0.5127 0.6237 0.6287 -0.0001 -0.0011 -0.0910 138 ILE A CG1 
824  C CG2 . ILE A 115 ? 0.5513 0.6616 0.6689 0.0005  -0.0038 -0.0887 138 ILE A CG2 
825  C CD1 . ILE A 115 ? 0.5036 0.6164 0.6181 -0.0003 -0.0013 -0.0905 138 ILE A CD1 
826  N N   . ASP A 116 ? 0.5837 0.6907 0.7090 -0.0012 0.0006  -0.0940 139 ASP A N   
827  C CA  . ASP A 116 ? 0.5503 0.6571 0.6776 -0.0021 0.0020  -0.0957 139 ASP A CA  
828  C C   . ASP A 116 ? 0.5283 0.6339 0.6606 -0.0026 0.0020  -0.0963 139 ASP A C   
829  O O   . ASP A 116 ? 0.5812 0.6865 0.7157 -0.0033 0.0032  -0.0978 139 ASP A O   
830  C CB  . ASP A 116 ? 0.5275 0.6342 0.6522 -0.0019 0.0034  -0.0966 139 ASP A CB  
831  C CG  . ASP A 116 ? 0.5266 0.6320 0.6501 -0.0012 0.0030  -0.0963 139 ASP A CG  
832  O OD1 . ASP A 116 ? 0.4680 0.5722 0.5946 -0.0012 0.0025  -0.0963 139 ASP A OD1 
833  O OD2 . ASP A 116 ? 0.5567 0.6624 0.6764 -0.0006 0.0031  -0.0960 139 ASP A OD2 
834  N N   . GLU A 117 ? 0.5079 0.6129 0.6420 -0.0022 0.0006  -0.0953 140 GLU A N   
835  C CA  . GLU A 117 ? 0.4814 0.5850 0.6202 -0.0027 0.0004  -0.0958 140 GLU A CA  
836  C C   . GLU A 117 ? 0.4894 0.5918 0.6296 -0.0029 0.0016  -0.0973 140 GLU A C   
837  O O   . GLU A 117 ? 0.4810 0.5825 0.6253 -0.0033 0.0017  -0.0980 140 GLU A O   
838  C CB  . GLU A 117 ? 0.4498 0.5540 0.5920 -0.0035 0.0003  -0.0962 140 GLU A CB  
839  C CG  . GLU A 117 ? 0.4691 0.5734 0.6127 -0.0034 -0.0014 -0.0946 140 GLU A CG  
840  C CD  . GLU A 117 ? 0.4860 0.5910 0.6324 -0.0042 -0.0016 -0.0947 140 GLU A CD  
841  O OE1 . GLU A 117 ? 0.4717 0.5766 0.6201 -0.0049 -0.0004 -0.0961 140 GLU A OE1 
842  O OE2 . GLU A 117 ? 0.5185 0.6239 0.6649 -0.0041 -0.0030 -0.0933 140 GLU A OE2 
843  N N   . LEU A 118 ? 0.4812 0.5836 0.6180 -0.0025 0.0025  -0.0977 141 LEU A N   
844  C CA  . LEU A 118 ? 0.4626 0.5639 0.6006 -0.0027 0.0037  -0.0991 141 LEU A CA  
845  C C   . LEU A 118 ? 0.4880 0.5878 0.6285 -0.0024 0.0029  -0.0989 141 LEU A C   
846  O O   . LEU A 118 ? 0.5237 0.6226 0.6671 -0.0028 0.0037  -0.1001 141 LEU A O   
847  C CB  . LEU A 118 ? 0.4441 0.5456 0.5778 -0.0023 0.0046  -0.0995 141 LEU A CB  
848  C CG  . LEU A 118 ? 0.4683 0.5710 0.5999 -0.0029 0.0058  -0.1002 141 LEU A CG  
849  C CD1 . LEU A 118 ? 0.4510 0.5539 0.5778 -0.0024 0.0065  -0.1002 141 LEU A CD1 
850  C CD2 . LEU A 118 ? 0.5122 0.6145 0.6470 -0.0039 0.0071  -0.1020 141 LEU A CD2 
851  N N   . HIS A 119 ? 0.5436 0.6432 0.6833 -0.0017 0.0014  -0.0973 142 HIS A N   
852  C CA  . HIS A 119 ? 0.5889 0.6872 0.7313 -0.0014 0.0007  -0.0971 142 HIS A CA  
853  C C   . HIS A 119 ? 0.5761 0.6737 0.7237 -0.0021 0.0004  -0.0976 142 HIS A C   
854  O O   . HIS A 119 ? 0.5537 0.6502 0.7043 -0.0022 0.0005  -0.0983 142 HIS A O   
855  C CB  . HIS A 119 ? 0.6214 0.7197 0.7618 -0.0005 -0.0009 -0.0952 142 HIS A CB  
856  C CG  . HIS A 119 ? 0.6126 0.7108 0.7486 0.0002  -0.0007 -0.0948 142 HIS A CG  
857  N ND1 . HIS A 119 ? 0.6222 0.7193 0.7580 0.0004  0.0000  -0.0956 142 HIS A ND1 
858  C CD2 . HIS A 119 ? 0.5640 0.6631 0.6957 0.0008  -0.0012 -0.0938 142 HIS A CD2 
859  C CE1 . HIS A 119 ? 0.5594 0.6567 0.6909 0.0011  0.0000  -0.0950 142 HIS A CE1 
860  N NE2 . HIS A 119 ? 0.5289 0.6275 0.6580 0.0014  -0.0008 -0.0939 142 HIS A NE2 
861  N N   . HIS A 120 ? 0.5752 0.6738 0.7241 -0.0026 0.0001  -0.0974 143 HIS A N   
862  C CA  . HIS A 120 ? 0.5938 0.6919 0.7476 -0.0032 -0.0002 -0.0978 143 HIS A CA  
863  C C   . HIS A 120 ? 0.5548 0.6526 0.7109 -0.0040 0.0013  -0.0997 143 HIS A C   
864  O O   . HIS A 120 ? 0.5848 0.6816 0.7449 -0.0043 0.0014  -0.1005 143 HIS A O   
865  C CB  . HIS A 120 ? 0.6221 0.7213 0.7762 -0.0034 -0.0012 -0.0967 143 HIS A CB  
866  C CG  . HIS A 120 ? 0.7360 0.8358 0.8868 -0.0027 -0.0026 -0.0949 143 HIS A CG  
867  N ND1 . HIS A 120 ? 0.8067 0.9061 0.9590 -0.0025 -0.0043 -0.0935 143 HIS A ND1 
868  C CD2 . HIS A 120 ? 0.7329 0.8334 0.8789 -0.0020 -0.0025 -0.0942 143 HIS A CD2 
869  C CE1 . HIS A 120 ? 0.7753 0.8754 0.9240 -0.0018 -0.0052 -0.0921 143 HIS A CE1 
870  N NE2 . HIS A 120 ? 0.7627 0.8634 0.9075 -0.0015 -0.0041 -0.0925 143 HIS A NE2 
871  N N   . ARG A 121 ? 0.5241 0.6229 0.6776 -0.0042 0.0026  -0.1005 144 ARG A N   
872  C CA  . ARG A 121 ? 0.5145 0.6132 0.6697 -0.0050 0.0043  -0.1024 144 ARG A CA  
873  C C   . ARG A 121 ? 0.5367 0.6341 0.6926 -0.0049 0.0051  -0.1034 144 ARG A C   
874  O O   . ARG A 121 ? 0.6065 0.7034 0.7650 -0.0056 0.0063  -0.1050 144 ARG A O   
875  C CB  . ARG A 121 ? 0.4820 0.5819 0.6337 -0.0053 0.0055  -0.1029 144 ARG A CB  
876  C CG  . ARG A 121 ? 0.4877 0.5887 0.6398 -0.0057 0.0050  -0.1024 144 ARG A CG  
877  C CD  . ARG A 121 ? 0.5128 0.6152 0.6611 -0.0058 0.0060  -0.1027 144 ARG A CD  
878  N NE  . ARG A 121 ? 0.5087 0.6109 0.6570 -0.0064 0.0078  -0.1045 144 ARG A NE  
879  C CZ  . ARG A 121 ? 0.5240 0.6271 0.6690 -0.0066 0.0089  -0.1050 144 ARG A CZ  
880  N NH1 . ARG A 121 ? 0.5811 0.6854 0.7225 -0.0062 0.0085  -0.1039 144 ARG A NH1 
881  N NH2 . ARG A 121 ? 0.5273 0.6301 0.6726 -0.0072 0.0105  -0.1066 144 ARG A NH2 
882  N N   . ALA A 122 ? 0.4981 0.5948 0.6517 -0.0041 0.0044  -0.1024 145 ALA A N   
883  C CA  . ALA A 122 ? 0.5291 0.6246 0.6834 -0.0040 0.0050  -0.1033 145 ALA A CA  
884  C C   . ALA A 122 ? 0.5358 0.6302 0.6946 -0.0039 0.0040  -0.1031 145 ALA A C   
885  O O   . ALA A 122 ? 0.5088 0.6021 0.6694 -0.0040 0.0045  -0.1040 145 ALA A O   
886  C CB  . ALA A 122 ? 0.5525 0.6478 0.7023 -0.0031 0.0047  -0.1024 145 ALA A CB  
887  N N   . GLY A 123 ? 0.5434 0.6380 0.7040 -0.0039 0.0025  -0.1019 146 GLY A N   
888  C CA  . GLY A 123 ? 0.5162 0.6097 0.6808 -0.0038 0.0013  -0.1015 146 GLY A CA  
889  C C   . GLY A 123 ? 0.5141 0.6071 0.6772 -0.0029 -0.0001 -0.0998 146 GLY A C   
890  O O   . GLY A 123 ? 0.4907 0.5825 0.6566 -0.0027 -0.0009 -0.0996 146 GLY A O   
891  N N   . SER A 124 ? 0.5532 0.6470 0.7119 -0.0023 -0.0006 -0.0985 147 SER A N   
892  C CA  . SER A 124 ? 0.5904 0.6839 0.7478 -0.0015 -0.0023 -0.0968 147 SER A CA  
893  C C   . SER A 124 ? 0.5941 0.6879 0.7538 -0.0017 -0.0037 -0.0957 147 SER A C   
894  O O   . SER A 124 ? 0.6213 0.7160 0.7814 -0.0023 -0.0034 -0.0960 147 SER A O   
895  C CB  . SER A 124 ? 0.5669 0.6611 0.7189 -0.0008 -0.0023 -0.0959 147 SER A CB  
896  O OG  . SER A 124 ? 0.6223 0.7156 0.7729 -0.0004 -0.0015 -0.0966 147 SER A OG  
897  N N   . LYS A 125 ? 0.5714 0.6643 0.7328 -0.0014 -0.0052 -0.0946 148 LYS A N   
898  C CA  . LYS A 125 ? 0.5900 0.6829 0.7539 -0.0016 -0.0067 -0.0936 148 LYS A CA  
899  C C   . LYS A 125 ? 0.5694 0.6629 0.7302 -0.0010 -0.0082 -0.0916 148 LYS A C   
900  O O   . LYS A 125 ? 0.5699 0.6644 0.7299 -0.0012 -0.0088 -0.0908 148 LYS A O   
901  C CB  . LYS A 125 ? 0.6275 0.7190 0.7963 -0.0018 -0.0075 -0.0938 148 LYS A CB  
902  C CG  . LYS A 125 ? 0.6847 0.7756 0.8571 -0.0024 -0.0061 -0.0957 148 LYS A CG  
903  C CD  . LYS A 125 ? 0.7730 0.8648 0.9475 -0.0032 -0.0056 -0.0965 148 LYS A CD  
904  C CE  . LYS A 125 ? 0.8509 0.9422 1.0288 -0.0039 -0.0041 -0.0986 148 LYS A CE  
905  N NZ  . LYS A 125 ? 0.9000 0.9924 1.0777 -0.0046 -0.0030 -0.0995 148 LYS A NZ  
906  N N   . HIS A 126 ? 0.5991 0.6918 0.7583 -0.0003 -0.0088 -0.0909 149 HIS A N   
907  C CA  . HIS A 126 ? 0.6452 0.7382 0.8019 0.0002  -0.0103 -0.0890 149 HIS A CA  
908  C C   . HIS A 126 ? 0.5860 0.6802 0.7376 0.0007  -0.0097 -0.0888 149 HIS A C   
909  O O   . HIS A 126 ? 0.6434 0.7373 0.7924 0.0013  -0.0094 -0.0886 149 HIS A O   
910  C CB  . HIS A 126 ? 0.7356 0.8272 0.8933 0.0007  -0.0114 -0.0883 149 HIS A CB  
911  C CG  . HIS A 126 ? 1.0187 1.1091 1.1818 0.0002  -0.0117 -0.0889 149 HIS A CG  
912  N ND1 . HIS A 126 ? 1.0524 1.1429 1.2191 -0.0004 -0.0120 -0.0892 149 HIS A ND1 
913  C CD2 . HIS A 126 ? 1.1644 1.2534 1.3299 0.0004  -0.0117 -0.0895 149 HIS A CD2 
914  C CE1 . HIS A 126 ? 1.1132 1.2025 1.2843 -0.0007 -0.0122 -0.0899 149 HIS A CE1 
915  N NE2 . HIS A 126 ? 1.1997 1.2880 1.3701 -0.0002 -0.0120 -0.0900 149 HIS A NE2 
916  N N   . VAL A 127 ? 0.5362 0.6317 0.6865 0.0003  -0.0093 -0.0888 150 VAL A N   
917  C CA  . VAL A 127 ? 0.5188 0.6156 0.6644 0.0007  -0.0086 -0.0887 150 VAL A CA  
918  C C   . VAL A 127 ? 0.5334 0.6313 0.6770 0.0008  -0.0098 -0.0871 150 VAL A C   
919  O O   . VAL A 127 ? 0.6249 0.7231 0.7710 0.0003  -0.0106 -0.0867 150 VAL A O   
920  C CB  . VAL A 127 ? 0.5096 0.6072 0.6552 0.0001  -0.0070 -0.0901 150 VAL A CB  
921  C CG1 . VAL A 127 ? 0.5045 0.6034 0.6452 0.0004  -0.0064 -0.0899 150 VAL A CG1 
922  C CG2 . VAL A 127 ? 0.5480 0.6447 0.6958 -0.0002 -0.0056 -0.0918 150 VAL A CG2 
923  N N   . TYR A 128 ? 0.5194 0.6181 0.6587 0.0015  -0.0100 -0.0863 151 TYR A N   
924  C CA  . TYR A 128 ? 0.4761 0.5761 0.6129 0.0017  -0.0110 -0.0850 151 TYR A CA  
925  C C   . TYR A 128 ? 0.4566 0.5581 0.5897 0.0018  -0.0099 -0.0854 151 TYR A C   
926  O O   . TYR A 128 ? 0.4390 0.5405 0.5688 0.0024  -0.0093 -0.0855 151 TYR A O   
927  C CB  . TYR A 128 ? 0.4928 0.5923 0.6276 0.0024  -0.0123 -0.0836 151 TYR A CB  
928  C CG  . TYR A 128 ? 0.5209 0.6194 0.6591 0.0023  -0.0137 -0.0827 151 TYR A CG  
929  C CD1 . TYR A 128 ? 0.5516 0.6506 0.6912 0.0019  -0.0150 -0.0817 151 TYR A CD1 
930  C CD2 . TYR A 128 ? 0.5481 0.6450 0.6880 0.0026  -0.0139 -0.0829 151 TYR A CD2 
931  C CE1 . TYR A 128 ? 0.5618 0.6596 0.7043 0.0017  -0.0164 -0.0809 151 TYR A CE1 
932  C CE2 . TYR A 128 ? 0.5497 0.6456 0.6927 0.0025  -0.0153 -0.0821 151 TYR A CE2 
933  C CZ  . TYR A 128 ? 0.5570 0.6533 0.7012 0.0020  -0.0165 -0.0811 151 TYR A CZ  
934  O OH  . TYR A 128 ? 0.5593 0.6546 0.7064 0.0019  -0.0180 -0.0802 151 TYR A OH  
935  N N   . GLU A 129 ? 0.4723 0.5749 0.6059 0.0011  -0.0097 -0.0856 152 GLU A N   
936  C CA  . GLU A 129 ? 0.5101 0.6141 0.6405 0.0011  -0.0086 -0.0860 152 GLU A CA  
937  C C   . GLU A 129 ? 0.5191 0.6244 0.6460 0.0015  -0.0097 -0.0846 152 GLU A C   
938  O O   . GLU A 129 ? 0.4973 0.6035 0.6251 0.0011  -0.0104 -0.0839 152 GLU A O   
939  C CB  . GLU A 129 ? 0.5157 0.6203 0.6483 0.0002  -0.0077 -0.0871 152 GLU A CB  
940  C CG  . GLU A 129 ? 0.5271 0.6304 0.6638 -0.0002 -0.0069 -0.0885 152 GLU A CG  
941  C CD  . GLU A 129 ? 0.6255 0.7295 0.7634 -0.0010 -0.0057 -0.0897 152 GLU A CD  
942  O OE1 . GLU A 129 ? 0.7991 0.9035 0.9348 -0.0010 -0.0043 -0.0907 152 GLU A OE1 
943  O OE2 . GLU A 129 ? 0.6204 0.7245 0.7614 -0.0017 -0.0061 -0.0897 152 GLU A OE2 
944  N N   . ILE A 130 ? 0.4958 0.6014 0.6190 0.0024  -0.0097 -0.0841 153 ILE A N   
945  C CA  . ILE A 130 ? 0.4773 0.5840 0.5977 0.0028  -0.0108 -0.0826 153 ILE A CA  
946  C C   . ILE A 130 ? 0.5134 0.6217 0.6307 0.0028  -0.0102 -0.0827 153 ILE A C   
947  O O   . ILE A 130 ? 0.5234 0.6328 0.6384 0.0031  -0.0111 -0.0816 153 ILE A O   
948  C CB  . ILE A 130 ? 0.4848 0.5909 0.6023 0.0038  -0.0113 -0.0820 153 ILE A CB  
949  C CG1 . ILE A 130 ? 0.4690 0.5757 0.5831 0.0043  -0.0100 -0.0828 153 ILE A CG1 
950  C CG2 . ILE A 130 ? 0.5045 0.6089 0.6247 0.0039  -0.0116 -0.0821 153 ILE A CG2 
951  C CD1 . ILE A 130 ? 0.4700 0.5765 0.5808 0.0052  -0.0106 -0.0820 153 ILE A CD1 
952  N N   . HIS A 131 ? 0.5357 0.6443 0.6530 0.0025  -0.0088 -0.0841 154 HIS A N   
953  C CA  . HIS A 131 ? 0.5557 0.6660 0.6708 0.0023  -0.0084 -0.0841 154 HIS A CA  
954  C C   . HIS A 131 ? 0.5291 0.6397 0.6472 0.0013  -0.0080 -0.0847 154 HIS A C   
955  O O   . HIS A 131 ? 0.5350 0.6469 0.6519 0.0010  -0.0076 -0.0849 154 HIS A O   
956  C CB  . HIS A 131 ? 0.6060 0.7167 0.7178 0.0026  -0.0070 -0.0850 154 HIS A CB  
957  C CG  . HIS A 131 ? 0.6290 0.7399 0.7369 0.0036  -0.0075 -0.0843 154 HIS A CG  
958  N ND1 . HIS A 131 ? 0.6455 0.7566 0.7505 0.0041  -0.0065 -0.0850 154 HIS A ND1 
959  C CD2 . HIS A 131 ? 0.6327 0.7439 0.7393 0.0042  -0.0088 -0.0829 154 HIS A CD2 
960  C CE1 . HIS A 131 ? 0.6375 0.7488 0.7395 0.0049  -0.0071 -0.0841 154 HIS A CE1 
961  N NE2 . HIS A 131 ? 0.6151 0.7265 0.7179 0.0050  -0.0085 -0.0829 154 HIS A NE2 
962  N N   . GLY A 132 ? 0.5174 0.6269 0.6396 0.0008  -0.0084 -0.0849 155 GLY A N   
963  C CA  . GLY A 132 ? 0.5379 0.6475 0.6632 0.0000  -0.0081 -0.0854 155 GLY A CA  
964  C C   . GLY A 132 ? 0.4955 0.6046 0.6224 -0.0004 -0.0065 -0.0871 155 GLY A C   
965  O O   . GLY A 132 ? 0.5139 0.6219 0.6407 -0.0001 -0.0059 -0.0878 155 GLY A O   
966  N N   . SER A 133 ? 0.4692 0.5790 0.5975 -0.0012 -0.0059 -0.0878 156 SER A N   
967  C CA  . SER A 133 ? 0.4886 0.5980 0.6188 -0.0018 -0.0044 -0.0895 156 SER A CA  
968  C C   . SER A 133 ? 0.4812 0.5919 0.6109 -0.0024 -0.0036 -0.0901 156 SER A C   
969  O O   . SER A 133 ? 0.4577 0.5693 0.5881 -0.0028 -0.0044 -0.0894 156 SER A O   
970  C CB  . SER A 133 ? 0.5222 0.6302 0.6574 -0.0023 -0.0046 -0.0901 156 SER A CB  
971  O OG  . SER A 133 ? 0.5178 0.6257 0.6551 -0.0031 -0.0032 -0.0916 156 SER A OG  
972  N N   . LEU A 134 ? 0.4781 0.5890 0.6067 -0.0026 -0.0021 -0.0914 157 LEU A N   
973  C CA  . LEU A 134 ? 0.4988 0.6107 0.6273 -0.0033 -0.0011 -0.0922 157 LEU A CA  
974  C C   . LEU A 134 ? 0.4990 0.6107 0.6319 -0.0042 -0.0011 -0.0927 157 LEU A C   
975  O O   . LEU A 134 ? 0.5067 0.6195 0.6397 -0.0048 -0.0008 -0.0930 157 LEU A O   
976  C CB  . LEU A 134 ? 0.5039 0.6157 0.6313 -0.0035 0.0005  -0.0938 157 LEU A CB  
977  C CG  . LEU A 134 ? 0.5132 0.6253 0.6359 -0.0027 0.0010  -0.0936 157 LEU A CG  
978  C CD1 . LEU A 134 ? 0.4909 0.6027 0.6132 -0.0030 0.0027  -0.0952 157 LEU A CD1 
979  C CD2 . LEU A 134 ? 0.5330 0.6469 0.6526 -0.0026 0.0007  -0.0928 157 LEU A CD2 
980  N N   . PHE A 135 ? 0.4477 0.5581 0.5844 -0.0043 -0.0016 -0.0929 158 PHE A N   
981  C CA  . PHE A 135 ? 0.4408 0.5508 0.5817 -0.0052 -0.0015 -0.0936 158 PHE A CA  
982  C C   . PHE A 135 ? 0.4217 0.5316 0.5648 -0.0052 -0.0032 -0.0923 158 PHE A C   
983  O O   . PHE A 135 ? 0.4804 0.5892 0.6276 -0.0057 -0.0036 -0.0926 158 PHE A O   
984  C CB  . PHE A 135 ? 0.4587 0.5674 0.6025 -0.0055 -0.0004 -0.0951 158 PHE A CB  
985  C CG  . PHE A 135 ? 0.4760 0.5850 0.6175 -0.0056 0.0012  -0.0964 158 PHE A CG  
986  C CD1 . PHE A 135 ? 0.4864 0.5963 0.6279 -0.0063 0.0023  -0.0974 158 PHE A CD1 
987  C CD2 . PHE A 135 ? 0.4946 0.6029 0.6338 -0.0050 0.0016  -0.0966 158 PHE A CD2 
988  C CE1 . PHE A 135 ? 0.4903 0.6005 0.6296 -0.0064 0.0039  -0.0986 158 PHE A CE1 
989  C CE2 . PHE A 135 ? 0.4966 0.6052 0.6337 -0.0051 0.0031  -0.0978 158 PHE A CE2 
990  C CZ  . PHE A 135 ? 0.5024 0.6119 0.6395 -0.0058 0.0043  -0.0988 158 PHE A CZ  
991  N N   . LYS A 136 ? 0.4157 0.5264 0.5558 -0.0048 -0.0042 -0.0908 159 LYS A N   
992  C CA  . LYS A 136 ? 0.4213 0.5322 0.5628 -0.0049 -0.0058 -0.0895 159 LYS A CA  
993  C C   . LYS A 136 ? 0.4144 0.5270 0.5527 -0.0049 -0.0060 -0.0887 159 LYS A C   
994  O O   . LYS A 136 ? 0.3367 0.4503 0.4711 -0.0045 -0.0053 -0.0888 159 LYS A O   
995  C CB  . LYS A 136 ? 0.4555 0.5655 0.5968 -0.0043 -0.0071 -0.0883 159 LYS A CB  
996  C CG  . LYS A 136 ? 0.4949 0.6032 0.6402 -0.0044 -0.0073 -0.0888 159 LYS A CG  
997  C CD  . LYS A 136 ? 0.5455 0.6528 0.6904 -0.0037 -0.0086 -0.0876 159 LYS A CD  
998  C CE  . LYS A 136 ? 0.5945 0.7001 0.7428 -0.0037 -0.0083 -0.0885 159 LYS A CE  
999  N NZ  . LYS A 136 ? 0.6847 0.7894 0.8342 -0.0034 -0.0100 -0.0872 159 LYS A NZ  
1000 N N   . THR A 137 ? 0.4500 0.5631 0.5902 -0.0054 -0.0070 -0.0880 160 THR A N   
1001 C CA  . THR A 137 ? 0.4873 0.6020 0.6250 -0.0056 -0.0074 -0.0871 160 THR A CA  
1002 C C   . THR A 137 ? 0.5411 0.6558 0.6789 -0.0054 -0.0093 -0.0854 160 THR A C   
1003 O O   . THR A 137 ? 0.5188 0.6323 0.6601 -0.0057 -0.0102 -0.0851 160 THR A O   
1004 C CB  . THR A 137 ? 0.4931 0.6084 0.6327 -0.0065 -0.0068 -0.0879 160 THR A CB  
1005 O OG1 . THR A 137 ? 0.5240 0.6385 0.6680 -0.0071 -0.0078 -0.0876 160 THR A OG1 
1006 C CG2 . THR A 137 ? 0.4527 0.5679 0.5929 -0.0068 -0.0050 -0.0897 160 THR A CG2 
1007 N N   . ARG A 138 ? 0.6128 0.7288 0.7470 -0.0051 -0.0098 -0.0843 161 ARG A N   
1008 C CA  . ARG A 138 ? 0.6643 0.7807 0.7984 -0.0051 -0.0115 -0.0827 161 ARG A CA  
1009 C C   . ARG A 138 ? 0.6296 0.7475 0.7628 -0.0057 -0.0116 -0.0824 161 ARG A C   
1010 O O   . ARG A 138 ? 0.6436 0.7627 0.7741 -0.0056 -0.0105 -0.0830 161 ARG A O   
1011 C CB  . ARG A 138 ? 0.6984 0.8149 0.8290 -0.0042 -0.0122 -0.0816 161 ARG A CB  
1012 C CG  . ARG A 138 ? 0.7238 0.8409 0.8539 -0.0043 -0.0139 -0.0799 161 ARG A CG  
1013 C CD  . ARG A 138 ? 0.6973 0.8147 0.8241 -0.0035 -0.0147 -0.0788 161 ARG A CD  
1014 N NE  . ARG A 138 ? 0.7073 0.8255 0.8303 -0.0028 -0.0136 -0.0793 161 ARG A NE  
1015 C CZ  . ARG A 138 ? 0.7500 0.8674 0.8716 -0.0020 -0.0133 -0.0796 161 ARG A CZ  
1016 N NH1 . ARG A 138 ? 0.7964 0.9122 0.9199 -0.0018 -0.0139 -0.0793 161 ARG A NH1 
1017 N NH2 . ARG A 138 ? 0.7759 0.8942 0.8940 -0.0014 -0.0123 -0.0800 161 ARG A NH2 
1018 N N   . CYS A 139 ? 0.5797 0.6976 0.7150 -0.0062 -0.0128 -0.0815 162 CYS A N   
1019 C CA  . CYS A 139 ? 0.5521 0.6714 0.6867 -0.0068 -0.0131 -0.0810 162 CYS A CA  
1020 C C   . CYS A 139 ? 0.5526 0.6733 0.6833 -0.0064 -0.0139 -0.0797 162 CYS A C   
1021 O O   . CYS A 139 ? 0.5215 0.6418 0.6518 -0.0061 -0.0152 -0.0785 162 CYS A O   
1022 C CB  . CYS A 139 ? 0.5476 0.6663 0.6861 -0.0077 -0.0141 -0.0806 162 CYS A CB  
1023 S SG  . CYS A 139 ? 0.5728 0.6932 0.7106 -0.0085 -0.0143 -0.0802 162 CYS A SG  
1024 N N   . MET A 140 ? 0.5267 0.6491 0.6546 -0.0065 -0.0132 -0.0799 163 MET A N   
1025 C CA  . MET A 140 ? 0.5417 0.6655 0.6659 -0.0061 -0.0139 -0.0787 163 MET A CA  
1026 C C   . MET A 140 ? 0.5869 0.7110 0.7124 -0.0068 -0.0155 -0.0774 163 MET A C   
1027 O O   . MET A 140 ? 0.6515 0.7761 0.7750 -0.0065 -0.0166 -0.0761 163 MET A O   
1028 C CB  . MET A 140 ? 0.5216 0.6471 0.6429 -0.0061 -0.0128 -0.0793 163 MET A CB  
1029 C CG  . MET A 140 ? 0.5761 0.7014 0.6961 -0.0056 -0.0113 -0.0806 163 MET A CG  
1030 S SD  . MET A 140 ? 0.6302 0.7554 0.7465 -0.0044 -0.0114 -0.0801 163 MET A SD  
1031 C CE  . MET A 140 ? 0.6051 0.7327 0.7168 -0.0041 -0.0109 -0.0800 163 MET A CE  
1032 N N   . SER A 141 ? 0.6142 0.7378 0.7431 -0.0076 -0.0156 -0.0777 164 SER A N   
1033 C CA  . SER A 141 ? 0.5881 0.7120 0.7185 -0.0083 -0.0171 -0.0765 164 SER A CA  
1034 C C   . SER A 141 ? 0.5816 0.7038 0.7142 -0.0083 -0.0184 -0.0757 164 SER A C   
1035 O O   . SER A 141 ? 0.6191 0.7415 0.7500 -0.0080 -0.0195 -0.0744 164 SER A O   
1036 C CB  . SER A 141 ? 0.6449 0.7686 0.7784 -0.0093 -0.0167 -0.0772 164 SER A CB  
1037 O OG  . SER A 141 ? 0.7389 0.8638 0.8719 -0.0099 -0.0176 -0.0762 164 SER A OG  
1038 N N   . CYS A 142 ? 0.5939 0.7145 0.7304 -0.0085 -0.0182 -0.0764 165 CYS A N   
1039 C CA  . CYS A 142 ? 0.5786 0.6976 0.7177 -0.0086 -0.0196 -0.0756 165 CYS A CA  
1040 C C   . CYS A 142 ? 0.5492 0.6671 0.6878 -0.0078 -0.0195 -0.0757 165 CYS A C   
1041 O O   . CYS A 142 ? 0.5442 0.6608 0.6847 -0.0077 -0.0207 -0.0750 165 CYS A O   
1042 C CB  . CYS A 142 ? 0.6255 0.7432 0.7695 -0.0094 -0.0197 -0.0763 165 CYS A CB  
1043 S SG  . CYS A 142 ? 0.6772 0.7939 0.8238 -0.0092 -0.0179 -0.0783 165 CYS A SG  
1044 N N   . GLY A 143 ? 0.5583 0.6766 0.6944 -0.0071 -0.0182 -0.0766 166 GLY A N   
1045 C CA  . GLY A 143 ? 0.5477 0.6649 0.6831 -0.0062 -0.0180 -0.0767 166 GLY A CA  
1046 C C   . GLY A 143 ? 0.5312 0.6466 0.6703 -0.0062 -0.0176 -0.0777 166 GLY A C   
1047 O O   . GLY A 143 ? 0.4981 0.6125 0.6370 -0.0056 -0.0177 -0.0777 166 GLY A O   
1048 N N   . GLU A 144 ? 0.5480 0.6629 0.6905 -0.0070 -0.0171 -0.0787 167 GLU A N   
1049 C CA  . GLU A 144 ? 0.5852 0.6984 0.7316 -0.0070 -0.0168 -0.0796 167 GLU A CA  
1050 C C   . GLU A 144 ? 0.6119 0.7248 0.7574 -0.0065 -0.0151 -0.0811 167 GLU A C   
1051 O O   . GLU A 144 ? 0.6283 0.7423 0.7718 -0.0065 -0.0138 -0.0819 167 GLU A O   
1052 C CB  . GLU A 144 ? 0.6236 0.7365 0.7741 -0.0080 -0.0168 -0.0803 167 GLU A CB  
1053 C CG  . GLU A 144 ? 0.6830 0.7944 0.8373 -0.0081 -0.0160 -0.0817 167 GLU A CG  
1054 C CD  . GLU A 144 ? 0.7552 0.8662 0.9136 -0.0090 -0.0161 -0.0822 167 GLU A CD  
1055 O OE1 . GLU A 144 ? 0.7613 0.8716 0.9224 -0.0094 -0.0176 -0.0813 167 GLU A OE1 
1056 O OE2 . GLU A 144 ? 0.7859 0.8975 0.9449 -0.0094 -0.0148 -0.0835 167 GLU A OE2 
1057 N N   . VAL A 145 ? 0.6432 0.7546 0.7902 -0.0061 -0.0152 -0.0814 168 VAL A N   
1058 C CA  . VAL A 145 ? 0.6124 0.7234 0.7590 -0.0057 -0.0137 -0.0827 168 VAL A CA  
1059 C C   . VAL A 145 ? 0.5604 0.6701 0.7114 -0.0062 -0.0130 -0.0841 168 VAL A C   
1060 O O   . VAL A 145 ? 0.5056 0.6139 0.6600 -0.0064 -0.0139 -0.0839 168 VAL A O   
1061 C CB  . VAL A 145 ? 0.5951 0.7053 0.7397 -0.0048 -0.0140 -0.0822 168 VAL A CB  
1062 C CG1 . VAL A 145 ? 0.5927 0.7023 0.7373 -0.0044 -0.0125 -0.0837 168 VAL A CG1 
1063 C CG2 . VAL A 145 ? 0.6252 0.7368 0.7651 -0.0042 -0.0144 -0.0811 168 VAL A CG2 
1064 N N   . LYS A 146 ? 0.5679 0.6781 0.7189 -0.0064 -0.0114 -0.0856 169 LYS A N   
1065 C CA  . LYS A 146 ? 0.5789 0.6882 0.7340 -0.0070 -0.0106 -0.0870 169 LYS A CA  
1066 C C   . LYS A 146 ? 0.5783 0.6874 0.7323 -0.0068 -0.0088 -0.0886 169 LYS A C   
1067 O O   . LYS A 146 ? 0.5595 0.6698 0.7097 -0.0065 -0.0079 -0.0888 169 LYS A O   
1068 C CB  . LYS A 146 ? 0.6182 0.7283 0.7751 -0.0079 -0.0106 -0.0872 169 LYS A CB  
1069 C CG  . LYS A 146 ? 0.7187 0.8282 0.8793 -0.0086 -0.0095 -0.0889 169 LYS A CG  
1070 C CD  . LYS A 146 ? 0.8236 0.9330 0.9878 -0.0094 -0.0102 -0.0888 169 LYS A CD  
1071 C CE  . LYS A 146 ? 0.9249 1.0348 1.0909 -0.0101 -0.0087 -0.0905 169 LYS A CE  
1072 N NZ  . LYS A 146 ? 0.9806 1.0916 1.1466 -0.0107 -0.0090 -0.0901 169 LYS A NZ  
1073 N N   . ALA A 147 ? 0.5562 0.6639 0.7136 -0.0069 -0.0083 -0.0896 170 ALA A N   
1074 C CA  . ALA A 147 ? 0.5400 0.6475 0.6970 -0.0069 -0.0066 -0.0912 170 ALA A CA  
1075 C C   . ALA A 147 ? 0.5562 0.6648 0.7133 -0.0075 -0.0054 -0.0923 170 ALA A C   
1076 O O   . ALA A 147 ? 0.6128 0.7216 0.7720 -0.0082 -0.0058 -0.0922 170 ALA A O   
1077 C CB  . ALA A 147 ? 0.5218 0.6277 0.6828 -0.0070 -0.0064 -0.0922 170 ALA A CB  
1078 N N   . ASN A 148 ? 0.5680 0.6771 0.7224 -0.0074 -0.0039 -0.0933 171 ASN A N   
1079 C CA  . ASN A 148 ? 0.5384 0.6484 0.6928 -0.0080 -0.0025 -0.0945 171 ASN A CA  
1080 C C   . ASN A 148 ? 0.5326 0.6426 0.6850 -0.0079 -0.0007 -0.0959 171 ASN A C   
1081 O O   . ASN A 148 ? 0.5141 0.6246 0.6624 -0.0073 -0.0005 -0.0955 171 ASN A O   
1082 C CB  . ASN A 148 ? 0.5195 0.6311 0.6711 -0.0081 -0.0029 -0.0936 171 ASN A CB  
1083 C CG  . ASN A 148 ? 0.5253 0.6380 0.6761 -0.0087 -0.0015 -0.0947 171 ASN A CG  
1084 O OD1 . ASN A 148 ? 0.4851 0.5974 0.6362 -0.0089 0.0000  -0.0963 171 ASN A OD1 
1085 N ND2 . ASN A 148 ? 0.5362 0.6501 0.6858 -0.0089 -0.0018 -0.0941 171 ASN A ND2 
1086 N N   . HIS A 149 ? 0.5388 0.6482 0.6940 -0.0085 0.0004  -0.0976 172 HIS A N   
1087 C CA  . HIS A 149 ? 0.5372 0.6466 0.6909 -0.0086 0.0022  -0.0991 172 HIS A CA  
1088 C C   . HIS A 149 ? 0.5378 0.6481 0.6921 -0.0095 0.0035  -0.1004 172 HIS A C   
1089 O O   . HIS A 149 ? 0.4866 0.5968 0.6405 -0.0097 0.0051  -0.1018 172 HIS A O   
1090 C CB  . HIS A 149 ? 0.5266 0.6345 0.6831 -0.0086 0.0026  -0.1001 172 HIS A CB  
1091 C CG  . HIS A 149 ? 0.5257 0.6325 0.6819 -0.0078 0.0014  -0.0989 172 HIS A CG  
1092 N ND1 . HIS A 149 ? 0.5250 0.6311 0.6841 -0.0077 0.0000  -0.0980 172 HIS A ND1 
1093 C CD2 . HIS A 149 ? 0.5440 0.6505 0.6975 -0.0070 0.0015  -0.0986 172 HIS A CD2 
1094 C CE1 . HIS A 149 ? 0.5156 0.6209 0.6737 -0.0070 -0.0009 -0.0971 172 HIS A CE1 
1095 N NE2 . HIS A 149 ? 0.5467 0.6523 0.7015 -0.0066 0.0000  -0.0975 172 HIS A NE2 
1096 N N   . LYS A 150 ? 0.5788 0.6900 0.7340 -0.0099 0.0029  -0.0998 173 LYS A N   
1097 C CA  . LYS A 150 ? 0.5782 0.6903 0.7340 -0.0107 0.0040  -0.1009 173 LYS A CA  
1098 C C   . LYS A 150 ? 0.5437 0.6566 0.6956 -0.0107 0.0055  -0.1017 173 LYS A C   
1099 O O   . LYS A 150 ? 0.5744 0.6878 0.7223 -0.0100 0.0052  -0.1008 173 LYS A O   
1100 C CB  . LYS A 150 ? 0.6443 0.7576 0.7997 -0.0109 0.0029  -0.0997 173 LYS A CB  
1101 C CG  . LYS A 150 ? 0.7184 0.8313 0.8784 -0.0115 0.0020  -0.0996 173 LYS A CG  
1102 C CD  . LYS A 150 ? 0.7690 0.8829 0.9278 -0.0115 0.0006  -0.0979 173 LYS A CD  
1103 C CE  . LYS A 150 ? 0.7517 0.8659 0.9138 -0.0123 0.0002  -0.0980 173 LYS A CE  
1104 N NZ  . LYS A 150 ? 0.7512 0.8641 0.9176 -0.0125 -0.0010 -0.0976 173 LYS A NZ  
1105 N N   . SER A 151 ? 0.5001 0.6132 0.6531 -0.0114 0.0070  -0.1033 174 SER A N   
1106 C CA  . SER A 151 ? 0.4669 0.5808 0.6162 -0.0115 0.0084  -0.1040 174 SER A CA  
1107 C C   . SER A 151 ? 0.4813 0.5963 0.6312 -0.0124 0.0094  -0.1049 174 SER A C   
1108 O O   . SER A 151 ? 0.5010 0.6155 0.6541 -0.0131 0.0103  -0.1064 174 SER A O   
1109 C CB  . SER A 151 ? 0.4438 0.5567 0.5933 -0.0115 0.0096  -0.1053 174 SER A CB  
1110 O OG  . SER A 151 ? 0.4233 0.5369 0.5689 -0.0115 0.0108  -0.1058 174 SER A OG  
1111 N N   . PRO A 152 ? 0.5153 0.6317 0.6621 -0.0123 0.0092  -0.1042 175 PRO A N   
1112 C CA  . PRO A 152 ? 0.5205 0.6377 0.6636 -0.0115 0.0081  -0.1025 175 PRO A CA  
1113 C C   . PRO A 152 ? 0.5080 0.6250 0.6529 -0.0112 0.0063  -0.1011 175 PRO A C   
1114 O O   . PRO A 152 ? 0.5025 0.6192 0.6511 -0.0118 0.0059  -0.1013 175 PRO A O   
1115 C CB  . PRO A 152 ? 0.5318 0.6506 0.6720 -0.0118 0.0087  -0.1026 175 PRO A CB  
1116 C CG  . PRO A 152 ? 0.5256 0.6445 0.6692 -0.0128 0.0091  -0.1035 175 PRO A CG  
1117 C CD  . PRO A 152 ? 0.5383 0.6558 0.6858 -0.0132 0.0099  -0.1048 175 PRO A CD  
1118 N N   . ILE A 153 ? 0.5410 0.6581 0.6831 -0.0104 0.0052  -0.0996 176 ILE A N   
1119 C CA  . ILE A 153 ? 0.5717 0.6888 0.7149 -0.0101 0.0034  -0.0980 176 ILE A CA  
1120 C C   . ILE A 153 ? 0.6004 0.7185 0.7446 -0.0107 0.0029  -0.0976 176 ILE A C   
1121 O O   . ILE A 153 ? 0.6259 0.7436 0.7729 -0.0109 0.0016  -0.0968 176 ILE A O   
1122 C CB  . ILE A 153 ? 0.5462 0.6637 0.6854 -0.0091 0.0025  -0.0966 176 ILE A CB  
1123 C CG1 . ILE A 153 ? 0.5337 0.6509 0.6741 -0.0089 0.0007  -0.0950 176 ILE A CG1 
1124 C CG2 . ILE A 153 ? 0.5276 0.6468 0.6625 -0.0090 0.0030  -0.0963 176 ILE A CG2 
1125 C CD1 . ILE A 153 ? 0.5294 0.6468 0.6665 -0.0079 -0.0002 -0.0936 176 ILE A CD1 
1126 N N   . CYS A 154 ? 0.5987 0.7181 0.7407 -0.0110 0.0038  -0.0980 177 CYS A N   
1127 C CA  . CYS A 154 ? 0.5758 0.6963 0.7188 -0.0117 0.0036  -0.0979 177 CYS A CA  
1128 C C   . CYS A 154 ? 0.5922 0.7136 0.7339 -0.0122 0.0053  -0.0992 177 CYS A C   
1129 O O   . CYS A 154 ? 0.5534 0.6750 0.6918 -0.0119 0.0062  -0.0997 177 CYS A O   
1130 C CB  . CYS A 154 ? 0.5871 0.7088 0.7274 -0.0113 0.0023  -0.0961 177 CYS A CB  
1131 S SG  . CYS A 154 ? 0.5810 0.7043 0.7154 -0.0108 0.0029  -0.0958 177 CYS A SG  
1132 N N   . PRO A 155 ? 0.5962 0.7181 0.7402 -0.0131 0.0056  -0.0998 178 PRO A N   
1133 C CA  . PRO A 155 ? 0.5735 0.6961 0.7167 -0.0137 0.0072  -0.1012 178 PRO A CA  
1134 C C   . PRO A 155 ? 0.5909 0.7149 0.7291 -0.0133 0.0076  -0.1008 178 PRO A C   
1135 O O   . PRO A 155 ? 0.6655 0.7895 0.8016 -0.0133 0.0089  -0.1017 178 PRO A O   
1136 C CB  . PRO A 155 ? 0.5609 0.6840 0.7071 -0.0146 0.0070  -0.1014 178 PRO A CB  
1137 C CG  . PRO A 155 ? 0.5806 0.7027 0.7302 -0.0145 0.0055  -0.1005 178 PRO A CG  
1138 C CD  . PRO A 155 ? 0.6027 0.7245 0.7498 -0.0135 0.0044  -0.0991 178 PRO A CD  
1139 N N   . ALA A 156 ? 0.5700 0.6951 0.7062 -0.0131 0.0065  -0.0993 179 ALA A N   
1140 C CA  . ALA A 156 ? 0.5956 0.7221 0.7271 -0.0126 0.0067  -0.0988 179 ALA A CA  
1141 C C   . ALA A 156 ? 0.5901 0.7164 0.7183 -0.0120 0.0074  -0.0991 179 ALA A C   
1142 O O   . ALA A 156 ? 0.5691 0.6964 0.6938 -0.0119 0.0081  -0.0993 179 ALA A O   
1143 C CB  . ALA A 156 ? 0.6505 0.7778 0.7806 -0.0122 0.0050  -0.0970 179 ALA A CB  
1144 N N   . LEU A 157 ? 0.6095 0.7343 0.7388 -0.0115 0.0072  -0.0992 180 LEU A N   
1145 C CA  . LEU A 157 ? 0.6325 0.7569 0.7590 -0.0109 0.0077  -0.0994 180 LEU A CA  
1146 C C   . LEU A 157 ? 0.6571 0.7806 0.7846 -0.0113 0.0093  -0.1011 180 LEU A C   
1147 O O   . LEU A 157 ? 0.6461 0.7691 0.7712 -0.0109 0.0099  -0.1014 180 LEU A O   
1148 C CB  . LEU A 157 ? 0.6685 0.7919 0.7952 -0.0100 0.0065  -0.0983 180 LEU A CB  
1149 C CG  . LEU A 157 ? 0.6843 0.8086 0.8079 -0.0092 0.0051  -0.0966 180 LEU A CG  
1150 C CD1 . LEU A 157 ? 0.6868 0.8100 0.8117 -0.0087 0.0038  -0.0956 180 LEU A CD1 
1151 C CD2 . LEU A 157 ? 0.6854 0.8105 0.8044 -0.0086 0.0056  -0.0965 180 LEU A CD2 
1152 N N   . ASP A 158 ? 0.6941 0.8173 0.8251 -0.0122 0.0100  -0.1022 181 ASP A N   
1153 C CA  . ASP A 158 ? 0.6940 0.8163 0.8265 -0.0128 0.0115  -0.1040 181 ASP A CA  
1154 C C   . ASP A 158 ? 0.6274 0.7502 0.7560 -0.0127 0.0128  -0.1047 181 ASP A C   
1155 O O   . ASP A 158 ? 0.5778 0.7019 0.7040 -0.0129 0.0131  -0.1046 181 ASP A O   
1156 C CB  . ASP A 158 ? 0.7284 0.8507 0.8649 -0.0138 0.0121  -0.1051 181 ASP A CB  
1157 C CG  . ASP A 158 ? 0.7743 0.8952 0.9137 -0.0143 0.0132  -0.1067 181 ASP A CG  
1158 O OD1 . ASP A 158 ? 0.8611 0.9810 1.0000 -0.0138 0.0133  -0.1068 181 ASP A OD1 
1159 O OD2 . ASP A 158 ? 0.8406 0.9615 0.9830 -0.0152 0.0140  -0.1078 181 ASP A OD2 
1160 N N   . GLY A 159 ? 0.6261 0.7479 0.7539 -0.0124 0.0134  -0.1052 182 GLY A N   
1161 C CA  . GLY A 159 ? 0.6489 0.7711 0.7729 -0.0123 0.0144  -0.1058 182 GLY A CA  
1162 C C   . GLY A 159 ? 0.6754 0.7987 0.7950 -0.0116 0.0137  -0.1045 182 GLY A C   
1163 O O   . GLY A 159 ? 0.6646 0.7888 0.7811 -0.0117 0.0145  -0.1048 182 GLY A O   
1164 N N   . LYS A 160 ? 0.7208 0.8442 0.8399 -0.0108 0.0122  -0.1029 183 LYS A N   
1165 C CA  . LYS A 160 ? 0.7293 0.8538 0.8442 -0.0100 0.0115  -0.1017 183 LYS A CA  
1166 C C   . LYS A 160 ? 0.7200 0.8436 0.8329 -0.0091 0.0111  -0.1013 183 LYS A C   
1167 O O   . LYS A 160 ? 0.6067 0.7289 0.7213 -0.0092 0.0117  -0.1021 183 LYS A O   
1168 C CB  . LYS A 160 ? 0.7484 0.8738 0.8636 -0.0098 0.0101  -0.1003 183 LYS A CB  
1169 C CG  . LYS A 160 ? 0.8021 0.9285 0.9196 -0.0107 0.0103  -0.1007 183 LYS A CG  
1170 C CD  . LYS A 160 ? 0.8818 1.0094 0.9965 -0.0110 0.0113  -0.1012 183 LYS A CD  
1171 C CE  . LYS A 160 ? 0.9145 1.0430 1.0314 -0.0120 0.0115  -0.1016 183 LYS A CE  
1172 N NZ  . LYS A 160 ? 0.9451 1.0747 1.0591 -0.0123 0.0125  -0.1022 183 LYS A NZ  
1173 N N   . GLY A 161 ? 0.7200 0.8444 0.8294 -0.0083 0.0103  -0.1001 184 GLY A N   
1174 C CA  . GLY A 161 ? 0.7042 0.8279 0.8114 -0.0073 0.0098  -0.0995 184 GLY A CA  
1175 C C   . GLY A 161 ? 0.7063 0.8294 0.8112 -0.0072 0.0110  -0.1005 184 GLY A C   
1176 O O   . GLY A 161 ? 0.6738 0.7960 0.7775 -0.0066 0.0107  -0.1002 184 GLY A O   
1177 N N   . ALA A 162 ? 0.7370 0.8605 0.8411 -0.0080 0.0123  -0.1016 185 ALA A N   
1178 C CA  . ALA A 162 ? 0.7197 0.8428 0.8213 -0.0080 0.0133  -0.1025 185 ALA A CA  
1179 C C   . ALA A 162 ? 0.7073 0.8306 0.8048 -0.0069 0.0126  -0.1014 185 ALA A C   
1180 O O   . ALA A 162 ? 0.7453 0.8698 0.8410 -0.0063 0.0117  -0.1003 185 ALA A O   
1181 C CB  . ALA A 162 ? 0.7445 0.8685 0.8450 -0.0088 0.0146  -0.1034 185 ALA A CB  
1182 N N   . PRO A 163 ? 0.6801 0.8024 0.7763 -0.0065 0.0130  -0.1018 186 PRO A N   
1183 C CA  . PRO A 163 ? 0.7103 0.8326 0.8028 -0.0054 0.0123  -0.1008 186 PRO A CA  
1184 C C   . PRO A 163 ? 0.7825 0.9056 0.8709 -0.0053 0.0128  -0.1011 186 PRO A C   
1185 O O   . PRO A 163 ? 0.7977 0.9209 0.8830 -0.0044 0.0122  -0.1003 186 PRO A O   
1186 C CB  . PRO A 163 ? 0.6962 0.8168 0.7898 -0.0052 0.0124  -0.1011 186 PRO A CB  
1187 C CG  . PRO A 163 ? 0.7417 0.8616 0.8376 -0.0062 0.0138  -0.1027 186 PRO A CG  
1188 C CD  . PRO A 163 ? 0.7235 0.8443 0.8218 -0.0071 0.0140  -0.1031 186 PRO A CD  
1189 N N   . ASP A 164 ? 0.8806 1.0041 0.9690 -0.0062 0.0140  -0.1021 187 ASP A N   
1190 C CA  . ASP A 164 ? 0.8976 1.0218 0.9820 -0.0061 0.0145  -0.1023 187 ASP A CA  
1191 C C   . ASP A 164 ? 0.9487 1.0745 1.0305 -0.0054 0.0134  -0.1010 187 ASP A C   
1192 O O   . ASP A 164 ? 0.8295 0.9563 0.9126 -0.0055 0.0129  -0.1005 187 ASP A O   
1193 C CB  . ASP A 164 ? 0.9225 1.0470 1.0075 -0.0073 0.0159  -0.1036 187 ASP A CB  
1194 C CG  . ASP A 164 ? 1.0405 1.1656 1.1216 -0.0073 0.0165  -0.1039 187 ASP A CG  
1195 O OD1 . ASP A 164 ? 1.2372 1.3611 1.3168 -0.0072 0.0170  -0.1044 187 ASP A OD1 
1196 O OD2 . ASP A 164 ? 1.0276 1.1541 1.1069 -0.0074 0.0164  -0.1037 187 ASP A OD2 
1197 N N   . PRO A 165 ? 1.0164 1.1424 1.0945 -0.0045 0.0131  -0.1005 188 PRO A N   
1198 C CA  . PRO A 165 ? 0.9918 1.1192 1.0673 -0.0037 0.0120  -0.0993 188 PRO A CA  
1199 C C   . PRO A 165 ? 0.9693 1.0984 1.0445 -0.0042 0.0121  -0.0993 188 PRO A C   
1200 O O   . PRO A 165 ? 0.8840 1.0143 0.9586 -0.0037 0.0111  -0.0982 188 PRO A O   
1201 C CB  . PRO A 165 ? 1.0292 1.1563 1.1007 -0.0030 0.0120  -0.0992 188 PRO A CB  
1202 C CG  . PRO A 165 ? 1.0069 1.1323 1.0792 -0.0032 0.0127  -0.1000 188 PRO A CG  
1203 C CD  . PRO A 165 ? 1.0170 1.1418 1.0928 -0.0044 0.0137  -0.1011 188 PRO A CD  
1204 N N   . ASN A 166 ? 1.0319 1.1610 1.1075 -0.0052 0.0134  -0.1004 189 ASN A N   
1205 C CA  . ASN A 166 ? 1.0987 1.2293 1.1741 -0.0058 0.0137  -0.1006 189 ASN A CA  
1206 C C   . ASN A 166 ? 0.9834 1.1140 1.0628 -0.0067 0.0140  -0.1010 189 ASN A C   
1207 O O   . ASN A 166 ? 0.8807 1.0121 0.9606 -0.0075 0.0147  -0.1017 189 ASN A O   
1208 C CB  . ASN A 166 ? 1.2095 1.3402 1.2826 -0.0064 0.0149  -0.1016 189 ASN A CB  
1209 C CG  . ASN A 166 ? 1.3494 1.4804 1.4183 -0.0055 0.0146  -0.1012 189 ASN A CG  
1210 O OD1 . ASN A 166 ? 1.3214 1.4537 1.3880 -0.0050 0.0138  -0.1003 189 ASN A OD1 
1211 N ND2 . ASN A 166 ? 1.4870 1.6167 1.5548 -0.0055 0.0151  -0.1017 189 ASN A ND2 
1212 N N   . THR A 167 ? 0.9057 1.0355 0.9882 -0.0066 0.0134  -0.1007 190 THR A N   
1213 C CA  . THR A 167 ? 0.8792 1.0090 0.9656 -0.0074 0.0136  -0.1011 190 THR A CA  
1214 C C   . THR A 167 ? 0.9069 1.0383 0.9930 -0.0073 0.0127  -0.1000 190 THR A C   
1215 O O   . THR A 167 ? 0.9351 1.0673 1.0189 -0.0064 0.0116  -0.0989 190 THR A O   
1216 C CB  . THR A 167 ? 0.8601 0.9883 0.9498 -0.0074 0.0133  -0.1011 190 THR A CB  
1217 O OG1 . THR A 167 ? 0.8616 0.9885 0.9519 -0.0078 0.0144  -0.1023 190 THR A OG1 
1218 C CG2 . THR A 167 ? 0.8786 1.0070 0.9723 -0.0081 0.0131  -0.1012 190 THR A CG2 
1219 N N   . LYS A 168 ? 0.9227 1.0547 1.0112 -0.0081 0.0130  -0.1005 191 LYS A N   
1220 C CA  . LYS A 168 ? 0.9371 1.0706 1.0257 -0.0081 0.0121  -0.0995 191 LYS A CA  
1221 C C   . LYS A 168 ? 0.8564 0.9893 0.9479 -0.0078 0.0110  -0.0987 191 LYS A C   
1222 O O   . LYS A 168 ? 0.7003 0.8320 0.7951 -0.0082 0.0112  -0.0992 191 LYS A O   
1223 C CB  . LYS A 168 ? 1.0392 1.1736 1.1289 -0.0091 0.0129  -0.1002 191 LYS A CB  
1224 C CG  . LYS A 168 ? 1.1530 1.2889 1.2392 -0.0091 0.0132  -0.1002 191 LYS A CG  
1225 C CD  . LYS A 168 ? 1.2482 1.3851 1.3359 -0.0100 0.0136  -0.1006 191 LYS A CD  
1226 C CE  . LYS A 168 ? 1.3096 1.4479 1.3941 -0.0101 0.0142  -0.1008 191 LYS A CE  
1227 N NZ  . LYS A 168 ? 1.4493 1.5878 1.5355 -0.0113 0.0153  -0.1020 191 LYS A NZ  
1228 N N   . GLU A 169 ? 0.8739 1.0078 0.9639 -0.0071 0.0097  -0.0973 192 GLU A N   
1229 C CA  . GLU A 169 ? 0.8414 0.9750 0.9339 -0.0070 0.0086  -0.0964 192 GLU A CA  
1230 C C   . GLU A 169 ? 0.7660 0.8995 0.8623 -0.0080 0.0089  -0.0969 192 GLU A C   
1231 O O   . GLU A 169 ? 0.7384 0.8728 0.8347 -0.0087 0.0096  -0.0975 192 GLU A O   
1232 C CB  . GLU A 169 ? 0.8549 0.9900 0.9452 -0.0063 0.0074  -0.0950 192 GLU A CB  
1233 C CG  . GLU A 169 ? 0.9579 1.0929 1.0454 -0.0052 0.0066  -0.0942 192 GLU A CG  
1234 C CD  . GLU A 169 ? 1.0491 1.1854 1.1351 -0.0047 0.0053  -0.0928 192 GLU A CD  
1235 O OE1 . GLU A 169 ? 1.1278 1.2656 1.2132 -0.0050 0.0053  -0.0926 192 GLU A OE1 
1236 O OE2 . GLU A 169 ? 1.2057 1.3416 1.2911 -0.0039 0.0044  -0.0919 192 GLU A OE2 
1237 N N   . ALA A 170 ? 0.7241 0.8567 0.8238 -0.0081 0.0083  -0.0967 193 ALA A N   
1238 C CA  . ALA A 170 ? 0.7139 0.8463 0.8174 -0.0090 0.0084  -0.0970 193 ALA A CA  
1239 C C   . ALA A 170 ? 0.7237 0.8575 0.8268 -0.0090 0.0073  -0.0959 193 ALA A C   
1240 O O   . ALA A 170 ? 0.7218 0.8563 0.8265 -0.0098 0.0076  -0.0963 193 ALA A O   
1241 C CB  . ALA A 170 ? 0.7725 0.9033 0.8794 -0.0090 0.0079  -0.0970 193 ALA A CB  
1242 N N   . ARG A 171 ? 0.7767 0.9110 0.8780 -0.0082 0.0061  -0.0946 194 ARG A N   
1243 C CA  . ARG A 171 ? 0.7589 0.8946 0.8596 -0.0081 0.0050  -0.0934 194 ARG A CA  
1244 C C   . ARG A 171 ? 0.7014 0.8367 0.8061 -0.0090 0.0046  -0.0934 194 ARG A C   
1245 O O   . ARG A 171 ? 0.7092 0.8455 0.8144 -0.0096 0.0047  -0.0934 194 ARG A O   
1246 C CB  . ARG A 171 ? 0.8183 0.9556 0.9157 -0.0082 0.0056  -0.0935 194 ARG A CB  
1247 C CG  . ARG A 171 ? 0.9619 1.1009 1.0582 -0.0082 0.0047  -0.0925 194 ARG A CG  
1248 C CD  . ARG A 171 ? 1.0672 1.2066 1.1625 -0.0074 0.0032  -0.0910 194 ARG A CD  
1249 N NE  . ARG A 171 ? 1.2134 1.3531 1.3049 -0.0065 0.0031  -0.0907 194 ARG A NE  
1250 C CZ  . ARG A 171 ? 1.1980 1.3381 1.2879 -0.0057 0.0019  -0.0895 194 ARG A CZ  
1251 N NH1 . ARG A 171 ? 1.1140 1.2543 1.2055 -0.0058 0.0007  -0.0885 194 ARG A NH1 
1252 N NH2 . ARG A 171 ? 1.2437 1.3841 1.3303 -0.0048 0.0019  -0.0893 194 ARG A NH2 
1253 N N   . ILE A 172 ? 0.6174 0.7511 0.7251 -0.0090 0.0042  -0.0934 195 ILE A N   
1254 C CA  . ILE A 172 ? 0.5854 0.7186 0.6972 -0.0097 0.0037  -0.0933 195 ILE A CA  
1255 C C   . ILE A 172 ? 0.5887 0.7228 0.7005 -0.0095 0.0022  -0.0918 195 ILE A C   
1256 O O   . ILE A 172 ? 0.5446 0.6786 0.6548 -0.0088 0.0012  -0.0907 195 ILE A O   
1257 C CB  . ILE A 172 ? 0.5799 0.7111 0.6949 -0.0096 0.0037  -0.0937 195 ILE A CB  
1258 C CG1 . ILE A 172 ? 0.5727 0.7030 0.6874 -0.0096 0.0051  -0.0951 195 ILE A CG1 
1259 C CG2 . ILE A 172 ? 0.5651 0.6958 0.6845 -0.0104 0.0031  -0.0937 195 ILE A CG2 
1260 C CD1 . ILE A 172 ? 0.5553 0.6838 0.6737 -0.0098 0.0053  -0.0958 195 ILE A CD1 
1261 N N   . PRO A 173 ? 0.6297 0.7645 0.7431 -0.0103 0.0020  -0.0916 196 PRO A N   
1262 C CA  . PRO A 173 ? 0.6295 0.7647 0.7437 -0.0104 0.0005  -0.0903 196 PRO A CA  
1263 C C   . PRO A 173 ? 0.6373 0.7710 0.7536 -0.0100 -0.0005 -0.0896 196 PRO A C   
1264 O O   . PRO A 173 ? 0.6493 0.7815 0.7689 -0.0104 -0.0001 -0.0904 196 PRO A O   
1265 C CB  . PRO A 173 ? 0.6223 0.7577 0.7395 -0.0114 0.0007  -0.0907 196 PRO A CB  
1266 C CG  . PRO A 173 ? 0.6528 0.7889 0.7686 -0.0117 0.0022  -0.0920 196 PRO A CG  
1267 C CD  . PRO A 173 ? 0.6543 0.7897 0.7686 -0.0111 0.0031  -0.0927 196 PRO A CD  
1268 N N   . VAL A 174 ? 0.6425 0.7767 0.7572 -0.0095 -0.0017 -0.0883 197 VAL A N   
1269 C CA  . VAL A 174 ? 0.6166 0.7495 0.7330 -0.0091 -0.0029 -0.0874 197 VAL A CA  
1270 C C   . VAL A 174 ? 0.6237 0.7555 0.7446 -0.0099 -0.0034 -0.0875 197 VAL A C   
1271 O O   . VAL A 174 ? 0.6542 0.7844 0.7775 -0.0098 -0.0038 -0.0875 197 VAL A O   
1272 C CB  . VAL A 174 ? 0.6107 0.7446 0.7245 -0.0086 -0.0042 -0.0859 197 VAL A CB  
1273 C CG1 . VAL A 174 ? 0.6448 0.7796 0.7596 -0.0093 -0.0052 -0.0850 197 VAL A CG1 
1274 C CG2 . VAL A 174 ? 0.6326 0.7651 0.7470 -0.0080 -0.0052 -0.0851 197 VAL A CG2 
1275 N N   . GLU A 175 ? 0.6342 0.7668 0.7564 -0.0107 -0.0035 -0.0875 198 GLU A N   
1276 C CA  . GLU A 175 ? 0.6738 0.8054 0.8003 -0.0115 -0.0040 -0.0876 198 GLU A CA  
1277 C C   . GLU A 175 ? 0.6219 0.7521 0.7514 -0.0117 -0.0028 -0.0891 198 GLU A C   
1278 O O   . GLU A 175 ? 0.5922 0.7210 0.7253 -0.0120 -0.0034 -0.0892 198 GLU A O   
1279 C CB  . GLU A 175 ? 0.7230 0.8558 0.8502 -0.0123 -0.0043 -0.0873 198 GLU A CB  
1280 C CG  . GLU A 175 ? 0.8027 0.9367 0.9286 -0.0127 -0.0029 -0.0884 198 GLU A CG  
1281 C CD  . GLU A 175 ? 0.9002 1.0360 1.0215 -0.0123 -0.0028 -0.0878 198 GLU A CD  
1282 O OE1 . GLU A 175 ? 0.8644 1.0004 0.9830 -0.0114 -0.0033 -0.0870 198 GLU A OE1 
1283 O OE2 . GLU A 175 ? 1.0529 1.1901 1.1736 -0.0128 -0.0023 -0.0880 198 GLU A OE2 
1284 N N   . LEU A 176 ? 0.5774 0.7078 0.7052 -0.0116 -0.0013 -0.0903 199 LEU A N   
1285 C CA  . LEU A 176 ? 0.6510 0.7802 0.7814 -0.0119 -0.0001 -0.0919 199 LEU A CA  
1286 C C   . LEU A 176 ? 0.7011 0.8290 0.8314 -0.0113 0.0000  -0.0922 199 LEU A C   
1287 O O   . LEU A 176 ? 0.7748 0.9014 0.9076 -0.0115 0.0009  -0.0934 199 LEU A O   
1288 C CB  . LEU A 176 ? 0.7083 0.8384 0.8373 -0.0123 0.0013  -0.0931 199 LEU A CB  
1289 C CG  . LEU A 176 ? 0.6676 0.7986 0.7982 -0.0133 0.0015  -0.0934 199 LEU A CG  
1290 C CD1 . LEU A 176 ? 0.6953 0.8276 0.8231 -0.0134 0.0029  -0.0942 199 LEU A CD1 
1291 C CD2 . LEU A 176 ? 0.5980 0.7278 0.7335 -0.0140 0.0017  -0.0943 199 LEU A CD2 
1292 N N   . LEU A 177 ? 0.6989 0.8269 0.8262 -0.0104 -0.0006 -0.0912 200 LEU A N   
1293 C CA  . LEU A 177 ? 0.6598 0.7866 0.7871 -0.0097 -0.0007 -0.0912 200 LEU A CA  
1294 C C   . LEU A 177 ? 0.6463 0.7716 0.7778 -0.0099 -0.0016 -0.0909 200 LEU A C   
1295 O O   . LEU A 177 ? 0.6321 0.7574 0.7661 -0.0106 -0.0023 -0.0905 200 LEU A O   
1296 C CB  . LEU A 177 ? 0.6868 0.8142 0.8100 -0.0088 -0.0013 -0.0900 200 LEU A CB  
1297 C CG  . LEU A 177 ? 0.7425 0.8712 0.8616 -0.0084 -0.0003 -0.0905 200 LEU A CG  
1298 C CD1 . LEU A 177 ? 0.7377 0.8672 0.8529 -0.0076 -0.0011 -0.0893 200 LEU A CD1 
1299 C CD2 . LEU A 177 ? 0.7795 0.9072 0.8984 -0.0083 0.0010  -0.0919 200 LEU A CD2 
1300 N N   . PRO A 178 ? 0.6186 0.7424 0.7508 -0.0094 -0.0017 -0.0910 201 PRO A N   
1301 C CA  . PRO A 178 ? 0.6414 0.7637 0.7776 -0.0096 -0.0026 -0.0908 201 PRO A CA  
1302 C C   . PRO A 178 ? 0.6540 0.7766 0.7907 -0.0096 -0.0044 -0.0891 201 PRO A C   
1303 O O   . PRO A 178 ? 0.6243 0.7474 0.7578 -0.0089 -0.0052 -0.0880 201 PRO A O   
1304 C CB  . PRO A 178 ? 0.6492 0.7704 0.7847 -0.0089 -0.0025 -0.0910 201 PRO A CB  
1305 C CG  . PRO A 178 ? 0.6672 0.7889 0.7998 -0.0086 -0.0010 -0.0920 201 PRO A CG  
1306 C CD  . PRO A 178 ? 0.6510 0.7746 0.7806 -0.0087 -0.0009 -0.0915 201 PRO A CD  
1307 N N   . ARG A 179 ? 0.6381 0.7602 0.7785 -0.0103 -0.0051 -0.0891 202 ARG A N   
1308 C CA  . ARG A 179 ? 0.6058 0.7280 0.7468 -0.0104 -0.0068 -0.0875 202 ARG A CA  
1309 C C   . ARG A 179 ? 0.6297 0.7502 0.7746 -0.0105 -0.0077 -0.0873 202 ARG A C   
1310 O O   . ARG A 179 ? 0.6687 0.7881 0.8168 -0.0108 -0.0070 -0.0885 202 ARG A O   
1311 C CB  . ARG A 179 ? 0.5895 0.7128 0.7314 -0.0112 -0.0069 -0.0874 202 ARG A CB  
1312 C CG  . ARG A 179 ? 0.6259 0.7507 0.7646 -0.0113 -0.0057 -0.0880 202 ARG A CG  
1313 C CD  . ARG A 179 ? 0.6445 0.7706 0.7784 -0.0105 -0.0060 -0.0870 202 ARG A CD  
1314 N NE  . ARG A 179 ? 0.6558 0.7824 0.7892 -0.0105 -0.0077 -0.0853 202 ARG A NE  
1315 C CZ  . ARG A 179 ? 0.6108 0.7389 0.7407 -0.0103 -0.0082 -0.0843 202 ARG A CZ  
1316 N NH1 . ARG A 179 ? 0.5905 0.7199 0.7170 -0.0100 -0.0071 -0.0848 202 ARG A NH1 
1317 N NH2 . ARG A 179 ? 0.5921 0.7205 0.7221 -0.0104 -0.0097 -0.0829 202 ARG A NH2 
1318 N N   . CYS A 180 ? 0.6163 0.7367 0.7611 -0.0104 -0.0094 -0.0858 203 CYS A N   
1319 C CA  . CYS A 180 ? 0.6188 0.7376 0.7670 -0.0105 -0.0106 -0.0852 203 CYS A CA  
1320 C C   . CYS A 180 ? 0.6277 0.7459 0.7804 -0.0114 -0.0108 -0.0857 203 CYS A C   
1321 O O   . CYS A 180 ? 0.6510 0.7702 0.8037 -0.0120 -0.0109 -0.0856 203 CYS A O   
1322 C CB  . CYS A 180 ? 0.6028 0.7219 0.7496 -0.0103 -0.0123 -0.0834 203 CYS A CB  
1323 S SG  . CYS A 180 ? 0.5669 0.6842 0.7167 -0.0101 -0.0139 -0.0824 203 CYS A SG  
1324 N N   . GLU A 181 ? 0.6317 0.7483 0.7882 -0.0115 -0.0109 -0.0863 204 GLU A N   
1325 C CA  . GLU A 181 ? 0.7216 0.8376 0.8824 -0.0123 -0.0109 -0.0871 204 GLU A CA  
1326 C C   . GLU A 181 ? 0.8300 0.9455 0.9934 -0.0128 -0.0127 -0.0858 204 GLU A C   
1327 O O   . GLU A 181 ? 1.0027 1.1176 1.1699 -0.0135 -0.0129 -0.0863 204 GLU A O   
1328 C CB  . GLU A 181 ? 0.8076 0.9222 0.9714 -0.0123 -0.0099 -0.0886 204 GLU A CB  
1329 C CG  . GLU A 181 ? 0.8820 0.9970 1.0431 -0.0117 -0.0082 -0.0897 204 GLU A CG  
1330 C CD  . GLU A 181 ? 0.9425 1.0567 1.1067 -0.0121 -0.0068 -0.0916 204 GLU A CD  
1331 O OE1 . GLU A 181 ? 0.9238 1.0379 1.0912 -0.0129 -0.0066 -0.0923 204 GLU A OE1 
1332 O OE2 . GLU A 181 ? 1.0412 1.1548 1.2047 -0.0116 -0.0059 -0.0924 204 GLU A OE2 
1333 N N   . ARG A 182 ? 0.9057 1.0213 1.0673 -0.0124 -0.0142 -0.0842 205 ARG A N   
1334 C CA  . ARG A 182 ? 1.0317 1.1466 1.1958 -0.0129 -0.0160 -0.0830 205 ARG A CA  
1335 C C   . ARG A 182 ? 1.0093 1.1253 1.1733 -0.0137 -0.0164 -0.0824 205 ARG A C   
1336 O O   . ARG A 182 ? 0.8879 1.0035 1.0536 -0.0142 -0.0180 -0.0813 205 ARG A O   
1337 C CB  . ARG A 182 ? 1.1787 1.2932 1.3409 -0.0124 -0.0174 -0.0814 205 ARG A CB  
1338 C CG  . ARG A 182 ? 1.1839 1.2969 1.3475 -0.0118 -0.0175 -0.0816 205 ARG A CG  
1339 C CD  . ARG A 182 ? 1.2105 1.3235 1.3712 -0.0112 -0.0187 -0.0801 205 ARG A CD  
1340 N NE  . ARG A 182 ? 1.2207 1.3336 1.3823 -0.0116 -0.0206 -0.0785 205 ARG A NE  
1341 C CZ  . ARG A 182 ? 1.1482 1.2623 1.3068 -0.0118 -0.0214 -0.0771 205 ARG A CZ  
1342 N NH1 . ARG A 182 ? 1.1734 1.2892 1.3278 -0.0115 -0.0205 -0.0772 205 ARG A NH1 
1343 N NH2 . ARG A 182 ? 0.9901 1.1038 1.1499 -0.0123 -0.0232 -0.0758 205 ARG A NH2 
1344 N N   . LYS A 183 ? 1.0693 1.1867 1.2316 -0.0139 -0.0151 -0.0833 206 LYS A N   
1345 C CA  . LYS A 183 ? 1.1139 1.2322 1.2770 -0.0148 -0.0152 -0.0832 206 LYS A CA  
1346 C C   . LYS A 183 ? 1.0771 1.1965 1.2379 -0.0149 -0.0166 -0.0815 206 LYS A C   
1347 O O   . LYS A 183 ? 1.0534 1.1743 1.2112 -0.0150 -0.0161 -0.0814 206 LYS A O   
1348 C CB  . LYS A 183 ? 1.1454 1.2625 1.3138 -0.0155 -0.0157 -0.0838 206 LYS A CB  
1349 C CG  . LYS A 183 ? 1.2303 1.3464 1.4015 -0.0155 -0.0143 -0.0857 206 LYS A CG  
1350 C CD  . LYS A 183 ? 1.2969 1.4121 1.4730 -0.0163 -0.0146 -0.0863 206 LYS A CD  
1351 C CE  . LYS A 183 ? 1.2838 1.3981 1.4629 -0.0164 -0.0131 -0.0883 206 LYS A CE  
1352 N NZ  . LYS A 183 ? 1.2440 1.3580 1.4271 -0.0172 -0.0130 -0.0891 206 LYS A NZ  
1353 N N   . SER A 184 ? 1.0625 1.1809 1.2247 -0.0150 -0.0184 -0.0802 207 SER A N   
1354 C CA  . SER A 184 ? 1.0030 1.1222 1.1624 -0.0151 -0.0197 -0.0784 207 SER A CA  
1355 C C   . SER A 184 ? 0.8886 1.0089 1.0432 -0.0142 -0.0191 -0.0782 207 SER A C   
1356 O O   . SER A 184 ? 0.7914 0.9130 0.9429 -0.0142 -0.0197 -0.0770 207 SER A O   
1357 C CB  . SER A 184 ? 1.0356 1.1534 1.1973 -0.0152 -0.0217 -0.0772 207 SER A CB  
1358 O OG  . SER A 184 ? 1.1068 1.2230 1.2704 -0.0146 -0.0215 -0.0777 207 SER A OG  
1359 N N   . CYS A 185 ? 0.7686 0.8884 0.9226 -0.0135 -0.0179 -0.0792 208 CYS A N   
1360 C CA  . CYS A 185 ? 0.6852 0.8060 0.8348 -0.0126 -0.0174 -0.0790 208 CYS A CA  
1361 C C   . CYS A 185 ? 0.6284 0.7506 0.7753 -0.0125 -0.0156 -0.0801 208 CYS A C   
1362 O O   . CYS A 185 ? 0.6225 0.7463 0.7660 -0.0124 -0.0156 -0.0795 208 CYS A O   
1363 C CB  . CYS A 185 ? 0.7081 0.8276 0.8580 -0.0119 -0.0172 -0.0793 208 CYS A CB  
1364 S SG  . CYS A 185 ? 0.6704 0.7910 0.8148 -0.0108 -0.0167 -0.0789 208 CYS A SG  
1365 N N   . ASN A 186 ? 0.5921 0.7137 0.7406 -0.0124 -0.0142 -0.0817 209 ASN A N   
1366 C CA  . ASN A 186 ? 0.5534 0.6762 0.6994 -0.0122 -0.0125 -0.0828 209 ASN A CA  
1367 C C   . ASN A 186 ? 0.5336 0.6575 0.6748 -0.0113 -0.0122 -0.0824 209 ASN A C   
1368 O O   . ASN A 186 ? 0.4813 0.6066 0.6197 -0.0113 -0.0111 -0.0829 209 ASN A O   
1369 C CB  . ASN A 186 ? 0.5258 0.6499 0.6719 -0.0130 -0.0121 -0.0831 209 ASN A CB  
1370 C CG  . ASN A 186 ? 0.5071 0.6320 0.6518 -0.0129 -0.0102 -0.0846 209 ASN A CG  
1371 O OD1 . ASN A 186 ? 0.5389 0.6628 0.6851 -0.0128 -0.0092 -0.0859 209 ASN A OD1 
1372 N ND2 . ASN A 186 ? 0.5076 0.6342 0.6491 -0.0130 -0.0098 -0.0844 209 ASN A ND2 
1373 N N   . GLY A 187 ? 0.5345 0.6577 0.6747 -0.0107 -0.0131 -0.0815 210 GLY A N   
1374 C CA  . GLY A 187 ? 0.5288 0.6528 0.6646 -0.0099 -0.0128 -0.0811 210 GLY A CA  
1375 C C   . GLY A 187 ? 0.5227 0.6468 0.6572 -0.0094 -0.0111 -0.0825 210 GLY A C   
1376 O O   . GLY A 187 ? 0.5305 0.6537 0.6677 -0.0097 -0.0102 -0.0838 210 GLY A O   
1377 N N   . LEU A 188 ? 0.5448 0.6701 0.6751 -0.0088 -0.0107 -0.0823 211 LEU A N   
1378 C CA  . LEU A 188 ? 0.5651 0.6904 0.6936 -0.0083 -0.0091 -0.0835 211 LEU A CA  
1379 C C   . LEU A 188 ? 0.5896 0.7135 0.7184 -0.0076 -0.0092 -0.0836 211 LEU A C   
1380 O O   . LEU A 188 ? 0.6585 0.7821 0.7865 -0.0072 -0.0104 -0.0824 211 LEU A O   
1381 C CB  . LEU A 188 ? 0.6139 0.7410 0.7378 -0.0078 -0.0087 -0.0832 211 LEU A CB  
1382 C CG  . LEU A 188 ? 0.6583 0.7853 0.7797 -0.0072 -0.0074 -0.0842 211 LEU A CG  
1383 C CD1 . LEU A 188 ? 0.7293 0.8563 0.8522 -0.0077 -0.0059 -0.0858 211 LEU A CD1 
1384 C CD2 . LEU A 188 ? 0.6331 0.7617 0.7499 -0.0066 -0.0073 -0.0837 211 LEU A CD2 
1385 N N   . LEU A 189 ? 0.5762 0.6992 0.7061 -0.0076 -0.0079 -0.0850 212 LEU A N   
1386 C CA  . LEU A 189 ? 0.5451 0.6667 0.6753 -0.0070 -0.0079 -0.0852 212 LEU A CA  
1387 C C   . LEU A 189 ? 0.5099 0.6321 0.6361 -0.0062 -0.0070 -0.0854 212 LEU A C   
1388 O O   . LEU A 189 ? 0.4859 0.6092 0.6099 -0.0062 -0.0060 -0.0861 212 LEU A O   
1389 C CB  . LEU A 189 ? 0.5678 0.6880 0.7019 -0.0074 -0.0070 -0.0865 212 LEU A CB  
1390 C CG  . LEU A 189 ? 0.6002 0.7196 0.7388 -0.0082 -0.0077 -0.0865 212 LEU A CG  
1391 C CD1 . LEU A 189 ? 0.6098 0.7278 0.7519 -0.0085 -0.0068 -0.0880 212 LEU A CD1 
1392 C CD2 . LEU A 189 ? 0.5872 0.7060 0.7268 -0.0081 -0.0096 -0.0850 212 LEU A CD2 
1393 N N   . ARG A 190 ? 0.4924 0.6138 0.6177 -0.0054 -0.0076 -0.0849 213 ARG A N   
1394 C CA  . ARG A 190 ? 0.4729 0.5943 0.5949 -0.0046 -0.0068 -0.0853 213 ARG A CA  
1395 C C   . ARG A 190 ? 0.4612 0.5808 0.5853 -0.0044 -0.0065 -0.0860 213 ARG A C   
1396 O O   . ARG A 190 ? 0.4577 0.5760 0.5852 -0.0047 -0.0072 -0.0858 213 ARG A O   
1397 C CB  . ARG A 190 ? 0.4923 0.6145 0.6110 -0.0039 -0.0078 -0.0839 213 ARG A CB  
1398 C CG  . ARG A 190 ? 0.5068 0.6280 0.6270 -0.0037 -0.0093 -0.0828 213 ARG A CG  
1399 C CD  . ARG A 190 ? 0.5237 0.6455 0.6401 -0.0028 -0.0101 -0.0817 213 ARG A CD  
1400 N NE  . ARG A 190 ? 0.5196 0.6406 0.6344 -0.0020 -0.0095 -0.0821 213 ARG A NE  
1401 C CZ  . ARG A 190 ? 0.5138 0.6352 0.6254 -0.0012 -0.0099 -0.0814 213 ARG A CZ  
1402 N NH1 . ARG A 190 ? 0.5257 0.6483 0.6352 -0.0010 -0.0109 -0.0802 213 ARG A NH1 
1403 N NH2 . ARG A 190 ? 0.5275 0.6481 0.6378 -0.0005 -0.0093 -0.0819 213 ARG A NH2 
1404 N N   . PRO A 191 ? 0.4366 0.5560 0.5586 -0.0039 -0.0054 -0.0868 214 PRO A N   
1405 C CA  . PRO A 191 ? 0.4225 0.5402 0.5459 -0.0036 -0.0051 -0.0873 214 PRO A CA  
1406 C C   . PRO A 191 ? 0.4031 0.5202 0.5262 -0.0030 -0.0066 -0.0860 214 PRO A C   
1407 O O   . PRO A 191 ? 0.4233 0.5413 0.5435 -0.0025 -0.0073 -0.0849 214 PRO A O   
1408 C CB  . PRO A 191 ? 0.4162 0.5341 0.5363 -0.0031 -0.0039 -0.0881 214 PRO A CB  
1409 C CG  . PRO A 191 ? 0.4371 0.5567 0.5547 -0.0033 -0.0033 -0.0883 214 PRO A CG  
1410 C CD  . PRO A 191 ? 0.4563 0.5769 0.5741 -0.0035 -0.0046 -0.0870 214 PRO A CD  
1411 N N   . HIS A 192 ? 0.4104 0.5259 0.5366 -0.0030 -0.0070 -0.0861 215 HIS A N   
1412 C CA  . HIS A 192 ? 0.4274 0.5421 0.5538 -0.0025 -0.0083 -0.0849 215 HIS A CA  
1413 C C   . HIS A 192 ? 0.4727 0.5868 0.5968 -0.0017 -0.0078 -0.0852 215 HIS A C   
1414 O O   . HIS A 192 ? 0.4530 0.5656 0.5789 -0.0015 -0.0077 -0.0857 215 HIS A O   
1415 C CB  . HIS A 192 ? 0.4430 0.5563 0.5741 -0.0030 -0.0089 -0.0850 215 HIS A CB  
1416 C CG  . HIS A 192 ? 0.4506 0.5631 0.5822 -0.0026 -0.0105 -0.0837 215 HIS A CG  
1417 N ND1 . HIS A 192 ? 0.4917 0.6051 0.6210 -0.0023 -0.0117 -0.0822 215 HIS A ND1 
1418 C CD2 . HIS A 192 ? 0.4342 0.5450 0.5685 -0.0025 -0.0111 -0.0836 215 HIS A CD2 
1419 C CE1 . HIS A 192 ? 0.4778 0.5901 0.6082 -0.0021 -0.0130 -0.0812 215 HIS A CE1 
1420 N NE2 . HIS A 192 ? 0.4359 0.5468 0.5694 -0.0022 -0.0126 -0.0820 215 HIS A NE2 
1421 N N   . VAL A 193 ? 0.5554 0.6706 0.6753 -0.0012 -0.0075 -0.0850 216 VAL A N   
1422 C CA  . VAL A 193 ? 0.6109 0.7259 0.7277 -0.0003 -0.0070 -0.0851 216 VAL A CA  
1423 C C   . VAL A 193 ? 0.5694 0.6855 0.6830 0.0003  -0.0081 -0.0837 216 VAL A C   
1424 O O   . VAL A 193 ? 0.5633 0.6807 0.6759 0.0000  -0.0086 -0.0830 216 VAL A O   
1425 C CB  . VAL A 193 ? 0.6630 0.7787 0.7779 -0.0004 -0.0054 -0.0864 216 VAL A CB  
1426 C CG1 . VAL A 193 ? 0.6875 0.8037 0.7978 0.0004  -0.0052 -0.0862 216 VAL A CG1 
1427 C CG2 . VAL A 193 ? 0.6879 0.8023 0.8056 -0.0009 -0.0043 -0.0878 216 VAL A CG2 
1428 N N   . VAL A 194 ? 0.5292 0.6446 0.6409 0.0011  -0.0084 -0.0833 217 VAL A N   
1429 C CA  . VAL A 194 ? 0.5263 0.6426 0.6346 0.0018  -0.0093 -0.0821 217 VAL A CA  
1430 C C   . VAL A 194 ? 0.5548 0.6723 0.6593 0.0022  -0.0083 -0.0827 217 VAL A C   
1431 O O   . VAL A 194 ? 0.5298 0.6468 0.6332 0.0025  -0.0073 -0.0836 217 VAL A O   
1432 C CB  . VAL A 194 ? 0.5282 0.6434 0.6359 0.0025  -0.0100 -0.0816 217 VAL A CB  
1433 C CG1 . VAL A 194 ? 0.4995 0.6158 0.6039 0.0032  -0.0110 -0.0803 217 VAL A CG1 
1434 C CG2 . VAL A 194 ? 0.5538 0.6676 0.6655 0.0022  -0.0108 -0.0812 217 VAL A CG2 
1435 N N   . TRP A 195 ? 0.5696 0.6888 0.6721 0.0021  -0.0087 -0.0820 218 TRP A N   
1436 C CA  . TRP A 195 ? 0.6135 0.7340 0.7124 0.0025  -0.0079 -0.0824 218 TRP A CA  
1437 C C   . TRP A 195 ? 0.6366 0.7575 0.7319 0.0035  -0.0086 -0.0815 218 TRP A C   
1438 O O   . TRP A 195 ? 0.6005 0.7208 0.6963 0.0038  -0.0096 -0.0807 218 TRP A O   
1439 C CB  . TRP A 195 ? 0.6358 0.7580 0.7344 0.0019  -0.0079 -0.0822 218 TRP A CB  
1440 C CG  . TRP A 195 ? 0.6778 0.7998 0.7787 0.0011  -0.0069 -0.0833 218 TRP A CG  
1441 C CD1 . TRP A 195 ? 0.7501 0.8712 0.8518 0.0009  -0.0056 -0.0847 218 TRP A CD1 
1442 C CD2 . TRP A 195 ? 0.6743 0.7972 0.7770 0.0002  -0.0070 -0.0833 218 TRP A CD2 
1443 N NE1 . TRP A 195 ? 0.7541 0.8754 0.8581 0.0000  -0.0049 -0.0855 218 TRP A NE1 
1444 C CE2 . TRP A 195 ? 0.6960 0.8184 0.8006 -0.0003 -0.0057 -0.0847 218 TRP A CE2 
1445 C CE3 . TRP A 195 ? 0.6411 0.7651 0.7439 0.0000  -0.0080 -0.0823 218 TRP A CE3 
1446 C CZ2 . TRP A 195 ? 0.6605 0.7835 0.7672 -0.0012 -0.0054 -0.0850 218 TRP A CZ2 
1447 C CZ3 . TRP A 195 ? 0.6471 0.7717 0.7520 -0.0009 -0.0077 -0.0826 218 TRP A CZ3 
1448 C CH2 . TRP A 195 ? 0.6704 0.7944 0.7771 -0.0015 -0.0065 -0.0840 218 TRP A CH2 
1449 N N   . PHE A 196 ? 0.6127 0.7346 0.7046 0.0039  -0.0079 -0.0819 219 PHE A N   
1450 C CA  . PHE A 196 ? 0.5817 0.7043 0.6702 0.0049  -0.0085 -0.0812 219 PHE A CA  
1451 C C   . PHE A 196 ? 0.6117 0.7357 0.6995 0.0048  -0.0097 -0.0799 219 PHE A C   
1452 O O   . PHE A 196 ? 0.5600 0.6851 0.6485 0.0042  -0.0097 -0.0799 219 PHE A O   
1453 C CB  . PHE A 196 ? 0.5979 0.7213 0.6831 0.0053  -0.0075 -0.0819 219 PHE A CB  
1454 C CG  . PHE A 196 ? 0.6722 0.7941 0.7575 0.0054  -0.0064 -0.0830 219 PHE A CG  
1455 C CD1 . PHE A 196 ? 0.7181 0.8387 0.8029 0.0061  -0.0068 -0.0827 219 PHE A CD1 
1456 C CD2 . PHE A 196 ? 0.7253 0.8471 0.8113 0.0049  -0.0051 -0.0842 219 PHE A CD2 
1457 C CE1 . PHE A 196 ? 0.7123 0.8316 0.7972 0.0062  -0.0058 -0.0837 219 PHE A CE1 
1458 C CE2 . PHE A 196 ? 0.7502 0.8707 0.8363 0.0049  -0.0042 -0.0852 219 PHE A CE2 
1459 C CZ  . PHE A 196 ? 0.7531 0.8724 0.8387 0.0056  -0.0045 -0.0849 219 PHE A CZ  
1460 N N   . GLY A 197 ? 0.5897 0.7136 0.6761 0.0055  -0.0107 -0.0790 220 GLY A N   
1461 C CA  . GLY A 197 ? 0.5596 0.6845 0.6457 0.0054  -0.0119 -0.0777 220 GLY A CA  
1462 C C   . GLY A 197 ? 0.6224 0.7466 0.7121 0.0047  -0.0128 -0.0771 220 GLY A C   
1463 O O   . GLY A 197 ? 0.6859 0.8109 0.7756 0.0044  -0.0138 -0.0761 220 GLY A O   
1464 N N   . GLU A 198 ? 0.6481 0.7705 0.7409 0.0044  -0.0125 -0.0777 221 GLU A N   
1465 C CA  . GLU A 198 ? 0.6677 0.7893 0.7639 0.0037  -0.0135 -0.0770 221 GLU A CA  
1466 C C   . GLU A 198 ? 0.6929 0.8128 0.7901 0.0042  -0.0142 -0.0766 221 GLU A C   
1467 O O   . GLU A 198 ? 0.6678 0.7869 0.7642 0.0048  -0.0136 -0.0771 221 GLU A O   
1468 C CB  . GLU A 198 ? 0.6617 0.7827 0.7614 0.0028  -0.0128 -0.0779 221 GLU A CB  
1469 C CG  . GLU A 198 ? 0.6155 0.7379 0.7143 0.0024  -0.0118 -0.0786 221 GLU A CG  
1470 C CD  . GLU A 198 ? 0.6278 0.7498 0.7302 0.0014  -0.0115 -0.0791 221 GLU A CD  
1471 O OE1 . GLU A 198 ? 0.6669 0.7873 0.7722 0.0012  -0.0111 -0.0799 221 GLU A OE1 
1472 O OE2 . GLU A 198 ? 0.6361 0.7593 0.7387 0.0009  -0.0118 -0.0788 221 GLU A OE2 
1473 N N   . THR A 199 ? 0.6632 0.7827 0.7624 0.0038  -0.0154 -0.0756 222 THR A N   
1474 C CA  . THR A 199 ? 0.6338 0.7518 0.7342 0.0042  -0.0161 -0.0751 222 THR A CA  
1475 C C   . THR A 199 ? 0.5820 0.6984 0.6863 0.0037  -0.0157 -0.0759 222 THR A C   
1476 O O   . THR A 199 ? 0.5475 0.6638 0.6542 0.0029  -0.0155 -0.0763 222 THR A O   
1477 C CB  . THR A 199 ? 0.6569 0.7751 0.7576 0.0041  -0.0177 -0.0736 222 THR A CB  
1478 O OG1 . THR A 199 ? 0.6592 0.7780 0.7617 0.0031  -0.0182 -0.0733 222 THR A OG1 
1479 C CG2 . THR A 199 ? 0.7058 0.8253 0.8025 0.0047  -0.0182 -0.0729 222 THR A CG2 
1480 N N   . LEU A 200 ? 0.5580 0.6728 0.6628 0.0042  -0.0158 -0.0760 223 LEU A N   
1481 C CA  . LEU A 200 ? 0.5217 0.6348 0.6303 0.0038  -0.0157 -0.0765 223 LEU A CA  
1482 C C   . LEU A 200 ? 0.5814 0.6941 0.6929 0.0032  -0.0171 -0.0755 223 LEU A C   
1483 O O   . LEU A 200 ? 0.6462 0.7597 0.7563 0.0032  -0.0182 -0.0743 223 LEU A O   
1484 C CB  . LEU A 200 ? 0.4670 0.5787 0.5751 0.0045  -0.0155 -0.0768 223 LEU A CB  
1485 C CG  . LEU A 200 ? 0.4673 0.5788 0.5741 0.0049  -0.0139 -0.0781 223 LEU A CG  
1486 C CD1 . LEU A 200 ? 0.4618 0.5749 0.5654 0.0050  -0.0131 -0.0785 223 LEU A CD1 
1487 C CD2 . LEU A 200 ? 0.4694 0.5797 0.5749 0.0057  -0.0139 -0.0781 223 LEU A CD2 
1488 N N   . ASP A 201 ? 0.5992 0.7106 0.7146 0.0026  -0.0170 -0.0761 224 ASP A N   
1489 C CA  . ASP A 201 ? 0.5966 0.7074 0.7153 0.0020  -0.0182 -0.0752 224 ASP A CA  
1490 C C   . ASP A 201 ? 0.6224 0.7320 0.7414 0.0024  -0.0193 -0.0744 224 ASP A C   
1491 O O   . ASP A 201 ? 0.7022 0.8106 0.8217 0.0029  -0.0188 -0.0750 224 ASP A O   
1492 C CB  . ASP A 201 ? 0.5930 0.7028 0.7159 0.0013  -0.0176 -0.0763 224 ASP A CB  
1493 C CG  . ASP A 201 ? 0.6149 0.7238 0.7414 0.0006  -0.0190 -0.0755 224 ASP A CG  
1494 O OD1 . ASP A 201 ? 0.6908 0.7997 0.8169 0.0007  -0.0204 -0.0742 224 ASP A OD1 
1495 O OD2 . ASP A 201 ? 0.6334 0.7416 0.7634 0.0000  -0.0186 -0.0763 224 ASP A OD2 
1496 N N   . SER A 202 ? 0.6389 0.7488 0.7576 0.0023  -0.0208 -0.0730 225 SER A N   
1497 C CA  . SER A 202 ? 0.6772 0.7860 0.7958 0.0028  -0.0218 -0.0721 225 SER A CA  
1498 C C   . SER A 202 ? 0.6403 0.7473 0.7631 0.0024  -0.0222 -0.0723 225 SER A C   
1499 O O   . SER A 202 ? 0.5868 0.6926 0.7097 0.0030  -0.0224 -0.0722 225 SER A O   
1500 C CB  . SER A 202 ? 0.7466 0.8562 0.8639 0.0026  -0.0233 -0.0705 225 SER A CB  
1501 O OG  . SER A 202 ? 0.8001 0.9116 0.9143 0.0027  -0.0231 -0.0703 225 SER A OG  
1502 N N   . ASP A 203 ? 0.6454 0.7521 0.7715 0.0016  -0.0225 -0.0724 226 ASP A N   
1503 C CA  . ASP A 203 ? 0.6868 0.7917 0.8173 0.0012  -0.0228 -0.0728 226 ASP A CA  
1504 C C   . ASP A 203 ? 0.6250 0.7289 0.7560 0.0017  -0.0215 -0.0741 226 ASP A C   
1505 O O   . ASP A 203 ? 0.6067 0.7091 0.7391 0.0020  -0.0218 -0.0741 226 ASP A O   
1506 C CB  . ASP A 203 ? 0.7603 0.8652 0.8942 0.0003  -0.0228 -0.0732 226 ASP A CB  
1507 C CG  . ASP A 203 ? 0.8698 0.9755 1.0037 -0.0002 -0.0242 -0.0718 226 ASP A CG  
1508 O OD1 . ASP A 203 ? 0.9235 1.0283 1.0587 -0.0003 -0.0256 -0.0707 226 ASP A OD1 
1509 O OD2 . ASP A 203 ? 0.8801 0.9872 1.0128 -0.0006 -0.0239 -0.0719 226 ASP A OD2 
1510 N N   . ILE A 204 ? 0.5529 0.6576 0.6825 0.0018  -0.0200 -0.0753 227 ILE A N   
1511 C CA  . ILE A 204 ? 0.5125 0.6163 0.6422 0.0022  -0.0186 -0.0766 227 ILE A CA  
1512 C C   . ILE A 204 ? 0.5188 0.6221 0.6458 0.0031  -0.0188 -0.0762 227 ILE A C   
1513 O O   . ILE A 204 ? 0.5114 0.6133 0.6401 0.0034  -0.0189 -0.0764 227 ILE A O   
1514 C CB  . ILE A 204 ? 0.4914 0.5962 0.6196 0.0021  -0.0170 -0.0779 227 ILE A CB  
1515 C CG1 . ILE A 204 ? 0.4855 0.5908 0.6165 0.0012  -0.0167 -0.0784 227 ILE A CG1 
1516 C CG2 . ILE A 204 ? 0.4971 0.6009 0.6258 0.0024  -0.0157 -0.0792 227 ILE A CG2 
1517 C CD1 . ILE A 204 ? 0.4767 0.5826 0.6070 0.0010  -0.0150 -0.0799 227 ILE A CD1 
1518 N N   . LEU A 205 ? 0.5384 0.6430 0.6614 0.0036  -0.0190 -0.0755 228 LEU A N   
1519 C CA  . LEU A 205 ? 0.5299 0.6342 0.6502 0.0045  -0.0193 -0.0750 228 LEU A CA  
1520 C C   . LEU A 205 ? 0.5110 0.6140 0.6329 0.0047  -0.0206 -0.0740 228 LEU A C   
1521 O O   . LEU A 205 ? 0.5192 0.6212 0.6403 0.0053  -0.0205 -0.0741 228 LEU A O   
1522 C CB  . LEU A 205 ? 0.5531 0.6591 0.6690 0.0050  -0.0195 -0.0742 228 LEU A CB  
1523 C CG  . LEU A 205 ? 0.5697 0.6770 0.6830 0.0051  -0.0181 -0.0752 228 LEU A CG  
1524 C CD1 . LEU A 205 ? 0.5892 0.6982 0.6987 0.0055  -0.0186 -0.0743 228 LEU A CD1 
1525 C CD2 . LEU A 205 ? 0.5405 0.6470 0.6525 0.0058  -0.0169 -0.0762 228 LEU A CD2 
1526 N N   . THR A 206 ? 0.5077 0.6105 0.6318 0.0041  -0.0219 -0.0731 229 THR A N   
1527 C CA  . THR A 206 ? 0.5383 0.6398 0.6640 0.0041  -0.0232 -0.0722 229 THR A CA  
1528 C C   . THR A 206 ? 0.5178 0.6175 0.6470 0.0041  -0.0228 -0.0731 229 THR A C   
1529 O O   . THR A 206 ? 0.5409 0.6394 0.6707 0.0044  -0.0234 -0.0727 229 THR A O   
1530 C CB  . THR A 206 ? 0.5947 0.6962 0.7229 0.0033  -0.0246 -0.0711 229 THR A CB  
1531 O OG1 . THR A 206 ? 0.7058 0.8090 0.8320 0.0030  -0.0248 -0.0706 229 THR A OG1 
1532 C CG2 . THR A 206 ? 0.6201 0.7207 0.7486 0.0035  -0.0262 -0.0698 229 THR A CG2 
1533 N N   . ALA A 207 ? 0.4961 0.5957 0.6278 0.0035  -0.0218 -0.0743 230 ALA A N   
1534 C CA  . ALA A 207 ? 0.4997 0.5978 0.6349 0.0034  -0.0213 -0.0754 230 ALA A CA  
1535 C C   . ALA A 207 ? 0.4972 0.5948 0.6305 0.0041  -0.0201 -0.0762 230 ALA A C   
1536 O O   . ALA A 207 ? 0.5058 0.6020 0.6406 0.0044  -0.0203 -0.0764 230 ALA A O   
1537 C CB  . ALA A 207 ? 0.5149 0.6132 0.6528 0.0026  -0.0203 -0.0765 230 ALA A CB  
1538 N N   . VAL A 208 ? 0.4969 0.5957 0.6269 0.0044  -0.0191 -0.0767 231 VAL A N   
1539 C CA  . VAL A 208 ? 0.4981 0.5965 0.6261 0.0050  -0.0179 -0.0776 231 VAL A CA  
1540 C C   . VAL A 208 ? 0.4931 0.5909 0.6192 0.0058  -0.0187 -0.0767 231 VAL A C   
1541 O O   . VAL A 208 ? 0.4242 0.5208 0.5506 0.0062  -0.0183 -0.0773 231 VAL A O   
1542 C CB  . VAL A 208 ? 0.5143 0.6143 0.6388 0.0052  -0.0168 -0.0781 231 VAL A CB  
1543 C CG1 . VAL A 208 ? 0.5112 0.6108 0.6333 0.0059  -0.0157 -0.0789 231 VAL A CG1 
1544 C CG2 . VAL A 208 ? 0.5312 0.6317 0.6576 0.0044  -0.0159 -0.0791 231 VAL A CG2 
1545 N N   . GLU A 209 ? 0.5228 0.6214 0.6470 0.0060  -0.0199 -0.0753 232 GLU A N   
1546 C CA  . GLU A 209 ? 0.6014 0.6996 0.7239 0.0066  -0.0209 -0.0743 232 GLU A CA  
1547 C C   . GLU A 209 ? 0.6235 0.7198 0.7495 0.0065  -0.0215 -0.0742 232 GLU A C   
1548 O O   . GLU A 209 ? 0.5944 0.6897 0.7200 0.0071  -0.0213 -0.0744 232 GLU A O   
1549 C CB  . GLU A 209 ? 0.6653 0.7646 0.7860 0.0066  -0.0222 -0.0728 232 GLU A CB  
1550 C CG  . GLU A 209 ? 0.6815 0.7804 0.7999 0.0073  -0.0232 -0.0717 232 GLU A CG  
1551 C CD  . GLU A 209 ? 0.6367 0.7363 0.7547 0.0070  -0.0247 -0.0701 232 GLU A CD  
1552 O OE1 . GLU A 209 ? 0.6441 0.7435 0.7651 0.0062  -0.0255 -0.0698 232 GLU A OE1 
1553 O OE2 . GLU A 209 ? 0.5809 0.6813 0.6956 0.0076  -0.0252 -0.0694 232 GLU A OE2 
1554 N N   . ARG A 210 ? 0.6548 0.7507 0.7844 0.0058  -0.0223 -0.0739 233 ARG A N   
1555 C CA  . ARG A 210 ? 0.6763 0.7705 0.8096 0.0056  -0.0231 -0.0738 233 ARG A CA  
1556 C C   . ARG A 210 ? 0.6607 0.7538 0.7952 0.0058  -0.0218 -0.0752 233 ARG A C   
1557 O O   . ARG A 210 ? 0.6639 0.7557 0.7990 0.0062  -0.0221 -0.0751 233 ARG A O   
1558 C CB  . ARG A 210 ? 0.6841 0.7780 0.8213 0.0047  -0.0239 -0.0735 233 ARG A CB  
1559 C CG  . ARG A 210 ? 0.7153 0.8075 0.8560 0.0046  -0.0249 -0.0732 233 ARG A CG  
1560 C CD  . ARG A 210 ? 0.8137 0.9057 0.9581 0.0037  -0.0259 -0.0728 233 ARG A CD  
1561 N NE  . ARG A 210 ? 0.9201 1.0104 1.0680 0.0036  -0.0269 -0.0725 233 ARG A NE  
1562 C CZ  . ARG A 210 ? 0.8987 0.9884 1.0496 0.0030  -0.0283 -0.0717 233 ARG A CZ  
1563 N NH1 . ARG A 210 ? 0.9086 0.9992 1.0594 0.0024  -0.0289 -0.0710 233 ARG A NH1 
1564 N NH2 . ARG A 210 ? 0.8677 0.9558 1.0215 0.0029  -0.0291 -0.0715 233 ARG A NH2 
1565 N N   . GLU A 211 ? 0.6497 0.7433 0.7844 0.0056  -0.0203 -0.0766 234 GLU A N   
1566 C CA  . GLU A 211 ? 0.6271 0.7196 0.7631 0.0056  -0.0190 -0.0781 234 GLU A CA  
1567 C C   . GLU A 211 ? 0.6210 0.7133 0.7537 0.0065  -0.0184 -0.0782 234 GLU A C   
1568 O O   . GLU A 211 ? 0.5972 0.6882 0.7311 0.0067  -0.0180 -0.0788 234 GLU A O   
1569 C CB  . GLU A 211 ? 0.6186 0.7119 0.7553 0.0051  -0.0176 -0.0794 234 GLU A CB  
1570 C CG  . GLU A 211 ? 0.6378 0.7313 0.7781 0.0042  -0.0181 -0.0793 234 GLU A CG  
1571 C CD  . GLU A 211 ? 0.6202 0.7123 0.7652 0.0038  -0.0178 -0.0804 234 GLU A CD  
1572 O OE1 . GLU A 211 ? 0.5329 0.6236 0.6789 0.0041  -0.0179 -0.0806 234 GLU A OE1 
1573 O OE2 . GLU A 211 ? 0.6520 0.7445 0.7994 0.0030  -0.0173 -0.0811 234 GLU A OE2 
1574 N N   . LEU A 212 ? 0.6689 0.7624 0.7974 0.0070  -0.0184 -0.0777 235 LEU A N   
1575 C CA  . LEU A 212 ? 0.6419 0.7352 0.7671 0.0078  -0.0179 -0.0778 235 LEU A CA  
1576 C C   . LEU A 212 ? 0.6571 0.7495 0.7819 0.0083  -0.0191 -0.0767 235 LEU A C   
1577 O O   . LEU A 212 ? 0.6273 0.7190 0.7506 0.0090  -0.0188 -0.0769 235 LEU A O   
1578 C CB  . LEU A 212 ? 0.6475 0.7424 0.7684 0.0082  -0.0175 -0.0776 235 LEU A CB  
1579 C CG  . LEU A 212 ? 0.6272 0.7229 0.7481 0.0077  -0.0160 -0.0788 235 LEU A CG  
1580 C CD1 . LEU A 212 ? 0.6044 0.7019 0.7215 0.0080  -0.0160 -0.0783 235 LEU A CD1 
1581 C CD2 . LEU A 212 ? 0.6137 0.7087 0.7344 0.0079  -0.0146 -0.0802 235 LEU A CD2 
1582 N N   . GLU A 213 ? 0.6939 0.7864 0.8200 0.0081  -0.0206 -0.0754 236 GLU A N   
1583 C CA  . GLU A 213 ? 0.7378 0.8294 0.8638 0.0085  -0.0219 -0.0743 236 GLU A CA  
1584 C C   . GLU A 213 ? 0.7384 0.8282 0.8681 0.0083  -0.0218 -0.0750 236 GLU A C   
1585 O O   . GLU A 213 ? 0.7371 0.8259 0.8662 0.0089  -0.0222 -0.0746 236 GLU A O   
1586 C CB  . GLU A 213 ? 0.8003 0.8924 0.9265 0.0082  -0.0235 -0.0728 236 GLU A CB  
1587 C CG  . GLU A 213 ? 0.8474 0.9390 0.9725 0.0087  -0.0248 -0.0716 236 GLU A CG  
1588 C CD  . GLU A 213 ? 0.8696 0.9617 0.9901 0.0096  -0.0244 -0.0713 236 GLU A CD  
1589 O OE1 . GLU A 213 ? 0.7916 0.8849 0.9094 0.0098  -0.0234 -0.0719 236 GLU A OE1 
1590 O OE2 . GLU A 213 ? 0.9791 1.0705 1.0988 0.0101  -0.0253 -0.0705 236 GLU A OE2 
1591 N N   . LYS A 214 ? 0.7658 0.8552 0.8992 0.0076  -0.0212 -0.0759 237 LYS A N   
1592 C CA  . LYS A 214 ? 0.8105 0.8982 0.9476 0.0075  -0.0211 -0.0767 237 LYS A CA  
1593 C C   . LYS A 214 ? 0.7093 0.7964 0.8461 0.0077  -0.0195 -0.0782 237 LYS A C   
1594 O O   . LYS A 214 ? 0.7253 0.8111 0.8649 0.0077  -0.0194 -0.0788 237 LYS A O   
1595 C CB  . LYS A 214 ? 0.9046 0.9920 1.0463 0.0066  -0.0214 -0.0770 237 LYS A CB  
1596 C CG  . LYS A 214 ? 1.0827 1.1705 1.2251 0.0063  -0.0232 -0.0754 237 LYS A CG  
1597 C CD  . LYS A 214 ? 1.1594 1.2465 1.3067 0.0055  -0.0239 -0.0754 237 LYS A CD  
1598 C CE  . LYS A 214 ? 1.1575 1.2437 1.3060 0.0054  -0.0258 -0.0740 237 LYS A CE  
1599 N NZ  . LYS A 214 ? 1.1507 1.2359 1.3043 0.0047  -0.0265 -0.0741 237 LYS A NZ  
1600 N N   . CYS A 215 ? 0.6134 0.7015 0.7470 0.0080  -0.0183 -0.0788 238 CYS A N   
1601 C CA  . CYS A 215 ? 0.6257 0.7133 0.7596 0.0079  -0.0167 -0.0804 238 CYS A CA  
1602 C C   . CYS A 215 ? 0.5969 0.6837 0.7287 0.0087  -0.0166 -0.0803 238 CYS A C   
1603 O O   . CYS A 215 ? 0.6556 0.7427 0.7843 0.0093  -0.0174 -0.0792 238 CYS A O   
1604 C CB  . CYS A 215 ? 0.6352 0.7241 0.7669 0.0078  -0.0155 -0.0812 238 CYS A CB  
1605 S SG  . CYS A 215 ? 0.7183 0.8081 0.8441 0.0086  -0.0150 -0.0809 238 CYS A SG  
1606 N N   . ASP A 216 ? 0.5939 0.6794 0.7274 0.0086  -0.0157 -0.0815 239 ASP A N   
1607 C CA  . ASP A 216 ? 0.6469 0.7315 0.7784 0.0093  -0.0154 -0.0816 239 ASP A CA  
1608 C C   . ASP A 216 ? 0.7122 0.7970 0.8416 0.0094  -0.0137 -0.0830 239 ASP A C   
1609 O O   . ASP A 216 ? 0.7796 0.8636 0.9079 0.0099  -0.0133 -0.0833 239 ASP A O   
1610 C CB  . ASP A 216 ? 0.6858 0.7688 0.8208 0.0093  -0.0160 -0.0817 239 ASP A CB  
1611 C CG  . ASP A 216 ? 0.6842 0.7666 0.8236 0.0085  -0.0152 -0.0830 239 ASP A CG  
1612 O OD1 . ASP A 216 ? 0.6738 0.7570 0.8134 0.0080  -0.0140 -0.0841 239 ASP A OD1 
1613 O OD2 . ASP A 216 ? 0.6254 0.7065 0.7681 0.0084  -0.0158 -0.0831 239 ASP A OD2 
1614 N N   . LEU A 217 ? 0.7231 0.8090 0.8518 0.0090  -0.0128 -0.0836 240 LEU A N   
1615 C CA  . LEU A 217 ? 0.6517 0.7380 0.7779 0.0090  -0.0113 -0.0847 240 LEU A CA  
1616 C C   . LEU A 217 ? 0.6583 0.7462 0.7834 0.0087  -0.0109 -0.0849 240 LEU A C   
1617 O O   . LEU A 217 ? 0.7485 0.8368 0.8763 0.0080  -0.0111 -0.0849 240 LEU A O   
1618 C CB  . LEU A 217 ? 0.6864 0.7717 0.8154 0.0085  -0.0101 -0.0863 240 LEU A CB  
1619 C CG  . LEU A 217 ? 0.7266 0.8121 0.8534 0.0084  -0.0084 -0.0876 240 LEU A CG  
1620 C CD1 . LEU A 217 ? 0.7615 0.8469 0.8838 0.0093  -0.0083 -0.0872 240 LEU A CD1 
1621 C CD2 . LEU A 217 ? 0.7338 0.8182 0.8640 0.0078  -0.0074 -0.0891 240 LEU A CD2 
1622 N N   . CYS A 218 ? 0.6109 0.6997 0.7320 0.0090  -0.0102 -0.0850 241 CYS A N   
1623 C CA  . CYS A 218 ? 0.5431 0.6334 0.6627 0.0087  -0.0098 -0.0851 241 CYS A CA  
1624 C C   . CYS A 218 ? 0.5305 0.6211 0.6479 0.0086  -0.0082 -0.0863 241 CYS A C   
1625 O O   . CYS A 218 ? 0.5434 0.6337 0.6578 0.0092  -0.0079 -0.0863 241 CYS A O   
1626 C CB  . CYS A 218 ? 0.5265 0.6179 0.6430 0.0093  -0.0109 -0.0836 241 CYS A CB  
1627 S SG  . CYS A 218 ? 0.5763 0.6697 0.6901 0.0091  -0.0104 -0.0836 241 CYS A SG  
1628 N N   . LEU A 219 ? 0.5114 0.6026 0.6303 0.0079  -0.0072 -0.0873 242 LEU A N   
1629 C CA  . LEU A 219 ? 0.5361 0.6278 0.6527 0.0077  -0.0058 -0.0884 242 LEU A CA  
1630 C C   . LEU A 219 ? 0.5647 0.6580 0.6789 0.0077  -0.0058 -0.0880 242 LEU A C   
1631 O O   . LEU A 219 ? 0.5903 0.6844 0.7058 0.0074  -0.0065 -0.0874 242 LEU A O   
1632 C CB  . LEU A 219 ? 0.5762 0.6673 0.6959 0.0069  -0.0045 -0.0900 242 LEU A CB  
1633 C CG  . LEU A 219 ? 0.6184 0.7078 0.7397 0.0068  -0.0040 -0.0909 242 LEU A CG  
1634 C CD1 . LEU A 219 ? 0.6424 0.7309 0.7642 0.0075  -0.0053 -0.0897 242 LEU A CD1 
1635 C CD2 . LEU A 219 ? 0.6311 0.7200 0.7569 0.0059  -0.0032 -0.0922 242 LEU A CD2 
1636 N N   . VAL A 220 ? 0.6446 0.7384 0.7551 0.0080  -0.0049 -0.0884 243 VAL A N   
1637 C CA  . VAL A 220 ? 0.6080 0.7034 0.7158 0.0080  -0.0047 -0.0882 243 VAL A CA  
1638 C C   . VAL A 220 ? 0.5535 0.6490 0.6607 0.0074  -0.0031 -0.0897 243 VAL A C   
1639 O O   . VAL A 220 ? 0.6113 0.7059 0.7169 0.0077  -0.0024 -0.0903 243 VAL A O   
1640 C CB  . VAL A 220 ? 0.6145 0.7106 0.7180 0.0089  -0.0054 -0.0872 243 VAL A CB  
1641 C CG1 . VAL A 220 ? 0.6328 0.7305 0.7334 0.0089  -0.0050 -0.0872 243 VAL A CG1 
1642 C CG2 . VAL A 220 ? 0.6137 0.7098 0.7178 0.0094  -0.0071 -0.0857 243 VAL A CG2 
1643 N N   . VAL A 221 ? 0.4934 0.5898 0.6018 0.0067  -0.0025 -0.0903 244 VAL A N   
1644 C CA  . VAL A 221 ? 0.4824 0.5787 0.5912 0.0060  -0.0009 -0.0919 244 VAL A CA  
1645 C C   . VAL A 221 ? 0.5040 0.6018 0.6108 0.0057  -0.0004 -0.0921 244 VAL A C   
1646 O O   . VAL A 221 ? 0.4871 0.5858 0.5951 0.0054  -0.0008 -0.0916 244 VAL A O   
1647 C CB  . VAL A 221 ? 0.5018 0.5973 0.6154 0.0052  -0.0005 -0.0927 244 VAL A CB  
1648 C CG1 . VAL A 221 ? 0.5431 0.6386 0.6574 0.0044  0.0010  -0.0944 244 VAL A CG1 
1649 C CG2 . VAL A 221 ? 0.5330 0.6270 0.6487 0.0054  -0.0010 -0.0926 244 VAL A CG2 
1650 N N   . GLY A 222 ? 0.5513 0.6493 0.6549 0.0058  0.0005  -0.0927 245 GLY A N   
1651 C CA  . GLY A 222 ? 0.5590 0.6584 0.6604 0.0056  0.0011  -0.0929 245 GLY A CA  
1652 C C   . GLY A 222 ? 0.5580 0.6587 0.6565 0.0063  0.0000  -0.0916 245 GLY A C   
1653 O O   . GLY A 222 ? 0.5273 0.6293 0.6251 0.0060  0.0001  -0.0915 245 GLY A O   
1654 N N   . THR A 223 ? 0.5711 0.6714 0.6679 0.0072  -0.0009 -0.0905 246 THR A N   
1655 C CA  . THR A 223 ? 0.5520 0.6534 0.6459 0.0080  -0.0020 -0.0892 246 THR A CA  
1656 C C   . THR A 223 ? 0.5836 0.6840 0.6763 0.0088  -0.0028 -0.0885 246 THR A C   
1657 O O   . THR A 223 ? 0.5216 0.6205 0.6157 0.0088  -0.0025 -0.0890 246 THR A O   
1658 C CB  . THR A 223 ? 0.5434 0.6459 0.6391 0.0077  -0.0030 -0.0883 246 THR A CB  
1659 O OG1 . THR A 223 ? 0.5771 0.6805 0.6701 0.0086  -0.0042 -0.0870 246 THR A OG1 
1660 C CG2 . THR A 223 ? 0.5413 0.6427 0.6410 0.0074  -0.0036 -0.0881 246 THR A CG2 
1661 N N   . SER A 224 ? 0.6596 0.7608 0.7499 0.0096  -0.0039 -0.0873 247 SER A N   
1662 C CA  . SER A 224 ? 0.6917 0.7921 0.7803 0.0105  -0.0046 -0.0866 247 SER A CA  
1663 C C   . SER A 224 ? 0.6945 0.7952 0.7840 0.0109  -0.0061 -0.0852 247 SER A C   
1664 O O   . SER A 224 ? 0.7157 0.8177 0.8052 0.0107  -0.0067 -0.0846 247 SER A O   
1665 C CB  . SER A 224 ? 0.7140 0.8152 0.7981 0.0112  -0.0045 -0.0864 247 SER A CB  
1666 O OG  . SER A 224 ? 0.7590 0.8595 0.8413 0.0121  -0.0052 -0.0858 247 SER A OG  
1667 N N   . SER A 225 ? 0.7187 0.8182 0.8088 0.0113  -0.0068 -0.0847 248 SER A N   
1668 C CA  . SER A 225 ? 0.7464 0.8460 0.8369 0.0118  -0.0083 -0.0833 248 SER A CA  
1669 C C   . SER A 225 ? 0.7055 0.8067 0.7927 0.0124  -0.0090 -0.0824 248 SER A C   
1670 O O   . SER A 225 ? 0.7027 0.8044 0.7902 0.0126  -0.0101 -0.0813 248 SER A O   
1671 C CB  . SER A 225 ? 0.7477 0.8459 0.8383 0.0124  -0.0088 -0.0830 248 SER A CB  
1672 O OG  . SER A 225 ? 0.7728 0.8695 0.8668 0.0118  -0.0084 -0.0837 248 SER A OG  
1673 N N   . ILE A 226 ? 0.7661 0.8679 0.8500 0.0127  -0.0083 -0.0828 249 ILE A N   
1674 C CA  . ILE A 226 ? 0.8603 0.9632 0.9405 0.0135  -0.0090 -0.0820 249 ILE A CA  
1675 C C   . ILE A 226 ? 0.7795 0.8843 0.8595 0.0131  -0.0091 -0.0817 249 ILE A C   
1676 O O   . ILE A 226 ? 0.7174 0.8233 0.7952 0.0136  -0.0099 -0.0808 249 ILE A O   
1677 C CB  . ILE A 226 ? 0.9387 1.0414 1.0156 0.0140  -0.0082 -0.0826 249 ILE A CB  
1678 C CG1 . ILE A 226 ? 0.9778 1.0787 1.0549 0.0144  -0.0080 -0.0830 249 ILE A CG1 
1679 C CG2 . ILE A 226 ? 0.9172 1.0213 0.9903 0.0149  -0.0088 -0.0819 249 ILE A CG2 
1680 C CD1 . ILE A 226 ? 1.0125 1.1128 1.0876 0.0144  -0.0068 -0.0840 249 ILE A CD1 
1681 N N   . VAL A 227 ? 0.7592 0.8642 0.8412 0.0123  -0.0083 -0.0825 250 VAL A N   
1682 C CA  . VAL A 227 ? 0.7490 0.8556 0.8305 0.0119  -0.0081 -0.0825 250 VAL A CA  
1683 C C   . VAL A 227 ? 0.7962 0.9030 0.8813 0.0111  -0.0086 -0.0822 250 VAL A C   
1684 O O   . VAL A 227 ? 0.8603 0.9658 0.9486 0.0107  -0.0087 -0.0824 250 VAL A O   
1685 C CB  . VAL A 227 ? 0.7737 0.8805 0.8548 0.0114  -0.0067 -0.0838 250 VAL A CB  
1686 C CG1 . VAL A 227 ? 0.8057 0.9144 0.8848 0.0113  -0.0066 -0.0836 250 VAL A CG1 
1687 C CG2 . VAL A 227 ? 0.7820 0.8878 0.8607 0.0119  -0.0061 -0.0844 250 VAL A CG2 
1688 N N   . TYR A 228 ? 0.7954 0.9037 0.8800 0.0109  -0.0090 -0.0816 251 TYR A N   
1689 C CA  . TYR A 228 ? 0.7754 0.8840 0.8633 0.0101  -0.0094 -0.0814 251 TYR A CA  
1690 C C   . TYR A 228 ? 0.8104 0.9182 0.9010 0.0093  -0.0082 -0.0827 251 TYR A C   
1691 O O   . TYR A 228 ? 0.8175 0.9255 0.9067 0.0092  -0.0071 -0.0837 251 TYR A O   
1692 C CB  . TYR A 228 ? 0.7506 0.8611 0.8373 0.0099  -0.0096 -0.0810 251 TYR A CB  
1693 C CG  . TYR A 228 ? 0.7024 0.8132 0.7923 0.0090  -0.0098 -0.0809 251 TYR A CG  
1694 C CD1 . TYR A 228 ? 0.7041 0.8151 0.7956 0.0082  -0.0088 -0.0820 251 TYR A CD1 
1695 C CD2 . TYR A 228 ? 0.6812 0.7921 0.7726 0.0089  -0.0111 -0.0798 251 TYR A CD2 
1696 C CE1 . TYR A 228 ? 0.7005 0.8118 0.7951 0.0074  -0.0090 -0.0819 251 TYR A CE1 
1697 C CE2 . TYR A 228 ? 0.6422 0.7534 0.7366 0.0080  -0.0114 -0.0797 251 TYR A CE2 
1698 C CZ  . TYR A 228 ? 0.6572 0.7686 0.7532 0.0073  -0.0104 -0.0807 251 TYR A CZ  
1699 O OH  . TYR A 228 ? 0.6260 0.7377 0.7250 0.0065  -0.0107 -0.0806 251 TYR A OH  
1700 N N   . PRO A 229 ? 0.7919 0.8989 0.8864 0.0087  -0.0085 -0.0828 252 PRO A N   
1701 C CA  . PRO A 229 ? 0.7835 0.8902 0.8797 0.0087  -0.0099 -0.0816 252 PRO A CA  
1702 C C   . PRO A 229 ? 0.6977 0.8028 0.7950 0.0091  -0.0104 -0.0813 252 PRO A C   
1703 O O   . PRO A 229 ? 0.6575 0.7624 0.7557 0.0093  -0.0116 -0.0802 252 PRO A O   
1704 C CB  . PRO A 229 ? 0.7764 0.8831 0.8765 0.0077  -0.0097 -0.0819 252 PRO A CB  
1705 C CG  . PRO A 229 ? 0.7474 0.8532 0.8487 0.0073  -0.0083 -0.0834 252 PRO A CG  
1706 C CD  . PRO A 229 ? 0.7517 0.8580 0.8492 0.0078  -0.0074 -0.0840 252 PRO A CD  
1707 N N   . ALA A 230 ? 0.6678 0.7717 0.7651 0.0093  -0.0095 -0.0823 253 ALA A N   
1708 C CA  . ALA A 230 ? 0.6896 0.7920 0.7877 0.0097  -0.0099 -0.0821 253 ALA A CA  
1709 C C   . ALA A 230 ? 0.7100 0.8127 0.8060 0.0105  -0.0112 -0.0807 253 ALA A C   
1710 O O   . ALA A 230 ? 0.6829 0.7846 0.7804 0.0106  -0.0120 -0.0801 253 ALA A O   
1711 C CB  . ALA A 230 ? 0.6834 0.7849 0.7803 0.0099  -0.0087 -0.0832 253 ALA A CB  
1712 N N   . ALA A 231 ? 0.7131 0.8170 0.8053 0.0110  -0.0112 -0.0803 254 ALA A N   
1713 C CA  . ALA A 231 ? 0.7486 0.8529 0.8385 0.0118  -0.0123 -0.0792 254 ALA A CA  
1714 C C   . ALA A 231 ? 0.8221 0.9265 0.9136 0.0116  -0.0137 -0.0780 254 ALA A C   
1715 O O   . ALA A 231 ? 1.0964 1.2005 1.1870 0.0122  -0.0147 -0.0771 254 ALA A O   
1716 C CB  . ALA A 231 ? 0.7848 0.8907 0.8708 0.0123  -0.0121 -0.0790 254 ALA A CB  
1717 N N   . MET A 232 ? 0.7709 0.8759 0.8648 0.0109  -0.0139 -0.0779 255 MET A N   
1718 C CA  . MET A 232 ? 0.8443 0.9495 0.9398 0.0106  -0.0152 -0.0767 255 MET A CA  
1719 C C   . MET A 232 ? 0.9112 1.0147 1.0092 0.0106  -0.0160 -0.0763 255 MET A C   
1720 O O   . MET A 232 ? 0.9257 1.0292 1.0243 0.0106  -0.0173 -0.0752 255 MET A O   
1721 C CB  . MET A 232 ? 0.9255 1.0313 1.0236 0.0097  -0.0152 -0.0769 255 MET A CB  
1722 C CG  . MET A 232 ? 0.9500 1.0578 1.0460 0.0095  -0.0150 -0.0767 255 MET A CG  
1723 S SD  . MET A 232 ? 0.9764 1.0846 1.0760 0.0084  -0.0153 -0.0766 255 MET A SD  
1724 C CE  . MET A 232 ? 0.9795 1.0874 1.0803 0.0079  -0.0136 -0.0783 255 MET A CE  
1725 N N   . PHE A 233 ? 0.9792 1.0813 1.0788 0.0106  -0.0151 -0.0773 256 PHE A N   
1726 C CA  . PHE A 233 ? 1.0342 1.1347 1.1372 0.0103  -0.0156 -0.0772 256 PHE A CA  
1727 C C   . PHE A 233 ? 1.0971 1.1961 1.1996 0.0109  -0.0153 -0.0776 256 PHE A C   
1728 O O   . PHE A 233 ? 1.1570 1.2551 1.2607 0.0111  -0.0163 -0.0769 256 PHE A O   
1729 C CB  . PHE A 233 ? 1.0327 1.1326 1.1392 0.0095  -0.0148 -0.0783 256 PHE A CB  
1730 C CG  . PHE A 233 ? 1.0192 1.1204 1.1270 0.0088  -0.0149 -0.0782 256 PHE A CG  
1731 C CD1 . PHE A 233 ? 1.0291 1.1306 1.1380 0.0085  -0.0163 -0.0770 256 PHE A CD1 
1732 C CD2 . PHE A 233 ? 0.9966 1.0984 1.1044 0.0083  -0.0136 -0.0793 256 PHE A CD2 
1733 C CE1 . PHE A 233 ? 1.1021 1.2046 1.2123 0.0078  -0.0164 -0.0769 256 PHE A CE1 
1734 C CE2 . PHE A 233 ? 0.9921 1.0949 1.1011 0.0077  -0.0137 -0.0792 256 PHE A CE2 
1735 C CZ  . PHE A 233 ? 1.1176 1.2208 1.2278 0.0074  -0.0151 -0.0780 256 PHE A CZ  
1736 N N   . ALA A 234 ? 1.0773 1.1762 1.1785 0.0111  -0.0140 -0.0787 257 ALA A N   
1737 C CA  . ALA A 234 ? 1.0468 1.1443 1.1475 0.0116  -0.0136 -0.0792 257 ALA A CA  
1738 C C   . ALA A 234 ? 1.0984 1.1957 1.1971 0.0124  -0.0148 -0.0780 257 ALA A C   
1739 O O   . ALA A 234 ? 1.2632 1.3592 1.3633 0.0126  -0.0152 -0.0778 257 ALA A O   
1740 C CB  . ALA A 234 ? 1.0407 1.1384 1.1390 0.0118  -0.0122 -0.0803 257 ALA A CB  
1741 N N   . PRO A 235 ? 0.9969 1.0956 1.0925 0.0128  -0.0154 -0.0771 258 PRO A N   
1742 C CA  . PRO A 235 ? 0.9456 1.0443 1.0397 0.0135  -0.0167 -0.0759 258 PRO A CA  
1743 C C   . PRO A 235 ? 0.9017 0.9995 0.9989 0.0132  -0.0179 -0.0750 258 PRO A C   
1744 O O   . PRO A 235 ? 0.8693 0.9660 0.9667 0.0136  -0.0184 -0.0747 258 PRO A O   
1745 C CB  . PRO A 235 ? 0.9738 1.0743 1.0651 0.0137  -0.0171 -0.0752 258 PRO A CB  
1746 C CG  . PRO A 235 ? 0.9918 1.0931 1.0814 0.0137  -0.0157 -0.0763 258 PRO A CG  
1747 C CD  . PRO A 235 ? 0.9860 1.0863 1.0788 0.0129  -0.0147 -0.0774 258 PRO A CD  
1748 N N   . GLN A 236 ? 0.9078 1.0061 1.0074 0.0124  -0.0183 -0.0747 259 GLN A N   
1749 C CA  . GLN A 236 ? 0.9903 1.0877 1.0932 0.0120  -0.0194 -0.0740 259 GLN A CA  
1750 C C   . GLN A 236 ? 0.9704 1.0659 1.0760 0.0119  -0.0191 -0.0746 259 GLN A C   
1751 O O   . GLN A 236 ? 0.9846 1.0791 1.0915 0.0121  -0.0202 -0.0739 259 GLN A O   
1752 C CB  . GLN A 236 ? 1.0936 1.1916 1.1990 0.0111  -0.0197 -0.0738 259 GLN A CB  
1753 C CG  . GLN A 236 ? 1.0576 1.1543 1.1674 0.0105  -0.0204 -0.0737 259 GLN A CG  
1754 C CD  . GLN A 236 ? 1.0576 1.1549 1.1700 0.0096  -0.0204 -0.0738 259 GLN A CD  
1755 O OE1 . GLN A 236 ? 1.1449 1.2436 1.2560 0.0093  -0.0199 -0.0740 259 GLN A OE1 
1756 N NE2 . GLN A 236 ? 0.9944 1.0906 1.1107 0.0090  -0.0211 -0.0736 259 GLN A NE2 
1757 N N   . VAL A 237 ? 0.9214 1.0163 1.0279 0.0117  -0.0178 -0.0760 260 VAL A N   
1758 C CA  . VAL A 237 ? 0.9290 1.0222 1.0381 0.0117  -0.0174 -0.0767 260 VAL A CA  
1759 C C   . VAL A 237 ? 0.8532 0.9455 0.9598 0.0125  -0.0171 -0.0768 260 VAL A C   
1760 O O   . VAL A 237 ? 0.8313 0.9223 0.9394 0.0127  -0.0176 -0.0766 260 VAL A O   
1761 C CB  . VAL A 237 ? 0.9337 1.0265 1.0453 0.0110  -0.0160 -0.0782 260 VAL A CB  
1762 C CG1 . VAL A 237 ? 0.9392 1.0331 1.0524 0.0102  -0.0160 -0.0783 260 VAL A CG1 
1763 C CG2 . VAL A 237 ? 0.9558 1.0487 1.0647 0.0113  -0.0146 -0.0793 260 VAL A CG2 
1764 N N   . ALA A 238 ? 0.7915 0.8847 0.8945 0.0130  -0.0165 -0.0771 261 ALA A N   
1765 C CA  . ALA A 238 ? 0.7908 0.8832 0.8913 0.0138  -0.0161 -0.0773 261 ALA A CA  
1766 C C   . ALA A 238 ? 0.7810 0.8731 0.8804 0.0144  -0.0175 -0.0760 261 ALA A C   
1767 O O   . ALA A 238 ? 0.7877 0.8785 0.8875 0.0148  -0.0177 -0.0760 261 ALA A O   
1768 C CB  . ALA A 238 ? 0.7885 0.8820 0.8850 0.0142  -0.0153 -0.0777 261 ALA A CB  
1769 N N   . SER A 239 ? 0.7841 0.8774 0.8823 0.0145  -0.0185 -0.0749 262 SER A N   
1770 C CA  . SER A 239 ? 0.8280 0.9212 0.9254 0.0149  -0.0199 -0.0736 262 SER A CA  
1771 C C   . SER A 239 ? 0.8378 0.9295 0.9388 0.0146  -0.0207 -0.0732 262 SER A C   
1772 O O   . SER A 239 ? 0.9189 1.0100 1.0193 0.0150  -0.0216 -0.0724 262 SER A O   
1773 C CB  . SER A 239 ? 0.8827 0.9775 0.9788 0.0148  -0.0207 -0.0726 262 SER A CB  
1774 O OG  . SER A 239 ? 0.8983 0.9934 0.9974 0.0139  -0.0207 -0.0727 262 SER A OG  
1775 N N   . ARG A 240 ? 0.9169 1.0081 1.0216 0.0138  -0.0204 -0.0738 263 ARG A N   
1776 C CA  . ARG A 240 ? 0.9235 1.0131 1.0316 0.0136  -0.0210 -0.0736 263 ARG A CA  
1777 C C   . ARG A 240 ? 0.8062 0.8943 0.9147 0.0139  -0.0201 -0.0746 263 ARG A C   
1778 O O   . ARG A 240 ? 0.7624 0.8491 0.8736 0.0138  -0.0206 -0.0746 263 ARG A O   
1779 C CB  . ARG A 240 ? 0.9155 1.0049 1.0278 0.0126  -0.0210 -0.0740 263 ARG A CB  
1780 C CG  . ARG A 240 ? 0.9446 1.0355 1.0569 0.0121  -0.0215 -0.0734 263 ARG A CG  
1781 C CD  . ARG A 240 ? 1.0174 1.1076 1.1340 0.0113  -0.0224 -0.0730 263 ARG A CD  
1782 N NE  . ARG A 240 ? 0.9743 1.0632 1.0943 0.0110  -0.0216 -0.0742 263 ARG A NE  
1783 C CZ  . ARG A 240 ? 0.9444 1.0334 1.0656 0.0105  -0.0203 -0.0755 263 ARG A CZ  
1784 N NH1 . ARG A 240 ? 0.9658 1.0563 1.0852 0.0104  -0.0197 -0.0758 263 ARG A NH1 
1785 N NH2 . ARG A 240 ? 0.9031 0.9910 1.0275 0.0102  -0.0197 -0.0765 263 ARG A NH2 
1786 N N   . GLY A 241 ? 0.7037 0.7922 0.8095 0.0143  -0.0190 -0.0754 264 GLY A N   
1787 C CA  . GLY A 241 ? 0.7482 0.8353 0.8541 0.0145  -0.0181 -0.0764 264 GLY A CA  
1788 C C   . GLY A 241 ? 0.7894 0.8759 0.8983 0.0138  -0.0169 -0.0778 264 GLY A C   
1789 O O   . GLY A 241 ? 0.8316 0.9168 0.9417 0.0139  -0.0163 -0.0785 264 GLY A O   
1790 N N   . VAL A 242 ? 0.7918 0.8793 0.9021 0.0132  -0.0165 -0.0782 265 VAL A N   
1791 C CA  . VAL A 242 ? 0.7414 0.8283 0.8548 0.0124  -0.0153 -0.0796 265 VAL A CA  
1792 C C   . VAL A 242 ? 0.6565 0.7438 0.7675 0.0125  -0.0138 -0.0808 265 VAL A C   
1793 O O   . VAL A 242 ? 0.7346 0.8232 0.8425 0.0127  -0.0136 -0.0806 265 VAL A O   
1794 C CB  . VAL A 242 ? 0.7878 0.8755 0.9039 0.0116  -0.0156 -0.0795 265 VAL A CB  
1795 C CG1 . VAL A 242 ? 0.7690 0.8561 0.8885 0.0109  -0.0145 -0.0810 265 VAL A CG1 
1796 C CG2 . VAL A 242 ? 0.8115 0.8988 0.9296 0.0115  -0.0172 -0.0782 265 VAL A CG2 
1797 N N   . PRO A 243 ? 0.5356 0.6217 0.6481 0.0122  -0.0127 -0.0821 266 PRO A N   
1798 C CA  . PRO A 243 ? 0.5449 0.6314 0.6552 0.0122  -0.0112 -0.0832 266 PRO A CA  
1799 C C   . PRO A 243 ? 0.5379 0.6257 0.6481 0.0116  -0.0104 -0.0838 266 PRO A C   
1800 O O   . PRO A 243 ? 0.5227 0.6108 0.6360 0.0109  -0.0106 -0.0839 266 PRO A O   
1801 C CB  . PRO A 243 ? 0.5173 0.6023 0.6301 0.0118  -0.0103 -0.0845 266 PRO A CB  
1802 C CG  . PRO A 243 ? 0.5112 0.5952 0.6272 0.0118  -0.0113 -0.0839 266 PRO A CG  
1803 C CD  . PRO A 243 ? 0.5297 0.6144 0.6463 0.0118  -0.0127 -0.0826 266 PRO A CD  
1804 N N   . VAL A 244 ? 0.5658 0.6544 0.6726 0.0118  -0.0096 -0.0842 267 VAL A N   
1805 C CA  . VAL A 244 ? 0.6107 0.7006 0.7171 0.0113  -0.0089 -0.0847 267 VAL A CA  
1806 C C   . VAL A 244 ? 0.6114 0.7011 0.7163 0.0111  -0.0074 -0.0860 267 VAL A C   
1807 O O   . VAL A 244 ? 0.6503 0.7395 0.7525 0.0117  -0.0072 -0.0861 267 VAL A O   
1808 C CB  . VAL A 244 ? 0.6485 0.7400 0.7516 0.0118  -0.0096 -0.0836 267 VAL A CB  
1809 C CG1 . VAL A 244 ? 0.6264 0.7191 0.7276 0.0115  -0.0086 -0.0843 267 VAL A CG1 
1810 C CG2 . VAL A 244 ? 0.6821 0.7741 0.7870 0.0117  -0.0110 -0.0825 267 VAL A CG2 
1811 N N   . ALA A 245 ? 0.6509 0.7409 0.7575 0.0103  -0.0063 -0.0871 268 ALA A N   
1812 C CA  . ALA A 245 ? 0.6801 0.7697 0.7860 0.0100  -0.0048 -0.0886 268 ALA A CA  
1813 C C   . ALA A 245 ? 0.6481 0.7391 0.7528 0.0095  -0.0040 -0.0891 268 ALA A C   
1814 O O   . ALA A 245 ? 0.7496 0.8411 0.8569 0.0089  -0.0040 -0.0893 268 ALA A O   
1815 C CB  . ALA A 245 ? 0.6945 0.7829 0.8044 0.0093  -0.0042 -0.0897 268 ALA A CB  
1816 N N   . GLU A 246 ? 0.6283 0.7198 0.7291 0.0098  -0.0035 -0.0892 269 GLU A N   
1817 C CA  . GLU A 246 ? 0.6329 0.7257 0.7325 0.0094  -0.0027 -0.0897 269 GLU A CA  
1818 C C   . GLU A 246 ? 0.6429 0.7352 0.7432 0.0086  -0.0011 -0.0913 269 GLU A C   
1819 O O   . GLU A 246 ? 0.6412 0.7323 0.7413 0.0087  -0.0005 -0.0920 269 GLU A O   
1820 C CB  . GLU A 246 ? 0.6685 0.7623 0.7635 0.0102  -0.0030 -0.0890 269 GLU A CB  
1821 C CG  . GLU A 246 ? 0.7154 0.8097 0.8093 0.0109  -0.0046 -0.0875 269 GLU A CG  
1822 C CD  . GLU A 246 ? 0.7582 0.8540 0.8484 0.0115  -0.0049 -0.0868 269 GLU A CD  
1823 O OE1 . GLU A 246 ? 0.8560 0.9520 0.9432 0.0117  -0.0041 -0.0873 269 GLU A OE1 
1824 O OE2 . GLU A 246 ? 0.7041 0.8008 0.7943 0.0117  -0.0060 -0.0857 269 GLU A OE2 
1825 N N   . PHE A 247 ? 0.6625 0.7557 0.7640 0.0079  -0.0004 -0.0920 270 PHE A N   
1826 C CA  . PHE A 247 ? 0.6580 0.7510 0.7600 0.0071  0.0010  -0.0936 270 PHE A CA  
1827 C C   . PHE A 247 ? 0.7029 0.7974 0.8028 0.0069  0.0015  -0.0937 270 PHE A C   
1828 O O   . PHE A 247 ? 0.7000 0.7954 0.8017 0.0064  0.0013  -0.0936 270 PHE A O   
1829 C CB  . PHE A 247 ? 0.6308 0.7232 0.7375 0.0062  0.0015  -0.0945 270 PHE A CB  
1830 C CG  . PHE A 247 ? 0.6177 0.7086 0.7270 0.0063  0.0012  -0.0945 270 PHE A CG  
1831 C CD1 . PHE A 247 ? 0.6407 0.7314 0.7512 0.0069  -0.0002 -0.0933 270 PHE A CD1 
1832 C CD2 . PHE A 247 ? 0.6161 0.7059 0.7267 0.0058  0.0023  -0.0959 270 PHE A CD2 
1833 C CE1 . PHE A 247 ? 0.6586 0.7479 0.7716 0.0070  -0.0005 -0.0933 270 PHE A CE1 
1834 C CE2 . PHE A 247 ? 0.6360 0.7244 0.7492 0.0059  0.0020  -0.0959 270 PHE A CE2 
1835 C CZ  . PHE A 247 ? 0.6459 0.7340 0.7602 0.0065  0.0005  -0.0946 270 PHE A CZ  
1836 N N   . ASN A 248 ? 0.8028 0.8975 0.8987 0.0072  0.0019  -0.0937 271 ASN A N   
1837 C CA  . ASN A 248 ? 0.8873 0.9835 0.9809 0.0071  0.0023  -0.0938 271 ASN A CA  
1838 C C   . ASN A 248 ? 0.8885 0.9843 0.9787 0.0071  0.0032  -0.0945 271 ASN A C   
1839 O O   . ASN A 248 ? 0.7545 0.8490 0.8446 0.0072  0.0036  -0.0950 271 ASN A O   
1840 C CB  . ASN A 248 ? 0.9010 0.9985 0.9928 0.0078  0.0010  -0.0923 271 ASN A CB  
1841 C CG  . ASN A 248 ? 0.9295 1.0265 1.0183 0.0089  0.0001  -0.0913 271 ASN A CG  
1842 O OD1 . ASN A 248 ? 0.8765 0.9728 0.9630 0.0092  0.0006  -0.0918 271 ASN A OD1 
1843 N ND2 . ASN A 248 ? 0.9824 1.0799 1.0713 0.0095  -0.0012 -0.0900 271 ASN A ND2 
1844 N N   . MET A 249 ? 0.9333 1.0304 1.0208 0.0071  0.0036  -0.0945 272 MET A N   
1845 C CA  . MET A 249 ? 0.9121 1.0089 0.9962 0.0072  0.0044  -0.0951 272 MET A CA  
1846 C C   . MET A 249 ? 0.9261 1.0235 1.0060 0.0082  0.0035  -0.0941 272 MET A C   
1847 O O   . MET A 249 ? 0.8924 0.9899 0.9692 0.0083  0.0040  -0.0944 272 MET A O   
1848 C CB  . MET A 249 ? 0.8909 0.9884 0.9751 0.0062  0.0056  -0.0962 272 MET A CB  
1849 C CG  . MET A 249 ? 0.8929 0.9898 0.9812 0.0052  0.0065  -0.0974 272 MET A CG  
1850 S SD  . MET A 249 ? 0.9183 1.0148 1.0060 0.0041  0.0084  -0.0991 272 MET A SD  
1851 C CE  . MET A 249 ? 0.9038 0.9991 0.9881 0.0046  0.0085  -0.0992 272 MET A CE  
1852 N N   . GLU A 250 ? 1.0447 1.1425 1.1247 0.0089  0.0022  -0.0928 273 GLU A N   
1853 C CA  . GLU A 250 ? 1.1282 1.2265 1.2046 0.0100  0.0013  -0.0918 273 GLU A CA  
1854 C C   . GLU A 250 ? 1.2189 1.3157 1.2939 0.0105  0.0013  -0.0919 273 GLU A C   
1855 O O   . GLU A 250 ? 1.1422 1.2376 1.2196 0.0101  0.0018  -0.0925 273 GLU A O   
1856 C CB  . GLU A 250 ? 1.0857 1.1850 1.1624 0.0106  0.0000  -0.0904 273 GLU A CB  
1857 C CG  . GLU A 250 ? 1.1544 1.2553 1.2320 0.0100  0.0001  -0.0905 273 GLU A CG  
1858 C CD  . GLU A 250 ? 1.2176 1.3195 1.2965 0.0102  -0.0010 -0.0894 273 GLU A CD  
1859 O OE1 . GLU A 250 ? 1.2619 1.3638 1.3395 0.0111  -0.0021 -0.0883 273 GLU A OE1 
1860 O OE2 . GLU A 250 ? 1.1208 1.2234 1.2020 0.0095  -0.0008 -0.0896 273 GLU A OE2 
1861 N N   . CYS A 251 ? 1.2401 1.3370 1.3113 0.0113  0.0009  -0.0913 274 CYS A N   
1862 C CA  . CYS A 251 ? 1.1024 1.1980 1.1718 0.0118  0.0010  -0.0915 274 CYS A CA  
1863 C C   . CYS A 251 ? 1.0258 1.1210 1.0949 0.0127  -0.0001 -0.0904 274 CYS A C   
1864 O O   . CYS A 251 ? 0.9139 1.0102 0.9824 0.0133  -0.0011 -0.0894 274 CYS A O   
1865 C CB  . CYS A 251 ? 1.0259 1.1218 1.0911 0.0120  0.0015  -0.0918 274 CYS A CB  
1866 S SG  . CYS A 251 ? 0.9910 1.0878 1.0521 0.0134  0.0002  -0.0905 274 CYS A SG  
1867 N N   . THR A 252 ? 1.1289 1.2225 1.1985 0.0129  -0.0001 -0.0906 275 THR A N   
1868 C CA  . THR A 252 ? 1.2984 1.3915 1.3674 0.0139  -0.0013 -0.0895 275 THR A CA  
1869 C C   . THR A 252 ? 1.3177 1.4102 1.3827 0.0146  -0.0013 -0.0895 275 THR A C   
1870 O O   . THR A 252 ? 1.2156 1.3072 1.2800 0.0142  -0.0003 -0.0904 275 THR A O   
1871 C CB  . THR A 252 ? 1.3680 1.4598 1.4405 0.0136  -0.0014 -0.0896 275 THR A CB  
1872 O OG1 . THR A 252 ? 1.1880 1.2804 1.2639 0.0132  -0.0018 -0.0893 275 THR A OG1 
1873 C CG2 . THR A 252 ? 1.4323 1.5233 1.5037 0.0146  -0.0025 -0.0887 275 THR A CG2 
1874 N N   . PRO A 253 ? 1.4241 1.5173 1.4866 0.0156  -0.0024 -0.0884 276 PRO A N   
1875 C CA  . PRO A 253 ? 1.4127 1.5053 1.4716 0.0163  -0.0025 -0.0883 276 PRO A CA  
1876 C C   . PRO A 253 ? 1.4833 1.5740 1.5428 0.0165  -0.0024 -0.0885 276 PRO A C   
1877 O O   . PRO A 253 ? 1.5141 1.6042 1.5765 0.0164  -0.0028 -0.0883 276 PRO A O   
1878 C CB  . PRO A 253 ? 1.3948 1.4884 1.4516 0.0174  -0.0038 -0.0871 276 PRO A CB  
1879 C CG  . PRO A 253 ? 1.3925 1.4876 1.4512 0.0171  -0.0041 -0.0866 276 PRO A CG  
1880 C CD  . PRO A 253 ? 1.4703 1.5649 1.5330 0.0161  -0.0035 -0.0873 276 PRO A CD  
1881 N N   . ALA A 254 ? 1.5622 1.6520 1.6189 0.0167  -0.0020 -0.0889 277 ALA A N   
1882 C CA  . ALA A 254 ? 1.5231 1.6111 1.5799 0.0167  -0.0017 -0.0893 277 ALA A CA  
1883 C C   . ALA A 254 ? 1.4617 1.5490 1.5201 0.0173  -0.0027 -0.0885 277 ALA A C   
1884 O O   . ALA A 254 ? 1.2968 1.3831 1.3582 0.0168  -0.0025 -0.0888 277 ALA A O   
1885 C CB  . ALA A 254 ? 1.4862 1.5737 1.5390 0.0172  -0.0016 -0.0894 277 ALA A CB  
1886 N N   . THR A 255 ? 1.3853 1.4732 1.4416 0.0183  -0.0039 -0.0874 278 THR A N   
1887 C CA  . THR A 255 ? 1.3357 1.4232 1.3932 0.0190  -0.0050 -0.0864 278 THR A CA  
1888 C C   . THR A 255 ? 1.3208 1.4092 1.3817 0.0186  -0.0054 -0.0860 278 THR A C   
1889 O O   . THR A 255 ? 1.2464 1.3361 1.3069 0.0190  -0.0062 -0.0851 278 THR A O   
1890 C CB  . THR A 255 ? 1.2995 1.3877 1.3537 0.0201  -0.0060 -0.0854 278 THR A CB  
1891 O OG1 . THR A 255 ? 1.1496 1.2389 1.2011 0.0202  -0.0058 -0.0856 278 THR A OG1 
1892 C CG2 . THR A 255 ? 1.3215 1.4082 1.3738 0.0207  -0.0062 -0.0854 278 THR A CG2 
1893 N N   . GLN A 256 ? 1.2885 1.3761 1.3529 0.0177  -0.0047 -0.0867 279 GLN A N   
1894 C CA  . GLN A 256 ? 1.1655 1.2535 1.2336 0.0172  -0.0051 -0.0864 279 GLN A CA  
1895 C C   . GLN A 256 ? 1.0511 1.1381 1.1224 0.0162  -0.0040 -0.0876 279 GLN A C   
1896 O O   . GLN A 256 ? 0.9385 1.0242 1.0099 0.0161  -0.0034 -0.0882 279 GLN A O   
1897 C CB  . GLN A 256 ? 1.2735 1.3633 1.3416 0.0171  -0.0053 -0.0861 279 GLN A CB  
1898 C CG  . GLN A 256 ? 1.4072 1.4979 1.4745 0.0179  -0.0067 -0.0847 279 GLN A CG  
1899 C CD  . GLN A 256 ? 1.5846 1.6770 1.6493 0.0182  -0.0069 -0.0844 279 GLN A CD  
1900 O OE1 . GLN A 256 ? 1.7010 1.7941 1.7652 0.0176  -0.0060 -0.0851 279 GLN A OE1 
1901 N NE2 . GLN A 256 ? 1.6587 1.7519 1.7218 0.0190  -0.0080 -0.0833 279 GLN A NE2 
1902 N N   . LYS A 259 ? 0.9803 1.0705 1.0722 0.0138  -0.0079 -0.0846 282 LYS A N   
1903 C CA  . LYS A 259 ? 1.0019 1.0905 1.0943 0.0141  -0.0079 -0.0848 282 LYS A CA  
1904 C C   . LYS A 259 ? 1.0007 1.0883 1.0935 0.0136  -0.0064 -0.0863 282 LYS A C   
1905 O O   . LYS A 259 ? 1.1788 1.2658 1.2691 0.0140  -0.0060 -0.0866 282 LYS A O   
1906 C CB  . LYS A 259 ? 0.9248 1.0125 1.0206 0.0140  -0.0088 -0.0842 282 LYS A CB  
1907 C CG  . LYS A 259 ? 0.9471 1.0354 1.0416 0.0147  -0.0103 -0.0827 282 LYS A CG  
1908 C CD  . LYS A 259 ? 0.9943 1.0821 1.0923 0.0144  -0.0113 -0.0820 282 LYS A CD  
1909 C CE  . LYS A 259 ? 1.0444 1.1328 1.1407 0.0151  -0.0128 -0.0805 282 LYS A CE  
1910 N NZ  . LYS A 259 ? 1.0344 1.1217 1.1330 0.0152  -0.0138 -0.0798 282 LYS A NZ  
1911 N N   . TYR A 260 ? 0.9395 1.0272 1.0354 0.0126  -0.0056 -0.0872 283 TYR A N   
1912 C CA  . TYR A 260 ? 0.9349 1.0221 1.0310 0.0120  -0.0041 -0.0887 283 TYR A CA  
1913 C C   . TYR A 260 ? 0.8421 0.9307 0.9368 0.0116  -0.0034 -0.0892 283 TYR A C   
1914 O O   . TYR A 260 ? 0.7871 0.8769 0.8821 0.0116  -0.0040 -0.0885 283 TYR A O   
1915 C CB  . TYR A 260 ? 0.9222 1.0084 1.0228 0.0112  -0.0035 -0.0897 283 TYR A CB  
1916 C CG  . TYR A 260 ? 0.9563 1.0412 1.0593 0.0114  -0.0044 -0.0892 283 TYR A CG  
1917 C CD1 . TYR A 260 ? 0.9722 1.0575 1.0762 0.0118  -0.0058 -0.0879 283 TYR A CD1 
1918 C CD2 . TYR A 260 ? 1.0113 1.0948 1.1157 0.0113  -0.0037 -0.0901 283 TYR A CD2 
1919 C CE1 . TYR A 260 ? 1.0167 1.1009 1.1230 0.0120  -0.0066 -0.0874 283 TYR A CE1 
1920 C CE2 . TYR A 260 ? 0.9831 1.0655 1.0898 0.0115  -0.0045 -0.0896 283 TYR A CE2 
1921 C CZ  . TYR A 260 ? 0.9804 1.0631 1.0881 0.0119  -0.0060 -0.0883 283 TYR A CZ  
1922 O OH  . TYR A 260 ? 0.9679 1.0495 1.0778 0.0121  -0.0068 -0.0878 283 TYR A OH  
1923 N N   . HIS A 261 ? 0.8220 0.9104 0.9153 0.0112  -0.0021 -0.0903 284 HIS A N   
1924 C CA  . HIS A 261 ? 0.8363 0.9260 0.9281 0.0108  -0.0013 -0.0908 284 HIS A CA  
1925 C C   . HIS A 261 ? 0.8219 0.9109 0.9141 0.0100  0.0001  -0.0924 284 HIS A C   
1926 O O   . HIS A 261 ? 0.9219 1.0100 1.0123 0.0102  0.0006  -0.0928 284 HIS A O   
1927 C CB  . HIS A 261 ? 0.8703 0.9609 0.9576 0.0116  -0.0017 -0.0901 284 HIS A CB  
1928 C CG  . HIS A 261 ? 0.9848 1.0769 1.0708 0.0112  -0.0012 -0.0903 284 HIS A CG  
1929 N ND1 . HIS A 261 ? 1.0145 1.1067 1.1008 0.0104  0.0000  -0.0916 284 HIS A ND1 
1930 C CD2 . HIS A 261 ? 1.0529 1.1465 1.1373 0.0116  -0.0019 -0.0895 284 HIS A CD2 
1931 C CE1 . HIS A 261 ? 1.0924 1.1860 1.1774 0.0102  0.0002  -0.0915 284 HIS A CE1 
1932 N NE2 . HIS A 261 ? 1.0624 1.1569 1.1463 0.0109  -0.0010 -0.0902 284 HIS A NE2 
1933 N N   . PHE A 262 ? 0.8149 0.9045 0.9096 0.0091  0.0009  -0.0932 285 PHE A N   
1934 C CA  . PHE A 262 ? 0.7756 0.8645 0.8714 0.0082  0.0024  -0.0948 285 PHE A CA  
1935 C C   . PHE A 262 ? 0.8233 0.9133 0.9172 0.0078  0.0032  -0.0953 285 PHE A C   
1936 O O   . PHE A 262 ? 0.8234 0.9144 0.9194 0.0072  0.0034  -0.0956 285 PHE A O   
1937 C CB  . PHE A 262 ? 0.7900 0.8782 0.8906 0.0075  0.0027  -0.0955 285 PHE A CB  
1938 C CG  . PHE A 262 ? 0.8288 0.9157 0.9313 0.0079  0.0020  -0.0951 285 PHE A CG  
1939 C CD1 . PHE A 262 ? 0.9108 0.9964 1.0128 0.0079  0.0026  -0.0958 285 PHE A CD1 
1940 C CD2 . PHE A 262 ? 0.8673 0.9543 0.9720 0.0082  0.0006  -0.0940 285 PHE A CD2 
1941 C CE1 . PHE A 262 ? 0.9545 1.0389 1.0582 0.0082  0.0020  -0.0954 285 PHE A CE1 
1942 C CE2 . PHE A 262 ? 0.9376 1.0233 1.0440 0.0086  0.0000  -0.0936 285 PHE A CE2 
1943 C CZ  . PHE A 262 ? 0.9646 1.0490 1.0705 0.0086  0.0006  -0.0944 285 PHE A CZ  
1944 N N   . GLU A 263 ? 0.9487 1.0388 1.0388 0.0080  0.0037  -0.0955 286 GLU A N   
1945 C CA  . GLU A 263 ? 0.9601 1.0514 1.0477 0.0078  0.0043  -0.0958 286 GLU A CA  
1946 C C   . GLU A 263 ? 0.9069 0.9980 0.9966 0.0066  0.0058  -0.0973 286 GLU A C   
1947 O O   . GLU A 263 ? 0.8237 0.9136 0.9149 0.0061  0.0065  -0.0983 286 GLU A O   
1948 C CB  . GLU A 263 ? 0.9707 1.0618 1.0536 0.0084  0.0044  -0.0956 286 GLU A CB  
1949 C CG  . GLU A 263 ? 1.0353 1.1277 1.1152 0.0083  0.0047  -0.0956 286 GLU A CG  
1950 C CD  . GLU A 263 ? 1.0550 1.1476 1.1305 0.0093  0.0041  -0.0948 286 GLU A CD  
1951 O OE1 . GLU A 263 ? 1.1549 1.2464 1.2292 0.0099  0.0038  -0.0946 286 GLU A OE1 
1952 O OE2 . GLU A 263 ? 1.0516 1.1454 1.1248 0.0095  0.0040  -0.0945 286 GLU A OE2 
1953 N N   . GLY A 264 ? 0.9412 1.0335 1.0312 0.0060  0.0062  -0.0976 287 GLY A N   
1954 C CA  . GLY A 264 ? 0.9721 1.0644 1.0641 0.0049  0.0076  -0.0991 287 GLY A CA  
1955 C C   . GLY A 264 ? 0.9771 1.0704 1.0724 0.0043  0.0075  -0.0991 287 GLY A C   
1956 O O   . GLY A 264 ? 0.9716 1.0652 1.0684 0.0048  0.0063  -0.0981 287 GLY A O   
1957 N N   . PRO A 265 ? 0.9220 1.0156 1.0184 0.0033  0.0087  -0.1004 288 PRO A N   
1958 C CA  . PRO A 265 ? 0.9007 0.9952 1.0005 0.0026  0.0088  -0.1006 288 PRO A CA  
1959 C C   . PRO A 265 ? 0.9509 1.0446 1.0552 0.0025  0.0083  -0.1007 288 PRO A C   
1960 O O   . PRO A 265 ? 0.8780 0.9704 0.9840 0.0022  0.0089  -0.1015 288 PRO A O   
1961 C CB  . PRO A 265 ? 0.8071 0.9017 0.9070 0.0015  0.0104  -0.1022 288 PRO A CB  
1962 C CG  . PRO A 265 ? 0.7817 0.8752 0.8801 0.0014  0.0112  -0.1030 288 PRO A CG  
1963 C CD  . PRO A 265 ? 0.8263 0.9195 0.9213 0.0026  0.0102  -0.1017 288 PRO A CD  
1964 N N   . CYS A 266 ? 0.8854 0.9798 0.9915 0.0028  0.0072  -0.0997 289 CYS A N   
1965 C CA  . CYS A 266 ? 0.8628 0.9565 0.9730 0.0027  0.0066  -0.0995 289 CYS A CA  
1966 C C   . CYS A 266 ? 0.8347 0.9277 0.9486 0.0017  0.0077  -0.1011 289 CYS A C   
1967 O O   . CYS A 266 ? 0.8038 0.8957 0.9205 0.0016  0.0076  -0.1014 289 CYS A O   
1968 C CB  . CYS A 266 ? 0.8900 0.9849 1.0015 0.0028  0.0055  -0.0985 289 CYS A CB  
1969 S SG  . CYS A 266 ? 0.8561 0.9521 0.9631 0.0038  0.0043  -0.0968 289 CYS A SG  
1970 N N   . GLY A 267 ? 0.8095 0.9033 0.9236 0.0008  0.0089  -0.1021 290 GLY A N   
1971 C CA  . GLY A 267 ? 0.8229 0.9162 0.9401 -0.0001 0.0102  -0.1038 290 GLY A CA  
1972 C C   . GLY A 267 ? 0.7720 0.8638 0.8895 -0.0002 0.0108  -0.1046 290 GLY A C   
1973 O O   . GLY A 267 ? 0.7141 0.8052 0.8355 -0.0008 0.0113  -0.1055 290 GLY A O   
1974 N N   . SER A 268 ? 0.7816 0.8730 0.8952 0.0003  0.0108  -0.1042 291 SER A N   
1975 C CA  . SER A 268 ? 0.7978 0.8878 0.9111 0.0002  0.0115  -0.1050 291 SER A CA  
1976 C C   . SER A 268 ? 0.7727 0.8617 0.8864 0.0011  0.0103  -0.1040 291 SER A C   
1977 O O   . SER A 268 ? 0.7357 0.8235 0.8518 0.0009  0.0105  -0.1046 291 SER A O   
1978 C CB  . SER A 268 ? 0.8254 0.9154 0.9340 0.0003  0.0122  -0.1052 291 SER A CB  
1979 O OG  . SER A 268 ? 0.9462 1.0372 1.0538 -0.0003 0.0131  -0.1059 291 SER A OG  
1980 N N   . THR A 269 ? 0.7509 0.8404 0.8622 0.0021  0.0090  -0.1024 292 THR A N   
1981 C CA  . THR A 269 ? 0.7507 0.8394 0.8617 0.0030  0.0078  -0.1013 292 THR A CA  
1982 C C   . THR A 269 ? 0.7513 0.8395 0.8667 0.0030  0.0070  -0.1010 292 THR A C   
1983 O O   . THR A 269 ? 0.7280 0.8151 0.8451 0.0032  0.0067  -0.1010 292 THR A O   
1984 C CB  . THR A 269 ? 0.7849 0.8744 0.8921 0.0040  0.0066  -0.0997 292 THR A CB  
1985 O OG1 . THR A 269 ? 0.8932 0.9838 1.0016 0.0041  0.0057  -0.0989 292 THR A OG1 
1986 C CG2 . THR A 269 ? 0.7900 0.8801 0.8929 0.0040  0.0074  -0.1000 292 THR A CG2 
1987 N N   . LEU A 270 ? 0.8364 0.9256 0.9541 0.0026  0.0067  -0.1008 293 LEU A N   
1988 C CA  . LEU A 270 ? 0.8207 0.9096 0.9420 0.0028  0.0055  -0.1001 293 LEU A CA  
1989 C C   . LEU A 270 ? 0.7452 0.8331 0.8711 0.0021  0.0060  -0.1013 293 LEU A C   
1990 O O   . LEU A 270 ? 0.7193 0.8063 0.8473 0.0025  0.0052  -0.1008 293 LEU A O   
1991 C CB  . LEU A 270 ? 0.8372 0.9274 0.9589 0.0027  0.0048  -0.0994 293 LEU A CB  
1992 C CG  . LEU A 270 ? 0.8433 0.9335 0.9677 0.0031  0.0033  -0.0982 293 LEU A CG  
1993 C CD1 . LEU A 270 ? 0.8184 0.9082 0.9409 0.0041  0.0019  -0.0967 293 LEU A CD1 
1994 C CD2 . LEU A 270 ? 0.8719 0.9636 0.9966 0.0028  0.0028  -0.0977 293 LEU A CD2 
1995 N N   . PRO A 271 ? 0.7070 0.7951 0.8348 0.0011  0.0074  -0.1028 294 PRO A N   
1996 C CA  . PRO A 271 ? 0.7396 0.8268 0.8722 0.0005  0.0078  -0.1039 294 PRO A CA  
1997 C C   . PRO A 271 ? 0.8559 0.9416 0.9892 0.0007  0.0079  -0.1043 294 PRO A C   
1998 O O   . PRO A 271 ? 0.9089 0.9938 1.0458 0.0007  0.0073  -0.1042 294 PRO A O   
1999 C CB  . PRO A 271 ? 0.6847 0.7724 0.8181 -0.0005 0.0095  -0.1056 294 PRO A CB  
2000 C CG  . PRO A 271 ? 0.6725 0.7615 0.8025 -0.0004 0.0095  -0.1051 294 PRO A CG  
2001 C CD  . PRO A 271 ? 0.6656 0.7547 0.7913 0.0006  0.0086  -0.1036 294 PRO A CD  
2002 N N   . PRO A 272 ? 0.9022 0.9875 1.0320 0.0009  0.0087  -0.1046 295 PRO A N   
2003 C CA  . PRO A 272 ? 0.8162 0.9002 0.9462 0.0012  0.0086  -0.1047 295 PRO A CA  
2004 C C   . PRO A 272 ? 0.7949 0.8785 0.9251 0.0022  0.0068  -0.1031 295 PRO A C   
2005 O O   . PRO A 272 ? 0.8361 0.9186 0.9690 0.0023  0.0064  -0.1032 295 PRO A O   
2006 C CB  . PRO A 272 ? 0.8384 0.9223 0.9636 0.0015  0.0093  -0.1048 295 PRO A CB  
2007 C CG  . PRO A 272 ? 0.8894 0.9743 1.0132 0.0008  0.0103  -0.1056 295 PRO A CG  
2008 C CD  . PRO A 272 ? 0.9335 1.0195 1.0591 0.0008  0.0096  -0.1049 295 PRO A CD  
2009 N N   . ALA A 273 ? 0.7399 0.8243 0.8672 0.0029  0.0058  -0.1016 296 ALA A N   
2010 C CA  . ALA A 273 ? 0.7210 0.8051 0.8482 0.0039  0.0041  -0.0999 296 ALA A CA  
2011 C C   . ALA A 273 ? 0.7460 0.8298 0.8780 0.0037  0.0032  -0.0997 296 ALA A C   
2012 O O   . ALA A 273 ? 0.8177 0.9005 0.9509 0.0042  0.0022  -0.0990 296 ALA A O   
2013 C CB  . ALA A 273 ? 0.6826 0.7679 0.8062 0.0045  0.0032  -0.0985 296 ALA A CB  
2014 N N   . LEU A 274 ? 0.6624 0.7469 0.7972 0.0029  0.0035  -0.1003 297 LEU A N   
2015 C CA  . LEU A 274 ? 0.6542 0.7385 0.7934 0.0027  0.0026  -0.1000 297 LEU A CA  
2016 C C   . LEU A 274 ? 0.7122 0.7955 0.8561 0.0020  0.0034  -0.1015 297 LEU A C   
2017 O O   . LEU A 274 ? 0.7113 0.7942 0.8592 0.0019  0.0025  -0.1013 297 LEU A O   
2018 C CB  . LEU A 274 ? 0.6423 0.7279 0.7819 0.0024  0.0024  -0.0997 297 LEU A CB  
2019 C CG  . LEU A 274 ? 0.6281 0.7149 0.7637 0.0031  0.0015  -0.0982 297 LEU A CG  
2020 C CD1 . LEU A 274 ? 0.6359 0.7239 0.7723 0.0026  0.0014  -0.0980 297 LEU A CD1 
2021 C CD2 . LEU A 274 ? 0.6137 0.7000 0.7487 0.0040  -0.0001 -0.0965 297 LEU A CD2 
2022 N N   . GLU A 275 ? 0.8100 0.8929 0.9535 0.0015  0.0049  -0.1030 298 GLU A N   
2023 C CA  . GLU A 275 ? 0.8234 0.9054 0.9709 0.0008  0.0058  -0.1046 298 GLU A CA  
2024 C C   . GLU A 275 ? 0.8496 0.9304 1.0003 0.0012  0.0048  -0.1041 298 GLU A C   
2025 O O   . GLU A 275 ? 0.8367 0.9170 0.9854 0.0020  0.0037  -0.1029 298 GLU A O   
2026 C CB  . GLU A 275 ? 0.8562 0.9379 1.0014 0.0005  0.0074  -0.1059 298 GLU A CB  
2027 C CG  . GLU A 275 ? 0.8806 0.9613 1.0290 -0.0001 0.0085  -0.1076 298 GLU A CG  
2028 C CD  . GLU A 275 ? 0.9221 1.0023 1.0672 -0.0003 0.0098  -0.1084 298 GLU A CD  
2029 O OE1 . GLU A 275 ? 0.9261 1.0069 1.0668 -0.0001 0.0101  -0.1080 298 GLU A OE1 
2030 O OE2 . GLU A 275 ? 0.9813 1.0605 1.1283 -0.0006 0.0105  -0.1095 298 GLU A OE2 
2031 O OXT . GLU A 275 ? 0.8981 0.9783 1.0533 0.0007  0.0049  -0.1050 298 GLU A OXT 
2032 N N   . SER B 10  ? 1.2757 1.5253 1.3551 -0.0946 0.0892  -0.1119 33  SER B N   
2033 C CA  . SER B 10  ? 1.2848 1.5427 1.3647 -0.0953 0.0893  -0.1125 33  SER B CA  
2034 C C   . SER B 10  ? 1.3455 1.5885 1.4263 -0.0855 0.0865  -0.1040 33  SER B C   
2035 O O   . SER B 10  ? 1.3129 1.5313 1.3933 -0.0824 0.0864  -0.1013 33  SER B O   
2036 C CB  . SER B 10  ? 1.2582 1.5090 1.3362 -0.1065 0.0944  -0.1223 33  SER B CB  
2037 O OG  . SER B 10  ? 1.1962 1.4554 1.2745 -0.1081 0.0948  -0.1237 33  SER B OG  
2038 N N   . SER B 11  ? 1.3521 1.6113 1.4343 -0.0806 0.0844  -0.0997 34  SER B N   
2039 C CA  . SER B 11  ? 1.3250 1.5717 1.4079 -0.0731 0.0828  -0.0932 34  SER B CA  
2040 C C   . SER B 11  ? 1.3257 1.5760 1.4083 -0.0783 0.0844  -0.0977 34  SER B C   
2041 O O   . SER B 11  ? 1.3264 1.5772 1.4099 -0.0728 0.0829  -0.0929 34  SER B O   
2042 C CB  . SER B 11  ? 1.2750 1.5344 1.3595 -0.0624 0.0799  -0.0837 34  SER B CB  
2043 O OG  . SER B 11  ? 1.2670 1.5056 1.3519 -0.0546 0.0788  -0.0770 34  SER B OG  
2044 N N   . ASP B 12  ? 1.2595 1.5112 1.3407 -0.0892 0.0879  -0.1072 35  ASP B N   
2045 C CA  . ASP B 12  ? 1.1607 1.4166 1.2414 -0.0956 0.0903  -0.1128 35  ASP B CA  
2046 C C   . ASP B 12  ? 1.0953 1.3228 1.1747 -0.0971 0.0925  -0.1142 35  ASP B C   
2047 O O   . ASP B 12  ? 1.0606 1.2731 1.1381 -0.1036 0.0965  -0.1199 35  ASP B O   
2048 C CB  . ASP B 12  ? 1.1352 1.4088 1.2147 -0.1073 0.0940  -0.1230 35  ASP B CB  
2049 C CG  . ASP B 12  ? 1.0797 1.3674 1.1591 -0.1130 0.0958  -0.1281 35  ASP B CG  
2050 O OD1 . ASP B 12  ? 0.9385 1.2188 1.0185 -0.1086 0.0946  -0.1243 35  ASP B OD1 
2051 O OD2 . ASP B 12  ? 1.1706 1.4778 1.2495 -0.1224 0.0986  -0.1363 35  ASP B OD2 
2052 N N   . LEU B 13  ? 0.9527 1.1739 1.0330 -0.0907 0.0904  -0.1087 36  LEU B N   
2053 C CA  . LEU B 13  ? 0.8879 1.0847 0.9674 -0.0906 0.0920  -0.1087 36  LEU B CA  
2054 C C   . LEU B 13  ? 0.9202 1.1126 0.9978 -0.1010 0.0972  -0.1177 36  LEU B C   
2055 O O   . LEU B 13  ? 0.8557 1.0265 0.9315 -0.1035 0.1005  -0.1201 36  LEU B O   
2056 C CB  . LEU B 13  ? 0.8529 1.0490 0.9338 -0.0826 0.0888  -0.1017 36  LEU B CB  
2057 C CG  . LEU B 13  ? 0.8397 1.0143 0.9201 -0.0810 0.0895  -0.1004 36  LEU B CG  
2058 C CD1 . LEU B 13  ? 0.8204 0.9710 0.8993 -0.0824 0.0917  -0.1018 36  LEU B CD1 
2059 C CD2 . LEU B 13  ? 0.8313 1.0039 0.9133 -0.0710 0.0858  -0.0918 36  LEU B CD2 
2060 N N   . THR B 14  ? 0.9870 1.2002 1.0646 -0.1071 0.0986  -0.1230 37  THR B N   
2061 C CA  . THR B 14  ? 1.0052 1.2145 1.0810 -0.1172 0.1043  -0.1318 37  THR B CA  
2062 C C   . THR B 14  ? 0.9639 1.1641 1.0374 -0.1254 0.1097  -0.1390 37  THR B C   
2063 O O   . THR B 14  ? 0.9505 1.1332 1.0218 -0.1312 0.1154  -0.1441 37  THR B O   
2064 C CB  . THR B 14  ? 1.0019 1.2382 1.0782 -0.1226 0.1047  -0.1365 37  THR B CB  
2065 O OG1 . THR B 14  ? 0.9804 1.2397 1.0589 -0.1157 0.0994  -0.1305 37  THR B OG1 
2066 C CG2 . THR B 14  ? 0.9482 1.1772 1.0243 -0.1232 0.1060  -0.1371 37  THR B CG2 
2067 N N   . ALA B 15  ? 0.9216 1.1334 0.9956 -0.1255 0.1083  -0.1391 38  ALA B N   
2068 C CA  . ALA B 15  ? 0.9375 1.1409 1.0095 -0.1326 0.1132  -0.1452 38  ALA B CA  
2069 C C   . ALA B 15  ? 0.9238 1.0961 0.9944 -0.1286 0.1148  -0.1419 38  ALA B C   
2070 O O   . ALA B 15  ? 0.7873 0.9435 0.8554 -0.1349 0.1214  -0.1474 38  ALA B O   
2071 C CB  . ALA B 15  ? 0.9418 1.1632 1.0148 -0.1314 0.1102  -0.1442 38  ALA B CB  
2072 N N   . PHE B 16  ? 0.8954 1.0603 0.9676 -0.1179 0.1091  -0.1326 39  PHE B N   
2073 C CA  . PHE B 16  ? 0.8598 0.9986 0.9311 -0.1130 0.1097  -0.1284 39  PHE B CA  
2074 C C   . PHE B 16  ? 0.8599 0.9815 0.9297 -0.1146 0.1136  -0.1299 39  PHE B C   
2075 O O   . PHE B 16  ? 0.9189 1.0211 0.9865 -0.1164 0.1184  -0.1316 39  PHE B O   
2076 C CB  . PHE B 16  ? 0.8574 0.9938 0.9309 -0.1019 0.1031  -0.1188 39  PHE B CB  
2077 C CG  . PHE B 16  ? 0.8242 0.9364 0.8970 -0.0968 0.1032  -0.1145 39  PHE B CG  
2078 C CD1 . PHE B 16  ? 0.7721 0.8698 0.8437 -0.0958 0.1047  -0.1139 39  PHE B CD1 
2079 C CD2 . PHE B 16  ? 0.8562 0.9611 0.9294 -0.0930 0.1021  -0.1114 39  PHE B CD2 
2080 C CE1 . PHE B 16  ? 0.7660 0.8436 0.8369 -0.0909 0.1049  -0.1098 39  PHE B CE1 
2081 C CE2 . PHE B 16  ? 0.8789 0.9634 0.9515 -0.0884 0.1023  -0.1076 39  PHE B CE2 
2082 C CZ  . PHE B 16  ? 0.8200 0.8914 0.8914 -0.0873 0.1037  -0.1068 39  PHE B CZ  
2083 N N   . ARG B 17  ? 0.8648 0.9936 0.9356 -0.1135 0.1119  -0.1290 40  ARG B N   
2084 C CA  . ARG B 17  ? 0.8749 0.9880 0.9443 -0.1147 0.1155  -0.1301 40  ARG B CA  
2085 C C   . ARG B 17  ? 0.8891 0.9959 0.9556 -0.1251 0.1241  -0.1391 40  ARG B C   
2086 O O   . ARG B 17  ? 0.8241 0.9109 0.8885 -0.1257 0.1291  -0.1398 40  ARG B O   
2087 C CB  . ARG B 17  ? 0.9074 1.0318 0.9784 -0.1130 0.1127  -0.1286 40  ARG B CB  
2088 C CG  . ARG B 17  ? 0.9296 1.0598 1.0033 -0.1029 0.1053  -0.1198 40  ARG B CG  
2089 C CD  . ARG B 17  ? 0.9331 1.0600 1.0076 -0.0989 0.1035  -0.1164 40  ARG B CD  
2090 N NE  . ARG B 17  ? 0.9607 1.0646 1.0345 -0.0938 0.1036  -0.1122 40  ARG B NE  
2091 C CZ  . ARG B 17  ? 0.9435 1.0319 1.0155 -0.0964 0.1080  -0.1145 40  ARG B CZ  
2092 N NH1 . ARG B 17  ? 1.0198 1.1109 1.0903 -0.1045 0.1132  -0.1215 40  ARG B NH1 
2093 N NH2 . ARG B 17  ? 0.9384 1.0091 1.0101 -0.0907 0.1074  -0.1099 40  ARG B NH2 
2094 N N   . GLU B 18  ? 0.9348 1.0596 1.0011 -0.1333 0.1264  -0.1462 41  GLU B N   
2095 C CA  . GLU B 18  ? 0.9293 1.0492 0.9926 -0.1444 0.1355  -0.1558 41  GLU B CA  
2096 C C   . GLU B 18  ? 0.8509 0.9486 0.9119 -0.1442 0.1404  -0.1558 41  GLU B C   
2097 O O   . GLU B 18  ? 0.8837 0.9659 0.9418 -0.1497 0.1489  -0.1606 41  GLU B O   
2098 C CB  . GLU B 18  ? 0.9998 1.1449 1.0634 -0.1533 0.1367  -0.1635 41  GLU B CB  
2099 C CG  . GLU B 18  ? 1.0474 1.2128 1.1119 -0.1583 0.1365  -0.1678 41  GLU B CG  
2100 C CD  . GLU B 18  ? 1.1050 1.2894 1.1683 -0.1709 0.1419  -0.1788 41  GLU B CD  
2101 O OE1 . GLU B 18  ? 1.0828 1.2796 1.1467 -0.1722 0.1404  -0.1800 41  GLU B OE1 
2102 O OE2 . GLU B 18  ? 1.1641 1.3509 1.2259 -0.1800 0.1480  -0.1867 41  GLU B OE2 
2103 N N   . HIS B 19  ? 0.7844 0.8805 0.8465 -0.1378 0.1357  -0.1502 42  HIS B N   
2104 C CA  . HIS B 19  ? 0.7930 0.8681 0.8530 -0.1363 0.1398  -0.1490 42  HIS B CA  
2105 C C   . HIS B 19  ? 0.7725 0.8262 0.8317 -0.1294 0.1403  -0.1432 42  HIS B C   
2106 O O   . HIS B 19  ? 0.7682 0.8028 0.8244 -0.1313 0.1479  -0.1449 42  HIS B O   
2107 C CB  . HIS B 19  ? 0.8036 0.8831 0.8652 -0.1308 0.1341  -0.1442 42  HIS B CB  
2108 C CG  . HIS B 19  ? 0.8365 0.9311 0.8978 -0.1382 0.1359  -0.1505 42  HIS B CG  
2109 N ND1 . HIS B 19  ? 0.8473 0.9320 0.9058 -0.1451 0.1436  -0.1565 42  HIS B ND1 
2110 C CD2 . HIS B 19  ? 0.8242 0.9442 0.8875 -0.1403 0.1316  -0.1522 42  HIS B CD2 
2111 C CE1 . HIS B 19  ? 0.9124 1.0159 0.9713 -0.1515 0.1437  -0.1620 42  HIS B CE1 
2112 N NE2 . HIS B 19  ? 0.8504 0.9762 0.9123 -0.1486 0.1364  -0.1594 42  HIS B NE2 
2113 N N   . PHE B 20  ? 0.7833 0.8411 0.8451 -0.1210 0.1325  -0.1359 43  PHE B N   
2114 C CA  . PHE B 20  ? 0.7956 0.8372 0.8574 -0.1136 0.1313  -0.1297 43  PHE B CA  
2115 C C   . PHE B 20  ? 0.8395 0.8684 0.8986 -0.1182 0.1393  -0.1338 43  PHE B C   
2116 O O   . PHE B 20  ? 0.7936 0.8031 0.8504 -0.1155 0.1439  -0.1316 43  PHE B O   
2117 C CB  . PHE B 20  ? 0.7823 0.8348 0.8472 -0.1069 0.1230  -0.1238 43  PHE B CB  
2118 C CG  . PHE B 20  ? 0.7635 0.8020 0.8286 -0.0995 0.1212  -0.1177 43  PHE B CG  
2119 C CD1 . PHE B 20  ? 0.7247 0.7468 0.7888 -0.0943 0.1218  -0.1134 43  PHE B CD1 
2120 C CD2 . PHE B 20  ? 0.7509 0.7935 0.8171 -0.0979 0.1189  -0.1163 43  PHE B CD2 
2121 C CE1 . PHE B 20  ? 0.7076 0.7187 0.7718 -0.0879 0.1203  -0.1081 43  PHE B CE1 
2122 C CE2 . PHE B 20  ? 0.7641 0.7945 0.8305 -0.0916 0.1175  -0.1110 43  PHE B CE2 
2123 C CZ  . PHE B 20  ? 0.7284 0.7436 0.7938 -0.0866 0.1182  -0.1071 43  PHE B CZ  
2124 N N   . ALA B 21  ? 0.8124 0.8529 0.8713 -0.1255 0.1417  -0.1399 44  ALA B N   
2125 C CA  . ALA B 21  ? 0.7897 0.8197 0.8461 -0.1310 0.1499  -0.1448 44  ALA B CA  
2126 C C   . ALA B 21  ? 0.8417 0.8528 0.8942 -0.1349 0.1599  -0.1483 44  ALA B C   
2127 O O   . ALA B 21  ? 0.8122 0.8055 0.8625 -0.1333 0.1657  -0.1470 44  ALA B O   
2128 C CB  . ALA B 21  ? 0.7896 0.8379 0.8463 -0.1402 0.1516  -0.1526 44  ALA B CB  
2129 N N   . LYS B 22  ? 0.9813 0.9965 1.0331 -0.1398 0.1624  -0.1525 45  LYS B N   
2130 C CA  . LYS B 22  ? 0.9966 0.9949 1.0445 -0.1449 0.1732  -0.1569 45  LYS B CA  
2131 C C   . LYS B 22  ? 0.9957 0.9756 1.0427 -0.1358 0.1732  -0.1493 45  LYS B C   
2132 O O   . LYS B 22  ? 1.0928 1.0534 1.1365 -0.1358 0.1820  -0.1494 45  LYS B O   
2133 C CB  . LYS B 22  ? 1.0132 1.0238 1.0606 -0.1543 0.1762  -0.1649 45  LYS B CB  
2134 C CG  . LYS B 22  ? 1.0894 1.1189 1.1373 -0.1643 0.1778  -0.1735 45  LYS B CG  
2135 C CD  . LYS B 22  ? 1.1780 1.2194 1.2248 -0.1756 0.1830  -0.1832 45  LYS B CD  
2136 C CE  . LYS B 22  ? 1.2254 1.2865 1.2725 -0.1859 0.1851  -0.1921 45  LYS B CE  
2137 N NZ  . LYS B 22  ? 1.2736 1.3532 1.3206 -0.1961 0.1875  -0.2010 45  LYS B NZ  
2138 N N   . ALA B 23  ? 0.9470 0.9332 0.9968 -0.1278 0.1635  -0.1424 46  ALA B N   
2139 C CA  . ALA B 23  ? 0.9503 0.9224 0.9995 -0.1196 0.1626  -0.1355 46  ALA B CA  
2140 C C   . ALA B 23  ? 0.8997 0.8510 0.9463 -0.1144 0.1684  -0.1312 46  ALA B C   
2141 O O   . ALA B 23  ? 0.8495 0.7991 0.8967 -0.1114 0.1670  -0.1288 46  ALA B O   
2142 C CB  . ALA B 23  ? 0.9524 0.9343 1.0053 -0.1114 0.1511  -0.1283 46  ALA B CB  
2143 N N   . LYS B 24  ? 0.9473 0.8834 0.9911 -0.1129 0.1750  -0.1301 47  LYS B N   
2144 C CA  . LYS B 24  ? 0.9893 0.9064 1.0305 -0.1065 0.1809  -0.1249 47  LYS B CA  
2145 C C   . LYS B 24  ? 0.9446 0.8564 0.9864 -0.0964 0.1762  -0.1164 47  LYS B C   
2146 O O   . LYS B 24  ? 0.8811 0.7836 0.9222 -0.0889 0.1768  -0.1103 47  LYS B O   
2147 C CB  . LYS B 24  ? 1.1170 1.0187 1.1535 -0.1129 0.1951  -0.1304 47  LYS B CB  
2148 C CG  . LYS B 24  ? 1.2951 1.1978 1.3307 -0.1199 0.2002  -0.1363 47  LYS B CG  
2149 C CD  . LYS B 24  ? 1.3361 1.2293 1.3677 -0.1302 0.2140  -0.1451 47  LYS B CD  
2150 C CE  . LYS B 24  ? 1.3059 1.2054 1.3378 -0.1365 0.2155  -0.1504 47  LYS B CE  
2151 N NZ  . LYS B 24  ? 1.3588 1.2460 1.3864 -0.1459 0.2303  -0.1585 47  LYS B NZ  
2152 N N   . HIS B 25  ? 0.9792 0.8987 1.0226 -0.0962 0.1711  -0.1161 48  HIS B N   
2153 C CA  . HIS B 25  ? 1.0290 0.9463 1.0735 -0.0871 0.1655  -0.1086 48  HIS B CA  
2154 C C   . HIS B 25  ? 0.9908 0.9249 1.0393 -0.0865 0.1547  -0.1079 48  HIS B C   
2155 O O   . HIS B 25  ? 1.0035 0.9449 1.0524 -0.0914 0.1541  -0.1119 48  HIS B O   
2156 C CB  . HIS B 25  ? 1.1039 1.0085 1.1453 -0.0863 0.1729  -0.1081 48  HIS B CB  
2157 C CG  . HIS B 25  ? 1.2756 1.1624 1.3127 -0.0858 0.1848  -0.1078 48  HIS B CG  
2158 N ND1 . HIS B 25  ? 1.3593 1.2349 1.3948 -0.0766 0.1871  -0.1003 48  HIS B ND1 
2159 C CD2 . HIS B 25  ? 1.3070 1.1854 1.3409 -0.0934 0.1957  -0.1142 48  HIS B CD2 
2160 C CE1 . HIS B 25  ? 1.3331 1.1937 1.3646 -0.0777 0.1990  -0.1013 48  HIS B CE1 
2161 N NE2 . HIS B 25  ? 1.3114 1.1725 1.3418 -0.0881 0.2047  -0.1099 48  HIS B NE2 
2162 N N   . ILE B 26  ? 0.8904 0.8305 0.9416 -0.0806 0.1466  -0.1030 49  ILE B N   
2163 C CA  . ILE B 26  ? 0.7922 0.7474 0.8469 -0.0795 0.1371  -0.1018 49  ILE B CA  
2164 C C   . ILE B 26  ? 0.7265 0.6803 0.7826 -0.0717 0.1315  -0.0954 49  ILE B C   
2165 O O   . ILE B 26  ? 0.7379 0.6844 0.7936 -0.0657 0.1314  -0.0906 49  ILE B O   
2166 C CB  . ILE B 26  ? 0.7998 0.7639 0.8568 -0.0791 0.1322  -0.1014 49  ILE B CB  
2167 C CG1 . ILE B 26  ? 0.8283 0.7970 0.8844 -0.0875 0.1370  -0.1083 49  ILE B CG1 
2168 C CG2 . ILE B 26  ? 0.7959 0.7743 0.8565 -0.0765 0.1231  -0.0990 49  ILE B CG2 
2169 C CD1 . ILE B 26  ? 0.8475 0.8275 0.9060 -0.0874 0.1318  -0.1082 49  ILE B CD1 
2170 N N   . ALA B 27  ? 0.6769 0.6388 0.7346 -0.0719 0.1271  -0.0955 50  ALA B N   
2171 C CA  . ALA B 27  ? 0.6563 0.6175 0.7153 -0.0652 0.1220  -0.0900 50  ALA B CA  
2172 C C   . ALA B 27  ? 0.6266 0.6011 0.6890 -0.0637 0.1138  -0.0886 50  ALA B C   
2173 O O   . ALA B 27  ? 0.5848 0.5701 0.6483 -0.0680 0.1124  -0.0919 50  ALA B O   
2174 C CB  . ALA B 27  ? 0.6384 0.5948 0.6959 -0.0656 0.1248  -0.0904 50  ALA B CB  
2175 N N   . ILE B 28  ? 0.5685 0.5426 0.6325 -0.0576 0.1092  -0.0836 51  ILE B N   
2176 C CA  . ILE B 28  ? 0.5393 0.5233 0.6061 -0.0555 0.1028  -0.0817 51  ILE B CA  
2177 C C   . ILE B 28  ? 0.5371 0.5197 0.6048 -0.0508 0.0995  -0.0779 51  ILE B C   
2178 O O   . ILE B 28  ? 0.5855 0.5613 0.6526 -0.0467 0.0997  -0.0749 51  ILE B O   
2179 C CB  . ILE B 28  ? 0.5786 0.5628 0.6463 -0.0532 0.1011  -0.0799 51  ILE B CB  
2180 C CG1 . ILE B 28  ? 0.6321 0.6162 0.6985 -0.0582 0.1053  -0.0839 51  ILE B CG1 
2181 C CG2 . ILE B 28  ? 0.5861 0.5802 0.6566 -0.0511 0.0953  -0.0778 51  ILE B CG2 
2182 C CD1 . ILE B 28  ? 0.6576 0.6432 0.7250 -0.0567 0.1037  -0.0827 51  ILE B CD1 
2183 N N   . ILE B 29  ? 0.5545 0.5445 0.6235 -0.0513 0.0966  -0.0781 52  ILE B N   
2184 C CA  . ILE B 29  ? 0.5450 0.5347 0.6150 -0.0474 0.0934  -0.0750 52  ILE B CA  
2185 C C   . ILE B 29  ? 0.5693 0.5658 0.6417 -0.0445 0.0887  -0.0725 52  ILE B C   
2186 O O   . ILE B 29  ? 0.5569 0.5624 0.6305 -0.0462 0.0875  -0.0735 52  ILE B O   
2187 C CB  . ILE B 29  ? 0.5406 0.5341 0.6104 -0.0499 0.0937  -0.0769 52  ILE B CB  
2188 C CG1 . ILE B 29  ? 0.5297 0.5156 0.5969 -0.0530 0.0992  -0.0796 52  ILE B CG1 
2189 C CG2 . ILE B 29  ? 0.5385 0.5330 0.6095 -0.0462 0.0903  -0.0738 52  ILE B CG2 
2190 C CD1 . ILE B 29  ? 0.5309 0.5233 0.5978 -0.0582 0.1005  -0.0836 52  ILE B CD1 
2191 N N   . THR B 30  ? 0.5635 0.5565 0.6366 -0.0403 0.0866  -0.0693 53  THR B N   
2192 C CA  . THR B 30  ? 0.5435 0.5409 0.6187 -0.0376 0.0834  -0.0670 53  THR B CA  
2193 C C   . THR B 30  ? 0.5276 0.5249 0.6038 -0.0348 0.0813  -0.0648 53  THR B C   
2194 O O   . THR B 30  ? 0.5508 0.5430 0.6262 -0.0333 0.0816  -0.0640 53  THR B O   
2195 C CB  . THR B 30  ? 0.5298 0.5236 0.6050 -0.0359 0.0834  -0.0659 53  THR B CB  
2196 O OG1 . THR B 30  ? 0.5038 0.4919 0.5785 -0.0333 0.0835  -0.0643 53  THR B OG1 
2197 C CG2 . THR B 30  ? 0.5347 0.5269 0.6086 -0.0387 0.0862  -0.0682 53  THR B CG2 
2198 N N   . GLY B 31  ? 0.5393 0.5427 0.6170 -0.0338 0.0796  -0.0636 54  GLY B N   
2199 C CA  . GLY B 31  ? 0.5790 0.5823 0.6575 -0.0314 0.0783  -0.0617 54  GLY B CA  
2200 C C   . GLY B 31  ? 0.6140 0.6168 0.6937 -0.0288 0.0776  -0.0597 54  GLY B C   
2201 O O   . GLY B 31  ? 0.6333 0.6353 0.7131 -0.0288 0.0778  -0.0598 54  GLY B O   
2202 N N   . ALA B 32  ? 0.6292 0.6320 0.7097 -0.0268 0.0773  -0.0580 55  ALA B N   
2203 C CA  . ALA B 32  ? 0.6068 0.6072 0.6881 -0.0248 0.0777  -0.0566 55  ALA B CA  
2204 C C   . ALA B 32  ? 0.5896 0.5940 0.6718 -0.0234 0.0782  -0.0550 55  ALA B C   
2205 O O   . ALA B 32  ? 0.5974 0.5993 0.6802 -0.0222 0.0791  -0.0542 55  ALA B O   
2206 C CB  . ALA B 32  ? 0.6024 0.6004 0.6841 -0.0235 0.0783  -0.0558 55  ALA B CB  
2207 N N   . GLY B 33  ? 0.5795 0.5909 0.6619 -0.0238 0.0779  -0.0548 56  GLY B N   
2208 C CA  . GLY B 33  ? 0.6137 0.6306 0.6967 -0.0223 0.0783  -0.0530 56  GLY B CA  
2209 C C   . GLY B 33  ? 0.6147 0.6282 0.6978 -0.0226 0.0785  -0.0536 56  GLY B C   
2210 O O   . GLY B 33  ? 0.6133 0.6276 0.6971 -0.0205 0.0795  -0.0517 56  GLY B O   
2211 N N   . VAL B 34  ? 0.6347 0.6441 0.7170 -0.0251 0.0780  -0.0561 57  VAL B N   
2212 C CA  . VAL B 34  ? 0.6662 0.6731 0.7483 -0.0258 0.0781  -0.0569 57  VAL B CA  
2213 C C   . VAL B 34  ? 0.6379 0.6388 0.7202 -0.0245 0.0786  -0.0564 57  VAL B C   
2214 O O   . VAL B 34  ? 0.6440 0.6440 0.7267 -0.0239 0.0790  -0.0560 57  VAL B O   
2215 C CB  . VAL B 34  ? 0.6559 0.6604 0.7367 -0.0286 0.0782  -0.0595 57  VAL B CB  
2216 C CG1 . VAL B 34  ? 0.6668 0.6710 0.7474 -0.0296 0.0787  -0.0603 57  VAL B CG1 
2217 C CG2 . VAL B 34  ? 0.6701 0.6789 0.7503 -0.0309 0.0785  -0.0610 57  VAL B CG2 
2218 N N   . SER B 35  ? 0.6037 0.6012 0.6857 -0.0244 0.0786  -0.0568 58  SER B N   
2219 C CA  . SER B 35  ? 0.6281 0.6218 0.7104 -0.0239 0.0792  -0.0571 58  SER B CA  
2220 C C   . SER B 35  ? 0.6335 0.6267 0.7167 -0.0223 0.0810  -0.0555 58  SER B C   
2221 O O   . SER B 35  ? 0.6055 0.5958 0.6890 -0.0222 0.0824  -0.0558 58  SER B O   
2222 C CB  . SER B 35  ? 0.6288 0.6205 0.7105 -0.0245 0.0789  -0.0581 58  SER B CB  
2223 O OG  . SER B 35  ? 0.7123 0.7035 0.7928 -0.0254 0.0783  -0.0590 58  SER B OG  
2224 N N   . ALA B 36  ? 0.6454 0.6415 0.7289 -0.0209 0.0814  -0.0537 59  ALA B N   
2225 C CA  . ALA B 36  ? 0.6817 0.6775 0.7658 -0.0183 0.0839  -0.0512 59  ALA B CA  
2226 C C   . ALA B 36  ? 0.6645 0.6614 0.7490 -0.0172 0.0848  -0.0501 59  ALA B C   
2227 O O   . ALA B 36  ? 0.6658 0.6586 0.7505 -0.0162 0.0874  -0.0495 59  ALA B O   
2228 C CB  . ALA B 36  ? 0.6591 0.6599 0.7433 -0.0164 0.0840  -0.0490 59  ALA B CB  
2229 N N   . GLU B 37  ? 0.6219 0.6244 0.7065 -0.0177 0.0830  -0.0500 60  GLU B N   
2230 C CA  . GLU B 37  ? 0.6054 0.6098 0.6903 -0.0166 0.0836  -0.0490 60  GLU B CA  
2231 C C   . GLU B 37  ? 0.6170 0.6156 0.7020 -0.0178 0.0841  -0.0505 60  GLU B C   
2232 O O   . GLU B 37  ? 0.6523 0.6512 0.7376 -0.0166 0.0853  -0.0494 60  GLU B O   
2233 C CB  . GLU B 37  ? 0.6058 0.6175 0.6907 -0.0180 0.0815  -0.0497 60  GLU B CB  
2234 C CG  . GLU B 37  ? 0.6293 0.6501 0.7144 -0.0167 0.0813  -0.0479 60  GLU B CG  
2235 C CD  . GLU B 37  ? 0.6906 0.7204 0.7757 -0.0181 0.0802  -0.0487 60  GLU B CD  
2236 O OE1 . GLU B 37  ? 0.7316 0.7613 0.8168 -0.0182 0.0803  -0.0489 60  GLU B OE1 
2237 O OE2 . GLU B 37  ? 0.7144 0.7518 0.7993 -0.0196 0.0793  -0.0497 60  GLU B OE2 
2238 N N   . SER B 38  ? 0.5869 0.5812 0.6714 -0.0199 0.0835  -0.0530 61  SER B N   
2239 C CA  . SER B 38  ? 0.5607 0.5513 0.6451 -0.0210 0.0841  -0.0546 61  SER B CA  
2240 C C   . SER B 38  ? 0.5633 0.5495 0.6479 -0.0210 0.0869  -0.0551 61  SER B C   
2241 O O   . SER B 38  ? 0.5559 0.5399 0.6405 -0.0226 0.0877  -0.0572 61  SER B O   
2242 C CB  . SER B 38  ? 0.5485 0.5390 0.6323 -0.0230 0.0819  -0.0568 61  SER B CB  
2243 O OG  . SER B 38  ? 0.5438 0.5368 0.6272 -0.0235 0.0805  -0.0568 61  SER B OG  
2244 N N   . GLY B 39  ? 0.5682 0.5537 0.6529 -0.0195 0.0887  -0.0535 62  GLY B N   
2245 C CA  . GLY B 39  ? 0.5926 0.5730 0.6772 -0.0196 0.0926  -0.0540 62  GLY B CA  
2246 C C   . GLY B 39  ? 0.6155 0.5945 0.6998 -0.0223 0.0922  -0.0570 62  GLY B C   
2247 O O   . GLY B 39  ? 0.6644 0.6404 0.7486 -0.0242 0.0948  -0.0593 62  GLY B O   
2248 N N   . VAL B 40  ? 0.6632 0.6451 0.7472 -0.0226 0.0891  -0.0572 63  VAL B N   
2249 C CA  . VAL B 40  ? 0.6658 0.6475 0.7495 -0.0248 0.0886  -0.0598 63  VAL B CA  
2250 C C   . VAL B 40  ? 0.7321 0.7118 0.8157 -0.0242 0.0905  -0.0592 63  VAL B C   
2251 O O   . VAL B 40  ? 0.7907 0.7719 0.8743 -0.0223 0.0895  -0.0568 63  VAL B O   
2252 C CB  . VAL B 40  ? 0.6397 0.6250 0.7229 -0.0253 0.0848  -0.0603 63  VAL B CB  
2253 C CG1 . VAL B 40  ? 0.6799 0.6662 0.7626 -0.0268 0.0845  -0.0624 63  VAL B CG1 
2254 C CG2 . VAL B 40  ? 0.6243 0.6111 0.7074 -0.0257 0.0836  -0.0609 63  VAL B CG2 
2255 N N   . PRO B 41  ? 0.8007 0.7778 0.8841 -0.0263 0.0932  -0.0616 64  PRO B N   
2256 C CA  . PRO B 41  ? 0.8739 0.8486 0.9572 -0.0261 0.0953  -0.0613 64  PRO B CA  
2257 C C   . PRO B 41  ? 0.9018 0.8799 0.9848 -0.0259 0.0917  -0.0611 64  PRO B C   
2258 O O   . PRO B 41  ? 0.8336 0.8150 0.9164 -0.0275 0.0891  -0.0630 64  PRO B O   
2259 C CB  . PRO B 41  ? 0.8404 0.8130 0.9234 -0.0296 0.0986  -0.0653 64  PRO B CB  
2260 C CG  . PRO B 41  ? 0.7767 0.7542 0.8598 -0.0317 0.0959  -0.0677 64  PRO B CG  
2261 C CD  . PRO B 41  ? 0.7549 0.7327 0.8383 -0.0295 0.0942  -0.0653 64  PRO B CD  
2262 N N   . THR B 42  ? 0.9831 0.9609 1.0661 -0.0238 0.0919  -0.0587 65  THR B N   
2263 C CA  . THR B 42  ? 1.0799 1.0603 1.1627 -0.0241 0.0889  -0.0589 65  THR B CA  
2264 C C   . THR B 42  ? 1.0806 1.0585 1.1631 -0.0251 0.0912  -0.0601 65  THR B C   
2265 O O   . THR B 42  ? 1.0849 1.0648 1.1671 -0.0258 0.0891  -0.0609 65  THR B O   
2266 C CB  . THR B 42  ? 1.1640 1.1475 1.2468 -0.0219 0.0868  -0.0561 65  THR B CB  
2267 O OG1 . THR B 42  ? 1.2173 1.1999 1.3004 -0.0192 0.0896  -0.0532 65  THR B OG1 
2268 C CG2 . THR B 42  ? 1.1599 1.1464 1.2428 -0.0217 0.0846  -0.0557 65  THR B CG2 
2269 N N   . PHE B 43  ? 1.1099 1.0831 1.1924 -0.0253 0.0959  -0.0604 66  PHE B N   
2270 C CA  . PHE B 43  ? 1.1182 1.0884 1.2004 -0.0267 0.0990  -0.0619 66  PHE B CA  
2271 C C   . PHE B 43  ? 1.1727 1.1435 1.2548 -0.0246 0.0979  -0.0596 66  PHE B C   
2272 O O   . PHE B 43  ? 1.1463 1.1171 1.2282 -0.0263 0.0979  -0.0614 66  PHE B O   
2273 C CB  . PHE B 43  ? 0.9663 0.9392 1.0483 -0.0307 0.0980  -0.0664 66  PHE B CB  
2274 C CG  . PHE B 43  ? 0.9592 0.9331 1.0413 -0.0330 0.0990  -0.0690 66  PHE B CG  
2275 C CD1 . PHE B 43  ? 1.0131 0.9819 1.0951 -0.0347 0.1045  -0.0706 66  PHE B CD1 
2276 C CD2 . PHE B 43  ? 0.9429 0.9226 1.0251 -0.0335 0.0949  -0.0698 66  PHE B CD2 
2277 C CE1 . PHE B 43  ? 0.9981 0.9683 1.0802 -0.0372 0.1056  -0.0734 66  PHE B CE1 
2278 C CE2 . PHE B 43  ? 0.9220 0.9035 1.0043 -0.0355 0.0957  -0.0721 66  PHE B CE2 
2279 C CZ  . PHE B 43  ? 0.9529 0.9301 1.0352 -0.0376 0.1008  -0.0741 66  PHE B CZ  
2280 N N   . ARG B 44  ? 1.2201 1.1921 1.3024 -0.0210 0.0974  -0.0556 67  ARG B N   
2281 C CA  . ARG B 44  ? 1.2080 1.1817 1.2902 -0.0187 0.0968  -0.0530 67  ARG B CA  
2282 C C   . ARG B 44  ? 1.2451 1.2161 1.3273 -0.0148 0.1016  -0.0491 67  ARG B C   
2283 O O   . ARG B 44  ? 1.2125 1.1791 1.2942 -0.0143 0.1053  -0.0488 67  ARG B O   
2284 C CB  . ARG B 44  ? 1.1976 1.1779 1.2800 -0.0179 0.0917  -0.0519 67  ARG B CB  
2285 C CG  . ARG B 44  ? 1.1389 1.1211 1.2211 -0.0208 0.0880  -0.0549 67  ARG B CG  
2286 C CD  . ARG B 44  ? 1.2017 1.1886 1.2837 -0.0202 0.0847  -0.0538 67  ARG B CD  
2287 N NE  . ARG B 44  ? 1.2824 1.2704 1.3639 -0.0223 0.0819  -0.0560 67  ARG B NE  
2288 C CZ  . ARG B 44  ? 1.2099 1.2008 1.2910 -0.0226 0.0797  -0.0560 67  ARG B CZ  
2289 N NH1 . ARG B 44  ? 1.3095 1.3039 1.3908 -0.0216 0.0795  -0.0543 67  ARG B NH1 
2290 N NH2 . ARG B 44  ? 1.0709 1.0614 1.1512 -0.0240 0.0783  -0.0576 67  ARG B NH2 
2291 N N   . GLY B 45  ? 1.2866 1.2601 1.3689 -0.0118 0.1019  -0.0460 68  GLY B N   
2292 C CA  . GLY B 45  ? 1.3939 1.3665 1.4760 -0.0068 0.1066  -0.0412 68  GLY B CA  
2293 C C   . GLY B 45  ? 1.5896 1.5525 1.6710 -0.0070 0.1135  -0.0417 68  GLY B C   
2294 O O   . GLY B 45  ? 1.8487 1.8069 1.9300 -0.0115 0.1143  -0.0463 68  GLY B O   
2295 N N   . PRO B 46  ? 1.4975 1.4577 1.5783 -0.0022 0.1190  -0.0371 69  PRO B N   
2296 C CA  . PRO B 46  ? 1.4093 1.3591 1.4891 -0.0027 0.1265  -0.0379 69  PRO B CA  
2297 C C   . PRO B 46  ? 1.4955 1.4375 1.5750 -0.0069 0.1306  -0.0422 69  PRO B C   
2298 O O   . PRO B 46  ? 1.6102 1.5469 1.6893 -0.0115 0.1330  -0.0468 69  PRO B O   
2299 C CB  . PRO B 46  ? 1.3293 1.2778 1.4084 0.0043  0.1325  -0.0311 69  PRO B CB  
2300 C CG  . PRO B 46  ? 1.4171 1.3740 1.4967 0.0078  0.1293  -0.0275 69  PRO B CG  
2301 C CD  . PRO B 46  ? 1.4048 1.3706 1.4856 0.0038  0.1201  -0.0310 69  PRO B CD  
2302 N N   . GLY B 47  ? 1.3774 1.3198 1.4571 -0.0057 0.1312  -0.0410 70  GLY B N   
2303 C CA  . GLY B 47  ? 1.3165 1.2527 1.3959 -0.0098 0.1347  -0.0452 70  GLY B CA  
2304 C C   . GLY B 47  ? 1.2884 1.2301 1.3687 -0.0151 0.1278  -0.0504 70  GLY B C   
2305 O O   . GLY B 47  ? 1.3243 1.2644 1.4046 -0.0174 0.1287  -0.0527 70  GLY B O   
2306 N N   . GLY B 48  ? 1.2221 1.1701 1.3029 -0.0167 0.1214  -0.0518 71  GLY B N   
2307 C CA  . GLY B 48  ? 1.2375 1.1901 1.3188 -0.0215 0.1160  -0.0566 71  GLY B CA  
2308 C C   . GLY B 48  ? 1.2433 1.1939 1.3243 -0.0259 0.1177  -0.0612 71  GLY B C   
2309 O O   . GLY B 48  ? 1.3586 1.3133 1.4397 -0.0266 0.1137  -0.0618 71  GLY B O   
2310 N N   . PHE B 49  ? 1.1660 1.1106 1.2464 -0.0292 0.1240  -0.0647 72  PHE B N   
2311 C CA  . PHE B 49  ? 1.0768 1.0212 1.1568 -0.0347 0.1258  -0.0703 72  PHE B CA  
2312 C C   . PHE B 49  ? 0.9905 0.9392 1.0707 -0.0396 0.1246  -0.0754 72  PHE B C   
2313 O O   . PHE B 49  ? 1.0850 1.0336 1.1655 -0.0390 0.1246  -0.0748 72  PHE B O   
2314 C CB  . PHE B 49  ? 1.0826 1.0174 1.1616 -0.0359 0.1349  -0.0714 72  PHE B CB  
2315 C CG  . PHE B 49  ? 1.1878 1.1203 1.2664 -0.0331 0.1357  -0.0685 72  PHE B CG  
2316 C CD1 . PHE B 49  ? 1.2621 1.1925 1.3406 -0.0264 0.1364  -0.0618 72  PHE B CD1 
2317 C CD2 . PHE B 49  ? 1.1528 1.0867 1.2312 -0.0369 0.1356  -0.0724 72  PHE B CD2 
2318 C CE1 . PHE B 49  ? 1.2963 1.2256 1.3745 -0.0236 0.1372  -0.0589 72  PHE B CE1 
2319 C CE2 . PHE B 49  ? 1.2335 1.1654 1.3116 -0.0342 0.1364  -0.0696 72  PHE B CE2 
2320 C CZ  . PHE B 49  ? 1.2855 1.2149 1.3635 -0.0275 0.1371  -0.0629 72  PHE B CZ  
2321 N N   . TRP B 50  ? 0.9301 0.8843 1.0104 -0.0441 0.1230  -0.0801 73  TRP B N   
2322 C CA  . TRP B 50  ? 0.9600 0.9198 1.0404 -0.0492 0.1230  -0.0856 73  TRP B CA  
2323 C C   . TRP B 50  ? 1.0807 1.0390 1.1604 -0.0546 0.1285  -0.0910 73  TRP B C   
2324 O O   . TRP B 50  ? 1.2814 1.2433 1.3610 -0.0553 0.1265  -0.0918 73  TRP B O   
2325 C CB  . TRP B 50  ? 0.9240 0.8950 1.0049 -0.0491 0.1151  -0.0859 73  TRP B CB  
2326 C CG  . TRP B 50  ? 0.9500 0.9291 1.0310 -0.0538 0.1150  -0.0911 73  TRP B CG  
2327 C CD1 . TRP B 50  ? 1.0424 1.0232 1.1236 -0.0545 0.1149  -0.0918 73  TRP B CD1 
2328 C CD2 . TRP B 50  ? 0.9439 0.9322 1.0247 -0.0584 0.1146  -0.0961 73  TRP B CD2 
2329 N NE1 . TRP B 50  ? 1.0259 1.0166 1.1071 -0.0591 0.1145  -0.0970 73  TRP B NE1 
2330 C CE2 . TRP B 50  ? 0.9746 0.9707 1.0555 -0.0616 0.1143  -0.0997 73  TRP B CE2 
2331 C CE3 . TRP B 50  ? 0.9504 0.9421 1.0309 -0.0601 0.1144  -0.0979 73  TRP B CE3 
2332 C CZ2 . TRP B 50  ? 0.9529 0.9615 1.0338 -0.0662 0.1139  -0.1049 73  TRP B CZ2 
2333 C CZ3 . TRP B 50  ? 0.9574 0.9611 1.0379 -0.0647 0.1139  -0.1031 73  TRP B CZ3 
2334 C CH2 . TRP B 50  ? 0.9569 0.9694 1.0375 -0.0677 0.1137  -0.1065 73  TRP B CH2 
2335 N N   . ARG B 51  ? 1.1445 1.0970 1.2235 -0.0585 0.1361  -0.0948 74  ARG B N   
2336 C CA  . ARG B 51  ? 1.2060 1.1546 1.2842 -0.0639 0.1433  -0.1001 74  ARG B CA  
2337 C C   . ARG B 51  ? 1.2593 1.2009 1.3370 -0.0598 0.1446  -0.0958 74  ARG B C   
2338 O O   . ARG B 51  ? 1.3007 1.2355 1.3784 -0.0537 0.1451  -0.0895 74  ARG B O   
2339 C CB  . ARG B 51  ? 1.2051 1.1665 1.2834 -0.0702 0.1407  -0.1067 74  ARG B CB  
2340 C CG  . ARG B 51  ? 1.1245 1.0948 1.2032 -0.0737 0.1390  -0.1106 74  ARG B CG  
2341 C CD  . ARG B 51  ? 1.0422 1.0271 1.1210 -0.0797 0.1372  -0.1170 74  ARG B CD  
2342 N NE  . ARG B 51  ? 0.9920 0.9877 1.0713 -0.0822 0.1348  -0.1200 74  ARG B NE  
2343 C CZ  . ARG B 51  ? 0.9823 0.9945 1.0618 -0.0856 0.1313  -0.1240 74  ARG B CZ  
2344 N NH1 . ARG B 51  ? 0.9240 0.9442 1.0034 -0.0873 0.1297  -0.1260 74  ARG B NH1 
2345 N NH2 . ARG B 51  ? 0.9274 0.9490 1.0073 -0.0871 0.1295  -0.1259 74  ARG B NH2 
2346 N N   . LYS B 52  ? 1.2947 1.2394 1.3722 -0.0628 0.1446  -0.0988 75  LYS B N   
2347 C CA  . LYS B 52  ? 1.3879 1.3259 1.4650 -0.0594 0.1465  -0.0952 75  LYS B CA  
2348 C C   . LYS B 52  ? 1.4414 1.3848 1.5194 -0.0534 0.1376  -0.0893 75  LYS B C   
2349 O O   . LYS B 52  ? 1.6891 1.6279 1.7669 -0.0497 0.1384  -0.0854 75  LYS B O   
2350 C CB  . LYS B 52  ? 1.3805 1.3187 1.4570 -0.0653 0.1510  -0.1011 75  LYS B CB  
2351 C CG  . LYS B 52  ? 1.4032 1.3355 1.4785 -0.0723 0.1611  -0.1079 75  LYS B CG  
2352 C CD  . LYS B 52  ? 1.4127 1.3555 1.4880 -0.0806 0.1611  -0.1164 75  LYS B CD  
2353 C CE  . LYS B 52  ? 1.3780 1.3236 1.4529 -0.0876 0.1659  -0.1234 75  LYS B CE  
2354 N NZ  . LYS B 52  ? 1.3499 1.3075 1.4248 -0.0963 0.1668  -0.1322 75  LYS B NZ  
2355 N N   . TRP B 53  ? 1.3800 1.3331 1.4589 -0.0524 0.1298  -0.0885 76  TRP B N   
2356 C CA  . TRP B 53  ? 1.2486 1.2075 1.3281 -0.0482 0.1218  -0.0844 76  TRP B CA  
2357 C C   . TRP B 53  ? 1.1225 1.0819 1.2026 -0.0428 0.1173  -0.0789 76  TRP B C   
2358 O O   . TRP B 53  ? 0.9672 0.9243 1.0474 -0.0420 0.1187  -0.0780 76  TRP B O   
2359 C CB  . TRP B 53  ? 1.2766 1.2471 1.3565 -0.0511 0.1165  -0.0878 76  TRP B CB  
2360 C CG  . TRP B 53  ? 1.3658 1.3388 1.4452 -0.0565 0.1199  -0.0933 76  TRP B CG  
2361 C CD1 . TRP B 53  ? 1.4281 1.4011 1.5072 -0.0566 0.1198  -0.0935 76  TRP B CD1 
2362 C CD2 . TRP B 53  ? 1.5068 1.4836 1.5859 -0.0629 0.1240  -0.1000 76  TRP B CD2 
2363 N NE1 . TRP B 53  ? 1.4643 1.4412 1.5431 -0.0629 0.1236  -0.0999 76  TRP B NE1 
2364 C CE2 . TRP B 53  ? 1.5409 1.5206 1.6197 -0.0670 0.1263  -0.1042 76  TRP B CE2 
2365 C CE3 . TRP B 53  ? 1.6253 1.6040 1.7044 -0.0659 0.1261  -0.1031 76  TRP B CE3 
2366 C CZ2 . TRP B 53  ? 1.6308 1.6159 1.7091 -0.0744 0.1308  -0.1117 76  TRP B CZ2 
2367 C CZ3 . TRP B 53  ? 1.6897 1.6737 1.7684 -0.0732 0.1306  -0.1105 76  TRP B CZ3 
2368 C CH2 . TRP B 53  ? 1.7415 1.7291 1.8199 -0.0775 0.1330  -0.1149 76  TRP B CH2 
2369 N N   . GLN B 54  ? 1.1001 1.0626 1.1804 -0.0394 0.1120  -0.0754 77  GLN B N   
2370 C CA  . GLN B 54  ? 1.1272 1.0926 1.2081 -0.0354 0.1070  -0.0712 77  GLN B CA  
2371 C C   . GLN B 54  ? 1.1458 1.1192 1.2268 -0.0359 0.1007  -0.0721 77  GLN B C   
2372 O O   . GLN B 54  ? 1.2433 1.2205 1.3241 -0.0384 0.1000  -0.0749 77  GLN B O   
2373 C CB  . GLN B 54  ? 1.1075 1.0697 1.1883 -0.0308 0.1070  -0.0663 77  GLN B CB  
2374 C CG  . GLN B 54  ? 1.1160 1.0705 1.1965 -0.0287 0.1137  -0.0640 77  GLN B CG  
2375 C CD  . GLN B 54  ? 1.1186 1.0737 1.1992 -0.0231 0.1126  -0.0581 77  GLN B CD  
2376 O OE1 . GLN B 54  ? 1.2242 1.1834 1.3051 -0.0209 0.1089  -0.0558 77  GLN B OE1 
2377 N NE2 . GLN B 54  ? 1.0482 1.0002 1.1288 -0.0207 0.1160  -0.0558 77  GLN B NE2 
2378 N N   . ALA B 55  ? 1.0591 1.0353 1.1404 -0.0336 0.0967  -0.0696 78  ALA B N   
2379 C CA  . ALA B 55  ? 1.0329 1.0152 1.1140 -0.0332 0.0916  -0.0695 78  ALA B CA  
2380 C C   . ALA B 55  ? 1.1424 1.1269 1.2232 -0.0332 0.0900  -0.0696 78  ALA B C   
2381 O O   . ALA B 55  ? 1.1490 1.1388 1.2295 -0.0348 0.0886  -0.0718 78  ALA B O   
2382 C CB  . ALA B 55  ? 1.0845 1.0669 1.1658 -0.0301 0.0888  -0.0660 78  ALA B CB  
2383 N N   . GLN B 56  ? 1.1486 1.1298 1.2294 -0.0312 0.0902  -0.0672 79  GLN B N   
2384 C CA  . GLN B 56  ? 1.1302 1.1131 1.2108 -0.0309 0.0884  -0.0669 79  GLN B CA  
2385 C C   . GLN B 56  ? 1.1105 1.0957 1.1908 -0.0339 0.0897  -0.0703 79  GLN B C   
2386 O O   . GLN B 56  ? 1.1968 1.1861 1.2767 -0.0339 0.0873  -0.0707 79  GLN B O   
2387 C CB  . GLN B 56  ? 1.1883 1.1675 1.2690 -0.0288 0.0897  -0.0643 79  GLN B CB  
2388 C CG  . GLN B 56  ? 1.1726 1.1461 1.2533 -0.0287 0.0949  -0.0640 79  GLN B CG  
2389 C CD  . GLN B 56  ? 1.2738 1.2454 1.3548 -0.0257 0.0961  -0.0607 79  GLN B CD  
2390 O OE1 . GLN B 56  ? 1.1194 1.0922 1.2006 -0.0257 0.0951  -0.0607 79  GLN B OE1 
2391 N NE2 . GLN B 56  ? 1.4180 1.3875 1.4990 -0.0227 0.0983  -0.0574 79  GLN B NE2 
2392 N N   . ASP B 57  ? 1.0435 1.0259 1.1239 -0.0364 0.0941  -0.0730 80  ASP B N   
2393 C CA  . ASP B 57  ? 1.0043 0.9898 1.0845 -0.0403 0.0962  -0.0773 80  ASP B CA  
2394 C C   . ASP B 57  ? 0.9701 0.9647 1.0501 -0.0418 0.0934  -0.0795 80  ASP B C   
2395 O O   . ASP B 57  ? 0.9446 0.9456 1.0244 -0.0428 0.0919  -0.0809 80  ASP B O   
2396 C CB  . ASP B 57  ? 1.0040 0.9838 1.0840 -0.0434 0.1026  -0.0802 80  ASP B CB  
2397 C CG  . ASP B 57  ? 1.1375 1.1079 1.2175 -0.0406 0.1063  -0.0768 80  ASP B CG  
2398 O OD1 . ASP B 57  ? 1.2218 1.1909 1.3018 -0.0376 0.1046  -0.0736 80  ASP B OD1 
2399 O OD2 . ASP B 57  ? 1.1683 1.1331 1.2482 -0.0409 0.1109  -0.0770 80  ASP B OD2 
2400 N N   . LEU B 58  ? 0.9587 0.9545 1.0389 -0.0414 0.0927  -0.0792 81  LEU B N   
2401 C CA  . LEU B 58  ? 1.0112 1.0163 1.0912 -0.0429 0.0911  -0.0814 81  LEU B CA  
2402 C C   . LEU B 58  ? 0.9866 0.9968 1.0663 -0.0394 0.0866  -0.0783 81  LEU B C   
2403 O O   . LEU B 58  ? 0.8933 0.9129 0.9726 -0.0396 0.0852  -0.0794 81  LEU B O   
2404 C CB  . LEU B 58  ? 1.0587 1.0628 1.1390 -0.0452 0.0939  -0.0837 81  LEU B CB  
2405 C CG  . LEU B 58  ? 1.1520 1.1520 1.2324 -0.0497 0.0997  -0.0879 81  LEU B CG  
2406 C CD1 . LEU B 58  ? 1.1667 1.1614 1.2473 -0.0512 0.1036  -0.0891 81  LEU B CD1 
2407 C CD2 . LEU B 58  ? 1.2098 1.2198 1.2900 -0.0541 0.1006  -0.0930 81  LEU B CD2 
2408 N N   . ALA B 59  ? 0.9730 0.9777 1.0526 -0.0361 0.0848  -0.0745 82  ALA B N   
2409 C CA  . ALA B 59  ? 0.9119 0.9192 0.9909 -0.0330 0.0817  -0.0717 82  ALA B CA  
2410 C C   . ALA B 59  ? 0.8371 0.8460 0.9154 -0.0311 0.0799  -0.0700 82  ALA B C   
2411 O O   . ALA B 59  ? 0.8100 0.8151 0.8879 -0.0288 0.0786  -0.0673 82  ALA B O   
2412 C CB  . ALA B 59  ? 0.9314 0.9326 1.0107 -0.0312 0.0812  -0.0692 82  ALA B CB  
2413 N N   . THR B 60  ? 0.7857 0.8005 0.8638 -0.0324 0.0802  -0.0719 83  THR B N   
2414 C CA  . THR B 60  ? 0.7808 0.7970 0.8581 -0.0306 0.0789  -0.0704 83  THR B CA  
2415 C C   . THR B 60  ? 0.7507 0.7777 0.8274 -0.0304 0.0785  -0.0713 83  THR B C   
2416 O O   . THR B 60  ? 0.8127 0.8465 0.8898 -0.0327 0.0794  -0.0741 83  THR B O   
2417 C CB  . THR B 60  ? 0.8098 0.8221 0.8876 -0.0323 0.0800  -0.0716 83  THR B CB  
2418 O OG1 . THR B 60  ? 0.8526 0.8708 0.9306 -0.0356 0.0817  -0.0753 83  THR B OG1 
2419 C CG2 . THR B 60  ? 0.8374 0.8412 0.9159 -0.0329 0.0815  -0.0712 83  THR B CG2 
2420 N N   . PRO B 61  ? 0.7003 0.7297 0.7761 -0.0276 0.0774  -0.0690 84  PRO B N   
2421 C CA  . PRO B 61  ? 0.7240 0.7654 0.7990 -0.0265 0.0772  -0.0692 84  PRO B CA  
2422 C C   . PRO B 61  ? 0.8004 0.8487 0.8760 -0.0304 0.0781  -0.0733 84  PRO B C   
2423 O O   . PRO B 61  ? 0.8050 0.8659 0.8804 -0.0310 0.0782  -0.0749 84  PRO B O   
2424 C CB  . PRO B 61  ? 0.6871 0.7275 0.7607 -0.0220 0.0765  -0.0651 84  PRO B CB  
2425 C CG  . PRO B 61  ? 0.6725 0.7006 0.7461 -0.0216 0.0764  -0.0635 84  PRO B CG  
2426 C CD  . PRO B 61  ? 0.6860 0.7082 0.7610 -0.0249 0.0767  -0.0658 84  PRO B CD  
2427 N N   . GLU B 62  ? 0.8910 0.9316 0.9672 -0.0328 0.0789  -0.0749 85  GLU B N   
2428 C CA  . GLU B 62  ? 0.9300 0.9747 1.0067 -0.0368 0.0805  -0.0789 85  GLU B CA  
2429 C C   . GLU B 62  ? 0.8901 0.9386 0.9675 -0.0415 0.0829  -0.0836 85  GLU B C   
2430 O O   . GLU B 62  ? 0.9831 1.0428 1.0605 -0.0446 0.0839  -0.0873 85  GLU B O   
2431 C CB  . GLU B 62  ? 0.9376 0.9716 1.0147 -0.0377 0.0813  -0.0788 85  GLU B CB  
2432 C CG  . GLU B 62  ? 0.9453 0.9764 1.0218 -0.0341 0.0793  -0.0751 85  GLU B CG  
2433 C CD  . GLU B 62  ? 0.9632 0.9885 1.0391 -0.0302 0.0777  -0.0709 85  GLU B CD  
2434 O OE1 . GLU B 62  ? 1.0870 1.1066 1.1635 -0.0305 0.0781  -0.0706 85  GLU B OE1 
2435 O OE2 . GLU B 62  ? 0.8916 0.9179 0.9665 -0.0270 0.0766  -0.0680 85  GLU B OE2 
2436 N N   . ALA B 63  ? 0.8733 0.9132 0.9512 -0.0422 0.0840  -0.0835 86  ALA B N   
2437 C CA  . ALA B 63  ? 0.8975 0.9395 0.9759 -0.0466 0.0869  -0.0879 86  ALA B CA  
2438 C C   . ALA B 63  ? 0.9141 0.9706 0.9923 -0.0469 0.0859  -0.0893 86  ALA B C   
2439 O O   . ALA B 63  ? 0.9196 0.9845 0.9980 -0.0518 0.0883  -0.0945 86  ALA B O   
2440 C CB  . ALA B 63  ? 0.8895 0.9205 0.9684 -0.0459 0.0879  -0.0864 86  ALA B CB  
2441 N N   . PHE B 64  ? 0.9151 0.9751 0.9927 -0.0419 0.0829  -0.0849 87  PHE B N   
2442 C CA  . PHE B 64  ? 0.9382 1.0121 1.0153 -0.0411 0.0821  -0.0852 87  PHE B CA  
2443 C C   . PHE B 64  ? 1.0099 1.0990 1.0866 -0.0420 0.0819  -0.0872 87  PHE B C   
2444 O O   . PHE B 64  ? 1.0595 1.1624 1.1364 -0.0453 0.0830  -0.0912 87  PHE B O   
2445 C CB  . PHE B 64  ? 0.9267 0.9992 1.0031 -0.0349 0.0798  -0.0794 87  PHE B CB  
2446 C CG  . PHE B 64  ? 0.9851 1.0704 1.0610 -0.0332 0.0794  -0.0789 87  PHE B CG  
2447 C CD1 . PHE B 64  ? 1.0504 1.1353 1.1269 -0.0354 0.0802  -0.0809 87  PHE B CD1 
2448 C CD2 . PHE B 64  ? 0.9571 1.0549 1.0318 -0.0288 0.0784  -0.0758 87  PHE B CD2 
2449 C CE1 . PHE B 64  ? 1.1045 1.2018 1.1806 -0.0337 0.0798  -0.0802 87  PHE B CE1 
2450 C CE2 . PHE B 64  ? 0.9391 1.0494 1.0132 -0.0264 0.0782  -0.0746 87  PHE B CE2 
2451 C CZ  . PHE B 64  ? 1.0280 1.1382 1.1028 -0.0290 0.0788  -0.0770 87  PHE B CZ  
2452 N N   . SER B 65  ? 1.1048 1.1920 1.1810 -0.0391 0.0807  -0.0843 88  SER B N   
2453 C CA  . SER B 65  ? 1.1068 1.2074 1.1825 -0.0395 0.0805  -0.0857 88  SER B CA  
2454 C C   . SER B 65  ? 1.0743 1.1810 1.1509 -0.0471 0.0832  -0.0930 88  SER B C   
2455 O O   . SER B 65  ? 1.0396 1.1636 1.1161 -0.0495 0.0837  -0.0964 88  SER B O   
2456 C CB  . SER B 65  ? 1.0913 1.1846 1.1665 -0.0363 0.0794  -0.0822 88  SER B CB  
2457 O OG  . SER B 65  ? 1.1677 1.2750 1.2424 -0.0356 0.0790  -0.0826 88  SER B OG  
2458 N N   . ARG B 66  ? 1.0661 1.1585 1.1433 -0.0508 0.0855  -0.0955 89  ARG B N   
2459 C CA  . ARG B 66  ? 1.0581 1.1518 1.1358 -0.0584 0.0895  -0.1026 89  ARG B CA  
2460 C C   . ARG B 66  ? 1.0072 1.1068 1.0853 -0.0636 0.0923  -0.1078 89  ARG B C   
2461 O O   . ARG B 66  ? 1.1347 1.2456 1.2128 -0.0696 0.0949  -0.1141 89  ARG B O   
2462 C CB  . ARG B 66  ? 1.0757 1.1515 1.1537 -0.0596 0.0917  -0.1026 89  ARG B CB  
2463 C CG  . ARG B 66  ? 1.2179 1.2920 1.2956 -0.0561 0.0894  -0.0992 89  ARG B CG  
2464 C CD  . ARG B 66  ? 1.2612 1.3183 1.3390 -0.0538 0.0895  -0.0958 89  ARG B CD  
2465 N NE  . ARG B 66  ? 1.1550 1.2051 1.2331 -0.0586 0.0940  -0.0999 89  ARG B NE  
2466 C CZ  . ARG B 66  ? 1.1744 1.2156 1.2528 -0.0618 0.0982  -0.1023 89  ARG B CZ  
2467 N NH1 . ARG B 66  ? 1.2708 1.3095 1.3494 -0.0607 0.0981  -0.1012 89  ARG B NH1 
2468 N NH2 . ARG B 66  ? 1.2108 1.2452 1.2891 -0.0659 0.1032  -0.1058 89  ARG B NH2 
2469 N N   . ASP B 67  ? 0.9499 1.0432 1.0282 -0.0616 0.0918  -0.1056 90  ASP B N   
2470 C CA  . ASP B 67  ? 0.9369 1.0326 1.0155 -0.0671 0.0952  -0.1108 90  ASP B CA  
2471 C C   . ASP B 67  ? 0.8757 0.9718 0.9545 -0.0631 0.0928  -0.1072 90  ASP B C   
2472 O O   . ASP B 67  ? 0.8117 0.8946 0.8908 -0.0626 0.0939  -0.1059 90  ASP B O   
2473 C CB  . ASP B 67  ? 0.9700 1.0492 1.0490 -0.0714 0.1003  -0.1139 90  ASP B CB  
2474 C CG  . ASP B 67  ? 1.0066 1.0873 1.0857 -0.0781 0.1052  -0.1203 90  ASP B CG  
2475 O OD1 . ASP B 67  ? 1.1460 1.2414 1.2252 -0.0794 0.1041  -0.1224 90  ASP B OD1 
2476 O OD2 . ASP B 67  ? 0.9319 0.9990 1.0111 -0.0816 0.1105  -0.1229 90  ASP B OD2 
2477 N N   . PRO B 68  ? 0.8699 0.9814 0.9482 -0.0597 0.0898  -0.1050 91  PRO B N   
2478 C CA  . PRO B 68  ? 0.9930 1.1050 1.0711 -0.0549 0.0874  -0.1006 91  PRO B CA  
2479 C C   . PRO B 68  ? 1.0715 1.1836 1.1501 -0.0591 0.0897  -0.1045 91  PRO B C   
2480 O O   . PRO B 68  ? 1.1502 1.2549 1.2289 -0.0558 0.0886  -0.1010 91  PRO B O   
2481 C CB  . PRO B 68  ? 0.9365 1.0670 1.0138 -0.0506 0.0848  -0.0978 91  PRO B CB  
2482 C CG  . PRO B 68  ? 0.9125 1.0560 0.9898 -0.0550 0.0860  -0.1027 91  PRO B CG  
2483 C CD  . PRO B 68  ? 0.8651 0.9941 0.9429 -0.0594 0.0885  -0.1058 91  PRO B CD  
2484 N N   . SER B 69  ? 1.1002 1.2202 1.1792 -0.0665 0.0934  -0.1119 92  SER B N   
2485 C CA  . SER B 69  ? 1.2028 1.3209 1.2822 -0.0711 0.0964  -0.1160 92  SER B CA  
2486 C C   . SER B 69  ? 1.1972 1.2929 1.2769 -0.0706 0.0984  -0.1142 92  SER B C   
2487 O O   . SER B 69  ? 1.2427 1.3323 1.3226 -0.0687 0.0980  -0.1121 92  SER B O   
2488 C CB  . SER B 69  ? 1.2953 1.4236 1.3748 -0.0804 0.1013  -0.1253 92  SER B CB  
2489 O OG  . SER B 69  ? 1.3064 1.4274 1.3861 -0.0855 0.1057  -0.1296 92  SER B OG  
2490 N N   . LEU B 70  ? 1.1613 1.2455 1.2410 -0.0720 0.1007  -0.1149 93  LEU B N   
2491 C CA  . LEU B 70  ? 1.1070 1.1717 1.1869 -0.0715 0.1034  -0.1132 93  LEU B CA  
2492 C C   . LEU B 70  ? 1.1236 1.1802 1.2037 -0.0640 0.0989  -0.1055 93  LEU B C   
2493 O O   . LEU B 70  ? 1.0860 1.1328 1.1663 -0.0628 0.0999  -0.1038 93  LEU B O   
2494 C CB  . LEU B 70  ? 1.0470 1.1018 1.1267 -0.0738 0.1070  -0.1148 93  LEU B CB  
2495 C CG  . LEU B 70  ? 0.9885 1.0242 1.0683 -0.0727 0.1107  -0.1127 93  LEU B CG  
2496 C CD1 . LEU B 70  ? 1.0195 1.0510 1.0994 -0.0768 0.1157  -0.1163 93  LEU B CD1 
2497 C CD2 . LEU B 70  ? 0.9625 0.9894 1.0420 -0.0745 0.1146  -0.1139 93  LEU B CD2 
2498 N N   . VAL B 71  ? 1.0639 1.1248 1.1436 -0.0590 0.0944  -0.1011 94  VAL B N   
2499 C CA  . VAL B 71  ? 1.0235 1.0771 1.1032 -0.0526 0.0908  -0.0946 94  VAL B CA  
2500 C C   . VAL B 71  ? 0.9773 1.0356 1.0570 -0.0514 0.0897  -0.0938 94  VAL B C   
2501 O O   . VAL B 71  ? 0.9624 1.0111 1.0424 -0.0499 0.0898  -0.0916 94  VAL B O   
2502 C CB  . VAL B 71  ? 1.0670 1.1234 1.1460 -0.0478 0.0872  -0.0903 94  VAL B CB  
2503 C CG1 . VAL B 71  ? 1.1319 1.1805 1.2106 -0.0422 0.0844  -0.0844 94  VAL B CG1 
2504 C CG2 . VAL B 71  ? 1.0392 1.0896 1.1183 -0.0491 0.0884  -0.0910 94  VAL B CG2 
2505 N N   . TRP B 72  ? 0.9522 1.0260 1.0316 -0.0521 0.0888  -0.0955 95  TRP B N   
2506 C CA  . TRP B 72  ? 0.9342 1.0135 1.0137 -0.0511 0.0881  -0.0950 95  TRP B CA  
2507 C C   . TRP B 72  ? 0.9451 1.0173 1.0251 -0.0557 0.0915  -0.0988 95  TRP B C   
2508 O O   . TRP B 72  ? 0.9637 1.0312 1.0439 -0.0536 0.0908  -0.0966 95  TRP B O   
2509 C CB  . TRP B 72  ? 0.9247 1.0240 1.0037 -0.0516 0.0872  -0.0968 95  TRP B CB  
2510 C CG  . TRP B 72  ? 0.9195 1.0254 0.9975 -0.0446 0.0838  -0.0908 95  TRP B CG  
2511 C CD1 . TRP B 72  ? 0.8925 1.0096 0.9698 -0.0421 0.0826  -0.0893 95  TRP B CD1 
2512 C CD2 . TRP B 72  ? 0.9554 1.0570 1.0330 -0.0389 0.0820  -0.0854 95  TRP B CD2 
2513 N NE1 . TRP B 72  ? 0.8590 0.9785 0.9353 -0.0348 0.0805  -0.0829 95  TRP B NE1 
2514 C CE2 . TRP B 72  ? 0.9109 1.0205 0.9872 -0.0329 0.0802  -0.0805 95  TRP B CE2 
2515 C CE3 . TRP B 72  ? 0.9491 1.0404 1.0270 -0.0382 0.0820  -0.0840 95  TRP B CE3 
2516 C CZ2 . TRP B 72  ? 0.9137 1.0203 0.9890 -0.0265 0.0791  -0.0745 95  TRP B CZ2 
2517 C CZ3 . TRP B 72  ? 0.9171 1.0064 0.9941 -0.0322 0.0804  -0.0784 95  TRP B CZ3 
2518 C CH2 . TRP B 72  ? 0.9403 1.0368 1.0160 -0.0265 0.0792  -0.0738 95  TRP B CH2 
2519 N N   . GLU B 73  ? 0.9812 1.0519 1.0615 -0.0619 0.0959  -0.1046 96  GLU B N   
2520 C CA  . GLU B 73  ? 1.0258 1.0875 1.1065 -0.0659 0.1003  -0.1078 96  GLU B CA  
2521 C C   . GLU B 73  ? 0.9633 1.0091 1.0443 -0.0613 0.0994  -0.1023 96  GLU B C   
2522 O O   . GLU B 73  ? 0.8621 0.9046 0.9433 -0.0602 0.0994  -0.1011 96  GLU B O   
2523 C CB  . GLU B 73  ? 1.1601 1.2178 1.2408 -0.0726 0.1063  -0.1139 96  GLU B CB  
2524 C CG  . GLU B 73  ? 1.2021 1.2744 1.2826 -0.0800 0.1095  -0.1218 96  GLU B CG  
2525 C CD  . GLU B 73  ? 1.1645 1.2283 1.2448 -0.0875 0.1175  -0.1284 96  GLU B CD  
2526 O OE1 . GLU B 73  ? 1.0792 1.1406 1.1592 -0.0900 0.1200  -0.1306 96  GLU B OE1 
2527 O OE2 . GLU B 73  ? 1.1914 1.2505 1.2716 -0.0909 0.1217  -0.1314 96  GLU B OE2 
2528 N N   . PHE B 74  ? 1.0254 1.0630 1.1063 -0.0584 0.0985  -0.0991 97  PHE B N   
2529 C CA  . PHE B 74  ? 0.9626 0.9872 1.0437 -0.0538 0.0973  -0.0937 97  PHE B CA  
2530 C C   . PHE B 74  ? 0.8636 0.8899 0.9446 -0.0493 0.0931  -0.0894 97  PHE B C   
2531 O O   . PHE B 74  ? 0.7864 0.8055 0.8677 -0.0479 0.0936  -0.0876 97  PHE B O   
2532 C CB  . PHE B 74  ? 0.9185 0.9391 0.9993 -0.0513 0.0958  -0.0910 97  PHE B CB  
2533 C CG  . PHE B 74  ? 0.9052 0.9152 0.9862 -0.0469 0.0945  -0.0859 97  PHE B CG  
2534 C CD1 . PHE B 74  ? 0.9405 0.9409 1.0218 -0.0468 0.0976  -0.0851 97  PHE B CD1 
2535 C CD2 . PHE B 74  ? 0.8750 0.8851 0.9557 -0.0431 0.0907  -0.0821 97  PHE B CD2 
2536 C CE1 . PHE B 74  ? 0.8799 0.8729 0.9614 -0.0427 0.0964  -0.0804 97  PHE B CE1 
2537 C CE2 . PHE B 74  ? 0.8896 0.8917 0.9705 -0.0398 0.0897  -0.0781 97  PHE B CE2 
2538 C CZ  . PHE B 74  ? 0.8488 0.8432 0.9300 -0.0395 0.0923  -0.0772 97  PHE B CZ  
2539 N N   . TYR B 75  ? 0.8151 0.8508 0.8957 -0.0467 0.0895  -0.0877 98  TYR B N   
2540 C CA  . TYR B 75  ? 0.7820 0.8186 0.8623 -0.0422 0.0864  -0.0835 98  TYR B CA  
2541 C C   . TYR B 75  ? 0.8102 0.8525 0.8906 -0.0435 0.0869  -0.0852 98  TYR B C   
2542 O O   . TYR B 75  ? 0.8470 0.8856 0.9274 -0.0408 0.0856  -0.0823 98  TYR B O   
2543 C CB  . TYR B 75  ? 0.7748 0.8177 0.8542 -0.0384 0.0834  -0.0804 98  TYR B CB  
2544 C CG  . TYR B 75  ? 0.8184 0.8523 0.8976 -0.0359 0.0824  -0.0772 98  TYR B CG  
2545 C CD1 . TYR B 75  ? 0.8202 0.8515 0.8995 -0.0378 0.0835  -0.0788 98  TYR B CD1 
2546 C CD2 . TYR B 75  ? 0.8706 0.8985 0.9494 -0.0320 0.0807  -0.0731 98  TYR B CD2 
2547 C CE1 . TYR B 75  ? 0.8504 0.8741 0.9297 -0.0355 0.0825  -0.0759 98  TYR B CE1 
2548 C CE2 . TYR B 75  ? 0.8661 0.8867 0.9446 -0.0303 0.0800  -0.0707 98  TYR B CE2 
2549 C CZ  . TYR B 75  ? 0.8606 0.8793 0.9394 -0.0319 0.0807  -0.0720 98  TYR B CZ  
2550 O OH  . TYR B 75  ? 0.7451 0.7575 0.8237 -0.0301 0.0798  -0.0695 98  TYR B OH  
2551 N N   . HIS B 76  ? 0.8905 0.9420 0.9711 -0.0481 0.0891  -0.0902 99  HIS B N   
2552 C CA  . HIS B 76  ? 0.8713 0.9281 0.9521 -0.0501 0.0901  -0.0926 99  HIS B CA  
2553 C C   . HIS B 76  ? 0.8485 0.8920 0.9299 -0.0509 0.0923  -0.0923 99  HIS B C   
2554 O O   . HIS B 76  ? 0.8583 0.8999 0.9398 -0.0488 0.0912  -0.0903 99  HIS B O   
2555 C CB  . HIS B 76  ? 0.9067 0.9758 0.9875 -0.0562 0.0929  -0.0992 99  HIS B CB  
2556 C CG  . HIS B 76  ? 0.9509 1.0256 1.0320 -0.0593 0.0945  -0.1025 99  HIS B CG  
2557 N ND1 . HIS B 76  ? 0.9976 1.0789 1.0786 -0.0557 0.0918  -0.0995 99  HIS B ND1 
2558 C CD2 . HIS B 76  ? 0.9718 1.0466 1.0532 -0.0659 0.0992  -0.1086 99  HIS B CD2 
2559 C CE1 . HIS B 76  ? 1.0320 1.1175 1.1133 -0.0598 0.0941  -0.1037 99  HIS B CE1 
2560 N NE2 . HIS B 76  ? 1.0229 1.1046 1.1045 -0.0662 0.0987  -0.1094 99  HIS B NE2 
2561 N N   . TYR B 77  ? 0.8249 0.8588 0.9065 -0.0532 0.0956  -0.0939 100 TYR B N   
2562 C CA  . TYR B 77  ? 0.8363 0.8578 0.9182 -0.0532 0.0984  -0.0930 100 TYR B CA  
2563 C C   . TYR B 77  ? 0.8194 0.8349 0.9014 -0.0478 0.0950  -0.0873 100 TYR B C   
2564 O O   . TYR B 77  ? 0.8527 0.8653 0.9350 -0.0470 0.0952  -0.0863 100 TYR B O   
2565 C CB  . TYR B 77  ? 0.8435 0.8556 0.9254 -0.0549 0.1024  -0.0940 100 TYR B CB  
2566 C CG  . TYR B 77  ? 0.8420 0.8419 0.9240 -0.0540 0.1059  -0.0924 100 TYR B CG  
2567 C CD1 . TYR B 77  ? 0.8645 0.8622 0.9466 -0.0574 0.1104  -0.0957 100 TYR B CD1 
2568 C CD2 . TYR B 77  ? 0.8264 0.8179 0.9086 -0.0496 0.1050  -0.0875 100 TYR B CD2 
2569 C CE1 . TYR B 77  ? 0.8375 0.8239 0.9196 -0.0559 0.1142  -0.0936 100 TYR B CE1 
2570 C CE2 . TYR B 77  ? 0.8478 0.8297 0.9301 -0.0481 0.1085  -0.0854 100 TYR B CE2 
2571 C CZ  . TYR B 77  ? 0.8189 0.7980 0.9011 -0.0509 0.1131  -0.0882 100 TYR B CZ  
2572 O OH  . TYR B 77  ? 0.7975 0.7671 0.8796 -0.0486 0.1168  -0.0854 100 TYR B OH  
2573 N N   . ARG B 78  ? 0.7847 0.7992 0.8665 -0.0444 0.0920  -0.0838 101 ARG B N   
2574 C CA  . ARG B 78  ? 0.7483 0.7576 0.8301 -0.0400 0.0892  -0.0790 101 ARG B CA  
2575 C C   . ARG B 78  ? 0.6875 0.7019 0.7690 -0.0381 0.0868  -0.0777 101 ARG B C   
2576 O O   . ARG B 78  ? 0.7175 0.7273 0.7993 -0.0363 0.0862  -0.0755 101 ARG B O   
2577 C CB  . ARG B 78  ? 0.7875 0.7955 0.8689 -0.0376 0.0871  -0.0765 101 ARG B CB  
2578 C CG  . ARG B 78  ? 0.8309 0.8327 0.9126 -0.0388 0.0897  -0.0771 101 ARG B CG  
2579 C CD  . ARG B 78  ? 0.8636 0.8647 0.9450 -0.0366 0.0876  -0.0749 101 ARG B CD  
2580 N NE  . ARG B 78  ? 0.8900 0.8870 0.9714 -0.0333 0.0854  -0.0710 101 ARG B NE  
2581 C CZ  . ARG B 78  ? 0.8599 0.8565 0.9408 -0.0313 0.0834  -0.0688 101 ARG B CZ  
2582 N NH1 . ARG B 78  ? 0.8976 0.8970 0.9781 -0.0317 0.0829  -0.0696 101 ARG B NH1 
2583 N NH2 . ARG B 78  ? 0.8442 0.8379 0.9251 -0.0292 0.0820  -0.0662 101 ARG B NH2 
2584 N N   . ARG B 79  ? 0.6000 0.6245 0.6810 -0.0382 0.0855  -0.0787 102 ARG B N   
2585 C CA  . ARG B 79  ? 0.6704 0.7008 0.7511 -0.0364 0.0840  -0.0775 102 ARG B CA  
2586 C C   . ARG B 79  ? 0.7268 0.7555 0.8081 -0.0386 0.0857  -0.0794 102 ARG B C   
2587 O O   . ARG B 79  ? 0.7490 0.7749 0.8303 -0.0363 0.0846  -0.0770 102 ARG B O   
2588 C CB  . ARG B 79  ? 0.6804 0.7243 0.7605 -0.0364 0.0833  -0.0787 102 ARG B CB  
2589 C CG  . ARG B 79  ? 0.6822 0.7283 0.7612 -0.0323 0.0813  -0.0751 102 ARG B CG  
2590 C CD  . ARG B 79  ? 0.6811 0.7410 0.7596 -0.0327 0.0812  -0.0767 102 ARG B CD  
2591 N NE  . ARG B 79  ? 0.6965 0.7685 0.7747 -0.0316 0.0810  -0.0766 102 ARG B NE  
2592 C CZ  . ARG B 79  ? 0.7326 0.8067 0.8097 -0.0263 0.0799  -0.0720 102 ARG B CZ  
2593 N NH1 . ARG B 79  ? 0.7722 0.8366 0.8484 -0.0224 0.0794  -0.0678 102 ARG B NH1 
2594 N NH2 . ARG B 79  ? 0.7743 0.8601 0.8510 -0.0250 0.0800  -0.0718 102 ARG B NH2 
2595 N N   . GLU B 80  ? 0.7746 0.8045 0.8564 -0.0432 0.0889  -0.0839 103 GLU B N   
2596 C CA  . GLU B 80  ? 0.8170 0.8459 0.8992 -0.0456 0.0911  -0.0862 103 GLU B CA  
2597 C C   . GLU B 80  ? 0.7649 0.7810 0.8476 -0.0443 0.0924  -0.0839 103 GLU B C   
2598 O O   . GLU B 80  ? 0.7528 0.7672 0.8357 -0.0434 0.0922  -0.0830 103 GLU B O   
2599 C CB  . GLU B 80  ? 0.8845 0.9191 0.9669 -0.0516 0.0950  -0.0925 103 GLU B CB  
2600 C CG  . GLU B 80  ? 0.9557 1.0060 1.0377 -0.0533 0.0938  -0.0952 103 GLU B CG  
2601 C CD  . GLU B 80  ? 1.0233 1.0854 1.1050 -0.0518 0.0916  -0.0946 103 GLU B CD  
2602 O OE1 . GLU B 80  ? 1.1890 1.2559 1.2710 -0.0556 0.0937  -0.0985 103 GLU B OE1 
2603 O OE2 . GLU B 80  ? 1.0290 1.0959 1.1101 -0.0467 0.0881  -0.0902 103 GLU B OE2 
2604 N N   . VAL B 81  ? 0.6626 0.6706 0.7454 -0.0437 0.0937  -0.0827 104 VAL B N   
2605 C CA  . VAL B 81  ? 0.6779 0.6761 0.7610 -0.0419 0.0953  -0.0802 104 VAL B CA  
2606 C C   . VAL B 81  ? 0.6934 0.6912 0.7765 -0.0382 0.0917  -0.0763 104 VAL B C   
2607 O O   . VAL B 81  ? 0.6513 0.6435 0.7348 -0.0368 0.0926  -0.0743 104 VAL B O   
2608 C CB  . VAL B 81  ? 0.6940 0.6845 0.7772 -0.0405 0.0970  -0.0782 104 VAL B CB  
2609 C CG1 . VAL B 81  ? 0.7156 0.7057 0.7985 -0.0440 0.1006  -0.0817 104 VAL B CG1 
2610 C CG2 . VAL B 81  ? 0.7634 0.7542 0.8465 -0.0368 0.0928  -0.0743 104 VAL B CG2 
2611 N N   . MET B 82  ? 0.7558 0.7595 0.8385 -0.0364 0.0881  -0.0750 105 MET B N   
2612 C CA  . MET B 82  ? 0.7939 0.7965 0.8764 -0.0332 0.0854  -0.0716 105 MET B CA  
2613 C C   . MET B 82  ? 0.8173 0.8214 0.8999 -0.0336 0.0857  -0.0722 105 MET B C   
2614 O O   . MET B 82  ? 0.7829 0.7839 0.8656 -0.0317 0.0847  -0.0699 105 MET B O   
2615 C CB  . MET B 82  ? 0.7869 0.7939 0.8685 -0.0309 0.0828  -0.0699 105 MET B CB  
2616 C CG  . MET B 82  ? 0.7690 0.7734 0.8503 -0.0301 0.0822  -0.0687 105 MET B CG  
2617 S SD  . MET B 82  ? 0.8264 0.8227 0.9082 -0.0291 0.0825  -0.0666 105 MET B SD  
2618 C CE  . MET B 82  ? 0.8221 0.8179 0.9035 -0.0272 0.0809  -0.0644 105 MET B CE  
2619 N N   . ARG B 83  ? 0.8262 0.8359 0.9090 -0.0363 0.0871  -0.0755 106 ARG B N   
2620 C CA  . ARG B 83  ? 0.8756 0.8875 0.9585 -0.0370 0.0876  -0.0765 106 ARG B CA  
2621 C C   . ARG B 83  ? 0.8683 0.8718 0.9518 -0.0367 0.0892  -0.0754 106 ARG B C   
2622 O O   . ARG B 83  ? 0.9161 0.9197 0.9997 -0.0358 0.0885  -0.0745 106 ARG B O   
2623 C CB  . ARG B 83  ? 0.9874 1.0060 1.0705 -0.0413 0.0900  -0.0813 106 ARG B CB  
2624 C CG  . ARG B 83  ? 1.0690 1.0987 1.1516 -0.0422 0.0890  -0.0830 106 ARG B CG  
2625 C CD  . ARG B 83  ? 1.1128 1.1473 1.1957 -0.0478 0.0926  -0.0889 106 ARG B CD  
2626 N NE  . ARG B 83  ? 1.1590 1.2078 1.2416 -0.0493 0.0919  -0.0914 106 ARG B NE  
2627 C CZ  . ARG B 83  ? 1.2379 1.2914 1.3205 -0.0485 0.0910  -0.0909 106 ARG B CZ  
2628 N NH1 . ARG B 83  ? 1.1611 1.2057 1.2440 -0.0465 0.0907  -0.0884 106 ARG B NH1 
2629 N NH2 . ARG B 83  ? 1.3376 1.4061 1.4199 -0.0495 0.0905  -0.0930 106 ARG B NH2 
2630 N N   . SER B 84  ? 0.8369 0.8337 0.9208 -0.0370 0.0915  -0.0751 107 SER B N   
2631 C CA  . SER B 84  ? 0.7902 0.7799 0.8745 -0.0361 0.0937  -0.0735 107 SER B CA  
2632 C C   . SER B 84  ? 0.7221 0.7081 0.8064 -0.0326 0.0920  -0.0694 107 SER B C   
2633 O O   . SER B 84  ? 0.7607 0.7426 0.8454 -0.0311 0.0937  -0.0675 107 SER B O   
2634 C CB  . SER B 84  ? 0.7770 0.7618 0.8613 -0.0387 0.0991  -0.0759 107 SER B CB  
2635 O OG  . SER B 84  ? 0.7043 0.6867 0.7885 -0.0383 0.1000  -0.0754 107 SER B OG  
2636 N N   . LYS B 85  ? 0.6809 0.6690 0.7649 -0.0313 0.0891  -0.0680 108 LYS B N   
2637 C CA  . LYS B 85  ? 0.6657 0.6520 0.7498 -0.0286 0.0875  -0.0648 108 LYS B CA  
2638 C C   . LYS B 85  ? 0.6426 0.6315 0.7262 -0.0276 0.0845  -0.0637 108 LYS B C   
2639 O O   . LYS B 85  ? 0.5701 0.5622 0.6531 -0.0277 0.0830  -0.0644 108 LYS B O   
2640 C CB  . LYS B 85  ? 0.6829 0.6690 0.7667 -0.0282 0.0869  -0.0642 108 LYS B CB  
2641 C CG  . LYS B 85  ? 0.7407 0.7243 0.8246 -0.0295 0.0901  -0.0656 108 LYS B CG  
2642 C CD  . LYS B 85  ? 0.7940 0.7727 0.8783 -0.0288 0.0940  -0.0646 108 LYS B CD  
2643 C CE  . LYS B 85  ? 0.8577 0.8326 0.9418 -0.0305 0.0983  -0.0665 108 LYS B CE  
2644 N NZ  . LYS B 85  ? 0.9535 0.9225 1.0376 -0.0285 0.1028  -0.0642 108 LYS B NZ  
2645 N N   . MET B 86  ? 0.6633 0.6511 0.7472 -0.0263 0.0841  -0.0620 109 MET B N   
2646 C CA  . MET B 86  ? 0.6518 0.6412 0.7352 -0.0257 0.0821  -0.0613 109 MET B CA  
2647 C C   . MET B 86  ? 0.6076 0.5972 0.6907 -0.0249 0.0810  -0.0598 109 MET B C   
2648 O O   . MET B 86  ? 0.6157 0.6052 0.6993 -0.0243 0.0816  -0.0587 109 MET B O   
2649 C CB  . MET B 86  ? 0.7014 0.6903 0.7852 -0.0255 0.0827  -0.0609 109 MET B CB  
2650 C CG  . MET B 86  ? 0.7533 0.7417 0.8376 -0.0267 0.0845  -0.0626 109 MET B CG  
2651 S SD  . MET B 86  ? 0.8678 0.8602 0.9515 -0.0282 0.0840  -0.0650 109 MET B SD  
2652 C CE  . MET B 86  ? 0.8983 0.8930 0.9812 -0.0268 0.0821  -0.0640 109 MET B CE  
2653 N N   . PRO B 87  ? 0.5789 0.5691 0.6612 -0.0250 0.0800  -0.0598 110 PRO B N   
2654 C CA  . PRO B 87  ? 0.5862 0.5769 0.6680 -0.0252 0.0795  -0.0593 110 PRO B CA  
2655 C C   . PRO B 87  ? 0.5764 0.5691 0.6590 -0.0250 0.0797  -0.0584 110 PRO B C   
2656 O O   . PRO B 87  ? 0.6788 0.6714 0.7619 -0.0247 0.0801  -0.0582 110 PRO B O   
2657 C CB  . PRO B 87  ? 0.6002 0.5900 0.6808 -0.0255 0.0797  -0.0597 110 PRO B CB  
2658 C CG  . PRO B 87  ? 0.6052 0.5947 0.6853 -0.0247 0.0798  -0.0598 110 PRO B CG  
2659 C CD  . PRO B 87  ? 0.6037 0.5943 0.6851 -0.0248 0.0798  -0.0603 110 PRO B CD  
2660 N N   . ASN B 88  ? 0.5677 0.5631 0.6505 -0.0251 0.0795  -0.0578 111 ASN B N   
2661 C CA  . ASN B 88  ? 0.5762 0.5760 0.6597 -0.0245 0.0796  -0.0567 111 ASN B CA  
2662 C C   . ASN B 88  ? 0.5839 0.5863 0.6667 -0.0266 0.0793  -0.0581 111 ASN B C   
2663 O O   . ASN B 88  ? 0.5796 0.5789 0.6613 -0.0281 0.0796  -0.0597 111 ASN B O   
2664 C CB  . ASN B 88  ? 0.5677 0.5708 0.6518 -0.0232 0.0799  -0.0551 111 ASN B CB  
2665 C CG  . ASN B 88  ? 0.5977 0.6020 0.6811 -0.0245 0.0792  -0.0562 111 ASN B CG  
2666 O OD1 . ASN B 88  ? 0.6279 0.6348 0.7106 -0.0267 0.0788  -0.0577 111 ASN B OD1 
2667 N ND2 . ASN B 88  ? 0.5744 0.5764 0.6578 -0.0237 0.0794  -0.0557 111 ASN B ND2 
2668 N N   . PRO B 89  ? 0.5493 0.5580 0.6327 -0.0266 0.0793  -0.0576 112 PRO B N   
2669 C CA  . PRO B 89  ? 0.5405 0.5525 0.6233 -0.0292 0.0795  -0.0595 112 PRO B CA  
2670 C C   . PRO B 89  ? 0.5764 0.5891 0.6581 -0.0320 0.0800  -0.0618 112 PRO B C   
2671 O O   . PRO B 89  ? 0.6124 0.6240 0.6930 -0.0348 0.0812  -0.0641 112 PRO B O   
2672 C CB  . PRO B 89  ? 0.5166 0.5374 0.6004 -0.0283 0.0793  -0.0582 112 PRO B CB  
2673 C CG  . PRO B 89  ? 0.5230 0.5410 0.6077 -0.0248 0.0796  -0.0554 112 PRO B CG  
2674 C CD  . PRO B 89  ? 0.5292 0.5414 0.6137 -0.0239 0.0797  -0.0550 112 PRO B CD  
2675 N N   . ALA B 90  ? 0.6239 0.6379 0.7057 -0.0315 0.0796  -0.0612 113 ALA B N   
2676 C CA  . ALA B 90  ? 0.6806 0.6947 0.7613 -0.0343 0.0804  -0.0636 113 ALA B CA  
2677 C C   . ALA B 90  ? 0.6549 0.6598 0.7340 -0.0349 0.0816  -0.0646 113 ALA B C   
2678 O O   . ALA B 90  ? 0.6101 0.6128 0.6878 -0.0377 0.0837  -0.0670 113 ALA B O   
2679 C CB  . ALA B 90  ? 0.7381 0.7556 0.8192 -0.0332 0.0796  -0.0625 113 ALA B CB  
2680 N N   . HIS B 91  ? 0.6082 0.6083 0.6877 -0.0322 0.0808  -0.0628 114 HIS B N   
2681 C CA  . HIS B 91  ? 0.6281 0.6215 0.7063 -0.0318 0.0819  -0.0630 114 HIS B CA  
2682 C C   . HIS B 91  ? 0.6219 0.6126 0.6989 -0.0330 0.0838  -0.0641 114 HIS B C   
2683 O O   . HIS B 91  ? 0.7103 0.6961 0.7855 -0.0337 0.0863  -0.0648 114 HIS B O   
2684 C CB  . HIS B 91  ? 0.6156 0.6069 0.6944 -0.0291 0.0808  -0.0613 114 HIS B CB  
2685 C CG  . HIS B 91  ? 0.6410 0.6329 0.7204 -0.0281 0.0799  -0.0606 114 HIS B CG  
2686 N ND1 . HIS B 91  ? 0.6507 0.6446 0.7315 -0.0269 0.0791  -0.0595 114 HIS B ND1 
2687 C CD2 . HIS B 91  ? 0.6312 0.6213 0.7097 -0.0281 0.0802  -0.0608 114 HIS B CD2 
2688 C CE1 . HIS B 91  ? 0.6608 0.6542 0.7416 -0.0265 0.0788  -0.0592 114 HIS B CE1 
2689 N NE2 . HIS B 91  ? 0.6483 0.6398 0.7278 -0.0272 0.0792  -0.0600 114 HIS B NE2 
2690 N N   . LEU B 92  ? 0.5589 0.5524 0.6369 -0.0330 0.0831  -0.0639 115 LEU B N   
2691 C CA  . LEU B 92  ? 0.5503 0.5411 0.6275 -0.0337 0.0847  -0.0646 115 LEU B CA  
2692 C C   . LEU B 92  ? 0.5455 0.5372 0.6215 -0.0374 0.0871  -0.0673 115 LEU B C   
2693 O O   . LEU B 92  ? 0.5538 0.5399 0.6280 -0.0385 0.0903  -0.0684 115 LEU B O   
2694 C CB  . LEU B 92  ? 0.5596 0.5532 0.6382 -0.0326 0.0832  -0.0636 115 LEU B CB  
2695 C CG  . LEU B 92  ? 0.5792 0.5698 0.6582 -0.0298 0.0822  -0.0619 115 LEU B CG  
2696 C CD1 . LEU B 92  ? 0.5899 0.5833 0.6706 -0.0284 0.0807  -0.0607 115 LEU B CD1 
2697 C CD2 . LEU B 92  ? 0.5867 0.5734 0.6645 -0.0292 0.0837  -0.0618 115 LEU B CD2 
2698 N N   . ALA B 93  ? 0.5488 0.5481 0.6258 -0.0393 0.0861  -0.0684 116 ALA B N   
2699 C CA  . ALA B 93  ? 0.5411 0.5440 0.6172 -0.0438 0.0884  -0.0719 116 ALA B CA  
2700 C C   . ALA B 93  ? 0.5572 0.5534 0.6311 -0.0461 0.0920  -0.0739 116 ALA B C   
2701 O O   . ALA B 93  ? 0.5670 0.5595 0.6392 -0.0493 0.0960  -0.0766 116 ALA B O   
2702 C CB  . ALA B 93  ? 0.5127 0.5268 0.5901 -0.0450 0.0866  -0.0723 116 ALA B CB  
2703 N N   . ILE B 94  ? 0.5658 0.5596 0.6396 -0.0441 0.0911  -0.0724 117 ILE B N   
2704 C CA  . ILE B 94  ? 0.5982 0.5850 0.6699 -0.0452 0.0946  -0.0735 117 ILE B CA  
2705 C C   . ILE B 94  ? 0.6409 0.6185 0.7109 -0.0434 0.0978  -0.0724 117 ILE B C   
2706 O O   . ILE B 94  ? 0.6763 0.6483 0.7441 -0.0459 0.1028  -0.0745 117 ILE B O   
2707 C CB  . ILE B 94  ? 0.5851 0.5715 0.6573 -0.0428 0.0927  -0.0716 117 ILE B CB  
2708 C CG1 . ILE B 94  ? 0.5579 0.5531 0.6313 -0.0448 0.0907  -0.0729 117 ILE B CG1 
2709 C CG2 . ILE B 94  ? 0.5762 0.5543 0.6461 -0.0426 0.0965  -0.0717 117 ILE B CG2 
2710 C CD1 . ILE B 94  ? 0.5416 0.5379 0.6161 -0.0418 0.0878  -0.0704 117 ILE B CD1 
2711 N N   . ALA B 95  ? 0.6633 0.6396 0.7341 -0.0390 0.0954  -0.0691 118 ALA B N   
2712 C CA  . ALA B 95  ? 0.6544 0.6238 0.7236 -0.0362 0.0980  -0.0672 118 ALA B CA  
2713 C C   . ALA B 95  ? 0.6318 0.5981 0.6998 -0.0384 0.1015  -0.0689 118 ALA B C   
2714 O O   . ALA B 95  ? 0.6065 0.5653 0.6721 -0.0378 0.1064  -0.0686 118 ALA B O   
2715 C CB  . ALA B 95  ? 0.6423 0.6138 0.7130 -0.0321 0.0944  -0.0642 118 ALA B CB  
2716 N N   . GLU B 96  ? 0.6248 0.5969 0.6943 -0.0408 0.0995  -0.0706 119 GLU B N   
2717 C CA  . GLU B 96  ? 0.6585 0.6287 0.7271 -0.0433 0.1026  -0.0725 119 GLU B CA  
2718 C C   . GLU B 96  ? 0.6773 0.6451 0.7439 -0.0484 0.1076  -0.0766 119 GLU B C   
2719 O O   . GLU B 96  ? 0.6958 0.6565 0.7602 -0.0501 0.1131  -0.0781 119 GLU B O   
2720 C CB  . GLU B 96  ? 0.6528 0.6307 0.7236 -0.0439 0.0988  -0.0728 119 GLU B CB  
2721 C CG  . GLU B 96  ? 0.6805 0.6595 0.7529 -0.0392 0.0948  -0.0692 119 GLU B CG  
2722 C CD  . GLU B 96  ? 0.6965 0.6796 0.7704 -0.0389 0.0927  -0.0689 119 GLU B CD  
2723 O OE1 . GLU B 96  ? 0.6624 0.6502 0.7365 -0.0423 0.0932  -0.0713 119 GLU B OE1 
2724 O OE2 . GLU B 96  ? 0.6654 0.6478 0.7401 -0.0357 0.0908  -0.0665 119 GLU B OE2 
2725 N N   . CYS B 97  ? 0.6984 0.6715 0.7657 -0.0510 0.1064  -0.0785 120 CYS B N   
2726 C CA  . CYS B 97  ? 0.7334 0.7053 0.7989 -0.0566 0.1114  -0.0830 120 CYS B CA  
2727 C C   . CYS B 97  ? 0.7067 0.6659 0.7691 -0.0558 0.1177  -0.0826 120 CYS B C   
2728 O O   . CYS B 97  ? 0.6834 0.6361 0.7434 -0.0593 0.1244  -0.0856 120 CYS B O   
2729 C CB  . CYS B 97  ? 0.7349 0.7151 0.8016 -0.0586 0.1087  -0.0844 120 CYS B CB  
2730 S SG  . CYS B 97  ? 0.6779 0.6607 0.7428 -0.0671 0.1144  -0.0913 120 CYS B SG  
2731 N N   . GLU B 98  ? 0.6347 0.5907 0.6971 -0.0509 0.1162  -0.0788 121 GLU B N   
2732 C CA  . GLU B 98  ? 0.6317 0.5768 0.6912 -0.0487 0.1219  -0.0772 121 GLU B CA  
2733 C C   . GLU B 98  ? 0.6709 0.6082 0.7285 -0.0472 0.1268  -0.0761 121 GLU B C   
2734 O O   . GLU B 98  ? 0.7727 0.7007 0.8273 -0.0491 0.1347  -0.0777 121 GLU B O   
2735 C CB  . GLU B 98  ? 0.6235 0.5690 0.6838 -0.0428 0.1182  -0.0726 121 GLU B CB  
2736 C CG  . GLU B 98  ? 0.6511 0.5873 0.7087 -0.0386 0.1232  -0.0694 121 GLU B CG  
2737 C CD  . GLU B 98  ? 0.7686 0.7086 0.8275 -0.0329 0.1183  -0.0651 121 GLU B CD  
2738 O OE1 . GLU B 98  ? 0.8315 0.7800 0.8932 -0.0333 0.1117  -0.0653 121 GLU B OE1 
2739 O OE2 . GLU B 98  ? 0.7623 0.6972 0.8192 -0.0282 0.1216  -0.0615 121 GLU B OE2 
2740 N N   . ALA B 99  ? 0.6799 0.6208 0.7391 -0.0440 0.1226  -0.0736 122 ALA B N   
2741 C CA  . ALA B 99  ? 0.6464 0.5812 0.7041 -0.0419 0.1265  -0.0720 122 ALA B CA  
2742 C C   . ALA B 99  ? 0.6167 0.5482 0.6729 -0.0480 0.1320  -0.0768 122 ALA B C   
2743 O O   . ALA B 99  ? 0.6336 0.5550 0.6868 -0.0484 0.1399  -0.0772 122 ALA B O   
2744 C CB  . ALA B 99  ? 0.6433 0.5844 0.7034 -0.0384 0.1203  -0.0693 122 ALA B CB  
2745 N N   . ARG B 100 ? 0.6089 0.5493 0.6672 -0.0528 0.1284  -0.0806 123 ARG B N   
2746 C CA  . ARG B 100 ? 0.6215 0.5614 0.6787 -0.0594 0.1331  -0.0858 123 ARG B CA  
2747 C C   . ARG B 100 ? 0.6075 0.5396 0.6616 -0.0642 0.1414  -0.0898 123 ARG B C   
2748 O O   . ARG B 100 ? 0.5713 0.4944 0.6227 -0.0667 0.1493  -0.0919 123 ARG B O   
2749 C CB  . ARG B 100 ? 0.6730 0.6268 0.7330 -0.0633 0.1273  -0.0888 123 ARG B CB  
2750 C CG  . ARG B 100 ? 0.7451 0.7022 0.8045 -0.0702 0.1308  -0.0943 123 ARG B CG  
2751 C CD  . ARG B 100 ? 0.7981 0.7702 0.8607 -0.0713 0.1240  -0.0951 123 ARG B CD  
2752 N NE  . ARG B 100 ? 0.8330 0.8153 0.8970 -0.0735 0.1208  -0.0967 123 ARG B NE  
2753 C CZ  . ARG B 100 ? 0.9519 0.9397 1.0181 -0.0690 0.1146  -0.0929 123 ARG B CZ  
2754 N NH1 . ARG B 100 ? 0.9458 0.9304 1.0132 -0.0624 0.1105  -0.0875 123 ARG B NH1 
2755 N NH2 . ARG B 100 ? 1.0305 1.0274 1.0976 -0.0715 0.1128  -0.0947 123 ARG B NH2 
2756 N N   . LEU B 101 ? 0.6398 0.5746 0.6943 -0.0653 0.1402  -0.0906 124 LEU B N   
2757 C CA  . LEU B 101 ? 0.7291 0.6569 0.7807 -0.0703 0.1482  -0.0948 124 LEU B CA  
2758 C C   . LEU B 101 ? 0.7638 0.6763 0.8121 -0.0660 0.1558  -0.0914 124 LEU B C   
2759 O O   . LEU B 101 ? 0.7629 0.6656 0.8079 -0.0701 0.1652  -0.0949 124 LEU B O   
2760 C CB  . LEU B 101 ? 0.7732 0.7081 0.8260 -0.0725 0.1450  -0.0965 124 LEU B CB  
2761 C CG  . LEU B 101 ? 0.8115 0.7594 0.8657 -0.0805 0.1433  -0.1029 124 LEU B CG  
2762 C CD1 . LEU B 101 ? 0.8655 0.8249 0.9227 -0.0793 0.1363  -0.1018 124 LEU B CD1 
2763 C CD2 . LEU B 101 ? 0.8024 0.7585 0.8579 -0.0824 0.1401  -0.1043 124 LEU B CD2 
2764 N N   . GLY B 102 ? 0.8099 0.7204 0.8587 -0.0576 0.1524  -0.0847 125 GLY B N   
2765 C CA  . GLY B 102 ? 0.8253 0.7227 0.8708 -0.0519 0.1595  -0.0801 125 GLY B CA  
2766 C C   . GLY B 102 ? 0.7997 0.6871 0.8424 -0.0528 0.1680  -0.0810 125 GLY B C   
2767 O O   . GLY B 102 ? 0.7435 0.6180 0.7824 -0.0528 0.1782  -0.0810 125 GLY B O   
2768 N N   . GLN B 103 ? 0.8082 0.7011 0.8526 -0.0538 0.1643  -0.0818 126 GLN B N   
2769 C CA  . GLN B 103 ? 0.8747 0.7592 0.9167 -0.0557 0.1719  -0.0833 126 GLN B CA  
2770 C C   . GLN B 103 ? 0.8585 0.7368 0.8980 -0.0649 0.1810  -0.0908 126 GLN B C   
2771 O O   . GLN B 103 ? 0.8778 0.7433 0.9138 -0.0659 0.1914  -0.0918 126 GLN B O   
2772 C CB  . GLN B 103 ? 0.8879 0.7813 0.9327 -0.0559 0.1653  -0.0835 126 GLN B CB  
2773 C CG  . GLN B 103 ? 0.9280 0.8220 0.9736 -0.0470 0.1612  -0.0764 126 GLN B CG  
2774 C CD  . GLN B 103 ? 1.0563 0.9615 1.1054 -0.0472 0.1526  -0.0765 126 GLN B CD  
2775 O OE1 . GLN B 103 ? 1.0832 0.9982 1.1348 -0.0524 0.1474  -0.0806 126 GLN B OE1 
2776 N NE2 . GLN B 103 ? 1.0993 1.0035 1.1485 -0.0412 0.1514  -0.0717 126 GLN B NE2 
2777 N N   . GLN B 104 ? 0.8353 0.7230 0.8766 -0.0717 0.1775  -0.0963 127 GLN B N   
2778 C CA  . GLN B 104 ? 0.8520 0.7361 0.8910 -0.0812 0.1858  -0.1042 127 GLN B CA  
2779 C C   . GLN B 104 ? 0.8319 0.7048 0.8679 -0.0812 0.1936  -0.1042 127 GLN B C   
2780 O O   . GLN B 104 ? 0.8371 0.7080 0.8714 -0.0896 0.2002  -0.1112 127 GLN B O   
2781 C CB  . GLN B 104 ? 0.8931 0.7941 0.9353 -0.0886 0.1790  -0.1101 127 GLN B CB  
2782 C CG  . GLN B 104 ? 0.9650 0.8791 1.0105 -0.0883 0.1705  -0.1098 127 GLN B CG  
2783 C CD  . GLN B 104 ? 0.9925 0.9247 1.0413 -0.0927 0.1627  -0.1133 127 GLN B CD  
2784 O OE1 . GLN B 104 ? 1.1399 1.0752 1.1880 -0.0984 0.1652  -0.1180 127 GLN B OE1 
2785 N NE2 . GLN B 104 ? 0.9541 0.8983 1.0062 -0.0899 0.1537  -0.1108 127 GLN B NE2 
2786 N N   . GLY B 105 ? 0.8224 0.6888 0.8576 -0.0722 0.1933  -0.0968 128 GLY B N   
2787 C CA  . GLY B 105 ? 0.8228 0.6792 0.8552 -0.0714 0.2004  -0.0962 128 GLY B CA  
2788 C C   . GLY B 105 ? 0.8183 0.6841 0.8526 -0.0753 0.1950  -0.0994 128 GLY B C   
2789 O O   . GLY B 105 ? 0.8584 0.7164 0.8903 -0.0766 0.2015  -0.1005 128 GLY B O   
2790 N N   . ARG B 106 ? 0.7962 0.6784 0.8346 -0.0769 0.1838  -0.1006 129 ARG B N   
2791 C CA  . ARG B 106 ? 0.7827 0.6745 0.8231 -0.0796 0.1784  -0.1027 129 ARG B CA  
2792 C C   . ARG B 106 ? 0.8366 0.7323 0.8791 -0.0707 0.1700  -0.0954 129 ARG B C   
2793 O O   . ARG B 106 ? 0.9195 0.8143 0.9627 -0.0636 0.1668  -0.0896 129 ARG B O   
2794 C CB  . ARG B 106 ? 0.7685 0.6767 0.8119 -0.0867 0.1721  -0.1084 129 ARG B CB  
2795 C CG  . ARG B 106 ? 0.7737 0.6805 0.8152 -0.0960 0.1799  -0.1162 129 ARG B CG  
2796 C CD  . ARG B 106 ? 0.7410 0.6643 0.7857 -0.1001 0.1730  -0.1195 129 ARG B CD  
2797 N NE  . ARG B 106 ? 0.7125 0.6515 0.7592 -0.1054 0.1682  -0.1238 129 ARG B NE  
2798 C CZ  . ARG B 106 ? 0.6951 0.6517 0.7452 -0.1065 0.1598  -0.1246 129 ARG B CZ  
2799 N NH1 . ARG B 106 ? 0.7203 0.6804 0.7721 -0.1029 0.1552  -0.1215 129 ARG B NH1 
2800 N NH2 . ARG B 106 ? 0.7023 0.6734 0.7540 -0.1108 0.1563  -0.1281 129 ARG B NH2 
2801 N N   . SER B 107 ? 0.8266 0.7274 0.8702 -0.0714 0.1665  -0.0959 130 SER B N   
2802 C CA  . SER B 107 ? 0.7694 0.6722 0.8144 -0.0637 0.1604  -0.0896 130 SER B CA  
2803 C C   . SER B 107 ? 0.7353 0.6534 0.7842 -0.0647 0.1499  -0.0902 130 SER B C   
2804 O O   . SER B 107 ? 0.6953 0.6216 0.7453 -0.0713 0.1488  -0.0956 130 SER B O   
2805 C CB  . SER B 107 ? 0.7927 0.6847 0.8347 -0.0619 0.1673  -0.0882 130 SER B CB  
2806 O OG  . SER B 107 ? 0.8778 0.7769 0.9216 -0.0614 0.1614  -0.0877 130 SER B OG  
2807 N N   . VAL B 108 ? 0.7068 0.6292 0.7579 -0.0577 0.1427  -0.0846 131 VAL B N   
2808 C CA  . VAL B 108 ? 0.6722 0.6069 0.7268 -0.0570 0.1335  -0.0838 131 VAL B CA  
2809 C C   . VAL B 108 ? 0.7173 0.6505 0.7723 -0.0498 0.1302  -0.0781 131 VAL B C   
2810 O O   . VAL B 108 ? 0.7490 0.6792 0.8038 -0.0441 0.1297  -0.0737 131 VAL B O   
2811 C CB  . VAL B 108 ? 0.6344 0.5780 0.6916 -0.0568 0.1276  -0.0836 131 VAL B CB  
2812 C CG1 . VAL B 108 ? 0.6006 0.5552 0.6611 -0.0549 0.1190  -0.0819 131 VAL B CG1 
2813 C CG2 . VAL B 108 ? 0.6228 0.5702 0.6798 -0.0641 0.1304  -0.0894 131 VAL B CG2 
2814 N N   . VAL B 109 ? 0.7258 0.6624 0.7816 -0.0503 0.1277  -0.0785 132 VAL B N   
2815 C CA  . VAL B 109 ? 0.7107 0.6470 0.7669 -0.0444 0.1246  -0.0738 132 VAL B CA  
2816 C C   . VAL B 109 ? 0.7055 0.6528 0.7650 -0.0445 0.1166  -0.0738 132 VAL B C   
2817 O O   . VAL B 109 ? 0.6709 0.6245 0.7315 -0.0493 0.1151  -0.0774 132 VAL B O   
2818 C CB  . VAL B 109 ? 0.7427 0.6702 0.7961 -0.0438 0.1309  -0.0734 132 VAL B CB  
2819 C CG1 . VAL B 109 ? 0.7873 0.7118 0.8390 -0.0512 0.1367  -0.0792 132 VAL B CG1 
2820 C CG2 . VAL B 109 ? 0.7724 0.7035 0.8269 -0.0407 0.1266  -0.0710 132 VAL B CG2 
2821 N N   . ILE B 110 ? 0.7043 0.6543 0.7653 -0.0393 0.1119  -0.0697 133 ILE B N   
2822 C CA  . ILE B 110 ? 0.6965 0.6550 0.7602 -0.0386 0.1053  -0.0691 133 ILE B CA  
2823 C C   . ILE B 110 ? 0.6802 0.6377 0.7437 -0.0358 0.1045  -0.0670 133 ILE B C   
2824 O O   . ILE B 110 ? 0.7127 0.6658 0.7748 -0.0317 0.1063  -0.0640 133 ILE B O   
2825 C CB  . ILE B 110 ? 0.7488 0.7117 0.8145 -0.0356 0.1008  -0.0668 133 ILE B CB  
2826 C CG1 . ILE B 110 ? 0.8044 0.7696 0.8707 -0.0384 0.1010  -0.0689 133 ILE B CG1 
2827 C CG2 . ILE B 110 ? 0.7400 0.7099 0.8083 -0.0347 0.0953  -0.0660 133 ILE B CG2 
2828 C CD1 . ILE B 110 ? 0.8704 0.8283 0.9345 -0.0383 0.1061  -0.0689 133 ILE B CD1 
2829 N N   . ILE B 111 ? 0.6457 0.6082 0.7105 -0.0380 0.1018  -0.0685 134 ILE B N   
2830 C CA  . ILE B 111 ? 0.6060 0.5686 0.6709 -0.0360 0.1004  -0.0670 134 ILE B CA  
2831 C C   . ILE B 111 ? 0.6070 0.5774 0.6747 -0.0351 0.0945  -0.0662 134 ILE B C   
2832 O O   . ILE B 111 ? 0.5596 0.5357 0.6286 -0.0380 0.0927  -0.0682 134 ILE B O   
2833 C CB  . ILE B 111 ? 0.6007 0.5624 0.6645 -0.0399 0.1030  -0.0700 134 ILE B CB  
2834 C CG1 . ILE B 111 ? 0.6595 0.6123 0.7203 -0.0417 0.1102  -0.0714 134 ILE B CG1 
2835 C CG2 . ILE B 111 ? 0.5942 0.5565 0.6583 -0.0381 0.1013  -0.0685 134 ILE B CG2 
2836 C CD1 . ILE B 111 ? 0.6880 0.6417 0.7480 -0.0481 0.1134  -0.0764 134 ILE B CD1 
2837 N N   . THR B 112 ? 0.5890 0.5603 0.6575 -0.0312 0.0919  -0.0635 135 THR B N   
2838 C CA  . THR B 112 ? 0.5689 0.5461 0.6399 -0.0305 0.0875  -0.0628 135 THR B CA  
2839 C C   . THR B 112 ? 0.6373 0.6155 0.7088 -0.0284 0.0856  -0.0615 135 THR B C   
2840 O O   . THR B 112 ? 0.6888 0.6646 0.7591 -0.0261 0.0869  -0.0600 135 THR B O   
2841 C CB  . THR B 112 ? 0.4971 0.4755 0.5690 -0.0288 0.0861  -0.0617 135 THR B CB  
2842 O OG1 . THR B 112 ? 0.4483 0.4311 0.5223 -0.0283 0.0829  -0.0613 135 THR B OG1 
2843 C CG2 . THR B 112 ? 0.4842 0.4600 0.5549 -0.0257 0.0873  -0.0598 135 THR B CG2 
2844 N N   . GLN B 113 ? 0.6724 0.6549 0.7456 -0.0291 0.0830  -0.0618 136 GLN B N   
2845 C CA  . GLN B 113 ? 0.6797 0.6636 0.7537 -0.0276 0.0813  -0.0608 136 GLN B CA  
2846 C C   . GLN B 113 ? 0.6473 0.6329 0.7225 -0.0260 0.0797  -0.0600 136 GLN B C   
2847 O O   . GLN B 113 ? 0.6616 0.6484 0.7375 -0.0252 0.0788  -0.0596 136 GLN B O   
2848 C CB  . GLN B 113 ? 0.7738 0.7610 0.8489 -0.0288 0.0799  -0.0613 136 GLN B CB  
2849 C CG  . GLN B 113 ? 0.8932 0.8830 0.9683 -0.0314 0.0806  -0.0628 136 GLN B CG  
2850 C CD  . GLN B 113 ? 1.0358 1.0313 1.1122 -0.0317 0.0791  -0.0625 136 GLN B CD  
2851 O OE1 . GLN B 113 ? 1.0164 1.0153 1.0924 -0.0338 0.0796  -0.0639 136 GLN B OE1 
2852 N NE2 . GLN B 113 ? 1.1246 1.1216 1.2024 -0.0296 0.0777  -0.0608 136 GLN B NE2 
2853 N N   . ASN B 114 ? 0.5999 0.5857 0.6754 -0.0260 0.0798  -0.0599 137 ASN B N   
2854 C CA  . ASN B 114 ? 0.6133 0.6008 0.6900 -0.0251 0.0788  -0.0596 137 ASN B CA  
2855 C C   . ASN B 114 ? 0.6686 0.6564 0.7445 -0.0235 0.0792  -0.0591 137 ASN B C   
2856 O O   . ASN B 114 ? 0.7383 0.7244 0.8126 -0.0224 0.0807  -0.0584 137 ASN B O   
2857 C CB  . ASN B 114 ? 0.6129 0.6012 0.6905 -0.0258 0.0786  -0.0598 137 ASN B CB  
2858 C CG  . ASN B 114 ? 0.6659 0.6563 0.7442 -0.0267 0.0782  -0.0598 137 ASN B CG  
2859 O OD1 . ASN B 114 ? 0.6957 0.6872 0.7747 -0.0264 0.0777  -0.0594 137 ASN B OD1 
2860 N ND2 . ASN B 114 ? 0.6698 0.6615 0.7480 -0.0280 0.0786  -0.0604 137 ASN B ND2 
2861 N N   . ILE B 115 ? 0.6425 0.6331 0.7193 -0.0233 0.0785  -0.0596 138 ILE B N   
2862 C CA  . ILE B 115 ? 0.5910 0.5848 0.6671 -0.0219 0.0787  -0.0593 138 ILE B CA  
2863 C C   . ILE B 115 ? 0.5775 0.5742 0.6544 -0.0221 0.0786  -0.0600 138 ILE B C   
2864 O O   . ILE B 115 ? 0.5774 0.5791 0.6540 -0.0214 0.0787  -0.0602 138 ILE B O   
2865 C CB  . ILE B 115 ? 0.5635 0.5603 0.6398 -0.0219 0.0783  -0.0598 138 ILE B CB  
2866 C CG1 . ILE B 115 ? 0.5205 0.5174 0.5983 -0.0240 0.0780  -0.0615 138 ILE B CG1 
2867 C CG2 . ILE B 115 ? 0.5787 0.5730 0.6540 -0.0212 0.0786  -0.0589 138 ILE B CG2 
2868 C CD1 . ILE B 115 ? 0.4985 0.4995 0.5765 -0.0246 0.0781  -0.0629 138 ILE B CD1 
2869 N N   . ASP B 116 ? 0.5805 0.5749 0.6582 -0.0231 0.0786  -0.0603 139 ASP B N   
2870 C CA  . ASP B 116 ? 0.5603 0.5564 0.6386 -0.0236 0.0787  -0.0611 139 ASP B CA  
2871 C C   . ASP B 116 ? 0.5420 0.5385 0.6196 -0.0223 0.0790  -0.0601 139 ASP B C   
2872 O O   . ASP B 116 ? 0.5753 0.5732 0.6534 -0.0227 0.0791  -0.0607 139 ASP B O   
2873 C CB  . ASP B 116 ? 0.5898 0.5833 0.6695 -0.0249 0.0789  -0.0616 139 ASP B CB  
2874 C CG  . ASP B 116 ? 0.6237 0.6146 0.7033 -0.0248 0.0786  -0.0605 139 ASP B CG  
2875 O OD1 . ASP B 116 ? 0.6548 0.6449 0.7335 -0.0244 0.0787  -0.0600 139 ASP B OD1 
2876 O OD2 . ASP B 116 ? 0.6584 0.6485 0.7386 -0.0251 0.0786  -0.0602 139 ASP B OD2 
2877 N N   . GLU B 117 ? 0.5617 0.5563 0.6377 -0.0207 0.0798  -0.0586 140 GLU B N   
2878 C CA  . GLU B 117 ? 0.5923 0.5861 0.6672 -0.0191 0.0811  -0.0573 140 GLU B CA  
2879 C C   . GLU B 117 ? 0.6014 0.5929 0.6770 -0.0204 0.0810  -0.0579 140 GLU B C   
2880 O O   . GLU B 117 ? 0.6020 0.5933 0.6769 -0.0192 0.0819  -0.0571 140 GLU B O   
2881 C CB  . GLU B 117 ? 0.6066 0.6066 0.6810 -0.0169 0.0813  -0.0565 140 GLU B CB  
2882 C CG  . GLU B 117 ? 0.6730 0.6736 0.7454 -0.0137 0.0830  -0.0541 140 GLU B CG  
2883 C CD  . GLU B 117 ? 0.7072 0.7165 0.7790 -0.0109 0.0832  -0.0528 140 GLU B CD  
2884 O OE1 . GLU B 117 ? 0.6817 0.6958 0.7542 -0.0115 0.0825  -0.0537 140 GLU B OE1 
2885 O OE2 . GLU B 117 ? 0.7416 0.7532 0.8120 -0.0081 0.0844  -0.0507 140 GLU B OE2 
2886 N N   . LEU B 118 ? 0.6199 0.6099 0.6968 -0.0224 0.0801  -0.0590 141 LEU B N   
2887 C CA  . LEU B 118 ? 0.5846 0.5736 0.6622 -0.0233 0.0800  -0.0593 141 LEU B CA  
2888 C C   . LEU B 118 ? 0.5802 0.5663 0.6565 -0.0235 0.0814  -0.0590 141 LEU B C   
2889 O O   . LEU B 118 ? 0.6738 0.6595 0.7502 -0.0237 0.0818  -0.0591 141 LEU B O   
2890 C CB  . LEU B 118 ? 0.6069 0.5961 0.6860 -0.0246 0.0792  -0.0598 141 LEU B CB  
2891 C CG  . LEU B 118 ? 0.6541 0.6446 0.7343 -0.0248 0.0791  -0.0603 141 LEU B CG  
2892 C CD1 . LEU B 118 ? 0.6763 0.6664 0.7576 -0.0251 0.0793  -0.0600 141 LEU B CD1 
2893 C CD2 . LEU B 118 ? 0.6716 0.6630 0.7523 -0.0249 0.0794  -0.0608 141 LEU B CD2 
2894 N N   . HIS B 119 ? 0.5763 0.5600 0.6514 -0.0237 0.0827  -0.0589 142 HIS B N   
2895 C CA  . HIS B 119 ? 0.5937 0.5738 0.6672 -0.0245 0.0852  -0.0592 142 HIS B CA  
2896 C C   . HIS B 119 ? 0.6009 0.5793 0.6731 -0.0222 0.0871  -0.0578 142 HIS B C   
2897 O O   . HIS B 119 ? 0.6049 0.5807 0.6764 -0.0229 0.0890  -0.0581 142 HIS B O   
2898 C CB  . HIS B 119 ? 0.5857 0.5629 0.6579 -0.0253 0.0872  -0.0596 142 HIS B CB  
2899 C CG  . HIS B 119 ? 0.6089 0.5882 0.6821 -0.0281 0.0860  -0.0613 142 HIS B CG  
2900 N ND1 . HIS B 119 ? 0.6688 0.6501 0.7426 -0.0306 0.0860  -0.0629 142 HIS B ND1 
2901 C CD2 . HIS B 119 ? 0.5817 0.5627 0.6554 -0.0286 0.0848  -0.0616 142 HIS B CD2 
2902 C CE1 . HIS B 119 ? 0.6177 0.6028 0.6923 -0.0323 0.0849  -0.0638 142 HIS B CE1 
2903 N NE2 . HIS B 119 ? 0.5871 0.5715 0.6617 -0.0311 0.0842  -0.0630 142 HIS B NE2 
2904 N N   . HIS B 120 ? 0.6242 0.6050 0.6961 -0.0195 0.0868  -0.0562 143 HIS B N   
2905 C CA  . HIS B 120 ? 0.6877 0.6687 0.7582 -0.0164 0.0887  -0.0542 143 HIS B CA  
2906 C C   . HIS B 120 ? 0.6352 0.6190 0.7070 -0.0168 0.0872  -0.0547 143 HIS B C   
2907 O O   . HIS B 120 ? 0.6696 0.6516 0.7405 -0.0158 0.0890  -0.0539 143 HIS B O   
2908 C CB  . HIS B 120 ? 0.8382 0.8239 0.9083 -0.0134 0.0884  -0.0525 143 HIS B CB  
2909 C CG  . HIS B 120 ? 0.9956 0.9851 1.0645 -0.0095 0.0898  -0.0499 143 HIS B CG  
2910 N ND1 . HIS B 120 ? 1.0099 0.9957 1.0762 -0.0060 0.0940  -0.0471 143 HIS B ND1 
2911 C CD2 . HIS B 120 ? 1.0128 1.0102 1.0825 -0.0084 0.0881  -0.0498 143 HIS B CD2 
2912 C CE1 . HIS B 120 ? 1.0406 1.0325 1.1064 -0.0024 0.0945  -0.0448 143 HIS B CE1 
2913 N NE2 . HIS B 120 ? 1.0827 1.0823 1.1506 -0.0041 0.0907  -0.0467 143 HIS B NE2 
2914 N N   . ARG B 121 ? 0.5995 0.5871 0.6733 -0.0184 0.0843  -0.0561 144 ARG B N   
2915 C CA  . ARG B 121 ? 0.5663 0.5563 0.6414 -0.0190 0.0831  -0.0568 144 ARG B CA  
2916 C C   . ARG B 121 ? 0.5511 0.5376 0.6265 -0.0207 0.0834  -0.0575 144 ARG B C   
2917 O O   . ARG B 121 ? 0.5611 0.5485 0.6370 -0.0208 0.0832  -0.0577 144 ARG B O   
2918 C CB  . ARG B 121 ? 0.5552 0.5488 0.6321 -0.0204 0.0812  -0.0583 144 ARG B CB  
2919 C CG  . ARG B 121 ? 0.5865 0.5857 0.6631 -0.0192 0.0809  -0.0582 144 ARG B CG  
2920 C CD  . ARG B 121 ? 0.6297 0.6314 0.7078 -0.0214 0.0800  -0.0603 144 ARG B CD  
2921 N NE  . ARG B 121 ? 0.6715 0.6724 0.7510 -0.0231 0.0799  -0.0617 144 ARG B NE  
2922 C CZ  . ARG B 121 ? 0.7552 0.7558 0.8358 -0.0252 0.0802  -0.0634 144 ARG B CZ  
2923 N NH1 . ARG B 121 ? 0.7907 0.7921 0.8714 -0.0260 0.0804  -0.0643 144 ARG B NH1 
2924 N NH2 . ARG B 121 ? 0.7658 0.7647 0.8473 -0.0263 0.0809  -0.0642 144 ARG B NH2 
2925 N N   . ALA B 122 ? 0.5397 0.5231 0.6147 -0.0223 0.0842  -0.0582 145 ALA B N   
2926 C CA  . ALA B 122 ? 0.5523 0.5341 0.6275 -0.0242 0.0849  -0.0592 145 ALA B CA  
2927 C C   . ALA B 122 ? 0.5363 0.5139 0.6094 -0.0237 0.0881  -0.0588 145 ALA B C   
2928 O O   . ALA B 122 ? 0.5748 0.5510 0.6477 -0.0254 0.0891  -0.0598 145 ALA B O   
2929 C CB  . ALA B 122 ? 0.5907 0.5731 0.6664 -0.0266 0.0844  -0.0604 145 ALA B CB  
2930 N N   . GLY B 123 ? 0.5600 0.5355 0.6314 -0.0213 0.0902  -0.0571 146 GLY B N   
2931 C CA  . GLY B 123 ? 0.6070 0.5771 0.6760 -0.0201 0.0947  -0.0561 146 GLY B CA  
2932 C C   . GLY B 123 ? 0.6247 0.5892 0.6918 -0.0216 0.0983  -0.0570 146 GLY B C   
2933 O O   . GLY B 123 ? 0.6297 0.5884 0.6949 -0.0223 0.1028  -0.0574 146 GLY B O   
2934 N N   . SER B 124 ? 0.6774 0.6432 0.7450 -0.0226 0.0969  -0.0577 147 SER B N   
2935 C CA  . SER B 124 ? 0.7229 0.6835 0.7887 -0.0242 0.1008  -0.0587 147 SER B CA  
2936 C C   . SER B 124 ? 0.7572 0.7144 0.8208 -0.0196 0.1041  -0.0554 147 SER B C   
2937 O O   . SER B 124 ? 0.6755 0.6375 0.7398 -0.0161 0.1016  -0.0531 147 SER B O   
2938 C CB  . SER B 124 ? 0.7318 0.6955 0.7989 -0.0270 0.0982  -0.0607 147 SER B CB  
2939 O OG  . SER B 124 ? 0.7400 0.7059 0.8080 -0.0313 0.0975  -0.0637 147 SER B OG  
2940 N N   . LYS B 125 ? 0.7899 0.7393 0.8507 -0.0197 0.1102  -0.0553 148 LYS B N   
2941 C CA  . LYS B 125 ? 0.8145 0.7599 0.8728 -0.0145 0.1147  -0.0514 148 LYS B CA  
2942 C C   . LYS B 125 ? 0.8128 0.7546 0.8698 -0.0147 0.1172  -0.0515 148 LYS B C   
2943 O O   . LYS B 125 ? 0.7280 0.6730 0.7848 -0.0108 0.1161  -0.0486 148 LYS B O   
2944 C CB  . LYS B 125 ? 0.9491 0.8865 1.0047 -0.0134 0.1215  -0.0504 148 LYS B CB  
2945 C CG  . LYS B 125 ? 1.0315 0.9714 1.0881 -0.0131 0.1199  -0.0503 148 LYS B CG  
2946 C CD  . LYS B 125 ? 1.0569 1.0042 1.1143 -0.0075 0.1167  -0.0463 148 LYS B CD  
2947 C CE  . LYS B 125 ? 1.0626 1.0130 1.1211 -0.0076 0.1147  -0.0465 148 LYS B CE  
2948 N NZ  . LYS B 125 ? 1.0973 1.0581 1.1580 -0.0053 0.1090  -0.0452 148 LYS B NZ  
2949 N N   . HIS B 126 ? 0.8560 0.7918 0.9119 -0.0195 0.1207  -0.0550 149 HIS B N   
2950 C CA  . HIS B 126 ? 0.8666 0.7981 0.9210 -0.0203 0.1240  -0.0555 149 HIS B CA  
2951 C C   . HIS B 126 ? 0.7908 0.7297 0.8479 -0.0232 0.1176  -0.0577 149 HIS B C   
2952 O O   . HIS B 126 ? 0.7644 0.7038 0.8222 -0.0285 0.1172  -0.0617 149 HIS B O   
2953 C CB  . HIS B 126 ? 1.0201 0.9422 1.0720 -0.0250 0.1314  -0.0589 149 HIS B CB  
2954 C CG  . HIS B 126 ? 1.1931 1.1075 1.2426 -0.0240 0.1380  -0.0582 149 HIS B CG  
2955 N ND1 . HIS B 126 ? 1.2465 1.1586 1.2959 -0.0299 0.1403  -0.0627 149 HIS B ND1 
2956 C CD2 . HIS B 126 ? 1.2801 1.1888 1.3271 -0.0179 0.1432  -0.0534 149 HIS B CD2 
2957 C CE1 . HIS B 126 ? 1.2709 1.1752 1.3178 -0.0276 0.1468  -0.0609 149 HIS B CE1 
2958 N NE2 . HIS B 126 ? 1.3571 1.2591 1.4025 -0.0201 0.1487  -0.0551 149 HIS B NE2 
2959 N N   . VAL B 127 ? 0.7583 0.7034 0.8169 -0.0195 0.1129  -0.0551 150 VAL B N   
2960 C CA  . VAL B 127 ? 0.7101 0.6617 0.7711 -0.0213 0.1072  -0.0565 150 VAL B CA  
2961 C C   . VAL B 127 ? 0.7458 0.6968 0.8059 -0.0187 0.1080  -0.0545 150 VAL B C   
2962 O O   . VAL B 127 ? 0.8302 0.7804 0.8888 -0.0138 0.1103  -0.0509 150 VAL B O   
2963 C CB  . VAL B 127 ? 0.6554 0.6148 0.7189 -0.0195 0.1015  -0.0553 150 VAL B CB  
2964 C CG1 . VAL B 127 ? 0.6212 0.5860 0.6869 -0.0212 0.0968  -0.0566 150 VAL B CG1 
2965 C CG2 . VAL B 127 ? 0.6593 0.6197 0.7238 -0.0213 0.1006  -0.0567 150 VAL B CG2 
2966 N N   . TYR B 128 ? 0.7070 0.6595 0.7680 -0.0217 0.1060  -0.0567 151 TYR B N   
2967 C CA  . TYR B 128 ? 0.6654 0.6182 0.7259 -0.0195 0.1060  -0.0552 151 TYR B CA  
2968 C C   . TYR B 128 ? 0.6021 0.5627 0.6654 -0.0201 0.0996  -0.0557 151 TYR B C   
2969 O O   . TYR B 128 ? 0.5794 0.5420 0.6441 -0.0238 0.0974  -0.0584 151 TYR B O   
2970 C CB  . TYR B 128 ? 0.7114 0.6581 0.7702 -0.0228 0.1103  -0.0574 151 TYR B CB  
2971 C CG  . TYR B 128 ? 0.7667 0.7037 0.8220 -0.0214 0.1183  -0.0563 151 TYR B CG  
2972 C CD1 . TYR B 128 ? 0.7513 0.6849 0.8044 -0.0158 0.1219  -0.0520 151 TYR B CD1 
2973 C CD2 . TYR B 128 ? 0.7854 0.7166 0.8394 -0.0256 0.1230  -0.0594 151 TYR B CD2 
2974 C CE1 . TYR B 128 ? 0.7634 0.6872 0.8130 -0.0139 0.1303  -0.0504 151 TYR B CE1 
2975 C CE2 . TYR B 128 ? 0.8090 0.7298 0.8595 -0.0245 0.1315  -0.0585 151 TYR B CE2 
2976 C CZ  . TYR B 128 ? 0.8241 0.7407 0.8724 -0.0183 0.1354  -0.0537 151 TYR B CZ  
2977 O OH  . TYR B 128 ? 0.8841 0.7896 0.9286 -0.0163 0.1448  -0.0520 151 TYR B OH  
2978 N N   . GLU B 129 ? 0.5664 0.5319 0.6303 -0.0165 0.0973  -0.0533 152 GLU B N   
2979 C CA  . GLU B 129 ? 0.5704 0.5425 0.6367 -0.0171 0.0922  -0.0540 152 GLU B CA  
2980 C C   . GLU B 129 ? 0.5804 0.5527 0.6463 -0.0165 0.0923  -0.0536 152 GLU B C   
2981 O O   . GLU B 129 ? 0.5788 0.5533 0.6437 -0.0129 0.0930  -0.0512 152 GLU B O   
2982 C CB  . GLU B 129 ? 0.5951 0.5734 0.6624 -0.0145 0.0901  -0.0526 152 GLU B CB  
2983 C CG  . GLU B 129 ? 0.6000 0.5782 0.6672 -0.0139 0.0907  -0.0522 152 GLU B CG  
2984 C CD  . GLU B 129 ? 0.6107 0.5964 0.6793 -0.0128 0.0879  -0.0519 152 GLU B CD  
2985 O OE1 . GLU B 129 ? 0.6431 0.6310 0.7138 -0.0154 0.0850  -0.0540 152 GLU B OE1 
2986 O OE2 . GLU B 129 ? 0.6073 0.5968 0.6749 -0.0092 0.0891  -0.0496 152 GLU B OE2 
2987 N N   . ILE B 130 ? 0.6163 0.5874 0.6829 -0.0197 0.0914  -0.0557 153 ILE B N   
2988 C CA  . ILE B 130 ? 0.6170 0.5869 0.6828 -0.0195 0.0922  -0.0555 153 ILE B CA  
2989 C C   . ILE B 130 ? 0.6107 0.5862 0.6782 -0.0188 0.0884  -0.0553 153 ILE B C   
2990 O O   . ILE B 130 ? 0.6220 0.5973 0.6890 -0.0183 0.0886  -0.0550 153 ILE B O   
2991 C CB  . ILE B 130 ? 0.6064 0.5735 0.6721 -0.0235 0.0931  -0.0582 153 ILE B CB  
2992 C CG1 . ILE B 130 ? 0.6190 0.5914 0.6873 -0.0261 0.0889  -0.0599 153 ILE B CG1 
2993 C CG2 . ILE B 130 ? 0.5841 0.5461 0.6483 -0.0257 0.0972  -0.0596 153 ILE B CG2 
2994 C CD1 . ILE B 130 ? 0.6389 0.6113 0.7071 -0.0295 0.0895  -0.0622 153 ILE B CD1 
2995 N N   . HIS B 131 ? 0.6292 0.6092 0.6987 -0.0193 0.0853  -0.0559 154 HIS B N   
2996 C CA  . HIS B 131 ? 0.6038 0.5885 0.6745 -0.0189 0.0828  -0.0560 154 HIS B CA  
2997 C C   . HIS B 131 ? 0.5963 0.5859 0.6669 -0.0165 0.0826  -0.0549 154 HIS B C   
2998 O O   . HIS B 131 ? 0.5090 0.5038 0.5806 -0.0166 0.0810  -0.0555 154 HIS B O   
2999 C CB  . HIS B 131 ? 0.6372 0.6232 0.7100 -0.0215 0.0805  -0.0578 154 HIS B CB  
3000 C CG  . HIS B 131 ? 0.6198 0.6037 0.6926 -0.0234 0.0806  -0.0586 154 HIS B CG  
3001 N ND1 . HIS B 131 ? 0.6743 0.6593 0.7486 -0.0253 0.0794  -0.0596 154 HIS B ND1 
3002 C CD2 . HIS B 131 ? 0.6263 0.6080 0.6980 -0.0236 0.0818  -0.0586 154 HIS B CD2 
3003 C CE1 . HIS B 131 ? 0.6668 0.6514 0.7407 -0.0266 0.0797  -0.0602 154 HIS B CE1 
3004 N NE2 . HIS B 131 ? 0.6561 0.6382 0.7285 -0.0260 0.0812  -0.0599 154 HIS B NE2 
3005 N N   . GLY B 132 ? 0.6578 0.6461 0.7271 -0.0145 0.0847  -0.0534 155 GLY B N   
3006 C CA  . GLY B 132 ? 0.7005 0.6949 0.7695 -0.0119 0.0846  -0.0520 155 GLY B CA  
3007 C C   . GLY B 132 ? 0.6851 0.6816 0.7557 -0.0137 0.0829  -0.0536 155 GLY B C   
3008 O O   . GLY B 132 ? 0.6351 0.6270 0.7063 -0.0157 0.0829  -0.0546 155 GLY B O   
3009 N N   . SER B 133 ? 0.6678 0.6721 0.7390 -0.0129 0.0819  -0.0538 156 SER B N   
3010 C CA  . SER B 133 ? 0.7101 0.7173 0.7825 -0.0143 0.0809  -0.0552 156 SER B CA  
3011 C C   . SER B 133 ? 0.7052 0.7214 0.7787 -0.0154 0.0797  -0.0571 156 SER B C   
3012 O O   . SER B 133 ? 0.8044 0.8279 0.8771 -0.0135 0.0799  -0.0562 156 SER B O   
3013 C CB  . SER B 133 ? 0.7101 0.7172 0.7812 -0.0115 0.0826  -0.0530 156 SER B CB  
3014 O OG  . SER B 133 ? 0.6953 0.7074 0.7674 -0.0123 0.0817  -0.0541 156 SER B OG  
3015 N N   . LEU B 134 ? 0.6571 0.6730 0.7322 -0.0185 0.0789  -0.0597 157 LEU B N   
3016 C CA  . LEU B 134 ? 0.6348 0.6585 0.7108 -0.0206 0.0786  -0.0623 157 LEU B CA  
3017 C C   . LEU B 134 ? 0.6571 0.6903 0.7324 -0.0185 0.0789  -0.0615 157 LEU B C   
3018 O O   . LEU B 134 ? 0.6103 0.6529 0.6860 -0.0199 0.0789  -0.0637 157 LEU B O   
3019 C CB  . LEU B 134 ? 0.6297 0.6496 0.7072 -0.0239 0.0788  -0.0648 157 LEU B CB  
3020 C CG  . LEU B 134 ? 0.6226 0.6353 0.7010 -0.0260 0.0790  -0.0658 157 LEU B CG  
3021 C CD1 . LEU B 134 ? 0.6103 0.6195 0.6899 -0.0281 0.0800  -0.0674 157 LEU B CD1 
3022 C CD2 . LEU B 134 ? 0.6406 0.6567 0.7193 -0.0277 0.0795  -0.0678 157 LEU B CD2 
3023 N N   . PHE B 135 ? 0.6857 0.7169 0.7598 -0.0152 0.0796  -0.0585 158 PHE B N   
3024 C CA  . PHE B 135 ? 0.7051 0.7455 0.7786 -0.0130 0.0800  -0.0574 158 PHE B CA  
3025 C C   . PHE B 135 ? 0.7440 0.7875 0.8154 -0.0076 0.0814  -0.0532 158 PHE B C   
3026 O O   . PHE B 135 ? 0.8079 0.8538 0.8781 -0.0038 0.0829  -0.0501 158 PHE B O   
3027 C CB  . PHE B 135 ? 0.7425 0.7788 0.8163 -0.0133 0.0802  -0.0574 158 PHE B CB  
3028 C CG  . PHE B 135 ? 0.7784 0.8114 0.8541 -0.0181 0.0795  -0.0612 158 PHE B CG  
3029 C CD1 . PHE B 135 ? 0.8064 0.8474 0.8831 -0.0211 0.0794  -0.0646 158 PHE B CD1 
3030 C CD2 . PHE B 135 ? 0.7784 0.8008 0.8547 -0.0196 0.0793  -0.0614 158 PHE B CD2 
3031 C CE1 . PHE B 135 ? 0.7952 0.8319 0.8734 -0.0253 0.0798  -0.0679 158 PHE B CE1 
3032 C CE2 . PHE B 135 ? 0.7989 0.8183 0.8767 -0.0231 0.0793  -0.0641 158 PHE B CE2 
3033 C CZ  . PHE B 135 ? 0.7890 0.8146 0.8677 -0.0258 0.0798  -0.0672 158 PHE B CZ  
3034 N N   . LYS B 136 ? 0.7089 0.7522 0.7799 -0.0071 0.0814  -0.0527 159 LYS B N   
3035 C CA  . LYS B 136 ? 0.7239 0.7732 0.7930 -0.0020 0.0830  -0.0489 159 LYS B CA  
3036 C C   . LYS B 136 ? 0.6820 0.7405 0.7516 -0.0033 0.0818  -0.0507 159 LYS B C   
3037 O O   . LYS B 136 ? 0.6412 0.6964 0.7124 -0.0080 0.0804  -0.0544 159 LYS B O   
3038 C CB  . LYS B 136 ? 0.7286 0.7662 0.7960 0.0007  0.0853  -0.0456 159 LYS B CB  
3039 C CG  . LYS B 136 ? 0.7178 0.7489 0.7840 0.0032  0.0877  -0.0431 159 LYS B CG  
3040 C CD  . LYS B 136 ? 0.7079 0.7266 0.7722 0.0047  0.0909  -0.0409 159 LYS B CD  
3041 C CE  . LYS B 136 ? 0.7397 0.7504 0.8032 0.0049  0.0931  -0.0402 159 LYS B CE  
3042 N NZ  . LYS B 136 ? 0.7369 0.7384 0.7978 0.0080  0.0980  -0.0371 159 LYS B NZ  
3043 N N   . THR B 137 ? 0.7258 0.7965 0.7942 0.0009  0.0827  -0.0479 160 THR B N   
3044 C CA  . THR B 137 ? 0.8219 0.9033 0.8905 0.0004  0.0819  -0.0491 160 THR B CA  
3045 C C   . THR B 137 ? 0.8914 0.9728 0.9578 0.0065  0.0840  -0.0439 160 THR B C   
3046 O O   . THR B 137 ? 0.9649 1.0454 1.0293 0.0124  0.0866  -0.0388 160 THR B O   
3047 C CB  . THR B 137 ? 0.7946 0.8950 0.8636 0.0000  0.0812  -0.0509 160 THR B CB  
3048 O OG1 . THR B 137 ? 0.8110 0.9202 0.8781 0.0069  0.0830  -0.0455 160 THR B OG1 
3049 C CG2 . THR B 137 ? 0.7834 0.8835 0.8542 -0.0055 0.0801  -0.0556 160 THR B CG2 
3050 N N   . ARG B 138 ? 0.8841 0.9654 0.9507 0.0052  0.0833  -0.0450 161 ARG B N   
3051 C CA  . ARG B 138 ? 0.9493 1.0332 1.0139 0.0110  0.0853  -0.0402 161 ARG B CA  
3052 C C   . ARG B 138 ? 0.9346 1.0369 0.9995 0.0111  0.0841  -0.0414 161 ARG B C   
3053 O O   . ARG B 138 ? 0.8269 0.9338 0.8938 0.0050  0.0818  -0.0469 161 ARG B O   
3054 C CB  . ARG B 138 ? 1.0131 1.0823 1.0773 0.0099  0.0859  -0.0401 161 ARG B CB  
3055 C CG  . ARG B 138 ? 1.0898 1.1621 1.1520 0.0155  0.0882  -0.0357 161 ARG B CG  
3056 C CD  . ARG B 138 ? 1.1377 1.1963 1.1995 0.0144  0.0890  -0.0357 161 ARG B CD  
3057 N NE  . ARG B 138 ? 1.0299 1.0827 1.0940 0.0073  0.0859  -0.0411 161 ARG B NE  
3058 C CZ  . ARG B 138 ? 1.0269 1.0658 1.0914 0.0042  0.0858  -0.0427 161 ARG B CZ  
3059 N NH1 . ARG B 138 ? 0.9606 0.9893 1.0236 0.0064  0.0888  -0.0401 161 ARG B NH1 
3060 N NH2 . ARG B 138 ? 1.0540 1.0897 1.1206 -0.0012 0.0832  -0.0470 161 ARG B NH2 
3061 N N   . CYS B 139 ? 0.9637 1.0770 1.0266 0.0182  0.0862  -0.0361 162 CYS B N   
3062 C CA  . CYS B 139 ? 1.0178 1.1514 1.0808 0.0190  0.0853  -0.0366 162 CYS B CA  
3063 C C   . CYS B 139 ? 0.9708 1.1019 1.0336 0.0187  0.0851  -0.0367 162 CYS B C   
3064 O O   . CYS B 139 ? 0.9000 1.0206 0.9611 0.0233  0.0876  -0.0321 162 CYS B O   
3065 C CB  . CYS B 139 ? 1.1115 1.2603 1.1724 0.0276  0.0878  -0.0302 162 CYS B CB  
3066 S SG  . CYS B 139 ? 1.0748 1.2529 1.1359 0.0284  0.0865  -0.0312 162 CYS B SG  
3067 N N   . MET B 140 ? 0.9160 1.0574 0.9805 0.0133  0.0827  -0.0420 163 MET B N   
3068 C CA  . MET B 140 ? 0.9207 1.0607 0.9851 0.0126  0.0824  -0.0425 163 MET B CA  
3069 C C   . MET B 140 ? 0.9789 1.1316 1.0411 0.0209  0.0845  -0.0361 163 MET B C   
3070 O O   . MET B 140 ? 0.9123 1.0589 0.9734 0.0237  0.0857  -0.0333 163 MET B O   
3071 C CB  . MET B 140 ? 0.9048 1.0535 0.9713 0.0047  0.0800  -0.0498 163 MET B CB  
3072 C CG  . MET B 140 ? 0.9074 1.0440 0.9760 -0.0027 0.0789  -0.0556 163 MET B CG  
3073 S SD  . MET B 140 ? 0.9454 1.0577 1.0143 -0.0049 0.0786  -0.0558 163 MET B SD  
3074 C CE  . MET B 140 ? 0.9344 1.0510 1.0050 -0.0118 0.0776  -0.0622 163 MET B CE  
3075 N N   . SER B 141 ? 1.0231 1.1938 1.0845 0.0251  0.0853  -0.0335 164 SER B N   
3076 C CA  . SER B 141 ? 0.9926 1.1784 1.0519 0.0336  0.0875  -0.0272 164 SER B CA  
3077 C C   . SER B 141 ? 0.9949 1.1685 1.0513 0.0424  0.0919  -0.0189 164 SER B C   
3078 O O   . SER B 141 ? 0.9374 1.1023 0.9923 0.0461  0.0941  -0.0153 164 SER B O   
3079 C CB  . SER B 141 ? 1.0389 1.2511 1.0985 0.0341  0.0866  -0.0281 164 SER B CB  
3080 O OG  . SER B 141 ? 1.1031 1.3241 1.1651 0.0248  0.0834  -0.0367 164 SER B OG  
3081 N N   . CYS B 142 ? 1.0284 1.1999 1.0841 0.0454  0.0935  -0.0163 165 CYS B N   
3082 C CA  . CYS B 142 ? 1.0280 1.1885 1.0807 0.0542  0.0989  -0.0082 165 CYS B CA  
3083 C C   . CYS B 142 ? 1.0688 1.2023 1.1214 0.0512  0.1004  -0.0093 165 CYS B C   
3084 O O   . CYS B 142 ? 1.0810 1.2028 1.1310 0.0573  0.1055  -0.0035 165 CYS B O   
3085 C CB  . CYS B 142 ? 1.0836 1.2571 1.1351 0.0606  0.1010  -0.0035 165 CYS B CB  
3086 S SG  . CYS B 142 ? 1.0749 1.2443 1.1284 0.0543  0.0985  -0.0086 165 CYS B SG  
3087 N N   . GLY B 143 ? 1.1332 1.2571 1.1884 0.0419  0.0964  -0.0166 166 GLY B N   
3088 C CA  . GLY B 143 ? 1.1626 1.2632 1.2179 0.0387  0.0975  -0.0180 166 GLY B CA  
3089 C C   . GLY B 143 ? 1.1440 1.2362 1.1987 0.0395  0.0993  -0.0168 166 GLY B C   
3090 O O   . GLY B 143 ? 1.0189 1.0928 1.0732 0.0375  0.1011  -0.0174 166 GLY B O   
3091 N N   . GLU B 144 ? 1.1659 1.2720 1.2206 0.0419  0.0989  -0.0156 167 GLU B N   
3092 C CA  . GLU B 144 ? 1.1322 1.2315 1.1863 0.0434  0.1010  -0.0140 167 GLU B CA  
3093 C C   . GLU B 144 ? 1.1107 1.2005 1.1674 0.0348  0.0973  -0.0206 167 GLU B C   
3094 O O   . GLU B 144 ? 1.1374 1.2348 1.1966 0.0287  0.0929  -0.0262 167 GLU B O   
3095 C CB  . GLU B 144 ? 1.1276 1.2464 1.1810 0.0487  0.1015  -0.0106 167 GLU B CB  
3096 C CG  . GLU B 144 ? 1.0642 1.1800 1.1179 0.0482  0.1018  -0.0109 167 GLU B CG  
3097 C CD  . GLU B 144 ? 1.0293 1.1662 1.0822 0.0541  0.1026  -0.0071 167 GLU B CD  
3098 O OE1 . GLU B 144 ? 0.9477 1.0882 0.9976 0.0637  0.1077  0.0007  167 GLU B OE1 
3099 O OE2 . GLU B 144 ? 1.0040 1.1542 1.0591 0.0493  0.0985  -0.0119 167 GLU B OE2 
3100 N N   . VAL B 145 ? 1.1026 1.1761 1.1585 0.0346  0.0997  -0.0199 168 VAL B N   
3101 C CA  . VAL B 145 ? 1.1579 1.2226 1.2160 0.0274  0.0968  -0.0253 168 VAL B CA  
3102 C C   . VAL B 145 ? 1.1903 1.2584 1.2483 0.0291  0.0975  -0.0242 168 VAL B C   
3103 O O   . VAL B 145 ? 1.2952 1.3579 1.3508 0.0346  0.1020  -0.0193 168 VAL B O   
3104 C CB  . VAL B 145 ? 1.2326 1.2776 1.2904 0.0246  0.0984  -0.0264 168 VAL B CB  
3105 C CG1 . VAL B 145 ? 1.2900 1.3276 1.3498 0.0184  0.0959  -0.0310 168 VAL B CG1 
3106 C CG2 . VAL B 145 ? 1.2342 1.2764 1.2925 0.0219  0.0970  -0.0285 168 VAL B CG2 
3107 N N   . LYS B 146 ? 1.1369 1.2128 1.1973 0.0241  0.0934  -0.0288 169 LYS B N   
3108 C CA  . LYS B 146 ? 1.0831 1.1643 1.1436 0.0252  0.0936  -0.0282 169 LYS B CA  
3109 C C   . LYS B 146 ? 1.0085 1.0829 1.0714 0.0177  0.0904  -0.0341 169 LYS B C   
3110 O O   . LYS B 146 ? 0.8725 0.9473 0.9376 0.0116  0.0872  -0.0392 169 LYS B O   
3111 C CB  . LYS B 146 ? 1.1529 1.2565 1.2133 0.0284  0.0928  -0.0269 169 LYS B CB  
3112 C CG  . LYS B 146 ? 1.2219 1.3355 1.2831 0.0280  0.0918  -0.0278 169 LYS B CG  
3113 C CD  . LYS B 146 ? 1.2541 1.3868 1.3135 0.0358  0.0939  -0.0224 169 LYS B CD  
3114 C CE  . LYS B 146 ? 1.3097 1.4608 1.3690 0.0372  0.0929  -0.0222 169 LYS B CE  
3115 N NZ  . LYS B 146 ? 1.3759 1.5398 1.4379 0.0291  0.0886  -0.0299 169 LYS B NZ  
3116 N N   . ALA B 147 ? 0.9419 1.0097 1.0044 0.0185  0.0918  -0.0330 170 ALA B N   
3117 C CA  . ALA B 147 ? 0.9193 0.9824 0.9840 0.0124  0.0892  -0.0378 170 ALA B CA  
3118 C C   . ALA B 147 ? 0.8984 0.9770 0.9649 0.0093  0.0863  -0.0414 170 ALA B C   
3119 O O   . ALA B 147 ? 0.8992 0.9932 0.9650 0.0130  0.0868  -0.0393 170 ALA B O   
3120 C CB  . ALA B 147 ? 0.9100 0.9660 0.9737 0.0145  0.0913  -0.0356 170 ALA B CB  
3121 N N   . ASN B 148 ? 0.8536 0.9286 0.9223 0.0026  0.0838  -0.0469 171 ASN B N   
3122 C CA  . ASN B 148 ? 0.8149 0.9022 0.8852 -0.0013 0.0821  -0.0512 171 ASN B CA  
3123 C C   . ASN B 148 ? 0.8474 0.9262 0.9198 -0.0078 0.0808  -0.0561 171 ASN B C   
3124 O O   . ASN B 148 ? 0.8525 0.9224 0.9258 -0.0112 0.0802  -0.0584 171 ASN B O   
3125 C CB  . ASN B 148 ? 0.8475 0.9466 0.9182 -0.0027 0.0813  -0.0532 171 ASN B CB  
3126 C CG  . ASN B 148 ? 0.9183 1.0284 0.9907 -0.0087 0.0802  -0.0592 171 ASN B CG  
3127 O OD1 . ASN B 148 ? 1.0042 1.1093 1.0778 -0.0127 0.0799  -0.0624 171 ASN B OD1 
3128 N ND2 . ASN B 148 ? 0.9630 1.0883 1.0354 -0.0095 0.0799  -0.0609 171 ASN B ND2 
3129 N N   . HIS B 149 ? 0.8986 0.9806 0.9716 -0.0090 0.0807  -0.0575 172 HIS B N   
3130 C CA  . HIS B 149 ? 0.8777 0.9526 0.9525 -0.0146 0.0801  -0.0618 172 HIS B CA  
3131 C C   . HIS B 149 ? 0.8658 0.9529 0.9417 -0.0190 0.0801  -0.0666 172 HIS B C   
3132 O O   . HIS B 149 ? 0.9161 0.9983 0.9931 -0.0232 0.0804  -0.0699 172 HIS B O   
3133 C CB  . HIS B 149 ? 0.8506 0.9157 0.9250 -0.0129 0.0805  -0.0596 172 HIS B CB  
3134 C CG  . HIS B 149 ? 0.8569 0.9101 0.9302 -0.0097 0.0813  -0.0558 172 HIS B CG  
3135 N ND1 . HIS B 149 ? 0.9386 0.9928 1.0098 -0.0040 0.0830  -0.0510 172 HIS B ND1 
3136 C CD2 . HIS B 149 ? 0.9476 0.9879 1.0213 -0.0115 0.0811  -0.0562 172 HIS B CD2 
3137 C CE1 . HIS B 149 ? 0.9520 0.9937 1.0224 -0.0031 0.0841  -0.0492 172 HIS B CE1 
3138 N NE2 . HIS B 149 ? 1.0044 1.0385 1.0764 -0.0077 0.0827  -0.0525 172 HIS B NE2 
3139 N N   . LYS B 150 ? 0.8653 0.9686 0.9407 -0.0181 0.0801  -0.0670 173 LYS B N   
3140 C CA  . LYS B 150 ? 0.9419 1.0603 1.0181 -0.0227 0.0804  -0.0721 173 LYS B CA  
3141 C C   . LYS B 150 ? 0.9527 1.0644 1.0305 -0.0304 0.0814  -0.0786 173 LYS B C   
3142 O O   . LYS B 150 ? 0.9718 1.0730 1.0500 -0.0319 0.0816  -0.0792 173 LYS B O   
3143 C CB  . LYS B 150 ? 1.0711 1.2065 1.1465 -0.0207 0.0803  -0.0715 173 LYS B CB  
3144 C CG  . LYS B 150 ? 1.0830 1.2398 1.1588 -0.0245 0.0807  -0.0763 173 LYS B CG  
3145 C CD  . LYS B 150 ? 1.0799 1.2554 1.1541 -0.0177 0.0803  -0.0715 173 LYS B CD  
3146 C CE  . LYS B 150 ? 1.1221 1.2929 1.1950 -0.0100 0.0806  -0.0644 173 LYS B CE  
3147 N NZ  . LYS B 150 ? 1.1779 1.3699 1.2495 -0.0041 0.0810  -0.0605 173 LYS B NZ  
3148 N N   . SER B 151 ? 0.9771 1.0938 1.0557 -0.0351 0.0826  -0.0832 174 SER B N   
3149 C CA  . SER B 151 ? 0.9975 1.1070 1.0773 -0.0423 0.0848  -0.0891 174 SER B CA  
3150 C C   . SER B 151 ? 1.1225 1.2474 1.2027 -0.0484 0.0868  -0.0958 174 SER B C   
3151 O O   . SER B 151 ? 1.1629 1.2944 1.2432 -0.0492 0.0871  -0.0969 174 SER B O   
3152 C CB  . SER B 151 ? 0.9294 1.0233 1.0098 -0.0427 0.0854  -0.0884 174 SER B CB  
3153 O OG  . SER B 151 ? 0.8904 0.9760 0.9717 -0.0486 0.0884  -0.0933 174 SER B OG  
3154 N N   . PRO B 152 ? 1.2283 1.3596 1.3087 -0.0532 0.0885  -0.1005 175 PRO B N   
3155 C CA  . PRO B 152 ? 1.1742 1.2992 1.2544 -0.0521 0.0880  -0.0992 175 PRO B CA  
3156 C C   . PRO B 152 ? 1.1045 1.2403 1.1837 -0.0457 0.0851  -0.0939 175 PRO B C   
3157 O O   . PRO B 152 ? 0.9887 1.1408 1.0673 -0.0431 0.0842  -0.0927 175 PRO B O   
3158 C CB  . PRO B 152 ? 1.2397 1.3718 1.3204 -0.0601 0.0913  -0.1069 175 PRO B CB  
3159 C CG  . PRO B 152 ? 1.3023 1.4551 1.3829 -0.0628 0.0918  -0.1106 175 PRO B CG  
3160 C CD  . PRO B 152 ? 1.2512 1.4004 1.3318 -0.0596 0.0906  -0.1075 175 PRO B CD  
3161 N N   . ILE B 153 ? 1.1742 1.3009 1.2530 -0.0427 0.0841  -0.0907 176 ILE B N   
3162 C CA  . ILE B 153 ? 1.2007 1.3348 1.2784 -0.0363 0.0821  -0.0853 176 ILE B CA  
3163 C C   . ILE B 153 ? 1.2131 1.3706 1.2904 -0.0370 0.0822  -0.0875 176 ILE B C   
3164 O O   . ILE B 153 ? 1.2330 1.4018 1.3091 -0.0306 0.0810  -0.0825 176 ILE B O   
3165 C CB  . ILE B 153 ? 1.2182 1.3395 1.2957 -0.0349 0.0817  -0.0832 176 ILE B CB  
3166 C CG1 . ILE B 153 ? 1.1998 1.3267 1.2758 -0.0277 0.0802  -0.0771 176 ILE B CG1 
3167 C CG2 . ILE B 153 ? 1.1655 1.2877 1.2439 -0.0416 0.0834  -0.0893 176 ILE B CG2 
3168 C CD1 . ILE B 153 ? 1.1924 1.3057 1.2682 -0.0257 0.0797  -0.0744 176 ILE B CD1 
3169 N N   . CYS B 154 ? 1.1807 1.3452 1.2588 -0.0448 0.0841  -0.0950 177 CYS B N   
3170 C CA  . CYS B 154 ? 1.1740 1.3625 1.2520 -0.0476 0.0846  -0.0989 177 CYS B CA  
3171 C C   . CYS B 154 ? 1.1290 1.3209 1.2080 -0.0578 0.0880  -0.1083 177 CYS B C   
3172 O O   . CYS B 154 ? 0.9040 1.0785 0.9837 -0.0625 0.0903  -0.1117 177 CYS B O   
3173 C CB  . CYS B 154 ? 1.2273 1.4220 1.3048 -0.0463 0.0840  -0.0981 177 CYS B CB  
3174 S SG  . CYS B 154 ? 1.2184 1.4027 1.2968 -0.0550 0.0867  -0.1054 177 CYS B SG  
3175 N N   . PRO B 155 ? 1.1536 1.3684 1.2326 -0.0611 0.0887  -0.1126 178 PRO B N   
3176 C CA  . PRO B 155 ? 1.2035 1.4229 1.2833 -0.0713 0.0926  -0.1222 178 PRO B CA  
3177 C C   . PRO B 155 ? 1.2660 1.4762 1.3461 -0.0788 0.0962  -0.1285 178 PRO B C   
3178 O O   . PRO B 155 ? 1.3608 1.5546 1.4414 -0.0842 0.0999  -0.1326 178 PRO B O   
3179 C CB  . PRO B 155 ? 1.1915 1.4416 1.2709 -0.0728 0.0923  -0.1253 178 PRO B CB  
3180 C CG  . PRO B 155 ? 1.1859 1.4450 1.2644 -0.0618 0.0882  -0.1157 178 PRO B CG  
3181 C CD  . PRO B 155 ? 1.1542 1.3936 1.2323 -0.0558 0.0866  -0.1093 178 PRO B CD  
3182 N N   . ALA B 156 ? 1.1929 1.4127 1.2727 -0.0785 0.0954  -0.1288 179 ALA B N   
3183 C CA  . ALA B 156 ? 1.1528 1.3647 1.2328 -0.0851 0.0988  -0.1343 179 ALA B CA  
3184 C C   . ALA B 156 ? 1.2634 1.4461 1.3438 -0.0864 0.1014  -0.1340 179 ALA B C   
3185 O O   . ALA B 156 ? 1.0605 1.2353 1.1410 -0.0939 0.1064  -0.1404 179 ALA B O   
3186 C CB  . ALA B 156 ? 1.0504 1.2702 1.1300 -0.0807 0.0961  -0.1307 179 ALA B CB  
3187 N N   . LEU B 157 ? 1.3666 1.5342 1.4470 -0.0790 0.0984  -0.1263 180 LEU B N   
3188 C CA  . LEU B 157 ? 1.2987 1.4409 1.3794 -0.0783 0.1000  -0.1242 180 LEU B CA  
3189 C C   . LEU B 157 ? 1.2079 1.3398 1.2890 -0.0809 0.1028  -0.1261 180 LEU B C   
3190 O O   . LEU B 157 ? 1.1938 1.3058 1.2750 -0.0803 0.1046  -0.1244 180 LEU B O   
3191 C CB  . LEU B 157 ? 1.2730 1.4052 1.3534 -0.0690 0.0953  -0.1151 180 LEU B CB  
3192 C CG  . LEU B 157 ? 1.1948 1.3251 1.2749 -0.0668 0.0940  -0.1129 180 LEU B CG  
3193 C CD1 . LEU B 157 ? 1.2481 1.3733 1.3276 -0.0578 0.0896  -0.1042 180 LEU B CD1 
3194 C CD2 . LEU B 157 ? 1.1374 1.2505 1.2178 -0.0707 0.0976  -0.1154 180 LEU B CD2 
3195 N N   . ASP B 158 ? 1.1469 1.2928 1.2280 -0.0837 0.1033  -0.1295 181 ASP B N   
3196 C CA  . ASP B 158 ? 1.1534 1.2903 1.2348 -0.0854 0.1055  -0.1305 181 ASP B CA  
3197 C C   . ASP B 158 ? 1.0495 1.1691 1.1311 -0.0917 0.1120  -0.1355 181 ASP B C   
3198 O O   . ASP B 158 ? 0.9484 1.0719 1.0297 -0.0992 0.1169  -0.1428 181 ASP B O   
3199 C CB  . ASP B 158 ? 1.1847 1.3415 1.2662 -0.0886 0.1057  -0.1347 181 ASP B CB  
3200 C CG  . ASP B 158 ? 1.1618 1.3112 1.2435 -0.0865 0.1053  -0.1323 181 ASP B CG  
3201 O OD1 . ASP B 158 ? 1.1166 1.2481 1.1984 -0.0811 0.1037  -0.1263 181 ASP B OD1 
3202 O OD2 . ASP B 158 ? 1.1527 1.3153 1.2346 -0.0902 0.1065  -0.1365 181 ASP B OD2 
3203 N N   . GLY B 159 ? 1.0411 1.1415 1.1228 -0.0882 0.1124  -0.1312 182 GLY B N   
3204 C CA  . GLY B 159 ? 1.0188 1.1016 1.1004 -0.0923 0.1188  -0.1341 182 GLY B CA  
3205 C C   . GLY B 159 ? 1.0549 1.1316 1.1362 -0.0938 0.1212  -0.1352 182 GLY B C   
3206 O O   . GLY B 159 ? 1.0176 1.0855 1.0985 -0.0997 0.1282  -0.1403 182 GLY B O   
3207 N N   . LYS B 160 ? 1.1044 1.1851 1.1858 -0.0887 0.1160  -0.1306 183 LYS B N   
3208 C CA  . LYS B 160 ? 1.1434 1.2165 1.2245 -0.0894 0.1179  -0.1308 183 LYS B CA  
3209 C C   . LYS B 160 ? 1.1852 1.2404 1.2664 -0.0825 0.1160  -0.1233 183 LYS B C   
3210 O O   . LYS B 160 ? 1.2984 1.3465 1.3799 -0.0784 0.1143  -0.1189 183 LYS B O   
3211 C CB  . LYS B 160 ? 1.1417 1.2310 1.2226 -0.0889 0.1141  -0.1311 183 LYS B CB  
3212 C CG  . LYS B 160 ? 1.2163 1.3270 1.2971 -0.0952 0.1154  -0.1383 183 LYS B CG  
3213 C CD  . LYS B 160 ? 1.2848 1.3936 1.3653 -0.1052 0.1234  -0.1475 183 LYS B CD  
3214 C CE  . LYS B 160 ? 1.3133 1.4454 1.3937 -0.1124 0.1249  -0.1555 183 LYS B CE  
3215 N NZ  . LYS B 160 ? 1.3369 1.4655 1.4168 -0.1231 0.1340  -0.1653 183 LYS B NZ  
3216 N N   . GLY B 161 ? 1.1134 1.1621 1.1944 -0.0816 0.1166  -0.1220 184 GLY B N   
3217 C CA  . GLY B 161 ? 1.0615 1.0959 1.1426 -0.0754 0.1148  -0.1153 184 GLY B CA  
3218 C C   . GLY B 161 ? 1.0409 1.0584 1.1219 -0.0753 0.1201  -0.1143 184 GLY B C   
3219 O O   . GLY B 161 ? 1.0567 1.0643 1.1378 -0.0696 0.1182  -0.1083 184 GLY B O   
3220 N N   . ALA B 162 ? 1.0337 1.0482 1.1143 -0.0814 0.1271  -0.1201 185 ALA B N   
3221 C CA  . ALA B 162 ? 1.0510 1.0489 1.1312 -0.0809 0.1333  -0.1188 185 ALA B CA  
3222 C C   . ALA B 162 ? 1.0085 0.9953 1.0884 -0.0768 0.1342  -0.1144 185 ALA B C   
3223 O O   . ALA B 162 ? 0.9336 0.9236 1.0134 -0.0784 0.1341  -0.1160 185 ALA B O   
3224 C CB  . ALA B 162 ? 1.1101 1.1053 1.1895 -0.0890 0.1425  -0.1267 185 ALA B CB  
3225 N N   . PRO B 163 ? 1.0364 1.0113 1.1164 -0.0715 0.1351  -0.1086 186 PRO B N   
3226 C CA  . PRO B 163 ? 1.1111 1.0768 1.1909 -0.0668 0.1358  -0.1036 186 PRO B CA  
3227 C C   . PRO B 163 ? 1.2000 1.1523 1.2786 -0.0687 0.1458  -0.1050 186 PRO B C   
3228 O O   . PRO B 163 ? 1.2393 1.1846 1.3177 -0.0646 0.1467  -0.1007 186 PRO B O   
3229 C CB  . PRO B 163 ? 1.0511 1.0135 1.1314 -0.0599 0.1315  -0.0966 186 PRO B CB  
3230 C CG  . PRO B 163 ? 1.0488 1.0104 1.1291 -0.0618 0.1340  -0.0985 186 PRO B CG  
3231 C CD  . PRO B 163 ? 1.0719 1.0433 1.1521 -0.0689 0.1348  -0.1059 186 PRO B CD  
3232 N N   . ASP B 164 ? 1.2179 1.1667 1.2958 -0.0748 0.1537  -0.1109 187 ASP B N   
3233 C CA  . ASP B 164 ? 1.2241 1.1592 1.3006 -0.0768 0.1645  -0.1126 187 ASP B CA  
3234 C C   . ASP B 164 ? 1.1708 1.1065 1.2469 -0.0790 0.1656  -0.1147 187 ASP B C   
3235 O O   . ASP B 164 ? 1.1616 1.1091 1.2381 -0.0843 0.1627  -0.1203 187 ASP B O   
3236 C CB  . ASP B 164 ? 1.2919 1.2239 1.3674 -0.0844 0.1732  -0.1200 187 ASP B CB  
3237 C CG  . ASP B 164 ? 1.4086 1.3237 1.4824 -0.0857 0.1858  -0.1208 187 ASP B CG  
3238 O OD1 . ASP B 164 ? 1.5014 1.4051 1.5747 -0.0793 0.1890  -0.1143 187 ASP B OD1 
3239 O OD2 . ASP B 164 ? 1.3308 1.2441 1.4035 -0.0926 0.1927  -0.1276 187 ASP B OD2 
3240 N N   . PRO B 165 ? 1.0801 1.0039 1.1554 -0.0746 0.1701  -0.1101 188 PRO B N   
3241 C CA  . PRO B 165 ? 1.0527 0.9768 1.1277 -0.0757 0.1705  -0.1112 188 PRO B CA  
3242 C C   . PRO B 165 ? 1.0544 0.9818 1.1286 -0.0855 0.1764  -0.1208 188 PRO B C   
3243 O O   . PRO B 165 ? 0.9702 0.9049 1.0447 -0.0877 0.1734  -0.1232 188 PRO B O   
3244 C CB  . PRO B 165 ? 1.0307 0.9394 1.1046 -0.0700 0.1774  -0.1052 188 PRO B CB  
3245 C CG  . PRO B 165 ? 1.0092 0.9138 1.0834 -0.0635 0.1764  -0.0988 188 PRO B CG  
3246 C CD  . PRO B 165 ? 1.0510 0.9611 1.1255 -0.0684 0.1756  -0.1037 188 PRO B CD  
3247 N N   . ASN B 166 ? 1.1043 1.0272 1.1776 -0.0915 0.1847  -0.1267 189 ASN B N   
3248 C CA  . ASN B 166 ? 1.1310 1.0583 1.2036 -0.1019 0.1910  -0.1369 189 ASN B CA  
3249 C C   . ASN B 166 ? 1.0962 1.0408 1.1697 -0.1075 0.1857  -0.1428 189 ASN B C   
3250 O O   . ASN B 166 ? 1.0394 0.9867 1.1121 -0.1164 0.1925  -0.1516 189 ASN B O   
3251 C CB  . ASN B 166 ? 1.1635 1.0744 1.2340 -0.1063 0.2055  -0.1407 189 ASN B CB  
3252 C CG  . ASN B 166 ? 1.2743 1.1680 1.3435 -0.1011 0.2127  -0.1353 189 ASN B CG  
3253 O OD1 . ASN B 166 ? 1.2572 1.1496 1.3258 -0.1036 0.2155  -0.1377 189 ASN B OD1 
3254 N ND2 . ASN B 166 ? 1.2732 1.1544 1.3418 -0.0937 0.2160  -0.1279 189 ASN B ND2 
3255 N N   . THR B 167 ? 1.1507 1.1074 1.2257 -0.1025 0.1742  -0.1383 190 THR B N   
3256 C CA  . THR B 167 ? 1.1801 1.1548 1.2560 -0.1072 0.1692  -0.1435 190 THR B CA  
3257 C C   . THR B 167 ? 1.1552 1.1441 1.2312 -0.1124 0.1672  -0.1490 190 THR B C   
3258 O O   . THR B 167 ? 1.1302 1.1165 1.2060 -0.1100 0.1659  -0.1466 190 THR B O   
3259 C CB  . THR B 167 ? 1.2278 1.2099 1.3050 -0.1000 0.1587  -0.1368 190 THR B CB  
3260 O OG1 . THR B 167 ? 1.1944 1.1658 1.2714 -0.0970 0.1614  -0.1335 190 THR B OG1 
3261 C CG2 . THR B 167 ? 1.2084 1.2111 1.2863 -0.1037 0.1530  -0.1411 190 THR B CG2 
3262 N N   . LYS B 168 ? 1.1898 1.1940 1.2658 -0.1200 0.1678  -0.1569 191 LYS B N   
3263 C CA  . LYS B 168 ? 1.2679 1.2880 1.3440 -0.1249 0.1657  -0.1622 191 LYS B CA  
3264 C C   . LYS B 168 ? 1.1804 1.2155 1.2578 -0.1184 0.1540  -0.1566 191 LYS B C   
3265 O O   . LYS B 168 ? 1.1881 1.2299 1.2661 -0.1151 0.1487  -0.1537 191 LYS B O   
3266 C CB  . LYS B 168 ? 1.4021 1.4352 1.4777 -0.1361 0.1715  -0.1735 191 LYS B CB  
3267 C CG  . LYS B 168 ? 1.5235 1.5483 1.5978 -0.1445 0.1825  -0.1811 191 LYS B CG  
3268 C CD  . LYS B 168 ? 1.5376 1.5643 1.6108 -0.1562 0.1930  -0.1923 191 LYS B CD  
3269 C CE  . LYS B 168 ? 1.5193 1.5292 1.5908 -0.1624 0.2056  -0.1976 191 LYS B CE  
3270 N NZ  . LYS B 168 ? 1.5289 1.5254 1.5989 -0.1683 0.2172  -0.2028 191 LYS B NZ  
3271 N N   . GLU B 169 ? 1.1263 1.1657 1.2038 -0.1165 0.1505  -0.1549 192 GLU B N   
3272 C CA  . GLU B 169 ? 1.1753 1.2309 1.2537 -0.1113 0.1405  -0.1507 192 GLU B CA  
3273 C C   . GLU B 169 ? 1.1277 1.2047 1.2063 -0.1155 0.1384  -0.1557 192 GLU B C   
3274 O O   . GLU B 169 ? 1.1113 1.1958 1.1895 -0.1245 0.1443  -0.1645 192 GLU B O   
3275 C CB  . GLU B 169 ? 1.2138 1.2738 1.2920 -0.1113 0.1389  -0.1509 192 GLU B CB  
3276 C CG  . GLU B 169 ? 1.2727 1.3161 1.3509 -0.1043 0.1374  -0.1434 192 GLU B CG  
3277 C CD  . GLU B 169 ? 1.3102 1.3599 1.3884 -0.1035 0.1345  -0.1429 192 GLU B CD  
3278 O OE1 . GLU B 169 ? 1.3551 1.4134 1.4328 -0.1109 0.1386  -0.1503 192 GLU B OE1 
3279 O OE2 . GLU B 169 ? 1.1146 1.1613 1.1931 -0.0960 0.1285  -0.1356 192 GLU B OE2 
3280 N N   . ALA B 170 ? 1.2090 1.2958 1.2883 -0.1090 0.1304  -0.1499 193 ALA B N   
3281 C CA  . ALA B 170 ? 1.2691 1.3779 1.3486 -0.1112 0.1276  -0.1531 193 ALA B CA  
3282 C C   . ALA B 170 ? 1.2803 1.4088 1.3597 -0.1135 0.1255  -0.1563 193 ALA B C   
3283 O O   . ALA B 170 ? 1.3272 1.4751 1.4065 -0.1197 0.1269  -0.1630 193 ALA B O   
3284 C CB  . ALA B 170 ? 1.2905 1.4018 1.3705 -0.1025 0.1203  -0.1451 193 ALA B CB  
3285 N N   . ARG B 171 ? 1.3186 1.4430 1.3980 -0.1084 0.1221  -0.1512 194 ARG B N   
3286 C CA  . ARG B 171 ? 1.2950 1.4370 1.3742 -0.1094 0.1197  -0.1530 194 ARG B CA  
3287 C C   . ARG B 171 ? 1.1039 1.2716 1.1833 -0.1080 0.1153  -0.1531 194 ARG B C   
3288 O O   . ARG B 171 ? 1.0577 1.2453 1.1370 -0.1144 0.1171  -0.1599 194 ARG B O   
3289 C CB  . ARG B 171 ? 1.4183 1.5615 1.4971 -0.1195 0.1270  -0.1625 194 ARG B CB  
3290 C CG  . ARG B 171 ? 1.4161 1.5344 1.4946 -0.1203 0.1323  -0.1620 194 ARG B CG  
3291 C CD  . ARG B 171 ? 1.4096 1.5305 1.4875 -0.1260 0.1362  -0.1675 194 ARG B CD  
3292 N NE  . ARG B 171 ? 1.4745 1.5801 1.5524 -0.1200 0.1343  -0.1611 194 ARG B NE  
3293 C CZ  . ARG B 171 ? 1.5122 1.6168 1.5897 -0.1230 0.1370  -0.1639 194 ARG B CZ  
3294 N NH1 . ARG B 171 ? 1.5029 1.6204 1.5800 -0.1325 0.1420  -0.1735 194 ARG B NH1 
3295 N NH2 . ARG B 171 ? 1.4761 1.5672 1.5536 -0.1169 0.1348  -0.1575 194 ARG B NH2 
3296 N N   . ILE B 172 ? 1.0914 1.2588 1.1709 -0.0997 0.1099  -0.1453 195 ILE B N   
3297 C CA  . ILE B 172 ? 1.1294 1.3197 1.2089 -0.0966 0.1057  -0.1436 195 ILE B CA  
3298 C C   . ILE B 172 ? 1.1862 1.3920 1.2653 -0.0921 0.1018  -0.1403 195 ILE B C   
3299 O O   . ILE B 172 ? 1.1529 1.3474 1.2318 -0.0860 0.0991  -0.1341 195 ILE B O   
3300 C CB  . ILE B 172 ? 1.3079 1.4910 1.3875 -0.0882 0.1015  -0.1355 195 ILE B CB  
3301 C CG1 . ILE B 172 ? 1.4965 1.6642 1.5764 -0.0917 0.1051  -0.1380 195 ILE B CG1 
3302 C CG2 . ILE B 172 ? 1.2852 1.4915 1.3644 -0.0841 0.0979  -0.1331 195 ILE B CG2 
3303 C CD1 . ILE B 172 ? 1.6223 1.8022 1.7024 -0.1009 0.1098  -0.1471 195 ILE B CD1 
3304 N N   . PRO B 173 ? 1.3678 1.6005 1.4468 -0.0950 0.1016  -0.1444 196 PRO B N   
3305 C CA  . PRO B 173 ? 1.3290 1.5797 1.4074 -0.0891 0.0975  -0.1399 196 PRO B CA  
3306 C C   . PRO B 173 ? 1.2313 1.4750 1.3092 -0.0773 0.0926  -0.1288 196 PRO B C   
3307 O O   . PRO B 173 ? 1.2074 1.4496 1.2853 -0.0737 0.0913  -0.1254 196 PRO B O   
3308 C CB  . PRO B 173 ? 1.3955 1.6767 1.4738 -0.0927 0.0979  -0.1448 196 PRO B CB  
3309 C CG  . PRO B 173 ? 1.4773 1.7569 1.5561 -0.1049 0.1038  -0.1559 196 PRO B CG  
3310 C CD  . PRO B 173 ? 1.5001 1.7482 1.5792 -0.1052 0.1060  -0.1545 196 PRO B CD  
3311 N N   . VAL B 174 ? 1.2557 1.4950 1.3331 -0.0716 0.0902  -0.1234 197 VAL B N   
3312 C CA  . VAL B 174 ? 1.3043 1.5362 1.3810 -0.0605 0.0864  -0.1129 197 VAL B CA  
3313 C C   . VAL B 174 ? 1.2855 1.5368 1.3615 -0.0541 0.0843  -0.1082 197 VAL B C   
3314 O O   . VAL B 174 ? 1.2459 1.4879 1.3213 -0.0468 0.0826  -0.1011 197 VAL B O   
3315 C CB  . VAL B 174 ? 1.2651 1.4945 1.3413 -0.0563 0.0849  -0.1089 197 VAL B CB  
3316 C CG1 . VAL B 174 ? 1.2871 1.5442 1.3626 -0.0545 0.0839  -0.1088 197 VAL B CG1 
3317 C CG2 . VAL B 174 ? 1.2368 1.4491 1.3123 -0.0470 0.0824  -0.0996 197 VAL B CG2 
3318 N N   . GLU B 175 ? 1.2639 1.5424 1.3397 -0.0569 0.0848  -0.1123 198 GLU B N   
3319 C CA  . GLU B 175 ? 1.3177 1.6168 1.3928 -0.0512 0.0833  -0.1082 198 GLU B CA  
3320 C C   . GLU B 175 ? 1.3230 1.6140 1.3986 -0.0518 0.0837  -0.1083 198 GLU B C   
3321 O O   . GLU B 175 ? 1.2318 1.5266 1.3065 -0.0438 0.0821  -0.1014 198 GLU B O   
3322 C CB  . GLU B 175 ? 1.2767 1.6086 1.3519 -0.0561 0.0843  -0.1143 198 GLU B CB  
3323 C CG  . GLU B 175 ? 1.2793 1.6256 1.3541 -0.0554 0.0838  -0.1144 198 GLU B CG  
3324 C CD  . GLU B 175 ? 1.3125 1.6538 1.3882 -0.0665 0.0865  -0.1241 198 GLU B CD  
3325 O OE1 . GLU B 175 ? 1.4031 1.7194 1.4795 -0.0717 0.0885  -0.1275 198 GLU B OE1 
3326 O OE2 . GLU B 175 ? 1.2528 1.6152 1.3284 -0.0698 0.0871  -0.1282 198 GLU B OE2 
3327 N N   . LEU B 176 ? 1.3507 1.6302 1.4274 -0.0610 0.0863  -0.1160 199 LEU B N   
3328 C CA  . LEU B 176 ? 1.3355 1.6086 1.4126 -0.0628 0.0871  -0.1173 199 LEU B CA  
3329 C C   . LEU B 176 ? 1.3490 1.5930 1.4262 -0.0586 0.0864  -0.1119 199 LEU B C   
3330 O O   . LEU B 176 ? 1.1963 1.4348 1.2738 -0.0584 0.0865  -0.1114 199 LEU B O   
3331 C CB  . LEU B 176 ? 1.2748 1.5511 1.3528 -0.0749 0.0913  -0.1285 199 LEU B CB  
3332 C CG  . LEU B 176 ? 1.1983 1.5067 1.2763 -0.0804 0.0925  -0.1350 199 LEU B CG  
3333 C CD1 . LEU B 176 ? 1.1665 1.4730 1.2452 -0.0936 0.0978  -0.1470 199 LEU B CD1 
3334 C CD2 . LEU B 176 ? 1.0922 1.4168 1.1700 -0.0766 0.0910  -0.1325 199 LEU B CD2 
3335 N N   . LEU B 177 ? 1.3447 1.5713 1.4218 -0.0556 0.0855  -0.1082 200 LEU B N   
3336 C CA  . LEU B 177 ? 1.2537 1.4560 1.3307 -0.0505 0.0843  -0.1022 200 LEU B CA  
3337 C C   . LEU B 177 ? 1.2028 1.4098 1.2787 -0.0407 0.0819  -0.0937 200 LEU B C   
3338 O O   . LEU B 177 ? 1.2488 1.4776 1.3239 -0.0374 0.0812  -0.0920 200 LEU B O   
3339 C CB  . LEU B 177 ? 1.2214 1.4080 1.2984 -0.0497 0.0841  -0.1006 200 LEU B CB  
3340 C CG  . LEU B 177 ? 1.2702 1.4465 1.3481 -0.0584 0.0873  -0.1079 200 LEU B CG  
3341 C CD1 . LEU B 177 ? 1.2471 1.4115 1.3249 -0.0573 0.0870  -0.1061 200 LEU B CD1 
3342 C CD2 . LEU B 177 ? 1.3073 1.4663 1.3859 -0.0615 0.0893  -0.1096 200 LEU B CD2 
3343 N N   . PRO B 178 ? 1.1108 1.2984 1.1865 -0.0362 0.0811  -0.0886 201 PRO B N   
3344 C CA  . PRO B 178 ? 1.1022 1.2918 1.1766 -0.0275 0.0798  -0.0808 201 PRO B CA  
3345 C C   . PRO B 178 ? 1.0928 1.2920 1.1657 -0.0200 0.0792  -0.0748 201 PRO B C   
3346 O O   . PRO B 178 ? 1.0859 1.2754 1.1585 -0.0189 0.0789  -0.0732 201 PRO B O   
3347 C CB  . PRO B 178 ? 1.1326 1.2970 1.2071 -0.0256 0.0796  -0.0776 201 PRO B CB  
3348 C CG  . PRO B 178 ? 1.1397 1.2933 1.2158 -0.0338 0.0808  -0.0842 201 PRO B CG  
3349 C CD  . PRO B 178 ? 1.1010 1.2648 1.1775 -0.0394 0.0818  -0.0900 201 PRO B CD  
3350 N N   . ARG B 179 ? 1.0637 1.2816 1.1354 -0.0144 0.0792  -0.0709 202 ARG B N   
3351 C CA  . ARG B 179 ? 1.0325 1.2617 1.1026 -0.0063 0.0793  -0.0644 202 ARG B CA  
3352 C C   . ARG B 179 ? 0.9946 1.2208 1.0628 0.0034  0.0802  -0.0557 202 ARG B C   
3353 O O   . ARG B 179 ? 0.9817 1.2058 1.0500 0.0038  0.0805  -0.0552 202 ARG B O   
3354 C CB  . ARG B 179 ? 1.1022 1.3611 1.1722 -0.0074 0.0792  -0.0671 202 ARG B CB  
3355 C CG  . ARG B 179 ? 1.1806 1.4459 1.2524 -0.0184 0.0792  -0.0772 202 ARG B CG  
3356 C CD  . ARG B 179 ? 1.1692 1.4214 1.2413 -0.0215 0.0791  -0.0792 202 ARG B CD  
3357 N NE  . ARG B 179 ? 1.1731 1.4342 1.2439 -0.0143 0.0788  -0.0733 202 ARG B NE  
3358 C CZ  . ARG B 179 ? 1.1296 1.3934 1.2005 -0.0168 0.0786  -0.0756 202 ARG B CZ  
3359 N NH1 . ARG B 179 ? 1.0748 1.3331 1.1472 -0.0265 0.0791  -0.0839 202 ARG B NH1 
3360 N NH2 . ARG B 179 ? 1.0665 1.3382 1.1359 -0.0091 0.0785  -0.0693 202 ARG B NH2 
3361 N N   . CYS B 180 ? 1.0411 1.2669 1.1074 0.0112  0.0813  -0.0489 203 CYS B N   
3362 C CA  . CYS B 180 ? 1.1500 1.3706 1.2141 0.0212  0.0836  -0.0399 203 CYS B CA  
3363 C C   . CYS B 180 ? 1.2284 1.4718 1.2916 0.0263  0.0844  -0.0367 203 CYS B C   
3364 O O   . CYS B 180 ? 1.3899 1.6579 1.4532 0.0260  0.0838  -0.0383 203 CYS B O   
3365 C CB  . CYS B 180 ? 1.1181 1.3363 1.1803 0.0280  0.0853  -0.0339 203 CYS B CB  
3366 S SG  . CYS B 180 ? 1.1889 1.3923 1.2481 0.0392  0.0897  -0.0234 203 CYS B SG  
3367 N N   . GLU B 181 ? 1.2688 1.5054 1.3309 0.0313  0.0861  -0.0321 204 GLU B N   
3368 C CA  . GLU B 181 ? 1.2724 1.5300 1.3339 0.0350  0.0866  -0.0301 204 GLU B CA  
3369 C C   . GLU B 181 ? 1.2617 1.5315 1.3203 0.0475  0.0900  -0.0199 204 GLU B C   
3370 O O   . GLU B 181 ? 1.2263 1.5141 1.2842 0.0523  0.0910  -0.0167 204 GLU B O   
3371 C CB  . GLU B 181 ? 1.2756 1.5213 1.3380 0.0320  0.0864  -0.0320 204 GLU B CB  
3372 C CG  . GLU B 181 ? 1.2996 1.5270 1.3644 0.0213  0.0840  -0.0402 204 GLU B CG  
3373 C CD  . GLU B 181 ? 1.2149 1.4464 1.2816 0.0142  0.0826  -0.0466 204 GLU B CD  
3374 O OE1 . GLU B 181 ? 1.1284 1.3777 1.1946 0.0169  0.0830  -0.0454 204 GLU B OE1 
3375 O OE2 . GLU B 181 ? 1.0633 1.2809 1.1318 0.0060  0.0813  -0.0530 204 GLU B OE2 
3376 N N   . ARG B 182 ? 1.2953 1.5563 1.3522 0.0530  0.0922  -0.0147 205 ARG B N   
3377 C CA  . ARG B 182 ? 1.3373 1.6094 1.3912 0.0654  0.0964  -0.0046 205 ARG B CA  
3378 C C   . ARG B 182 ? 1.5235 1.8257 1.5779 0.0654  0.0946  -0.0061 205 ARG B C   
3379 O O   . ARG B 182 ? 1.6530 1.9548 1.7084 0.0603  0.0926  -0.0104 205 ARG B O   
3380 C CB  . ARG B 182 ? 1.2534 1.5037 1.3052 0.0708  0.1000  0.0010  205 ARG B CB  
3381 C CG  . ARG B 182 ? 1.2183 1.4405 1.2694 0.0708  0.1024  0.0025  205 ARG B CG  
3382 C CD  . ARG B 182 ? 1.2497 1.4484 1.2994 0.0720  0.1051  0.0047  205 ARG B CD  
3383 N NE  . ARG B 182 ? 1.2958 1.4929 1.3419 0.0838  0.1117  0.0148  205 ARG B NE  
3384 C CZ  . ARG B 182 ? 1.1725 1.3518 1.2168 0.0863  0.1155  0.0178  205 ARG B CZ  
3385 N NH1 . ARG B 182 ? 1.1386 1.3022 1.1847 0.0781  0.1126  0.0116  205 ARG B NH1 
3386 N NH2 . ARG B 182 ? 1.1462 1.3237 1.1868 0.0974  0.1225  0.0272  205 ARG B NH2 
3387 N N   . LYS B 183 ? 1.6164 1.9453 1.6699 0.0710  0.0954  -0.0026 206 LYS B N   
3388 C CA  . LYS B 183 ? 1.5470 1.9097 1.6015 0.0688  0.0931  -0.0062 206 LYS B CA  
3389 C C   . LYS B 183 ? 1.4814 1.8493 1.5351 0.0717  0.0937  -0.0039 206 LYS B C   
3390 O O   . LYS B 183 ? 1.3052 1.6842 1.3607 0.0635  0.0906  -0.0115 206 LYS B O   
3391 C CB  . LYS B 183 ? 1.4408 1.8328 1.4939 0.0770  0.0948  -0.0005 206 LYS B CB  
3392 C CG  . LYS B 183 ? 1.3746 1.7688 1.4289 0.0725  0.0935  -0.0045 206 LYS B CG  
3393 C CD  . LYS B 183 ? 1.3096 1.7395 1.3631 0.0786  0.0942  -0.0009 206 LYS B CD  
3394 C CE  . LYS B 183 ? 1.2521 1.6852 1.3069 0.0736  0.0928  -0.0054 206 LYS B CE  
3395 N NZ  . LYS B 183 ? 1.1393 1.6120 1.1944 0.0743  0.0919  -0.0067 206 LYS B NZ  
3396 N N   . SER B 184 ? 1.4533 1.8111 1.5040 0.0830  0.0981  0.0062  207 SER B N   
3397 C CA  . SER B 184 ? 1.3949 1.7536 1.4444 0.0869  0.0994  0.0096  207 SER B CA  
3398 C C   . SER B 184 ? 1.4859 1.8260 1.5377 0.0760  0.0961  0.0011  207 SER B C   
3399 O O   . SER B 184 ? 1.4646 1.8118 1.5164 0.0756  0.0954  0.0004  207 SER B O   
3400 C CB  . SER B 184 ? 1.3100 1.6527 1.3559 0.0999  0.1058  0.0215  207 SER B CB  
3401 O OG  . SER B 184 ? 1.0852 1.3983 1.1307 0.0989  0.1077  0.0221  207 SER B OG  
3402 N N   . CYS B 185 ? 1.6245 1.9413 1.6781 0.0674  0.0942  -0.0050 208 CYS B N   
3403 C CA  . CYS B 185 ? 1.5723 1.8675 1.6276 0.0585  0.0919  -0.0116 208 CYS B CA  
3404 C C   . CYS B 185 ? 1.4488 1.7513 1.5072 0.0456  0.0874  -0.0231 208 CYS B C   
3405 O O   . CYS B 185 ? 1.3800 1.6893 1.4393 0.0414  0.0859  -0.0271 208 CYS B O   
3406 C CB  . CYS B 185 ? 1.5623 1.8254 1.6174 0.0575  0.0931  -0.0109 208 CYS B CB  
3407 S SG  . CYS B 185 ? 1.7911 2.0304 1.8479 0.0483  0.0908  -0.0175 208 CYS B SG  
3408 N N   . ASN B 186 ? 1.3422 1.6411 1.4023 0.0391  0.0859  -0.0285 209 ASN B N   
3409 C CA  . ASN B 186 ? 1.3503 1.6501 1.4132 0.0265  0.0829  -0.0396 209 ASN B CA  
3410 C C   . ASN B 186 ? 1.3602 1.6389 1.4243 0.0197  0.0817  -0.0444 209 ASN B C   
3411 O O   . ASN B 186 ? 1.3077 1.5907 1.3738 0.0101  0.0802  -0.0529 209 ASN B O   
3412 C CB  . ASN B 186 ? 1.2924 1.6253 1.3560 0.0233  0.0819  -0.0441 209 ASN B CB  
3413 C CG  . ASN B 186 ? 1.2601 1.5964 1.3261 0.0109  0.0803  -0.0551 209 ASN B CG  
3414 O OD1 . ASN B 186 ? 1.2033 1.5339 1.2699 0.0086  0.0802  -0.0568 209 ASN B OD1 
3415 N ND2 . ASN B 186 ? 1.2721 1.6163 1.3394 0.0027  0.0794  -0.0627 209 ASN B ND2 
3416 N N   . GLY B 187 ? 1.3221 1.5775 1.3851 0.0240  0.0829  -0.0393 210 GLY B N   
3417 C CA  . GLY B 187 ? 1.2645 1.4996 1.3286 0.0181  0.0819  -0.0433 210 GLY B CA  
3418 C C   . GLY B 187 ? 1.3371 1.5607 1.4036 0.0080  0.0802  -0.0514 210 GLY B C   
3419 O O   . GLY B 187 ? 1.5728 1.7978 1.6398 0.0064  0.0802  -0.0530 210 GLY B O   
3420 N N   . LEU B 188 ? 1.3125 1.5249 1.3802 0.0015  0.0793  -0.0565 211 LEU B N   
3421 C CA  . LEU B 188 ? 1.1550 1.3527 1.2247 -0.0070 0.0786  -0.0632 211 LEU B CA  
3422 C C   . LEU B 188 ? 1.1347 1.3079 1.2040 -0.0044 0.0789  -0.0594 211 LEU B C   
3423 O O   . LEU B 188 ? 1.0288 1.1915 1.0968 0.0007  0.0795  -0.0542 211 LEU B O   
3424 C CB  . LEU B 188 ? 0.9996 1.1937 1.0705 -0.0142 0.0782  -0.0693 211 LEU B CB  
3425 C CG  . LEU B 188 ? 0.9541 1.1292 1.0266 -0.0213 0.0783  -0.0744 211 LEU B CG  
3426 C CD1 . LEU B 188 ? 0.9213 1.1040 0.9950 -0.0275 0.0791  -0.0804 211 LEU B CD1 
3427 C CD2 . LEU B 188 ? 1.0091 1.1774 1.0824 -0.0263 0.0785  -0.0784 211 LEU B CD2 
3428 N N   . LEU B 189 ? 1.0943 1.2591 1.1647 -0.0083 0.0787  -0.0623 212 LEU B N   
3429 C CA  . LEU B 189 ? 1.0234 1.1670 1.0937 -0.0068 0.0789  -0.0597 212 LEU B CA  
3430 C C   . LEU B 189 ? 0.9015 1.0292 0.9733 -0.0131 0.0784  -0.0642 212 LEU B C   
3431 O O   . LEU B 189 ? 0.7685 0.8998 0.8417 -0.0198 0.0783  -0.0702 212 LEU B O   
3432 C CB  . LEU B 189 ? 1.1687 1.3126 1.2391 -0.0063 0.0792  -0.0593 212 LEU B CB  
3433 C CG  . LEU B 189 ? 1.2301 1.3901 1.2990 0.0002  0.0801  -0.0545 212 LEU B CG  
3434 C CD1 . LEU B 189 ? 1.1396 1.2962 1.2088 0.0001  0.0803  -0.0545 212 LEU B CD1 
3435 C CD2 . LEU B 189 ? 1.2435 1.4007 1.3100 0.0091  0.0818  -0.0466 212 LEU B CD2 
3436 N N   . ARG B 190 ? 0.8927 1.0029 0.9639 -0.0108 0.0785  -0.0609 213 ARG B N   
3437 C CA  . ARG B 190 ? 0.8646 0.9587 0.9372 -0.0154 0.0781  -0.0637 213 ARG B CA  
3438 C C   . ARG B 190 ? 0.8298 0.9110 0.9022 -0.0137 0.0784  -0.0613 213 ARG B C   
3439 O O   . ARG B 190 ? 0.7895 0.8715 0.8604 -0.0085 0.0792  -0.0568 213 ARG B O   
3440 C CB  . ARG B 190 ? 0.8594 0.9457 0.9315 -0.0144 0.0780  -0.0623 213 ARG B CB  
3441 C CG  . ARG B 190 ? 0.8076 0.8874 0.8778 -0.0079 0.0789  -0.0562 213 ARG B CG  
3442 C CD  . ARG B 190 ? 0.8233 0.8924 0.8934 -0.0084 0.0788  -0.0557 213 ARG B CD  
3443 N NE  . ARG B 190 ? 0.8835 0.9374 0.9544 -0.0110 0.0785  -0.0568 213 ARG B NE  
3444 C CZ  . ARG B 190 ? 0.8586 0.9026 0.9296 -0.0119 0.0784  -0.0567 213 ARG B CZ  
3445 N NH1 . ARG B 190 ? 0.8316 0.8778 0.9020 -0.0108 0.0785  -0.0559 213 ARG B NH1 
3446 N NH2 . ARG B 190 ? 0.8417 0.8744 0.9134 -0.0140 0.0782  -0.0574 213 ARG B NH2 
3447 N N   . PRO B 191 ? 0.7506 0.8199 0.8242 -0.0179 0.0781  -0.0640 214 PRO B N   
3448 C CA  . PRO B 191 ? 0.7242 0.7821 0.7977 -0.0166 0.0783  -0.0620 214 PRO B CA  
3449 C C   . PRO B 191 ? 0.7596 0.8094 0.8317 -0.0126 0.0788  -0.0578 214 PRO B C   
3450 O O   . PRO B 191 ? 0.7663 0.8141 0.8382 -0.0128 0.0787  -0.0578 214 PRO B O   
3451 C CB  . PRO B 191 ? 0.7014 0.7500 0.7766 -0.0216 0.0781  -0.0655 214 PRO B CB  
3452 C CG  . PRO B 191 ? 0.7070 0.7624 0.7831 -0.0258 0.0785  -0.0699 214 PRO B CG  
3453 C CD  . PRO B 191 ? 0.7396 0.8057 0.8147 -0.0234 0.0782  -0.0687 214 PRO B CD  
3454 N N   . HIS B 192 ? 0.8081 0.8526 0.8792 -0.0094 0.0799  -0.0547 215 HIS B N   
3455 C CA  . HIS B 192 ? 0.7292 0.7645 0.7987 -0.0063 0.0815  -0.0512 215 HIS B CA  
3456 C C   . HIS B 192 ? 0.7339 0.7572 0.8043 -0.0097 0.0809  -0.0530 215 HIS B C   
3457 O O   . HIS B 192 ? 0.6751 0.6915 0.7451 -0.0093 0.0819  -0.0521 215 HIS B O   
3458 C CB  . HIS B 192 ? 0.6797 0.7154 0.7474 -0.0015 0.0838  -0.0473 215 HIS B CB  
3459 C CG  . HIS B 192 ? 0.6561 0.6834 0.7216 0.0020  0.0869  -0.0437 215 HIS B CG  
3460 N ND1 . HIS B 192 ? 0.6811 0.7082 0.7456 0.0036  0.0877  -0.0423 215 HIS B ND1 
3461 C CD2 . HIS B 192 ? 0.6593 0.6781 0.7232 0.0042  0.0900  -0.0412 215 HIS B CD2 
3462 C CE1 . HIS B 192 ? 0.6979 0.7162 0.7603 0.0067  0.0915  -0.0392 215 HIS B CE1 
3463 N NE2 . HIS B 192 ? 0.6506 0.6636 0.7125 0.0069  0.0931  -0.0387 215 HIS B NE2 
3464 N N   . VAL B 193 ? 0.7221 0.7442 0.7938 -0.0129 0.0795  -0.0556 216 VAL B N   
3465 C CA  . VAL B 193 ? 0.7448 0.7575 0.8173 -0.0155 0.0791  -0.0567 216 VAL B CA  
3466 C C   . VAL B 193 ? 0.7617 0.7720 0.8336 -0.0150 0.0793  -0.0561 216 VAL B C   
3467 O O   . VAL B 193 ? 0.8340 0.8504 0.9055 -0.0138 0.0792  -0.0557 216 VAL B O   
3468 C CB  . VAL B 193 ? 0.7381 0.7506 0.8126 -0.0194 0.0780  -0.0599 216 VAL B CB  
3469 C CG1 . VAL B 193 ? 0.7708 0.7872 0.8459 -0.0201 0.0780  -0.0610 216 VAL B CG1 
3470 C CG2 . VAL B 193 ? 0.7390 0.7555 0.8142 -0.0212 0.0776  -0.0620 216 VAL B CG2 
3471 N N   . VAL B 194 ? 0.7170 0.7195 0.7890 -0.0162 0.0795  -0.0561 217 VAL B N   
3472 C CA  . VAL B 194 ? 0.6592 0.6590 0.7310 -0.0168 0.0793  -0.0562 217 VAL B CA  
3473 C C   . VAL B 194 ? 0.6788 0.6793 0.7524 -0.0197 0.0778  -0.0586 217 VAL B C   
3474 O O   . VAL B 194 ? 0.6685 0.6664 0.7433 -0.0215 0.0773  -0.0596 217 VAL B O   
3475 C CB  . VAL B 194 ? 0.6050 0.5976 0.6760 -0.0171 0.0806  -0.0556 217 VAL B CB  
3476 C CG1 . VAL B 194 ? 0.6119 0.6025 0.6825 -0.0176 0.0807  -0.0557 217 VAL B CG1 
3477 C CG2 . VAL B 194 ? 0.5924 0.5825 0.6613 -0.0145 0.0834  -0.0535 217 VAL B CG2 
3478 N N   . TRP B 195 ? 0.7096 0.7140 0.7834 -0.0199 0.0774  -0.0592 218 TRP B N   
3479 C CA  . TRP B 195 ? 0.7386 0.7433 0.8138 -0.0225 0.0768  -0.0615 218 TRP B CA  
3480 C C   . TRP B 195 ? 0.7355 0.7351 0.8108 -0.0230 0.0766  -0.0611 218 TRP B C   
3481 O O   . TRP B 195 ? 0.7744 0.7711 0.8486 -0.0217 0.0769  -0.0595 218 TRP B O   
3482 C CB  . TRP B 195 ? 0.7808 0.7929 0.8560 -0.0230 0.0768  -0.0630 218 TRP B CB  
3483 C CG  . TRP B 195 ? 0.8487 0.8667 0.9244 -0.0243 0.0772  -0.0648 218 TRP B CG  
3484 C CD1 . TRP B 195 ? 0.8744 0.8899 0.9510 -0.0260 0.0776  -0.0660 218 TRP B CD1 
3485 C CD2 . TRP B 195 ? 0.9373 0.9657 1.0127 -0.0243 0.0773  -0.0659 218 TRP B CD2 
3486 N NE1 . TRP B 195 ? 0.9290 0.9520 1.0059 -0.0272 0.0781  -0.0680 218 TRP B NE1 
3487 C CE2 . TRP B 195 ? 0.9542 0.9860 1.0303 -0.0263 0.0779  -0.0681 218 TRP B CE2 
3488 C CE3 . TRP B 195 ? 0.9820 1.0184 1.0565 -0.0226 0.0771  -0.0652 218 TRP B CE3 
3489 C CZ2 . TRP B 195 ? 0.9354 0.9789 1.0115 -0.0271 0.0782  -0.0700 218 TRP B CZ2 
3490 C CZ3 . TRP B 195 ? 0.9763 1.0250 1.0507 -0.0229 0.0773  -0.0667 218 TRP B CZ3 
3491 C CH2 . TRP B 195 ? 0.9645 1.0169 1.0397 -0.0254 0.0778  -0.0692 218 TRP B CH2 
3492 N N   . PHE B 196 ? 0.7571 0.7557 0.8335 -0.0248 0.0766  -0.0625 219 PHE B N   
3493 C CA  . PHE B 196 ? 0.7322 0.7276 0.8087 -0.0250 0.0764  -0.0620 219 PHE B CA  
3494 C C   . PHE B 196 ? 0.7558 0.7532 0.8314 -0.0241 0.0761  -0.0616 219 PHE B C   
3495 O O   . PHE B 196 ? 0.7152 0.7174 0.7905 -0.0241 0.0762  -0.0624 219 PHE B O   
3496 C CB  . PHE B 196 ? 0.6978 0.6916 0.7755 -0.0265 0.0773  -0.0631 219 PHE B CB  
3497 C CG  . PHE B 196 ? 0.6999 0.6912 0.7784 -0.0265 0.0779  -0.0625 219 PHE B CG  
3498 C CD1 . PHE B 196 ? 0.7162 0.7059 0.7946 -0.0257 0.0773  -0.0609 219 PHE B CD1 
3499 C CD2 . PHE B 196 ? 0.7650 0.7563 0.8442 -0.0276 0.0794  -0.0638 219 PHE B CD2 
3500 C CE1 . PHE B 196 ? 0.6937 0.6826 0.7729 -0.0254 0.0779  -0.0601 219 PHE B CE1 
3501 C CE2 . PHE B 196 ? 0.7887 0.7775 0.8684 -0.0272 0.0803  -0.0629 219 PHE B CE2 
3502 C CZ  . PHE B 196 ? 0.7426 0.7306 0.8224 -0.0258 0.0794  -0.0608 219 PHE B CZ  
3503 N N   . GLY B 197 ? 0.8016 0.7958 0.8766 -0.0235 0.0760  -0.0605 220 GLY B N   
3504 C CA  . GLY B 197 ? 0.8610 0.8558 0.9348 -0.0223 0.0761  -0.0596 220 GLY B CA  
3505 C C   . GLY B 197 ? 0.8184 0.8140 0.8905 -0.0199 0.0772  -0.0580 220 GLY B C   
3506 O O   . GLY B 197 ? 0.8123 0.8091 0.8833 -0.0183 0.0778  -0.0569 220 GLY B O   
3507 N N   . GLU B 198 ? 0.7654 0.7603 0.8372 -0.0193 0.0778  -0.0574 221 GLU B N   
3508 C CA  . GLU B 198 ? 0.7801 0.7752 0.8500 -0.0164 0.0797  -0.0553 221 GLU B CA  
3509 C C   . GLU B 198 ? 0.7553 0.7435 0.8239 -0.0164 0.0818  -0.0546 221 GLU B C   
3510 O O   . GLU B 198 ? 0.6558 0.6413 0.7252 -0.0188 0.0813  -0.0560 221 GLU B O   
3511 C CB  . GLU B 198 ? 0.7888 0.7893 0.8588 -0.0150 0.0796  -0.0549 221 GLU B CB  
3512 C CG  . GLU B 198 ? 0.8287 0.8368 0.8999 -0.0161 0.0781  -0.0566 221 GLU B CG  
3513 C CD  . GLU B 198 ? 0.8464 0.8621 0.9172 -0.0141 0.0785  -0.0558 221 GLU B CD  
3514 O OE1 . GLU B 198 ? 0.9206 0.9348 0.9912 -0.0136 0.0789  -0.0553 221 GLU B OE1 
3515 O OE2 . GLU B 198 ? 0.8945 0.9187 0.9651 -0.0132 0.0783  -0.0559 221 GLU B OE2 
3516 N N   . THR B 199 ? 0.8002 0.7861 0.8667 -0.0139 0.0846  -0.0526 222 THR B N   
3517 C CA  . THR B 199 ? 0.8442 0.8230 0.9092 -0.0143 0.0878  -0.0524 222 THR B CA  
3518 C C   . THR B 199 ? 0.8062 0.7840 0.8704 -0.0130 0.0894  -0.0514 222 THR B C   
3519 O O   . THR B 199 ? 0.7854 0.7683 0.8496 -0.0102 0.0890  -0.0497 222 THR B O   
3520 C CB  . THR B 199 ? 0.9419 0.9168 1.0044 -0.0118 0.0916  -0.0503 222 THR B CB  
3521 O OG1 . THR B 199 ? 0.9313 0.9117 0.9930 -0.0073 0.0919  -0.0473 222 THR B OG1 
3522 C CG2 . THR B 199 ? 0.9245 0.8979 0.9873 -0.0139 0.0908  -0.0517 222 THR B CG2 
3523 N N   . LEU B 200 ? 0.7784 0.7505 0.8420 -0.0151 0.0916  -0.0525 223 LEU B N   
3524 C CA  . LEU B 200 ? 0.7955 0.7650 0.8580 -0.0140 0.0941  -0.0516 223 LEU B CA  
3525 C C   . LEU B 200 ? 0.7992 0.7653 0.8588 -0.0094 0.0991  -0.0482 223 LEU B C   
3526 O O   . LEU B 200 ? 0.7619 0.7258 0.8202 -0.0080 0.1012  -0.0470 223 LEU B O   
3527 C CB  . LEU B 200 ? 0.8120 0.7767 0.8745 -0.0181 0.0955  -0.0543 223 LEU B CB  
3528 C CG  . LEU B 200 ? 0.8192 0.7881 0.8842 -0.0212 0.0915  -0.0566 223 LEU B CG  
3529 C CD1 . LEU B 200 ? 0.8133 0.7878 0.8805 -0.0215 0.0871  -0.0569 223 LEU B CD1 
3530 C CD2 . LEU B 200 ? 0.8767 0.8432 0.9417 -0.0255 0.0927  -0.0594 223 LEU B CD2 
3531 N N   . ASP B 201 ? 0.8169 0.7830 0.8757 -0.0068 0.1010  -0.0463 224 ASP B N   
3532 C CA  . ASP B 201 ? 0.8457 0.8090 0.9016 -0.0014 0.1064  -0.0421 224 ASP B CA  
3533 C C   . ASP B 201 ? 0.8359 0.7876 0.8893 -0.0029 0.1128  -0.0427 224 ASP B C   
3534 O O   . ASP B 201 ? 0.8552 0.8028 0.9090 -0.0071 0.1133  -0.0458 224 ASP B O   
3535 C CB  . ASP B 201 ? 0.8880 0.8554 0.9440 0.0011  0.1061  -0.0403 224 ASP B CB  
3536 C CG  . ASP B 201 ? 0.9818 0.9498 1.0351 0.0082  0.1111  -0.0350 224 ASP B CG  
3537 O OD1 . ASP B 201 ? 1.0467 1.0226 1.0997 0.0122  0.1102  -0.0322 224 ASP B OD1 
3538 O OD2 . ASP B 201 ? 0.9921 0.9537 1.0433 0.0101  0.1162  -0.0332 224 ASP B OD2 
3539 N N   . SER B 202 ? 0.8841 0.8307 0.9349 0.0001  0.1180  -0.0402 225 SER B N   
3540 C CA  . SER B 202 ? 0.8668 0.8014 0.9150 -0.0024 0.1248  -0.0418 225 SER B CA  
3541 C C   . SER B 202 ? 0.8195 0.7466 0.8653 -0.0007 0.1313  -0.0403 225 SER B C   
3542 O O   . SER B 202 ? 0.8298 0.7489 0.8746 -0.0055 0.1354  -0.0438 225 SER B O   
3543 C CB  . SER B 202 ? 0.8665 0.7970 0.9127 0.0000  0.1289  -0.0398 225 SER B CB  
3544 O OG  . SER B 202 ? 0.9723 0.9059 1.0168 0.0078  0.1312  -0.0339 225 SER B OG  
3545 N N   . ASP B 203 ? 0.8081 0.7389 0.8531 0.0056  0.1323  -0.0355 226 ASP B N   
3546 C CA  . ASP B 203 ? 0.9045 0.8295 0.9475 0.0077  0.1377  -0.0337 226 ASP B CA  
3547 C C   . ASP B 203 ? 0.9335 0.8574 0.9784 0.0010  0.1351  -0.0389 226 ASP B C   
3548 O O   . ASP B 203 ? 0.9629 0.8771 1.0060 -0.0020 0.1410  -0.0410 226 ASP B O   
3549 C CB  . ASP B 203 ? 0.9636 0.8976 1.0066 0.0149  0.1363  -0.0284 226 ASP B CB  
3550 C CG  . ASP B 203 ? 0.9348 0.8736 0.9762 0.0223  0.1383  -0.0228 226 ASP B CG  
3551 O OD1 . ASP B 203 ? 0.8375 0.7667 0.8758 0.0248  0.1459  -0.0205 226 ASP B OD1 
3552 O OD2 . ASP B 203 ? 0.8848 0.8372 0.9280 0.0253  0.1326  -0.0209 226 ASP B OD2 
3553 N N   . ILE B 204 ? 0.8933 0.8271 0.9417 -0.0012 0.1267  -0.0409 227 ILE B N   
3554 C CA  . ILE B 204 ? 0.8166 0.7513 0.8670 -0.0068 0.1235  -0.0452 227 ILE B CA  
3555 C C   . ILE B 204 ? 0.8339 0.7627 0.8842 -0.0136 0.1255  -0.0502 227 ILE B C   
3556 O O   . ILE B 204 ? 0.8615 0.7846 0.9107 -0.0172 0.1294  -0.0528 227 ILE B O   
3557 C CB  . ILE B 204 ? 0.7618 0.7075 0.8159 -0.0079 0.1148  -0.0463 227 ILE B CB  
3558 C CG1 . ILE B 204 ? 0.8011 0.7540 0.8554 -0.0022 0.1131  -0.0423 227 ILE B CG1 
3559 C CG2 . ILE B 204 ? 0.7510 0.6975 0.8069 -0.0126 0.1123  -0.0499 227 ILE B CG2 
3560 C CD1 . ILE B 204 ? 0.8234 0.7857 0.8809 -0.0039 0.1061  -0.0440 227 ILE B CD1 
3561 N N   . LEU B 205 ? 0.8311 0.7619 0.8821 -0.0155 0.1231  -0.0516 228 LEU B N   
3562 C CA  . LEU B 205 ? 0.8228 0.7503 0.8738 -0.0220 0.1247  -0.0565 228 LEU B CA  
3563 C C   . LEU B 205 ? 0.8625 0.7785 0.9100 -0.0240 0.1341  -0.0580 228 LEU B C   
3564 O O   . LEU B 205 ? 0.8465 0.7606 0.8940 -0.0305 0.1360  -0.0630 228 LEU B O   
3565 C CB  . LEU B 205 ? 0.7831 0.7140 0.8351 -0.0227 0.1217  -0.0570 228 LEU B CB  
3566 C CG  . LEU B 205 ? 0.7918 0.7330 0.8472 -0.0231 0.1131  -0.0574 228 LEU B CG  
3567 C CD1 . LEU B 205 ? 0.8324 0.7761 0.8884 -0.0227 0.1109  -0.0572 228 LEU B CD1 
3568 C CD2 . LEU B 205 ? 0.8076 0.7530 0.8651 -0.0285 0.1099  -0.0615 228 LEU B CD2 
3569 N N   . THR B 206 ? 0.8871 0.7959 0.9316 -0.0185 0.1404  -0.0536 229 THR B N   
3570 C CA  . THR B 206 ? 0.9930 0.8890 1.0338 -0.0200 0.1509  -0.0547 229 THR B CA  
3571 C C   . THR B 206 ? 0.9545 0.8466 0.9945 -0.0219 0.1543  -0.0561 229 THR B C   
3572 O O   . THR B 206 ? 1.1247 1.0086 1.1627 -0.0273 0.1612  -0.0604 229 THR B O   
3573 C CB  . THR B 206 ? 1.0484 0.9374 1.0859 -0.0127 0.1576  -0.0489 229 THR B CB  
3574 O OG1 . THR B 206 ? 1.1706 1.0680 1.2092 -0.0054 0.1527  -0.0433 229 THR B OG1 
3575 C CG2 . THR B 206 ? 1.0533 0.9405 1.0902 -0.0140 0.1586  -0.0499 229 THR B CG2 
3576 N N   . ALA B 207 ? 0.8411 0.7397 0.8828 -0.0182 0.1493  -0.0533 230 ALA B N   
3577 C CA  . ALA B 207 ? 0.8226 0.7191 0.8641 -0.0202 0.1510  -0.0549 230 ALA B CA  
3578 C C   . ALA B 207 ? 0.8087 0.7098 0.8525 -0.0287 0.1473  -0.0615 230 ALA B C   
3579 O O   . ALA B 207 ? 0.7724 0.6681 0.8149 -0.0338 0.1525  -0.0655 230 ALA B O   
3580 C CB  . ALA B 207 ? 0.8232 0.7271 0.8663 -0.0145 0.1458  -0.0506 230 ALA B CB  
3581 N N   . VAL B 208 ? 0.8196 0.7314 0.8668 -0.0299 0.1384  -0.0625 231 VAL B N   
3582 C CA  . VAL B 208 ? 0.8200 0.7390 0.8698 -0.0363 0.1338  -0.0675 231 VAL B CA  
3583 C C   . VAL B 208 ? 0.8560 0.7708 0.9041 -0.0433 0.1392  -0.0729 231 VAL B C   
3584 O O   . VAL B 208 ? 0.8310 0.7476 0.8794 -0.0494 0.1405  -0.0778 231 VAL B O   
3585 C CB  . VAL B 208 ? 0.7787 0.7087 0.8319 -0.0354 0.1245  -0.0668 231 VAL B CB  
3586 C CG1 . VAL B 208 ? 0.7535 0.6915 0.8090 -0.0413 0.1204  -0.0713 231 VAL B CG1 
3587 C CG2 . VAL B 208 ? 0.7766 0.7111 0.8313 -0.0298 0.1198  -0.0625 231 VAL B CG2 
3588 N N   . GLU B 209 ? 0.8435 0.7532 0.8899 -0.0425 0.1428  -0.0723 232 GLU B N   
3589 C CA  . GLU B 209 ? 0.8959 0.8004 0.9403 -0.0490 0.1493  -0.0776 232 GLU B CA  
3590 C C   . GLU B 209 ? 0.8558 0.7502 0.8972 -0.0521 0.1586  -0.0801 232 GLU B C   
3591 O O   . GLU B 209 ? 0.7793 0.6757 0.8207 -0.0599 0.1608  -0.0863 232 GLU B O   
3592 C CB  . GLU B 209 ? 0.9934 0.8920 1.0360 -0.0465 0.1527  -0.0756 232 GLU B CB  
3593 C CG  . GLU B 209 ? 1.0481 0.9427 1.0889 -0.0541 0.1588  -0.0816 232 GLU B CG  
3594 C CD  . GLU B 209 ? 0.9875 0.8746 1.0261 -0.0513 0.1634  -0.0794 232 GLU B CD  
3595 O OE1 . GLU B 209 ? 0.9903 0.8790 1.0295 -0.0441 0.1595  -0.0737 232 GLU B OE1 
3596 O OE2 . GLU B 209 ? 0.9567 0.8367 0.9928 -0.0567 0.1710  -0.0838 232 GLU B OE2 
3597 N N   . ARG B 210 ? 0.8547 0.7392 0.8935 -0.0460 0.1643  -0.0752 233 ARG B N   
3598 C CA  . ARG B 210 ? 0.9096 0.7829 0.9452 -0.0481 0.1742  -0.0769 233 ARG B CA  
3599 C C   . ARG B 210 ? 0.8877 0.7676 0.9252 -0.0535 0.1711  -0.0813 233 ARG B C   
3600 O O   . ARG B 210 ? 0.9170 0.7929 0.9529 -0.0609 0.1775  -0.0873 233 ARG B O   
3601 C CB  . ARG B 210 ? 0.9454 0.8100 0.9785 -0.0390 0.1791  -0.0696 233 ARG B CB  
3602 C CG  . ARG B 210 ? 1.0392 0.8921 1.0686 -0.0353 0.1881  -0.0667 233 ARG B CG  
3603 C CD  . ARG B 210 ? 1.0840 0.9320 1.1114 -0.0248 0.1916  -0.0583 233 ARG B CD  
3604 N NE  . ARG B 210 ? 1.1153 0.9534 1.1392 -0.0205 0.1998  -0.0548 233 ARG B NE  
3605 C CZ  . ARG B 210 ? 1.0962 0.9324 1.1184 -0.0103 0.2024  -0.0466 233 ARG B CZ  
3606 N NH1 . ARG B 210 ? 1.1078 0.9519 1.1314 -0.0036 0.1972  -0.0413 233 ARG B NH1 
3607 N NH2 . ARG B 210 ? 1.0902 0.9173 1.1091 -0.0069 0.2104  -0.0438 233 ARG B NH2 
3608 N N   . GLU B 211 ? 0.8114 0.7020 0.8523 -0.0502 0.1614  -0.0786 234 GLU B N   
3609 C CA  . GLU B 211 ? 0.7516 0.6490 0.7944 -0.0541 0.1578  -0.0817 234 GLU B CA  
3610 C C   . GLU B 211 ? 0.7984 0.7050 0.8428 -0.0628 0.1554  -0.0887 234 GLU B C   
3611 O O   . GLU B 211 ? 0.8200 0.7286 0.8643 -0.0687 0.1576  -0.0935 234 GLU B O   
3612 C CB  . GLU B 211 ? 0.6751 0.5815 0.7211 -0.0484 0.1485  -0.0772 234 GLU B CB  
3613 C CG  . GLU B 211 ? 0.6470 0.5470 0.6913 -0.0402 0.1508  -0.0706 234 GLU B CG  
3614 C CD  . GLU B 211 ? 0.6482 0.5447 0.6918 -0.0395 0.1538  -0.0701 234 GLU B CD  
3615 O OE1 . GLU B 211 ? 0.6571 0.5495 0.6994 -0.0456 0.1589  -0.0750 234 GLU B OE1 
3616 O OE2 . GLU B 211 ? 0.6601 0.5583 0.7041 -0.0329 0.1511  -0.0649 234 GLU B OE2 
3617 N N   . LEU B 212 ? 0.7860 0.6993 0.8320 -0.0636 0.1508  -0.0893 235 LEU B N   
3618 C CA  . LEU B 212 ? 0.8077 0.7317 0.8553 -0.0712 0.1483  -0.0954 235 LEU B CA  
3619 C C   . LEU B 212 ? 0.8293 0.7471 0.8739 -0.0790 0.1578  -0.1018 235 LEU B C   
3620 O O   . LEU B 212 ? 0.7977 0.7244 0.8431 -0.0868 0.1579  -0.1081 235 LEU B O   
3621 C CB  . LEU B 212 ? 0.7944 0.7280 0.8446 -0.0692 0.1405  -0.0936 235 LEU B CB  
3622 C CG  . LEU B 212 ? 0.7639 0.7049 0.8173 -0.0630 0.1315  -0.0885 235 LEU B CG  
3623 C CD1 . LEU B 212 ? 0.7547 0.7008 0.8098 -0.0600 0.1259  -0.0859 235 LEU B CD1 
3624 C CD2 . LEU B 212 ? 0.7886 0.7410 0.8444 -0.0661 0.1269  -0.0908 235 LEU B CD2 
3625 N N   . GLU B 213 ? 0.9141 0.8173 0.9553 -0.0769 0.1661  -0.1002 236 GLU B N   
3626 C CA  . GLU B 213 ? 0.9747 0.8685 1.0124 -0.0841 0.1774  -0.1062 236 GLU B CA  
3627 C C   . GLU B 213 ? 0.9781 0.8694 1.0146 -0.0892 0.1827  -0.1105 236 GLU B C   
3628 O O   . GLU B 213 ? 1.0205 0.9134 1.0558 -0.0987 0.1882  -0.1184 236 GLU B O   
3629 C CB  . GLU B 213 ? 1.0333 0.9095 1.0671 -0.0789 0.1865  -0.1020 236 GLU B CB  
3630 C CG  . GLU B 213 ? 1.1241 0.9976 1.1571 -0.0782 0.1878  -0.1014 236 GLU B CG  
3631 C CD  . GLU B 213 ? 1.1874 1.0452 1.2170 -0.0704 0.1954  -0.0952 236 GLU B CD  
3632 O OE1 . GLU B 213 ? 1.1081 0.9558 1.1353 -0.0664 0.2015  -0.0919 236 GLU B OE1 
3633 O OE2 . GLU B 213 ? 1.1654 1.0217 1.1945 -0.0681 0.1952  -0.0932 236 GLU B OE2 
3634 N N   . LYS B 214 ? 0.9671 0.8546 1.0037 -0.0832 0.1814  -0.1055 237 LYS B N   
3635 C CA  . LYS B 214 ? 0.9925 0.8755 1.0277 -0.0869 0.1873  -0.1086 237 LYS B CA  
3636 C C   . LYS B 214 ? 0.9166 0.8156 0.9551 -0.0920 0.1800  -0.1128 237 LYS B C   
3637 O O   . LYS B 214 ? 0.8964 0.7939 0.9338 -0.0969 0.1847  -0.1169 237 LYS B O   
3638 C CB  . LYS B 214 ? 1.0615 0.9337 1.0952 -0.0780 0.1898  -0.1014 237 LYS B CB  
3639 C CG  . LYS B 214 ? 1.2002 1.0570 1.2304 -0.0713 0.1976  -0.0960 237 LYS B CG  
3640 C CD  . LYS B 214 ? 1.3001 1.1520 1.3298 -0.0614 0.1971  -0.0879 237 LYS B CD  
3641 C CE  . LYS B 214 ? 1.3677 1.2082 1.3943 -0.0537 0.2034  -0.0816 237 LYS B CE  
3642 N NZ  . LYS B 214 ? 1.3276 1.1635 1.3531 -0.0438 0.2048  -0.0736 237 LYS B NZ  
3643 N N   . CYS B 215 ? 0.8842 0.7985 0.9265 -0.0906 0.1691  -0.1115 238 CYS B N   
3644 C CA  . CYS B 215 ? 0.8667 0.7946 0.9120 -0.0923 0.1622  -0.1128 238 CYS B CA  
3645 C C   . CYS B 215 ? 0.8076 0.7465 0.8531 -0.1026 0.1641  -0.1213 238 CYS B C   
3646 O O   . CYS B 215 ? 0.7319 0.6735 0.7768 -0.1071 0.1661  -0.1250 238 CYS B O   
3647 C CB  . CYS B 215 ? 0.8965 0.8352 0.9456 -0.0855 0.1504  -0.1070 238 CYS B CB  
3648 S SG  . CYS B 215 ? 0.9134 0.8697 0.9655 -0.0882 0.1427  -0.1090 238 CYS B SG  
3649 N N   . ASP B 216 ? 0.8333 0.7796 0.8796 -0.1064 0.1633  -0.1245 239 ASP B N   
3650 C CA  . ASP B 216 ? 0.8896 0.8504 0.9365 -0.1162 0.1642  -0.1326 239 ASP B CA  
3651 C C   . ASP B 216 ? 0.8525 0.8337 0.9035 -0.1151 0.1538  -0.1315 239 ASP B C   
3652 O O   . ASP B 216 ? 0.8410 0.8370 0.8927 -0.1224 0.1537  -0.1375 239 ASP B O   
3653 C CB  . ASP B 216 ? 1.0018 0.9554 1.0458 -0.1240 0.1744  -0.1393 239 ASP B CB  
3654 C CG  . ASP B 216 ? 0.9984 0.9452 1.0424 -0.1195 0.1744  -0.1356 239 ASP B CG  
3655 O OD1 . ASP B 216 ? 1.0274 0.9785 1.0740 -0.1116 0.1656  -0.1288 239 ASP B OD1 
3656 O OD2 . ASP B 216 ? 1.0106 0.9474 1.0516 -0.1243 0.1837  -0.1397 239 ASP B OD2 
3657 N N   . LEU B 217 ? 0.7931 0.7754 0.8464 -0.1059 0.1455  -0.1237 240 LEU B N   
3658 C CA  . LEU B 217 ? 0.7382 0.7379 0.7953 -0.1032 0.1360  -0.1212 240 LEU B CA  
3659 C C   . LEU B 217 ? 0.7386 0.7348 0.7974 -0.0937 0.1292  -0.1131 240 LEU B C   
3660 O O   . LEU B 217 ? 0.8085 0.7907 0.8662 -0.0884 0.1308  -0.1089 240 LEU B O   
3661 C CB  . LEU B 217 ? 0.7161 0.7201 0.7740 -0.1036 0.1349  -0.1215 240 LEU B CB  
3662 C CG  . LEU B 217 ? 0.6856 0.7064 0.7470 -0.1002 0.1262  -0.1184 240 LEU B CG  
3663 C CD1 . LEU B 217 ? 0.6563 0.6965 0.7191 -0.1047 0.1237  -0.1221 240 LEU B CD1 
3664 C CD2 . LEU B 217 ? 0.6953 0.7179 0.7570 -0.1013 0.1267  -0.1194 240 LEU B CD2 
3665 N N   . CYS B 218 ? 0.7006 0.7101 0.7621 -0.0914 0.1223  -0.1110 241 CYS B N   
3666 C CA  . CYS B 218 ? 0.7078 0.7146 0.7709 -0.0833 0.1165  -0.1042 241 CYS B CA  
3667 C C   . CYS B 218 ? 0.6644 0.6849 0.7306 -0.0798 0.1091  -0.1010 241 CYS B C   
3668 O O   . CYS B 218 ? 0.6655 0.7009 0.7329 -0.0827 0.1072  -0.1033 241 CYS B O   
3669 C CB  . CYS B 218 ? 0.7285 0.7342 0.7910 -0.0837 0.1169  -0.1046 241 CYS B CB  
3670 S SG  . CYS B 218 ? 0.7364 0.7418 0.8011 -0.0749 0.1097  -0.0971 241 CYS B SG  
3671 N N   . LEU B 219 ? 0.6456 0.6615 0.7130 -0.0733 0.1055  -0.0956 242 LEU B N   
3672 C CA  . LEU B 219 ? 0.6549 0.6814 0.7250 -0.0689 0.0992  -0.0918 242 LEU B CA  
3673 C C   . LEU B 219 ? 0.6450 0.6682 0.7163 -0.0630 0.0955  -0.0869 242 LEU B C   
3674 O O   . LEU B 219 ? 0.6957 0.7070 0.7658 -0.0607 0.0968  -0.0852 242 LEU B O   
3675 C CB  . LEU B 219 ? 0.6790 0.7035 0.7498 -0.0664 0.0980  -0.0897 242 LEU B CB  
3676 C CG  . LEU B 219 ? 0.6879 0.7203 0.7585 -0.0715 0.1001  -0.0939 242 LEU B CG  
3677 C CD1 . LEU B 219 ? 0.6910 0.7235 0.7594 -0.0793 0.1059  -0.1005 242 LEU B CD1 
3678 C CD2 . LEU B 219 ? 0.6826 0.7070 0.7530 -0.0695 0.1008  -0.0924 242 LEU B CD2 
3679 N N   . VAL B 220 ? 0.5731 0.6073 0.6463 -0.0606 0.0913  -0.0846 243 VAL B N   
3680 C CA  . VAL B 220 ? 0.5397 0.5718 0.6141 -0.0554 0.0882  -0.0803 243 VAL B CA  
3681 C C   . VAL B 220 ? 0.5140 0.5515 0.5903 -0.0511 0.0849  -0.0765 243 VAL B C   
3682 O O   . VAL B 220 ? 0.4853 0.5349 0.5625 -0.0519 0.0840  -0.0768 243 VAL B O   
3683 C CB  . VAL B 220 ? 0.5452 0.5856 0.6198 -0.0567 0.0874  -0.0811 243 VAL B CB  
3684 C CG1 . VAL B 220 ? 0.5572 0.5969 0.6332 -0.0510 0.0841  -0.0763 243 VAL B CG1 
3685 C CG2 . VAL B 220 ? 0.5666 0.6004 0.6392 -0.0611 0.0913  -0.0850 243 VAL B CG2 
3686 N N   . VAL B 221 ? 0.4904 0.5194 0.5672 -0.0466 0.0834  -0.0730 244 VAL B N   
3687 C CA  . VAL B 221 ? 0.4740 0.5051 0.5521 -0.0431 0.0815  -0.0700 244 VAL B CA  
3688 C C   . VAL B 221 ? 0.4813 0.5086 0.5604 -0.0383 0.0796  -0.0661 244 VAL B C   
3689 O O   . VAL B 221 ? 0.4542 0.4723 0.5328 -0.0371 0.0798  -0.0655 244 VAL B O   
3690 C CB  . VAL B 221 ? 0.4837 0.5073 0.5611 -0.0437 0.0828  -0.0708 244 VAL B CB  
3691 C CG1 . VAL B 221 ? 0.5087 0.5335 0.5875 -0.0402 0.0811  -0.0678 244 VAL B CG1 
3692 C CG2 . VAL B 221 ? 0.4876 0.5147 0.5640 -0.0488 0.0854  -0.0749 244 VAL B CG2 
3693 N N   . GLY B 222 ? 0.5270 0.5618 0.6075 -0.0354 0.0783  -0.0633 245 GLY B N   
3694 C CA  . GLY B 222 ? 0.5393 0.5701 0.6207 -0.0310 0.0775  -0.0597 245 GLY B CA  
3695 C C   . GLY B 222 ? 0.5478 0.5773 0.6290 -0.0307 0.0773  -0.0595 245 GLY B C   
3696 O O   . GLY B 222 ? 0.5797 0.6027 0.6610 -0.0284 0.0771  -0.0579 245 GLY B O   
3697 N N   . THR B 223 ? 0.5887 0.6250 0.6694 -0.0334 0.0774  -0.0616 246 THR B N   
3698 C CA  . THR B 223 ? 0.5940 0.6309 0.6745 -0.0336 0.0772  -0.0616 246 THR B CA  
3699 C C   . THR B 223 ? 0.6079 0.6550 0.6879 -0.0375 0.0778  -0.0646 246 THR B C   
3700 O O   . THR B 223 ? 0.6327 0.6863 0.7127 -0.0398 0.0783  -0.0664 246 THR B O   
3701 C CB  . THR B 223 ? 0.6118 0.6374 0.6911 -0.0345 0.0777  -0.0629 246 THR B CB  
3702 O OG1 . THR B 223 ? 0.6591 0.6862 0.7381 -0.0355 0.0777  -0.0636 246 THR B OG1 
3703 C CG2 . THR B 223 ? 0.6415 0.6624 0.7194 -0.0380 0.0794  -0.0661 246 THR B CG2 
3704 N N   . SER B 224 ? 0.6462 0.6950 0.7257 -0.0387 0.0779  -0.0656 247 SER B N   
3705 C CA  . SER B 224 ? 0.6574 0.7179 0.7367 -0.0425 0.0785  -0.0685 247 SER B CA  
3706 C C   . SER B 224 ? 0.6490 0.7033 0.7268 -0.0469 0.0803  -0.0724 247 SER B C   
3707 O O   . SER B 224 ? 0.6628 0.7072 0.7401 -0.0453 0.0802  -0.0713 247 SER B O   
3708 C CB  . SER B 224 ? 0.6705 0.7411 0.7509 -0.0390 0.0771  -0.0652 247 SER B CB  
3709 O OG  . SER B 224 ? 0.7066 0.7906 0.7868 -0.0427 0.0776  -0.0681 247 SER B OG  
3710 N N   . SER B 225 ? 0.6810 0.7416 0.7578 -0.0527 0.0823  -0.0771 248 SER B N   
3711 C CA  . SER B 225 ? 0.7017 0.7568 0.7767 -0.0574 0.0852  -0.0813 248 SER B CA  
3712 C C   . SER B 225 ? 0.7077 0.7629 0.7828 -0.0561 0.0842  -0.0802 248 SER B C   
3713 O O   . SER B 225 ? 0.6911 0.7382 0.7647 -0.0585 0.0865  -0.0824 248 SER B O   
3714 C CB  . SER B 225 ? 0.7583 0.8238 0.8325 -0.0644 0.0879  -0.0871 248 SER B CB  
3715 O OG  . SER B 225 ? 0.8632 0.9270 0.9367 -0.0672 0.0899  -0.0895 248 SER B OG  
3716 N N   . ILE B 226 ? 0.7186 0.7833 0.7953 -0.0522 0.0814  -0.0766 249 ILE B N   
3717 C CA  . ILE B 226 ? 0.6936 0.7613 0.7704 -0.0515 0.0807  -0.0759 249 ILE B CA  
3718 C C   . ILE B 226 ? 0.6644 0.7212 0.7417 -0.0464 0.0792  -0.0718 249 ILE B C   
3719 O O   . ILE B 226 ? 0.6300 0.6866 0.7072 -0.0459 0.0788  -0.0713 249 ILE B O   
3720 C CB  . ILE B 226 ? 0.7297 0.8155 0.8078 -0.0503 0.0791  -0.0745 249 ILE B CB  
3721 C CG1 . ILE B 226 ? 0.7834 0.8733 0.8630 -0.0441 0.0773  -0.0691 249 ILE B CG1 
3722 C CG2 . ILE B 226 ? 0.7282 0.8277 0.8057 -0.0566 0.0808  -0.0797 249 ILE B CG2 
3723 C CD1 . ILE B 226 ? 0.8236 0.9266 0.9043 -0.0398 0.0761  -0.0652 249 ILE B CD1 
3724 N N   . VAL B 227 ? 0.7033 0.7515 0.7809 -0.0430 0.0785  -0.0692 250 VAL B N   
3725 C CA  . VAL B 227 ? 0.7227 0.7620 0.8007 -0.0387 0.0774  -0.0658 250 VAL B CA  
3726 C C   . VAL B 227 ? 0.7034 0.7297 0.7802 -0.0395 0.0785  -0.0669 250 VAL B C   
3727 O O   . VAL B 227 ? 0.6111 0.6338 0.6870 -0.0417 0.0800  -0.0689 250 VAL B O   
3728 C CB  . VAL B 227 ? 0.7365 0.7764 0.8158 -0.0341 0.0763  -0.0618 250 VAL B CB  
3729 C CG1 . VAL B 227 ? 0.7683 0.8030 0.8482 -0.0302 0.0758  -0.0587 250 VAL B CG1 
3730 C CG2 . VAL B 227 ? 0.7755 0.8293 0.8558 -0.0331 0.0760  -0.0605 250 VAL B CG2 
3731 N N   . TYR B 228 ? 0.7994 0.8195 0.8761 -0.0374 0.0780  -0.0655 251 TYR B N   
3732 C CA  . TYR B 228 ? 0.8687 0.8783 0.9442 -0.0373 0.0790  -0.0659 251 TYR B CA  
3733 C C   . TYR B 228 ? 0.8626 0.8685 0.9388 -0.0347 0.0783  -0.0640 251 TYR B C   
3734 O O   . TYR B 228 ? 0.8992 0.9073 0.9767 -0.0321 0.0769  -0.0618 251 TYR B O   
3735 C CB  . TYR B 228 ? 0.9087 0.9153 0.9841 -0.0358 0.0784  -0.0649 251 TYR B CB  
3736 C CG  . TYR B 228 ? 1.0116 1.0094 1.0858 -0.0348 0.0793  -0.0646 251 TYR B CG  
3737 C CD1 . TYR B 228 ? 1.0941 1.0875 1.1665 -0.0366 0.0816  -0.0662 251 TYR B CD1 
3738 C CD2 . TYR B 228 ? 1.1170 1.1117 1.1919 -0.0318 0.0781  -0.0626 251 TYR B CD2 
3739 C CE1 . TYR B 228 ? 1.1240 1.1108 1.1953 -0.0347 0.0827  -0.0652 251 TYR B CE1 
3740 C CE2 . TYR B 228 ? 1.1388 1.1282 1.2127 -0.0306 0.0788  -0.0621 251 TYR B CE2 
3741 C CZ  . TYR B 228 ? 1.1418 1.1275 1.2139 -0.0316 0.0810  -0.0630 251 TYR B CZ  
3742 O OH  . TYR B 228 ? 1.0533 1.0348 1.1242 -0.0296 0.0820  -0.0619 251 TYR B OH  
3743 N N   . PRO B 229 ? 0.9136 0.9138 0.9888 -0.0352 0.0796  -0.0648 252 PRO B N   
3744 C CA  . PRO B 229 ? 0.9071 0.9022 0.9802 -0.0374 0.0823  -0.0668 252 PRO B CA  
3745 C C   . PRO B 229 ? 0.8385 0.8354 0.9108 -0.0412 0.0847  -0.0697 252 PRO B C   
3746 O O   . PRO B 229 ? 0.8257 0.8181 0.8960 -0.0437 0.0880  -0.0718 252 PRO B O   
3747 C CB  . PRO B 229 ? 0.9573 0.9458 1.0298 -0.0348 0.0827  -0.0652 252 PRO B CB  
3748 C CG  . PRO B 229 ? 1.0048 0.9959 1.0788 -0.0335 0.0810  -0.0641 252 PRO B CG  
3749 C CD  . PRO B 229 ? 0.9819 0.9798 1.0576 -0.0332 0.0790  -0.0634 252 PRO B CD  
3750 N N   . ALA B 230 ? 0.7177 0.7206 0.7910 -0.0417 0.0836  -0.0699 253 ALA B N   
3751 C CA  . ALA B 230 ? 0.6910 0.6971 0.7636 -0.0459 0.0858  -0.0731 253 ALA B CA  
3752 C C   . ALA B 230 ? 0.7067 0.7155 0.7781 -0.0504 0.0883  -0.0767 253 ALA B C   
3753 O O   . ALA B 230 ? 0.7154 0.7219 0.7852 -0.0546 0.0922  -0.0802 253 ALA B O   
3754 C CB  . ALA B 230 ? 0.7129 0.7286 0.7872 -0.0455 0.0837  -0.0724 253 ALA B CB  
3755 N N   . ALA B 231 ? 0.7017 0.7154 0.7738 -0.0498 0.0866  -0.0760 254 ALA B N   
3756 C CA  . ALA B 231 ? 0.6537 0.6714 0.7249 -0.0543 0.0886  -0.0795 254 ALA B CA  
3757 C C   . ALA B 231 ? 0.6642 0.6711 0.7329 -0.0568 0.0932  -0.0819 254 ALA B C   
3758 O O   . ALA B 231 ? 0.7277 0.7363 0.7951 -0.0621 0.0968  -0.0862 254 ALA B O   
3759 C CB  . ALA B 231 ? 0.6080 0.6312 0.6804 -0.0522 0.0859  -0.0777 254 ALA B CB  
3760 N N   . MET B 232 ? 0.7030 0.6994 0.7710 -0.0530 0.0937  -0.0791 255 MET B N   
3761 C CA  . MET B 232 ? 0.7645 0.7500 0.8299 -0.0540 0.0987  -0.0803 255 MET B CA  
3762 C C   . MET B 232 ? 0.7436 0.7250 0.8071 -0.0582 0.1041  -0.0837 255 MET B C   
3763 O O   . MET B 232 ? 0.7565 0.7296 0.8175 -0.0603 0.1098  -0.0857 255 MET B O   
3764 C CB  . MET B 232 ? 0.8083 0.7858 0.8734 -0.0485 0.0981  -0.0760 255 MET B CB  
3765 C CG  . MET B 232 ? 0.8611 0.8387 0.9269 -0.0452 0.0953  -0.0734 255 MET B CG  
3766 S SD  . MET B 232 ? 0.8255 0.7946 0.8902 -0.0396 0.0962  -0.0694 255 MET B SD  
3767 C CE  . MET B 232 ? 0.8946 0.8691 0.9619 -0.0365 0.0909  -0.0670 255 MET B CE  
3768 N N   . PHE B 233 ? 0.7105 0.6969 0.7749 -0.0592 0.1029  -0.0845 256 PHE B N   
3769 C CA  . PHE B 233 ? 0.7250 0.7062 0.7876 -0.0623 0.1080  -0.0872 256 PHE B CA  
3770 C C   . PHE B 233 ? 0.7598 0.7506 0.8226 -0.0690 0.1094  -0.0925 256 PHE B C   
3771 O O   . PHE B 233 ? 0.7721 0.7602 0.8328 -0.0748 0.1153  -0.0973 256 PHE B O   
3772 C CB  . PHE B 233 ? 0.6862 0.6645 0.7496 -0.0578 0.1058  -0.0835 256 PHE B CB  
3773 C CG  . PHE B 233 ? 0.6788 0.6503 0.7422 -0.0516 0.1043  -0.0787 256 PHE B CG  
3774 C CD1 . PHE B 233 ? 0.7241 0.6853 0.7850 -0.0502 0.1092  -0.0778 256 PHE B CD1 
3775 C CD2 . PHE B 233 ? 0.7131 0.6889 0.7787 -0.0472 0.0986  -0.0752 256 PHE B CD2 
3776 C CE1 . PHE B 233 ? 0.7362 0.6932 0.7968 -0.0444 0.1079  -0.0734 256 PHE B CE1 
3777 C CE2 . PHE B 233 ? 0.7509 0.7222 0.8164 -0.0422 0.0975  -0.0714 256 PHE B CE2 
3778 C CZ  . PHE B 233 ? 0.7648 0.7275 0.8279 -0.0407 0.1018  -0.0705 256 PHE B CZ  
3779 N N   . ALA B 234 ? 0.7922 0.7951 0.8575 -0.0683 0.1043  -0.0916 257 ALA B N   
3780 C CA  . ALA B 234 ? 0.7656 0.7796 0.8312 -0.0739 0.1053  -0.0961 257 ALA B CA  
3781 C C   . ALA B 234 ? 0.7255 0.7465 0.7902 -0.0806 0.1083  -0.1016 257 ALA B C   
3782 O O   . ALA B 234 ? 0.7362 0.7586 0.7993 -0.0873 0.1134  -0.1073 257 ALA B O   
3783 C CB  . ALA B 234 ? 0.7191 0.7454 0.7875 -0.0707 0.0994  -0.0932 257 ALA B CB  
3784 N N   . PRO B 235 ? 0.7096 0.7348 0.7751 -0.0791 0.1057  -0.1002 258 PRO B N   
3785 C CA  . PRO B 235 ? 0.7282 0.7573 0.7925 -0.0851 0.1092  -0.1053 258 PRO B CA  
3786 C C   . PRO B 235 ? 0.7843 0.7997 0.8452 -0.0902 0.1175  -0.1097 258 PRO B C   
3787 O O   . PRO B 235 ? 0.8204 0.8407 0.8800 -0.0980 0.1222  -0.1163 258 PRO B O   
3788 C CB  . PRO B 235 ? 0.7071 0.7366 0.7724 -0.0804 0.1052  -0.1013 258 PRO B CB  
3789 C CG  . PRO B 235 ? 0.6612 0.6978 0.7291 -0.0743 0.0989  -0.0960 258 PRO B CG  
3790 C CD  . PRO B 235 ? 0.6866 0.7164 0.7544 -0.0724 0.0994  -0.0945 258 PRO B CD  
3791 N N   . GLN B 236 ? 0.8400 0.8389 0.8994 -0.0858 0.1198  -0.1063 259 GLN B N   
3792 C CA  . GLN B 236 ? 0.8717 0.8560 0.9276 -0.0894 0.1288  -0.1096 259 GLN B CA  
3793 C C   . GLN B 236 ? 0.8661 0.8501 0.9206 -0.0955 0.1343  -0.1147 259 GLN B C   
3794 O O   . GLN B 236 ? 0.9190 0.8974 0.9708 -0.1021 0.1422  -0.1203 259 GLN B O   
3795 C CB  . GLN B 236 ? 0.9562 0.9242 1.0107 -0.0825 0.1305  -0.1040 259 GLN B CB  
3796 C CG  . GLN B 236 ? 1.0360 1.0021 1.0914 -0.0764 0.1263  -0.0989 259 GLN B CG  
3797 C CD  . GLN B 236 ? 1.0696 1.0231 1.1221 -0.0761 0.1326  -0.0988 259 GLN B CD  
3798 O OE1 . GLN B 236 ? 1.1870 1.1314 1.2365 -0.0802 0.1410  -0.1024 259 GLN B OE1 
3799 N NE2 . GLN B 236 ? 1.0410 0.9937 1.0943 -0.0710 0.1288  -0.0946 259 GLN B NE2 
3800 N N   . VAL B 237 ? 0.8627 0.8515 0.9188 -0.0933 0.1305  -0.1128 260 VAL B N   
3801 C CA  . VAL B 237 ? 0.7951 0.7842 0.8500 -0.0989 0.1353  -0.1175 260 VAL B CA  
3802 C C   . VAL B 237 ? 0.6825 0.6893 0.7384 -0.1068 0.1349  -0.1241 260 VAL B C   
3803 O O   . VAL B 237 ? 0.6531 0.6597 0.7070 -0.1147 0.1417  -0.1308 260 VAL B O   
3804 C CB  . VAL B 237 ? 0.8311 0.8201 0.8876 -0.0934 0.1309  -0.1129 260 VAL B CB  
3805 C CG1 . VAL B 237 ? 0.8562 0.8512 0.9125 -0.0992 0.1335  -0.1177 260 VAL B CG1 
3806 C CG2 . VAL B 237 ? 0.8972 0.8688 0.9520 -0.0872 0.1335  -0.1079 260 VAL B CG2 
3807 N N   . ALA B 238 ? 0.6569 0.6799 0.7157 -0.1045 0.1272  -0.1219 261 ALA B N   
3808 C CA  . ALA B 238 ? 0.6598 0.7033 0.7199 -0.1106 0.1259  -0.1269 261 ALA B CA  
3809 C C   . ALA B 238 ? 0.6887 0.7360 0.7470 -0.1192 0.1315  -0.1343 261 ALA B C   
3810 O O   . ALA B 238 ? 0.6461 0.7029 0.7036 -0.1279 0.1359  -0.1417 261 ALA B O   
3811 C CB  . ALA B 238 ? 0.6247 0.6836 0.6881 -0.1047 0.1170  -0.1217 261 ALA B CB  
3812 N N   . SER B 239 ? 0.7525 0.7923 0.8102 -0.1169 0.1318  -0.1323 262 SER B N   
3813 C CA  . SER B 239 ? 0.7272 0.7673 0.7829 -0.1243 0.1375  -0.1386 262 SER B CA  
3814 C C   . SER B 239 ? 0.7597 0.7863 0.8119 -0.1318 0.1484  -0.1452 262 SER B C   
3815 O O   . SER B 239 ? 0.8531 0.8841 0.9036 -0.1407 0.1542  -0.1529 262 SER B O   
3816 C CB  . SER B 239 ? 0.6828 0.7133 0.7384 -0.1187 0.1358  -0.1339 262 SER B CB  
3817 O OG  . SER B 239 ? 0.6457 0.6565 0.7001 -0.1123 0.1374  -0.1286 262 SER B OG  
3818 N N   . ARG B 240 ? 0.7563 0.7664 0.8071 -0.1283 0.1516  -0.1424 263 ARG B N   
3819 C CA  . ARG B 240 ? 0.7568 0.7545 0.8041 -0.1353 0.1625  -0.1485 263 ARG B CA  
3820 C C   . ARG B 240 ? 0.7300 0.7424 0.7779 -0.1430 0.1634  -0.1550 263 ARG B C   
3821 O O   . ARG B 240 ? 0.7124 0.7172 0.7575 -0.1501 0.1726  -0.1612 263 ARG B O   
3822 C CB  . ARG B 240 ? 0.7982 0.7748 0.8436 -0.1289 0.1661  -0.1432 263 ARG B CB  
3823 C CG  . ARG B 240 ? 0.8971 0.8611 0.9424 -0.1194 0.1637  -0.1351 263 ARG B CG  
3824 C CD  . ARG B 240 ? 0.9484 0.8901 0.9903 -0.1158 0.1721  -0.1323 263 ARG B CD  
3825 N NE  . ARG B 240 ? 0.9374 0.8740 0.9797 -0.1104 0.1706  -0.1278 263 ARG B NE  
3826 C CZ  . ARG B 240 ? 0.9551 0.8900 0.9963 -0.1150 0.1754  -0.1317 263 ARG B CZ  
3827 N NH1 . ARG B 240 ? 0.9495 0.8885 0.9892 -0.1256 0.1820  -0.1406 263 ARG B NH1 
3828 N NH2 . ARG B 240 ? 0.9926 0.9225 1.0341 -0.1092 0.1737  -0.1269 263 ARG B NH2 
3829 N N   . GLY B 241 ? 0.7094 0.7427 0.7606 -0.1414 0.1545  -0.1535 264 GLY B N   
3830 C CA  . GLY B 241 ? 0.7464 0.7961 0.7985 -0.1475 0.1543  -0.1587 264 GLY B CA  
3831 C C   . GLY B 241 ? 0.7992 0.8431 0.8517 -0.1434 0.1530  -0.1551 264 GLY B C   
3832 O O   . GLY B 241 ? 0.9069 0.9597 0.9593 -0.1495 0.1554  -0.1604 264 GLY B O   
3833 N N   . VAL B 242 ? 0.8000 0.8305 0.8533 -0.1333 0.1491  -0.1465 265 VAL B N   
3834 C CA  . VAL B 242 ? 0.7888 0.8153 0.8429 -0.1287 0.1468  -0.1426 265 VAL B CA  
3835 C C   . VAL B 242 ? 0.7824 0.8274 0.8402 -0.1235 0.1365  -0.1380 265 VAL B C   
3836 O O   . VAL B 242 ? 0.6891 0.7401 0.7488 -0.1182 0.1304  -0.1334 265 VAL B O   
3837 C CB  . VAL B 242 ? 0.8425 0.8478 0.8955 -0.1201 0.1474  -0.1354 265 VAL B CB  
3838 C CG1 . VAL B 242 ? 0.8476 0.8487 0.9011 -0.1160 0.1458  -0.1320 265 VAL B CG1 
3839 C CG2 . VAL B 242 ? 0.8566 0.8430 0.9058 -0.1232 0.1576  -0.1383 265 VAL B CG2 
3840 N N   . PRO B 243 ? 0.8003 0.8539 0.8592 -0.1246 0.1351  -0.1389 266 PRO B N   
3841 C CA  . PRO B 243 ? 0.7785 0.8497 0.8408 -0.1194 0.1263  -0.1343 266 PRO B CA  
3842 C C   . PRO B 243 ? 0.7625 0.8250 0.8264 -0.1083 0.1199  -0.1249 266 PRO B C   
3843 O O   . PRO B 243 ? 0.7083 0.7533 0.7712 -0.1044 0.1215  -0.1217 266 PRO B O   
3844 C CB  . PRO B 243 ? 0.7947 0.8734 0.8572 -0.1230 0.1274  -0.1374 266 PRO B CB  
3845 C CG  . PRO B 243 ? 0.8524 0.9195 0.9115 -0.1315 0.1371  -0.1448 266 PRO B CG  
3846 C CD  . PRO B 243 ? 0.8222 0.8689 0.8791 -0.1299 0.1417  -0.1436 266 PRO B CD  
3847 N N   . VAL B 244 ? 0.7660 0.8419 0.8325 -0.1034 0.1130  -0.1205 267 VAL B N   
3848 C CA  . VAL B 244 ? 0.7396 0.8088 0.8078 -0.0939 0.1075  -0.1124 267 VAL B CA  
3849 C C   . VAL B 244 ? 0.7439 0.8286 0.8146 -0.0901 0.1020  -0.1089 267 VAL B C   
3850 O O   . VAL B 244 ? 0.7702 0.8738 0.8419 -0.0926 0.1006  -0.1109 267 VAL B O   
3851 C CB  . VAL B 244 ? 0.7614 0.8290 0.8298 -0.0911 0.1055  -0.1099 267 VAL B CB  
3852 C CG1 . VAL B 244 ? 0.7760 0.8447 0.8467 -0.0820 0.0990  -0.1022 267 VAL B CG1 
3853 C CG2 . VAL B 244 ? 0.7339 0.7824 0.7998 -0.0921 0.1105  -0.1110 267 VAL B CG2 
3854 N N   . ALA B 245 ? 0.7680 0.8451 0.8397 -0.0837 0.0992  -0.1035 268 ALA B N   
3855 C CA  . ALA B 245 ? 0.7399 0.8291 0.8137 -0.0796 0.0949  -0.0999 268 ALA B CA  
3856 C C   . ALA B 245 ? 0.6970 0.7799 0.7723 -0.0709 0.0906  -0.0925 268 ALA B C   
3857 O O   . ALA B 245 ? 0.7154 0.7826 0.7902 -0.0680 0.0909  -0.0902 268 ALA B O   
3858 C CB  . ALA B 245 ? 0.7827 0.8681 0.8559 -0.0817 0.0969  -0.1017 268 ALA B CB  
3859 N N   . GLU B 246 ? 0.6645 0.7594 0.7415 -0.0667 0.0871  -0.0887 269 GLU B N   
3860 C CA  . GLU B 246 ? 0.7160 0.8036 0.7942 -0.0591 0.0841  -0.0822 269 GLU B CA  
3861 C C   . GLU B 246 ? 0.6883 0.7791 0.7677 -0.0547 0.0823  -0.0784 269 GLU B C   
3862 O O   . GLU B 246 ? 0.6801 0.7851 0.7602 -0.0560 0.0821  -0.0793 269 GLU B O   
3863 C CB  . GLU B 246 ? 0.8357 0.9315 0.9147 -0.0562 0.0822  -0.0796 269 GLU B CB  
3864 C CG  . GLU B 246 ? 0.9662 1.0605 1.0440 -0.0607 0.0839  -0.0835 269 GLU B CG  
3865 C CD  . GLU B 246 ? 1.0693 1.1670 1.1479 -0.0566 0.0818  -0.0798 269 GLU B CD  
3866 O OE1 . GLU B 246 ? 1.1949 1.2992 1.2750 -0.0507 0.0795  -0.0746 269 GLU B OE1 
3867 O OE2 . GLU B 246 ? 1.0837 1.1770 1.1613 -0.0590 0.0829  -0.0820 269 GLU B OE2 
3868 N N   . PHE B 247 ? 0.6593 0.7377 0.7392 -0.0497 0.0811  -0.0743 270 PHE B N   
3869 C CA  . PHE B 247 ? 0.6751 0.7553 0.7563 -0.0449 0.0796  -0.0701 270 PHE B CA  
3870 C C   . PHE B 247 ? 0.7144 0.7875 0.7964 -0.0388 0.0782  -0.0651 270 PHE B C   
3871 O O   . PHE B 247 ? 0.6519 0.7112 0.7333 -0.0379 0.0783  -0.0647 270 PHE B O   
3872 C CB  . PHE B 247 ? 0.7125 0.7827 0.7931 -0.0461 0.0805  -0.0714 270 PHE B CB  
3873 C CG  . PHE B 247 ? 0.6887 0.7637 0.7683 -0.0523 0.0827  -0.0767 270 PHE B CG  
3874 C CD1 . PHE B 247 ? 0.6427 0.7136 0.7206 -0.0580 0.0855  -0.0817 270 PHE B CD1 
3875 C CD2 . PHE B 247 ? 0.7000 0.7831 0.7803 -0.0525 0.0825  -0.0767 270 PHE B CD2 
3876 C CE1 . PHE B 247 ? 0.6408 0.7152 0.7177 -0.0643 0.0885  -0.0870 270 PHE B CE1 
3877 C CE2 . PHE B 247 ? 0.6681 0.7557 0.7474 -0.0588 0.0849  -0.0820 270 PHE B CE2 
3878 C CZ  . PHE B 247 ? 0.6449 0.7278 0.7224 -0.0649 0.0881  -0.0874 270 PHE B CZ  
3879 N N   . ASN B 248 ? 0.7712 0.8542 0.8542 -0.0348 0.0774  -0.0613 271 ASN B N   
3880 C CA  . ASN B 248 ? 0.7826 0.8589 0.8661 -0.0293 0.0770  -0.0567 271 ASN B CA  
3881 C C   . ASN B 248 ? 0.8027 0.8907 0.8872 -0.0241 0.0772  -0.0519 271 ASN B C   
3882 O O   . ASN B 248 ? 0.7549 0.8566 0.8397 -0.0248 0.0771  -0.0523 271 ASN B O   
3883 C CB  . ASN B 248 ? 0.8116 0.8837 0.8946 -0.0302 0.0769  -0.0576 271 ASN B CB  
3884 C CG  . ASN B 248 ? 0.9031 0.9895 0.9861 -0.0323 0.0767  -0.0591 271 ASN B CG  
3885 O OD1 . ASN B 248 ? 0.9778 1.0783 1.0615 -0.0298 0.0766  -0.0566 271 ASN B OD1 
3886 N ND2 . ASN B 248 ? 0.9328 1.0163 1.0148 -0.0367 0.0771  -0.0629 271 ASN B ND2 
3887 N N   . MET B 249 ? 0.8618 0.9449 0.9467 -0.0187 0.0779  -0.0474 272 MET B N   
3888 C CA  . MET B 249 ? 0.9580 1.0513 1.0436 -0.0128 0.0791  -0.0420 272 MET B CA  
3889 C C   . MET B 249 ? 1.1093 1.2028 1.1949 -0.0094 0.0799  -0.0390 272 MET B C   
3890 O O   . MET B 249 ? 1.1325 1.2177 1.2181 -0.0047 0.0819  -0.0350 272 MET B O   
3891 C CB  . MET B 249 ? 0.9289 1.0156 1.0149 -0.0087 0.0807  -0.0385 272 MET B CB  
3892 C CG  . MET B 249 ? 0.8952 0.9640 0.9810 -0.0084 0.0816  -0.0387 272 MET B CG  
3893 S SD  . MET B 249 ? 0.9487 1.0127 1.0349 -0.0039 0.0841  -0.0349 272 MET B SD  
3894 C CE  . MET B 249 ? 0.9204 1.0027 1.0070 0.0013  0.0855  -0.0297 272 MET B CE  
3895 N N   . GLU B 250 ? 1.2750 1.3779 1.3604 -0.0123 0.0787  -0.0413 273 GLU B N   
3896 C CA  . GLU B 250 ? 1.4004 1.5021 1.4856 -0.0105 0.0790  -0.0397 273 GLU B CA  
3897 C C   . GLU B 250 ? 1.4058 1.5258 1.4911 -0.0095 0.0787  -0.0385 273 GLU B C   
3898 O O   . GLU B 250 ? 1.2173 1.3366 1.3026 -0.0077 0.0790  -0.0369 273 GLU B O   
3899 C CB  . GLU B 250 ? 1.4526 1.5410 1.5371 -0.0157 0.0778  -0.0445 273 GLU B CB  
3900 C CG  . GLU B 250 ? 1.4536 1.5244 1.5381 -0.0143 0.0787  -0.0438 273 GLU B CG  
3901 C CD  . GLU B 250 ? 1.4275 1.4869 1.5112 -0.0192 0.0776  -0.0484 273 GLU B CD  
3902 O OE1 . GLU B 250 ? 1.4073 1.4686 1.4905 -0.0227 0.0768  -0.0514 273 GLU B OE1 
3903 O OE2 . GLU B 250 ? 1.2707 1.3195 1.3544 -0.0193 0.0779  -0.0488 273 GLU B OE2 
3904 N N   . CYS B 251 ? 1.4571 1.5943 1.5427 -0.0108 0.0781  -0.0394 274 CYS B N   
3905 C CA  . CYS B 251 ? 1.4157 1.5742 1.5015 -0.0091 0.0780  -0.0377 274 CYS B CA  
3906 C C   . CYS B 251 ? 1.2594 1.4213 1.3449 -0.0139 0.0769  -0.0418 274 CYS B C   
3907 O O   . CYS B 251 ? 1.0966 1.2700 1.1818 -0.0202 0.0760  -0.0472 274 CYS B O   
3908 C CB  . CYS B 251 ? 1.5294 1.6917 1.6155 0.0005  0.0803  -0.0291 274 CYS B CB  
3909 S SG  . CYS B 251 ? 1.5541 1.7056 1.6404 0.0069  0.0830  -0.0236 274 CYS B SG  
3910 N N   . PHE B 258 ? 1.2269 1.3710 1.3048 -0.0723 0.0853  -0.0929 281 PHE B N   
3911 C CA  . PHE B 258 ? 1.3308 1.4767 1.4069 -0.0818 0.0894  -0.1011 281 PHE B CA  
3912 C C   . PHE B 258 ? 1.2516 1.4108 1.3274 -0.0880 0.0915  -0.1064 281 PHE B C   
3913 O O   . PHE B 258 ? 1.2181 1.3941 1.2954 -0.0851 0.0890  -0.1038 281 PHE B O   
3914 C CB  . PHE B 258 ? 1.3826 1.5047 1.4569 -0.0837 0.0925  -0.1029 281 PHE B CB  
3915 C CG  . PHE B 258 ? 1.3970 1.5121 1.4707 -0.0829 0.0926  -0.1024 281 PHE B CG  
3916 C CD1 . PHE B 258 ? 1.3611 1.4858 1.4363 -0.0781 0.0890  -0.0980 281 PHE B CD1 
3917 C CD2 . PHE B 258 ? 1.3213 1.4195 1.3929 -0.0866 0.0968  -0.1057 281 PHE B CD2 
3918 C CE1 . PHE B 258 ? 1.3020 1.4199 1.3766 -0.0776 0.0891  -0.0976 281 PHE B CE1 
3919 C CE2 . PHE B 258 ? 1.3054 1.3970 1.3764 -0.0857 0.0970  -0.1050 281 PHE B CE2 
3920 C CZ  . PHE B 258 ? 1.3383 1.4398 1.4109 -0.0815 0.0929  -0.1012 281 PHE B CZ  
3921 N N   . LYS B 259 ? 1.1712 1.3230 1.2450 -0.0963 0.0965  -0.1137 282 LYS B N   
3922 C CA  . LYS B 259 ? 1.1425 1.3072 1.2158 -0.1039 0.0995  -0.1202 282 LYS B CA  
3923 C C   . LYS B 259 ? 1.1716 1.3469 1.2466 -0.0997 0.0964  -0.1165 282 LYS B C   
3924 O O   . LYS B 259 ? 1.1476 1.3467 1.2235 -0.1015 0.0953  -0.1180 282 LYS B O   
3925 C CB  . LYS B 259 ? 1.1217 1.2687 1.1925 -0.1111 0.1059  -0.1266 282 LYS B CB  
3926 C CG  . LYS B 259 ? 1.1574 1.2988 1.2263 -0.1168 0.1101  -0.1316 282 LYS B CG  
3927 C CD  . LYS B 259 ? 1.1516 1.2659 1.2184 -0.1161 0.1141  -0.1311 282 LYS B CD  
3928 C CE  . LYS B 259 ? 1.1616 1.2726 1.2269 -0.1204 0.1175  -0.1348 282 LYS B CE  
3929 N NZ  . LYS B 259 ? 1.1630 1.2534 1.2251 -0.1254 0.1256  -0.1393 282 LYS B NZ  
3930 N N   . TYR B 260 ? 1.1533 1.3122 1.2285 -0.0941 0.0951  -0.1117 283 TYR B N   
3931 C CA  . TYR B 260 ? 0.9790 1.1452 1.0560 -0.0877 0.0915  -0.1062 283 TYR B CA  
3932 C C   . TYR B 260 ? 0.8512 1.0070 0.9294 -0.0776 0.0876  -0.0974 283 TYR B C   
3933 O O   . TYR B 260 ? 0.8500 0.9888 0.9276 -0.0757 0.0878  -0.0959 283 TYR B O   
3934 C CB  . TYR B 260 ? 0.9344 1.0917 1.0107 -0.0901 0.0936  -0.1083 283 TYR B CB  
3935 C CG  . TYR B 260 ? 0.9289 1.0875 1.0033 -0.1007 0.0991  -0.1176 283 TYR B CG  
3936 C CD1 . TYR B 260 ? 0.8929 1.0728 0.9675 -0.1066 0.1003  -0.1226 283 TYR B CD1 
3937 C CD2 . TYR B 260 ? 0.9043 1.0425 0.9765 -0.1047 0.1038  -0.1212 283 TYR B CD2 
3938 C CE1 . TYR B 260 ? 0.8591 1.0389 0.9318 -0.1172 0.1062  -0.1318 283 TYR B CE1 
3939 C CE2 . TYR B 260 ? 0.8961 1.0329 0.9661 -0.1144 0.1102  -0.1296 283 TYR B CE2 
3940 C CZ  . TYR B 260 ? 0.8816 1.0388 0.9519 -0.1210 0.1115  -0.1352 283 TYR B CZ  
3941 O OH  . TYR B 260 ? 0.9441 1.0984 1.0121 -0.1313 0.1186  -0.1442 283 TYR B OH  
3942 N N   . HIS B 261 ? 0.7807 0.9470 0.8607 -0.0713 0.0846  -0.0919 284 HIS B N   
3943 C CA  . HIS B 261 ? 0.7236 0.8806 0.8047 -0.0620 0.0818  -0.0839 284 HIS B CA  
3944 C C   . HIS B 261 ? 0.7431 0.9055 0.8253 -0.0572 0.0804  -0.0797 284 HIS B C   
3945 O O   . HIS B 261 ? 0.7964 0.9787 0.8792 -0.0578 0.0802  -0.0801 284 HIS B O   
3946 C CB  . HIS B 261 ? 0.6983 0.8663 0.7802 -0.0576 0.0800  -0.0799 284 HIS B CB  
3947 C CG  . HIS B 261 ? 0.6526 0.8125 0.7355 -0.0484 0.0781  -0.0720 284 HIS B CG  
3948 N ND1 . HIS B 261 ? 0.6896 0.8331 0.7723 -0.0457 0.0778  -0.0698 284 HIS B ND1 
3949 C CD2 . HIS B 261 ? 0.6129 0.7787 0.6969 -0.0414 0.0771  -0.0659 284 HIS B CD2 
3950 C CE1 . HIS B 261 ? 0.6626 0.8021 0.7462 -0.0380 0.0768  -0.0632 284 HIS B CE1 
3951 N NE2 . HIS B 261 ? 0.6591 0.8112 0.7434 -0.0351 0.0766  -0.0605 284 HIS B NE2 
3952 N N   . PHE B 262 ? 0.7231 0.8690 0.8056 -0.0524 0.0797  -0.0757 285 PHE B N   
3953 C CA  . PHE B 262 ? 0.7337 0.8823 0.8171 -0.0479 0.0789  -0.0718 285 PHE B CA  
3954 C C   . PHE B 262 ? 0.7328 0.8728 0.8171 -0.0393 0.0776  -0.0643 285 PHE B C   
3955 O O   . PHE B 262 ? 0.6763 0.7978 0.7603 -0.0377 0.0776  -0.0632 285 PHE B O   
3956 C CB  . PHE B 262 ? 0.7675 0.9043 0.8501 -0.0520 0.0802  -0.0755 285 PHE B CB  
3957 C CG  . PHE B 262 ? 0.7960 0.9413 0.8776 -0.0607 0.0825  -0.0829 285 PHE B CG  
3958 C CD1 . PHE B 262 ? 0.8793 1.0440 0.9614 -0.0626 0.0825  -0.0844 285 PHE B CD1 
3959 C CD2 . PHE B 262 ? 0.8169 0.9510 0.8968 -0.0671 0.0852  -0.0886 285 PHE B CD2 
3960 C CE1 . PHE B 262 ? 0.9384 1.1115 1.0195 -0.0715 0.0852  -0.0921 285 PHE B CE1 
3961 C CE2 . PHE B 262 ? 0.9050 1.0457 0.9837 -0.0757 0.0885  -0.0960 285 PHE B CE2 
3962 C CZ  . PHE B 262 ? 0.9609 1.1212 1.0402 -0.0783 0.0885  -0.0981 285 PHE B CZ  
3963 N N   . GLU B 263 ? 0.7959 0.9501 0.8811 -0.0338 0.0770  -0.0594 286 GLU B N   
3964 C CA  . GLU B 263 ? 0.8202 0.9675 0.9060 -0.0257 0.0770  -0.0524 286 GLU B CA  
3965 C C   . GLU B 263 ? 0.7459 0.8842 0.8321 -0.0220 0.0774  -0.0493 286 GLU B C   
3966 O O   . GLU B 263 ? 0.6955 0.8422 0.7820 -0.0228 0.0775  -0.0499 286 GLU B O   
3967 C CB  . GLU B 263 ? 0.8609 1.0263 0.9473 -0.0201 0.0772  -0.0473 286 GLU B CB  
3968 C CG  . GLU B 263 ? 0.9674 1.1228 1.0540 -0.0125 0.0782  -0.0407 286 GLU B CG  
3969 C CD  . GLU B 263 ? 1.0313 1.1821 1.1175 -0.0135 0.0779  -0.0416 286 GLU B CD  
3970 O OE1 . GLU B 263 ? 1.2202 1.3846 1.3063 -0.0169 0.0771  -0.0445 286 GLU B OE1 
3971 O OE2 . GLU B 263 ? 0.9250 1.0592 1.0111 -0.0111 0.0785  -0.0398 286 GLU B OE2 
3972 N N   . GLY B 264 ? 0.7379 0.8592 0.8240 -0.0185 0.0780  -0.0465 287 GLY B N   
3973 C CA  . GLY B 264 ? 0.7340 0.8460 0.8205 -0.0153 0.0788  -0.0438 287 GLY B CA  
3974 C C   . GLY B 264 ? 0.7394 0.8318 0.8254 -0.0175 0.0786  -0.0462 287 GLY B C   
3975 O O   . GLY B 264 ? 0.7444 0.8310 0.8297 -0.0223 0.0779  -0.0505 287 GLY B O   
3976 N N   . PRO B 265 ? 0.7600 0.8429 0.8463 -0.0141 0.0797  -0.0434 288 PRO B N   
3977 C CA  . PRO B 265 ? 0.7307 0.7970 0.8166 -0.0160 0.0797  -0.0455 288 PRO B CA  
3978 C C   . PRO B 265 ? 0.6623 0.7266 0.7477 -0.0216 0.0785  -0.0505 288 PRO B C   
3979 O O   . PRO B 265 ? 0.6098 0.6810 0.6953 -0.0229 0.0784  -0.0515 288 PRO B O   
3980 C CB  . PRO B 265 ? 0.7393 0.8002 0.8256 -0.0115 0.0815  -0.0417 288 PRO B CB  
3981 C CG  . PRO B 265 ? 0.7324 0.8070 0.8192 -0.0086 0.0821  -0.0388 288 PRO B CG  
3982 C CD  . PRO B 265 ? 0.7378 0.8258 0.8246 -0.0084 0.0814  -0.0383 288 PRO B CD  
3983 N N   . CYS B 266 ? 0.6490 0.7039 0.7336 -0.0247 0.0781  -0.0535 289 CYS B N   
3984 C CA  . CYS B 266 ? 0.7006 0.7512 0.7842 -0.0297 0.0781  -0.0579 289 CYS B CA  
3985 C C   . CYS B 266 ? 0.6947 0.7420 0.7785 -0.0296 0.0783  -0.0580 289 CYS B C   
3986 O O   . CYS B 266 ? 0.6422 0.6926 0.7255 -0.0332 0.0787  -0.0610 289 CYS B O   
3987 C CB  . CYS B 266 ? 0.7621 0.8010 0.8449 -0.0307 0.0782  -0.0592 289 CYS B CB  
3988 S SG  . CYS B 266 ? 0.7514 0.7926 0.8341 -0.0304 0.0778  -0.0588 289 CYS B SG  
3989 N N   . GLY B 267 ? 0.6827 0.7235 0.7671 -0.0259 0.0785  -0.0551 290 GLY B N   
3990 C CA  . GLY B 267 ? 0.6259 0.6641 0.7106 -0.0251 0.0788  -0.0545 290 GLY B CA  
3991 C C   . GLY B 267 ? 0.6318 0.6809 0.7167 -0.0261 0.0787  -0.0549 290 GLY B C   
3992 O O   . GLY B 267 ? 0.6498 0.6972 0.7345 -0.0282 0.0788  -0.0569 290 GLY B O   
3993 N N   . SER B 268 ? 0.6181 0.6794 0.7036 -0.0244 0.0787  -0.0530 291 SER B N   
3994 C CA  . SER B 268 ? 0.6015 0.6766 0.6874 -0.0249 0.0787  -0.0531 291 SER B CA  
3995 C C   . SER B 268 ? 0.5966 0.6814 0.6819 -0.0305 0.0785  -0.0577 291 SER B C   
3996 O O   . SER B 268 ? 0.6200 0.7111 0.7052 -0.0337 0.0787  -0.0604 291 SER B O   
3997 C CB  . SER B 268 ? 0.6289 0.7145 0.7156 -0.0193 0.0793  -0.0480 291 SER B CB  
3998 O OG  . SER B 268 ? 0.7031 0.7789 0.7902 -0.0144 0.0806  -0.0439 291 SER B OG  
3999 N N   . THR B 269 ? 0.5756 0.6618 0.6605 -0.0320 0.0783  -0.0590 292 THR B N   
4000 C CA  . THR B 269 ? 0.5610 0.6576 0.6453 -0.0375 0.0787  -0.0636 292 THR B CA  
4001 C C   . THR B 269 ? 0.5536 0.6405 0.6366 -0.0436 0.0801  -0.0690 292 THR B C   
4002 O O   . THR B 269 ? 0.5531 0.6470 0.6354 -0.0488 0.0814  -0.0734 292 THR B O   
4003 C CB  . THR B 269 ? 0.6029 0.7029 0.6871 -0.0372 0.0784  -0.0632 292 THR B CB  
4004 O OG1 . THR B 269 ? 0.7201 0.8044 0.8035 -0.0379 0.0786  -0.0641 292 THR B OG1 
4005 C CG2 . THR B 269 ? 0.6506 0.7566 0.7358 -0.0301 0.0778  -0.0569 292 THR B CG2 
4006 N N   . LEU B 270 ? 0.5301 0.6009 0.6125 -0.0427 0.0803  -0.0686 293 LEU B N   
4007 C CA  . LEU B 270 ? 0.5163 0.5776 0.5970 -0.0475 0.0824  -0.0729 293 LEU B CA  
4008 C C   . LEU B 270 ? 0.5282 0.5859 0.6083 -0.0500 0.0839  -0.0752 293 LEU B C   
4009 O O   . LEU B 270 ? 0.5288 0.5870 0.6076 -0.0554 0.0865  -0.0798 293 LEU B O   
4010 C CB  . LEU B 270 ? 0.5212 0.5686 0.6014 -0.0452 0.0822  -0.0713 293 LEU B CB  
4011 C CG  . LEU B 270 ? 0.5390 0.5768 0.6173 -0.0491 0.0849  -0.0749 293 LEU B CG  
4012 C CD1 . LEU B 270 ? 0.5161 0.5600 0.5934 -0.0540 0.0868  -0.0789 293 LEU B CD1 
4013 C CD2 . LEU B 270 ? 0.5624 0.5888 0.6404 -0.0455 0.0843  -0.0723 293 LEU B CD2 
4014 N N   . PRO B 271 ? 0.5645 0.6182 0.6454 -0.0462 0.0827  -0.0720 294 PRO B N   
4015 C CA  . PRO B 271 ? 0.5850 0.6343 0.6652 -0.0485 0.0842  -0.0742 294 PRO B CA  
4016 C C   . PRO B 271 ? 0.6018 0.6626 0.6817 -0.0536 0.0858  -0.0782 294 PRO B C   
4017 O O   . PRO B 271 ? 0.5956 0.6512 0.6740 -0.0582 0.0887  -0.0822 294 PRO B O   
4018 C CB  . PRO B 271 ? 0.5836 0.6299 0.6650 -0.0434 0.0824  -0.0699 294 PRO B CB  
4019 C CG  . PRO B 271 ? 0.5811 0.6243 0.6633 -0.0389 0.0808  -0.0662 294 PRO B CG  
4020 C CD  . PRO B 271 ? 0.5787 0.6306 0.6609 -0.0401 0.0806  -0.0669 294 PRO B CD  
4021 N N   . PRO B 272 ? 0.6105 0.6870 0.6917 -0.0528 0.0842  -0.0772 295 PRO B N   
4022 C CA  . PRO B 272 ? 0.6106 0.7004 0.6915 -0.0581 0.0857  -0.0816 295 PRO B CA  
4023 C C   . PRO B 272 ? 0.6448 0.7342 0.7241 -0.0649 0.0887  -0.0874 295 PRO B C   
4024 O O   . PRO B 272 ? 0.6716 0.7622 0.7497 -0.0709 0.0918  -0.0926 295 PRO B O   
4025 C CB  . PRO B 272 ? 0.6026 0.7103 0.6850 -0.0549 0.0834  -0.0785 295 PRO B CB  
4026 C CG  . PRO B 272 ? 0.6032 0.7045 0.6868 -0.0471 0.0812  -0.0718 295 PRO B CG  
4027 C CD  . PRO B 272 ? 0.6238 0.7068 0.7066 -0.0465 0.0816  -0.0717 295 PRO B CD  
4028 N N   . ALA B 273 ? 0.6902 0.7772 0.7692 -0.0640 0.0883  -0.0867 296 ALA B N   
4029 C CA  . ALA B 273 ? 0.7506 0.8365 0.8280 -0.0705 0.0916  -0.0922 296 ALA B CA  
4030 C C   . ALA B 273 ? 0.7879 0.8579 0.8631 -0.0743 0.0961  -0.0958 296 ALA B C   
4031 O O   . ALA B 273 ? 0.8336 0.9050 0.9072 -0.0815 0.1005  -0.1019 296 ALA B O   
4032 C CB  . ALA B 273 ? 0.7759 0.8593 0.8535 -0.0680 0.0903  -0.0901 296 ALA B CB  
4033 N N   . LEU B 274 ? 0.8217 0.8769 0.8967 -0.0696 0.0954  -0.0920 297 LEU B N   
4034 C CA  . LEU B 274 ? 0.8292 0.8684 0.9020 -0.0714 0.0998  -0.0938 297 LEU B CA  
4035 C C   . LEU B 274 ? 0.8543 0.8901 0.9265 -0.0729 0.1019  -0.0952 297 LEU B C   
4036 O O   . LEU B 274 ? 0.8358 0.8596 0.9060 -0.0751 0.1067  -0.0973 297 LEU B O   
4037 C CB  . LEU B 274 ? 0.8381 0.8646 0.9109 -0.0654 0.0982  -0.0890 297 LEU B CB  
4038 C CG  . LEU B 274 ? 0.8629 0.8899 0.9360 -0.0639 0.0967  -0.0877 297 LEU B CG  
4039 C CD1 . LEU B 274 ? 0.8741 0.8895 0.9472 -0.0582 0.0953  -0.0832 297 LEU B CD1 
4040 C CD2 . LEU B 274 ? 0.8445 0.8700 0.9156 -0.0697 0.1013  -0.0926 297 LEU B CD2 
4041 N N   . GLU B 275 ? 0.8729 0.9190 0.9469 -0.0715 0.0988  -0.0938 298 GLU B N   
4042 C CA  . GLU B 275 ? 0.9335 0.9771 1.0072 -0.0726 0.1003  -0.0948 298 GLU B CA  
4043 C C   . GLU B 275 ? 0.9062 0.9478 0.9776 -0.0804 0.1065  -0.1014 298 GLU B C   
4044 O O   . GLU B 275 ? 0.9903 1.0379 1.0608 -0.0863 0.1094  -0.1064 298 GLU B O   
4045 C CB  . GLU B 275 ? 0.9778 1.0350 1.0537 -0.0705 0.0965  -0.0928 298 GLU B CB  
4046 C CG  . GLU B 275 ? 0.9963 1.0729 1.0730 -0.0742 0.0958  -0.0956 298 GLU B CG  
4047 C CD  . GLU B 275 ? 1.0335 1.1218 1.1114 -0.0743 0.0946  -0.0956 298 GLU B CD  
4048 O OE1 . GLU B 275 ? 1.1696 1.2556 1.2461 -0.0795 0.0981  -0.1001 298 GLU B OE1 
4049 O OE2 . GLU B 275 ? 1.0697 1.1686 1.1494 -0.0693 0.0908  -0.0911 298 GLU B OE2 
4050 O OXT . GLU B 275 ? 0.9128 0.9466 0.9833 -0.0811 0.1092  -0.1022 298 GLU B OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   24  ?   ?   ?   A . n 
A 1 2   ILE 2   25  ?   ?   ?   A . n 
A 1 3   ASP 3   26  ?   ?   ?   A . n 
A 1 4   PRO 4   27  ?   ?   ?   A . n 
A 1 5   PHE 5   28  ?   ?   ?   A . n 
A 1 6   THR 6   29  ?   ?   ?   A . n 
A 1 7   THR 7   30  ?   ?   ?   A . n 
A 1 8   ARG 8   31  ?   ?   ?   A . n 
A 1 9   PRO 9   32  ?   ?   ?   A . n 
A 1 10  SER 10  33  ?   ?   ?   A . n 
A 1 11  SER 11  34  ?   ?   ?   A . n 
A 1 12  ASP 12  35  35  ASP ASP A . n 
A 1 13  LEU 13  36  36  LEU LEU A . n 
A 1 14  THR 14  37  37  THR THR A . n 
A 1 15  ALA 15  38  38  ALA ALA A . n 
A 1 16  PHE 16  39  39  PHE PHE A . n 
A 1 17  ARG 17  40  40  ARG ARG A . n 
A 1 18  GLU 18  41  41  GLU GLU A . n 
A 1 19  HIS 19  42  42  HIS HIS A . n 
A 1 20  PHE 20  43  43  PHE PHE A . n 
A 1 21  ALA 21  44  44  ALA ALA A . n 
A 1 22  LYS 22  45  45  LYS LYS A . n 
A 1 23  ALA 23  46  46  ALA ALA A . n 
A 1 24  LYS 24  47  47  LYS LYS A . n 
A 1 25  HIS 25  48  48  HIS HIS A . n 
A 1 26  ILE 26  49  49  ILE ILE A . n 
A 1 27  ALA 27  50  50  ALA ALA A . n 
A 1 28  ILE 28  51  51  ILE ILE A . n 
A 1 29  ILE 29  52  52  ILE ILE A . n 
A 1 30  THR 30  53  53  THR THR A . n 
A 1 31  GLY 31  54  54  GLY GLY A . n 
A 1 32  ALA 32  55  55  ALA ALA A . n 
A 1 33  GLY 33  56  56  GLY GLY A . n 
A 1 34  VAL 34  57  57  VAL VAL A . n 
A 1 35  SER 35  58  58  SER SER A . n 
A 1 36  ALA 36  59  59  ALA ALA A . n 
A 1 37  GLU 37  60  60  GLU GLU A . n 
A 1 38  SER 38  61  61  SER SER A . n 
A 1 39  GLY 39  62  62  GLY GLY A . n 
A 1 40  VAL 40  63  63  VAL VAL A . n 
A 1 41  PRO 41  64  64  PRO PRO A . n 
A 1 42  THR 42  65  65  THR THR A . n 
A 1 43  PHE 43  66  66  PHE PHE A . n 
A 1 44  ARG 44  67  67  ARG ARG A . n 
A 1 45  GLY 45  68  68  GLY GLY A . n 
A 1 46  PRO 46  69  69  PRO PRO A . n 
A 1 47  GLY 47  70  70  GLY GLY A . n 
A 1 48  GLY 48  71  71  GLY GLY A . n 
A 1 49  PHE 49  72  72  PHE PHE A . n 
A 1 50  TRP 50  73  73  TRP TRP A . n 
A 1 51  ARG 51  74  74  ARG ARG A . n 
A 1 52  LYS 52  75  75  LYS LYS A . n 
A 1 53  TRP 53  76  76  TRP TRP A . n 
A 1 54  GLN 54  77  77  GLN GLN A . n 
A 1 55  ALA 55  78  78  ALA ALA A . n 
A 1 56  GLN 56  79  79  GLN GLN A . n 
A 1 57  ASP 57  80  80  ASP ASP A . n 
A 1 58  LEU 58  81  81  LEU LEU A . n 
A 1 59  ALA 59  82  82  ALA ALA A . n 
A 1 60  THR 60  83  83  THR THR A . n 
A 1 61  PRO 61  84  84  PRO PRO A . n 
A 1 62  GLU 62  85  85  GLU GLU A . n 
A 1 63  ALA 63  86  86  ALA ALA A . n 
A 1 64  PHE 64  87  87  PHE PHE A . n 
A 1 65  SER 65  88  88  SER SER A . n 
A 1 66  ARG 66  89  89  ARG ARG A . n 
A 1 67  ASP 67  90  90  ASP ASP A . n 
A 1 68  PRO 68  91  91  PRO PRO A . n 
A 1 69  SER 69  92  92  SER SER A . n 
A 1 70  LEU 70  93  93  LEU LEU A . n 
A 1 71  VAL 71  94  94  VAL VAL A . n 
A 1 72  TRP 72  95  95  TRP TRP A . n 
A 1 73  GLU 73  96  96  GLU GLU A . n 
A 1 74  PHE 74  97  97  PHE PHE A . n 
A 1 75  TYR 75  98  98  TYR TYR A . n 
A 1 76  HIS 76  99  99  HIS HIS A . n 
A 1 77  TYR 77  100 100 TYR TYR A . n 
A 1 78  ARG 78  101 101 ARG ARG A . n 
A 1 79  ARG 79  102 102 ARG ARG A . n 
A 1 80  GLU 80  103 103 GLU GLU A . n 
A 1 81  VAL 81  104 104 VAL VAL A . n 
A 1 82  MET 82  105 105 MET MET A . n 
A 1 83  ARG 83  106 106 ARG ARG A . n 
A 1 84  SER 84  107 107 SER SER A . n 
A 1 85  LYS 85  108 108 LYS LYS A . n 
A 1 86  MET 86  109 109 MET MET A . n 
A 1 87  PRO 87  110 110 PRO PRO A . n 
A 1 88  ASN 88  111 111 ASN ASN A . n 
A 1 89  PRO 89  112 112 PRO PRO A . n 
A 1 90  ALA 90  113 113 ALA ALA A . n 
A 1 91  HIS 91  114 114 HIS HIS A . n 
A 1 92  LEU 92  115 115 LEU LEU A . n 
A 1 93  ALA 93  116 116 ALA ALA A . n 
A 1 94  ILE 94  117 117 ILE ILE A . n 
A 1 95  ALA 95  118 118 ALA ALA A . n 
A 1 96  GLU 96  119 119 GLU GLU A . n 
A 1 97  CYS 97  120 120 CYS CYS A . n 
A 1 98  GLU 98  121 121 GLU GLU A . n 
A 1 99  ALA 99  122 122 ALA ALA A . n 
A 1 100 ARG 100 123 123 ARG ARG A . n 
A 1 101 LEU 101 124 124 LEU LEU A . n 
A 1 102 GLY 102 125 125 GLY GLY A . n 
A 1 103 GLN 103 126 126 GLN GLN A . n 
A 1 104 GLN 104 127 127 GLN GLN A . n 
A 1 105 GLY 105 128 128 GLY GLY A . n 
A 1 106 ARG 106 129 129 ARG ARG A . n 
A 1 107 SER 107 130 130 SER SER A . n 
A 1 108 VAL 108 131 131 VAL VAL A . n 
A 1 109 VAL 109 132 132 VAL VAL A . n 
A 1 110 ILE 110 133 133 ILE ILE A . n 
A 1 111 ILE 111 134 134 ILE ILE A . n 
A 1 112 THR 112 135 135 THR THR A . n 
A 1 113 GLN 113 136 136 GLN GLN A . n 
A 1 114 ASN 114 137 137 ASN ASN A . n 
A 1 115 ILE 115 138 138 ILE ILE A . n 
A 1 116 ASP 116 139 139 ASP ASP A . n 
A 1 117 GLU 117 140 140 GLU GLU A . n 
A 1 118 LEU 118 141 141 LEU LEU A . n 
A 1 119 HIS 119 142 142 HIS HIS A . n 
A 1 120 HIS 120 143 143 HIS HIS A . n 
A 1 121 ARG 121 144 144 ARG ARG A . n 
A 1 122 ALA 122 145 145 ALA ALA A . n 
A 1 123 GLY 123 146 146 GLY GLY A . n 
A 1 124 SER 124 147 147 SER SER A . n 
A 1 125 LYS 125 148 148 LYS LYS A . n 
A 1 126 HIS 126 149 149 HIS HIS A . n 
A 1 127 VAL 127 150 150 VAL VAL A . n 
A 1 128 TYR 128 151 151 TYR TYR A . n 
A 1 129 GLU 129 152 152 GLU GLU A . n 
A 1 130 ILE 130 153 153 ILE ILE A . n 
A 1 131 HIS 131 154 154 HIS HIS A . n 
A 1 132 GLY 132 155 155 GLY GLY A . n 
A 1 133 SER 133 156 156 SER SER A . n 
A 1 134 LEU 134 157 157 LEU LEU A . n 
A 1 135 PHE 135 158 158 PHE PHE A . n 
A 1 136 LYS 136 159 159 LYS LYS A . n 
A 1 137 THR 137 160 160 THR THR A . n 
A 1 138 ARG 138 161 161 ARG ARG A . n 
A 1 139 CYS 139 162 162 CYS CYS A . n 
A 1 140 MET 140 163 163 MET MET A . n 
A 1 141 SER 141 164 164 SER SER A . n 
A 1 142 CYS 142 165 165 CYS CYS A . n 
A 1 143 GLY 143 166 166 GLY GLY A . n 
A 1 144 GLU 144 167 167 GLU GLU A . n 
A 1 145 VAL 145 168 168 VAL VAL A . n 
A 1 146 LYS 146 169 169 LYS LYS A . n 
A 1 147 ALA 147 170 170 ALA ALA A . n 
A 1 148 ASN 148 171 171 ASN ASN A . n 
A 1 149 HIS 149 172 172 HIS HIS A . n 
A 1 150 LYS 150 173 173 LYS LYS A . n 
A 1 151 SER 151 174 174 SER SER A . n 
A 1 152 PRO 152 175 175 PRO PRO A . n 
A 1 153 ILE 153 176 176 ILE ILE A . n 
A 1 154 CYS 154 177 177 CYS CYS A . n 
A 1 155 PRO 155 178 178 PRO PRO A . n 
A 1 156 ALA 156 179 179 ALA ALA A . n 
A 1 157 LEU 157 180 180 LEU LEU A . n 
A 1 158 ASP 158 181 181 ASP ASP A . n 
A 1 159 GLY 159 182 182 GLY GLY A . n 
A 1 160 LYS 160 183 183 LYS LYS A . n 
A 1 161 GLY 161 184 184 GLY GLY A . n 
A 1 162 ALA 162 185 185 ALA ALA A . n 
A 1 163 PRO 163 186 186 PRO PRO A . n 
A 1 164 ASP 164 187 187 ASP ASP A . n 
A 1 165 PRO 165 188 188 PRO PRO A . n 
A 1 166 ASN 166 189 189 ASN ASN A . n 
A 1 167 THR 167 190 190 THR THR A . n 
A 1 168 LYS 168 191 191 LYS LYS A . n 
A 1 169 GLU 169 192 192 GLU GLU A . n 
A 1 170 ALA 170 193 193 ALA ALA A . n 
A 1 171 ARG 171 194 194 ARG ARG A . n 
A 1 172 ILE 172 195 195 ILE ILE A . n 
A 1 173 PRO 173 196 196 PRO PRO A . n 
A 1 174 VAL 174 197 197 VAL VAL A . n 
A 1 175 GLU 175 198 198 GLU GLU A . n 
A 1 176 LEU 176 199 199 LEU LEU A . n 
A 1 177 LEU 177 200 200 LEU LEU A . n 
A 1 178 PRO 178 201 201 PRO PRO A . n 
A 1 179 ARG 179 202 202 ARG ARG A . n 
A 1 180 CYS 180 203 203 CYS CYS A . n 
A 1 181 GLU 181 204 204 GLU GLU A . n 
A 1 182 ARG 182 205 205 ARG ARG A . n 
A 1 183 LYS 183 206 206 LYS LYS A . n 
A 1 184 SER 184 207 207 SER SER A . n 
A 1 185 CYS 185 208 208 CYS CYS A . n 
A 1 186 ASN 186 209 209 ASN ASN A . n 
A 1 187 GLY 187 210 210 GLY GLY A . n 
A 1 188 LEU 188 211 211 LEU LEU A . n 
A 1 189 LEU 189 212 212 LEU LEU A . n 
A 1 190 ARG 190 213 213 ARG ARG A . n 
A 1 191 PRO 191 214 214 PRO PRO A . n 
A 1 192 HIS 192 215 215 HIS HIS A . n 
A 1 193 VAL 193 216 216 VAL VAL A . n 
A 1 194 VAL 194 217 217 VAL VAL A . n 
A 1 195 TRP 195 218 218 TRP TRP A . n 
A 1 196 PHE 196 219 219 PHE PHE A . n 
A 1 197 GLY 197 220 220 GLY GLY A . n 
A 1 198 GLU 198 221 221 GLU GLU A . n 
A 1 199 THR 199 222 222 THR THR A . n 
A 1 200 LEU 200 223 223 LEU LEU A . n 
A 1 201 ASP 201 224 224 ASP ASP A . n 
A 1 202 SER 202 225 225 SER SER A . n 
A 1 203 ASP 203 226 226 ASP ASP A . n 
A 1 204 ILE 204 227 227 ILE ILE A . n 
A 1 205 LEU 205 228 228 LEU LEU A . n 
A 1 206 THR 206 229 229 THR THR A . n 
A 1 207 ALA 207 230 230 ALA ALA A . n 
A 1 208 VAL 208 231 231 VAL VAL A . n 
A 1 209 GLU 209 232 232 GLU GLU A . n 
A 1 210 ARG 210 233 233 ARG ARG A . n 
A 1 211 GLU 211 234 234 GLU GLU A . n 
A 1 212 LEU 212 235 235 LEU LEU A . n 
A 1 213 GLU 213 236 236 GLU GLU A . n 
A 1 214 LYS 214 237 237 LYS LYS A . n 
A 1 215 CYS 215 238 238 CYS CYS A . n 
A 1 216 ASP 216 239 239 ASP ASP A . n 
A 1 217 LEU 217 240 240 LEU LEU A . n 
A 1 218 CYS 218 241 241 CYS CYS A . n 
A 1 219 LEU 219 242 242 LEU LEU A . n 
A 1 220 VAL 220 243 243 VAL VAL A . n 
A 1 221 VAL 221 244 244 VAL VAL A . n 
A 1 222 GLY 222 245 245 GLY GLY A . n 
A 1 223 THR 223 246 246 THR THR A . n 
A 1 224 SER 224 247 247 SER SER A . n 
A 1 225 SER 225 248 248 SER SER A . n 
A 1 226 ILE 226 249 249 ILE ILE A . n 
A 1 227 VAL 227 250 250 VAL VAL A . n 
A 1 228 TYR 228 251 251 TYR TYR A . n 
A 1 229 PRO 229 252 252 PRO PRO A . n 
A 1 230 ALA 230 253 253 ALA ALA A . n 
A 1 231 ALA 231 254 254 ALA ALA A . n 
A 1 232 MET 232 255 255 MET MET A . n 
A 1 233 PHE 233 256 256 PHE PHE A . n 
A 1 234 ALA 234 257 257 ALA ALA A . n 
A 1 235 PRO 235 258 258 PRO PRO A . n 
A 1 236 GLN 236 259 259 GLN GLN A . n 
A 1 237 VAL 237 260 260 VAL VAL A . n 
A 1 238 ALA 238 261 261 ALA ALA A . n 
A 1 239 SER 239 262 262 SER SER A . n 
A 1 240 ARG 240 263 263 ARG ARG A . n 
A 1 241 GLY 241 264 264 GLY GLY A . n 
A 1 242 VAL 242 265 265 VAL VAL A . n 
A 1 243 PRO 243 266 266 PRO PRO A . n 
A 1 244 VAL 244 267 267 VAL VAL A . n 
A 1 245 ALA 245 268 268 ALA ALA A . n 
A 1 246 GLU 246 269 269 GLU GLU A . n 
A 1 247 PHE 247 270 270 PHE PHE A . n 
A 1 248 ASN 248 271 271 ASN ASN A . n 
A 1 249 MET 249 272 272 MET MET A . n 
A 1 250 GLU 250 273 273 GLU GLU A . n 
A 1 251 CYS 251 274 274 CYS CYS A . n 
A 1 252 THR 252 275 275 THR THR A . n 
A 1 253 PRO 253 276 276 PRO PRO A . n 
A 1 254 ALA 254 277 277 ALA ALA A . n 
A 1 255 THR 255 278 278 THR THR A . n 
A 1 256 GLN 256 279 279 GLN GLN A . n 
A 1 257 ARG 257 280 ?   ?   ?   A . n 
A 1 258 PHE 258 281 ?   ?   ?   A . n 
A 1 259 LYS 259 282 282 LYS LYS A . n 
A 1 260 TYR 260 283 283 TYR TYR A . n 
A 1 261 HIS 261 284 284 HIS HIS A . n 
A 1 262 PHE 262 285 285 PHE PHE A . n 
A 1 263 GLU 263 286 286 GLU GLU A . n 
A 1 264 GLY 264 287 287 GLY GLY A . n 
A 1 265 PRO 265 288 288 PRO PRO A . n 
A 1 266 CYS 266 289 289 CYS CYS A . n 
A 1 267 GLY 267 290 290 GLY GLY A . n 
A 1 268 SER 268 291 291 SER SER A . n 
A 1 269 THR 269 292 292 THR THR A . n 
A 1 270 LEU 270 293 293 LEU LEU A . n 
A 1 271 PRO 271 294 294 PRO PRO A . n 
A 1 272 PRO 272 295 295 PRO PRO A . n 
A 1 273 ALA 273 296 296 ALA ALA A . n 
A 1 274 LEU 274 297 297 LEU LEU A . n 
A 1 275 GLU 275 298 298 GLU GLU A . n 
B 1 1   GLY 1   24  ?   ?   ?   B . n 
B 1 2   ILE 2   25  ?   ?   ?   B . n 
B 1 3   ASP 3   26  ?   ?   ?   B . n 
B 1 4   PRO 4   27  ?   ?   ?   B . n 
B 1 5   PHE 5   28  ?   ?   ?   B . n 
B 1 6   THR 6   29  ?   ?   ?   B . n 
B 1 7   THR 7   30  ?   ?   ?   B . n 
B 1 8   ARG 8   31  ?   ?   ?   B . n 
B 1 9   PRO 9   32  ?   ?   ?   B . n 
B 1 10  SER 10  33  33  SER SER B . n 
B 1 11  SER 11  34  34  SER SER B . n 
B 1 12  ASP 12  35  35  ASP ASP B . n 
B 1 13  LEU 13  36  36  LEU LEU B . n 
B 1 14  THR 14  37  37  THR THR B . n 
B 1 15  ALA 15  38  38  ALA ALA B . n 
B 1 16  PHE 16  39  39  PHE PHE B . n 
B 1 17  ARG 17  40  40  ARG ARG B . n 
B 1 18  GLU 18  41  41  GLU GLU B . n 
B 1 19  HIS 19  42  42  HIS HIS B . n 
B 1 20  PHE 20  43  43  PHE PHE B . n 
B 1 21  ALA 21  44  44  ALA ALA B . n 
B 1 22  LYS 22  45  45  LYS LYS B . n 
B 1 23  ALA 23  46  46  ALA ALA B . n 
B 1 24  LYS 24  47  47  LYS LYS B . n 
B 1 25  HIS 25  48  48  HIS HIS B . n 
B 1 26  ILE 26  49  49  ILE ILE B . n 
B 1 27  ALA 27  50  50  ALA ALA B . n 
B 1 28  ILE 28  51  51  ILE ILE B . n 
B 1 29  ILE 29  52  52  ILE ILE B . n 
B 1 30  THR 30  53  53  THR THR B . n 
B 1 31  GLY 31  54  54  GLY GLY B . n 
B 1 32  ALA 32  55  55  ALA ALA B . n 
B 1 33  GLY 33  56  56  GLY GLY B . n 
B 1 34  VAL 34  57  57  VAL VAL B . n 
B 1 35  SER 35  58  58  SER SER B . n 
B 1 36  ALA 36  59  59  ALA ALA B . n 
B 1 37  GLU 37  60  60  GLU GLU B . n 
B 1 38  SER 38  61  61  SER SER B . n 
B 1 39  GLY 39  62  62  GLY GLY B . n 
B 1 40  VAL 40  63  63  VAL VAL B . n 
B 1 41  PRO 41  64  64  PRO PRO B . n 
B 1 42  THR 42  65  65  THR THR B . n 
B 1 43  PHE 43  66  66  PHE PHE B . n 
B 1 44  ARG 44  67  67  ARG ARG B . n 
B 1 45  GLY 45  68  68  GLY GLY B . n 
B 1 46  PRO 46  69  69  PRO PRO B . n 
B 1 47  GLY 47  70  70  GLY GLY B . n 
B 1 48  GLY 48  71  71  GLY GLY B . n 
B 1 49  PHE 49  72  72  PHE PHE B . n 
B 1 50  TRP 50  73  73  TRP TRP B . n 
B 1 51  ARG 51  74  74  ARG ARG B . n 
B 1 52  LYS 52  75  75  LYS LYS B . n 
B 1 53  TRP 53  76  76  TRP TRP B . n 
B 1 54  GLN 54  77  77  GLN GLN B . n 
B 1 55  ALA 55  78  78  ALA ALA B . n 
B 1 56  GLN 56  79  79  GLN GLN B . n 
B 1 57  ASP 57  80  80  ASP ASP B . n 
B 1 58  LEU 58  81  81  LEU LEU B . n 
B 1 59  ALA 59  82  82  ALA ALA B . n 
B 1 60  THR 60  83  83  THR THR B . n 
B 1 61  PRO 61  84  84  PRO PRO B . n 
B 1 62  GLU 62  85  85  GLU GLU B . n 
B 1 63  ALA 63  86  86  ALA ALA B . n 
B 1 64  PHE 64  87  87  PHE PHE B . n 
B 1 65  SER 65  88  88  SER SER B . n 
B 1 66  ARG 66  89  89  ARG ARG B . n 
B 1 67  ASP 67  90  90  ASP ASP B . n 
B 1 68  PRO 68  91  91  PRO PRO B . n 
B 1 69  SER 69  92  92  SER SER B . n 
B 1 70  LEU 70  93  93  LEU LEU B . n 
B 1 71  VAL 71  94  94  VAL VAL B . n 
B 1 72  TRP 72  95  95  TRP TRP B . n 
B 1 73  GLU 73  96  96  GLU GLU B . n 
B 1 74  PHE 74  97  97  PHE PHE B . n 
B 1 75  TYR 75  98  98  TYR TYR B . n 
B 1 76  HIS 76  99  99  HIS HIS B . n 
B 1 77  TYR 77  100 100 TYR TYR B . n 
B 1 78  ARG 78  101 101 ARG ARG B . n 
B 1 79  ARG 79  102 102 ARG ARG B . n 
B 1 80  GLU 80  103 103 GLU GLU B . n 
B 1 81  VAL 81  104 104 VAL VAL B . n 
B 1 82  MET 82  105 105 MET MET B . n 
B 1 83  ARG 83  106 106 ARG ARG B . n 
B 1 84  SER 84  107 107 SER SER B . n 
B 1 85  LYS 85  108 108 LYS LYS B . n 
B 1 86  MET 86  109 109 MET MET B . n 
B 1 87  PRO 87  110 110 PRO PRO B . n 
B 1 88  ASN 88  111 111 ASN ASN B . n 
B 1 89  PRO 89  112 112 PRO PRO B . n 
B 1 90  ALA 90  113 113 ALA ALA B . n 
B 1 91  HIS 91  114 114 HIS HIS B . n 
B 1 92  LEU 92  115 115 LEU LEU B . n 
B 1 93  ALA 93  116 116 ALA ALA B . n 
B 1 94  ILE 94  117 117 ILE ILE B . n 
B 1 95  ALA 95  118 118 ALA ALA B . n 
B 1 96  GLU 96  119 119 GLU GLU B . n 
B 1 97  CYS 97  120 120 CYS CYS B . n 
B 1 98  GLU 98  121 121 GLU GLU B . n 
B 1 99  ALA 99  122 122 ALA ALA B . n 
B 1 100 ARG 100 123 123 ARG ARG B . n 
B 1 101 LEU 101 124 124 LEU LEU B . n 
B 1 102 GLY 102 125 125 GLY GLY B . n 
B 1 103 GLN 103 126 126 GLN GLN B . n 
B 1 104 GLN 104 127 127 GLN GLN B . n 
B 1 105 GLY 105 128 128 GLY GLY B . n 
B 1 106 ARG 106 129 129 ARG ARG B . n 
B 1 107 SER 107 130 130 SER SER B . n 
B 1 108 VAL 108 131 131 VAL VAL B . n 
B 1 109 VAL 109 132 132 VAL VAL B . n 
B 1 110 ILE 110 133 133 ILE ILE B . n 
B 1 111 ILE 111 134 134 ILE ILE B . n 
B 1 112 THR 112 135 135 THR THR B . n 
B 1 113 GLN 113 136 136 GLN GLN B . n 
B 1 114 ASN 114 137 137 ASN ASN B . n 
B 1 115 ILE 115 138 138 ILE ILE B . n 
B 1 116 ASP 116 139 139 ASP ASP B . n 
B 1 117 GLU 117 140 140 GLU GLU B . n 
B 1 118 LEU 118 141 141 LEU LEU B . n 
B 1 119 HIS 119 142 142 HIS HIS B . n 
B 1 120 HIS 120 143 143 HIS HIS B . n 
B 1 121 ARG 121 144 144 ARG ARG B . n 
B 1 122 ALA 122 145 145 ALA ALA B . n 
B 1 123 GLY 123 146 146 GLY GLY B . n 
B 1 124 SER 124 147 147 SER SER B . n 
B 1 125 LYS 125 148 148 LYS LYS B . n 
B 1 126 HIS 126 149 149 HIS HIS B . n 
B 1 127 VAL 127 150 150 VAL VAL B . n 
B 1 128 TYR 128 151 151 TYR TYR B . n 
B 1 129 GLU 129 152 152 GLU GLU B . n 
B 1 130 ILE 130 153 153 ILE ILE B . n 
B 1 131 HIS 131 154 154 HIS HIS B . n 
B 1 132 GLY 132 155 155 GLY GLY B . n 
B 1 133 SER 133 156 156 SER SER B . n 
B 1 134 LEU 134 157 157 LEU LEU B . n 
B 1 135 PHE 135 158 158 PHE PHE B . n 
B 1 136 LYS 136 159 159 LYS LYS B . n 
B 1 137 THR 137 160 160 THR THR B . n 
B 1 138 ARG 138 161 161 ARG ARG B . n 
B 1 139 CYS 139 162 162 CYS CYS B . n 
B 1 140 MET 140 163 163 MET MET B . n 
B 1 141 SER 141 164 164 SER SER B . n 
B 1 142 CYS 142 165 165 CYS CYS B . n 
B 1 143 GLY 143 166 166 GLY GLY B . n 
B 1 144 GLU 144 167 167 GLU GLU B . n 
B 1 145 VAL 145 168 168 VAL VAL B . n 
B 1 146 LYS 146 169 169 LYS LYS B . n 
B 1 147 ALA 147 170 170 ALA ALA B . n 
B 1 148 ASN 148 171 171 ASN ASN B . n 
B 1 149 HIS 149 172 172 HIS HIS B . n 
B 1 150 LYS 150 173 173 LYS LYS B . n 
B 1 151 SER 151 174 174 SER SER B . n 
B 1 152 PRO 152 175 175 PRO PRO B . n 
B 1 153 ILE 153 176 176 ILE ILE B . n 
B 1 154 CYS 154 177 177 CYS CYS B . n 
B 1 155 PRO 155 178 178 PRO PRO B . n 
B 1 156 ALA 156 179 179 ALA ALA B . n 
B 1 157 LEU 157 180 180 LEU LEU B . n 
B 1 158 ASP 158 181 181 ASP ASP B . n 
B 1 159 GLY 159 182 182 GLY GLY B . n 
B 1 160 LYS 160 183 183 LYS LYS B . n 
B 1 161 GLY 161 184 184 GLY GLY B . n 
B 1 162 ALA 162 185 185 ALA ALA B . n 
B 1 163 PRO 163 186 186 PRO PRO B . n 
B 1 164 ASP 164 187 187 ASP ASP B . n 
B 1 165 PRO 165 188 188 PRO PRO B . n 
B 1 166 ASN 166 189 189 ASN ASN B . n 
B 1 167 THR 167 190 190 THR THR B . n 
B 1 168 LYS 168 191 191 LYS LYS B . n 
B 1 169 GLU 169 192 192 GLU GLU B . n 
B 1 170 ALA 170 193 193 ALA ALA B . n 
B 1 171 ARG 171 194 194 ARG ARG B . n 
B 1 172 ILE 172 195 195 ILE ILE B . n 
B 1 173 PRO 173 196 196 PRO PRO B . n 
B 1 174 VAL 174 197 197 VAL VAL B . n 
B 1 175 GLU 175 198 198 GLU GLU B . n 
B 1 176 LEU 176 199 199 LEU LEU B . n 
B 1 177 LEU 177 200 200 LEU LEU B . n 
B 1 178 PRO 178 201 201 PRO PRO B . n 
B 1 179 ARG 179 202 202 ARG ARG B . n 
B 1 180 CYS 180 203 203 CYS CYS B . n 
B 1 181 GLU 181 204 204 GLU GLU B . n 
B 1 182 ARG 182 205 205 ARG ARG B . n 
B 1 183 LYS 183 206 206 LYS LYS B . n 
B 1 184 SER 184 207 207 SER SER B . n 
B 1 185 CYS 185 208 208 CYS CYS B . n 
B 1 186 ASN 186 209 209 ASN ASN B . n 
B 1 187 GLY 187 210 210 GLY GLY B . n 
B 1 188 LEU 188 211 211 LEU LEU B . n 
B 1 189 LEU 189 212 212 LEU LEU B . n 
B 1 190 ARG 190 213 213 ARG ARG B . n 
B 1 191 PRO 191 214 214 PRO PRO B . n 
B 1 192 HIS 192 215 215 HIS HIS B . n 
B 1 193 VAL 193 216 216 VAL VAL B . n 
B 1 194 VAL 194 217 217 VAL VAL B . n 
B 1 195 TRP 195 218 218 TRP TRP B . n 
B 1 196 PHE 196 219 219 PHE PHE B . n 
B 1 197 GLY 197 220 220 GLY GLY B . n 
B 1 198 GLU 198 221 221 GLU GLU B . n 
B 1 199 THR 199 222 222 THR THR B . n 
B 1 200 LEU 200 223 223 LEU LEU B . n 
B 1 201 ASP 201 224 224 ASP ASP B . n 
B 1 202 SER 202 225 225 SER SER B . n 
B 1 203 ASP 203 226 226 ASP ASP B . n 
B 1 204 ILE 204 227 227 ILE ILE B . n 
B 1 205 LEU 205 228 228 LEU LEU B . n 
B 1 206 THR 206 229 229 THR THR B . n 
B 1 207 ALA 207 230 230 ALA ALA B . n 
B 1 208 VAL 208 231 231 VAL VAL B . n 
B 1 209 GLU 209 232 232 GLU GLU B . n 
B 1 210 ARG 210 233 233 ARG ARG B . n 
B 1 211 GLU 211 234 234 GLU GLU B . n 
B 1 212 LEU 212 235 235 LEU LEU B . n 
B 1 213 GLU 213 236 236 GLU GLU B . n 
B 1 214 LYS 214 237 237 LYS LYS B . n 
B 1 215 CYS 215 238 238 CYS CYS B . n 
B 1 216 ASP 216 239 239 ASP ASP B . n 
B 1 217 LEU 217 240 240 LEU LEU B . n 
B 1 218 CYS 218 241 241 CYS CYS B . n 
B 1 219 LEU 219 242 242 LEU LEU B . n 
B 1 220 VAL 220 243 243 VAL VAL B . n 
B 1 221 VAL 221 244 244 VAL VAL B . n 
B 1 222 GLY 222 245 245 GLY GLY B . n 
B 1 223 THR 223 246 246 THR THR B . n 
B 1 224 SER 224 247 247 SER SER B . n 
B 1 225 SER 225 248 248 SER SER B . n 
B 1 226 ILE 226 249 249 ILE ILE B . n 
B 1 227 VAL 227 250 250 VAL VAL B . n 
B 1 228 TYR 228 251 251 TYR TYR B . n 
B 1 229 PRO 229 252 252 PRO PRO B . n 
B 1 230 ALA 230 253 253 ALA ALA B . n 
B 1 231 ALA 231 254 254 ALA ALA B . n 
B 1 232 MET 232 255 255 MET MET B . n 
B 1 233 PHE 233 256 256 PHE PHE B . n 
B 1 234 ALA 234 257 257 ALA ALA B . n 
B 1 235 PRO 235 258 258 PRO PRO B . n 
B 1 236 GLN 236 259 259 GLN GLN B . n 
B 1 237 VAL 237 260 260 VAL VAL B . n 
B 1 238 ALA 238 261 261 ALA ALA B . n 
B 1 239 SER 239 262 262 SER SER B . n 
B 1 240 ARG 240 263 263 ARG ARG B . n 
B 1 241 GLY 241 264 264 GLY GLY B . n 
B 1 242 VAL 242 265 265 VAL VAL B . n 
B 1 243 PRO 243 266 266 PRO PRO B . n 
B 1 244 VAL 244 267 267 VAL VAL B . n 
B 1 245 ALA 245 268 268 ALA ALA B . n 
B 1 246 GLU 246 269 269 GLU GLU B . n 
B 1 247 PHE 247 270 270 PHE PHE B . n 
B 1 248 ASN 248 271 271 ASN ASN B . n 
B 1 249 MET 249 272 272 MET MET B . n 
B 1 250 GLU 250 273 273 GLU GLU B . n 
B 1 251 CYS 251 274 274 CYS CYS B . n 
B 1 252 THR 252 275 ?   ?   ?   B . n 
B 1 253 PRO 253 276 ?   ?   ?   B . n 
B 1 254 ALA 254 277 ?   ?   ?   B . n 
B 1 255 THR 255 278 ?   ?   ?   B . n 
B 1 256 GLN 256 279 ?   ?   ?   B . n 
B 1 257 ARG 257 280 ?   ?   ?   B . n 
B 1 258 PHE 258 281 281 PHE PHE B . n 
B 1 259 LYS 259 282 282 LYS LYS B . n 
B 1 260 TYR 260 283 283 TYR TYR B . n 
B 1 261 HIS 261 284 284 HIS HIS B . n 
B 1 262 PHE 262 285 285 PHE PHE B . n 
B 1 263 GLU 263 286 286 GLU GLU B . n 
B 1 264 GLY 264 287 287 GLY GLY B . n 
B 1 265 PRO 265 288 288 PRO PRO B . n 
B 1 266 CYS 266 289 289 CYS CYS B . n 
B 1 267 GLY 267 290 290 GLY GLY B . n 
B 1 268 SER 268 291 291 SER SER B . n 
B 1 269 THR 269 292 292 THR THR B . n 
B 1 270 LEU 270 293 293 LEU LEU B . n 
B 1 271 PRO 271 294 294 PRO PRO B . n 
B 1 272 PRO 272 295 295 PRO PRO B . n 
B 1 273 ALA 273 296 296 ALA ALA B . n 
B 1 274 LEU 274 297 297 LEU LEU B . n 
B 1 275 GLU 275 298 298 GLU GLU B . n 
C 2 1   BEZ 1   0   0   BEZ BEZ C . n 
C 2 2   GLY 2   1   1   GLY GLY C . n 
C 2 3   VAL 3   2   2   VAL VAL C . n 
C 2 4   LEU 4   3   3   LEU LEU C . n 
C 2 5   LYS 5   4   4   LYS LYS C . n 
C 2 6   GLU 6   5   5   GLU GLU C . n 
C 2 7   TYR 7   6   6   TYR TYR C . n 
C 2 8   GLY 8   7   7   GLY GLY C . n 
C 2 9   VAL 9   8   8   VAL VAL C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 ZN  1  1299 1299 ZN  ZN  A . 
E 4 EDO 1  1300 1300 EDO EDO A . 
F 4 EDO 1  1301 1301 EDO EDO A . 
G 3 ZN  1  1299 1299 ZN  ZN  B . 
H 5 EPE 1  1300 1300 EPE EPE B . 
I 6 DMS 1  1301 1301 DMS DMS B . 
J 4 EDO 1  1302 1302 EDO EDO B . 
K 7 NA  1  1303 1303 NA  NA  B . 
L 8 3NP 1  1004 1004 3NP 3NP C . 
M 9 HOH 1  2001 2001 HOH HOH A . 
M 9 HOH 2  2002 2002 HOH HOH A . 
M 9 HOH 3  2003 2003 HOH HOH A . 
M 9 HOH 4  2004 2004 HOH HOH A . 
M 9 HOH 5  2005 2005 HOH HOH A . 
M 9 HOH 6  2006 2006 HOH HOH A . 
M 9 HOH 7  2007 2007 HOH HOH A . 
M 9 HOH 8  2008 2008 HOH HOH A . 
M 9 HOH 9  2009 2009 HOH HOH A . 
M 9 HOH 10 2010 2010 HOH HOH A . 
M 9 HOH 11 2011 2011 HOH HOH A . 
M 9 HOH 12 2012 2012 HOH HOH A . 
M 9 HOH 13 2013 2013 HOH HOH A . 
M 9 HOH 14 2014 2014 HOH HOH A . 
M 9 HOH 15 2015 2015 HOH HOH A . 
M 9 HOH 16 2016 2016 HOH HOH A . 
M 9 HOH 17 2017 2017 HOH HOH A . 
M 9 HOH 18 2018 2018 HOH HOH A . 
M 9 HOH 19 2019 2019 HOH HOH A . 
M 9 HOH 20 2020 2020 HOH HOH A . 
M 9 HOH 21 2021 2021 HOH HOH A . 
M 9 HOH 22 2022 2022 HOH HOH A . 
M 9 HOH 23 2023 2023 HOH HOH A . 
N 9 HOH 1  2001 2001 HOH HOH B . 
N 9 HOH 2  2002 2002 HOH HOH B . 
N 9 HOH 3  2003 2003 HOH HOH B . 
N 9 HOH 4  2004 2004 HOH HOH B . 
N 9 HOH 5  2005 2005 HOH HOH B . 
N 9 HOH 6  2006 2006 HOH HOH B . 
N 9 HOH 7  2007 2007 HOH HOH B . 
N 9 HOH 8  2008 2008 HOH HOH B . 
N 9 HOH 9  2009 2009 HOH HOH B . 
N 9 HOH 10 2010 2010 HOH HOH B . 
N 9 HOH 11 2011 2011 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric   2 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,L,M 
2 1 B,G,H,I,J,K,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1340  ? 
1 MORE         -8.6  ? 
1 'SSA (A^2)'  15640 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    NA 
_pdbx_struct_special_symmetry.auth_seq_id     1303 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   K 
_pdbx_struct_special_symmetry.label_comp_id   NA 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 185 ? A CYS 208 ? 1_555  ZN ? D ZN . ? A ZN 1299 ? 1_555 SG  ? A CYS 139 ? A CYS 162 ? 1_555  107.9 ? 
2  SG  ? A CYS 185 ? A CYS 208 ? 1_555  ZN ? D ZN . ? A ZN 1299 ? 1_555 SG  ? A CYS 142 ? A CYS 165 ? 1_555  114.0 ? 
3  SG  ? A CYS 139 ? A CYS 162 ? 1_555  ZN ? D ZN . ? A ZN 1299 ? 1_555 SG  ? A CYS 142 ? A CYS 165 ? 1_555  106.4 ? 
4  SG  ? A CYS 185 ? A CYS 208 ? 1_555  ZN ? D ZN . ? A ZN 1299 ? 1_555 SG  ? A CYS 180 ? A CYS 203 ? 1_555  112.7 ? 
5  SG  ? A CYS 139 ? A CYS 162 ? 1_555  ZN ? D ZN . ? A ZN 1299 ? 1_555 SG  ? A CYS 180 ? A CYS 203 ? 1_555  108.9 ? 
6  SG  ? A CYS 142 ? A CYS 165 ? 1_555  ZN ? D ZN . ? A ZN 1299 ? 1_555 SG  ? A CYS 180 ? A CYS 203 ? 1_555  106.6 ? 
7  SG  ? B CYS 185 ? B CYS 208 ? 1_555  ZN ? G ZN . ? B ZN 1299 ? 1_555 SG  ? B CYS 142 ? B CYS 165 ? 1_555  114.8 ? 
8  SG  ? B CYS 185 ? B CYS 208 ? 1_555  ZN ? G ZN . ? B ZN 1299 ? 1_555 SG  ? B CYS 139 ? B CYS 162 ? 1_555  108.5 ? 
9  SG  ? B CYS 142 ? B CYS 165 ? 1_555  ZN ? G ZN . ? B ZN 1299 ? 1_555 SG  ? B CYS 139 ? B CYS 162 ? 1_555  109.7 ? 
10 SG  ? B CYS 185 ? B CYS 208 ? 1_555  ZN ? G ZN . ? B ZN 1299 ? 1_555 SG  ? B CYS 180 ? B CYS 203 ? 1_555  107.8 ? 
11 SG  ? B CYS 142 ? B CYS 165 ? 1_555  ZN ? G ZN . ? B ZN 1299 ? 1_555 SG  ? B CYS 180 ? B CYS 203 ? 1_555  107.9 ? 
12 SG  ? B CYS 139 ? B CYS 162 ? 1_555  ZN ? G ZN . ? B ZN 1299 ? 1_555 SG  ? B CYS 180 ? B CYS 203 ? 1_555  107.9 ? 
13 OD1 ? B ASP 201 ? B ASP 224 ? 1_555  NA ? K NA . ? B NA 1303 ? 1_555 OD2 ? B ASP 203 ? B ASP 226 ? 12_544 89.0  ? 
14 OD1 ? B ASP 201 ? B ASP 224 ? 1_555  NA ? K NA . ? B NA 1303 ? 1_555 OD1 ? B ASP 201 ? B ASP 224 ? 12_544 175.7 ? 
15 OD2 ? B ASP 203 ? B ASP 226 ? 12_544 NA ? K NA . ? B NA 1303 ? 1_555 OD1 ? B ASP 201 ? B ASP 224 ? 12_544 87.9  ? 
16 OD1 ? B ASP 201 ? B ASP 224 ? 1_555  NA ? K NA . ? B NA 1303 ? 1_555 OD2 ? B ASP 203 ? B ASP 226 ? 1_555  87.8  ? 
17 OD2 ? B ASP 203 ? B ASP 226 ? 12_544 NA ? K NA . ? B NA 1303 ? 1_555 OD2 ? B ASP 203 ? B ASP 226 ? 1_555  85.0  ? 
18 OD1 ? B ASP 201 ? B ASP 224 ? 12_544 NA ? K NA . ? B NA 1303 ? 1_555 OD2 ? B ASP 203 ? B ASP 226 ? 1_555  89.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-08-20 
2 'Structure model' 1 1 2014-10-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 2 'Structure model' Other                 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -22.8244 -26.2668 -6.2798  0.0478 0.1538 0.1671 0.0014  -0.0026 -0.0904 0.0298 0.0321 0.0180 
0.0307  0.0166  0.0166 -0.0045 0.0072  -0.0599 -0.0055 0.0145 -0.0647 -0.0068 -0.0324 -0.0100 
'X-RAY DIFFRACTION' 2 ? refined 3.2455   -30.0096 -26.7052 0.1029 0.0894 0.1781 -0.0235 0.0800  -0.0590 0.5722 0.0012 0.7361 
-0.0173 -0.6490 0.0196 -0.0401 -0.0226 -0.0188 0.0033  0.0094 0.0099  0.0546  0.0225  0.0306  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 35 ? ? A 298 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 33 ? ? B 298 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.8.0073 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             4UTX 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;N-TERMINAL RESIDUES GIDPFT ARE ENCODED ON PET151
EXPRESSION VECTOR AND DO NOT BELONG TO THE NATIVE PROTEIN
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    40 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   GLU 
_pdbx_validate_close_contact.auth_seq_id_2    298 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OD1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ASN 
_pdbx_validate_symm_contact.auth_seq_id_1     189 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OD1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ASN 
_pdbx_validate_symm_contact.auth_seq_id_2     189 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   12_554 
_pdbx_validate_symm_contact.dist              2.14 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              123 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              123 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              123 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.27 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.03 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 74  ? ? 49.01   -131.44 
2  1 ASP A 90  ? ? -152.15 70.21   
3  1 GLU A 140 ? ? 55.42   14.94   
4  1 SER A 164 ? ? -79.66  -72.11  
5  1 ASN A 171 ? ? -161.03 118.23  
6  1 ALA A 179 ? ? -38.53  -29.27  
7  1 LYS A 206 ? ? 69.12   -64.23  
8  1 CYS A 208 ? ? -97.00  -68.28  
9  1 THR A 246 ? ? -174.15 -174.81 
10 1 ARG B 67  ? ? -120.39 -67.11  
11 1 ARG B 74  ? ? 50.05   -130.37 
12 1 ASP B 90  ? ? -154.50 70.99   
13 1 GLU B 140 ? ? 54.45   17.01   
14 1 ASN B 171 ? ? -161.04 119.43  
15 1 ALA B 179 ? ? -38.17  -30.03  
16 1 ASN B 189 ? ? -99.91  30.32   
17 1 CYS B 208 ? ? -97.88  -69.55  
18 1 THR B 246 ? ? -175.85 -174.53 
19 1 GLU C 5   ? ? 53.36   18.11   
20 1 TYR C 6   ? ? 70.84   32.84   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 24  ? A GLY 1   
2  1 Y 1 A ILE 25  ? A ILE 2   
3  1 Y 1 A ASP 26  ? A ASP 3   
4  1 Y 1 A PRO 27  ? A PRO 4   
5  1 Y 1 A PHE 28  ? A PHE 5   
6  1 Y 1 A THR 29  ? A THR 6   
7  1 Y 1 A THR 30  ? A THR 7   
8  1 Y 1 A ARG 31  ? A ARG 8   
9  1 Y 1 A PRO 32  ? A PRO 9   
10 1 Y 1 A SER 33  ? A SER 10  
11 1 Y 1 A SER 34  ? A SER 11  
12 1 Y 1 A ARG 280 ? A ARG 257 
13 1 Y 1 A PHE 281 ? A PHE 258 
14 1 Y 1 B GLY 24  ? B GLY 1   
15 1 Y 1 B ILE 25  ? B ILE 2   
16 1 Y 1 B ASP 26  ? B ASP 3   
17 1 Y 1 B PRO 27  ? B PRO 4   
18 1 Y 1 B PHE 28  ? B PHE 5   
19 1 Y 1 B THR 29  ? B THR 6   
20 1 Y 1 B THR 30  ? B THR 7   
21 1 Y 1 B ARG 31  ? B ARG 8   
22 1 Y 1 B PRO 32  ? B PRO 9   
23 1 Y 1 B THR 275 ? B THR 252 
24 1 Y 1 B PRO 276 ? B PRO 253 
25 1 Y 1 B ALA 277 ? B ALA 254 
26 1 Y 1 B THR 278 ? B THR 255 
27 1 Y 1 B GLN 279 ? B GLN 256 
28 1 Y 1 B ARG 280 ? B ARG 257 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION'                                            ZN  
4 1,2-ETHANEDIOL                                        EDO 
5 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 
6 'DIMETHYL SULFOXIDE'                                  DMS 
7 'SODIUM ION'                                          NA  
8 '3-NITROPROPANOIC ACID'                               3NP 
9 water                                                 HOH 
#