data_4WNC
# 
_entry.id   4WNC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4WNC         
WWPDB D_1000204125 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          4WNI 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4WNC 
_pdbx_database_status.recvd_initial_deposition_date   2014-10-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Garcin, E.D.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                1770 
_citation.page_last                 1785 
_citation.title                     
'A Dimer Interface Mutation in Glyceraldehyde-3-Phosphate Dehydrogenase Regulates Its Binding to AU-rich RNA.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.618165 
_citation.pdbx_database_id_PubMed   25451934 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'White, M.R.'    1  
primary 'Khan, M.M.'     2  
primary 'Deredge, D.'    3  
primary 'Ross, C.R.'     4  
primary 'Quintyn, R.'    5  
primary 'Zucconi, B.E.'  6  
primary 'Wysocki, V.H.'  7  
primary 'Wintrode, P.L.' 8  
primary 'Wilson, G.M.'   9  
primary 'Garcin, E.D.'   10 
# 
_cell.length_a           132.537 
_cell.length_b           81.423 
_cell.length_c           147.802 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.060 
_cell.angle_gamma        90.000 
_cell.entry_id           4WNC 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         4WNC 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glyceraldehyde-3-phosphate dehydrogenase' 36099.168 8    1.2.1.12,2.6.99.- ? ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE          663.425   6    ?                 ? ? ? 
3 non-polymer syn 'ZINC ION'                                 65.409    6    ?                 ? ? ? 
4 non-polymer syn 'ACETATE ION'                              59.044    2    ?                 ? ? ? 
5 water       nat water                                      18.015    2399 ?                 ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GAPDH,Peptidyl-cysteine S-nitrosylase GAPDH' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQER
DPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPL
AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY
SNRVVDLMAHMASKE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQER
DPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPL
AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY
SNRVVDLMAHMASKE
;
_entity_poly.pdbx_strand_id                 O,A,B,C,D,E,F,G 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   LYS n 
1 4   VAL n 
1 5   LYS n 
1 6   VAL n 
1 7   GLY n 
1 8   VAL n 
1 9   ASN n 
1 10  GLY n 
1 11  PHE n 
1 12  GLY n 
1 13  ARG n 
1 14  ILE n 
1 15  GLY n 
1 16  ARG n 
1 17  LEU n 
1 18  VAL n 
1 19  THR n 
1 20  ARG n 
1 21  ALA n 
1 22  ALA n 
1 23  PHE n 
1 24  ASN n 
1 25  SER n 
1 26  GLY n 
1 27  LYS n 
1 28  VAL n 
1 29  ASP n 
1 30  ILE n 
1 31  VAL n 
1 32  ALA n 
1 33  ILE n 
1 34  ASN n 
1 35  ASP n 
1 36  PRO n 
1 37  PHE n 
1 38  ILE n 
1 39  ASP n 
1 40  LEU n 
1 41  ASN n 
1 42  TYR n 
1 43  MET n 
1 44  VAL n 
1 45  TYR n 
1 46  MET n 
1 47  PHE n 
1 48  GLN n 
1 49  TYR n 
1 50  ASP n 
1 51  SER n 
1 52  THR n 
1 53  HIS n 
1 54  GLY n 
1 55  LYS n 
1 56  PHE n 
1 57  HIS n 
1 58  GLY n 
1 59  THR n 
1 60  VAL n 
1 61  LYS n 
1 62  ALA n 
1 63  GLU n 
1 64  ASN n 
1 65  GLY n 
1 66  LYS n 
1 67  LEU n 
1 68  VAL n 
1 69  ILE n 
1 70  ASN n 
1 71  GLY n 
1 72  ASN n 
1 73  PRO n 
1 74  ILE n 
1 75  THR n 
1 76  ILE n 
1 77  PHE n 
1 78  GLN n 
1 79  GLU n 
1 80  ARG n 
1 81  ASP n 
1 82  PRO n 
1 83  SER n 
1 84  LYS n 
1 85  ILE n 
1 86  LYS n 
1 87  TRP n 
1 88  GLY n 
1 89  ASP n 
1 90  ALA n 
1 91  GLY n 
1 92  ALA n 
1 93  GLU n 
1 94  TYR n 
1 95  VAL n 
1 96  VAL n 
1 97  GLU n 
1 98  SER n 
1 99  THR n 
1 100 GLY n 
1 101 VAL n 
1 102 PHE n 
1 103 THR n 
1 104 THR n 
1 105 MET n 
1 106 GLU n 
1 107 LYS n 
1 108 ALA n 
1 109 GLY n 
1 110 ALA n 
1 111 HIS n 
1 112 LEU n 
1 113 GLN n 
1 114 GLY n 
1 115 GLY n 
1 116 ALA n 
1 117 LYS n 
1 118 ARG n 
1 119 VAL n 
1 120 ILE n 
1 121 ILE n 
1 122 SER n 
1 123 ALA n 
1 124 PRO n 
1 125 SER n 
1 126 ALA n 
1 127 ASP n 
1 128 ALA n 
1 129 PRO n 
1 130 MET n 
1 131 PHE n 
1 132 VAL n 
1 133 MET n 
1 134 GLY n 
1 135 VAL n 
1 136 ASN n 
1 137 HIS n 
1 138 GLU n 
1 139 LYS n 
1 140 TYR n 
1 141 ASP n 
1 142 ASN n 
1 143 SER n 
1 144 LEU n 
1 145 LYS n 
1 146 ILE n 
1 147 ILE n 
1 148 SER n 
1 149 ASN n 
1 150 ALA n 
1 151 SER n 
1 152 CYS n 
1 153 THR n 
1 154 THR n 
1 155 ASN n 
1 156 CYS n 
1 157 LEU n 
1 158 ALA n 
1 159 PRO n 
1 160 LEU n 
1 161 ALA n 
1 162 LYS n 
1 163 VAL n 
1 164 ILE n 
1 165 HIS n 
1 166 ASP n 
1 167 ASN n 
1 168 PHE n 
1 169 GLY n 
1 170 ILE n 
1 171 VAL n 
1 172 GLU n 
1 173 GLY n 
1 174 LEU n 
1 175 MET n 
1 176 THR n 
1 177 THR n 
1 178 VAL n 
1 179 HIS n 
1 180 ALA n 
1 181 ILE n 
1 182 THR n 
1 183 ALA n 
1 184 THR n 
1 185 GLN n 
1 186 LYS n 
1 187 THR n 
1 188 VAL n 
1 189 ASP n 
1 190 GLY n 
1 191 PRO n 
1 192 SER n 
1 193 GLY n 
1 194 LYS n 
1 195 LEU n 
1 196 TRP n 
1 197 ARG n 
1 198 ASP n 
1 199 GLY n 
1 200 ARG n 
1 201 GLY n 
1 202 ALA n 
1 203 LEU n 
1 204 GLN n 
1 205 ASN n 
1 206 ILE n 
1 207 ILE n 
1 208 PRO n 
1 209 ALA n 
1 210 SER n 
1 211 THR n 
1 212 GLY n 
1 213 ALA n 
1 214 ALA n 
1 215 LYS n 
1 216 ALA n 
1 217 VAL n 
1 218 GLY n 
1 219 LYS n 
1 220 VAL n 
1 221 ILE n 
1 222 PRO n 
1 223 GLU n 
1 224 LEU n 
1 225 ASN n 
1 226 GLY n 
1 227 LYS n 
1 228 LEU n 
1 229 THR n 
1 230 GLY n 
1 231 MET n 
1 232 ALA n 
1 233 PHE n 
1 234 ARG n 
1 235 VAL n 
1 236 PRO n 
1 237 THR n 
1 238 ALA n 
1 239 ASN n 
1 240 VAL n 
1 241 SER n 
1 242 VAL n 
1 243 VAL n 
1 244 ASP n 
1 245 LEU n 
1 246 THR n 
1 247 CYS n 
1 248 ARG n 
1 249 LEU n 
1 250 GLU n 
1 251 LYS n 
1 252 PRO n 
1 253 ALA n 
1 254 LYS n 
1 255 TYR n 
1 256 ASP n 
1 257 ASP n 
1 258 ILE n 
1 259 LYS n 
1 260 LYS n 
1 261 VAL n 
1 262 VAL n 
1 263 LYS n 
1 264 GLN n 
1 265 ALA n 
1 266 SER n 
1 267 GLU n 
1 268 GLY n 
1 269 PRO n 
1 270 LEU n 
1 271 LYS n 
1 272 GLY n 
1 273 ILE n 
1 274 LEU n 
1 275 GLY n 
1 276 TYR n 
1 277 THR n 
1 278 GLU n 
1 279 HIS n 
1 280 GLN n 
1 281 VAL n 
1 282 VAL n 
1 283 SER n 
1 284 SER n 
1 285 ASP n 
1 286 PHE n 
1 287 ASN n 
1 288 SER n 
1 289 ASP n 
1 290 THR n 
1 291 HIS n 
1 292 SER n 
1 293 SER n 
1 294 THR n 
1 295 PHE n 
1 296 ASP n 
1 297 ALA n 
1 298 GLY n 
1 299 ALA n 
1 300 GLY n 
1 301 ILE n 
1 302 ALA n 
1 303 LEU n 
1 304 ASN n 
1 305 ASP n 
1 306 HIS n 
1 307 PHE n 
1 308 VAL n 
1 309 LYS n 
1 310 LEU n 
1 311 ILE n 
1 312 SER n 
1 313 TRP n 
1 314 TYR n 
1 315 ASP n 
1 316 ASN n 
1 317 GLU n 
1 318 PHE n 
1 319 GLY n 
1 320 TYR n 
1 321 SER n 
1 322 ASN n 
1 323 ARG n 
1 324 VAL n 
1 325 VAL n 
1 326 ASP n 
1 327 LEU n 
1 328 MET n 
1 329 ALA n 
1 330 HIS n 
1 331 MET n 
1 332 ALA n 
1 333 SER n 
1 334 LYS n 
1 335 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   335 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GAPDH, GAPD, CDABP0047, OK/SW-cl.12' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pRIPL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.db_code                    G3P_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.details                    ? 
_struct_ref.entity_id                  1 
_struct_ref.id                         1 
_struct_ref.seq_align                  ? 
_struct_ref.seq_dif                    ? 
_struct_ref.pdbx_db_accession          P04406 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   
;MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQER
DPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPL
AKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGY
SNRVVDLMAHMASKE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_align_end             ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4WNC O 1 ? 335 ? P04406 1 ? 335 ? 1 335 
2 1 4WNC A 1 ? 335 ? P04406 1 ? 335 ? 1 335 
3 1 4WNC B 1 ? 335 ? P04406 1 ? 335 ? 1 335 
4 1 4WNC C 1 ? 335 ? P04406 1 ? 335 ? 1 335 
5 1 4WNC D 1 ? 335 ? P04406 1 ? 335 ? 1 335 
6 1 4WNC E 1 ? 335 ? P04406 1 ? 335 ? 1 335 
7 1 4WNC F 1 ? 335 ? P04406 1 ? 335 ? 1 335 
8 1 4WNC G 1 ? 335 ? P04406 1 ? 335 ? 1 335 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                     ? 'C2 H3 O2 -1'       59.044  
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                        ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4WNC 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.66 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.7 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% (w/v) PEG6000, 0.1 M sodium acetate, 0.01 M ZnCl2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-10-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.116 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 12.3.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.116 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   12.3.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.d_resolution_high            1.990 
_reflns.d_resolution_low             50.000 
_reflns.pdbx_number_measured_all     795088 
_reflns.number_obs                   216430 
_reflns.pdbx_Rmerge_I_obs            0.092 
_reflns.pdbx_netI_over_av_sigmaI     11.221 
_reflns.pdbx_netI_over_sigmaI        19.100 
_reflns.pdbx_chi_squared             1.311 
_reflns.pdbx_redundancy              3.700 
_reflns.percent_possible_obs         99.900 
_reflns.B_iso_Wilson_estimate        17.270 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4WNC 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  1.990 2.020  ? ? ? 0 0.336 ? ? 2.387 3.300 ? ? ? 10672 ? ? ? ? 99.900  ? ? ? 
1 2  2.020 2.060  ? ? ? 0 0.310 ? ? 2.050 3.600 ? ? ? 10789 ? ? ? ? 100.000 ? ? ? 
1 3  2.060 2.100  ? ? ? 0 0.314 ? ? 1.964 3.600 ? ? ? 10772 ? ? ? ? 99.800  ? ? ? 
1 4  2.100 2.140  ? ? ? 0 0.236 ? ? 1.498 3.700 ? ? ? 10812 ? ? ? ? 100.000 ? ? ? 
1 5  2.140 2.190  ? ? ? 0 0.208 ? ? 1.391 3.700 ? ? ? 10737 ? ? ? ? 100.000 ? ? ? 
1 6  2.190 2.240  ? ? ? 0 0.196 ? ? 1.449 3.700 ? ? ? 10763 ? ? ? ? 100.000 ? ? ? 
1 7  2.240 2.300  ? ? ? 0 0.198 ? ? 1.487 3.600 ? ? ? 10768 ? ? ? ? 99.900  ? ? ? 
1 8  2.300 2.360  ? ? ? 0 0.154 ? ? 1.137 3.700 ? ? ? 10836 ? ? ? ? 100.000 ? ? ? 
1 9  2.360 2.430  ? ? ? 0 0.141 ? ? 1.116 3.700 ? ? ? 10720 ? ? ? ? 100.000 ? ? ? 
1 10 2.430 2.510  ? ? ? 0 0.131 ? ? 1.171 3.700 ? ? ? 10842 ? ? ? ? 100.000 ? ? ? 
1 11 2.510 2.600  ? ? ? 0 0.116 ? ? 1.125 3.700 ? ? ? 10840 ? ? ? ? 100.000 ? ? ? 
1 12 2.600 2.700  ? ? ? 0 0.118 ? ? 1.149 3.700 ? ? ? 10737 ? ? ? ? 99.900  ? ? ? 
1 13 2.700 2.820  ? ? ? 0 0.099 ? ? 1.102 3.700 ? ? ? 10868 ? ? ? ? 100.000 ? ? ? 
1 14 2.820 2.970  ? ? ? 0 0.088 ? ? 1.040 3.700 ? ? ? 10794 ? ? ? ? 100.000 ? ? ? 
1 15 2.970 3.160  ? ? ? 0 0.077 ? ? 1.082 3.700 ? ? ? 10851 ? ? ? ? 99.900  ? ? ? 
1 16 3.160 3.400  ? ? ? 0 0.070 ? ? 1.067 3.700 ? ? ? 10840 ? ? ? ? 100.000 ? ? ? 
1 17 3.400 3.740  ? ? ? 0 0.071 ? ? 1.108 3.700 ? ? ? 10859 ? ? ? ? 99.900  ? ? ? 
1 18 3.740 4.290  ? ? ? 0 0.065 ? ? 1.083 3.700 ? ? ? 10901 ? ? ? ? 99.900  ? ? ? 
1 19 4.290 5.400  ? ? ? 0 0.050 ? ? 1.041 3.600 ? ? ? 10934 ? ? ? ? 99.900  ? ? ? 
1 20 5.400 50.000 ? ? ? 0 0.040 ? ? 1.038 3.700 ? ? ? 11095 ? ? ? ? 99.400  ? ? ? 
# 
_refine.entry_id                                 4WNC 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            1.990 
_refine.ls_d_res_low                             49.3610 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.4500 
_refine.ls_number_reflns_obs                     215842 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1390 
_refine.ls_R_factor_R_work                       0.1387 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.1790 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 0.9300 
_refine.ls_number_reflns_R_free                  2000 
_refine.ls_number_reflns_R_work                  213842 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               24.7573 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1500 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      1U8F 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                158.820 
_refine.B_iso_min                                5.790 
_refine.pdbx_overall_phase_error                 16.6500 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.990 
_refine_hist.d_res_low                        49.3610 
_refine_hist.pdbx_number_atoms_ligand         440 
_refine_hist.number_atoms_solvent             2399 
_refine_hist.number_atoms_total               23023 
_refine_hist.pdbx_number_residues_total       2664 
_refine_hist.pdbx_B_iso_mean_ligand           31.18 
_refine_hist.pdbx_B_iso_mean_solvent          33.10 
_refine_hist.pdbx_number_atoms_protein        20184 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           20909 0.009  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          28361 1.182  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     3215  0.069  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      3628  0.006  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 7475  12.928 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_obs 
1.9861 2.0357  14 96.0000  14642 . 0.1634 0.1896 . 135 . 14777 . 'X-RAY DIFFRACTION' . 
2.0357 2.0908  14 99.0000  15125 . 0.1614 0.2012 . 137 . 15262 . 'X-RAY DIFFRACTION' . 
2.0908 2.1523  14 100.0000 15200 . 0.1470 0.1972 . 140 . 15340 . 'X-RAY DIFFRACTION' . 
2.1523 2.2218  14 100.0000 15224 . 0.1393 0.1888 . 144 . 15368 . 'X-RAY DIFFRACTION' . 
2.2218 2.3012  14 99.0000  15193 . 0.1434 0.1847 . 145 . 15338 . 'X-RAY DIFFRACTION' . 
2.3012 2.3933  14 100.0000 15357 . 0.1331 0.1803 . 144 . 15501 . 'X-RAY DIFFRACTION' . 
2.3933 2.5022  14 100.0000 15279 . 0.1377 0.2137 . 145 . 15424 . 'X-RAY DIFFRACTION' . 
2.5022 2.6341  14 100.0000 15313 . 0.1345 0.1863 . 142 . 15455 . 'X-RAY DIFFRACTION' . 
2.6341 2.7992  14 100.0000 15304 . 0.1470 0.2402 . 139 . 15443 . 'X-RAY DIFFRACTION' . 
2.7992 3.0152  14 100.0000 15368 . 0.1497 0.1866 . 143 . 15511 . 'X-RAY DIFFRACTION' . 
3.0152 3.3186  14 100.0000 15342 . 0.1423 0.1601 . 145 . 15487 . 'X-RAY DIFFRACTION' . 
3.3186 3.7987  14 100.0000 15415 . 0.1333 0.2253 . 144 . 15559 . 'X-RAY DIFFRACTION' . 
3.7987 4.7853  14 100.0000 15470 . 0.1122 0.1191 . 145 . 15615 . 'X-RAY DIFFRACTION' . 
4.7853 49.3766 14 99.0000  15610 . 0.1462 0.1547 . 152 . 15762 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                     4WNC 
_struct.title                        'Crystal structure of human wild-type GAPDH at 1.99 angstroms resolution' 
_struct.pdbx_descriptor              'Glyceraldehyde 3-phosphate dehydrogenase (E.C.1.2.1.12)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4WNC 
_struct_keywords.text            'glycolytic, Rossman fold, NAD-binding, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 12  ? GLY A 26  ? GLY O 12  GLY O 26  1 ? 15 
HELX_P HELX_P2   AA2 ASP A 39  ? TYR A 49  ? ASP O 39  TYR O 49  1 ? 11 
HELX_P HELX_P3   AA3 ASP A 81  ? ILE A 85  ? ASP O 81  ILE O 85  5 ? 5  
HELX_P HELX_P4   AA4 LYS A 86  ? GLY A 91  ? LYS O 86  GLY O 91  1 ? 6  
HELX_P HELX_P5   AA5 THR A 104 ? GLY A 109 ? THR O 104 GLY O 109 1 ? 6  
HELX_P HELX_P6   AA6 GLY A 109 ? GLY A 114 ? GLY O 109 GLY O 114 1 ? 6  
HELX_P HELX_P7   AA7 ASN A 136 ? TYR A 140 ? ASN O 136 TYR O 140 5 ? 5  
HELX_P HELX_P8   AA8 SER A 151 ? PHE A 168 ? SER O 151 PHE O 168 1 ? 18 
HELX_P HELX_P9   AA9 LEU A 195 ? ARG A 200 ? LEU O 195 ARG O 200 5 ? 6  
HELX_P HELX_P10  AB1 GLY A 212 ? ILE A 221 ? GLY O 212 ILE O 221 1 ? 10 
HELX_P HELX_P11  AB2 PRO A 222 ? ASN A 225 ? PRO O 222 ASN O 225 5 ? 4  
HELX_P HELX_P12  AB3 LYS A 254 ? GLY A 268 ? LYS O 254 GLY O 268 1 ? 15 
HELX_P HELX_P13  AB4 VAL A 282 ? ASN A 287 ? VAL O 282 ASN O 287 5 ? 6  
HELX_P HELX_P14  AB5 GLU A 317 ? GLU A 335 ? GLU O 317 GLU O 335 1 ? 19 
HELX_P HELX_P15  AB6 GLY B 12  ? GLY B 26  ? GLY A 12  GLY A 26  1 ? 15 
HELX_P HELX_P16  AB7 ASP B 39  ? TYR B 49  ? ASP A 39  TYR A 49  1 ? 11 
HELX_P HELX_P17  AB8 ASP B 81  ? ILE B 85  ? ASP A 81  ILE A 85  5 ? 5  
HELX_P HELX_P18  AB9 LYS B 86  ? GLY B 91  ? LYS A 86  GLY A 91  1 ? 6  
HELX_P HELX_P19  AC1 THR B 104 ? GLY B 109 ? THR A 104 GLY A 109 1 ? 6  
HELX_P HELX_P20  AC2 ALA B 110 ? GLN B 113 ? ALA A 110 GLN A 113 5 ? 4  
HELX_P HELX_P21  AC3 ASN B 136 ? TYR B 140 ? ASN A 136 TYR A 140 5 ? 5  
HELX_P HELX_P22  AC4 SER B 151 ? GLY B 169 ? SER A 151 GLY A 169 1 ? 19 
HELX_P HELX_P23  AC5 LEU B 195 ? ARG B 200 ? LEU A 195 ARG A 200 5 ? 6  
HELX_P HELX_P24  AC6 GLY B 212 ? ILE B 221 ? GLY A 212 ILE A 221 1 ? 10 
HELX_P HELX_P25  AC7 PRO B 222 ? ASN B 225 ? PRO A 222 ASN A 225 5 ? 4  
HELX_P HELX_P26  AC8 LYS B 254 ? GLY B 268 ? LYS A 254 GLY A 268 1 ? 15 
HELX_P HELX_P27  AC9 VAL B 282 ? ASN B 287 ? VAL A 282 ASN A 287 5 ? 6  
HELX_P HELX_P28  AD1 GLU B 317 ? GLU B 335 ? GLU A 317 GLU A 335 1 ? 19 
HELX_P HELX_P29  AD2 GLY C 12  ? GLY C 26  ? GLY B 12  GLY B 26  1 ? 15 
HELX_P HELX_P30  AD3 ASP C 39  ? TYR C 49  ? ASP B 39  TYR B 49  1 ? 11 
HELX_P HELX_P31  AD4 ASP C 81  ? ILE C 85  ? ASP B 81  ILE B 85  5 ? 5  
HELX_P HELX_P32  AD5 LYS C 86  ? GLY C 91  ? LYS B 86  GLY B 91  1 ? 6  
HELX_P HELX_P33  AD6 THR C 104 ? GLY C 109 ? THR B 104 GLY B 109 1 ? 6  
HELX_P HELX_P34  AD7 ALA C 110 ? GLN C 113 ? ALA B 110 GLN B 113 5 ? 4  
HELX_P HELX_P35  AD8 ASN C 136 ? TYR C 140 ? ASN B 136 TYR B 140 5 ? 5  
HELX_P HELX_P36  AD9 SER C 151 ? GLY C 169 ? SER B 151 GLY B 169 1 ? 19 
HELX_P HELX_P37  AE1 LEU C 195 ? ARG C 200 ? LEU B 195 ARG B 200 5 ? 6  
HELX_P HELX_P38  AE2 GLY C 212 ? ILE C 221 ? GLY B 212 ILE B 221 1 ? 10 
HELX_P HELX_P39  AE3 PRO C 222 ? ASN C 225 ? PRO B 222 ASN B 225 5 ? 4  
HELX_P HELX_P40  AE4 LYS C 254 ? GLY C 268 ? LYS B 254 GLY B 268 1 ? 15 
HELX_P HELX_P41  AE5 VAL C 282 ? ASN C 287 ? VAL B 282 ASN B 287 5 ? 6  
HELX_P HELX_P42  AE6 GLU C 317 ? GLU C 335 ? GLU B 317 GLU B 335 1 ? 19 
HELX_P HELX_P43  AE7 GLY D 12  ? GLY D 26  ? GLY C 12  GLY C 26  1 ? 15 
HELX_P HELX_P44  AE8 ASP D 39  ? TYR D 49  ? ASP C 39  TYR C 49  1 ? 11 
HELX_P HELX_P45  AE9 ASP D 81  ? ILE D 85  ? ASP C 81  ILE C 85  5 ? 5  
HELX_P HELX_P46  AF1 LYS D 86  ? GLY D 91  ? LYS C 86  GLY C 91  1 ? 6  
HELX_P HELX_P47  AF2 THR D 104 ? GLY D 109 ? THR C 104 GLY C 109 1 ? 6  
HELX_P HELX_P48  AF3 ALA D 110 ? GLN D 113 ? ALA C 110 GLN C 113 5 ? 4  
HELX_P HELX_P49  AF4 ASN D 136 ? TYR D 140 ? ASN C 136 TYR C 140 5 ? 5  
HELX_P HELX_P50  AF5 SER D 151 ? GLY D 169 ? SER C 151 GLY C 169 1 ? 19 
HELX_P HELX_P51  AF6 LEU D 195 ? ARG D 200 ? LEU C 195 ARG C 200 5 ? 6  
HELX_P HELX_P52  AF7 GLY D 212 ? ILE D 221 ? GLY C 212 ILE C 221 1 ? 10 
HELX_P HELX_P53  AF8 PRO D 222 ? ASN D 225 ? PRO C 222 ASN C 225 5 ? 4  
HELX_P HELX_P54  AF9 LYS D 254 ? GLY D 268 ? LYS C 254 GLY C 268 1 ? 15 
HELX_P HELX_P55  AG1 VAL D 282 ? ASN D 287 ? VAL C 282 ASN C 287 5 ? 6  
HELX_P HELX_P56  AG2 GLU D 317 ? LYS D 334 ? GLU C 317 LYS C 334 1 ? 18 
HELX_P HELX_P57  AG3 GLY E 12  ? GLY E 26  ? GLY D 12  GLY D 26  1 ? 15 
HELX_P HELX_P58  AG4 ASP E 39  ? TYR E 49  ? ASP D 39  TYR D 49  1 ? 11 
HELX_P HELX_P59  AG5 ASP E 81  ? ILE E 85  ? ASP D 81  ILE D 85  5 ? 5  
HELX_P HELX_P60  AG6 LYS E 86  ? GLY E 91  ? LYS D 86  GLY D 91  1 ? 6  
HELX_P HELX_P61  AG7 THR E 104 ? GLY E 109 ? THR D 104 GLY D 109 1 ? 6  
HELX_P HELX_P62  AG8 GLY E 109 ? GLY E 114 ? GLY D 109 GLY D 114 1 ? 6  
HELX_P HELX_P63  AG9 ASN E 136 ? TYR E 140 ? ASN D 136 TYR D 140 5 ? 5  
HELX_P HELX_P64  AH1 SER E 151 ? PHE E 168 ? SER D 151 PHE D 168 1 ? 18 
HELX_P HELX_P65  AH2 LEU E 195 ? ARG E 200 ? LEU D 195 ARG D 200 5 ? 6  
HELX_P HELX_P66  AH3 GLY E 212 ? ILE E 221 ? GLY D 212 ILE D 221 1 ? 10 
HELX_P HELX_P67  AH4 PRO E 222 ? ASN E 225 ? PRO D 222 ASN D 225 5 ? 4  
HELX_P HELX_P68  AH5 LYS E 254 ? GLY E 268 ? LYS D 254 GLY D 268 1 ? 15 
HELX_P HELX_P69  AH6 VAL E 282 ? ASN E 287 ? VAL D 282 ASN D 287 5 ? 6  
HELX_P HELX_P70  AH7 GLU E 317 ? LYS E 334 ? GLU D 317 LYS D 334 1 ? 18 
HELX_P HELX_P71  AH8 GLY F 12  ? GLY F 26  ? GLY E 12  GLY E 26  1 ? 15 
HELX_P HELX_P72  AH9 ASP F 39  ? TYR F 49  ? ASP E 39  TYR E 49  1 ? 11 
HELX_P HELX_P73  AI1 ASP F 81  ? ILE F 85  ? ASP E 81  ILE E 85  5 ? 5  
HELX_P HELX_P74  AI2 LYS F 86  ? GLY F 91  ? LYS E 86  GLY E 91  1 ? 6  
HELX_P HELX_P75  AI3 THR F 104 ? GLY F 109 ? THR E 104 GLY E 109 1 ? 6  
HELX_P HELX_P76  AI4 GLY F 109 ? GLY F 114 ? GLY E 109 GLY E 114 1 ? 6  
HELX_P HELX_P77  AI5 ASN F 136 ? TYR F 140 ? ASN E 136 TYR E 140 5 ? 5  
HELX_P HELX_P78  AI6 SER F 151 ? GLY F 169 ? SER E 151 GLY E 169 1 ? 19 
HELX_P HELX_P79  AI7 LEU F 195 ? ARG F 200 ? LEU E 195 ARG E 200 5 ? 6  
HELX_P HELX_P80  AI8 GLY F 212 ? ILE F 221 ? GLY E 212 ILE E 221 1 ? 10 
HELX_P HELX_P81  AI9 PRO F 222 ? ASN F 225 ? PRO E 222 ASN E 225 5 ? 4  
HELX_P HELX_P82  AJ1 LYS F 254 ? GLY F 268 ? LYS E 254 GLY E 268 1 ? 15 
HELX_P HELX_P83  AJ2 VAL F 282 ? ASN F 287 ? VAL E 282 ASN E 287 5 ? 6  
HELX_P HELX_P84  AJ3 GLU F 317 ? LYS F 334 ? GLU E 317 LYS E 334 1 ? 18 
HELX_P HELX_P85  AJ4 GLY G 12  ? GLY G 26  ? GLY F 12  GLY F 26  1 ? 15 
HELX_P HELX_P86  AJ5 ASP G 39  ? TYR G 49  ? ASP F 39  TYR F 49  1 ? 11 
HELX_P HELX_P87  AJ6 ASP G 81  ? ILE G 85  ? ASP F 81  ILE F 85  5 ? 5  
HELX_P HELX_P88  AJ7 LYS G 86  ? GLY G 91  ? LYS F 86  GLY F 91  1 ? 6  
HELX_P HELX_P89  AJ8 THR G 104 ? GLY G 109 ? THR F 104 GLY F 109 1 ? 6  
HELX_P HELX_P90  AJ9 GLY G 109 ? GLY G 114 ? GLY F 109 GLY F 114 1 ? 6  
HELX_P HELX_P91  AK1 ASN G 136 ? TYR G 140 ? ASN F 136 TYR F 140 5 ? 5  
HELX_P HELX_P92  AK2 SER G 151 ? GLY G 169 ? SER F 151 GLY F 169 1 ? 19 
HELX_P HELX_P93  AK3 LEU G 195 ? ARG G 200 ? LEU F 195 ARG F 200 5 ? 6  
HELX_P HELX_P94  AK4 GLY G 212 ? ILE G 221 ? GLY F 212 ILE F 221 1 ? 10 
HELX_P HELX_P95  AK5 PRO G 222 ? ASN G 225 ? PRO F 222 ASN F 225 5 ? 4  
HELX_P HELX_P96  AK6 LYS G 254 ? GLY G 268 ? LYS F 254 GLY F 268 1 ? 15 
HELX_P HELX_P97  AK7 VAL G 282 ? ASN G 287 ? VAL F 282 ASN F 287 5 ? 6  
HELX_P HELX_P98  AK8 GLU G 317 ? GLU G 335 ? GLU F 317 GLU F 335 1 ? 19 
HELX_P HELX_P99  AK9 GLY H 12  ? GLY H 26  ? GLY G 12  GLY G 26  1 ? 15 
HELX_P HELX_P100 AL1 ASP H 39  ? TYR H 49  ? ASP G 39  TYR G 49  1 ? 11 
HELX_P HELX_P101 AL2 ASP H 81  ? ILE H 85  ? ASP G 81  ILE G 85  5 ? 5  
HELX_P HELX_P102 AL3 LYS H 86  ? GLY H 91  ? LYS G 86  GLY G 91  1 ? 6  
HELX_P HELX_P103 AL4 THR H 104 ? GLY H 109 ? THR G 104 GLY G 109 1 ? 6  
HELX_P HELX_P104 AL5 GLY H 109 ? GLY H 114 ? GLY G 109 GLY G 114 1 ? 6  
HELX_P HELX_P105 AL6 ASN H 136 ? TYR H 140 ? ASN G 136 TYR G 140 5 ? 5  
HELX_P HELX_P106 AL7 SER H 151 ? GLY H 169 ? SER G 151 GLY G 169 1 ? 19 
HELX_P HELX_P107 AL8 LEU H 195 ? ARG H 200 ? LEU G 195 ARG G 200 5 ? 6  
HELX_P HELX_P108 AL9 GLY H 212 ? ILE H 221 ? GLY G 212 ILE G 221 1 ? 10 
HELX_P HELX_P109 AM1 PRO H 222 ? ASN H 225 ? PRO G 222 ASN G 225 5 ? 4  
HELX_P HELX_P110 AM2 LYS H 254 ? GLY H 268 ? LYS G 254 GLY G 268 1 ? 15 
HELX_P HELX_P111 AM3 VAL H 282 ? ASN H 287 ? VAL G 282 ASN G 287 5 ? 6  
HELX_P HELX_P112 AM4 GLU H 317 ? GLU H 335 ? GLU G 317 GLU G 335 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 306 NE2 ? ? ? 1_555 J  ZN  . ZN  ? ? O HIS 306 O ZN  402 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc2  metalc ? ? B GLU 63  OE1 ? ? ? 1_555 M  ZN  . ZN  ? ? A GLU 63  A ZN  402 1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc3  metalc ? ? C GLU 63  OE1 ? ? ? 1_555 O  ZN  . ZN  ? ? B GLU 63  B ZN  402 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc4  metalc ? ? D GLU 106 OE1 ? ? ? 1_555 R  ZN  . ZN  ? ? C GLU 106 C ZN  403 1_555 ? ? ? ? ? ? ? 1.893 ? 
metalc5  metalc ? ? D ASP 127 OD2 ? ? ? 1_555 R  ZN  . ZN  ? ? C ASP 127 C ZN  403 1_555 ? ? ? ? ? ? ? 1.990 ? 
metalc6  metalc ? ? D GLU 335 OXT ? ? ? 1_555 Q  ZN  . ZN  ? ? C GLU 335 C ZN  402 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc7  metalc ? ? F GLU 106 OE1 ? ? ? 1_555 J  ZN  . ZN  ? ? E GLU 106 O ZN  402 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc8  metalc ? ? F ASP 127 OD2 ? ? ? 1_555 J  ZN  . ZN  ? ? E ASP 127 O ZN  402 1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc9  metalc ? ? F GLU 335 OXT ? ? ? 1_555 V  ZN  . ZN  ? ? E GLU 335 E ZN  402 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc10 metalc ? ? J ZN  .   ZN  ? ? ? 1_555 K  ACT . O   ? ? O ZN  402 O ACT 403 1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc11 metalc ? ? J ZN  .   ZN  ? ? ? 1_555 K  ACT . OXT ? ? O ZN  402 O ACT 403 1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc12 metalc ? ? Q ZN  .   ZN  ? ? ? 1_555 Z  HOH . O   ? ? C ZN  402 C HOH 509 1_555 ? ? ? ? ? ? ? 2.577 ? 
metalc13 metalc ? ? Q ZN  .   ZN  ? ? ? 1_555 Z  HOH . O   ? ? C ZN  402 C HOH 501 1_555 ? ? ? ? ? ? ? 1.952 ? 
metalc14 metalc ? ? R ZN  .   ZN  ? ? ? 1_555 S  ACT . O   ? ? C ZN  403 C ACT 404 1_555 ? ? ? ? ? ? ? 1.887 ? 
metalc15 metalc ? ? R ZN  .   ZN  ? ? ? 1_555 S  ACT . OXT ? ? C ZN  403 C ACT 404 1_555 ? ? ? ? ? ? ? 2.700 ? 
metalc16 metalc ? ? V ZN  .   ZN  ? ? ? 1_555 BA HOH . O   ? ? E ZN  402 E HOH 505 1_555 ? ? ? ? ? ? ? 1.922 ? 
metalc17 metalc ? ? V ZN  .   ZN  ? ? ? 1_555 BA HOH . O   ? ? E ZN  402 E HOH 510 1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc18 metalc ? ? A GLU 138 OE2 ? ? ? 1_555 O  ZN  . ZN  ? ? O GLU 138 B ZN  402 2_444 ? ? ? ? ? ? ? 2.129 ? 
metalc19 metalc ? ? A HIS 330 NE2 ? ? ? 1_555 O  ZN  . ZN  ? ? O HIS 330 B ZN  402 2_444 ? ? ? ? ? ? ? 2.140 ? 
metalc20 metalc ? ? B HIS 330 ND1 ? ? ? 1_555 Q  ZN  . ZN  ? ? A HIS 330 C ZN  402 2_544 ? ? ? ? ? ? ? 2.137 ? 
metalc21 metalc ? ? C HIS 330 ND1 ? ? ? 1_555 V  ZN  . ZN  ? ? B HIS 330 E ZN  402 2_454 ? ? ? ? ? ? ? 2.135 ? 
metalc22 metalc ? ? E GLU 138 OE2 ? ? ? 1_555 M  ZN  . ZN  ? ? D GLU 138 A ZN  402 2_553 ? ? ? ? ? ? ? 2.253 ? 
metalc23 metalc ? ? E HIS 306 NE2 ? ? ? 1_555 R  ZN  . ZN  ? ? D HIS 306 C ZN  403 1_554 ? ? ? ? ? ? ? 2.061 ? 
metalc24 metalc ? ? E HIS 330 NE2 ? ? ? 1_555 M  ZN  . ZN  ? ? D HIS 330 A ZN  402 2_553 ? ? ? ? ? ? ? 2.154 ? 
metalc25 metalc ? ? M ZN  .   ZN  ? ? ? 1_555 AA HOH . O   ? ? A ZN  402 D HOH 524 2_543 ? ? ? ? ? ? ? 2.299 ? 
metalc26 metalc ? ? O ZN  .   ZN  ? ? ? 1_555 W  HOH . O   ? ? B ZN  402 O HOH 523 2_454 ? ? ? ? ? ? ? 2.246 ? 
metalc27 metalc ? ? Q ZN  .   ZN  ? ? ? 1_555 X  HOH . O   ? ? C ZN  402 A HOH 503 2_554 ? ? ? ? ? ? ? 2.096 ? 
metalc28 metalc ? ? Q ZN  .   ZN  ? ? ? 1_555 X  HOH . O   ? ? C ZN  402 A HOH 510 2_554 ? ? ? ? ? ? ? 2.173 ? 
metalc29 metalc ? ? V ZN  .   ZN  ? ? ? 1_555 Y  HOH . O   ? ? E ZN  402 B HOH 506 2_444 ? ? ? ? ? ? ? 2.106 ? 
metalc30 metalc ? ? V ZN  .   ZN  ? ? ? 1_555 Y  HOH . O   ? ? E ZN  402 B HOH 515 2_444 ? ? ? ? ? ? ? 2.203 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 7 ? 
AA3 ? 6 ? 
AA4 ? 8 ? 
AA5 ? 7 ? 
AA6 ? 6 ? 
AA7 ? 8 ? 
AA8 ? 7 ? 
AA9 ? 6 ? 
AB1 ? 8 ? 
AB2 ? 7 ? 
AB3 ? 6 ? 
AB4 ? 8 ? 
AB5 ? 7 ? 
AB6 ? 6 ? 
AB7 ? 8 ? 
AB8 ? 7 ? 
AB9 ? 6 ? 
AC1 ? 8 ? 
AC2 ? 7 ? 
AC3 ? 6 ? 
AC4 ? 8 ? 
AC5 ? 7 ? 
AC6 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA1 7 8 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? parallel      
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA4 5 6 ? parallel      
AA4 6 7 ? parallel      
AA4 7 8 ? parallel      
AA5 1 2 ? anti-parallel 
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA5 6 7 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA7 5 6 ? parallel      
AA7 6 7 ? parallel      
AA7 7 8 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? parallel      
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
AA8 6 7 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? parallel      
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AA9 5 6 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? parallel      
AB1 4 5 ? parallel      
AB1 5 6 ? parallel      
AB1 6 7 ? parallel      
AB1 7 8 ? parallel      
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB2 5 6 ? anti-parallel 
AB2 6 7 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? parallel      
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
AB4 5 6 ? parallel      
AB4 6 7 ? parallel      
AB4 7 8 ? parallel      
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB5 5 6 ? anti-parallel 
AB5 6 7 ? parallel      
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB6 5 6 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? parallel      
AB7 4 5 ? parallel      
AB7 5 6 ? parallel      
AB7 6 7 ? parallel      
AB7 7 8 ? parallel      
AB8 1 2 ? anti-parallel 
AB8 2 3 ? parallel      
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB8 5 6 ? anti-parallel 
AB8 6 7 ? parallel      
AB9 1 2 ? anti-parallel 
AB9 2 3 ? parallel      
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC1 4 5 ? parallel      
AC1 5 6 ? parallel      
AC1 6 7 ? parallel      
AC1 7 8 ? parallel      
AC2 1 2 ? anti-parallel 
AC2 2 3 ? parallel      
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC2 5 6 ? anti-parallel 
AC2 6 7 ? parallel      
AC3 1 2 ? anti-parallel 
AC3 2 3 ? parallel      
AC3 3 4 ? anti-parallel 
AC3 4 5 ? anti-parallel 
AC3 5 6 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? parallel      
AC4 4 5 ? parallel      
AC4 5 6 ? parallel      
AC4 6 7 ? parallel      
AC4 7 8 ? parallel      
AC5 1 2 ? anti-parallel 
AC5 2 3 ? parallel      
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
AC5 5 6 ? anti-parallel 
AC5 6 7 ? parallel      
AC6 1 2 ? anti-parallel 
AC6 2 3 ? parallel      
AC6 3 4 ? anti-parallel 
AC6 4 5 ? anti-parallel 
AC6 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 60  ? GLU A 63  ? VAL O 60  GLU O 63  
AA1 2 LYS A 66  ? ILE A 69  ? LYS O 66  ILE O 69  
AA1 3 ASN A 72  ? PHE A 77  ? ASN O 72  PHE O 77  
AA1 4 ASP A 29  ? ASN A 34  ? ASP O 29  ASN O 34  
AA1 5 LYS A 5   ? ASN A 9   ? LYS O 5   ASN O 9   
AA1 6 TYR A 94  ? GLU A 97  ? TYR O 94  GLU O 97  
AA1 7 ARG A 118 ? ILE A 121 ? ARG O 118 ILE O 121 
AA1 8 ILE A 146 ? SER A 148 ? ILE O 146 SER O 148 
AA2 1 ILE A 207 ? SER A 210 ? ILE O 207 SER O 210 
AA2 2 LEU A 228 ? ARG A 234 ? LEU O 228 ARG O 234 
AA2 3 ILE A 170 ? HIS A 179 ? ILE O 170 HIS O 179 
AA2 4 SER A 241 ? LEU A 249 ? SER O 241 LEU O 249 
AA2 5 PHE A 307 ? TYR A 314 ? PHE O 307 TYR O 314 
AA2 6 SER A 293 ? ASP A 296 ? SER O 293 ASP O 296 
AA2 7 LEU A 274 ? THR A 277 ? LEU O 274 THR O 277 
AA3 1 ILE A 207 ? SER A 210 ? ILE O 207 SER O 210 
AA3 2 LEU A 228 ? ARG A 234 ? LEU O 228 ARG O 234 
AA3 3 ILE A 170 ? HIS A 179 ? ILE O 170 HIS O 179 
AA3 4 SER A 241 ? LEU A 249 ? SER O 241 LEU O 249 
AA3 5 PHE A 307 ? TYR A 314 ? PHE O 307 TYR O 314 
AA3 6 ILE A 301 ? ASN A 304 ? ILE O 301 ASN O 304 
AA4 1 VAL B 60  ? GLU B 63  ? VAL A 60  GLU A 63  
AA4 2 LYS B 66  ? ILE B 69  ? LYS A 66  ILE A 69  
AA4 3 ASN B 72  ? PHE B 77  ? ASN A 72  PHE A 77  
AA4 4 ASP B 29  ? ASN B 34  ? ASP A 29  ASN A 34  
AA4 5 LYS B 5   ? ASN B 9   ? LYS A 5   ASN A 9   
AA4 6 TYR B 94  ? GLU B 97  ? TYR A 94  GLU A 97  
AA4 7 ARG B 118 ? ILE B 121 ? ARG A 118 ILE A 121 
AA4 8 ILE B 146 ? SER B 148 ? ILE A 146 SER A 148 
AA5 1 ILE B 207 ? SER B 210 ? ILE A 207 SER A 210 
AA5 2 LEU B 228 ? ARG B 234 ? LEU A 228 ARG A 234 
AA5 3 ILE B 170 ? HIS B 179 ? ILE A 170 HIS A 179 
AA5 4 SER B 241 ? LEU B 249 ? SER A 241 LEU A 249 
AA5 5 PHE B 307 ? TYR B 314 ? PHE A 307 TYR A 314 
AA5 6 SER B 293 ? ASP B 296 ? SER A 293 ASP A 296 
AA5 7 LEU B 274 ? THR B 277 ? LEU A 274 THR A 277 
AA6 1 ILE B 207 ? SER B 210 ? ILE A 207 SER A 210 
AA6 2 LEU B 228 ? ARG B 234 ? LEU A 228 ARG A 234 
AA6 3 ILE B 170 ? HIS B 179 ? ILE A 170 HIS A 179 
AA6 4 SER B 241 ? LEU B 249 ? SER A 241 LEU A 249 
AA6 5 PHE B 307 ? TYR B 314 ? PHE A 307 TYR A 314 
AA6 6 ILE B 301 ? ASN B 304 ? ILE A 301 ASN A 304 
AA7 1 VAL C 60  ? GLU C 63  ? VAL B 60  GLU B 63  
AA7 2 LYS C 66  ? ILE C 69  ? LYS B 66  ILE B 69  
AA7 3 ASN C 72  ? PHE C 77  ? ASN B 72  PHE B 77  
AA7 4 ASP C 29  ? ASN C 34  ? ASP B 29  ASN B 34  
AA7 5 LYS C 5   ? ASN C 9   ? LYS B 5   ASN B 9   
AA7 6 TYR C 94  ? GLU C 97  ? TYR B 94  GLU B 97  
AA7 7 ARG C 118 ? ILE C 121 ? ARG B 118 ILE B 121 
AA7 8 ILE C 146 ? SER C 148 ? ILE B 146 SER B 148 
AA8 1 ILE C 207 ? SER C 210 ? ILE B 207 SER B 210 
AA8 2 LEU C 228 ? ARG C 234 ? LEU B 228 ARG B 234 
AA8 3 ILE C 170 ? HIS C 179 ? ILE B 170 HIS B 179 
AA8 4 SER C 241 ? LEU C 249 ? SER B 241 LEU B 249 
AA8 5 PHE C 307 ? TYR C 314 ? PHE B 307 TYR B 314 
AA8 6 SER C 293 ? ASP C 296 ? SER B 293 ASP B 296 
AA8 7 LEU C 274 ? THR C 277 ? LEU B 274 THR B 277 
AA9 1 ILE C 207 ? SER C 210 ? ILE B 207 SER B 210 
AA9 2 LEU C 228 ? ARG C 234 ? LEU B 228 ARG B 234 
AA9 3 ILE C 170 ? HIS C 179 ? ILE B 170 HIS B 179 
AA9 4 SER C 241 ? LEU C 249 ? SER B 241 LEU B 249 
AA9 5 PHE C 307 ? TYR C 314 ? PHE B 307 TYR B 314 
AA9 6 ILE C 301 ? ASN C 304 ? ILE B 301 ASN B 304 
AB1 1 VAL D 60  ? GLU D 63  ? VAL C 60  GLU C 63  
AB1 2 LYS D 66  ? ILE D 69  ? LYS C 66  ILE C 69  
AB1 3 ASN D 72  ? PHE D 77  ? ASN C 72  PHE C 77  
AB1 4 ASP D 29  ? ASN D 34  ? ASP C 29  ASN C 34  
AB1 5 LYS D 5   ? ASN D 9   ? LYS C 5   ASN C 9   
AB1 6 TYR D 94  ? GLU D 97  ? TYR C 94  GLU C 97  
AB1 7 ARG D 118 ? ILE D 121 ? ARG C 118 ILE C 121 
AB1 8 ILE D 146 ? SER D 148 ? ILE C 146 SER C 148 
AB2 1 ILE D 207 ? SER D 210 ? ILE C 207 SER C 210 
AB2 2 LEU D 228 ? ARG D 234 ? LEU C 228 ARG C 234 
AB2 3 ILE D 170 ? HIS D 179 ? ILE C 170 HIS C 179 
AB2 4 SER D 241 ? LEU D 249 ? SER C 241 LEU C 249 
AB2 5 PHE D 307 ? TYR D 314 ? PHE C 307 TYR C 314 
AB2 6 SER D 293 ? ASP D 296 ? SER C 293 ASP C 296 
AB2 7 LEU D 274 ? THR D 277 ? LEU C 274 THR C 277 
AB3 1 ILE D 207 ? SER D 210 ? ILE C 207 SER C 210 
AB3 2 LEU D 228 ? ARG D 234 ? LEU C 228 ARG C 234 
AB3 3 ILE D 170 ? HIS D 179 ? ILE C 170 HIS C 179 
AB3 4 SER D 241 ? LEU D 249 ? SER C 241 LEU C 249 
AB3 5 PHE D 307 ? TYR D 314 ? PHE C 307 TYR C 314 
AB3 6 ILE D 301 ? ASN D 304 ? ILE C 301 ASN C 304 
AB4 1 VAL E 60  ? GLU E 63  ? VAL D 60  GLU D 63  
AB4 2 LYS E 66  ? ILE E 69  ? LYS D 66  ILE D 69  
AB4 3 ASN E 72  ? PHE E 77  ? ASN D 72  PHE D 77  
AB4 4 ASP E 29  ? ASN E 34  ? ASP D 29  ASN D 34  
AB4 5 LYS E 5   ? ASN E 9   ? LYS D 5   ASN D 9   
AB4 6 TYR E 94  ? GLU E 97  ? TYR D 94  GLU D 97  
AB4 7 ARG E 118 ? ILE E 121 ? ARG D 118 ILE D 121 
AB4 8 ILE E 146 ? SER E 148 ? ILE D 146 SER D 148 
AB5 1 ILE E 207 ? SER E 210 ? ILE D 207 SER D 210 
AB5 2 LEU E 228 ? ARG E 234 ? LEU D 228 ARG D 234 
AB5 3 ILE E 170 ? HIS E 179 ? ILE D 170 HIS D 179 
AB5 4 SER E 241 ? LEU E 249 ? SER D 241 LEU D 249 
AB5 5 PHE E 307 ? TYR E 314 ? PHE D 307 TYR D 314 
AB5 6 SER E 293 ? ASP E 296 ? SER D 293 ASP D 296 
AB5 7 LEU E 274 ? THR E 277 ? LEU D 274 THR D 277 
AB6 1 ILE E 207 ? SER E 210 ? ILE D 207 SER D 210 
AB6 2 LEU E 228 ? ARG E 234 ? LEU D 228 ARG D 234 
AB6 3 ILE E 170 ? HIS E 179 ? ILE D 170 HIS D 179 
AB6 4 SER E 241 ? LEU E 249 ? SER D 241 LEU D 249 
AB6 5 PHE E 307 ? TYR E 314 ? PHE D 307 TYR D 314 
AB6 6 ILE E 301 ? ASN E 304 ? ILE D 301 ASN D 304 
AB7 1 VAL F 60  ? GLU F 63  ? VAL E 60  GLU E 63  
AB7 2 LYS F 66  ? ILE F 69  ? LYS E 66  ILE E 69  
AB7 3 ASN F 72  ? PHE F 77  ? ASN E 72  PHE E 77  
AB7 4 ASP F 29  ? ASN F 34  ? ASP E 29  ASN E 34  
AB7 5 LYS F 5   ? ASN F 9   ? LYS E 5   ASN E 9   
AB7 6 TYR F 94  ? GLU F 97  ? TYR E 94  GLU E 97  
AB7 7 ARG F 118 ? ILE F 121 ? ARG E 118 ILE E 121 
AB7 8 ILE F 146 ? SER F 148 ? ILE E 146 SER E 148 
AB8 1 ILE F 207 ? SER F 210 ? ILE E 207 SER E 210 
AB8 2 LEU F 228 ? ARG F 234 ? LEU E 228 ARG E 234 
AB8 3 ILE F 170 ? HIS F 179 ? ILE E 170 HIS E 179 
AB8 4 SER F 241 ? LEU F 249 ? SER E 241 LEU E 249 
AB8 5 PHE F 307 ? TYR F 314 ? PHE E 307 TYR E 314 
AB8 6 SER F 293 ? ASP F 296 ? SER E 293 ASP E 296 
AB8 7 LEU F 274 ? THR F 277 ? LEU E 274 THR E 277 
AB9 1 ILE F 207 ? SER F 210 ? ILE E 207 SER E 210 
AB9 2 LEU F 228 ? ARG F 234 ? LEU E 228 ARG E 234 
AB9 3 ILE F 170 ? HIS F 179 ? ILE E 170 HIS E 179 
AB9 4 SER F 241 ? LEU F 249 ? SER E 241 LEU E 249 
AB9 5 PHE F 307 ? TYR F 314 ? PHE E 307 TYR E 314 
AB9 6 ILE F 301 ? ASN F 304 ? ILE E 301 ASN E 304 
AC1 1 VAL G 60  ? GLU G 63  ? VAL F 60  GLU F 63  
AC1 2 LYS G 66  ? ILE G 69  ? LYS F 66  ILE F 69  
AC1 3 ASN G 72  ? PHE G 77  ? ASN F 72  PHE F 77  
AC1 4 ASP G 29  ? ASN G 34  ? ASP F 29  ASN F 34  
AC1 5 LYS G 5   ? ASN G 9   ? LYS F 5   ASN F 9   
AC1 6 TYR G 94  ? GLU G 97  ? TYR F 94  GLU F 97  
AC1 7 ARG G 118 ? ILE G 121 ? ARG F 118 ILE F 121 
AC1 8 ILE G 146 ? SER G 148 ? ILE F 146 SER F 148 
AC2 1 ILE G 207 ? SER G 210 ? ILE F 207 SER F 210 
AC2 2 LEU G 228 ? ARG G 234 ? LEU F 228 ARG F 234 
AC2 3 ILE G 170 ? HIS G 179 ? ILE F 170 HIS F 179 
AC2 4 SER G 241 ? LEU G 249 ? SER F 241 LEU F 249 
AC2 5 PHE G 307 ? TYR G 314 ? PHE F 307 TYR F 314 
AC2 6 SER G 293 ? ASP G 296 ? SER F 293 ASP F 296 
AC2 7 LEU G 274 ? THR G 277 ? LEU F 274 THR F 277 
AC3 1 ILE G 207 ? SER G 210 ? ILE F 207 SER F 210 
AC3 2 LEU G 228 ? ARG G 234 ? LEU F 228 ARG F 234 
AC3 3 ILE G 170 ? HIS G 179 ? ILE F 170 HIS F 179 
AC3 4 SER G 241 ? LEU G 249 ? SER F 241 LEU F 249 
AC3 5 PHE G 307 ? TYR G 314 ? PHE F 307 TYR F 314 
AC3 6 ILE G 301 ? ASN G 304 ? ILE F 301 ASN F 304 
AC4 1 VAL H 60  ? GLU H 63  ? VAL G 60  GLU G 63  
AC4 2 LYS H 66  ? ILE H 69  ? LYS G 66  ILE G 69  
AC4 3 ASN H 72  ? PHE H 77  ? ASN G 72  PHE G 77  
AC4 4 ASP H 29  ? ASN H 34  ? ASP G 29  ASN G 34  
AC4 5 LYS H 5   ? ASN H 9   ? LYS G 5   ASN G 9   
AC4 6 TYR H 94  ? GLU H 97  ? TYR G 94  GLU G 97  
AC4 7 ARG H 118 ? ILE H 121 ? ARG G 118 ILE G 121 
AC4 8 ILE H 146 ? SER H 148 ? ILE G 146 SER G 148 
AC5 1 ILE H 207 ? SER H 210 ? ILE G 207 SER G 210 
AC5 2 LEU H 228 ? ARG H 234 ? LEU G 228 ARG G 234 
AC5 3 ILE H 170 ? HIS H 179 ? ILE G 170 HIS G 179 
AC5 4 SER H 241 ? LEU H 249 ? SER G 241 LEU G 249 
AC5 5 PHE H 307 ? TYR H 314 ? PHE G 307 TYR G 314 
AC5 6 SER H 293 ? ASP H 296 ? SER G 293 ASP G 296 
AC5 7 LEU H 274 ? THR H 277 ? LEU G 274 THR G 277 
AC6 1 ILE H 207 ? SER H 210 ? ILE G 207 SER G 210 
AC6 2 LEU H 228 ? ARG H 234 ? LEU G 228 ARG G 234 
AC6 3 ILE H 170 ? HIS H 179 ? ILE G 170 HIS G 179 
AC6 4 SER H 241 ? LEU H 249 ? SER G 241 LEU G 249 
AC6 5 PHE H 307 ? TYR H 314 ? PHE G 307 TYR G 314 
AC6 6 ILE H 301 ? ASN H 304 ? ILE G 301 ASN G 304 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 61  ? N LYS O 61  O VAL A 68  ? O VAL O 68  
AA1 2 3 N ILE A 69  ? N ILE O 69  O ASN A 72  ? O ASN O 72  
AA1 3 4 O PHE A 77  ? O PHE O 77  N ILE A 33  ? N ILE O 33  
AA1 4 5 O VAL A 31  ? O VAL O 31  N VAL A 6   ? N VAL O 6   
AA1 5 6 N ASN A 9   ? N ASN O 9   O VAL A 96  ? O VAL O 96  
AA1 6 7 N VAL A 95  ? N VAL O 95  O ILE A 120 ? O ILE O 120 
AA1 7 8 N ILE A 121 ? N ILE O 121 O ILE A 147 ? O ILE O 147 
AA2 1 2 N ILE A 207 ? N ILE O 207 O ARG A 234 ? O ARG O 234 
AA2 2 3 O PHE A 233 ? O PHE O 233 N HIS A 179 ? N HIS O 179 
AA2 3 4 N GLU A 172 ? N GLU O 172 O ARG A 248 ? O ARG O 248 
AA2 4 5 N LEU A 245 ? N LEU O 245 O LEU A 310 ? O LEU O 310 
AA2 5 6 O ILE A 311 ? O ILE O 311 N ASP A 296 ? N ASP O 296 
AA2 6 7 O SER A 293 ? O SER O 293 N GLY A 275 ? N GLY O 275 
AA3 1 2 N ILE A 207 ? N ILE O 207 O ARG A 234 ? O ARG O 234 
AA3 2 3 O PHE A 233 ? O PHE O 233 N HIS A 179 ? N HIS O 179 
AA3 3 4 N GLU A 172 ? N GLU O 172 O ARG A 248 ? O ARG O 248 
AA3 4 5 N LEU A 245 ? N LEU O 245 O LEU A 310 ? O LEU O 310 
AA3 5 6 O LYS A 309 ? O LYS O 309 N ILE A 301 ? N ILE O 301 
AA4 1 2 N LYS B 61  ? N LYS A 61  O VAL B 68  ? O VAL A 68  
AA4 2 3 N LEU B 67  ? N LEU A 67  O ILE B 74  ? O ILE A 74  
AA4 3 4 O PHE B 77  ? O PHE A 77  N ILE B 33  ? N ILE A 33  
AA4 4 5 O ASP B 29  ? O ASP A 29  N VAL B 6   ? N VAL A 6   
AA4 5 6 N ASN B 9   ? N ASN A 9   O VAL B 96  ? O VAL A 96  
AA4 6 7 N VAL B 95  ? N VAL A 95  O ILE B 120 ? O ILE A 120 
AA4 7 8 N ILE B 121 ? N ILE A 121 O ILE B 147 ? O ILE A 147 
AA5 1 2 N ILE B 207 ? N ILE A 207 O ARG B 234 ? O ARG A 234 
AA5 2 3 O PHE B 233 ? O PHE A 233 N HIS B 179 ? N HIS A 179 
AA5 3 4 N LEU B 174 ? N LEU A 174 O THR B 246 ? O THR A 246 
AA5 4 5 N LEU B 245 ? N LEU A 245 O LEU B 310 ? O LEU A 310 
AA5 5 6 O TRP B 313 ? O TRP A 313 N THR B 294 ? N THR A 294 
AA5 6 7 O SER B 293 ? O SER A 293 N GLY B 275 ? N GLY A 275 
AA6 1 2 N ILE B 207 ? N ILE A 207 O ARG B 234 ? O ARG A 234 
AA6 2 3 O PHE B 233 ? O PHE A 233 N HIS B 179 ? N HIS A 179 
AA6 3 4 N LEU B 174 ? N LEU A 174 O THR B 246 ? O THR A 246 
AA6 4 5 N LEU B 245 ? N LEU A 245 O LEU B 310 ? O LEU A 310 
AA6 5 6 O PHE B 307 ? O PHE A 307 N LEU B 303 ? N LEU A 303 
AA7 1 2 N LYS C 61  ? N LYS B 61  O VAL C 68  ? O VAL B 68  
AA7 2 3 N LEU C 67  ? N LEU B 67  O ILE C 74  ? O ILE B 74  
AA7 3 4 O PHE C 77  ? O PHE B 77  N ILE C 33  ? N ILE B 33  
AA7 4 5 O ASP C 29  ? O ASP B 29  N VAL C 6   ? N VAL B 6   
AA7 5 6 N ASN C 9   ? N ASN B 9   O VAL C 96  ? O VAL B 96  
AA7 6 7 N VAL C 95  ? N VAL B 95  O ILE C 120 ? O ILE B 120 
AA7 7 8 N ILE C 121 ? N ILE B 121 O ILE C 147 ? O ILE B 147 
AA8 1 2 N ILE C 207 ? N ILE B 207 O ARG C 234 ? O ARG B 234 
AA8 2 3 O PHE C 233 ? O PHE B 233 N HIS C 179 ? N HIS B 179 
AA8 3 4 N THR C 176 ? N THR B 176 O ASP C 244 ? O ASP B 244 
AA8 4 5 N LEU C 245 ? N LEU B 245 O LEU C 310 ? O LEU B 310 
AA8 5 6 O ILE C 311 ? O ILE B 311 N ASP C 296 ? N ASP B 296 
AA8 6 7 O SER C 293 ? O SER B 293 N GLY C 275 ? N GLY B 275 
AA9 1 2 N ILE C 207 ? N ILE B 207 O ARG C 234 ? O ARG B 234 
AA9 2 3 O PHE C 233 ? O PHE B 233 N HIS C 179 ? N HIS B 179 
AA9 3 4 N THR C 176 ? N THR B 176 O ASP C 244 ? O ASP B 244 
AA9 4 5 N LEU C 245 ? N LEU B 245 O LEU C 310 ? O LEU B 310 
AA9 5 6 O LYS C 309 ? O LYS B 309 N ILE C 301 ? N ILE B 301 
AB1 1 2 N LYS D 61  ? N LYS C 61  O VAL D 68  ? O VAL C 68  
AB1 2 3 N LEU D 67  ? N LEU C 67  O ILE D 74  ? O ILE C 74  
AB1 3 4 O PHE D 77  ? O PHE C 77  N ILE D 33  ? N ILE C 33  
AB1 4 5 O VAL D 31  ? O VAL C 31  N VAL D 6   ? N VAL C 6   
AB1 5 6 N ASN D 9   ? N ASN C 9   O VAL D 96  ? O VAL C 96  
AB1 6 7 N VAL D 95  ? N VAL C 95  O ILE D 120 ? O ILE C 120 
AB1 7 8 N ILE D 121 ? N ILE C 121 O ILE D 147 ? O ILE C 147 
AB2 1 2 N ILE D 207 ? N ILE C 207 O ARG D 234 ? O ARG C 234 
AB2 2 3 O PHE D 233 ? O PHE C 233 N HIS D 179 ? N HIS C 179 
AB2 3 4 N THR D 176 ? N THR C 176 O ASP D 244 ? O ASP C 244 
AB2 4 5 N SER D 241 ? N SER C 241 O TYR D 314 ? O TYR C 314 
AB2 5 6 O ILE D 311 ? O ILE C 311 N ASP D 296 ? N ASP C 296 
AB2 6 7 O SER D 293 ? O SER C 293 N GLY D 275 ? N GLY C 275 
AB3 1 2 N ILE D 207 ? N ILE C 207 O ARG D 234 ? O ARG C 234 
AB3 2 3 O PHE D 233 ? O PHE C 233 N HIS D 179 ? N HIS C 179 
AB3 3 4 N THR D 176 ? N THR C 176 O ASP D 244 ? O ASP C 244 
AB3 4 5 N SER D 241 ? N SER C 241 O TYR D 314 ? O TYR C 314 
AB3 5 6 O LYS D 309 ? O LYS C 309 N ILE D 301 ? N ILE C 301 
AB4 1 2 N LYS E 61  ? N LYS D 61  O VAL E 68  ? O VAL D 68  
AB4 2 3 N ILE E 69  ? N ILE D 69  O ASN E 72  ? O ASN D 72  
AB4 3 4 O PHE E 77  ? O PHE D 77  N ILE E 33  ? N ILE D 33  
AB4 4 5 O VAL E 31  ? O VAL D 31  N VAL E 6   ? N VAL D 6   
AB4 5 6 N ASN E 9   ? N ASN D 9   O VAL E 96  ? O VAL D 96  
AB4 6 7 N VAL E 95  ? N VAL D 95  O ILE E 120 ? O ILE D 120 
AB4 7 8 N ILE E 121 ? N ILE D 121 O ILE E 147 ? O ILE D 147 
AB5 1 2 N ILE E 207 ? N ILE D 207 O ARG E 234 ? O ARG D 234 
AB5 2 3 O PHE E 233 ? O PHE D 233 N HIS E 179 ? N HIS D 179 
AB5 3 4 N THR E 176 ? N THR D 176 O ASP E 244 ? O ASP D 244 
AB5 4 5 N LEU E 245 ? N LEU D 245 O LEU E 310 ? O LEU D 310 
AB5 5 6 O ILE E 311 ? O ILE D 311 N ASP E 296 ? N ASP D 296 
AB5 6 7 O SER E 293 ? O SER D 293 N GLY E 275 ? N GLY D 275 
AB6 1 2 N ILE E 207 ? N ILE D 207 O ARG E 234 ? O ARG D 234 
AB6 2 3 O PHE E 233 ? O PHE D 233 N HIS E 179 ? N HIS D 179 
AB6 3 4 N THR E 176 ? N THR D 176 O ASP E 244 ? O ASP D 244 
AB6 4 5 N LEU E 245 ? N LEU D 245 O LEU E 310 ? O LEU D 310 
AB6 5 6 O LYS E 309 ? O LYS D 309 N ILE E 301 ? N ILE D 301 
AB7 1 2 N LYS F 61  ? N LYS E 61  O VAL F 68  ? O VAL E 68  
AB7 2 3 N LEU F 67  ? N LEU E 67  O ILE F 74  ? O ILE E 74  
AB7 3 4 O PHE F 77  ? O PHE E 77  N ILE F 33  ? N ILE E 33  
AB7 4 5 O ASP F 29  ? O ASP E 29  N VAL F 6   ? N VAL E 6   
AB7 5 6 N ASN F 9   ? N ASN E 9   O VAL F 96  ? O VAL E 96  
AB7 6 7 N VAL F 95  ? N VAL E 95  O ILE F 120 ? O ILE E 120 
AB7 7 8 N ILE F 121 ? N ILE E 121 O ILE F 147 ? O ILE E 147 
AB8 1 2 N ILE F 207 ? N ILE E 207 O ARG F 234 ? O ARG E 234 
AB8 2 3 O PHE F 233 ? O PHE E 233 N HIS F 179 ? N HIS E 179 
AB8 3 4 N THR F 176 ? N THR E 176 O ASP F 244 ? O ASP E 244 
AB8 4 5 N VAL F 243 ? N VAL E 243 O SER F 312 ? O SER E 312 
AB8 5 6 O ILE F 311 ? O ILE E 311 N ASP F 296 ? N ASP E 296 
AB8 6 7 O SER F 293 ? O SER E 293 N GLY F 275 ? N GLY E 275 
AB9 1 2 N ILE F 207 ? N ILE E 207 O ARG F 234 ? O ARG E 234 
AB9 2 3 O PHE F 233 ? O PHE E 233 N HIS F 179 ? N HIS E 179 
AB9 3 4 N THR F 176 ? N THR E 176 O ASP F 244 ? O ASP E 244 
AB9 4 5 N VAL F 243 ? N VAL E 243 O SER F 312 ? O SER E 312 
AB9 5 6 O LYS F 309 ? O LYS E 309 N ILE F 301 ? N ILE E 301 
AC1 1 2 N LYS G 61  ? N LYS F 61  O VAL G 68  ? O VAL F 68  
AC1 2 3 N LEU G 67  ? N LEU F 67  O ILE G 74  ? O ILE F 74  
AC1 3 4 O PHE G 77  ? O PHE F 77  N ILE G 33  ? N ILE F 33  
AC1 4 5 O VAL G 31  ? O VAL F 31  N VAL G 6   ? N VAL F 6   
AC1 5 6 N GLY G 7   ? N GLY F 7   O TYR G 94  ? O TYR F 94  
AC1 6 7 N GLU G 97  ? N GLU F 97  O ILE G 120 ? O ILE F 120 
AC1 7 8 N ILE G 121 ? N ILE F 121 O ILE G 147 ? O ILE F 147 
AC2 1 2 N ILE G 207 ? N ILE F 207 O ARG G 234 ? O ARG F 234 
AC2 2 3 O PHE G 233 ? O PHE F 233 N HIS G 179 ? N HIS F 179 
AC2 3 4 N THR G 176 ? N THR F 176 O ASP G 244 ? O ASP F 244 
AC2 4 5 N LEU G 245 ? N LEU F 245 O LEU G 310 ? O LEU F 310 
AC2 5 6 O ILE G 311 ? O ILE F 311 N ASP G 296 ? N ASP F 296 
AC2 6 7 O SER G 293 ? O SER F 293 N GLY G 275 ? N GLY F 275 
AC3 1 2 N ILE G 207 ? N ILE F 207 O ARG G 234 ? O ARG F 234 
AC3 2 3 O PHE G 233 ? O PHE F 233 N HIS G 179 ? N HIS F 179 
AC3 3 4 N THR G 176 ? N THR F 176 O ASP G 244 ? O ASP F 244 
AC3 4 5 N LEU G 245 ? N LEU F 245 O LEU G 310 ? O LEU F 310 
AC3 5 6 O LYS G 309 ? O LYS F 309 N ILE G 301 ? N ILE F 301 
AC4 1 2 N LYS H 61  ? N LYS G 61  O VAL H 68  ? O VAL G 68  
AC4 2 3 N LEU H 67  ? N LEU G 67  O ILE H 74  ? O ILE G 74  
AC4 3 4 O PHE H 77  ? O PHE G 77  N ILE H 33  ? N ILE G 33  
AC4 4 5 O ASP H 29  ? O ASP G 29  N VAL H 6   ? N VAL G 6   
AC4 5 6 N GLY H 7   ? N GLY G 7   O TYR H 94  ? O TYR G 94  
AC4 6 7 N GLU H 97  ? N GLU G 97  O ILE H 120 ? O ILE G 120 
AC4 7 8 N ILE H 121 ? N ILE G 121 O ILE H 147 ? O ILE G 147 
AC5 1 2 N ILE H 207 ? N ILE G 207 O ARG H 234 ? O ARG G 234 
AC5 2 3 O PHE H 233 ? O PHE G 233 N HIS H 179 ? N HIS G 179 
AC5 3 4 N LEU H 174 ? N LEU G 174 O THR H 246 ? O THR G 246 
AC5 4 5 N VAL H 243 ? N VAL G 243 O SER H 312 ? O SER G 312 
AC5 5 6 O ILE H 311 ? O ILE G 311 N ASP H 296 ? N ASP G 296 
AC5 6 7 O SER H 293 ? O SER G 293 N GLY H 275 ? N GLY G 275 
AC6 1 2 N ILE H 207 ? N ILE G 207 O ARG H 234 ? O ARG G 234 
AC6 2 3 O PHE H 233 ? O PHE G 233 N HIS H 179 ? N HIS G 179 
AC6 3 4 N LEU H 174 ? N LEU G 174 O THR H 246 ? O THR G 246 
AC6 4 5 N VAL H 243 ? N VAL G 243 O SER H 312 ? O SER G 312 
AC6 5 6 O LYS H 309 ? O LYS G 309 N ILE H 301 ? N ILE G 301 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software O NAD 401 ? 31 'binding site for residue NAD O 401' 
AC2 Software O ZN  402 ? 4  'binding site for residue ZN O 402'  
AC3 Software O ACT 403 ? 8  'binding site for residue ACT O 403' 
AC4 Software A NAD 401 ? 32 'binding site for residue NAD A 401' 
AC5 Software A ZN  402 ? 1  'binding site for residue ZN A 402'  
AC6 Software B NAD 401 ? 31 'binding site for residue NAD B 401' 
AC7 Software B ZN  402 ? 1  'binding site for residue ZN B 402'  
AC8 Software C NAD 401 ? 28 'binding site for residue NAD C 401' 
AC9 Software C ZN  402 ? 3  'binding site for residue ZN C 402'  
AD1 Software C ZN  403 ? 4  'binding site for residue ZN C 403'  
AD2 Software C ACT 404 ? 7  'binding site for residue ACT C 404' 
AD3 Software D NAD 401 ? 30 'binding site for residue NAD D 401' 
AD4 Software E NAD 401 ? 29 'binding site for residue NAD E 401' 
AD5 Software E ZN  402 ? 3  'binding site for residue ZN E 402'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 31 ASN A  9   ? ASN O 9   . ? 1_555 ? 
2   AC1 31 GLY A  10  ? GLY O 10  . ? 1_555 ? 
3   AC1 31 PHE A  11  ? PHE O 11  . ? 1_555 ? 
4   AC1 31 GLY A  12  ? GLY O 12  . ? 1_555 ? 
5   AC1 31 ARG A  13  ? ARG O 13  . ? 1_555 ? 
6   AC1 31 ILE A  14  ? ILE O 14  . ? 1_555 ? 
7   AC1 31 ASN A  34  ? ASN O 34  . ? 1_555 ? 
8   AC1 31 ASP A  35  ? ASP O 35  . ? 1_555 ? 
9   AC1 31 PRO A  36  ? PRO O 36  . ? 1_555 ? 
10  AC1 31 PHE A  37  ? PHE O 37  . ? 1_555 ? 
11  AC1 31 ARG A  80  ? ARG O 80  . ? 1_555 ? 
12  AC1 31 SER A  98  ? SER O 98  . ? 1_555 ? 
13  AC1 31 THR A  99  ? THR O 99  . ? 1_555 ? 
14  AC1 31 GLY A  100 ? GLY O 100 . ? 1_555 ? 
15  AC1 31 SER A  122 ? SER O 122 . ? 1_555 ? 
16  AC1 31 ALA A  123 ? ALA O 123 . ? 1_555 ? 
17  AC1 31 CYS A  152 ? CYS O 152 . ? 1_555 ? 
18  AC1 31 ALA A  183 ? ALA O 183 . ? 1_555 ? 
19  AC1 31 ASN A  316 ? ASN O 316 . ? 1_555 ? 
20  AC1 31 TYR A  320 ? TYR O 320 . ? 1_555 ? 
21  AC1 31 HOH W  .   ? HOH O 535 . ? 1_555 ? 
22  AC1 31 HOH W  .   ? HOH O 544 . ? 1_555 ? 
23  AC1 31 HOH W  .   ? HOH O 561 . ? 1_555 ? 
24  AC1 31 HOH W  .   ? HOH O 566 . ? 1_555 ? 
25  AC1 31 HOH W  .   ? HOH O 620 . ? 1_555 ? 
26  AC1 31 HOH W  .   ? HOH O 644 . ? 1_555 ? 
27  AC1 31 HOH W  .   ? HOH O 664 . ? 1_555 ? 
28  AC1 31 HOH W  .   ? HOH O 716 . ? 1_555 ? 
29  AC1 31 HOH W  .   ? HOH O 718 . ? 1_555 ? 
30  AC1 31 HOH W  .   ? HOH O 788 . ? 1_555 ? 
31  AC1 31 HOH W  .   ? HOH O 816 . ? 1_555 ? 
32  AC2 4  GLU F  106 ? GLU E 106 . ? 1_555 ? 
33  AC2 4  ASP F  127 ? ASP E 127 . ? 1_555 ? 
34  AC2 4  HIS A  306 ? HIS O 306 . ? 1_555 ? 
35  AC2 4  ACT K  .   ? ACT O 403 . ? 1_555 ? 
36  AC3 8  THR F  104 ? THR E 104 . ? 1_555 ? 
37  AC3 8  GLU F  106 ? GLU E 106 . ? 1_555 ? 
38  AC3 8  ALA F  126 ? ALA E 126 . ? 1_555 ? 
39  AC3 8  ASP F  127 ? ASP E 127 . ? 1_555 ? 
40  AC3 8  HIS A  306 ? HIS O 306 . ? 1_555 ? 
41  AC3 8  ZN  J  .   ? ZN  O 402 . ? 1_555 ? 
42  AC3 8  HOH W  .   ? HOH O 819 . ? 1_555 ? 
43  AC3 8  HOH W  .   ? HOH O 820 . ? 1_555 ? 
44  AC4 32 ASN B  9   ? ASN A 9   . ? 1_555 ? 
45  AC4 32 GLY B  10  ? GLY A 10  . ? 1_555 ? 
46  AC4 32 PHE B  11  ? PHE A 11  . ? 1_555 ? 
47  AC4 32 GLY B  12  ? GLY A 12  . ? 1_555 ? 
48  AC4 32 ARG B  13  ? ARG A 13  . ? 1_555 ? 
49  AC4 32 ILE B  14  ? ILE A 14  . ? 1_555 ? 
50  AC4 32 ASN B  34  ? ASN A 34  . ? 1_555 ? 
51  AC4 32 ASP B  35  ? ASP A 35  . ? 1_555 ? 
52  AC4 32 PRO B  36  ? PRO A 36  . ? 1_555 ? 
53  AC4 32 PHE B  37  ? PHE A 37  . ? 1_555 ? 
54  AC4 32 ARG B  80  ? ARG A 80  . ? 1_555 ? 
55  AC4 32 SER B  98  ? SER A 98  . ? 1_555 ? 
56  AC4 32 THR B  99  ? THR A 99  . ? 1_555 ? 
57  AC4 32 GLY B  100 ? GLY A 100 . ? 1_555 ? 
58  AC4 32 SER B  122 ? SER A 122 . ? 1_555 ? 
59  AC4 32 ALA B  123 ? ALA A 123 . ? 1_555 ? 
60  AC4 32 CYS B  152 ? CYS A 152 . ? 1_555 ? 
61  AC4 32 ALA B  183 ? ALA A 183 . ? 1_555 ? 
62  AC4 32 ASN B  316 ? ASN A 316 . ? 1_555 ? 
63  AC4 32 TYR B  320 ? TYR A 320 . ? 1_555 ? 
64  AC4 32 HOH X  .   ? HOH A 551 . ? 1_555 ? 
65  AC4 32 HOH X  .   ? HOH A 556 . ? 1_555 ? 
66  AC4 32 HOH X  .   ? HOH A 571 . ? 1_555 ? 
67  AC4 32 HOH X  .   ? HOH A 572 . ? 1_555 ? 
68  AC4 32 HOH X  .   ? HOH A 643 . ? 1_555 ? 
69  AC4 32 HOH X  .   ? HOH A 694 . ? 1_555 ? 
70  AC4 32 HOH X  .   ? HOH A 709 . ? 1_555 ? 
71  AC4 32 HOH X  .   ? HOH A 813 . ? 1_555 ? 
72  AC4 32 HOH X  .   ? HOH A 815 . ? 1_555 ? 
73  AC4 32 HOH X  .   ? HOH A 849 . ? 1_555 ? 
74  AC4 32 HOH X  .   ? HOH A 851 . ? 1_555 ? 
75  AC4 32 HOH X  .   ? HOH A 852 . ? 1_555 ? 
76  AC5 1  GLU B  63  ? GLU A 63  . ? 1_555 ? 
77  AC6 31 ASN C  9   ? ASN B 9   . ? 1_555 ? 
78  AC6 31 GLY C  10  ? GLY B 10  . ? 1_555 ? 
79  AC6 31 PHE C  11  ? PHE B 11  . ? 1_555 ? 
80  AC6 31 GLY C  12  ? GLY B 12  . ? 1_555 ? 
81  AC6 31 ARG C  13  ? ARG B 13  . ? 1_555 ? 
82  AC6 31 ILE C  14  ? ILE B 14  . ? 1_555 ? 
83  AC6 31 ASN C  34  ? ASN B 34  . ? 1_555 ? 
84  AC6 31 ASP C  35  ? ASP B 35  . ? 1_555 ? 
85  AC6 31 PRO C  36  ? PRO B 36  . ? 1_555 ? 
86  AC6 31 PHE C  37  ? PHE B 37  . ? 1_555 ? 
87  AC6 31 ARG C  80  ? ARG B 80  . ? 1_555 ? 
88  AC6 31 SER C  98  ? SER B 98  . ? 1_555 ? 
89  AC6 31 THR C  99  ? THR B 99  . ? 1_555 ? 
90  AC6 31 GLY C  100 ? GLY B 100 . ? 1_555 ? 
91  AC6 31 SER C  122 ? SER B 122 . ? 1_555 ? 
92  AC6 31 ALA C  123 ? ALA B 123 . ? 1_555 ? 
93  AC6 31 CYS C  152 ? CYS B 152 . ? 1_555 ? 
94  AC6 31 ALA C  183 ? ALA B 183 . ? 1_555 ? 
95  AC6 31 ASN C  316 ? ASN B 316 . ? 1_555 ? 
96  AC6 31 TYR C  320 ? TYR B 320 . ? 1_555 ? 
97  AC6 31 HOH Y  .   ? HOH B 552 . ? 1_555 ? 
98  AC6 31 HOH Y  .   ? HOH B 553 . ? 1_555 ? 
99  AC6 31 HOH Y  .   ? HOH B 567 . ? 1_555 ? 
100 AC6 31 HOH Y  .   ? HOH B 577 . ? 1_555 ? 
101 AC6 31 HOH Y  .   ? HOH B 628 . ? 1_555 ? 
102 AC6 31 HOH Y  .   ? HOH B 671 . ? 1_555 ? 
103 AC6 31 HOH Y  .   ? HOH B 685 . ? 1_555 ? 
104 AC6 31 HOH Y  .   ? HOH B 803 . ? 1_555 ? 
105 AC6 31 HOH Y  .   ? HOH B 833 . ? 1_555 ? 
106 AC6 31 HOH Y  .   ? HOH B 834 . ? 1_555 ? 
107 AC6 31 HOH Y  .   ? HOH B 836 . ? 1_555 ? 
108 AC7 1  GLU C  63  ? GLU B 63  . ? 1_555 ? 
109 AC8 28 ASN D  9   ? ASN C 9   . ? 1_555 ? 
110 AC8 28 GLY D  10  ? GLY C 10  . ? 1_555 ? 
111 AC8 28 PHE D  11  ? PHE C 11  . ? 1_555 ? 
112 AC8 28 GLY D  12  ? GLY C 12  . ? 1_555 ? 
113 AC8 28 ARG D  13  ? ARG C 13  . ? 1_555 ? 
114 AC8 28 ILE D  14  ? ILE C 14  . ? 1_555 ? 
115 AC8 28 ASP D  35  ? ASP C 35  . ? 1_555 ? 
116 AC8 28 PRO D  36  ? PRO C 36  . ? 1_555 ? 
117 AC8 28 PHE D  37  ? PHE C 37  . ? 1_555 ? 
118 AC8 28 ARG D  80  ? ARG C 80  . ? 1_555 ? 
119 AC8 28 SER D  98  ? SER C 98  . ? 1_555 ? 
120 AC8 28 THR D  99  ? THR C 99  . ? 1_555 ? 
121 AC8 28 GLY D  100 ? GLY C 100 . ? 1_555 ? 
122 AC8 28 PHE D  102 ? PHE C 102 . ? 1_555 ? 
123 AC8 28 SER D  122 ? SER C 122 . ? 1_555 ? 
124 AC8 28 ALA D  123 ? ALA C 123 . ? 1_555 ? 
125 AC8 28 CYS D  152 ? CYS C 152 . ? 1_555 ? 
126 AC8 28 ALA D  183 ? ALA C 183 . ? 1_555 ? 
127 AC8 28 ASN D  316 ? ASN C 316 . ? 1_555 ? 
128 AC8 28 TYR D  320 ? TYR C 320 . ? 1_555 ? 
129 AC8 28 HOH Z  .   ? HOH C 533 . ? 1_555 ? 
130 AC8 28 HOH Z  .   ? HOH C 534 . ? 1_555 ? 
131 AC8 28 HOH Z  .   ? HOH C 561 . ? 1_555 ? 
132 AC8 28 HOH Z  .   ? HOH C 590 . ? 1_555 ? 
133 AC8 28 HOH Z  .   ? HOH C 642 . ? 1_555 ? 
134 AC8 28 HOH Z  .   ? HOH C 726 . ? 1_555 ? 
135 AC8 28 HOH Z  .   ? HOH C 763 . ? 1_555 ? 
136 AC8 28 HOH Z  .   ? HOH C 765 . ? 1_555 ? 
137 AC9 3  GLU D  335 ? GLU C 335 . ? 1_555 ? 
138 AC9 3  HOH Z  .   ? HOH C 501 . ? 1_555 ? 
139 AC9 3  HOH Z  .   ? HOH C 509 . ? 1_555 ? 
140 AD1 4  GLU D  106 ? GLU C 106 . ? 1_555 ? 
141 AD1 4  ASP D  127 ? ASP C 127 . ? 1_555 ? 
142 AD1 4  ACT S  .   ? ACT C 404 . ? 1_555 ? 
143 AD1 4  HIS E  306 ? HIS D 306 . ? 1_556 ? 
144 AD2 7  THR D  104 ? THR C 104 . ? 1_555 ? 
145 AD2 7  GLU D  106 ? GLU C 106 . ? 1_555 ? 
146 AD2 7  ASP D  127 ? ASP C 127 . ? 1_555 ? 
147 AD2 7  ZN  R  .   ? ZN  C 403 . ? 1_555 ? 
148 AD2 7  HOH Z  .   ? HOH C 502 . ? 1_555 ? 
149 AD2 7  HOH Z  .   ? HOH C 503 . ? 1_555 ? 
150 AD2 7  HIS E  306 ? HIS D 306 . ? 1_556 ? 
151 AD3 30 ASN E  9   ? ASN D 9   . ? 1_555 ? 
152 AD3 30 GLY E  10  ? GLY D 10  . ? 1_555 ? 
153 AD3 30 PHE E  11  ? PHE D 11  . ? 1_555 ? 
154 AD3 30 GLY E  12  ? GLY D 12  . ? 1_555 ? 
155 AD3 30 ARG E  13  ? ARG D 13  . ? 1_555 ? 
156 AD3 30 ILE E  14  ? ILE D 14  . ? 1_555 ? 
157 AD3 30 ASN E  34  ? ASN D 34  . ? 1_555 ? 
158 AD3 30 ASP E  35  ? ASP D 35  . ? 1_555 ? 
159 AD3 30 PRO E  36  ? PRO D 36  . ? 1_555 ? 
160 AD3 30 PHE E  37  ? PHE D 37  . ? 1_555 ? 
161 AD3 30 ARG E  80  ? ARG D 80  . ? 1_555 ? 
162 AD3 30 SER E  98  ? SER D 98  . ? 1_555 ? 
163 AD3 30 THR E  99  ? THR D 99  . ? 1_555 ? 
164 AD3 30 GLY E  100 ? GLY D 100 . ? 1_555 ? 
165 AD3 30 SER E  122 ? SER D 122 . ? 1_555 ? 
166 AD3 30 ALA E  123 ? ALA D 123 . ? 1_555 ? 
167 AD3 30 CYS E  152 ? CYS D 152 . ? 1_555 ? 
168 AD3 30 ALA E  183 ? ALA D 183 . ? 1_555 ? 
169 AD3 30 ASN E  316 ? ASN D 316 . ? 1_555 ? 
170 AD3 30 TYR E  320 ? TYR D 320 . ? 1_555 ? 
171 AD3 30 HOH AA .   ? HOH D 535 . ? 1_555 ? 
172 AD3 30 HOH AA .   ? HOH D 541 . ? 1_555 ? 
173 AD3 30 HOH AA .   ? HOH D 567 . ? 1_555 ? 
174 AD3 30 HOH AA .   ? HOH D 581 . ? 1_555 ? 
175 AD3 30 HOH AA .   ? HOH D 637 . ? 1_555 ? 
176 AD3 30 HOH AA .   ? HOH D 676 . ? 1_555 ? 
177 AD3 30 HOH AA .   ? HOH D 681 . ? 1_555 ? 
178 AD3 30 HOH AA .   ? HOH D 709 . ? 1_555 ? 
179 AD3 30 HOH AA .   ? HOH D 818 . ? 1_555 ? 
180 AD3 30 HOH AA .   ? HOH D 819 . ? 1_555 ? 
181 AD4 29 ASN F  9   ? ASN E 9   . ? 1_555 ? 
182 AD4 29 GLY F  10  ? GLY E 10  . ? 1_555 ? 
183 AD4 29 PHE F  11  ? PHE E 11  . ? 1_555 ? 
184 AD4 29 GLY F  12  ? GLY E 12  . ? 1_555 ? 
185 AD4 29 ARG F  13  ? ARG E 13  . ? 1_555 ? 
186 AD4 29 ILE F  14  ? ILE E 14  . ? 1_555 ? 
187 AD4 29 ASP F  35  ? ASP E 35  . ? 1_555 ? 
188 AD4 29 PRO F  36  ? PRO E 36  . ? 1_555 ? 
189 AD4 29 PHE F  37  ? PHE E 37  . ? 1_555 ? 
190 AD4 29 ARG F  80  ? ARG E 80  . ? 1_555 ? 
191 AD4 29 SER F  98  ? SER E 98  . ? 1_555 ? 
192 AD4 29 THR F  99  ? THR E 99  . ? 1_555 ? 
193 AD4 29 GLY F  100 ? GLY E 100 . ? 1_555 ? 
194 AD4 29 PHE F  102 ? PHE E 102 . ? 1_555 ? 
195 AD4 29 SER F  122 ? SER E 122 . ? 1_555 ? 
196 AD4 29 CYS F  152 ? CYS E 152 . ? 1_555 ? 
197 AD4 29 ALA F  183 ? ALA E 183 . ? 1_555 ? 
198 AD4 29 ASN F  316 ? ASN E 316 . ? 1_555 ? 
199 AD4 29 TYR F  320 ? TYR E 320 . ? 1_555 ? 
200 AD4 29 HOH BA .   ? HOH E 523 . ? 1_555 ? 
201 AD4 29 HOH BA .   ? HOH E 537 . ? 1_555 ? 
202 AD4 29 HOH BA .   ? HOH E 552 . ? 1_555 ? 
203 AD4 29 HOH BA .   ? HOH E 579 . ? 1_555 ? 
204 AD4 29 HOH BA .   ? HOH E 644 . ? 1_555 ? 
205 AD4 29 HOH BA .   ? HOH E 657 . ? 1_555 ? 
206 AD4 29 HOH BA .   ? HOH E 689 . ? 1_555 ? 
207 AD4 29 HOH BA .   ? HOH E 702 . ? 1_555 ? 
208 AD4 29 HOH BA .   ? HOH E 712 . ? 1_555 ? 
209 AD4 29 HOH BA .   ? HOH E 724 . ? 1_555 ? 
210 AD5 3  GLU F  335 ? GLU E 335 . ? 1_555 ? 
211 AD5 3  HOH BA .   ? HOH E 505 . ? 1_555 ? 
212 AD5 3  HOH BA .   ? HOH E 510 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4WNC 
_atom_sites.fract_transf_matrix[1][1]   0.007545 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000007 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012282 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006766 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . LYS A  1 3   ? -66.943 -23.584 -55.982  1.00 35.82  ? 3   LYS O N    1 
ATOM   2     C  CA   . LYS A  1 3   ? -67.611 -24.852 -55.715  1.00 26.00  ? 3   LYS O CA   1 
ATOM   3     C  C    . LYS A  1 3   ? -66.626 -25.980 -55.380  1.00 21.79  ? 3   LYS O C    1 
ATOM   4     O  O    . LYS A  1 3   ? -66.780 -26.613 -54.349  1.00 20.29  ? 3   LYS O O    1 
ATOM   5     C  CB   . LYS A  1 3   ? -68.474 -25.273 -56.894  1.00 40.61  ? 3   LYS O CB   1 
ATOM   6     C  CG   . LYS A  1 3   ? -69.295 -26.532 -56.626  1.00 31.26  ? 3   LYS O CG   1 
ATOM   7     C  CD   . LYS A  1 3   ? -70.363 -26.276 -55.578  1.00 56.95  ? 3   LYS O CD   1 
ATOM   8     C  CE   . LYS A  1 3   ? -71.174 -27.523 -55.291  1.00 69.10  ? 3   LYS O CE   1 
ATOM   9     N  NZ   . LYS A  1 3   ? -70.341 -28.585 -54.665  1.00 77.50  ? 3   LYS O NZ   1 
ATOM   10    H  HA   . LYS A  1 3   ? -68.196 -24.738 -54.950  1.00 31.19  ? 3   LYS O HA   1 
ATOM   11    H  HB2  . LYS A  1 3   ? -69.091 -24.554 -57.103  1.00 48.73  ? 3   LYS O HB2  1 
ATOM   12    H  HB3  . LYS A  1 3   ? -67.900 -25.448 -57.656  1.00 48.73  ? 3   LYS O HB3  1 
ATOM   13    H  HG2  . LYS A  1 3   ? -69.732 -26.811 -57.446  1.00 37.51  ? 3   LYS O HG2  1 
ATOM   14    H  HG3  . LYS A  1 3   ? -68.710 -27.234 -56.301  1.00 37.51  ? 3   LYS O HG3  1 
ATOM   15    H  HD2  . LYS A  1 3   ? -69.939 -25.993 -54.753  1.00 68.34  ? 3   LYS O HD2  1 
ATOM   16    H  HD3  . LYS A  1 3   ? -70.967 -25.588 -55.899  1.00 68.34  ? 3   LYS O HD3  1 
ATOM   17    H  HE2  . LYS A  1 3   ? -71.895 -27.303 -54.681  1.00 82.92  ? 3   LYS O HE2  1 
ATOM   18    H  HE3  . LYS A  1 3   ? -71.533 -27.870 -56.123  1.00 82.92  ? 3   LYS O HE3  1 
ATOM   19    H  HZ1  . LYS A  1 3   ? -70.837 -29.307 -54.505  1.00 93.00  ? 3   LYS O HZ1  1 
ATOM   20    H  HZ2  . LYS A  1 3   ? -69.673 -28.808 -55.209  1.00 93.00  ? 3   LYS O HZ2  1 
ATOM   21    H  HZ3  . LYS A  1 3   ? -70.002 -28.292 -53.896  1.00 93.00  ? 3   LYS O HZ3  1 
ATOM   22    N  N    . VAL A  1 4   ? -65.624 -26.253 -56.217  1.00 22.16  ? 4   VAL O N    1 
ATOM   23    C  CA   . VAL A  1 4   ? -64.663 -27.290 -55.853  1.00 21.69  ? 4   VAL O CA   1 
ATOM   24    C  C    . VAL A  1 4   ? -63.813 -26.797 -54.677  1.00 13.94  ? 4   VAL O C    1 
ATOM   25    O  O    . VAL A  1 4   ? -63.451 -25.609 -54.593  1.00 13.95  ? 4   VAL O O    1 
ATOM   26    C  CB   . VAL A  1 4   ? -63.752 -27.707 -57.039  1.00 15.94  ? 4   VAL O CB   1 
ATOM   27    C  CG1  . VAL A  1 4   ? -62.855 -26.554 -57.470  1.00 13.06  ? 4   VAL O CG1  1 
ATOM   28    C  CG2  . VAL A  1 4   ? -62.922 -28.936 -56.679  1.00 16.16  ? 4   VAL O CG2  1 
ATOM   29    H  H    . VAL A  1 4   ? -65.483 -25.867 -56.972  1.00 26.59  ? 4   VAL O H    1 
ATOM   30    H  HA   . VAL A  1 4   ? -65.149 -28.077 -55.560  1.00 26.02  ? 4   VAL O HA   1 
ATOM   31    H  HB   . VAL A  1 4   ? -64.313 -27.942 -57.795  1.00 19.13  ? 4   VAL O HB   1 
ATOM   32    H  HG11 . VAL A  1 4   ? -62.300 -26.846 -58.210  1.00 15.68  ? 4   VAL O HG11 1 
ATOM   33    H  HG12 . VAL A  1 4   ? -63.411 -25.808 -57.746  1.00 15.68  ? 4   VAL O HG12 1 
ATOM   34    H  HG13 . VAL A  1 4   ? -62.297 -26.292 -56.721  1.00 15.68  ? 4   VAL O HG13 1 
ATOM   35    H  HG21 . VAL A  1 4   ? -62.364 -29.172 -57.436  1.00 19.39  ? 4   VAL O HG21 1 
ATOM   36    H  HG22 . VAL A  1 4   ? -62.367 -28.727 -55.911  1.00 19.39  ? 4   VAL O HG22 1 
ATOM   37    H  HG23 . VAL A  1 4   ? -63.520 -29.669 -56.466  1.00 19.39  ? 4   VAL O HG23 1 
ATOM   38    N  N    . LYS A  1 5   ? -63.506 -27.712 -53.764  1.00 15.26  ? 5   LYS O N    1 
ATOM   39    C  CA   . LYS A  1 5   ? -62.715 -27.395 -52.576  1.00 13.52  ? 5   LYS O CA   1 
ATOM   40    C  C    . LYS A  1 5   ? -61.246 -27.715 -52.822  1.00 13.89  ? 5   LYS O C    1 
ATOM   41    O  O    . LYS A  1 5   ? -60.899 -28.811 -53.290  1.00 12.65  ? 5   LYS O O    1 
ATOM   42    C  CB   . LYS A  1 5   ? -63.239 -28.161 -51.358  1.00 14.24  ? 5   LYS O CB   1 
ATOM   43    C  CG   . LYS A  1 5   ? -64.633 -27.757 -50.935  1.00 17.11  ? 5   LYS O CG   1 
ATOM   44    C  CD   . LYS A  1 5   ? -65.093 -28.569 -49.724  1.00 22.27  ? 5   LYS O CD   1 
ATOM   45    C  CE   . LYS A  1 5   ? -66.609 -28.650 -49.629  1.00 33.84  ? 5   LYS O CE   1 
ATOM   46    N  NZ   . LYS A  1 5   ? -67.250 -27.327 -49.756  1.00 44.69  ? 5   LYS O NZ   1 
ATOM   47    H  H    . LYS A  1 5   ? -63.748 -28.536 -53.808  1.00 18.31  ? 5   LYS O H    1 
ATOM   48    H  HA   . LYS A  1 5   ? -62.789 -26.446 -52.389  1.00 16.22  ? 5   LYS O HA   1 
ATOM   49    H  HB2  . LYS A  1 5   ? -63.256 -29.108 -51.569  1.00 17.09  ? 5   LYS O HB2  1 
ATOM   50    H  HB3  . LYS A  1 5   ? -62.644 -28.002 -50.609  1.00 17.09  ? 5   LYS O HB3  1 
ATOM   51    H  HG2  . LYS A  1 5   ? -64.637 -26.818 -50.692  1.00 20.53  ? 5   LYS O HG2  1 
ATOM   52    H  HG3  . LYS A  1 5   ? -65.251 -27.920 -51.665  1.00 20.53  ? 5   LYS O HG3  1 
ATOM   53    H  HD2  . LYS A  1 5   ? -64.747 -29.473 -49.796  1.00 26.73  ? 5   LYS O HD2  1 
ATOM   54    H  HD3  . LYS A  1 5   ? -64.762 -28.149 -48.914  1.00 26.73  ? 5   LYS O HD3  1 
ATOM   55    H  HE2  . LYS A  1 5   ? -66.942 -29.216 -50.343  1.00 40.61  ? 5   LYS O HE2  1 
ATOM   56    H  HE3  . LYS A  1 5   ? -66.854 -29.022 -48.767  1.00 40.61  ? 5   LYS O HE3  1 
ATOM   57    H  HZ1  . LYS A  1 5   ? -67.046 -26.965 -50.543  1.00 53.63  ? 5   LYS O HZ1  1 
ATOM   58    H  HZ2  . LYS A  1 5   ? -68.134 -27.410 -49.697  1.00 53.63  ? 5   LYS O HZ2  1 
ATOM   59    H  HZ3  . LYS A  1 5   ? -66.966 -26.788 -49.108  1.00 53.63  ? 5   LYS O HZ3  1 
ATOM   60    N  N    . VAL A  1 6   ? -60.397 -26.752 -52.483  1.00 12.08  ? 6   VAL O N    1 
ATOM   61    C  CA   . VAL A  1 6   ? -58.997 -26.740 -52.896  1.00 11.33  ? 6   VAL O CA   1 
ATOM   62    C  C    . VAL A  1 6   ? -58.047 -26.664 -51.722  1.00 13.83  ? 6   VAL O C    1 
ATOM   63    O  O    . VAL A  1 6   ? -58.303 -25.971 -50.730  1.00 11.83  ? 6   VAL O O    1 
ATOM   64    C  CB   . VAL A  1 6   ? -58.712 -25.545 -53.824  1.00 11.38  ? 6   VAL O CB   1 
ATOM   65    C  CG1  . VAL A  1 6   ? -57.240 -25.425 -54.163  1.00 13.95  ? 6   VAL O CG1  1 
ATOM   66    C  CG2  . VAL A  1 6   ? -59.577 -25.634 -55.084  1.00 11.82  ? 6   VAL O CG2  1 
ATOM   67    H  H    . VAL A  1 6   ? -60.614 -26.074 -52.000  1.00 14.50  ? 6   VAL O H    1 
ATOM   68    H  HA   . VAL A  1 6   ? -58.805 -27.555 -53.386  1.00 13.60  ? 6   VAL O HA   1 
ATOM   69    H  HB   . VAL A  1 6   ? -58.966 -24.732 -53.358  1.00 13.66  ? 6   VAL O HB   1 
ATOM   70    H  HG11 . VAL A  1 6   ? -57.112 -24.661 -54.747  1.00 16.74  ? 6   VAL O HG11 1 
ATOM   71    H  HG12 . VAL A  1 6   ? -56.736 -25.304 -53.343  1.00 16.74  ? 6   VAL O HG12 1 
ATOM   72    H  HG13 . VAL A  1 6   ? -56.953 -26.236 -54.611  1.00 16.74  ? 6   VAL O HG13 1 
ATOM   73    H  HG21 . VAL A  1 6   ? -59.383 -24.874 -55.654  1.00 14.19  ? 6   VAL O HG21 1 
ATOM   74    H  HG22 . VAL A  1 6   ? -59.370 -26.459 -55.551  1.00 14.19  ? 6   VAL O HG22 1 
ATOM   75    H  HG23 . VAL A  1 6   ? -60.512 -25.625 -54.827  1.00 14.19  ? 6   VAL O HG23 1 
ATOM   76    N  N    . GLY A  1 7   ? -56.943 -27.384 -51.864  1.00 10.81  ? 7   GLY O N    1 
ATOM   77    C  CA   . GLY A  1 7   ? -55.842 -27.339 -50.930  1.00 10.63  ? 7   GLY O CA   1 
ATOM   78    C  C    . GLY A  1 7   ? -54.655 -26.702 -51.624  1.00 10.02  ? 7   GLY O C    1 
ATOM   79    O  O    . GLY A  1 7   ? -54.471 -26.877 -52.824  1.00 11.81  ? 7   GLY O O    1 
ATOM   80    H  H    . GLY A  1 7   ? -56.809 -27.924 -52.519  1.00 12.97  ? 7   GLY O H    1 
ATOM   81    H  HA2  . GLY A  1 7   ? -56.081 -26.810 -50.153  1.00 12.76  ? 7   GLY O HA2  1 
ATOM   82    H  HA3  . GLY A  1 7   ? -55.605 -28.236 -50.647  1.00 12.76  ? 7   GLY O HA3  1 
ATOM   83    N  N    . VAL A  1 8   ? -53.855 -25.946 -50.880  1.00 10.38  ? 8   VAL O N    1 
ATOM   84    C  CA   . VAL A  1 8   ? -52.664 -25.318 -51.438  1.00 9.38   ? 8   VAL O CA   1 
ATOM   85    C  C    . VAL A  1 8   ? -51.442 -25.854 -50.709  1.00 10.09  ? 8   VAL O C    1 
ATOM   86    O  O    . VAL A  1 8   ? -51.352 -25.752 -49.477  1.00 10.90  ? 8   VAL O O    1 
ATOM   87    C  CB   . VAL A  1 8   ? -52.728 -23.774 -51.329  1.00 10.66  ? 8   VAL O CB   1 
ATOM   88    C  CG1  . VAL A  1 8   ? -51.460 -23.146 -51.884  1.00 11.89  ? 8   VAL O CG1  1 
ATOM   89    C  CG2  . VAL A  1 8   ? -53.947 -23.255 -52.074  1.00 14.32  ? 8   VAL O CG2  1 
ATOM   90    H  H    . VAL A  1 8   ? -53.981 -25.780 -50.046  1.00 12.46  ? 8   VAL O H    1 
ATOM   91    H  HA   . VAL A  1 8   ? -52.587 -25.554 -52.375  1.00 11.25  ? 8   VAL O HA   1 
ATOM   92    H  HB   . VAL A  1 8   ? -52.810 -23.521 -50.396  1.00 12.79  ? 8   VAL O HB   1 
ATOM   93    H  HG11 . VAL A  1 8   ? -51.525 -22.181 -51.804  1.00 14.27  ? 8   VAL O HG11 1 
ATOM   94    H  HG12 . VAL A  1 8   ? -50.700 -23.469 -51.376  1.00 14.27  ? 8   VAL O HG12 1 
ATOM   95    H  HG13 . VAL A  1 8   ? -51.367 -23.395 -52.816  1.00 14.27  ? 8   VAL O HG13 1 
ATOM   96    H  HG21 . VAL A  1 8   ? -53.975 -22.289 -51.998  1.00 17.18  ? 8   VAL O HG21 1 
ATOM   97    H  HG22 . VAL A  1 8   ? -53.880 -23.513 -53.006  1.00 17.18  ? 8   VAL O HG22 1 
ATOM   98    H  HG23 . VAL A  1 8   ? -54.745 -23.642 -51.680  1.00 17.18  ? 8   VAL O HG23 1 
ATOM   99    N  N    . ASN A  1 9   ? -50.524 -26.464 -51.461  1.00 9.80   ? 9   ASN O N    1 
ATOM   100   C  CA   . ASN A  1 9   ? -49.241 -26.872 -50.906  1.00 10.03  ? 9   ASN O CA   1 
ATOM   101   C  C    . ASN A  1 9   ? -48.163 -25.870 -51.281  1.00 13.50  ? 9   ASN O C    1 
ATOM   102   O  O    . ASN A  1 9   ? -47.832 -25.732 -52.459  1.00 12.18  ? 9   ASN O O    1 
ATOM   103   C  CB   . ASN A  1 9   ? -48.840 -28.258 -51.389  1.00 12.40  ? 9   ASN O CB   1 
ATOM   104   C  CG   . ASN A  1 9   ? -47.773 -28.884 -50.499  1.00 11.90  ? 9   ASN O CG   1 
ATOM   105   O  OD1  . ASN A  1 9   ? -47.823 -28.758 -49.281  1.00 15.44  ? 9   ASN O OD1  1 
ATOM   106   N  ND2  . ASN A  1 9   ? -46.806 -29.555 -51.102  1.00 14.42  ? 9   ASN O ND2  1 
ATOM   107   H  H    . ASN A  1 9   ? -50.623 -26.653 -52.294  1.00 11.76  ? 9   ASN O H    1 
ATOM   108   H  HA   . ASN A  1 9   ? -49.307 -26.896 -49.939  1.00 12.03  ? 9   ASN O HA   1 
ATOM   109   H  HB2  . ASN A  1 9   ? -49.619 -28.836 -51.379  1.00 14.88  ? 9   ASN O HB2  1 
ATOM   110   H  HB3  . ASN A  1 9   ? -48.483 -28.192 -52.288  1.00 14.88  ? 9   ASN O HB3  1 
ATOM   111   H  HD21 . ASN A  1 9   ? -46.184 -29.924 -50.638  1.00 17.30  ? 9   ASN O HD21 1 
ATOM   112   H  HD22 . ASN A  1 9   ? -46.801 -29.623 -51.960  1.00 17.30  ? 9   ASN O HD22 1 
ATOM   113   N  N    . GLY A  1 10  ? -47.608 -25.201 -50.268  1.00 12.76  ? 10  GLY O N    1 
ATOM   114   C  CA   . GLY A  1 10  ? -46.650 -24.126 -50.467  1.00 13.47  ? 10  GLY O CA   1 
ATOM   115   C  C    . GLY A  1 10  ? -47.314 -22.753 -50.476  1.00 13.89  ? 10  GLY O C    1 
ATOM   116   O  O    . GLY A  1 10  ? -47.879 -22.320 -51.490  1.00 19.82  ? 10  GLY O O    1 
ATOM   117   H  H    . GLY A  1 10  ? -47.779 -25.360 -49.440  1.00 15.31  ? 10  GLY O H    1 
ATOM   118   H  HA2  . GLY A  1 10  ? -45.991 -24.145 -49.756  1.00 16.17  ? 10  GLY O HA2  1 
ATOM   119   H  HA3  . GLY A  1 10  ? -46.194 -24.252 -51.314  1.00 16.17  ? 10  GLY O HA3  1 
ATOM   120   N  N    . PHE A  1 11  ? -47.190 -22.034 -49.375  1.00 13.81  ? 11  PHE O N    1 
ATOM   121   C  CA   . PHE A  1 11  ? -47.878 -20.750 -49.232  1.00 14.46  ? 11  PHE O CA   1 
ATOM   122   C  C    . PHE A  1 11  ? -46.924 -19.601 -49.601  1.00 19.03  ? 11  PHE O C    1 
ATOM   123   O  O    . PHE A  1 11  ? -46.664 -18.702 -48.796  1.00 12.37  ? 11  PHE O O    1 
ATOM   124   C  CB   . PHE A  1 11  ? -48.413 -20.606 -47.799  1.00 13.38  ? 11  PHE O CB   1 
ATOM   125   C  CG   . PHE A  1 11  ? -49.565 -19.628 -47.654  1.00 11.82  ? 11  PHE O CG   1 
ATOM   126   C  CD1  . PHE A  1 11  ? -50.684 -19.713 -48.462  1.00 14.00  ? 11  PHE O CD1  1 
ATOM   127   C  CD2  . PHE A  1 11  ? -49.526 -18.653 -46.676  1.00 13.24  ? 11  PHE O CD2  1 
ATOM   128   C  CE1  . PHE A  1 11  ? -51.738 -18.835 -48.303  1.00 15.60  ? 11  PHE O CE1  1 
ATOM   129   C  CE2  . PHE A  1 11  ? -50.566 -17.767 -46.519  1.00 10.58  ? 11  PHE O CE2  1 
ATOM   130   C  CZ   . PHE A  1 11  ? -51.676 -17.855 -47.330  1.00 14.36  ? 11  PHE O CZ   1 
ATOM   131   H  H    . PHE A  1 11  ? -46.716 -22.261 -48.693  1.00 16.57  ? 11  PHE O H    1 
ATOM   132   H  HA   . PHE A  1 11  ? -48.633 -20.724 -49.841  1.00 17.36  ? 11  PHE O HA   1 
ATOM   133   H  HB2  . PHE A  1 11  ? -48.723 -21.473 -47.494  1.00 16.06  ? 11  PHE O HB2  1 
ATOM   134   H  HB3  . PHE A  1 11  ? -47.692 -20.297 -47.228  1.00 16.06  ? 11  PHE O HB3  1 
ATOM   135   H  HD1  . PHE A  1 11  ? -50.729 -20.372 -49.117  1.00 16.80  ? 11  PHE O HD1  1 
ATOM   136   H  HD2  . PHE A  1 11  ? -48.781 -18.587 -46.124  1.00 15.89  ? 11  PHE O HD2  1 
ATOM   137   H  HE1  . PHE A  1 11  ? -52.482 -18.895 -48.857  1.00 18.71  ? 11  PHE O HE1  1 
ATOM   138   H  HE2  . PHE A  1 11  ? -50.522 -17.112 -45.860  1.00 12.69  ? 11  PHE O HE2  1 
ATOM   139   H  HZ   . PHE A  1 11  ? -52.381 -17.257 -47.224  1.00 17.23  ? 11  PHE O HZ   1 
ATOM   140   N  N    . GLY A  1 12  ? -46.427 -19.639 -50.834  1.00 19.79  ? 12  GLY O N    1 
ATOM   141   C  CA   . GLY A  1 12  ? -45.435 -18.694 -51.315  1.00 13.59  ? 12  GLY O CA   1 
ATOM   142   C  C    . GLY A  1 12  ? -46.042 -17.611 -52.161  1.00 13.88  ? 12  GLY O C    1 
ATOM   143   O  O    . GLY A  1 12  ? -47.224 -17.297 -52.037  1.00 19.06  ? 12  GLY O O    1 
ATOM   144   H  H    . GLY A  1 12  ? -46.659 -20.221 -51.424  1.00 23.74  ? 12  GLY O H    1 
ATOM   145   H  HA2  . GLY A  1 12  ? -44.989 -18.281 -50.560  1.00 16.31  ? 12  GLY O HA2  1 
ATOM   146   H  HA3  . GLY A  1 12  ? -44.772 -19.163 -51.846  1.00 16.31  ? 12  GLY O HA3  1 
ATOM   147   N  N    . ARG A  1 13  ? -45.231 -17.017 -53.026  1.00 12.18  ? 13  ARG O N    1 
ATOM   148   C  CA   . ARG A  1 13  ? -45.748 -16.000 -53.909  1.00 14.62  ? 13  ARG O CA   1 
ATOM   149   C  C    . ARG A  1 13  ? -46.967 -16.558 -54.636  1.00 15.93  ? 13  ARG O C    1 
ATOM   150   O  O    . ARG A  1 13  ? -48.028 -15.924 -54.665  1.00 14.11  ? 13  ARG O O    1 
ATOM   151   C  CB   . ARG A  1 13  ? -44.700 -15.546 -54.926  1.00 12.13  ? 13  ARG O CB   1 
ATOM   152   C  CG   . ARG A  1 13  ? -43.475 -14.865 -54.344  1.00 16.51  ? 13  ARG O CG   1 
ATOM   153   C  CD   . ARG A  1 13  ? -43.813 -13.724 -53.446  1.00 15.72  ? 13  ARG O CD   1 
ATOM   154   N  NE   . ARG A  1 13  ? -44.518 -12.635 -54.119  1.00 18.12  ? 13  ARG O NE   1 
ATOM   155   C  CZ   . ARG A  1 13  ? -45.298 -11.758 -53.493  1.00 19.82  ? 13  ARG O CZ   1 
ATOM   156   N  NH1  . ARG A  1 13  ? -45.519 -11.869 -52.187  1.00 18.58  ? 13  ARG O NH1  1 
ATOM   157   N  NH2  . ARG A  1 13  ? -45.900 -10.794 -54.174  1.00 14.53  ? 13  ARG O NH2  1 
ATOM   158   H  H    . ARG A  1 13  ? -44.392 -17.184 -53.116  1.00 14.62  ? 13  ARG O H    1 
ATOM   159   H  HA   . ARG A  1 13  ? -46.025 -15.230 -53.389  1.00 17.54  ? 13  ARG O HA   1 
ATOM   160   H  HB2  . ARG A  1 13  ? -44.394 -16.324 -55.419  1.00 14.55  ? 13  ARG O HB2  1 
ATOM   161   H  HB3  . ARG A  1 13  ? -45.118 -14.920 -55.537  1.00 14.55  ? 13  ARG O HB3  1 
ATOM   162   H  HG2  . ARG A  1 13  ? -42.969 -15.513 -53.828  1.00 19.81  ? 13  ARG O HG2  1 
ATOM   163   H  HG3  . ARG A  1 13  ? -42.930 -14.523 -55.070  1.00 19.81  ? 13  ARG O HG3  1 
ATOM   164   H  HD2  . ARG A  1 13  ? -44.383 -14.048 -52.730  1.00 18.87  ? 13  ARG O HD2  1 
ATOM   165   H  HD3  . ARG A  1 13  ? -42.993 -13.363 -53.075  1.00 18.87  ? 13  ARG O HD3  1 
ATOM   166   H  HE   . ARG A  1 13  ? -44.351 -12.502 -54.952  1.00 21.75  ? 13  ARG O HE   1 
ATOM   167   H  HH11 . ARG A  1 13  ? -45.134 -12.493 -51.737  1.00 22.30  ? 13  ARG O HH11 1 
ATOM   168   H  HH12 . ARG A  1 13  ? -46.030 -11.305 -51.788  1.00 22.30  ? 13  ARG O HH12 1 
ATOM   169   H  HH21 . ARG A  1 13  ? -45.771 -10.720 -55.021  1.00 17.43  ? 13  ARG O HH21 1 
ATOM   170   H  HH22 . ARG A  1 13  ? -46.414 -10.237 -53.768  1.00 17.43  ? 13  ARG O HH22 1 
ATOM   171   N  N    . ILE A  1 14  ? -46.820 -17.730 -55.239  1.00 15.73  ? 14  ILE O N    1 
ATOM   172   C  CA   . ILE A  1 14  ? -47.930 -18.275 -56.017  1.00 12.49  ? 14  ILE O CA   1 
ATOM   173   C  C    . ILE A  1 14  ? -49.011 -18.842 -55.089  1.00 8.20   ? 14  ILE O C    1 
ATOM   174   O  O    . ILE A  1 14  ? -50.183 -18.572 -55.288  1.00 12.39  ? 14  ILE O O    1 
ATOM   175   C  CB   . ILE A  1 14  ? -47.431 -19.329 -57.022  1.00 16.83  ? 14  ILE O CB   1 
ATOM   176   C  CG1  . ILE A  1 14  ? -46.497 -18.673 -58.045  1.00 18.02  ? 14  ILE O CG1  1 
ATOM   177   C  CG2  . ILE A  1 14  ? -48.585 -19.941 -57.791  1.00 14.24  ? 14  ILE O CG2  1 
ATOM   178   C  CD1  . ILE A  1 14  ? -47.145 -17.472 -58.842  1.00 23.40  ? 14  ILE O CD1  1 
ATOM   179   H  H    . ILE A  1 14  ? -46.113 -18.218 -55.217  1.00 18.87  ? 14  ILE O H    1 
ATOM   180   H  HA   . ILE A  1 14  ? -48.332 -17.554 -56.527  1.00 14.99  ? 14  ILE O HA   1 
ATOM   181   H  HB   . ILE A  1 14  ? -46.952 -20.027 -56.548  1.00 20.20  ? 14  ILE O HB   1 
ATOM   182   H  HG12 . ILE A  1 14  ? -45.718 -18.331 -57.580  1.00 21.63  ? 14  ILE O HG12 1 
ATOM   183   H  HG13 . ILE A  1 14  ? -46.225 -19.343 -58.691  1.00 21.63  ? 14  ILE O HG13 1 
ATOM   184   H  HG21 . ILE A  1 14  ? -48.236 -20.599 -58.413  1.00 17.09  ? 14  ILE O HG21 1 
ATOM   185   H  HG22 . ILE A  1 14  ? -49.191 -20.367 -57.164  1.00 17.09  ? 14  ILE O HG22 1 
ATOM   186   H  HG23 . ILE A  1 14  ? -49.048 -19.240 -58.275  1.00 17.09  ? 14  ILE O HG23 1 
ATOM   187   H  HD11 . ILE A  1 14  ? -46.490 -17.117 -59.464  1.00 28.08  ? 14  ILE O HD11 1 
ATOM   188   H  HD12 . ILE A  1 14  ? -47.920 -17.797 -59.327  1.00 28.08  ? 14  ILE O HD12 1 
ATOM   189   H  HD13 . ILE A  1 14  ? -47.412 -16.784 -58.213  1.00 28.08  ? 14  ILE O HD13 1 
ATOM   190   N  N    . GLY A  1 15  ? -48.638 -19.581 -54.052  1.00 12.50  ? 15  GLY O N    1 
ATOM   191   C  CA   . GLY A  1 15  ? -49.654 -20.113 -53.140  1.00 12.97  ? 15  GLY O CA   1 
ATOM   192   C  C    . GLY A  1 15  ? -50.556 -19.036 -52.541  1.00 13.76  ? 15  GLY O C    1 
ATOM   193   O  O    . GLY A  1 15  ? -51.790 -19.178 -52.480  1.00 12.33  ? 15  GLY O O    1 
ATOM   194   H  H    . GLY A  1 15  ? -47.826 -19.787 -53.854  1.00 14.99  ? 15  GLY O H    1 
ATOM   195   H  HA2  . GLY A  1 15  ? -50.213 -20.746 -53.618  1.00 15.56  ? 15  GLY O HA2  1 
ATOM   196   H  HA3  . GLY A  1 15  ? -49.217 -20.583 -52.413  1.00 15.56  ? 15  GLY O HA3  1 
ATOM   197   N  N    . ARG A  1 16  ? -49.946 -17.933 -52.109  1.00 13.05  ? 16  ARG O N    1 
ATOM   198   C  CA   . ARG A  1 16  ? -50.707 -16.830 -51.513  1.00 14.55  ? 16  ARG O CA   1 
ATOM   199   C  C    . ARG A  1 16  ? -51.549 -16.106 -52.523  1.00 11.79  ? 16  ARG O C    1 
ATOM   200   O  O    . ARG A  1 16  ? -52.677 -15.716 -52.236  1.00 15.97  ? 16  ARG O O    1 
ATOM   201   C  CB   . ARG A  1 16  ? -49.766 -15.833 -50.820  1.00 14.09  ? 16  ARG O CB   1 
ATOM   202   C  CG   . ARG A  1 16  ? -49.019 -16.483 -49.690  1.00 12.53  ? 16  ARG O CG   1 
ATOM   203   C  CD   . ARG A  1 16  ? -48.418 -15.501 -48.676  1.00 13.18  ? 16  ARG O CD   1 
ATOM   204   N  NE   . ARG A  1 16  ? -47.395 -14.565 -49.170  1.00 14.39  ? 16  ARG O NE   1 
ATOM   205   C  CZ   . ARG A  1 16  ? -46.112 -14.851 -49.370  1.00 12.87  ? 16  ARG O CZ   1 
ATOM   206   N  NH1  . ARG A  1 16  ? -45.654 -16.089 -49.230  1.00 12.69  ? 16  ARG O NH1  1 
ATOM   207   N  NH2  . ARG A  1 16  ? -45.273 -13.889 -49.754  1.00 13.07  ? 16  ARG O NH2  1 
ATOM   208   H  H    . ARG A  1 16  ? -49.098 -17.797 -52.148  1.00 15.66  ? 16  ARG O H    1 
ATOM   209   H  HA   . ARG A  1 16  ? -51.302 -17.192 -50.838  1.00 17.46  ? 16  ARG O HA   1 
ATOM   210   H  HB2  . ARG A  1 16  ? -49.119 -15.503 -51.463  1.00 16.91  ? 16  ARG O HB2  1 
ATOM   211   H  HB3  . ARG A  1 16  ? -50.286 -15.098 -50.459  1.00 16.91  ? 16  ARG O HB3  1 
ATOM   212   H  HG2  . ARG A  1 16  ? -49.629 -17.065 -49.210  1.00 15.04  ? 16  ARG O HG2  1 
ATOM   213   H  HG3  . ARG A  1 16  ? -48.291 -17.007 -50.060  1.00 15.04  ? 16  ARG O HG3  1 
ATOM   214   H  HD2  . ARG A  1 16  ? -49.140 -14.966 -48.311  1.00 15.81  ? 16  ARG O HD2  1 
ATOM   215   H  HD3  . ARG A  1 16  ? -48.011 -16.017 -47.963  1.00 15.81  ? 16  ARG O HD3  1 
ATOM   216   H  HE   . ARG A  1 16  ? -47.650 -13.763 -49.344  1.00 17.27  ? 16  ARG O HE   1 
ATOM   217   H  HH11 . ARG A  1 16  ? -46.181 -16.715 -48.967  1.00 15.23  ? 16  ARG O HH11 1 
ATOM   218   H  HH12 . ARG A  1 16  ? -44.824 -16.259 -49.379  1.00 15.23  ? 16  ARG O HH12 1 
ATOM   219   H  HH21 . ARG A  1 16  ? -45.563 -13.087 -49.870  1.00 15.69  ? 16  ARG O HH21 1 
ATOM   220   H  HH22 . ARG A  1 16  ? -44.451 -14.077 -49.922  1.00 15.69  ? 16  ARG O HH22 1 
ATOM   221   N  N    . LEU A  1 17  ? -51.012 -15.898 -53.717  1.00 13.37  ? 17  LEU O N    1 
ATOM   222   C  CA   . LEU A  1 17  ? -51.776 -15.165 -54.705  1.00 13.14  ? 17  LEU O CA   1 
ATOM   223   C  C    . LEU A  1 17  ? -52.865 -16.026 -55.366  1.00 10.64  ? 17  LEU O C    1 
ATOM   224   O  O    . LEU A  1 17  ? -53.886 -15.500 -55.795  1.00 14.97  ? 17  LEU O O    1 
ATOM   225   C  CB   . LEU A  1 17  ? -50.839 -14.571 -55.747  1.00 15.91  ? 17  LEU O CB   1 
ATOM   226   C  CG   . LEU A  1 17  ? -49.960 -13.482 -55.095  1.00 17.82  ? 17  LEU O CG   1 
ATOM   227   C  CD1  . LEU A  1 17  ? -48.867 -13.026 -56.037  1.00 22.04  ? 17  LEU O CD1  1 
ATOM   228   C  CD2  . LEU A  1 17  ? -50.781 -12.285 -54.642  1.00 29.55  ? 17  LEU O CD2  1 
ATOM   229   H  H    . LEU A  1 17  ? -50.234 -16.161 -53.971  1.00 16.05  ? 17  LEU O H    1 
ATOM   230   H  HA   . LEU A  1 17  ? -52.221 -14.426 -54.261  1.00 15.77  ? 17  LEU O HA   1 
ATOM   231   H  HB2  . LEU A  1 17  ? -50.261 -15.266 -56.099  1.00 19.09  ? 17  LEU O HB2  1 
ATOM   232   H  HB3  . LEU A  1 17  ? -51.358 -14.166 -56.459  1.00 19.09  ? 17  LEU O HB3  1 
ATOM   233   H  HG   . LEU A  1 17  ? -49.533 -13.858 -54.310  1.00 21.39  ? 17  LEU O HG   1 
ATOM   234   H  HD11 . LEU A  1 17  ? -48.336 -12.344 -55.598  1.00 26.45  ? 17  LEU O HD11 1 
ATOM   235   H  HD12 . LEU A  1 17  ? -48.309 -13.786 -56.264  1.00 26.45  ? 17  LEU O HD12 1 
ATOM   236   H  HD13 . LEU A  1 17  ? -49.274 -12.663 -56.840  1.00 26.45  ? 17  LEU O HD13 1 
ATOM   237   H  HD21 . LEU A  1 17  ? -50.189 -11.630 -54.240  1.00 35.46  ? 17  LEU O HD21 1 
ATOM   238   H  HD22 . LEU A  1 17  ? -51.228 -11.900 -55.411  1.00 35.46  ? 17  LEU O HD22 1 
ATOM   239   H  HD23 . LEU A  1 17  ? -51.437 -12.581 -53.991  1.00 35.46  ? 17  LEU O HD23 1 
ATOM   240   N  N    . VAL A  1 18  ? -52.654 -17.333 -55.437  1.00 12.59  ? 18  VAL O N    1 
ATOM   241   C  CA   . VAL A  1 18  ? -53.744 -18.232 -55.842  1.00 10.99  ? 18  VAL O CA   1 
ATOM   242   C  C    . VAL A  1 18  ? -54.851 -18.136 -54.796  1.00 9.13   ? 18  VAL O C    1 
ATOM   243   O  O    . VAL A  1 18  ? -56.043 -18.008 -55.132  1.00 12.33  ? 18  VAL O O    1 
ATOM   244   C  CB   . VAL A  1 18  ? -53.266 -19.675 -55.995  1.00 11.21  ? 18  VAL O CB   1 
ATOM   245   C  CG1  . VAL A  1 18  ? -54.482 -20.641 -56.084  1.00 13.40  ? 18  VAL O CG1  1 
ATOM   246   C  CG2  . VAL A  1 18  ? -52.414 -19.805 -57.244  1.00 15.54  ? 18  VAL O CG2  1 
ATOM   247   H  H    . VAL A  1 18  ? -51.909 -17.725 -55.261  1.00 15.11  ? 18  VAL O H    1 
ATOM   248   H  HA   . VAL A  1 18  ? -54.103 -17.938 -56.694  1.00 13.18  ? 18  VAL O HA   1 
ATOM   249   H  HB   . VAL A  1 18  ? -52.729 -19.923 -55.226  1.00 13.45  ? 18  VAL O HB   1 
ATOM   250   H  HG11 . VAL A  1 18  ? -54.156 -21.550 -56.181  1.00 16.08  ? 18  VAL O HG11 1 
ATOM   251   H  HG12 . VAL A  1 18  ? -55.007 -20.562 -55.273  1.00 16.08  ? 18  VAL O HG12 1 
ATOM   252   H  HG13 . VAL A  1 18  ? -55.021 -20.399 -56.853  1.00 16.08  ? 18  VAL O HG13 1 
ATOM   253   H  HG21 . VAL A  1 18  ? -52.117 -20.725 -57.328  1.00 18.65  ? 18  VAL O HG21 1 
ATOM   254   H  HG22 . VAL A  1 18  ? -52.945 -19.556 -58.016  1.00 18.65  ? 18  VAL O HG22 1 
ATOM   255   H  HG23 . VAL A  1 18  ? -51.647 -19.216 -57.165  1.00 18.65  ? 18  VAL O HG23 1 
ATOM   256   N  N    . THR A  1 19  ? -54.461 -18.141 -53.523  1.00 12.99  ? 19  THR O N    1 
ATOM   257   C  CA   . THR A  1 19  ? -55.437 -17.992 -52.441  1.00 13.41  ? 19  THR O CA   1 
ATOM   258   C  C    . THR A  1 19  ? -56.199 -16.643 -52.567  1.00 13.69  ? 19  THR O C    1 
ATOM   259   O  O    . THR A  1 19  ? -57.440 -16.619 -52.515  1.00 13.15  ? 19  THR O O    1 
ATOM   260   C  CB   . THR A  1 19  ? -54.748 -18.160 -51.063  1.00 11.18  ? 19  THR O CB   1 
ATOM   261   O  OG1  . THR A  1 19  ? -54.181 -19.468 -50.970  1.00 12.75  ? 19  THR O OG1  1 
ATOM   262   C  CG2  . THR A  1 19  ? -55.736 -18.022 -49.903  1.00 12.23  ? 19  THR O CG2  1 
ATOM   263   H  H    . THR A  1 19  ? -53.647 -18.228 -53.259  1.00 15.58  ? 19  THR O H    1 
ATOM   264   H  HA   . THR A  1 19  ? -56.093 -18.701 -52.524  1.00 16.09  ? 19  THR O HA   1 
ATOM   265   H  HB   . THR A  1 19  ? -54.052 -17.493 -50.960  1.00 13.41  ? 19  THR O HB   1 
ATOM   266   H  HG1  . THR A  1 19  ? -53.613 -19.579 -51.579  1.00 15.30  ? 19  THR O HG1  1 
ATOM   267   H  HG21 . THR A  1 19  ? -55.272 -18.132 -49.058  1.00 14.68  ? 19  THR O HG21 1 
ATOM   268   H  HG22 . THR A  1 19  ? -56.150 -17.145 -49.923  1.00 14.68  ? 19  THR O HG22 1 
ATOM   269   H  HG23 . THR A  1 19  ? -56.427 -18.699 -49.974  1.00 14.68  ? 19  THR O HG23 1 
ATOM   270   N  N    . ARG A  1 20  ? -55.490 -15.527 -52.789  1.00 14.88  ? 20  ARG O N    1 
ATOM   271   C  CA   . ARG A  1 20  ? -56.161 -14.247 -53.082  1.00 15.14  ? 20  ARG O CA   1 
ATOM   272   C  C    . ARG A  1 20  ? -57.104 -14.296 -54.267  1.00 10.40  ? 20  ARG O C    1 
ATOM   273   O  O    . ARG A  1 20  ? -58.198 -13.732 -54.228  1.00 14.76  ? 20  ARG O O    1 
ATOM   274   C  CB   . ARG A  1 20  ? -55.158 -13.126 -53.398  1.00 21.39  ? 20  ARG O CB   1 
ATOM   275   C  CG   . ARG A  1 20  ? -54.610 -12.395 -52.255  1.00 28.96  ? 20  ARG O CG   1 
ATOM   276   C  CD   . ARG A  1 20  ? -53.983 -11.044 -52.666  1.00 19.70  ? 20  ARG O CD   1 
ATOM   277   N  NE   . ARG A  1 20  ? -53.226 -10.584 -51.523  1.00 21.00  ? 20  ARG O NE   1 
ATOM   278   C  CZ   . ARG A  1 20  ? -52.851 -9.337  -51.293  1.00 16.44  ? 20  ARG O CZ   1 
ATOM   279   N  NH1  . ARG A  1 20  ? -53.175 -8.362  -52.129  1.00 14.68  ? 20  ARG O NH1  1 
ATOM   280   N  NH2  . ARG A  1 20  ? -52.175 -9.086  -50.186  1.00 16.60  ? 20  ARG O NH2  1 
ATOM   281   H  H    . ARG A  1 20  ? -54.631 -15.483 -52.776  1.00 17.85  ? 20  ARG O H    1 
ATOM   282   H  HA   . ARG A  1 20  ? -56.674 -13.978 -52.304  1.00 18.17  ? 20  ARG O HA   1 
ATOM   283   H  HB2  . ARG A  1 20  ? -54.409 -13.516 -53.876  1.00 25.67  ? 20  ARG O HB2  1 
ATOM   284   H  HB3  . ARG A  1 20  ? -55.599 -12.477 -53.969  1.00 25.67  ? 20  ARG O HB3  1 
ATOM   285   H  HG2  . ARG A  1 20  ? -55.322 -12.217 -51.621  1.00 34.76  ? 20  ARG O HG2  1 
ATOM   286   H  HG3  . ARG A  1 20  ? -53.919 -12.933 -51.837  1.00 34.76  ? 20  ARG O HG3  1 
ATOM   287   H  HD2  . ARG A  1 20  ? -53.384 -11.166 -53.419  1.00 23.64  ? 20  ARG O HD2  1 
ATOM   288   H  HD3  . ARG A  1 20  ? -54.679 -10.399 -52.870  1.00 23.64  ? 20  ARG O HD3  1 
ATOM   289   H  HE   . ARG A  1 20  ? -52.999 -11.175 -50.941  1.00 25.20  ? 20  ARG O HE   1 
ATOM   290   H  HH11 . ARG A  1 20  ? -53.622 -8.538  -52.843  1.00 17.62  ? 20  ARG O HH11 1 
ATOM   291   H  HH12 . ARG A  1 20  ? -52.928 -7.555  -51.965  1.00 17.62  ? 20  ARG O HH12 1 
ATOM   292   H  HH21 . ARG A  1 20  ? -51.974 -9.728  -49.651  1.00 19.92  ? 20  ARG O HH21 1 
ATOM   293   H  HH22 . ARG A  1 20  ? -51.919 -8.284  -50.011  1.00 19.92  ? 20  ARG O HH22 1 
ATOM   294   N  N    . ALA A  1 21  ? -56.652 -14.906 -55.358  1.00 14.07  ? 21  ALA O N    1 
ATOM   295   C  CA   . ALA A  1 21  ? -57.471 -14.964 -56.568  1.00 16.61  ? 21  ALA O CA   1 
ATOM   296   C  C    . ALA A  1 21  ? -58.732 -15.774 -56.298  1.00 13.76  ? 21  ALA O C    1 
ATOM   297   O  O    . ALA A  1 21  ? -59.820 -15.406 -56.706  1.00 17.13  ? 21  ALA O O    1 
ATOM   298   C  CB   . ALA A  1 21  ? -56.665 -15.567 -57.738  1.00 18.31  ? 21  ALA O CB   1 
ATOM   299   H  H    . ALA A  1 21  ? -55.885 -15.290 -55.425  1.00 16.89  ? 21  ALA O H    1 
ATOM   300   H  HA   . ALA A  1 21  ? -57.737 -14.064 -56.816  1.00 19.93  ? 21  ALA O HA   1 
ATOM   301   H  HB1  . ALA A  1 21  ? -57.227 -15.595 -58.527  1.00 21.97  ? 21  ALA O HB1  1 
ATOM   302   H  HB2  . ALA A  1 21  ? -55.887 -15.011 -57.905  1.00 21.97  ? 21  ALA O HB2  1 
ATOM   303   H  HB3  . ALA A  1 21  ? -56.385 -16.464 -57.498  1.00 21.97  ? 21  ALA O HB3  1 
ATOM   304   N  N    . ALA A  1 22  ? -58.585 -16.864 -55.563  1.00 15.65  ? 22  ALA O N    1 
ATOM   305   C  CA   . ALA A  1 22  ? -59.724 -17.705 -55.243  1.00 12.38  ? 22  ALA O CA   1 
ATOM   306   C  C    . ALA A  1 22  ? -60.780 -16.909 -54.476  1.00 15.56  ? 22  ALA O C    1 
ATOM   307   O  O    . ALA A  1 22  ? -61.961 -16.961 -54.802  1.00 17.95  ? 22  ALA O O    1 
ATOM   308   C  CB   . ALA A  1 22  ? -59.273 -18.917 -54.437  1.00 14.70  ? 22  ALA O CB   1 
ATOM   309   H  H    . ALA A  1 22  ? -57.838 -17.138 -55.237  1.00 18.79  ? 22  ALA O H    1 
ATOM   310   H  HA   . ALA A  1 22  ? -60.125 -18.023 -56.067  1.00 14.85  ? 22  ALA O HA   1 
ATOM   311   H  HB1  . ALA A  1 22  ? -60.046 -19.466 -54.233  1.00 17.64  ? 22  ALA O HB1  1 
ATOM   312   H  HB2  . ALA A  1 22  ? -58.635 -19.425 -54.962  1.00 17.64  ? 22  ALA O HB2  1 
ATOM   313   H  HB3  . ALA A  1 22  ? -58.857 -18.612 -53.615  1.00 17.64  ? 22  ALA O HB3  1 
ATOM   314   N  N    . PHE A  1 23  ? -60.359 -16.159 -53.460  1.00 18.99  ? 23  PHE O N    1 
ATOM   315   C  CA   . PHE A  1 23  ? -61.319 -15.437 -52.635  1.00 20.49  ? 23  PHE O CA   1 
ATOM   316   C  C    . PHE A  1 23  ? -61.850 -14.196 -53.346  1.00 22.51  ? 23  PHE O C    1 
ATOM   317   O  O    . PHE A  1 23  ? -62.985 -13.804 -53.130  1.00 32.09  ? 23  PHE O O    1 
ATOM   318   C  CB   . PHE A  1 23  ? -60.695 -15.056 -51.291  1.00 15.00  ? 23  PHE O CB   1 
ATOM   319   C  CG   . PHE A  1 23  ? -60.654 -16.192 -50.315  1.00 12.61  ? 23  PHE O CG   1 
ATOM   320   C  CD1  . PHE A  1 23  ? -61.795 -16.558 -49.623  1.00 24.24  ? 23  PHE O CD1  1 
ATOM   321   C  CD2  . PHE A  1 23  ? -59.502 -16.929 -50.127  1.00 16.58  ? 23  PHE O CD2  1 
ATOM   322   C  CE1  . PHE A  1 23  ? -61.769 -17.614 -48.744  1.00 29.44  ? 23  PHE O CE1  1 
ATOM   323   C  CE2  . PHE A  1 23  ? -59.472 -17.984 -49.244  1.00 17.16  ? 23  PHE O CE2  1 
ATOM   324   C  CZ   . PHE A  1 23  ? -60.610 -18.328 -48.556  1.00 23.39  ? 23  PHE O CZ   1 
ATOM   325   H  H    . PHE A  1 23  ? -59.536 -16.054 -53.232  1.00 22.79  ? 23  PHE O H    1 
ATOM   326   H  HA   . PHE A  1 23  ? -62.074 -16.020 -52.455  1.00 24.59  ? 23  PHE O HA   1 
ATOM   327   H  HB2  . PHE A  1 23  ? -59.784 -14.758 -51.441  1.00 18.00  ? 23  PHE O HB2  1 
ATOM   328   H  HB3  . PHE A  1 23  ? -61.216 -14.341 -50.895  1.00 18.00  ? 23  PHE O HB3  1 
ATOM   329   H  HD1  . PHE A  1 23  ? -62.582 -16.079 -49.746  1.00 29.09  ? 23  PHE O HD1  1 
ATOM   330   H  HD2  . PHE A  1 23  ? -58.730 -16.699 -50.591  1.00 19.90  ? 23  PHE O HD2  1 
ATOM   331   H  HE1  . PHE A  1 23  ? -62.538 -17.846 -48.275  1.00 35.33  ? 23  PHE O HE1  1 
ATOM   332   H  HE2  . PHE A  1 23  ? -58.687 -18.466 -49.119  1.00 20.59  ? 23  PHE O HE2  1 
ATOM   333   H  HZ   . PHE A  1 23  ? -60.595 -19.040 -47.958  1.00 28.06  ? 23  PHE O HZ   1 
ATOM   334   N  N    . ASN A  1 24  ? -61.033 -13.584 -54.196  1.00 24.90  ? 24  ASN O N    1 
ATOM   335   C  CA   . ASN A  1 24  ? -61.482 -12.409 -54.950  1.00 23.20  ? 24  ASN O CA   1 
ATOM   336   C  C    . ASN A  1 24  ? -62.482 -12.771 -56.054  1.00 25.81  ? 24  ASN O C    1 
ATOM   337   O  O    . ASN A  1 24  ? -63.452 -12.049 -56.277  1.00 28.94  ? 24  ASN O O    1 
ATOM   338   C  CB   . ASN A  1 24  ? -60.288 -11.671 -55.549  1.00 27.35  ? 24  ASN O CB   1 
ATOM   339   C  CG   . ASN A  1 24  ? -59.405 -11.013 -54.485  1.00 54.19  ? 24  ASN O CG   1 
ATOM   340   O  OD1  . ASN A  1 24  ? -59.797 -10.876 -53.322  1.00 59.05  ? 24  ASN O OD1  1 
ATOM   341   N  ND2  . ASN A  1 24  ? -58.207 -10.602 -54.887  1.00 65.09  ? 24  ASN O ND2  1 
ATOM   342   H  H    . ASN A  1 24  ? -60.222 -13.822 -54.356  1.00 29.88  ? 24  ASN O H    1 
ATOM   343   H  HA   . ASN A  1 24  ? -61.927 -11.801 -54.339  1.00 27.84  ? 24  ASN O HA   1 
ATOM   344   H  HB2  . ASN A  1 24  ? -59.742 -12.302 -56.043  1.00 32.82  ? 24  ASN O HB2  1 
ATOM   345   H  HB3  . ASN A  1 24  ? -60.611 -10.976 -56.143  1.00 32.82  ? 24  ASN O HB3  1 
ATOM   346   H  HD21 . ASN A  1 24  ? -57.672 -10.226 -54.329  1.00 78.11  ? 24  ASN O HD21 1 
ATOM   347   H  HD22 . ASN A  1 24  ? -57.967 -10.713 -55.706  1.00 78.11  ? 24  ASN O HD22 1 
ATOM   348   N  N    . SER A  1 25  ? -62.268 -13.899 -56.726  1.00 27.48  ? 25  SER O N    1 
ATOM   349   C  CA   . SER A  1 25  ? -63.161 -14.319 -57.813  1.00 24.76  ? 25  SER O CA   1 
ATOM   350   C  C    . SER A  1 25  ? -64.305 -15.199 -57.321  1.00 21.85  ? 25  SER O C    1 
ATOM   351   O  O    . SER A  1 25  ? -65.374 -15.246 -57.928  1.00 26.68  ? 25  SER O O    1 
ATOM   352   C  CB   . SER A  1 25  ? -62.370 -15.069 -58.890  1.00 25.51  ? 25  SER O CB   1 
ATOM   353   O  OG   . SER A  1 25  ? -61.982 -16.360 -58.429  1.00 20.28  ? 25  SER O OG   1 
ATOM   354   H  H    . SER A  1 25  ? -61.617 -14.440 -56.576  1.00 32.97  ? 25  SER O H    1 
ATOM   355   H  HA   . SER A  1 25  ? -63.548 -13.529 -58.223  1.00 29.71  ? 25  SER O HA   1 
ATOM   356   H  HB2  . SER A  1 25  ? -62.926 -15.170 -59.678  1.00 30.61  ? 25  SER O HB2  1 
ATOM   357   H  HB3  . SER A  1 25  ? -61.574 -14.560 -59.109  1.00 30.61  ? 25  SER O HB3  1 
ATOM   358   H  HG   . SER A  1 25  ? -61.499 -16.288 -57.746  1.00 24.34  ? 25  SER O HG   1 
ATOM   359   N  N    . GLY A  1 26  ? -64.078 -15.925 -56.232  1.00 22.72  ? 26  GLY O N    1 
ATOM   360   C  CA   . GLY A  1 26  ? -65.072 -16.862 -55.729  1.00 22.60  ? 26  GLY O CA   1 
ATOM   361   C  C    . GLY A  1 26  ? -65.259 -18.107 -56.590  1.00 23.33  ? 26  GLY O C    1 
ATOM   362   O  O    . GLY A  1 26  ? -66.211 -18.859 -56.383  1.00 31.61  ? 26  GLY O O    1 
ATOM   363   H  H    . GLY A  1 26  ? -63.356 -15.892 -55.766  1.00 27.27  ? 26  GLY O H    1 
ATOM   364   H  HA2  . GLY A  1 26  ? -64.814 -17.148 -54.839  1.00 27.12  ? 26  GLY O HA2  1 
ATOM   365   H  HA3  . GLY A  1 26  ? -65.928 -16.410 -55.664  1.00 27.12  ? 26  GLY O HA3  1 
ATOM   366   N  N    . LYS A  1 27  ? -64.357 -18.352 -57.540  1.00 22.64  ? 27  LYS O N    1 
ATOM   367   C  CA   . LYS A  1 27  ? -64.545 -19.470 -58.477  1.00 17.07  ? 27  LYS O CA   1 
ATOM   368   C  C    . LYS A  1 27  ? -64.279 -20.846 -57.858  1.00 19.79  ? 27  LYS O C    1 
ATOM   369   O  O    . LYS A  1 27  ? -64.839 -21.830 -58.312  1.00 17.91  ? 27  LYS O O    1 
ATOM   370   C  CB   . LYS A  1 27  ? -63.632 -19.306 -59.697  1.00 22.48  ? 27  LYS O CB   1 
ATOM   371   C  CG   . LYS A  1 27  ? -64.019 -18.173 -60.626  1.00 25.42  ? 27  LYS O CG   1 
ATOM   372   C  CD   . LYS A  1 27  ? -63.050 -18.090 -61.808  1.00 40.54  ? 27  LYS O CD   1 
ATOM   373   C  CE   . LYS A  1 27  ? -63.488 -17.038 -62.813  1.00 53.06  ? 27  LYS O CE   1 
ATOM   374   N  NZ   . LYS A  1 27  ? -62.594 -16.987 -64.003  1.00 61.27  ? 27  LYS O NZ   1 
ATOM   375   H  H    . LYS A  1 27  ? -63.638 -17.897 -57.665  1.00 27.16  ? 27  LYS O H    1 
ATOM   376   H  HA   . LYS A  1 27  ? -65.463 -19.460 -58.791  1.00 20.48  ? 27  LYS O HA   1 
ATOM   377   H  HB2  . LYS A  1 27  ? -62.729 -19.138 -59.388  1.00 26.97  ? 27  LYS O HB2  1 
ATOM   378   H  HB3  . LYS A  1 27  ? -63.653 -20.128 -60.211  1.00 26.97  ? 27  LYS O HB3  1 
ATOM   379   H  HG2  . LYS A  1 27  ? -64.911 -18.329 -60.972  1.00 30.50  ? 27  LYS O HG2  1 
ATOM   380   H  HG3  . LYS A  1 27  ? -63.985 -17.333 -60.142  1.00 30.50  ? 27  LYS O HG3  1 
ATOM   381   H  HD2  . LYS A  1 27  ? -62.168 -17.850 -61.483  1.00 48.65  ? 27  LYS O HD2  1 
ATOM   382   H  HD3  . LYS A  1 27  ? -63.020 -18.948 -62.259  1.00 48.65  ? 27  LYS O HD3  1 
ATOM   383   H  HE2  . LYS A  1 27  ? -64.385 -17.246 -63.118  1.00 63.67  ? 27  LYS O HE2  1 
ATOM   384   H  HE3  . LYS A  1 27  ? -63.474 -16.167 -62.388  1.00 63.67  ? 27  LYS O HE3  1 
ATOM   385   H  HZ1  . LYS A  1 27  ? -61.763 -16.793 -63.751  1.00 73.52  ? 27  LYS O HZ1  1 
ATOM   386   H  HZ2  . LYS A  1 27  ? -62.593 -17.775 -64.417  1.00 73.52  ? 27  LYS O HZ2  1 
ATOM   387   H  HZ3  . LYS A  1 27  ? -62.878 -16.363 -64.570  1.00 73.52  ? 27  LYS O HZ3  1 
ATOM   388   N  N    . VAL A  1 28  ? -63.380 -20.907 -56.875  1.00 21.32  ? 28  VAL O N    1 
ATOM   389   C  CA   . VAL A  1 28  ? -63.072 -22.139 -56.130  1.00 13.68  ? 28  VAL O CA   1 
ATOM   390   C  C    . VAL A  1 28  ? -63.044 -21.790 -54.628  1.00 27.25  ? 28  VAL O C    1 
ATOM   391   O  O    . VAL A  1 28  ? -62.939 -20.613 -54.269  1.00 20.47  ? 28  VAL O O    1 
ATOM   392   C  CB   . VAL A  1 28  ? -61.712 -22.761 -56.535  1.00 12.08  ? 28  VAL O CB   1 
ATOM   393   C  CG1  . VAL A  1 28  ? -61.640 -22.993 -58.040  1.00 12.34  ? 28  VAL O CG1  1 
ATOM   394   C  CG2  . VAL A  1 28  ? -60.539 -21.873 -56.082  1.00 12.50  ? 28  VAL O CG2  1 
ATOM   395   H  H    . VAL A  1 28  ? -62.920 -20.230 -56.612  1.00 25.59  ? 28  VAL O H    1 
ATOM   396   H  HA   . VAL A  1 28  ? -63.770 -22.795 -56.283  1.00 16.42  ? 28  VAL O HA   1 
ATOM   397   H  HB   . VAL A  1 28  ? -61.619 -23.621 -56.097  1.00 14.50  ? 28  VAL O HB   1 
ATOM   398   H  HG11 . VAL A  1 28  ? -60.778 -23.382 -58.258  1.00 14.81  ? 28  VAL O HG11 1 
ATOM   399   H  HG12 . VAL A  1 28  ? -62.352 -23.599 -58.300  1.00 14.81  ? 28  VAL O HG12 1 
ATOM   400   H  HG13 . VAL A  1 28  ? -61.744 -22.143 -58.496  1.00 14.81  ? 28  VAL O HG13 1 
ATOM   401   H  HG21 . VAL A  1 28  ? -59.706 -22.291 -56.351  1.00 15.00  ? 28  VAL O HG21 1 
ATOM   402   H  HG22 . VAL A  1 28  ? -60.623 -21.002 -56.500  1.00 15.00  ? 28  VAL O HG22 1 
ATOM   403   H  HG23 . VAL A  1 28  ? -60.568 -21.782 -55.117  1.00 15.00  ? 28  VAL O HG23 1 
ATOM   404   N  N    . ASP A  1 29  ? -63.133 -22.797 -53.762  1.00 21.20  ? 29  ASP O N    1 
ATOM   405   C  CA   . ASP A  1 29  ? -63.085 -22.579 -52.308  1.00 13.20  ? 29  ASP O CA   1 
ATOM   406   C  C    . ASP A  1 29  ? -61.835 -23.188 -51.681  1.00 15.87  ? 29  ASP O C    1 
ATOM   407   O  O    . ASP A  1 29  ? -61.695 -24.409 -51.626  1.00 18.81  ? 29  ASP O O    1 
ATOM   408   C  CB   . ASP A  1 29  ? -64.317 -23.169 -51.634  1.00 18.14  ? 29  ASP O CB   1 
ATOM   409   C  CG   . ASP A  1 29  ? -65.574 -22.330 -51.863  1.00 51.05  ? 29  ASP O CG   1 
ATOM   410   O  OD1  . ASP A  1 29  ? -65.449 -21.131 -52.195  1.00 60.68  ? 29  ASP O OD1  1 
ATOM   411   O  OD2  . ASP A  1 29  ? -66.690 -22.869 -51.698  1.00 59.56  ? 29  ASP O OD2  1 
ATOM   412   H  H    . ASP A  1 29  ? -63.223 -23.622 -53.987  1.00 25.45  ? 29  ASP O H    1 
ATOM   413   H  HA   . ASP A  1 29  ? -63.075 -21.625 -52.132  1.00 15.84  ? 29  ASP O HA   1 
ATOM   414   H  HB2  . ASP A  1 29  ? -64.478 -24.056 -51.993  1.00 21.77  ? 29  ASP O HB2  1 
ATOM   415   H  HB3  . ASP A  1 29  ? -64.160 -23.221 -50.679  1.00 21.77  ? 29  ASP O HB3  1 
ATOM   416   N  N    . ILE A  1 30  ? -60.941 -22.338 -51.184  1.00 12.04  ? 30  ILE O N    1 
ATOM   417   C  CA   . ILE A  1 30  ? -59.756 -22.813 -50.486  1.00 14.07  ? 30  ILE O CA   1 
ATOM   418   C  C    . ILE A  1 30  ? -60.162 -23.334 -49.122  1.00 17.10  ? 30  ILE O C    1 
ATOM   419   O  O    . ILE A  1 30  ? -60.760 -22.594 -48.362  1.00 12.56  ? 30  ILE O O    1 
ATOM   420   C  CB   . ILE A  1 30  ? -58.702 -21.710 -50.282  1.00 15.64  ? 30  ILE O CB   1 
ATOM   421   C  CG1  . ILE A  1 30  ? -58.394 -20.976 -51.597  1.00 19.54  ? 30  ILE O CG1  1 
ATOM   422   C  CG2  . ILE A  1 30  ? -57.451 -22.315 -49.656  1.00 14.81  ? 30  ILE O CG2  1 
ATOM   423   C  CD1  . ILE A  1 30  ? -57.618 -21.762 -52.623  1.00 14.59  ? 30  ILE O CD1  1 
ATOM   424   H  H    . ILE A  1 30  ? -60.999 -21.481 -51.238  1.00 14.45  ? 30  ILE O H    1 
ATOM   425   H  HA   . ILE A  1 30  ? -59.351 -23.539 -50.988  1.00 16.88  ? 30  ILE O HA   1 
ATOM   426   H  HB   . ILE A  1 30  ? -59.065 -21.063 -49.658  1.00 18.76  ? 30  ILE O HB   1 
ATOM   427   H  HG12 . ILE A  1 30  ? -59.234 -20.716 -52.006  1.00 23.45  ? 30  ILE O HG12 1 
ATOM   428   H  HG13 . ILE A  1 30  ? -57.877 -20.181 -51.390  1.00 23.45  ? 30  ILE O HG13 1 
ATOM   429   H  HG21 . ILE A  1 30  ? -56.791 -21.615 -49.530  1.00 17.77  ? 30  ILE O HG21 1 
ATOM   430   H  HG22 . ILE A  1 30  ? -57.685 -22.708 -48.800  1.00 17.77  ? 30  ILE O HG22 1 
ATOM   431   H  HG23 . ILE A  1 30  ? -57.100 -22.998 -50.249  1.00 17.77  ? 30  ILE O HG23 1 
ATOM   432   H  HD11 . ILE A  1 30  ? -57.480 -21.208 -53.407  1.00 17.50  ? 30  ILE O HD11 1 
ATOM   433   H  HD12 . ILE A  1 30  ? -56.763 -22.018 -52.243  1.00 17.50  ? 30  ILE O HD12 1 
ATOM   434   H  HD13 . ILE A  1 30  ? -58.125 -22.554 -52.862  1.00 17.50  ? 30  ILE O HD13 1 
ATOM   435   N  N    . VAL A  1 31  ? -59.815 -24.582 -48.795  1.00 13.55  ? 31  VAL O N    1 
ATOM   436   C  CA   . VAL A  1 31  ? -60.192 -25.154 -47.507  1.00 12.87  ? 31  VAL O CA   1 
ATOM   437   C  C    . VAL A  1 31  ? -59.010 -25.678 -46.702  1.00 13.86  ? 31  VAL O C    1 
ATOM   438   O  O    . VAL A  1 31  ? -59.184 -26.042 -45.550  1.00 13.25  ? 31  VAL O O    1 
ATOM   439   C  CB   . VAL A  1 31  ? -61.208 -26.299 -47.675  1.00 13.58  ? 31  VAL O CB   1 
ATOM   440   C  CG1  . VAL A  1 31  ? -62.452 -25.790 -48.393  1.00 16.70  ? 31  VAL O CG1  1 
ATOM   441   C  CG2  . VAL A  1 31  ? -60.578 -27.476 -48.416  1.00 14.76  ? 31  VAL O CG2  1 
ATOM   442   H  H    . VAL A  1 31  ? -59.365 -25.113 -49.300  1.00 16.26  ? 31  VAL O H    1 
ATOM   443   H  HA   . VAL A  1 31  ? -60.619 -24.462 -46.978  1.00 15.44  ? 31  VAL O HA   1 
ATOM   444   H  HB   . VAL A  1 31  ? -61.478 -26.610 -46.797  1.00 16.30  ? 31  VAL O HB   1 
ATOM   445   H  HG11 . VAL A  1 31  ? -63.081 -26.521 -48.491  1.00 20.04  ? 31  VAL O HG11 1 
ATOM   446   H  HG12 . VAL A  1 31  ? -62.850 -25.078 -47.868  1.00 20.04  ? 31  VAL O HG12 1 
ATOM   447   H  HG13 . VAL A  1 31  ? -62.196 -25.454 -49.266  1.00 20.04  ? 31  VAL O HG13 1 
ATOM   448   H  HG21 . VAL A  1 31  ? -61.239 -28.180 -48.507  1.00 17.71  ? 31  VAL O HG21 1 
ATOM   449   H  HG22 . VAL A  1 31  ? -60.289 -27.177 -49.292  1.00 17.71  ? 31  VAL O HG22 1 
ATOM   450   H  HG23 . VAL A  1 31  ? -59.818 -27.798 -47.908  1.00 17.71  ? 31  VAL O HG23 1 
ATOM   451   N  N    . ALA A  1 32  ? -57.817 -25.712 -47.297  1.00 11.98  ? 32  ALA O N    1 
ATOM   452   C  CA   . ALA A  1 32  ? -56.639 -26.194 -46.600  1.00 11.89  ? 32  ALA O CA   1 
ATOM   453   C  C    . ALA A  1 32  ? -55.356 -25.646 -47.216  1.00 11.88  ? 32  ALA O C    1 
ATOM   454   O  O    . ALA A  1 32  ? -55.244 -25.475 -48.426  1.00 10.72  ? 32  ALA O O    1 
ATOM   455   C  CB   . ALA A  1 32  ? -56.603 -27.704 -46.601  1.00 12.27  ? 32  ALA O CB   1 
ATOM   456   H  H    . ALA A  1 32  ? -57.669 -25.458 -48.105  1.00 14.38  ? 32  ALA O H    1 
ATOM   457   H  HA   . ALA A  1 32  ? -56.677 -25.897 -45.678  1.00 14.27  ? 32  ALA O HA   1 
ATOM   458   H  HB1  . ALA A  1 32  ? -55.808 -28.001 -46.130  1.00 14.72  ? 32  ALA O HB1  1 
ATOM   459   H  HB2  . ALA A  1 32  ? -57.397 -28.038 -46.154  1.00 14.72  ? 32  ALA O HB2  1 
ATOM   460   H  HB3  . ALA A  1 32  ? -56.582 -28.019 -47.518  1.00 14.72  ? 32  ALA O HB3  1 
ATOM   461   N  N    . ILE A  1 33  ? -54.382 -25.409 -46.355  1.00 11.16  ? 33  ILE O N    1 
ATOM   462   C  CA   . ILE A  1 33  ? -53.072 -24.909 -46.754  1.00 10.65  ? 33  ILE O CA   1 
ATOM   463   C  C    . ILE A  1 33  ? -51.996 -25.633 -45.979  1.00 10.92  ? 33  ILE O C    1 
ATOM   464   O  O    . ILE A  1 33  ? -52.092 -25.764 -44.753  1.00 11.51  ? 33  ILE O O    1 
ATOM   465   C  CB   . ILE A  1 33  ? -52.941 -23.407 -46.488  1.00 10.79  ? 33  ILE O CB   1 
ATOM   466   C  CG1  . ILE A  1 33  ? -53.989 -22.638 -47.286  1.00 11.34  ? 33  ILE O CG1  1 
ATOM   467   C  CG2  . ILE A  1 33  ? -51.523 -22.911 -46.854  1.00 13.33  ? 33  ILE O CG2  1 
ATOM   468   C  CD1  . ILE A  1 33  ? -54.165 -21.198 -46.840  1.00 18.10  ? 33  ILE O CD1  1 
ATOM   469   H  H    . ILE A  1 33  ? -54.455 -25.532 -45.507  1.00 13.39  ? 33  ILE O H    1 
ATOM   470   H  HA   . ILE A  1 33  ? -52.936 -25.070 -47.700  1.00 12.77  ? 33  ILE O HA   1 
ATOM   471   H  HB   . ILE A  1 33  ? -53.092 -23.246 -45.544  1.00 12.95  ? 33  ILE O HB   1 
ATOM   472   H  HG12 . ILE A  1 33  ? -53.726 -22.629 -48.220  1.00 13.61  ? 33  ILE O HG12 1 
ATOM   473   H  HG13 . ILE A  1 33  ? -54.844 -23.085 -47.190  1.00 13.61  ? 33  ILE O HG13 1 
ATOM   474   H  HG21 . ILE A  1 33  ? -51.467 -21.959 -46.677  1.00 16.00  ? 33  ILE O HG21 1 
ATOM   475   H  HG22 . ILE A  1 33  ? -50.874 -23.388 -46.314  1.00 16.00  ? 33  ILE O HG22 1 
ATOM   476   H  HG23 . ILE A  1 33  ? -51.362 -23.084 -47.795  1.00 16.00  ? 33  ILE O HG23 1 
ATOM   477   H  HD11 . ILE A  1 33  ? -54.843 -20.778 -47.391  1.00 21.72  ? 33  ILE O HD11 1 
ATOM   478   H  HD12 . ILE A  1 33  ? -54.440 -21.187 -45.910  1.00 21.72  ? 33  ILE O HD12 1 
ATOM   479   H  HD13 . ILE A  1 33  ? -53.320 -20.731 -46.940  1.00 21.72  ? 33  ILE O HD13 1 
ATOM   480   N  N    . ASN A  1 34  ? -50.969 -26.097 -46.685  1.00 10.67  ? 34  ASN O N    1 
ATOM   481   C  CA   . ASN A  1 34  ? -49.799 -26.686 -46.043  1.00 12.05  ? 34  ASN O CA   1 
ATOM   482   C  C    . ASN A  1 34  ? -48.537 -25.878 -46.334  1.00 11.57  ? 34  ASN O C    1 
ATOM   483   O  O    . ASN A  1 34  ? -48.231 -25.558 -47.489  1.00 13.31  ? 34  ASN O O    1 
ATOM   484   C  CB   . ASN A  1 34  ? -49.590 -28.136 -46.497  1.00 11.70  ? 34  ASN O CB   1 
ATOM   485   C  CG   . ASN A  1 34  ? -48.394 -28.793 -45.812  1.00 20.11  ? 34  ASN O CG   1 
ATOM   486   O  OD1  . ASN A  1 34  ? -48.416 -29.030 -44.611  1.00 18.64  ? 34  ASN O OD1  1 
ATOM   487   N  ND2  . ASN A  1 34  ? -47.348 -29.093 -46.581  1.00 11.63  ? 34  ASN O ND2  1 
ATOM   488   H  H    . ASN A  1 34  ? -50.926 -26.082 -47.543  1.00 12.81  ? 34  ASN O H    1 
ATOM   489   H  HA   . ASN A  1 34  ? -49.936 -26.691 -45.083  1.00 14.46  ? 34  ASN O HA   1 
ATOM   490   H  HB2  . ASN A  1 34  ? -50.382 -28.653 -46.283  1.00 14.04  ? 34  ASN O HB2  1 
ATOM   491   H  HB3  . ASN A  1 34  ? -49.433 -28.149 -47.455  1.00 14.04  ? 34  ASN O HB3  1 
ATOM   492   H  HD21 . ASN A  1 34  ? -46.654 -29.465 -46.235  1.00 13.96  ? 34  ASN O HD21 1 
ATOM   493   H  HD22 . ASN A  1 34  ? -47.368 -28.916 -47.422  1.00 13.96  ? 34  ASN O HD22 1 
ATOM   494   N  N    . ASP A  1 35  ? -47.795 -25.568 -45.286  1.00 16.54  ? 35  ASP O N    1 
ATOM   495   C  CA   . ASP A  1 35  ? -46.470 -24.968 -45.439  1.00 16.35  ? 35  ASP O CA   1 
ATOM   496   C  C    . ASP A  1 35  ? -45.706 -25.152 -44.131  1.00 25.99  ? 35  ASP O C    1 
ATOM   497   O  O    . ASP A  1 35  ? -46.008 -24.499 -43.127  1.00 20.34  ? 35  ASP O O    1 
ATOM   498   C  CB   . ASP A  1 35  ? -46.561 -23.490 -45.814  1.00 17.69  ? 35  ASP O CB   1 
ATOM   499   C  CG   . ASP A  1 35  ? -45.254 -22.957 -46.413  1.00 21.87  ? 35  ASP O CG   1 
ATOM   500   O  OD1  . ASP A  1 35  ? -44.190 -23.272 -45.866  1.00 21.07  ? 35  ASP O OD1  1 
ATOM   501   O  OD2  . ASP A  1 35  ? -45.295 -22.229 -47.430  1.00 26.13  ? 35  ASP O OD2  1 
ATOM   502   H  H    . ASP A  1 35  ? -48.032 -25.694 -44.469  1.00 19.84  ? 35  ASP O H    1 
ATOM   503   H  HA   . ASP A  1 35  ? -45.988 -25.431 -46.141  1.00 19.62  ? 35  ASP O HA   1 
ATOM   504   H  HB2  . ASP A  1 35  ? -47.263 -23.373 -46.473  1.00 21.23  ? 35  ASP O HB2  1 
ATOM   505   H  HB3  . ASP A  1 35  ? -46.761 -22.973 -45.019  1.00 21.23  ? 35  ASP O HB3  1 
ATOM   506   N  N    . PRO A  1 36  ? -44.713 -26.051 -44.133  1.00 21.52  ? 36  PRO O N    1 
ATOM   507   C  CA   . PRO A  1 36  ? -43.987 -26.288 -42.886  1.00 20.90  ? 36  PRO O CA   1 
ATOM   508   C  C    . PRO A  1 36  ? -43.130 -25.106 -42.422  1.00 19.46  ? 36  PRO O C    1 
ATOM   509   O  O    . PRO A  1 36  ? -42.682 -25.134 -41.278  1.00 23.07  ? 36  PRO O O    1 
ATOM   510   C  CB   . PRO A  1 36  ? -43.101 -27.495 -43.210  1.00 24.72  ? 36  PRO O CB   1 
ATOM   511   C  CG   . PRO A  1 36  ? -43.156 -27.700 -44.668  1.00 29.40  ? 36  PRO O CG   1 
ATOM   512   C  CD   . PRO A  1 36  ? -44.084 -26.711 -45.287  1.00 19.82  ? 36  PRO O CD   1 
ATOM   513   H  HA   . PRO A  1 36  ? -44.606 -26.529 -42.180  1.00 25.08  ? 36  PRO O HA   1 
ATOM   514   H  HB2  . PRO A  1 36  ? -42.191 -27.309 -42.930  1.00 29.67  ? 36  PRO O HB2  1 
ATOM   515   H  HB3  . PRO A  1 36  ? -43.442 -28.276 -42.747  1.00 29.67  ? 36  PRO O HB3  1 
ATOM   516   H  HG2  . PRO A  1 36  ? -42.264 -27.587 -45.033  1.00 35.28  ? 36  PRO O HG2  1 
ATOM   517   H  HG3  . PRO A  1 36  ? -43.471 -28.600 -44.845  1.00 35.28  ? 36  PRO O HG3  1 
ATOM   518   H  HD2  . PRO A  1 36  ? -43.586 -26.066 -45.814  1.00 23.79  ? 36  PRO O HD2  1 
ATOM   519   H  HD3  . PRO A  1 36  ? -44.753 -27.165 -45.822  1.00 23.79  ? 36  PRO O HD3  1 
ATOM   520   N  N    . PHE A  1 37  ? -42.931 -24.092 -43.258  1.00 23.88  ? 37  PHE O N    1 
ATOM   521   C  CA   . PHE A  1 37  ? -42.066 -22.960 -42.891  1.00 24.37  ? 37  PHE O CA   1 
ATOM   522   C  C    . PHE A  1 37  ? -42.828 -21.677 -42.556  1.00 33.07  ? 37  PHE O C    1 
ATOM   523   O  O    . PHE A  1 37  ? -42.237 -20.609 -42.393  1.00 27.23  ? 37  PHE O O    1 
ATOM   524   C  CB   . PHE A  1 37  ? -41.079 -22.695 -44.026  1.00 22.61  ? 37  PHE O CB   1 
ATOM   525   C  CG   . PHE A  1 37  ? -40.244 -23.886 -44.361  1.00 28.64  ? 37  PHE O CG   1 
ATOM   526   C  CD1  . PHE A  1 37  ? -39.275 -24.338 -43.480  1.00 31.55  ? 37  PHE O CD1  1 
ATOM   527   C  CD2  . PHE A  1 37  ? -40.457 -24.591 -45.536  1.00 42.95  ? 37  PHE O CD2  1 
ATOM   528   C  CE1  . PHE A  1 37  ? -38.517 -25.456 -43.781  1.00 34.12  ? 37  PHE O CE1  1 
ATOM   529   C  CE2  . PHE A  1 37  ? -39.704 -25.705 -45.837  1.00 37.03  ? 37  PHE O CE2  1 
ATOM   530   C  CZ   . PHE A  1 37  ? -38.734 -26.139 -44.961  1.00 31.56  ? 37  PHE O CZ   1 
ATOM   531   H  H    . PHE A  1 37  ? -43.280 -24.030 -44.041  1.00 28.65  ? 37  PHE O H    1 
ATOM   532   H  HA   . PHE A  1 37  ? -41.551 -23.207 -42.107  1.00 29.25  ? 37  PHE O HA   1 
ATOM   533   H  HB2  . PHE A  1 37  ? -41.573 -22.442 -44.821  1.00 27.13  ? 37  PHE O HB2  1 
ATOM   534   H  HB3  . PHE A  1 37  ? -40.483 -21.975 -43.763  1.00 27.13  ? 37  PHE O HB3  1 
ATOM   535   H  HD1  . PHE A  1 37  ? -39.125 -23.881 -42.684  1.00 37.86  ? 37  PHE O HD1  1 
ATOM   536   H  HD2  . PHE A  1 37  ? -41.111 -24.303 -46.132  1.00 51.54  ? 37  PHE O HD2  1 
ATOM   537   H  HE1  . PHE A  1 37  ? -37.862 -25.748 -43.189  1.00 40.94  ? 37  PHE O HE1  1 
ATOM   538   H  HE2  . PHE A  1 37  ? -39.851 -26.164 -46.633  1.00 44.44  ? 37  PHE O HE2  1 
ATOM   539   H  HZ   . PHE A  1 37  ? -38.224 -26.889 -45.166  1.00 37.87  ? 37  PHE O HZ   1 
ATOM   540   N  N    . ILE A  1 38  ? -44.145 -21.781 -42.455  1.00 18.31  ? 38  ILE O N    1 
ATOM   541   C  CA   . ILE A  1 38  ? -44.982 -20.639 -42.101  1.00 14.88  ? 38  ILE O CA   1 
ATOM   542   C  C    . ILE A  1 38  ? -46.091 -21.123 -41.174  1.00 25.24  ? 38  ILE O C    1 
ATOM   543   O  O    . ILE A  1 38  ? -47.030 -21.791 -41.639  1.00 19.33  ? 38  ILE O O    1 
ATOM   544   C  CB   . ILE A  1 38  ? -45.601 -19.976 -43.352  1.00 16.39  ? 38  ILE O CB   1 
ATOM   545   C  CG1  . ILE A  1 38  ? -44.515 -19.618 -44.378  1.00 19.51  ? 38  ILE O CG1  1 
ATOM   546   C  CG2  . ILE A  1 38  ? -46.343 -18.735 -42.988  1.00 14.31  ? 38  ILE O CG2  1 
ATOM   547   C  CD1  . ILE A  1 38  ? -45.085 -19.175 -45.755  1.00 23.79  ? 38  ILE O CD1  1 
ATOM   548   H  H    . ILE A  1 38  ? -44.585 -22.508 -42.587  1.00 21.97  ? 38  ILE O H    1 
ATOM   549   H  HA   . ILE A  1 38  ? -44.450 -19.978 -41.631  1.00 17.86  ? 38  ILE O HA   1 
ATOM   550   H  HB   . ILE A  1 38  ? -46.221 -20.601 -43.761  1.00 19.66  ? 38  ILE O HB   1 
ATOM   551   H  HG12 . ILE A  1 38  ? -43.981 -18.888 -44.027  1.00 23.41  ? 38  ILE O HG12 1 
ATOM   552   H  HG13 . ILE A  1 38  ? -43.953 -20.396 -44.524  1.00 23.41  ? 38  ILE O HG13 1 
ATOM   553   H  HG21 . ILE A  1 38  ? -46.718 -18.345 -43.793  1.00 17.17  ? 38  ILE O HG21 1 
ATOM   554   H  HG22 . ILE A  1 38  ? -47.053 -18.962 -42.368  1.00 17.17  ? 38  ILE O HG22 1 
ATOM   555   H  HG23 . ILE A  1 38  ? -45.727 -18.111 -42.573  1.00 17.17  ? 38  ILE O HG23 1 
ATOM   556   H  HD11 . ILE A  1 38  ? -44.347 -18.966 -46.349  1.00 28.54  ? 38  ILE O HD11 1 
ATOM   557   H  HD12 . ILE A  1 38  ? -45.613 -19.900 -46.125  1.00 28.54  ? 38  ILE O HD12 1 
ATOM   558   H  HD13 . ILE A  1 38  ? -45.641 -18.391 -45.628  1.00 28.54  ? 38  ILE O HD13 1 
ATOM   559   N  N    . ASP A  1 39  ? -46.003 -20.803 -39.879  1.00 19.06  ? 39  ASP O N    1 
ATOM   560   C  CA   . ASP A  1 39  ? -47.066 -21.215 -38.947  1.00 25.90  ? 39  ASP O CA   1 
ATOM   561   C  C    . ASP A  1 39  ? -48.289 -20.304 -39.075  1.00 25.02  ? 39  ASP O C    1 
ATOM   562   O  O    . ASP A  1 39  ? -48.255 -19.303 -39.778  1.00 15.08  ? 39  ASP O O    1 
ATOM   563   C  CB   . ASP A  1 39  ? -46.565 -21.263 -37.493  1.00 26.25  ? 39  ASP O CB   1 
ATOM   564   C  CG   . ASP A  1 39  ? -46.178 -19.907 -36.930  1.00 40.18  ? 39  ASP O CG   1 
ATOM   565   O  OD1  . ASP A  1 39  ? -46.899 -18.915 -37.135  1.00 29.77  ? 39  ASP O OD1  1 
ATOM   566   O  OD2  . ASP A  1 39  ? -45.141 -19.843 -36.236  1.00 72.91  ? 39  ASP O OD2  1 
ATOM   567   H  H    . ASP A  1 39  ? -45.358 -20.361 -39.521  1.00 22.87  ? 39  ASP O H    1 
ATOM   568   H  HA   . ASP A  1 39  ? -47.348 -22.112 -39.185  1.00 31.08  ? 39  ASP O HA   1 
ATOM   569   H  HB2  . ASP A  1 39  ? -47.269 -21.626 -36.933  1.00 31.51  ? 39  ASP O HB2  1 
ATOM   570   H  HB3  . ASP A  1 39  ? -45.783 -21.835 -37.451  1.00 31.51  ? 39  ASP O HB3  1 
ATOM   571   N  N    . LEU A  1 40  ? -49.364 -20.664 -38.386  1.00 16.56  ? 40  LEU O N    1 
ATOM   572   C  CA   . LEU A  1 40  ? -50.656 -20.010 -38.569  1.00 16.44  ? 40  LEU O CA   1 
ATOM   573   C  C    . LEU A  1 40  ? -50.602 -18.491 -38.347  1.00 15.42  ? 40  LEU O C    1 
ATOM   574   O  O    . LEU A  1 40  ? -51.070 -17.720 -39.188  1.00 16.01  ? 40  LEU O O    1 
ATOM   575   C  CB   . LEU A  1 40  ? -51.686 -20.649 -37.631  1.00 17.10  ? 40  LEU O CB   1 
ATOM   576   C  CG   . LEU A  1 40  ? -53.035 -19.957 -37.477  1.00 26.97  ? 40  LEU O CG   1 
ATOM   577   C  CD1  . LEU A  1 40  ? -53.712 -19.782 -38.815  1.00 23.78  ? 40  LEU O CD1  1 
ATOM   578   C  CD2  . LEU A  1 40  ? -53.906 -20.768 -36.530  1.00 24.22  ? 40  LEU O CD2  1 
ATOM   579   H  H    . LEU A  1 40  ? -49.373 -21.292 -37.798  1.00 19.87  ? 40  LEU O H    1 
ATOM   580   H  HA   . LEU A  1 40  ? -50.953 -20.162 -39.480  1.00 19.73  ? 40  LEU O HA   1 
ATOM   581   H  HB2  . LEU A  1 40  ? -51.865 -21.547 -37.952  1.00 20.52  ? 40  LEU O HB2  1 
ATOM   582   H  HB3  . LEU A  1 40  ? -51.293 -20.701 -36.746  1.00 20.52  ? 40  LEU O HB3  1 
ATOM   583   H  HG   . LEU A  1 40  ? -52.900 -19.079 -37.088  1.00 32.37  ? 40  LEU O HG   1 
ATOM   584   H  HD11 . LEU A  1 40  ? -54.564 -19.339 -38.681  1.00 28.53  ? 40  LEU O HD11 1 
ATOM   585   H  HD12 . LEU A  1 40  ? -53.144 -19.241 -39.387  1.00 28.53  ? 40  LEU O HD12 1 
ATOM   586   H  HD13 . LEU A  1 40  ? -53.850 -20.654 -39.215  1.00 28.53  ? 40  LEU O HD13 1 
ATOM   587   H  HD21 . LEU A  1 40  ? -54.764 -20.326 -36.433  1.00 29.07  ? 40  LEU O HD21 1 
ATOM   588   H  HD22 . LEU A  1 40  ? -54.031 -21.657 -36.899  1.00 29.07  ? 40  LEU O HD22 1 
ATOM   589   H  HD23 . LEU A  1 40  ? -53.465 -20.828 -35.668  1.00 29.07  ? 40  LEU O HD23 1 
ATOM   590   N  N    . ASN A  1 41  ? -50.019 -18.043 -37.244  1.00 13.76  ? 41  ASN O N    1 
ATOM   591   C  CA   . ASN A  1 41  ? -49.942 -16.597 -37.012  1.00 15.94  ? 41  ASN O CA   1 
ATOM   592   C  C    . ASN A  1 41  ? -49.103 -15.868 -38.068  1.00 15.17  ? 41  ASN O C    1 
ATOM   593   O  O    . ASN A  1 41  ? -49.405 -14.741 -38.440  1.00 16.23  ? 41  ASN O O    1 
ATOM   594   C  CB   . ASN A  1 41  ? -49.389 -16.304 -35.624  1.00 20.26  ? 41  ASN O CB   1 
ATOM   595   C  CG   . ASN A  1 41  ? -50.374 -16.657 -34.529  1.00 40.43  ? 41  ASN O CG   1 
ATOM   596   O  OD1  . ASN A  1 41  ? -51.589 -16.580 -34.724  1.00 29.01  ? 41  ASN O OD1  1 
ATOM   597   N  ND2  . ASN A  1 41  ? -49.859 -17.059 -33.375  1.00 37.19  ? 41  ASN O ND2  1 
ATOM   598   H  H    . ASN A  1 41  ? -49.669 -18.532 -36.629  1.00 16.51  ? 41  ASN O H    1 
ATOM   599   H  HA   . ASN A  1 41  ? -50.840 -16.232 -37.052  1.00 19.13  ? 41  ASN O HA   1 
ATOM   600   H  HB2  . ASN A  1 41  ? -48.584 -16.828 -35.486  1.00 24.32  ? 41  ASN O HB2  1 
ATOM   601   H  HB3  . ASN A  1 41  ? -49.187 -15.358 -35.555  1.00 24.32  ? 41  ASN O HB3  1 
ATOM   602   H  HD21 . ASN A  1 41  ? -50.378 -17.271 -32.723  1.00 44.63  ? 41  ASN O HD21 1 
ATOM   603   H  HD22 . ASN A  1 41  ? -49.006 -17.109 -33.279  1.00 44.63  ? 41  ASN O HD22 1 
ATOM   604   N  N    . TYR A  1 42  ? -48.058 -16.516 -38.554  1.00 16.28  ? 42  TYR O N    1 
ATOM   605   C  CA   . TYR A  1 42  ? -47.218 -15.926 -39.586  1.00 14.16  ? 42  TYR O CA   1 
ATOM   606   C  C    . TYR A  1 42  ? -47.981 -15.886 -40.916  1.00 17.13  ? 42  TYR O C    1 
ATOM   607   O  O    . TYR A  1 42  ? -47.824 -14.945 -41.702  1.00 12.77  ? 42  TYR O O    1 
ATOM   608   C  CB   . TYR A  1 42  ? -45.917 -16.728 -39.706  1.00 12.53  ? 42  TYR O CB   1 
ATOM   609   C  CG   . TYR A  1 42  ? -44.789 -16.089 -40.479  1.00 12.73  ? 42  TYR O CG   1 
ATOM   610   C  CD1  . TYR A  1 42  ? -44.776 -14.722 -40.769  1.00 12.18  ? 42  TYR O CD1  1 
ATOM   611   C  CD2  . TYR A  1 42  ? -43.724 -16.859 -40.920  1.00 15.10  ? 42  TYR O CD2  1 
ATOM   612   C  CE1  . TYR A  1 42  ? -43.721 -14.145 -41.498  1.00 12.10  ? 42  TYR O CE1  1 
ATOM   613   C  CE2  . TYR A  1 42  ? -42.685 -16.306 -41.646  1.00 12.49  ? 42  TYR O CE2  1 
ATOM   614   C  CZ   . TYR A  1 42  ? -42.684 -14.947 -41.931  1.00 13.10  ? 42  TYR O CZ   1 
ATOM   615   O  OH   . TYR A  1 42  ? -41.637 -14.420 -42.641  1.00 16.20  ? 42  TYR O OH   1 
ATOM   616   H  H    . TYR A  1 42  ? -47.812 -17.301 -38.304  1.00 19.54  ? 42  TYR O H    1 
ATOM   617   H  HA   . TYR A  1 42  ? -46.993 -15.016 -39.336  1.00 16.99  ? 42  TYR O HA   1 
ATOM   618   H  HB2  . TYR A  1 42  ? -45.587 -16.903 -38.810  1.00 15.04  ? 42  TYR O HB2  1 
ATOM   619   H  HB3  . TYR A  1 42  ? -46.122 -17.570 -40.141  1.00 15.04  ? 42  TYR O HB3  1 
ATOM   620   H  HD1  . TYR A  1 42  ? -45.480 -14.187 -40.481  1.00 14.62  ? 42  TYR O HD1  1 
ATOM   621   H  HD2  . TYR A  1 42  ? -43.718 -17.772 -40.741  1.00 18.12  ? 42  TYR O HD2  1 
ATOM   622   H  HE1  . TYR A  1 42  ? -43.724 -13.235 -41.689  1.00 14.52  ? 42  TYR O HE1  1 
ATOM   623   H  HE2  . TYR A  1 42  ? -41.982 -16.842 -41.934  1.00 14.99  ? 42  TYR O HE2  1 
ATOM   624   H  HH   . TYR A  1 42  ? -41.748 -13.594 -42.746  1.00 19.44  ? 42  TYR O HH   1 
ATOM   625   N  N    . MET A  1 43  ? -48.807 -16.903 -41.176  1.00 14.72  ? 43  MET O N    1 
ATOM   626   C  CA   . MET A  1 43  ? -49.622 -16.926 -42.401  1.00 13.51  ? 43  MET O CA   1 
ATOM   627   C  C    . MET A  1 43  ? -50.548 -15.729 -42.498  1.00 11.08  ? 43  MET O C    1 
ATOM   628   O  O    . MET A  1 43  ? -50.769 -15.182 -43.587  1.00 13.17  ? 43  MET O O    1 
ATOM   629   C  CB   . MET A  1 43  ? -50.482 -18.192 -42.475  1.00 14.49  ? 43  MET O CB   1 
ATOM   630   C  CG   . MET A  1 43  ? -49.776 -19.400 -42.946  1.00 19.10  ? 43  MET O CG   1 
ATOM   631   S  SD   . MET A  1 43  ? -50.919 -20.781 -43.232  1.00 20.54  ? 43  MET O SD   1 
ATOM   632   C  CE   . MET A  1 43  ? -49.730 -21.966 -43.833  1.00 17.74  ? 43  MET O CE   1 
ATOM   633   H  H    . MET A  1 43  ? -48.915 -17.587 -40.666  1.00 17.66  ? 43  MET O H    1 
ATOM   634   H  HA   . MET A  1 43  ? -49.029 -16.925 -43.169  1.00 16.22  ? 43  MET O HA   1 
ATOM   635   H  HB2  . MET A  1 43  ? -50.827 -18.382 -41.589  1.00 17.39  ? 43  MET O HB2  1 
ATOM   636   H  HB3  . MET A  1 43  ? -51.219 -18.029 -43.083  1.00 17.39  ? 43  MET O HB3  1 
ATOM   637   H  HG2  . MET A  1 43  ? -49.327 -19.201 -43.783  1.00 22.92  ? 43  MET O HG2  1 
ATOM   638   H  HG3  . MET A  1 43  ? -49.131 -19.675 -42.276  1.00 22.92  ? 43  MET O HG3  1 
ATOM   639   H  HE1  . MET A  1 43  ? -50.189 -22.795 -44.042  1.00 21.28  ? 43  MET O HE1  1 
ATOM   640   H  HE2  . MET A  1 43  ? -49.307 -21.611 -44.630  1.00 21.28  ? 43  MET O HE2  1 
ATOM   641   H  HE3  . MET A  1 43  ? -49.064 -22.120 -43.145  1.00 21.28  ? 43  MET O HE3  1 
ATOM   642   N  N    . VAL A  1 44  ? -51.155 -15.369 -41.370  1.00 11.61  ? 44  VAL O N    1 
ATOM   643   C  CA   . VAL A  1 44  ? -52.021 -14.199 -41.313  1.00 11.78  ? 44  VAL O CA   1 
ATOM   644   C  C    . VAL A  1 44  ? -51.266 -12.971 -41.839  1.00 13.22  ? 44  VAL O C    1 
ATOM   645   O  O    . VAL A  1 44  ? -51.738 -12.264 -42.725  1.00 13.46  ? 44  VAL O O    1 
ATOM   646   C  CB   . VAL A  1 44  ? -52.486 -13.932 -39.877  1.00 13.59  ? 44  VAL O CB   1 
ATOM   647   C  CG1  . VAL A  1 44  ? -53.204 -12.574 -39.754  1.00 18.07  ? 44  VAL O CG1  1 
ATOM   648   C  CG2  . VAL A  1 44  ? -53.375 -15.073 -39.387  1.00 18.09  ? 44  VAL O CG2  1 
ATOM   649   H  H    . VAL A  1 44  ? -51.080 -15.787 -40.623  1.00 13.93  ? 44  VAL O H    1 
ATOM   650   H  HA   . VAL A  1 44  ? -52.802 -14.344 -41.869  1.00 14.14  ? 44  VAL O HA   1 
ATOM   651   H  HB   . VAL A  1 44  ? -51.705 -13.902 -39.302  1.00 16.30  ? 44  VAL O HB   1 
ATOM   652   H  HG11 . VAL A  1 44  ? -53.480 -12.446 -38.833  1.00 21.68  ? 44  VAL O HG11 1 
ATOM   653   H  HG12 . VAL A  1 44  ? -52.593 -11.869 -40.018  1.00 21.68  ? 44  VAL O HG12 1 
ATOM   654   H  HG13 . VAL A  1 44  ? -53.980 -12.574 -40.335  1.00 21.68  ? 44  VAL O HG13 1 
ATOM   655   H  HG21 . VAL A  1 44  ? -53.657 -14.885 -38.478  1.00 21.71  ? 44  VAL O HG21 1 
ATOM   656   H  HG22 . VAL A  1 44  ? -54.149 -15.141 -39.967  1.00 21.71  ? 44  VAL O HG22 1 
ATOM   657   H  HG23 . VAL A  1 44  ? -52.869 -15.900 -39.411  1.00 21.71  ? 44  VAL O HG23 1 
ATOM   658   N  N    . TYR A  1 45  ? -50.091 -12.740 -41.273  1.00 11.71  ? 45  TYR O N    1 
ATOM   659   C  CA   . TYR A  1 45  ? -49.227 -11.611 -41.652  1.00 11.65  ? 45  TYR O CA   1 
ATOM   660   C  C    . TYR A  1 45  ? -48.805 -11.653 -43.126  1.00 11.09  ? 45  TYR O C    1 
ATOM   661   O  O    . TYR A  1 45  ? -48.914 -10.654 -43.833  1.00 11.01  ? 45  TYR O O    1 
ATOM   662   C  CB   . TYR A  1 45  ? -47.993 -11.597 -40.771  1.00 12.02  ? 45  TYR O CB   1 
ATOM   663   C  CG   . TYR A  1 45  ? -46.940 -10.593 -41.178  1.00 12.63  ? 45  TYR O CG   1 
ATOM   664   C  CD1  . TYR A  1 45  ? -47.064 -9.242  -40.851  1.00 14.09  ? 45  TYR O CD1  1 
ATOM   665   C  CD2  . TYR A  1 45  ? -45.820 -10.992 -41.899  1.00 11.83  ? 45  TYR O CD2  1 
ATOM   666   C  CE1  . TYR A  1 45  ? -46.095 -8.323  -41.235  1.00 12.51  ? 45  TYR O CE1  1 
ATOM   667   C  CE2  . TYR A  1 45  ? -44.851 -10.084 -42.270  1.00 11.97  ? 45  TYR O CE2  1 
ATOM   668   C  CZ   . TYR A  1 45  ? -44.991 -8.754  -41.937  1.00 12.32  ? 45  TYR O CZ   1 
ATOM   669   O  OH   . TYR A  1 45  ? -44.012 -7.882  -42.332  1.00 12.55  ? 45  TYR O OH   1 
ATOM   670   H  H    . TYR A  1 45  ? -49.757 -13.231 -40.651  1.00 14.06  ? 45  TYR O H    1 
ATOM   671   H  HA   . TYR A  1 45  ? -49.709 -10.782 -41.503  1.00 13.98  ? 45  TYR O HA   1 
ATOM   672   H  HB2  . TYR A  1 45  ? -48.263 -11.388 -39.864  1.00 14.42  ? 45  TYR O HB2  1 
ATOM   673   H  HB3  . TYR A  1 45  ? -47.586 -12.477 -40.796  1.00 14.42  ? 45  TYR O HB3  1 
ATOM   674   H  HD1  . TYR A  1 45  ? -47.808 -8.952  -40.374  1.00 16.91  ? 45  TYR O HD1  1 
ATOM   675   H  HD2  . TYR A  1 45  ? -45.716 -11.888 -42.124  1.00 14.19  ? 45  TYR O HD2  1 
ATOM   676   H  HE1  . TYR A  1 45  ? -46.185 -7.425  -41.009  1.00 15.02  ? 45  TYR O HE1  1 
ATOM   677   H  HE2  . TYR A  1 45  ? -44.107 -10.367 -42.750  1.00 14.37  ? 45  TYR O HE2  1 
ATOM   678   H  HH   . TYR A  1 45  ? -44.203 -7.103  -42.083  1.00 15.06  ? 45  TYR O HH   1 
ATOM   679   N  N    . MET A  1 46  ? -48.327 -12.807 -43.593  1.00 10.79  ? 46  MET O N    1 
ATOM   680   C  CA   . MET A  1 46  ? -47.807 -12.907 -44.948  1.00 10.36  ? 46  MET O CA   1 
ATOM   681   C  C    . MET A  1 46  ? -48.915 -12.764 -45.974  1.00 19.03  ? 46  MET O C    1 
ATOM   682   O  O    . MET A  1 46  ? -48.681 -12.263 -47.062  1.00 13.42  ? 46  MET O O    1 
ATOM   683   C  CB   . MET A  1 46  ? -47.083 -14.235 -45.167  1.00 15.04  ? 46  MET O CB   1 
ATOM   684   C  CG   . MET A  1 46  ? -45.759 -14.346 -44.401  1.00 17.54  ? 46  MET O CG   1 
ATOM   685   S  SD   . MET A  1 46  ? -44.789 -15.791 -44.865  1.00 23.78  ? 46  MET O SD   1 
ATOM   686   C  CE   . MET A  1 46  ? -43.800 -15.103 -46.177  1.00 20.23  ? 46  MET O CE   1 
ATOM   687   H  H    . MET A  1 46  ? -48.295 -13.540 -43.144  1.00 12.95  ? 46  MET O H    1 
ATOM   688   H  HA   . MET A  1 46  ? -47.163 -12.195 -45.086  1.00 12.43  ? 46  MET O HA   1 
ATOM   689   H  HB2  . MET A  1 46  ? -47.658 -14.958 -44.872  1.00 18.05  ? 46  MET O HB2  1 
ATOM   690   H  HB3  . MET A  1 46  ? -46.888 -14.334 -46.112  1.00 18.05  ? 46  MET O HB3  1 
ATOM   691   H  HG2  . MET A  1 46  ? -45.224 -13.557 -44.581  1.00 21.05  ? 46  MET O HG2  1 
ATOM   692   H  HG3  . MET A  1 46  ? -45.949 -14.407 -43.452  1.00 21.05  ? 46  MET O HG3  1 
ATOM   693   H  HE1  . MET A  1 46  ? -43.215 -15.793 -46.526  1.00 24.27  ? 46  MET O HE1  1 
ATOM   694   H  HE2  . MET A  1 46  ? -44.387 -14.780 -46.878  1.00 24.27  ? 46  MET O HE2  1 
ATOM   695   H  HE3  . MET A  1 46  ? -43.272 -14.370 -45.823  1.00 24.27  ? 46  MET O HE3  1 
ATOM   696   N  N    . PHE A  1 47  ? -50.110 -13.233 -45.639  1.00 11.96  ? 47  PHE O N    1 
ATOM   697   C  CA   . PHE A  1 47  ? -51.247 -13.109 -46.534  1.00 12.75  ? 47  PHE O CA   1 
ATOM   698   C  C    . PHE A  1 47  ? -51.814 -11.706 -46.520  1.00 14.40  ? 47  PHE O C    1 
ATOM   699   O  O    . PHE A  1 47  ? -52.231 -11.179 -47.547  1.00 12.85  ? 47  PHE O O    1 
ATOM   700   C  CB   . PHE A  1 47  ? -52.361 -14.092 -46.163  1.00 12.27  ? 47  PHE O CB   1 
ATOM   701   C  CG   . PHE A  1 47  ? -53.477 -14.124 -47.165  1.00 10.13  ? 47  PHE O CG   1 
ATOM   702   C  CD1  . PHE A  1 47  ? -53.301 -14.733 -48.387  1.00 12.27  ? 47  PHE O CD1  1 
ATOM   703   C  CD2  . PHE A  1 47  ? -54.680 -13.522 -46.894  1.00 10.57  ? 47  PHE O CD2  1 
ATOM   704   C  CE1  . PHE A  1 47  ? -54.319 -14.754 -49.316  1.00 14.09  ? 47  PHE O CE1  1 
ATOM   705   C  CE2  . PHE A  1 47  ? -55.703 -13.532 -47.822  1.00 14.07  ? 47  PHE O CE2  1 
ATOM   706   C  CZ   . PHE A  1 47  ? -55.517 -14.155 -49.031  1.00 14.67  ? 47  PHE O CZ   1 
ATOM   707   H  H    . PHE A  1 47  ? -50.287 -13.628 -44.896  1.00 14.35  ? 47  PHE O H    1 
ATOM   708   H  HA   . PHE A  1 47  ? -50.960 -13.308 -47.439  1.00 15.30  ? 47  PHE O HA   1 
ATOM   709   H  HB2  . PHE A  1 47  ? -51.987 -14.985 -46.104  1.00 14.72  ? 47  PHE O HB2  1 
ATOM   710   H  HB3  . PHE A  1 47  ? -52.737 -13.834 -45.306  1.00 14.72  ? 47  PHE O HB3  1 
ATOM   711   H  HD1  . PHE A  1 47  ? -52.490 -15.142 -48.585  1.00 14.73  ? 47  PHE O HD1  1 
ATOM   712   H  HD2  . PHE A  1 47  ? -54.808 -13.100 -46.075  1.00 12.68  ? 47  PHE O HD2  1 
ATOM   713   H  HE1  . PHE A  1 47  ? -54.192 -15.173 -50.136  1.00 16.91  ? 47  PHE O HE1  1 
ATOM   714   H  HE2  . PHE A  1 47  ? -56.517 -13.127 -47.624  1.00 16.88  ? 47  PHE O HE2  1 
ATOM   715   H  HZ   . PHE A  1 47  ? -56.204 -14.168 -49.657  1.00 17.61  ? 47  PHE O HZ   1 
ATOM   716   N  N    . GLN A  1 48  ? -51.833 -11.084 -45.360  1.00 10.73  ? 48  GLN O N    1 
ATOM   717   C  CA   . GLN A  1 48  ? -52.474 -9.789  -45.273  1.00 12.88  ? 48  GLN O CA   1 
ATOM   718   C  C    . GLN A  1 48  ? -51.677 -8.664  -45.954  1.00 17.95  ? 48  GLN O C    1 
ATOM   719   O  O    . GLN A  1 48  ? -52.259 -7.756  -46.554  1.00 13.05  ? 48  GLN O O    1 
ATOM   720   C  CB   . GLN A  1 48  ? -52.699 -9.433  -43.832  1.00 15.78  ? 48  GLN O CB   1 
ATOM   721   C  CG   . GLN A  1 48  ? -53.455 -8.149  -43.662  1.00 34.28  ? 48  GLN O CG   1 
ATOM   722   C  CD   . GLN A  1 48  ? -54.177 -8.126  -42.355  1.00 37.78  ? 48  GLN O CD   1 
ATOM   723   O  OE1  . GLN A  1 48  ? -55.341 -7.747  -42.285  1.00 32.91  ? 48  GLN O OE1  1 
ATOM   724   N  NE2  . GLN A  1 48  ? -53.495 -8.556  -41.301  1.00 33.40  ? 48  GLN O NE2  1 
ATOM   725   H  H    . GLN A  1 48  ? -51.492 -11.378 -44.627  1.00 12.87  ? 48  GLN O H    1 
ATOM   726   H  HA   . GLN A  1 48  ? -53.341 -9.841  -45.705  1.00 15.45  ? 48  GLN O HA   1 
ATOM   727   H  HB2  . GLN A  1 48  ? -53.210 -10.140 -43.408  1.00 18.93  ? 48  GLN O HB2  1 
ATOM   728   H  HB3  . GLN A  1 48  ? -51.840 -9.336  -43.393  1.00 18.93  ? 48  GLN O HB3  1 
ATOM   729   H  HG2  . GLN A  1 48  ? -52.834 -7.404  -43.682  1.00 41.13  ? 48  GLN O HG2  1 
ATOM   730   H  HG3  . GLN A  1 48  ? -54.109 -8.063  -44.374  1.00 41.13  ? 48  GLN O HG3  1 
ATOM   731   H  HE21 . GLN A  1 48  ? -52.685 -8.827  -41.395  1.00 40.08  ? 48  GLN O HE21 1 
ATOM   732   H  HE22 . GLN A  1 48  ? -53.864 -8.564  -40.525  1.00 40.08  ? 48  GLN O HE22 1 
ATOM   733   N  N    . TYR A  1 49  ? -50.358 -8.722  -45.824  1.00 12.21  ? 49  TYR O N    1 
ATOM   734   C  CA   . TYR A  1 49  ? -49.464 -7.677  -46.335  1.00 11.06  ? 49  TYR O CA   1 
ATOM   735   C  C    . TYR A  1 49  ? -48.647 -8.206  -47.487  1.00 14.07  ? 49  TYR O C    1 
ATOM   736   O  O    . TYR A  1 49  ? -48.051 -9.261  -47.378  1.00 17.84  ? 49  TYR O O    1 
ATOM   737   C  CB   . TYR A  1 49  ? -48.532 -7.180  -45.250  1.00 11.41  ? 49  TYR O CB   1 
ATOM   738   C  CG   . TYR A  1 49  ? -49.253 -6.511  -44.120  1.00 15.79  ? 49  TYR O CG   1 
ATOM   739   C  CD1  . TYR A  1 49  ? -49.804 -5.253  -44.289  1.00 21.08  ? 49  TYR O CD1  1 
ATOM   740   C  CD2  . TYR A  1 49  ? -49.415 -7.140  -42.906  1.00 20.46  ? 49  TYR O CD2  1 
ATOM   741   C  CE1  . TYR A  1 49  ? -50.480 -4.629  -43.282  1.00 29.55  ? 49  TYR O CE1  1 
ATOM   742   C  CE2  . TYR A  1 49  ? -50.102 -6.520  -41.871  1.00 28.79  ? 49  TYR O CE2  1 
ATOM   743   C  CZ   . TYR A  1 49  ? -50.629 -5.261  -42.072  1.00 40.26  ? 49  TYR O CZ   1 
ATOM   744   O  OH   . TYR A  1 49  ? -51.305 -4.617  -41.071  1.00 40.69  ? 49  TYR O OH   1 
ATOM   745   H  H    . TYR A  1 49  ? -49.944 -9.368  -45.436  1.00 14.66  ? 49  TYR O H    1 
ATOM   746   H  HA   . TYR A  1 49  ? -49.992 -6.928  -46.652  1.00 13.27  ? 49  TYR O HA   1 
ATOM   747   H  HB2  . TYR A  1 49  ? -48.041 -7.934  -44.887  1.00 13.70  ? 49  TYR O HB2  1 
ATOM   748   H  HB3  . TYR A  1 49  ? -47.915 -6.537  -45.634  1.00 13.70  ? 49  TYR O HB3  1 
ATOM   749   H  HD1  . TYR A  1 49  ? -49.707 -4.820  -45.107  1.00 25.30  ? 49  TYR O HD1  1 
ATOM   750   H  HD2  . TYR A  1 49  ? -49.058 -7.989  -42.777  1.00 24.55  ? 49  TYR O HD2  1 
ATOM   751   H  HE1  . TYR A  1 49  ? -50.837 -3.780  -43.413  1.00 35.46  ? 49  TYR O HE1  1 
ATOM   752   H  HE2  . TYR A  1 49  ? -50.201 -6.946  -41.050  1.00 34.55  ? 49  TYR O HE2  1 
ATOM   753   H  HH   . TYR A  1 49  ? -51.331 -5.100  -40.384  1.00 48.83  ? 49  TYR O HH   1 
ATOM   754   N  N    . ASP A  1 50  ? -48.597 -7.450  -48.578  1.00 13.81  ? 50  ASP O N    1 
ATOM   755   C  CA   . ASP A  1 50  ? -47.880 -7.869  -49.767  1.00 10.44  ? 50  ASP O CA   1 
ATOM   756   C  C    . ASP A  1 50  ? -47.174 -6.676  -50.328  1.00 11.51  ? 50  ASP O C    1 
ATOM   757   O  O    . ASP A  1 50  ? -47.833 -5.693  -50.664  1.00 11.12  ? 50  ASP O O    1 
ATOM   758   C  CB   . ASP A  1 50  ? -48.831 -8.454  -50.806  1.00 11.19  ? 50  ASP O CB   1 
ATOM   759   C  CG   . ASP A  1 50  ? -48.096 -9.237  -51.876  1.00 19.18  ? 50  ASP O CG   1 
ATOM   760   O  OD1  . ASP A  1 50  ? -47.572 -8.606  -52.832  1.00 12.71  ? 50  ASP O OD1  1 
ATOM   761   O  OD2  . ASP A  1 50  ? -48.027 -10.478 -51.737  1.00 20.01  ? 50  ASP O OD2  1 
ATOM   762   H  H    . ASP A  1 50  ? -48.976 -6.681  -48.651  1.00 16.57  ? 50  ASP O H    1 
ATOM   763   H  HA   . ASP A  1 50  ? -47.221 -8.541  -49.533  1.00 12.53  ? 50  ASP O HA   1 
ATOM   764   H  HB2  . ASP A  1 50  ? -49.453 -9.055  -50.365  1.00 13.43  ? 50  ASP O HB2  1 
ATOM   765   H  HB3  . ASP A  1 50  ? -49.314 -7.732  -51.237  1.00 13.43  ? 50  ASP O HB3  1 
ATOM   766   N  N    . SER A  1 51  ? -45.840 -6.742  -50.432  1.00 10.88  ? 51  SER O N    1 
ATOM   767   C  CA   . SER A  1 51  ? -45.067 -5.592  -50.907  1.00 11.36  ? 51  SER O CA   1 
ATOM   768   C  C    . SER A  1 51  ? -45.417 -5.237  -52.332  1.00 12.44  ? 51  SER O C    1 
ATOM   769   O  O    . SER A  1 51  ? -45.317 -4.072  -52.739  1.00 12.32  ? 51  SER O O    1 
ATOM   770   C  CB   . SER A  1 51  ? -43.559 -5.857  -50.826  1.00 11.53  ? 51  SER O CB   1 
ATOM   771   O  OG   . SER A  1 51  ? -43.155 -6.047  -49.492  1.00 11.66  ? 51  SER O OG   1 
ATOM   772   H  H    . SER A  1 51  ? -45.366 -7.433  -50.235  1.00 13.06  ? 51  SER O H    1 
ATOM   773   H  HA   . SER A  1 51  ? -45.268 -4.824  -50.349  1.00 13.63  ? 51  SER O HA   1 
ATOM   774   H  HB2  . SER A  1 51  ? -43.351 -6.655  -51.336  1.00 13.84  ? 51  SER O HB2  1 
ATOM   775   H  HB3  . SER A  1 51  ? -43.084 -5.095  -51.194  1.00 13.84  ? 51  SER O HB3  1 
ATOM   776   H  HG   . SER A  1 51  ? -43.559 -6.704  -49.160  1.00 13.99  ? 51  SER O HG   1 
ATOM   777   N  N    . THR A  1 52  ? -45.783 -6.239  -53.108  1.00 11.00  ? 52  THR O N    1 
ATOM   778   C  CA   . THR A  1 52  ? -46.006 -6.020  -54.528  1.00 13.34  ? 52  THR O CA   1 
ATOM   779   C  C    . THR A  1 52  ? -47.449 -5.646  -54.868  1.00 11.46  ? 52  THR O C    1 
ATOM   780   O  O    . THR A  1 52  ? -47.694 -4.729  -55.659  1.00 12.06  ? 52  THR O O    1 
ATOM   781   C  CB   . THR A  1 52  ? -45.595 -7.263  -55.319  1.00 10.89  ? 52  THR O CB   1 
ATOM   782   O  OG1  . THR A  1 52  ? -44.236 -7.574  -54.988  1.00 13.65  ? 52  THR O OG1  1 
ATOM   783   C  CG2  . THR A  1 52  ? -45.715 -7.013  -56.837  1.00 10.98  ? 52  THR O CG2  1 
ATOM   784   H  H    . THR A  1 52  ? -45.910 -7.047  -52.844  1.00 13.19  ? 52  THR O H    1 
ATOM   785   H  HA   . THR A  1 52  ? -45.440 -5.288  -54.819  1.00 16.01  ? 52  THR O HA   1 
ATOM   786   H  HB   . THR A  1 52  ? -46.168 -8.008  -55.079  1.00 13.07  ? 52  THR O HB   1 
ATOM   787   H  HG1  . THR A  1 52  ? -43.986 -8.255  -55.411  1.00 16.37  ? 52  THR O HG1  1 
ATOM   788   H  HG21 . THR A  1 52  ? -45.451 -7.809  -57.326  1.00 13.18  ? 52  THR O HG21 1 
ATOM   789   H  HG22 . THR A  1 52  ? -46.631 -6.793  -57.065  1.00 13.18  ? 52  THR O HG22 1 
ATOM   790   H  HG23 . THR A  1 52  ? -45.139 -6.278  -57.098  1.00 13.18  ? 52  THR O HG23 1 
ATOM   791   N  N    . HIS A  1 53  ? -48.396 -6.341  -54.262  1.00 10.90  ? 53  HIS O N    1 
ATOM   792   C  CA   . HIS A  1 53  ? -49.795 -6.194  -54.651  1.00 13.68  ? 53  HIS O CA   1 
ATOM   793   C  C    . HIS A  1 53  ? -50.648 -5.498  -53.580  1.00 20.51  ? 53  HIS O C    1 
ATOM   794   O  O    . HIS A  1 53  ? -51.852 -5.369  -53.732  1.00 17.75  ? 53  HIS O O    1 
ATOM   795   C  CB   . HIS A  1 53  ? -50.355 -7.569  -54.995  1.00 11.35  ? 53  HIS O CB   1 
ATOM   796   C  CG   . HIS A  1 53  ? -49.589 -8.268  -56.076  1.00 14.53  ? 53  HIS O CG   1 
ATOM   797   N  ND1  . HIS A  1 53  ? -49.685 -7.915  -57.405  1.00 12.42  ? 53  HIS O ND1  1 
ATOM   798   C  CD2  . HIS A  1 53  ? -48.696 -9.285  -56.019  1.00 13.03  ? 53  HIS O CD2  1 
ATOM   799   C  CE1  . HIS A  1 53  ? -48.893 -8.694  -58.125  1.00 18.59  ? 53  HIS O CE1  1 
ATOM   800   N  NE2  . HIS A  1 53  ? -48.284 -9.539  -57.309  1.00 11.19  ? 53  HIS O NE2  1 
ATOM   801   H  H    . HIS A  1 53  ? -48.260 -6.903  -53.626  1.00 13.08  ? 53  HIS O H    1 
ATOM   802   H  HA   . HIS A  1 53  ? -49.836 -5.651  -55.454  1.00 16.41  ? 53  HIS O HA   1 
ATOM   803   H  HB2  . HIS A  1 53  ? -50.327 -8.126  -54.202  1.00 13.62  ? 53  HIS O HB2  1 
ATOM   804   H  HB3  . HIS A  1 53  ? -51.271 -7.468  -55.296  1.00 13.62  ? 53  HIS O HB3  1 
ATOM   805   H  HD2  . HIS A  1 53  ? -48.422 -9.737  -55.254  1.00 15.64  ? 53  HIS O HD2  1 
ATOM   806   H  HE1  . HIS A  1 53  ? -48.786 -8.656  -59.048  1.00 22.31  ? 53  HIS O HE1  1 
ATOM   807   N  N    . GLY A  1 54  ? -50.012 -5.030  -52.509  1.00 11.71  ? 54  GLY O N    1 
ATOM   808   C  CA   . GLY A  1 54  ? -50.705 -4.276  -51.487  1.00 11.83  ? 54  GLY O CA   1 
ATOM   809   C  C    . GLY A  1 54  ? -51.443 -5.141  -50.486  1.00 13.70  ? 54  GLY O C    1 
ATOM   810   O  O    . GLY A  1 54  ? -51.476 -6.380  -50.576  1.00 11.15  ? 54  GLY O O    1 
ATOM   811   H  H    . GLY A  1 54  ? -49.173 -5.139  -52.355  1.00 14.05  ? 54  GLY O H    1 
ATOM   812   H  HA2  . GLY A  1 54  ? -50.064 -3.733  -51.003  1.00 14.19  ? 54  GLY O HA2  1 
ATOM   813   H  HA3  . GLY A  1 54  ? -51.347 -3.685  -51.909  1.00 14.19  ? 54  GLY O HA3  1 
ATOM   814   N  N    . LYS A  1 55  ? -52.024 -4.478  -49.500  1.00 12.03  ? 55  LYS O N    1 
ATOM   815   C  CA   . LYS A  1 55  ? -52.755 -5.158  -48.450  1.00 11.99  ? 55  LYS O CA   1 
ATOM   816   C  C    . LYS A  1 55  ? -53.991 -5.893  -48.971  1.00 15.07  ? 55  LYS O C    1 
ATOM   817   O  O    . LYS A  1 55  ? -54.708 -5.409  -49.863  1.00 13.70  ? 55  LYS O O    1 
ATOM   818   C  CB   . LYS A  1 55  ? -53.162 -4.140  -47.378  1.00 17.36  ? 55  LYS O CB   1 
ATOM   819   C  CG   . LYS A  1 55  ? -53.884 -4.755  -46.187  1.00 31.05  ? 55  LYS O CG   1 
ATOM   820   C  CD   . LYS A  1 55  ? -54.158 -3.714  -45.103  1.00 43.20  ? 55  LYS O CD   1 
ATOM   821   C  CE   . LYS A  1 55  ? -54.870 -4.334  -43.908  1.00 46.57  ? 55  LYS O CE   1 
ATOM   822   N  NZ   . LYS A  1 55  ? -55.067 -3.344  -42.817  1.00 51.39  ? 55  LYS O NZ   1 
ATOM   823   H  H    . LYS A  1 55  ? -52.008 -3.622  -49.416  1.00 14.43  ? 55  LYS O H    1 
ATOM   824   H  HA   . LYS A  1 55  ? -52.172 -5.813  -48.035  1.00 14.39  ? 55  LYS O HA   1 
ATOM   825   H  HB2  . LYS A  1 55  ? -52.363 -3.701  -47.046  1.00 20.83  ? 55  LYS O HB2  1 
ATOM   826   H  HB3  . LYS A  1 55  ? -53.755 -3.486  -47.779  1.00 20.83  ? 55  LYS O HB3  1 
ATOM   827   H  HG2  . LYS A  1 55  ? -54.733 -5.120  -46.480  1.00 37.26  ? 55  LYS O HG2  1 
ATOM   828   H  HG3  . LYS A  1 55  ? -53.331 -5.455  -45.803  1.00 37.26  ? 55  LYS O HG3  1 
ATOM   829   H  HD2  . LYS A  1 55  ? -53.317 -3.340  -44.796  1.00 51.83  ? 55  LYS O HD2  1 
ATOM   830   H  HD3  . LYS A  1 55  ? -54.725 -3.015  -45.466  1.00 51.83  ? 55  LYS O HD3  1 
ATOM   831   H  HE2  . LYS A  1 55  ? -55.742 -4.656  -44.187  1.00 55.88  ? 55  LYS O HE2  1 
ATOM   832   H  HE3  . LYS A  1 55  ? -54.336 -5.066  -43.562  1.00 55.88  ? 55  LYS O HE3  1 
ATOM   833   H  HZ1  . LYS A  1 55  ? -55.484 -3.727  -42.131  1.00 61.67  ? 55  LYS O HZ1  1 
ATOM   834   H  HZ2  . LYS A  1 55  ? -54.279 -3.035  -42.542  1.00 61.67  ? 55  LYS O HZ2  1 
ATOM   835   H  HZ3  . LYS A  1 55  ? -55.558 -2.663  -43.110  1.00 61.67  ? 55  LYS O HZ3  1 
ATOM   836   N  N    . PHE A  1 56  ? -54.248 -7.065  -48.408  1.00 15.76  ? 56  PHE O N    1 
ATOM   837   C  CA   . PHE A  1 56  ? -55.406 -7.848  -48.800  1.00 13.20  ? 56  PHE O CA   1 
ATOM   838   C  C    . PHE A  1 56  ? -56.690 -7.049  -48.550  1.00 17.38  ? 56  PHE O C    1 
ATOM   839   O  O    . PHE A  1 56  ? -56.844 -6.439  -47.500  1.00 17.07  ? 56  PHE O O    1 
ATOM   840   C  CB   . PHE A  1 56  ? -55.430 -9.177  -48.037  1.00 14.10  ? 56  PHE O CB   1 
ATOM   841   C  CG   . PHE A  1 56  ? -56.653 -10.021 -48.319  1.00 13.66  ? 56  PHE O CG   1 
ATOM   842   C  CD1  . PHE A  1 56  ? -56.869 -10.546 -49.579  1.00 16.81  ? 56  PHE O CD1  1 
ATOM   843   C  CD2  . PHE A  1 56  ? -57.572 -10.289 -47.319  1.00 12.09  ? 56  PHE O CD2  1 
ATOM   844   C  CE1  . PHE A  1 56  ? -57.981 -11.315 -49.845  1.00 21.90  ? 56  PHE O CE1  1 
ATOM   845   C  CE2  . PHE A  1 56  ? -58.682 -11.067 -47.576  1.00 14.38  ? 56  PHE O CE2  1 
ATOM   846   C  CZ   . PHE A  1 56  ? -58.893 -11.569 -48.843  1.00 20.72  ? 56  PHE O CZ   1 
ATOM   847   H  H    . PHE A  1 56  ? -53.766 -7.428  -47.796  1.00 18.91  ? 56  PHE O H    1 
ATOM   848   H  HA   . PHE A  1 56  ? -55.352 -8.045  -49.749  1.00 15.83  ? 56  PHE O HA   1 
ATOM   849   H  HB2  . PHE A  1 56  ? -54.649 -9.695  -48.286  1.00 16.93  ? 56  PHE O HB2  1 
ATOM   850   H  HB3  . PHE A  1 56  ? -55.411 -8.991  -47.085  1.00 16.93  ? 56  PHE O HB3  1 
ATOM   851   H  HD1  . PHE A  1 56  ? -56.260 -10.371 -50.259  1.00 20.17  ? 56  PHE O HD1  1 
ATOM   852   H  HD2  . PHE A  1 56  ? -57.437 -9.947  -46.465  1.00 14.51  ? 56  PHE O HD2  1 
ATOM   853   H  HE1  . PHE A  1 56  ? -58.117 -11.659 -50.698  1.00 26.28  ? 56  PHE O HE1  1 
ATOM   854   H  HE2  . PHE A  1 56  ? -59.297 -11.237 -46.900  1.00 17.26  ? 56  PHE O HE2  1 
ATOM   855   H  HZ   . PHE A  1 56  ? -59.641 -12.094 -49.017  1.00 24.87  ? 56  PHE O HZ   1 
ATOM   856   N  N    . HIS A  1 57  ? -57.577 -7.038  -49.542  1.00 21.22  ? 57  HIS O N    1 
ATOM   857   C  CA   . HIS A  1 57  ? -58.877 -6.384  -49.426  1.00 34.99  ? 57  HIS O CA   1 
ATOM   858   C  C    . HIS A  1 57  ? -59.872 -7.421  -48.933  1.00 31.32  ? 57  HIS O C    1 
ATOM   859   O  O    . HIS A  1 57  ? -60.373 -8.241  -49.707  1.00 35.55  ? 57  HIS O O    1 
ATOM   860   C  CB   . HIS A  1 57  ? -59.321 -5.793  -50.768  1.00 42.68  ? 57  HIS O CB   1 
ATOM   861   C  CG   . HIS A  1 57  ? -58.475 -4.646  -51.229  1.00 63.06  ? 57  HIS O CG   1 
ATOM   862   N  ND1  . HIS A  1 57  ? -57.996 -3.682  -50.366  1.00 64.19  ? 57  HIS O ND1  1 
ATOM   863   C  CD2  . HIS A  1 57  ? -58.009 -4.315  -52.457  1.00 65.44  ? 57  HIS O CD2  1 
ATOM   864   C  CE1  . HIS A  1 57  ? -57.279 -2.804  -51.044  1.00 60.75  ? 57  HIS O CE1  1 
ATOM   865   N  NE2  . HIS A  1 57  ? -57.270 -3.165  -52.314  1.00 63.32  ? 57  HIS O NE2  1 
ATOM   866   H  H    . HIS A  1 57  ? -57.446 -7.410  -50.306  1.00 25.47  ? 57  HIS O H    1 
ATOM   867   H  HA   . HIS A  1 57  ? -58.826 -5.668  -48.773  1.00 41.99  ? 57  HIS O HA   1 
ATOM   868   H  HB2  . HIS A  1 57  ? -59.275 -6.486  -51.445  1.00 51.22  ? 57  HIS O HB2  1 
ATOM   869   H  HB3  . HIS A  1 57  ? -60.233 -5.475  -50.684  1.00 51.22  ? 57  HIS O HB3  1 
ATOM   870   H  HD2  . HIS A  1 57  ? -58.162 -4.778  -53.249  1.00 78.52  ? 57  HIS O HD2  1 
ATOM   871   H  HE1  . HIS A  1 57  ? -56.852 -2.059  -50.687  1.00 72.91  ? 57  HIS O HE1  1 
ATOM   872   N  N    . GLY A  1 58  ? -60.140 -7.391  -47.640  1.00 29.94  ? 58  GLY O N    1 
ATOM   873   C  CA   . GLY A  1 58  ? -60.916 -8.441  -47.010  1.00 24.42  ? 58  GLY O CA   1 
ATOM   874   C  C    . GLY A  1 58  ? -60.391 -8.618  -45.614  1.00 19.52  ? 58  GLY O C    1 
ATOM   875   O  O    . GLY A  1 58  ? -59.615 -7.797  -45.135  1.00 23.20  ? 58  GLY O O    1 
ATOM   876   H  H    . GLY A  1 58  ? -59.883 -6.771  -47.102  1.00 35.93  ? 58  GLY O H    1 
ATOM   877   H  HA2  . GLY A  1 58  ? -61.853 -8.194  -46.973  1.00 29.30  ? 58  GLY O HA2  1 
ATOM   878   H  HA3  . GLY A  1 58  ? -60.820 -9.273  -47.499  1.00 29.30  ? 58  GLY O HA3  1 
ATOM   879   N  N    . THR A  1 59  ? -60.811 -9.686  -44.955  1.00 15.52  ? 59  THR O N    1 
ATOM   880   C  CA   . THR A  1 59  ? -60.409 -9.924  -43.580  1.00 22.23  ? 59  THR O CA   1 
ATOM   881   C  C    . THR A  1 59  ? -59.604 -11.203 -43.480  1.00 22.39  ? 59  THR O C    1 
ATOM   882   O  O    . THR A  1 59  ? -59.863 -12.188 -44.187  1.00 20.00  ? 59  THR O O    1 
ATOM   883   C  CB   . THR A  1 59  ? -61.625 -10.022 -42.645  1.00 24.11  ? 59  THR O CB   1 
ATOM   884   O  OG1  . THR A  1 59  ? -62.444 -11.117 -43.058  1.00 26.63  ? 59  THR O OG1  1 
ATOM   885   C  CG2  . THR A  1 59  ? -62.438 -8.740  -42.678  1.00 34.52  ? 59  THR O CG2  1 
ATOM   886   H  H    . THR A  1 59  ? -61.330 -10.289 -45.282  1.00 18.62  ? 59  THR O H    1 
ATOM   887   H  HA   . THR A  1 59  ? -59.852 -9.189  -43.278  1.00 26.68  ? 59  THR O HA   1 
ATOM   888   H  HB   . THR A  1 59  ? -61.322 -10.171 -41.735  1.00 28.93  ? 59  THR O HB   1 
ATOM   889   H  HG1  . THR A  1 59  ? -63.113 -11.181 -42.554  1.00 31.95  ? 59  THR O HG1  1 
ATOM   890   H  HG21 . THR A  1 59  ? -63.201 -8.816  -42.084  1.00 41.43  ? 59  THR O HG21 1 
ATOM   891   H  HG22 . THR A  1 59  ? -61.890 -7.992  -42.393  1.00 41.43  ? 59  THR O HG22 1 
ATOM   892   H  HG23 . THR A  1 59  ? -62.756 -8.572  -43.579  1.00 41.43  ? 59  THR O HG23 1 
ATOM   893   N  N    . VAL A  1 60  ? -58.610 -11.181 -42.605  1.00 17.41  ? 60  VAL O N    1 
ATOM   894   C  CA   . VAL A  1 60  ? -57.850 -12.386 -42.325  1.00 15.02  ? 60  VAL O CA   1 
ATOM   895   C  C    . VAL A  1 60  ? -57.436 -12.408 -40.854  1.00 21.53  ? 60  VAL O C    1 
ATOM   896   O  O    . VAL A  1 60  ? -56.928 -11.434 -40.308  1.00 19.11  ? 60  VAL O O    1 
ATOM   897   C  CB   . VAL A  1 60  ? -56.617 -12.504 -43.272  1.00 25.03  ? 60  VAL O CB   1 
ATOM   898   C  CG1  . VAL A  1 60  ? -55.837 -11.233 -43.308  1.00 25.00  ? 60  VAL O CG1  1 
ATOM   899   C  CG2  . VAL A  1 60  ? -55.727 -13.675 -42.883  1.00 20.75  ? 60  VAL O CG2  1 
ATOM   900   H  H    . VAL A  1 60  ? -58.359 -10.488 -42.164  1.00 20.89  ? 60  VAL O H    1 
ATOM   901   H  HA   . VAL A  1 60  ? -58.418 -13.156 -42.483  1.00 18.02  ? 60  VAL O HA   1 
ATOM   902   H  HB   . VAL A  1 60  ? -56.938 -12.672 -44.172  1.00 30.04  ? 60  VAL O HB   1 
ATOM   903   H  HG11 . VAL A  1 60  ? -55.081 -11.344 -43.905  1.00 30.00  ? 60  VAL O HG11 1 
ATOM   904   H  HG12 . VAL A  1 60  ? -56.411 -10.520 -43.629  1.00 30.00  ? 60  VAL O HG12 1 
ATOM   905   H  HG13 . VAL A  1 60  ? -55.525 -11.029 -42.412  1.00 30.00  ? 60  VAL O HG13 1 
ATOM   906   H  HG21 . VAL A  1 60  ? -54.974 -13.715 -43.493  1.00 24.90  ? 60  VAL O HG21 1 
ATOM   907   H  HG22 . VAL A  1 60  ? -55.411 -13.543 -41.975  1.00 24.90  ? 60  VAL O HG22 1 
ATOM   908   H  HG23 . VAL A  1 60  ? -56.242 -14.495 -42.938  1.00 24.90  ? 60  VAL O HG23 1 
ATOM   909   N  N    . LYS A  1 61  ? -57.693 -13.538 -40.210  1.00 20.71  ? 61  LYS O N    1 
ATOM   910   C  CA   . LYS A  1 61  ? -57.314 -13.714 -38.829  1.00 16.62  ? 61  LYS O CA   1 
ATOM   911   C  C    . LYS A  1 61  ? -57.077 -15.190 -38.541  1.00 15.13  ? 61  LYS O C    1 
ATOM   912   O  O    . LYS A  1 61  ? -57.425 -16.062 -39.341  1.00 17.25  ? 61  LYS O O    1 
ATOM   913   C  CB   . LYS A  1 61  ? -58.392 -13.157 -37.894  1.00 25.43  ? 61  LYS O CB   1 
ATOM   914   C  CG   . LYS A  1 61  ? -59.703 -13.904 -37.945  1.00 38.59  ? 61  LYS O CG   1 
ATOM   915   C  CD   . LYS A  1 61  ? -60.727 -13.323 -36.971  1.00 52.07  ? 61  LYS O CD   1 
ATOM   916   C  CE   . LYS A  1 61  ? -61.960 -14.226 -36.860  1.00 60.78  ? 61  LYS O CE   1 
ATOM   917   N  NZ   . LYS A  1 61  ? -63.033 -13.645 -35.998  1.00 62.99  ? 61  LYS O NZ   1 
ATOM   918   H  H    . LYS A  1 61  ? -58.089 -14.218 -40.557  1.00 24.86  ? 61  LYS O H    1 
ATOM   919   H  HA   . LYS A  1 61  ? -56.487 -13.235 -38.660  1.00 19.95  ? 61  LYS O HA   1 
ATOM   920   H  HB2  . LYS A  1 61  ? -58.065 -13.198 -36.982  1.00 30.51  ? 61  LYS O HB2  1 
ATOM   921   H  HB3  . LYS A  1 61  ? -58.568 -12.235 -38.137  1.00 30.51  ? 61  LYS O HB3  1 
ATOM   922   H  HG2  . LYS A  1 61  ? -60.070 -13.844 -38.841  1.00 46.31  ? 61  LYS O HG2  1 
ATOM   923   H  HG3  . LYS A  1 61  ? -59.551 -14.832 -37.707  1.00 46.31  ? 61  LYS O HG3  1 
ATOM   924   H  HD2  . LYS A  1 61  ? -60.325 -13.246 -36.091  1.00 62.48  ? 61  LYS O HD2  1 
ATOM   925   H  HD3  . LYS A  1 61  ? -61.013 -12.452 -37.288  1.00 62.48  ? 61  LYS O HD3  1 
ATOM   926   H  HE2  . LYS A  1 61  ? -62.330 -14.364 -37.746  1.00 72.93  ? 61  LYS O HE2  1 
ATOM   927   H  HE3  . LYS A  1 61  ? -61.695 -15.076 -36.476  1.00 72.93  ? 61  LYS O HE3  1 
ATOM   928   H  HZ1  . LYS A  1 61  ? -63.728 -14.201 -35.962  1.00 75.58  ? 61  LYS O HZ1  1 
ATOM   929   H  HZ2  . LYS A  1 61  ? -62.724 -13.515 -35.174  1.00 75.58  ? 61  LYS O HZ2  1 
ATOM   930   H  HZ3  . LYS A  1 61  ? -63.303 -12.866 -36.332  1.00 75.58  ? 61  LYS O HZ3  1 
ATOM   931   N  N    . ALA A  1 62  ? -56.499 -15.447 -37.374  1.00 17.15  ? 62  ALA O N    1 
ATOM   932   C  CA   . ALA A  1 62  ? -56.344 -16.793 -36.858  1.00 17.36  ? 62  ALA O CA   1 
ATOM   933   C  C    . ALA A  1 62  ? -57.424 -17.011 -35.813  1.00 17.31  ? 62  ALA O C    1 
ATOM   934   O  O    . ALA A  1 62  ? -57.627 -16.172 -34.941  1.00 19.29  ? 62  ALA O O    1 
ATOM   935   C  CB   . ALA A  1 62  ? -54.974 -16.984 -36.266  1.00 19.39  ? 62  ALA O CB   1 
ATOM   936   H  H    . ALA A  1 62  ? -56.183 -14.840 -36.853  1.00 20.58  ? 62  ALA O H    1 
ATOM   937   H  HA   . ALA A  1 62  ? -56.467 -17.436 -37.574  1.00 20.83  ? 62  ALA O HA   1 
ATOM   938   H  HB1  . ALA A  1 62  ? -54.899 -17.890 -35.930  1.00 23.27  ? 62  ALA O HB1  1 
ATOM   939   H  HB2  . ALA A  1 62  ? -54.309 -16.830 -36.955  1.00 23.27  ? 62  ALA O HB2  1 
ATOM   940   H  HB3  . ALA A  1 62  ? -54.853 -16.351 -35.541  1.00 23.27  ? 62  ALA O HB3  1 
ATOM   941   N  N    . GLU A  1 63  ? -58.128 -18.131 -35.908  1.00 22.81  ? 63  GLU O N    1 
ATOM   942   C  CA   . GLU A  1 63  ? -59.187 -18.435 -34.953  1.00 25.90  ? 63  GLU O CA   1 
ATOM   943   C  C    . GLU A  1 63  ? -59.314 -19.930 -34.763  1.00 24.99  ? 63  GLU O C    1 
ATOM   944   O  O    . GLU A  1 63  ? -59.515 -20.658 -35.729  1.00 21.25  ? 63  GLU O O    1 
ATOM   945   C  CB   . GLU A  1 63  ? -60.519 -17.846 -35.432  1.00 42.91  ? 63  GLU O CB   1 
ATOM   946   C  CG   . GLU A  1 63  ? -61.688 -18.062 -34.479  1.00 58.46  ? 63  GLU O CG   1 
ATOM   947   C  CD   . GLU A  1 63  ? -62.985 -17.450 -34.989  1.00 66.65  ? 63  GLU O CD   1 
ATOM   948   O  OE1  . GLU A  1 63  ? -63.780 -16.974 -34.153  1.00 67.53  ? 63  GLU O OE1  1 
ATOM   949   O  OE2  . GLU A  1 63  ? -63.212 -17.450 -36.221  1.00 65.98  ? 63  GLU O OE2  1 
ATOM   950   H  H    . GLU A  1 63  ? -58.014 -18.730 -36.514  1.00 27.37  ? 63  GLU O H    1 
ATOM   951   H  HA   . GLU A  1 63  ? -58.969 -18.037 -34.095  1.00 31.08  ? 63  GLU O HA   1 
ATOM   952   H  HB2  . GLU A  1 63  ? -60.410 -16.889 -35.551  1.00 51.49  ? 63  GLU O HB2  1 
ATOM   953   H  HB3  . GLU A  1 63  ? -60.752 -18.255 -36.280  1.00 51.49  ? 63  GLU O HB3  1 
ATOM   954   H  HG2  . GLU A  1 63  ? -61.830 -19.014 -34.364  1.00 70.15  ? 63  GLU O HG2  1 
ATOM   955   H  HG3  . GLU A  1 63  ? -61.479 -17.652 -33.625  1.00 70.15  ? 63  GLU O HG3  1 
ATOM   956   N  N    . ASN A  1 64  ? -59.181 -20.384 -33.522  1.00 25.07  ? 64  ASN O N    1 
ATOM   957   C  CA   . ASN A  1 64  ? -59.342 -21.807 -33.199  1.00 24.55  ? 64  ASN O CA   1 
ATOM   958   C  C    . ASN A  1 64  ? -58.435 -22.703 -34.041  1.00 29.38  ? 64  ASN O C    1 
ATOM   959   O  O    . ASN A  1 64  ? -58.825 -23.795 -34.442  1.00 25.62  ? 64  ASN O O    1 
ATOM   960   C  CB   . ASN A  1 64  ? -60.804 -22.227 -33.386  1.00 39.80  ? 64  ASN O CB   1 
ATOM   961   C  CG   . ASN A  1 64  ? -61.749 -21.468 -32.473  1.00 59.62  ? 64  ASN O CG   1 
ATOM   962   O  OD1  . ASN A  1 64  ? -61.389 -21.121 -31.346  1.00 61.89  ? 64  ASN O OD1  1 
ATOM   963   N  ND2  . ASN A  1 64  ? -62.963 -21.198 -32.958  1.00 61.24  ? 64  ASN O ND2  1 
ATOM   964   H  H    . ASN A  1 64  ? -58.997 -19.890 -32.842  1.00 30.09  ? 64  ASN O H    1 
ATOM   965   H  HA   . ASN A  1 64  ? -59.110 -21.944 -32.267  1.00 29.46  ? 64  ASN O HA   1 
ATOM   966   H  HB2  . ASN A  1 64  ? -61.069 -22.055 -34.303  1.00 47.76  ? 64  ASN O HB2  1 
ATOM   967   H  HB3  . ASN A  1 64  ? -60.890 -23.173 -33.187  1.00 47.76  ? 64  ASN O HB3  1 
ATOM   968   H  HD21 . ASN A  1 64  ? -63.532 -20.769 -32.476  1.00 73.49  ? 64  ASN O HD21 1 
ATOM   969   H  HD22 . ASN A  1 64  ? -63.176 -21.452 -33.751  1.00 73.49  ? 64  ASN O HD22 1 
ATOM   970   N  N    . GLY A  1 65  ? -57.228 -22.226 -34.319  1.00 23.92  ? 65  GLY O N    1 
ATOM   971   C  CA   . GLY A  1 65  ? -56.226 -23.020 -35.010  1.00 20.36  ? 65  GLY O CA   1 
ATOM   972   C  C    . GLY A  1 65  ? -56.392 -23.058 -36.516  1.00 19.04  ? 65  GLY O C    1 
ATOM   973   O  O    . GLY A  1 65  ? -55.668 -23.792 -37.197  1.00 22.40  ? 65  GLY O O    1 
ATOM   974   H  H    . GLY A  1 65  ? -56.963 -21.434 -34.114  1.00 28.70  ? 65  GLY O H    1 
ATOM   975   H  HA2  . GLY A  1 65  ? -55.347 -22.662 -34.813  1.00 24.43  ? 65  GLY O HA2  1 
ATOM   976   H  HA3  . GLY A  1 65  ? -56.262 -23.932 -34.680  1.00 24.43  ? 65  GLY O HA3  1 
ATOM   977   N  N    . LYS A  1 66  ? -57.348 -22.274 -37.021  1.00 18.43  ? 66  LYS O N    1 
ATOM   978   C  CA   . LYS A  1 66  ? -57.634 -22.156 -38.447  1.00 18.27  ? 66  LYS O CA   1 
ATOM   979   C  C    . LYS A  1 66  ? -57.293 -20.762 -38.963  1.00 17.26  ? 66  LYS O C    1 
ATOM   980   O  O    . LYS A  1 66  ? -57.334 -19.805 -38.216  1.00 14.88  ? 66  LYS O O    1 
ATOM   981   C  CB   . LYS A  1 66  ? -59.111 -22.431 -38.716  1.00 20.12  ? 66  LYS O CB   1 
ATOM   982   C  CG   . LYS A  1 66  ? -59.610 -23.818 -38.260  1.00 23.58  ? 66  LYS O CG   1 
ATOM   983   C  CD   . LYS A  1 66  ? -59.585 -24.787 -39.398  1.00 32.25  ? 66  LYS O CD   1 
ATOM   984   C  CE   . LYS A  1 66  ? -60.172 -26.135 -39.015  1.00 38.82  ? 66  LYS O CE   1 
ATOM   985   N  NZ   . LYS A  1 66  ? -61.638 -26.060 -38.929  1.00 51.57  ? 66  LYS O NZ   1 
ATOM   986   H  H    . LYS A  1 66  ? -57.861 -21.784 -36.535  1.00 22.11  ? 66  LYS O H    1 
ATOM   987   H  HA   . LYS A  1 66  ? -57.106 -22.804 -38.938  1.00 21.92  ? 66  LYS O HA   1 
ATOM   988   H  HB2  . LYS A  1 66  ? -59.639 -21.763 -38.251  1.00 24.14  ? 66  LYS O HB2  1 
ATOM   989   H  HB3  . LYS A  1 66  ? -59.269 -22.363 -39.670  1.00 24.14  ? 66  LYS O HB3  1 
ATOM   990   H  HG2  . LYS A  1 66  ? -59.031 -24.155 -37.558  1.00 28.29  ? 66  LYS O HG2  1 
ATOM   991   H  HG3  . LYS A  1 66  ? -60.523 -23.744 -37.940  1.00 28.29  ? 66  LYS O HG3  1 
ATOM   992   H  HD2  . LYS A  1 66  ? -60.107 -24.428 -40.133  1.00 38.70  ? 66  LYS O HD2  1 
ATOM   993   H  HD3  . LYS A  1 66  ? -58.667 -24.927 -39.678  1.00 38.70  ? 66  LYS O HD3  1 
ATOM   994   H  HE2  . LYS A  1 66  ? -59.938 -26.792 -39.689  1.00 46.58  ? 66  LYS O HE2  1 
ATOM   995   H  HE3  . LYS A  1 66  ? -59.828 -26.402 -38.148  1.00 46.58  ? 66  LYS O HE3  1 
ATOM   996   H  HZ1  . LYS A  1 66  ? -61.971 -26.855 -38.704  1.00 61.89  ? 66  LYS O HZ1  1 
ATOM   997   H  HZ2  . LYS A  1 66  ? -61.877 -25.462 -38.315  1.00 61.89  ? 66  LYS O HZ2  1 
ATOM   998   H  HZ3  . LYS A  1 66  ? -61.977 -25.818 -39.716  1.00 61.89  ? 66  LYS O HZ3  1 
ATOM   999   N  N    . LEU A  1 67  ? -56.945 -20.674 -40.243  1.00 14.59  ? 67  LEU O N    1 
ATOM   1000  C  CA   . LEU A  1 67  ? -56.793 -19.406 -40.927  1.00 14.94  ? 67  LEU O CA   1 
ATOM   1001  C  C    . LEU A  1 67  ? -58.177 -19.029 -41.478  1.00 18.75  ? 67  LEU O C    1 
ATOM   1002  O  O    . LEU A  1 67  ? -58.803 -19.812 -42.192  1.00 20.79  ? 67  LEU O O    1 
ATOM   1003  C  CB   . LEU A  1 67  ? -55.746 -19.512 -42.037  1.00 13.99  ? 67  LEU O CB   1 
ATOM   1004  C  CG   . LEU A  1 67  ? -55.470 -18.238 -42.827  1.00 13.96  ? 67  LEU O CG   1 
ATOM   1005  C  CD1  . LEU A  1 67  ? -54.759 -17.207 -41.954  1.00 18.23  ? 67  LEU O CD1  1 
ATOM   1006  C  CD2  . LEU A  1 67  ? -54.655 -18.564 -44.060  1.00 12.39  ? 67  LEU O CD2  1 
ATOM   1007  H  H    . LEU A  1 67  ? -56.788 -21.355 -40.744  1.00 17.51  ? 67  LEU O H    1 
ATOM   1008  H  HA   . LEU A  1 67  ? -56.512 -18.725 -40.296  1.00 17.92  ? 67  LEU O HA   1 
ATOM   1009  H  HB2  . LEU A  1 67  ? -54.907 -19.791 -41.638  1.00 16.79  ? 67  LEU O HB2  1 
ATOM   1010  H  HB3  . LEU A  1 67  ? -56.040 -20.185 -42.670  1.00 16.79  ? 67  LEU O HB3  1 
ATOM   1011  H  HG   . LEU A  1 67  ? -56.313 -17.856 -43.116  1.00 16.75  ? 67  LEU O HG   1 
ATOM   1012  H  HD11 . LEU A  1 67  ? -54.595 -16.409 -42.479  1.00 21.87  ? 67  LEU O HD11 1 
ATOM   1013  H  HD12 . LEU A  1 67  ? -55.323 -16.995 -41.194  1.00 21.87  ? 67  LEU O HD12 1 
ATOM   1014  H  HD13 . LEU A  1 67  ? -53.917 -17.581 -41.648  1.00 21.87  ? 67  LEU O HD13 1 
ATOM   1015  H  HD21 . LEU A  1 67  ? -54.487 -17.746 -44.553  1.00 14.86  ? 67  LEU O HD21 1 
ATOM   1016  H  HD22 . LEU A  1 67  ? -53.815 -18.965 -43.787  1.00 14.86  ? 67  LEU O HD22 1 
ATOM   1017  H  HD23 . LEU A  1 67  ? -55.154 -19.187 -44.612  1.00 14.86  ? 67  LEU O HD23 1 
ATOM   1018  N  N    . VAL A  1 68  ? -58.673 -17.857 -41.105  1.00 16.43  ? 68  VAL O N    1 
ATOM   1019  C  CA   . VAL A  1 68  ? -60.022 -17.460 -41.487  1.00 17.00  ? 68  VAL O CA   1 
ATOM   1020  C  C    . VAL A  1 68  ? -59.956 -16.254 -42.413  1.00 18.49  ? 68  VAL O C    1 
ATOM   1021  O  O    . VAL A  1 68  ? -59.597 -15.164 -41.993  1.00 15.32  ? 68  VAL O O    1 
ATOM   1022  C  CB   . VAL A  1 68  ? -60.877 -17.146 -40.263  1.00 19.30  ? 68  VAL O CB   1 
ATOM   1023  C  CG1  . VAL A  1 68  ? -62.319 -16.802 -40.686  1.00 21.28  ? 68  VAL O CG1  1 
ATOM   1024  C  CG2  . VAL A  1 68  ? -60.857 -18.316 -39.305  1.00 23.68  ? 68  VAL O CG2  1 
ATOM   1025  H  H    . VAL A  1 68  ? -58.251 -17.275 -40.633  1.00 19.72  ? 68  VAL O H    1 
ATOM   1026  H  HA   . VAL A  1 68  ? -60.442 -18.188 -41.969  1.00 20.40  ? 68  VAL O HA   1 
ATOM   1027  H  HB   . VAL A  1 68  ? -60.505 -16.376 -39.805  1.00 23.16  ? 68  VAL O HB   1 
ATOM   1028  H  HG11 . VAL A  1 68  ? -62.842 -16.607 -39.893  1.00 25.53  ? 68  VAL O HG11 1 
ATOM   1029  H  HG12 . VAL A  1 68  ? -62.300 -16.027 -41.269  1.00 25.53  ? 68  VAL O HG12 1 
ATOM   1030  H  HG13 . VAL A  1 68  ? -62.699 -17.560 -41.156  1.00 25.53  ? 68  VAL O HG13 1 
ATOM   1031  H  HG21 . VAL A  1 68  ? -61.405 -18.101 -38.533  1.00 28.42  ? 68  VAL O HG21 1 
ATOM   1032  H  HG22 . VAL A  1 68  ? -61.211 -19.099 -39.755  1.00 28.42  ? 68  VAL O HG22 1 
ATOM   1033  H  HG23 . VAL A  1 68  ? -59.942 -18.480 -39.026  1.00 28.42  ? 68  VAL O HG23 1 
ATOM   1034  N  N    . ILE A  1 69  ? -60.305 -16.475 -43.677  1.00 14.21  ? 69  ILE O N    1 
ATOM   1035  C  CA   . ILE A  1 69  ? -60.273 -15.430 -44.684  1.00 13.28  ? 69  ILE O CA   1 
ATOM   1036  C  C    . ILE A  1 69  ? -61.694 -15.141 -45.136  1.00 18.13  ? 69  ILE O C    1 
ATOM   1037  O  O    . ILE A  1 69  ? -62.425 -16.042 -45.580  1.00 16.26  ? 69  ILE O O    1 
ATOM   1038  C  CB   . ILE A  1 69  ? -59.394 -15.820 -45.886  1.00 15.46  ? 69  ILE O CB   1 
ATOM   1039  C  CG1  . ILE A  1 69  ? -57.954 -16.039 -45.424  1.00 16.99  ? 69  ILE O CG1  1 
ATOM   1040  C  CG2  . ILE A  1 69  ? -59.437 -14.745 -46.982  1.00 18.61  ? 69  ILE O CG2  1 
ATOM   1041  C  CD1  . ILE A  1 69  ? -57.051 -16.642 -46.474  1.00 12.49  ? 69  ILE O CD1  1 
ATOM   1042  H  H    . ILE A  1 69  ? -60.567 -17.236 -43.978  1.00 17.06  ? 69  ILE O H    1 
ATOM   1043  H  HA   . ILE A  1 69  ? -59.909 -14.620 -44.293  1.00 15.93  ? 69  ILE O HA   1 
ATOM   1044  H  HB   . ILE A  1 69  ? -59.730 -16.651 -46.256  1.00 18.55  ? 69  ILE O HB   1 
ATOM   1045  H  HG12 . ILE A  1 69  ? -57.577 -15.184 -45.166  1.00 20.39  ? 69  ILE O HG12 1 
ATOM   1046  H  HG13 . ILE A  1 69  ? -57.960 -16.638 -44.661  1.00 20.39  ? 69  ILE O HG13 1 
ATOM   1047  H  HG21 . ILE A  1 69  ? -58.873 -15.025 -47.720  1.00 22.33  ? 69  ILE O HG21 1 
ATOM   1048  H  HG22 . ILE A  1 69  ? -60.352 -14.640 -47.285  1.00 22.33  ? 69  ILE O HG22 1 
ATOM   1049  H  HG23 . ILE A  1 69  ? -59.111 -13.908 -46.616  1.00 22.33  ? 69  ILE O HG23 1 
ATOM   1050  H  HD11 . ILE A  1 69  ? -56.161 -16.747 -46.102  1.00 14.99  ? 69  ILE O HD11 1 
ATOM   1051  H  HD12 . ILE A  1 69  ? -57.405 -17.506 -46.736  1.00 14.99  ? 69  ILE O HD12 1 
ATOM   1052  H  HD13 . ILE A  1 69  ? -57.021 -16.049 -47.242  1.00 14.99  ? 69  ILE O HD13 1 
ATOM   1053  N  N    . ASN A  1 70  ? -62.065 -13.872 -45.029  1.00 20.33  ? 70  ASN O N    1 
ATOM   1054  C  CA   . ASN A  1 70  ? -63.427 -13.418 -45.296  1.00 25.99  ? 70  ASN O CA   1 
ATOM   1055  C  C    . ASN A  1 70  ? -64.457 -14.305 -44.607  1.00 26.09  ? 70  ASN O C    1 
ATOM   1056  O  O    . ASN A  1 70  ? -65.502 -14.598 -45.172  1.00 22.37  ? 70  ASN O O    1 
ATOM   1057  C  CB   . ASN A  1 70  ? -63.696 -13.377 -46.801  1.00 22.72  ? 70  ASN O CB   1 
ATOM   1058  C  CG   . ASN A  1 70  ? -62.880 -12.331 -47.512  1.00 22.39  ? 70  ASN O CG   1 
ATOM   1059  O  OD1  . ASN A  1 70  ? -62.417 -11.362 -46.912  1.00 22.75  ? 70  ASN O OD1  1 
ATOM   1060  N  ND2  . ASN A  1 70  ? -62.713 -12.511 -48.810  1.00 20.86  ? 70  ASN O ND2  1 
ATOM   1061  H  H    . ASN A  1 70  ? -61.533 -13.237 -44.796  1.00 24.40  ? 70  ASN O H    1 
ATOM   1062  H  HA   . ASN A  1 70  ? -63.531 -12.518 -44.951  1.00 31.19  ? 70  ASN O HA   1 
ATOM   1063  H  HB2  . ASN A  1 70  ? -63.477 -14.240 -47.185  1.00 27.27  ? 70  ASN O HB2  1 
ATOM   1064  H  HB3  . ASN A  1 70  ? -64.634 -13.177 -46.949  1.00 27.27  ? 70  ASN O HB3  1 
ATOM   1065  H  HD21 . ASN A  1 70  ? -62.256 -11.945 -49.267  1.00 25.03  ? 70  ASN O HD21 1 
ATOM   1066  H  HD22 . ASN A  1 70  ? -63.062 -13.195 -49.197  1.00 25.03  ? 70  ASN O HD22 1 
ATOM   1067  N  N    . GLY A  1 71  ? -64.147 -14.734 -43.386  1.00 23.68  ? 71  GLY O N    1 
ATOM   1068  C  CA   . GLY A  1 71  ? -65.062 -15.537 -42.590  1.00 22.40  ? 71  GLY O CA   1 
ATOM   1069  C  C    . GLY A  1 71  ? -65.050 -17.031 -42.886  1.00 28.22  ? 71  GLY O C    1 
ATOM   1070  O  O    . GLY A  1 71  ? -65.811 -17.781 -42.276  1.00 24.56  ? 71  GLY O O    1 
ATOM   1071  H  H    . GLY A  1 71  ? -63.400 -14.570 -42.993  1.00 28.42  ? 71  GLY O H    1 
ATOM   1072  H  HA2  . GLY A  1 71  ? -64.847 -15.418 -41.652  1.00 26.88  ? 71  GLY O HA2  1 
ATOM   1073  H  HA3  . GLY A  1 71  ? -65.966 -15.213 -42.733  1.00 26.88  ? 71  GLY O HA3  1 
ATOM   1074  N  N    . ASN A  1 72  ? -64.207 -17.466 -43.819  1.00 22.32  ? 72  ASN O N    1 
ATOM   1075  C  CA   . ASN A  1 72  ? -64.106 -18.882 -44.180  1.00 20.84  ? 72  ASN O CA   1 
ATOM   1076  C  C    . ASN A  1 72  ? -62.912 -19.553 -43.527  1.00 22.94  ? 72  ASN O C    1 
ATOM   1077  O  O    . ASN A  1 72  ? -61.777 -19.190 -43.815  1.00 19.26  ? 72  ASN O O    1 
ATOM   1078  C  CB   . ASN A  1 72  ? -63.996 -19.045 -45.691  1.00 20.97  ? 72  ASN O CB   1 
ATOM   1079  C  CG   . ASN A  1 72  ? -65.134 -18.363 -46.420  1.00 31.85  ? 72  ASN O CG   1 
ATOM   1080  O  OD1  . ASN A  1 72  ? -66.255 -18.860 -46.428  1.00 28.51  ? 72  ASN O OD1  1 
ATOM   1081  N  ND2  . ASN A  1 72  ? -64.860 -17.205 -47.006  1.00 36.37  ? 72  ASN O ND2  1 
ATOM   1082  H  H    . ASN A  1 72  ? -63.676 -16.956 -44.264  1.00 26.79  ? 72  ASN O H    1 
ATOM   1083  H  HA   . ASN A  1 72  ? -64.908 -19.342 -43.886  1.00 25.00  ? 72  ASN O HA   1 
ATOM   1084  H  HB2  . ASN A  1 72  ? -63.163 -18.650 -45.993  1.00 25.16  ? 72  ASN O HB2  1 
ATOM   1085  H  HB3  . ASN A  1 72  ? -64.017 -19.989 -45.912  1.00 25.16  ? 72  ASN O HB3  1 
ATOM   1086  H  HD21 . ASN A  1 72  ? -65.476 -16.783 -47.431  1.00 43.65  ? 72  ASN O HD21 1 
ATOM   1087  H  HD22 . ASN A  1 72  ? -64.066 -16.877 -46.959  1.00 43.65  ? 72  ASN O HD22 1 
ATOM   1088  N  N    . PRO A  1 73  ? -63.161 -20.535 -42.651  1.00 22.66  ? 73  PRO O N    1 
ATOM   1089  C  CA   . PRO A  1 73  ? -62.046 -21.212 -41.982  1.00 20.03  ? 73  PRO O CA   1 
ATOM   1090  C  C    . PRO A  1 73  ? -61.284 -22.167 -42.898  1.00 18.29  ? 73  PRO O C    1 
ATOM   1091  O  O    . PRO A  1 73  ? -61.861 -22.861 -43.725  1.00 21.42  ? 73  PRO O O    1 
ATOM   1092  C  CB   . PRO A  1 73  ? -62.733 -21.965 -40.840  1.00 25.54  ? 73  PRO O CB   1 
ATOM   1093  C  CG   . PRO A  1 73  ? -64.116 -22.172 -41.301  1.00 34.14  ? 73  PRO O CG   1 
ATOM   1094  C  CD   . PRO A  1 73  ? -64.464 -20.967 -42.110  1.00 27.88  ? 73  PRO O CD   1 
ATOM   1095  H  HA   . PRO A  1 73  ? -61.430 -20.561 -41.613  1.00 24.04  ? 73  PRO O HA   1 
ATOM   1096  H  HB2  . PRO A  1 73  ? -62.288 -22.814 -40.693  1.00 30.65  ? 73  PRO O HB2  1 
ATOM   1097  H  HB3  . PRO A  1 73  ? -62.716 -21.424 -40.035  1.00 30.65  ? 73  PRO O HB3  1 
ATOM   1098  H  HG2  . PRO A  1 73  ? -64.159 -22.973 -41.846  1.00 40.97  ? 73  PRO O HG2  1 
ATOM   1099  H  HG3  . PRO A  1 73  ? -64.705 -22.250 -40.534  1.00 40.97  ? 73  PRO O HG3  1 
ATOM   1100  H  HD2  . PRO A  1 73  ? -65.068 -21.206 -42.831  1.00 33.45  ? 73  PRO O HD2  1 
ATOM   1101  H  HD3  . PRO A  1 73  ? -64.842 -20.276 -41.544  1.00 33.45  ? 73  PRO O HD3  1 
ATOM   1102  N  N    . ILE A  1 74  ? -59.969 -22.175 -42.734  1.00 14.06  ? 74  ILE O N    1 
ATOM   1103  C  CA   . ILE A  1 74  ? -59.061 -22.963 -43.551  1.00 13.40  ? 74  ILE O CA   1 
ATOM   1104  C  C    . ILE A  1 74  ? -58.193 -23.804 -42.630  1.00 14.49  ? 74  ILE O C    1 
ATOM   1105  O  O    . ILE A  1 74  ? -57.593 -23.278 -41.698  1.00 13.68  ? 74  ILE O O    1 
ATOM   1106  C  CB   . ILE A  1 74  ? -58.182 -22.053 -44.429  1.00 12.53  ? 74  ILE O CB   1 
ATOM   1107  C  CG1  . ILE A  1 74  ? -59.063 -21.169 -45.311  1.00 19.14  ? 74  ILE O CG1  1 
ATOM   1108  C  CG2  . ILE A  1 74  ? -57.210 -22.854 -45.261  1.00 11.95  ? 74  ILE O CG2  1 
ATOM   1109  C  CD1  . ILE A  1 74  ? -58.290 -20.081 -46.021  1.00 15.65  ? 74  ILE O CD1  1 
ATOM   1110  H  H    . ILE A  1 74  ? -59.565 -21.714 -42.131  1.00 16.88  ? 74  ILE O H    1 
ATOM   1111  H  HA   . ILE A  1 74  ? -59.569 -23.556 -44.127  1.00 16.08  ? 74  ILE O HA   1 
ATOM   1112  H  HB   . ILE A  1 74  ? -57.669 -21.475 -43.842  1.00 15.04  ? 74  ILE O HB   1 
ATOM   1113  H  HG12 . ILE A  1 74  ? -59.488 -21.722 -45.985  1.00 22.97  ? 74  ILE O HG12 1 
ATOM   1114  H  HG13 . ILE A  1 74  ? -59.737 -20.745 -44.758  1.00 22.97  ? 74  ILE O HG13 1 
ATOM   1115  H  HG21 . ILE A  1 74  ? -56.677 -22.246 -45.797  1.00 14.34  ? 74  ILE O HG21 1 
ATOM   1116  H  HG22 . ILE A  1 74  ? -56.635 -23.365 -44.671  1.00 14.34  ? 74  ILE O HG22 1 
ATOM   1117  H  HG23 . ILE A  1 74  ? -57.708 -23.454 -45.838  1.00 14.34  ? 74  ILE O HG23 1 
ATOM   1118  H  HD11 . ILE A  1 74  ? -58.905 -19.560 -46.561  1.00 18.78  ? 74  ILE O HD11 1 
ATOM   1119  H  HD12 . ILE A  1 74  ? -57.866 -19.513 -45.360  1.00 18.78  ? 74  ILE O HD12 1 
ATOM   1120  H  HD13 . ILE A  1 74  ? -57.617 -20.491 -46.587  1.00 18.78  ? 74  ILE O HD13 1 
ATOM   1121  N  N    . THR A  1 75  ? -58.138 -25.108 -42.894  1.00 13.72  ? 75  THR O N    1 
ATOM   1122  C  CA   . THR A  1 75  ? -57.302 -26.025 -42.121  1.00 14.60  ? 75  THR O CA   1 
ATOM   1123  C  C    . THR A  1 75  ? -55.851 -25.790 -42.480  1.00 13.28  ? 75  THR O C    1 
ATOM   1124  O  O    . THR A  1 75  ? -55.536 -25.654 -43.639  1.00 13.54  ? 75  THR O O    1 
ATOM   1125  C  CB   . THR A  1 75  ? -57.683 -27.487 -42.386  1.00 14.75  ? 75  THR O CB   1 
ATOM   1126  O  OG1  . THR A  1 75  ? -59.027 -27.700 -41.950  1.00 15.37  ? 75  THR O OG1  1 
ATOM   1127  C  CG2  . THR A  1 75  ? -56.760 -28.447 -41.643  1.00 21.21  ? 75  THR O CG2  1 
ATOM   1128  H  H    . THR A  1 75  ? -58.581 -25.491 -43.524  1.00 16.46  ? 75  THR O H    1 
ATOM   1129  H  HA   . THR A  1 75  ? -57.417 -25.846 -41.175  1.00 17.52  ? 75  THR O HA   1 
ATOM   1130  H  HB   . THR A  1 75  ? -57.617 -27.671 -43.336  1.00 17.70  ? 75  THR O HB   1 
ATOM   1131  H  HG1  . THR A  1 75  ? -59.250 -28.497 -42.089  1.00 18.45  ? 75  THR O HG1  1 
ATOM   1132  H  HG21 . THR A  1 75  ? -57.019 -29.363 -41.825  1.00 25.45  ? 75  THR O HG21 1 
ATOM   1133  H  HG22 . THR A  1 75  ? -55.843 -28.315 -41.932  1.00 25.45  ? 75  THR O HG22 1 
ATOM   1134  H  HG23 . THR A  1 75  ? -56.816 -28.287 -40.688  1.00 25.45  ? 75  THR O HG23 1 
ATOM   1135  N  N    . ILE A  1 76  ? -54.981 -25.730 -41.478  1.00 14.23  ? 76  ILE O N    1 
ATOM   1136  C  CA   . ILE A  1 76  ? -53.560 -25.452 -41.700  1.00 14.85  ? 76  ILE O CA   1 
ATOM   1137  C  C    . ILE A  1 76  ? -52.722 -26.662 -41.352  1.00 19.42  ? 76  ILE O C    1 
ATOM   1138  O  O    . ILE A  1 76  ? -52.790 -27.151 -40.231  1.00 17.48  ? 76  ILE O O    1 
ATOM   1139  C  CB   . ILE A  1 76  ? -53.081 -24.249 -40.863  1.00 15.91  ? 76  ILE O CB   1 
ATOM   1140  C  CG1  . ILE A  1 76  ? -53.884 -22.999 -41.220  1.00 18.76  ? 76  ILE O CG1  1 
ATOM   1141  C  CG2  . ILE A  1 76  ? -51.576 -23.982 -41.061  1.00 16.75  ? 76  ILE O CG2  1 
ATOM   1142  C  CD1  . ILE A  1 76  ? -53.921 -22.662 -42.672  1.00 18.95  ? 76  ILE O CD1  1 
ATOM   1143  H  H    . ILE A  1 76  ? -55.188 -25.847 -40.651  1.00 17.08  ? 76  ILE O H    1 
ATOM   1144  H  HA   . ILE A  1 76  ? -53.419 -25.244 -42.637  1.00 17.81  ? 76  ILE O HA   1 
ATOM   1145  H  HB   . ILE A  1 76  ? -53.233 -24.451 -39.927  1.00 19.10  ? 76  ILE O HB   1 
ATOM   1146  H  HG12 . ILE A  1 76  ? -54.799 -23.127 -40.926  1.00 22.52  ? 76  ILE O HG12 1 
ATOM   1147  H  HG13 . ILE A  1 76  ? -53.496 -22.241 -40.754  1.00 22.52  ? 76  ILE O HG13 1 
ATOM   1148  H  HG21 . ILE A  1 76  ? -51.316 -23.221 -40.519  1.00 20.10  ? 76  ILE O HG21 1 
ATOM   1149  H  HG22 . ILE A  1 76  ? -51.077 -24.768 -40.788  1.00 20.10  ? 76  ILE O HG22 1 
ATOM   1150  H  HG23 . ILE A  1 76  ? -51.410 -23.794 -41.998  1.00 20.10  ? 76  ILE O HG23 1 
ATOM   1151  H  HD11 . ILE A  1 76  ? -54.450 -21.858 -42.795  1.00 22.74  ? 76  ILE O HD11 1 
ATOM   1152  H  HD12 . ILE A  1 76  ? -53.015 -22.512 -42.984  1.00 22.74  ? 76  ILE O HD12 1 
ATOM   1153  H  HD13 . ILE A  1 76  ? -54.321 -23.400 -43.157  1.00 22.74  ? 76  ILE O HD13 1 
ATOM   1154  N  N    . PHE A  1 77  ? -51.933 -27.131 -42.316  1.00 16.10  ? 77  PHE O N    1 
ATOM   1155  C  CA   . PHE A  1 77  ? -51.009 -28.231 -42.088  1.00 16.35  ? 77  PHE O CA   1 
ATOM   1156  C  C    . PHE A  1 77  ? -49.557 -27.734 -42.067  1.00 13.59  ? 77  PHE O C    1 
ATOM   1157  O  O    . PHE A  1 77  ? -49.241 -26.667 -42.595  1.00 15.08  ? 77  PHE O O    1 
ATOM   1158  C  CB   . PHE A  1 77  ? -51.183 -29.303 -43.162  1.00 18.62  ? 77  PHE O CB   1 
ATOM   1159  C  CG   . PHE A  1 77  ? -52.547 -29.948 -43.179  1.00 18.18  ? 77  PHE O CG   1 
ATOM   1160  C  CD1  . PHE A  1 77  ? -52.978 -30.724 -42.122  1.00 24.82  ? 77  PHE O CD1  1 
ATOM   1161  C  CD2  . PHE A  1 77  ? -53.379 -29.799 -44.280  1.00 23.85  ? 77  PHE O CD2  1 
ATOM   1162  C  CE1  . PHE A  1 77  ? -54.227 -31.332 -42.149  1.00 24.26  ? 77  PHE O CE1  1 
ATOM   1163  C  CE2  . PHE A  1 77  ? -54.622 -30.411 -44.318  1.00 18.55  ? 77  PHE O CE2  1 
ATOM   1164  C  CZ   . PHE A  1 77  ? -55.045 -31.174 -43.256  1.00 18.15  ? 77  PHE O CZ   1 
ATOM   1165  H  H    . PHE A  1 77  ? -51.917 -26.824 -43.119  1.00 19.32  ? 77  PHE O H    1 
ATOM   1166  H  HA   . PHE A  1 77  ? -51.201 -28.634 -41.227  1.00 19.62  ? 77  PHE O HA   1 
ATOM   1167  H  HB2  . PHE A  1 77  ? -51.037 -28.898 -44.031  1.00 22.34  ? 77  PHE O HB2  1 
ATOM   1168  H  HB3  . PHE A  1 77  ? -50.528 -30.002 -43.013  1.00 22.34  ? 77  PHE O HB3  1 
ATOM   1169  H  HD1  . PHE A  1 77  ? -52.429 -30.836 -41.380  1.00 29.78  ? 77  PHE O HD1  1 
ATOM   1170  H  HD2  . PHE A  1 77  ? -53.097 -29.288 -45.004  1.00 28.62  ? 77  PHE O HD2  1 
ATOM   1171  H  HE1  . PHE A  1 77  ? -54.509 -31.849 -41.430  1.00 29.11  ? 77  PHE O HE1  1 
ATOM   1172  H  HE2  . PHE A  1 77  ? -55.174 -30.298 -45.058  1.00 22.26  ? 77  PHE O HE2  1 
ATOM   1173  H  HZ   . PHE A  1 77  ? -55.883 -31.576 -43.276  1.00 21.79  ? 77  PHE O HZ   1 
ATOM   1174  N  N    . GLN A  1 78  ? -48.676 -28.514 -41.450  1.00 14.18  ? 78  GLN O N    1 
ATOM   1175  C  CA   . GLN A  1 78  ? -47.262 -28.142 -41.344  1.00 17.36  ? 78  GLN O CA   1 
ATOM   1176  C  C    . GLN A  1 78  ? -46.348 -29.321 -41.672  1.00 30.81  ? 78  GLN O C    1 
ATOM   1177  O  O    . GLN A  1 78  ? -45.453 -29.636 -40.890  1.00 20.75  ? 78  GLN O O    1 
ATOM   1178  C  CB   . GLN A  1 78  ? -46.944 -27.636 -39.937  1.00 21.23  ? 78  GLN O CB   1 
ATOM   1179  C  CG   . GLN A  1 78  ? -47.804 -26.467 -39.444  1.00 30.79  ? 78  GLN O CG   1 
ATOM   1180  C  CD   . GLN A  1 78  ? -47.248 -25.124 -39.866  1.00 33.63  ? 78  GLN O CD   1 
ATOM   1181  O  OE1  . GLN A  1 78  ? -46.359 -24.578 -39.208  1.00 31.78  ? 78  GLN O OE1  1 
ATOM   1182  N  NE2  . GLN A  1 78  ? -47.764 -24.581 -40.981  1.00 22.88  ? 78  GLN O NE2  1 
ATOM   1183  H  H    . GLN A  1 78  ? -48.868 -29.267 -41.082  1.00 17.02  ? 78  GLN O H    1 
ATOM   1184  H  HA   . GLN A  1 78  ? -47.073 -27.427 -41.973  1.00 20.83  ? 78  GLN O HA   1 
ATOM   1185  H  HB2  . GLN A  1 78  ? -47.065 -28.369 -39.314  1.00 25.48  ? 78  GLN O HB2  1 
ATOM   1186  H  HB3  . GLN A  1 78  ? -46.019 -27.345 -39.918  1.00 25.48  ? 78  GLN O HB3  1 
ATOM   1187  H  HG2  . GLN A  1 78  ? -48.697 -26.553 -39.812  1.00 36.95  ? 78  GLN O HG2  1 
ATOM   1188  H  HG3  . GLN A  1 78  ? -47.840 -26.487 -38.475  1.00 36.95  ? 78  GLN O HG3  1 
ATOM   1189  H  HE21 . GLN A  1 78  ? -48.379 -24.995 -41.417  1.00 27.46  ? 78  GLN O HE21 1 
ATOM   1190  H  HE22 . GLN A  1 78  ? -47.479 -23.818 -41.260  1.00 27.46  ? 78  GLN O HE22 1 
ATOM   1191  N  N    . GLU A  1 79  ? -46.562 -29.943 -42.834  1.00 23.26  ? 79  GLU O N    1 
ATOM   1192  C  CA   . GLU A  1 79  ? -45.889 -31.191 -43.210  1.00 26.49  ? 79  GLU O CA   1 
ATOM   1193  C  C    . GLU A  1 79  ? -44.840 -30.990 -44.292  1.00 26.12  ? 79  GLU O C    1 
ATOM   1194  O  O    . GLU A  1 79  ? -45.122 -30.377 -45.313  1.00 21.59  ? 79  GLU O O    1 
ATOM   1195  C  CB   . GLU A  1 79  ? -46.912 -32.211 -43.713  1.00 28.28  ? 79  GLU O CB   1 
ATOM   1196  C  CG   . GLU A  1 79  ? -47.991 -32.568 -42.726  1.00 41.87  ? 79  GLU O CG   1 
ATOM   1197  C  CD   . GLU A  1 79  ? -47.512 -33.520 -41.647  1.00 49.03  ? 79  GLU O CD   1 
ATOM   1198  O  OE1  . GLU A  1 79  ? -46.458 -34.166 -41.848  1.00 33.33  ? 79  GLU O OE1  1 
ATOM   1199  O  OE2  . GLU A  1 79  ? -48.204 -33.620 -40.606  1.00 51.91  ? 79  GLU O OE2  1 
ATOM   1200  H  H    . GLU A  1 79  ? -47.105 -29.655 -43.435  1.00 27.91  ? 79  GLU O H    1 
ATOM   1201  H  HA   . GLU A  1 79  ? -45.450 -31.563 -42.429  1.00 31.79  ? 79  GLU O HA   1 
ATOM   1202  H  HB2  . GLU A  1 79  ? -47.345 -31.850 -44.502  1.00 33.94  ? 79  GLU O HB2  1 
ATOM   1203  H  HB3  . GLU A  1 79  ? -46.444 -33.029 -43.944  1.00 33.94  ? 79  GLU O HB3  1 
ATOM   1204  H  HG2  . GLU A  1 79  ? -48.303 -31.757 -42.293  1.00 50.24  ? 79  GLU O HG2  1 
ATOM   1205  H  HG3  . GLU A  1 79  ? -48.722 -32.994 -43.199  1.00 50.24  ? 79  GLU O HG3  1 
ATOM   1206  N  N    . ARG A  1 80  ? -43.641 -31.530 -44.080  1.00 26.75  ? 80  ARG O N    1 
ATOM   1207  C  CA   . ARG A  1 80  ? -42.586 -31.494 -45.097  1.00 21.36  ? 80  ARG O CA   1 
ATOM   1208  C  C    . ARG A  1 80  ? -42.811 -32.539 -46.191  1.00 31.50  ? 80  ARG O C    1 
ATOM   1209  O  O    . ARG A  1 80  ? -42.421 -32.333 -47.341  1.00 23.26  ? 80  ARG O O    1 
ATOM   1210  C  CB   . ARG A  1 80  ? -41.213 -31.713 -44.454  1.00 33.91  ? 80  ARG O CB   1 
ATOM   1211  C  CG   . ARG A  1 80  ? -40.677 -30.479 -43.751  1.00 34.05  ? 80  ARG O CG   1 
ATOM   1212  C  CD   . ARG A  1 80  ? -39.390 -30.767 -43.007  1.00 43.42  ? 80  ARG O CD   1 
ATOM   1213  N  NE   . ARG A  1 80  ? -38.872 -29.579 -42.331  1.00 49.35  ? 80  ARG O NE   1 
ATOM   1214  C  CZ   . ARG A  1 80  ? -39.394 -29.062 -41.223  1.00 60.35  ? 80  ARG O CZ   1 
ATOM   1215  N  NH1  . ARG A  1 80  ? -40.463 -29.619 -40.658  1.00 59.46  ? 80  ARG O NH1  1 
ATOM   1216  N  NH2  . ARG A  1 80  ? -38.851 -27.978 -40.683  1.00 65.05  ? 80  ARG O NH2  1 
ATOM   1217  H  H    . ARG A  1 80  ? -43.411 -31.925 -43.352  1.00 32.10  ? 80  ARG O H    1 
ATOM   1218  H  HA   . ARG A  1 80  ? -42.584 -30.619 -45.516  1.00 25.63  ? 80  ARG O HA   1 
ATOM   1219  H  HB2  . ARG A  1 80  ? -41.283 -32.424 -43.798  1.00 40.69  ? 80  ARG O HB2  1 
ATOM   1220  H  HB3  . ARG A  1 80  ? -40.579 -31.962 -45.145  1.00 40.69  ? 80  ARG O HB3  1 
ATOM   1221  H  HG2  . ARG A  1 80  ? -40.498 -29.789 -44.409  1.00 40.86  ? 80  ARG O HG2  1 
ATOM   1222  H  HG3  . ARG A  1 80  ? -41.334 -30.167 -43.109  1.00 40.86  ? 80  ARG O HG3  1 
ATOM   1223  H  HD2  . ARG A  1 80  ? -39.554 -31.449 -42.337  1.00 52.11  ? 80  ARG O HD2  1 
ATOM   1224  H  HD3  . ARG A  1 80  ? -38.719 -31.073 -43.637  1.00 52.11  ? 80  ARG O HD3  1 
ATOM   1225  H  HE   . ARG A  1 80  ? -38.186 -29.189 -42.672  1.00 59.22  ? 80  ARG O HE   1 
ATOM   1226  H  HH11 . ARG A  1 80  ? -40.817 -30.321 -41.007  1.00 71.35  ? 80  ARG O HH11 1 
ATOM   1227  H  HH12 . ARG A  1 80  ? -40.797 -29.279 -39.942  1.00 71.35  ? 80  ARG O HH12 1 
ATOM   1228  H  HH21 . ARG A  1 80  ? -38.162 -27.615 -41.048  1.00 78.06  ? 80  ARG O HH21 1 
ATOM   1229  H  HH22 . ARG A  1 80  ? -39.188 -27.639 -39.968  1.00 78.06  ? 80  ARG O HH22 1 
ATOM   1230  N  N    . ASP A  1 81  ? -43.453 -33.643 -45.820  1.00 17.14  ? 81  ASP O N    1 
ATOM   1231  C  CA   . ASP A  1 81  ? -43.638 -34.793 -46.702  1.00 21.11  ? 81  ASP O CA   1 
ATOM   1232  C  C    . ASP A  1 81  ? -45.069 -34.806 -47.251  1.00 18.90  ? 81  ASP O C    1 
ATOM   1233  O  O    . ASP A  1 81  ? -46.008 -35.078 -46.497  1.00 22.82  ? 81  ASP O O    1 
ATOM   1234  C  CB   . ASP A  1 81  ? -43.339 -36.076 -45.934  1.00 23.11  ? 81  ASP O CB   1 
ATOM   1235  C  CG   . ASP A  1 81  ? -43.495 -37.337 -46.778  1.00 31.17  ? 81  ASP O CG   1 
ATOM   1236  O  OD1  . ASP A  1 81  ? -44.043 -37.282 -47.904  1.00 36.06  ? 81  ASP O OD1  1 
ATOM   1237  O  OD2  . ASP A  1 81  ? -43.080 -38.406 -46.286  1.00 32.53  ? 81  ASP O OD2  1 
ATOM   1238  H  H    . ASP A  1 81  ? -43.800 -33.753 -45.040  1.00 20.57  ? 81  ASP O H    1 
ATOM   1239  H  HA   . ASP A  1 81  ? -43.022 -34.730 -47.449  1.00 25.33  ? 81  ASP O HA   1 
ATOM   1240  H  HB2  . ASP A  1 81  ? -42.424 -36.044 -45.613  1.00 27.74  ? 81  ASP O HB2  1 
ATOM   1241  H  HB3  . ASP A  1 81  ? -43.949 -36.142 -45.183  1.00 27.74  ? 81  ASP O HB3  1 
ATOM   1242  N  N    . PRO A  1 82  ? -45.239 -34.536 -48.564  1.00 16.47  ? 82  PRO O N    1 
ATOM   1243  C  CA   . PRO A  1 82  ? -46.577 -34.330 -49.128  1.00 18.86  ? 82  PRO O CA   1 
ATOM   1244  C  C    . PRO A  1 82  ? -47.492 -35.545 -48.980  1.00 15.99  ? 82  PRO O C    1 
ATOM   1245  O  O    . PRO A  1 82  ? -48.710 -35.375 -48.921  1.00 23.03  ? 82  PRO O O    1 
ATOM   1246  C  CB   . PRO A  1 82  ? -46.307 -34.045 -50.619  1.00 22.53  ? 82  PRO O CB   1 
ATOM   1247  C  CG   . PRO A  1 82  ? -44.886 -33.968 -50.784  1.00 27.67  ? 82  PRO O CG   1 
ATOM   1248  C  CD   . PRO A  1 82  ? -44.218 -34.599 -49.623  1.00 28.18  ? 82  PRO O CD   1 
ATOM   1249  H  HA   . PRO A  1 82  ? -46.999 -33.556 -48.723  1.00 22.64  ? 82  PRO O HA   1 
ATOM   1250  H  HB2  . PRO A  1 82  ? -46.670 -34.767 -51.155  1.00 27.04  ? 82  PRO O HB2  1 
ATOM   1251  H  HB3  . PRO A  1 82  ? -46.721 -33.202 -50.865  1.00 27.04  ? 82  PRO O HB3  1 
ATOM   1252  H  HG2  . PRO A  1 82  ? -44.639 -34.433 -51.599  1.00 33.21  ? 82  PRO O HG2  1 
ATOM   1253  H  HG3  . PRO A  1 82  ? -44.627 -33.035 -50.845  1.00 33.21  ? 82  PRO O HG3  1 
ATOM   1254  H  HD2  . PRO A  1 82  ? -43.995 -35.522 -49.823  1.00 33.82  ? 82  PRO O HD2  1 
ATOM   1255  H  HD3  . PRO A  1 82  ? -43.433 -34.091 -49.367  1.00 33.82  ? 82  PRO O HD3  1 
ATOM   1256  N  N    . SER A  1 83  ? -46.918 -36.742 -48.883  1.00 15.27  ? 83  SER O N    1 
ATOM   1257  C  CA   . SER A  1 83  ? -47.720 -37.956 -48.736  1.00 18.06  ? 83  SER O CA   1 
ATOM   1258  C  C    . SER A  1 83  ? -48.425 -38.022 -47.390  1.00 20.20  ? 83  SER O C    1 
ATOM   1259  O  O    . SER A  1 83  ? -49.351 -38.811 -47.208  1.00 28.57  ? 83  SER O O    1 
ATOM   1260  C  CB   . SER A  1 83  ? -46.846 -39.201 -48.919  1.00 24.03  ? 83  SER O CB   1 
ATOM   1261  O  OG   . SER A  1 83  ? -45.928 -39.345 -47.850  1.00 22.46  ? 83  SER O OG   1 
ATOM   1262  H  H    . SER A  1 83  ? -46.069 -36.879 -48.898  1.00 18.32  ? 83  SER O H    1 
ATOM   1263  H  HA   . SER A  1 83  ? -48.400 -37.966 -49.428  1.00 21.67  ? 83  SER O HA   1 
ATOM   1264  H  HB2  . SER A  1 83  ? -47.417 -39.984 -48.951  1.00 28.83  ? 83  SER O HB2  1 
ATOM   1265  H  HB3  . SER A  1 83  ? -46.351 -39.119 -49.749  1.00 28.83  ? 83  SER O HB3  1 
ATOM   1266  H  HG   . SER A  1 83  ? -45.425 -38.674 -47.810  1.00 26.95  ? 83  SER O HG   1 
ATOM   1267  N  N    . LYS A  1 84  ? -48.003 -37.174 -46.463  1.00 21.54  ? 84  LYS O N    1 
ATOM   1268  C  CA   . LYS A  1 84  ? -48.534 -37.183 -45.102  1.00 27.09  ? 84  LYS O CA   1 
ATOM   1269  C  C    . LYS A  1 84  ? -49.622 -36.121 -44.866  1.00 20.62  ? 84  LYS O C    1 
ATOM   1270  O  O    . LYS A  1 84  ? -50.256 -36.103 -43.821  1.00 19.99  ? 84  LYS O O    1 
ATOM   1271  C  CB   . LYS A  1 84  ? -47.389 -36.972 -44.104  1.00 26.43  ? 84  LYS O CB   1 
ATOM   1272  C  CG   . LYS A  1 84  ? -46.282 -38.027 -44.166  1.00 39.83  ? 84  LYS O CG   1 
ATOM   1273  C  CD   . LYS A  1 84  ? -46.813 -39.419 -43.861  1.00 48.96  ? 84  LYS O CD   1 
ATOM   1274  C  CE   . LYS A  1 84  ? -45.731 -40.484 -43.981  1.00 62.64  ? 84  LYS O CE   1 
ATOM   1275  N  NZ   . LYS A  1 84  ? -44.631 -40.286 -43.004  1.00 60.71  ? 84  LYS O NZ   1 
ATOM   1276  H  H    . LYS A  1 84  ? -47.402 -36.574 -46.597  1.00 25.84  ? 84  LYS O H    1 
ATOM   1277  H  HA   . LYS A  1 84  ? -48.926 -38.053 -44.925  1.00 32.51  ? 84  LYS O HA   1 
ATOM   1278  H  HB2  . LYS A  1 84  ? -46.981 -36.109 -44.279  1.00 31.71  ? 84  LYS O HB2  1 
ATOM   1279  H  HB3  . LYS A  1 84  ? -47.755 -36.983 -43.206  1.00 31.71  ? 84  LYS O HB3  1 
ATOM   1280  H  HG2  . LYS A  1 84  ? -45.900 -38.038 -45.058  1.00 47.80  ? 84  LYS O HG2  1 
ATOM   1281  H  HG3  . LYS A  1 84  ? -45.599 -37.813 -43.512  1.00 47.80  ? 84  LYS O HG3  1 
ATOM   1282  H  HD2  . LYS A  1 84  ? -47.155 -39.437 -42.953  1.00 58.75  ? 84  LYS O HD2  1 
ATOM   1283  H  HD3  . LYS A  1 84  ? -47.520 -39.635 -44.488  1.00 58.75  ? 84  LYS O HD3  1 
ATOM   1284  H  HE2  . LYS A  1 84  ? -46.124 -41.356 -43.819  1.00 75.16  ? 84  LYS O HE2  1 
ATOM   1285  H  HE3  . LYS A  1 84  ? -45.351 -40.451 -44.873  1.00 75.16  ? 84  LYS O HE3  1 
ATOM   1286  H  HZ1  . LYS A  1 84  ? -44.952 -40.318 -42.175  1.00 72.85  ? 84  LYS O HZ1  1 
ATOM   1287  H  HZ2  . LYS A  1 84  ? -44.018 -40.923 -43.103  1.00 72.85  ? 84  LYS O HZ2  1 
ATOM   1288  H  HZ3  . LYS A  1 84  ? -44.247 -39.493 -43.136  1.00 72.85  ? 84  LYS O HZ3  1 
ATOM   1289  N  N    . ILE A  1 85  ? -49.845 -35.239 -45.828  1.00 16.03  ? 85  ILE O N    1 
ATOM   1290  C  CA   . ILE A  1 85  ? -50.861 -34.200 -45.673  1.00 15.36  ? 85  ILE O CA   1 
ATOM   1291  C  C    . ILE A  1 85  ? -52.263 -34.802 -45.790  1.00 19.49  ? 85  ILE O C    1 
ATOM   1292  O  O    . ILE A  1 85  ? -52.578 -35.437 -46.790  1.00 17.60  ? 85  ILE O O    1 
ATOM   1293  C  CB   . ILE A  1 85  ? -50.728 -33.101 -46.726  1.00 16.53  ? 85  ILE O CB   1 
ATOM   1294  C  CG1  . ILE A  1 85  ? -49.300 -32.568 -46.789  1.00 19.76  ? 85  ILE O CG1  1 
ATOM   1295  C  CG2  . ILE A  1 85  ? -51.704 -31.955 -46.406  1.00 14.75  ? 85  ILE O CG2  1 
ATOM   1296  C  CD1  . ILE A  1 85  ? -49.015 -31.734 -48.009  1.00 20.52  ? 85  ILE O CD1  1 
ATOM   1297  H  H    . ILE A  1 85  ? -49.426 -35.216 -46.579  1.00 19.24  ? 85  ILE O H    1 
ATOM   1298  H  HA   . ILE A  1 85  ? -50.775 -33.795 -44.795  1.00 18.44  ? 85  ILE O HA   1 
ATOM   1299  H  HB   . ILE A  1 85  ? -50.959 -33.471 -47.592  1.00 19.83  ? 85  ILE O HB   1 
ATOM   1300  H  HG12 . ILE A  1 85  ? -49.137 -32.016 -46.008  1.00 23.71  ? 85  ILE O HG12 1 
ATOM   1301  H  HG13 . ILE A  1 85  ? -48.686 -33.319 -46.793  1.00 23.71  ? 85  ILE O HG13 1 
ATOM   1302  H  HG21 . ILE A  1 85  ? -51.610 -31.264 -47.080  1.00 17.70  ? 85  ILE O HG21 1 
ATOM   1303  H  HG22 . ILE A  1 85  ? -52.610 -32.301 -46.411  1.00 17.70  ? 85  ILE O HG22 1 
ATOM   1304  H  HG23 . ILE A  1 85  ? -51.491 -31.595 -45.531  1.00 17.70  ? 85  ILE O HG23 1 
ATOM   1305  H  HD11 . ILE A  1 85  ? -48.094 -31.434 -47.978  1.00 24.63  ? 85  ILE O HD11 1 
ATOM   1306  H  HD12 . ILE A  1 85  ? -49.161 -32.274 -48.801  1.00 24.63  ? 85  ILE O HD12 1 
ATOM   1307  H  HD13 . ILE A  1 85  ? -49.613 -30.970 -48.015  1.00 24.63  ? 85  ILE O HD13 1 
ATOM   1308  N  N    . LYS A  1 86  ? -53.111 -34.563 -44.796  1.00 14.88  ? 86  LYS O N    1 
ATOM   1309  C  CA   . LYS A  1 86  ? -54.441 -35.170 -44.763  1.00 15.44  ? 86  LYS O CA   1 
ATOM   1310  C  C    . LYS A  1 86  ? -55.485 -34.325 -45.502  1.00 14.91  ? 86  LYS O C    1 
ATOM   1311  O  O    . LYS A  1 86  ? -56.457 -33.855 -44.914  1.00 15.24  ? 86  LYS O O    1 
ATOM   1312  C  CB   . LYS A  1 86  ? -54.880 -35.389 -43.319  1.00 20.87  ? 86  LYS O CB   1 
ATOM   1313  C  CG   . LYS A  1 86  ? -53.951 -36.286 -42.515  1.00 32.65  ? 86  LYS O CG   1 
ATOM   1314  C  CD   . LYS A  1 86  ? -53.824 -37.663 -43.114  1.00 45.23  ? 86  LYS O CD   1 
ATOM   1315  C  CE   . LYS A  1 86  ? -52.927 -38.541 -42.251  1.00 61.51  ? 86  LYS O CE   1 
ATOM   1316  N  NZ   . LYS A  1 86  ? -52.682 -39.854 -42.883  1.00 64.07  ? 86  LYS O NZ   1 
ATOM   1317  H  H    . LYS A  1 86  ? -52.941 -34.053 -44.125  1.00 17.85  ? 86  LYS O H    1 
ATOM   1318  H  HA   . LYS A  1 86  ? -54.400 -36.037 -45.196  1.00 18.53  ? 86  LYS O HA   1 
ATOM   1319  H  HB2  . LYS A  1 86  ? -54.920 -34.529 -42.872  1.00 25.04  ? 86  LYS O HB2  1 
ATOM   1320  H  HB3  . LYS A  1 86  ? -55.758 -35.800 -43.319  1.00 25.04  ? 86  LYS O HB3  1 
ATOM   1321  H  HG2  . LYS A  1 86  ? -53.068 -35.886 -42.489  1.00 39.18  ? 86  LYS O HG2  1 
ATOM   1322  H  HG3  . LYS A  1 86  ? -54.301 -36.380 -41.615  1.00 39.18  ? 86  LYS O HG3  1 
ATOM   1323  H  HD2  . LYS A  1 86  ? -54.700 -38.075 -43.165  1.00 54.27  ? 86  LYS O HD2  1 
ATOM   1324  H  HD3  . LYS A  1 86  ? -53.429 -37.595 -43.998  1.00 54.27  ? 86  LYS O HD3  1 
ATOM   1325  H  HE2  . LYS A  1 86  ? -52.072 -38.100 -42.125  1.00 73.81  ? 86  LYS O HE2  1 
ATOM   1326  H  HE3  . LYS A  1 86  ? -53.356 -38.692 -41.394  1.00 73.81  ? 86  LYS O HE3  1 
ATOM   1327  H  HZ1  . LYS A  1 86  ? -53.454 -40.280 -43.006  1.00 76.89  ? 86  LYS O HZ1  1 
ATOM   1328  H  HZ2  . LYS A  1 86  ? -52.285 -39.742 -43.672  1.00 76.89  ? 86  LYS O HZ2  1 
ATOM   1329  H  HZ3  . LYS A  1 86  ? -52.157 -40.349 -42.362  1.00 76.89  ? 86  LYS O HZ3  1 
ATOM   1330  N  N    . TRP A  1 87  ? -55.273 -34.147 -46.800  1.00 14.19  ? 87  TRP O N    1 
ATOM   1331  C  CA   . TRP A  1 87  ? -56.185 -33.386 -47.635  1.00 13.76  ? 87  TRP O CA   1 
ATOM   1332  C  C    . TRP A  1 87  ? -57.625 -33.880 -47.570  1.00 18.67  ? 87  TRP O C    1 
ATOM   1333  O  O    . TRP A  1 87  ? -58.564 -33.083 -47.542  1.00 16.42  ? 87  TRP O O    1 
ATOM   1334  C  CB   . TRP A  1 87  ? -55.721 -33.432 -49.084  1.00 14.10  ? 87  TRP O CB   1 
ATOM   1335  C  CG   . TRP A  1 87  ? -54.374 -32.880 -49.350  1.00 12.46  ? 87  TRP O CG   1 
ATOM   1336  C  CD1  . TRP A  1 87  ? -53.299 -33.570 -49.855  1.00 12.37  ? 87  TRP O CD1  1 
ATOM   1337  C  CD2  . TRP A  1 87  ? -53.937 -31.521 -49.186  1.00 11.89  ? 87  TRP O CD2  1 
ATOM   1338  N  NE1  . TRP A  1 87  ? -52.231 -32.726 -50.009  1.00 12.36  ? 87  TRP O NE1  1 
ATOM   1339  C  CE2  . TRP A  1 87  ? -52.591 -31.463 -49.611  1.00 11.50  ? 87  TRP O CE2  1 
ATOM   1340  C  CE3  . TRP A  1 87  ? -54.547 -30.351 -48.716  1.00 12.11  ? 87  TRP O CE3  1 
ATOM   1341  C  CZ2  . TRP A  1 87  ? -51.843 -30.279 -49.581  1.00 11.00  ? 87  TRP O CZ2  1 
ATOM   1342  C  CZ3  . TRP A  1 87  ? -53.809 -29.181 -48.690  1.00 12.46  ? 87  TRP O CZ3  1 
ATOM   1343  C  CH2  . TRP A  1 87  ? -52.467 -29.150 -49.127  1.00 12.27  ? 87  TRP O CH2  1 
ATOM   1344  H  H    . TRP A  1 87  ? -54.596 -34.462 -47.226  1.00 17.03  ? 87  TRP O H    1 
ATOM   1345  H  HA   . TRP A  1 87  ? -56.175 -32.459 -47.348  1.00 16.51  ? 87  TRP O HA   1 
ATOM   1346  H  HB2  . TRP A  1 87  ? -55.716 -34.358 -49.373  1.00 16.91  ? 87  TRP O HB2  1 
ATOM   1347  H  HB3  . TRP A  1 87  ? -56.351 -32.929 -49.623  1.00 16.91  ? 87  TRP O HB3  1 
ATOM   1348  H  HD1  . TRP A  1 87  ? -53.300 -34.475 -50.073  1.00 14.84  ? 87  TRP O HD1  1 
ATOM   1349  H  HE1  . TRP A  1 87  ? -51.458 -32.951 -50.311  1.00 14.84  ? 87  TRP O HE1  1 
ATOM   1350  H  HE3  . TRP A  1 87  ? -55.436 -30.357 -48.443  1.00 14.53  ? 87  TRP O HE3  1 
ATOM   1351  H  HZ2  . TRP A  1 87  ? -50.955 -30.263 -49.856  1.00 13.20  ? 87  TRP O HZ2  1 
ATOM   1352  H  HZ3  . TRP A  1 87  ? -54.207 -28.397 -48.387  1.00 14.95  ? 87  TRP O HZ3  1 
ATOM   1353  H  HH2  . TRP A  1 87  ? -51.992 -28.351 -49.086  1.00 14.72  ? 87  TRP O HH2  1 
ATOM   1354  N  N    . GLY A  1 88  ? -57.790 -35.201 -47.593  1.00 15.15  ? 88  GLY O N    1 
ATOM   1355  C  CA   . GLY A  1 88  ? -59.101 -35.804 -47.585  1.00 21.16  ? 88  GLY O CA   1 
ATOM   1356  C  C    . GLY A  1 88  ? -59.868 -35.452 -46.330  1.00 18.96  ? 88  GLY O C    1 
ATOM   1357  O  O    . GLY A  1 88  ? -61.025 -35.081 -46.407  1.00 21.55  ? 88  GLY O O    1 
ATOM   1358  H  H    . GLY A  1 88  ? -57.145 -35.769 -47.613  1.00 18.17  ? 88  GLY O H    1 
ATOM   1359  H  HA2  . GLY A  1 88  ? -59.607 -35.496 -48.353  1.00 25.39  ? 88  GLY O HA2  1 
ATOM   1360  H  HA3  . GLY A  1 88  ? -59.017 -36.769 -47.636  1.00 25.39  ? 88  GLY O HA3  1 
ATOM   1361  N  N    . ASP A  1 89  ? -59.212 -35.540 -45.178  1.00 19.39  ? 89  ASP O N    1 
ATOM   1362  C  CA   . ASP A  1 89  ? -59.837 -35.143 -43.917  1.00 21.47  ? 89  ASP O CA   1 
ATOM   1363  C  C    . ASP A  1 89  ? -60.269 -33.685 -43.927  1.00 17.73  ? 89  ASP O C    1 
ATOM   1364  O  O    . ASP A  1 89  ? -61.269 -33.329 -43.307  1.00 19.13  ? 89  ASP O O    1 
ATOM   1365  C  CB   . ASP A  1 89  ? -58.891 -35.366 -42.745  1.00 19.29  ? 89  ASP O CB   1 
ATOM   1366  C  CG   . ASP A  1 89  ? -58.690 -36.842 -42.417  1.00 36.38  ? 89  ASP O CG   1 
ATOM   1367  O  OD1  . ASP A  1 89  ? -59.482 -37.689 -42.888  1.00 32.90  ? 89  ASP O OD1  1 
ATOM   1368  O  OD2  . ASP A  1 89  ? -57.734 -37.144 -41.669  1.00 30.76  ? 89  ASP O OD2  1 
ATOM   1369  H  H    . ASP A  1 89  ? -58.405 -35.827 -45.097  1.00 23.26  ? 89  ASP O H    1 
ATOM   1370  H  HA   . ASP A  1 89  ? -60.626 -35.688 -43.771  1.00 25.76  ? 89  ASP O HA   1 
ATOM   1371  H  HB2  . ASP A  1 89  ? -58.025 -34.987 -42.963  1.00 23.15  ? 89  ASP O HB2  1 
ATOM   1372  H  HB3  . ASP A  1 89  ? -59.255 -34.931 -41.959  1.00 23.15  ? 89  ASP O HB3  1 
ATOM   1373  N  N    . ALA A  1 90  ? -59.511 -32.833 -44.601  1.00 17.61  ? 90  ALA O N    1 
ATOM   1374  C  CA   . ALA A  1 90  ? -59.860 -31.412 -44.645  1.00 20.61  ? 90  ALA O CA   1 
ATOM   1375  C  C    . ALA A  1 90  ? -60.910 -31.095 -45.715  1.00 20.33  ? 90  ALA O C    1 
ATOM   1376  O  O    . ALA A  1 90  ? -61.413 -29.974 -45.779  1.00 20.13  ? 90  ALA O O    1 
ATOM   1377  C  CB   . ALA A  1 90  ? -58.615 -30.569 -44.874  1.00 14.65  ? 90  ALA O CB   1 
ATOM   1378  H  H    . ALA A  1 90  ? -58.800 -33.042 -45.037  1.00 21.13  ? 90  ALA O H    1 
ATOM   1379  H  HA   . ALA A  1 90  ? -60.232 -31.159 -43.785  1.00 24.73  ? 90  ALA O HA   1 
ATOM   1380  H  HB1  . ALA A  1 90  ? -58.868 -29.633 -44.900  1.00 17.58  ? 90  ALA O HB1  1 
ATOM   1381  H  HB2  . ALA A  1 90  ? -57.991 -30.724 -44.148  1.00 17.58  ? 90  ALA O HB2  1 
ATOM   1382  H  HB3  . ALA A  1 90  ? -58.211 -30.826 -45.718  1.00 17.58  ? 90  ALA O HB3  1 
ATOM   1383  N  N    . GLY A  1 91  ? -61.236 -32.065 -46.553  1.00 19.30  ? 91  GLY O N    1 
ATOM   1384  C  CA   . GLY A  1 91  ? -62.164 -31.835 -47.645  1.00 26.03  ? 91  GLY O CA   1 
ATOM   1385  C  C    . GLY A  1 91  ? -61.538 -31.234 -48.905  1.00 25.61  ? 91  GLY O C    1 
ATOM   1386  O  O    . GLY A  1 91  ? -62.258 -30.823 -49.803  1.00 23.49  ? 91  GLY O O    1 
ATOM   1387  H  H    . GLY A  1 91  ? -60.932 -32.868 -46.511  1.00 23.16  ? 91  GLY O H    1 
ATOM   1388  H  HA2  . GLY A  1 91  ? -62.577 -32.678 -47.890  1.00 31.24  ? 91  GLY O HA2  1 
ATOM   1389  H  HA3  . GLY A  1 91  ? -62.863 -31.234 -47.343  1.00 31.24  ? 91  GLY O HA3  1 
ATOM   1390  N  N    . ALA A  1 92  ? -60.213 -31.181 -48.997  1.00 19.67  ? 92  ALA O N    1 
ATOM   1391  C  CA   . ALA A  1 92  ? -59.567 -30.668 -50.213  1.00 13.20  ? 92  ALA O CA   1 
ATOM   1392  C  C    . ALA A  1 92  ? -59.641 -31.692 -51.346  1.00 24.20  ? 92  ALA O C    1 
ATOM   1393  O  O    . ALA A  1 92  ? -59.034 -32.759 -51.276  1.00 27.16  ? 92  ALA O O    1 
ATOM   1394  C  CB   . ALA A  1 92  ? -58.115 -30.288 -49.934  1.00 13.18  ? 92  ALA O CB   1 
ATOM   1395  H  H    . ALA A  1 92  ? -59.667 -31.431 -48.381  1.00 23.60  ? 92  ALA O H    1 
ATOM   1396  H  HA   . ALA A  1 92  ? -60.034 -29.869 -50.503  1.00 15.84  ? 92  ALA O HA   1 
ATOM   1397  H  HB1  . ALA A  1 92  ? -57.714 -29.953 -50.751  1.00 15.82  ? 92  ALA O HB1  1 
ATOM   1398  H  HB2  . ALA A  1 92  ? -58.095 -29.600 -49.250  1.00 15.82  ? 92  ALA O HB2  1 
ATOM   1399  H  HB3  . ALA A  1 92  ? -57.636 -31.074 -49.627  1.00 15.82  ? 92  ALA O HB3  1 
ATOM   1400  N  N    . GLU A  1 93  ? -60.379 -31.362 -52.398  1.00 15.85  ? 93  GLU O N    1 
ATOM   1401  C  CA   . GLU A  1 93  ? -60.536 -32.265 -53.527  1.00 13.95  ? 93  GLU O CA   1 
ATOM   1402  C  C    . GLU A  1 93  ? -59.421 -32.063 -54.564  1.00 16.17  ? 93  GLU O C    1 
ATOM   1403  O  O    . GLU A  1 93  ? -58.892 -33.037 -55.098  1.00 12.64  ? 93  GLU O O    1 
ATOM   1404  C  CB   . GLU A  1 93  ? -61.911 -32.083 -54.178  1.00 21.14  ? 93  GLU O CB   1 
ATOM   1405  C  CG   . GLU A  1 93  ? -62.106 -32.950 -55.416  1.00 32.01  ? 93  GLU O CG   1 
ATOM   1406  C  CD   . GLU A  1 93  ? -63.532 -32.927 -55.971  1.00 37.12  ? 93  GLU O CD   1 
ATOM   1407  O  OE1  . GLU A  1 93  ? -64.410 -32.248 -55.383  1.00 28.00  ? 93  GLU O OE1  1 
ATOM   1408  O  OE2  . GLU A  1 93  ? -63.760 -33.596 -57.003  1.00 29.23  ? 93  GLU O OE2  1 
ATOM   1409  H  H    . GLU A  1 93  ? -60.800 -30.617 -52.482  1.00 19.02  ? 93  GLU O H    1 
ATOM   1410  H  HA   . GLU A  1 93  ? -60.479 -33.179 -53.205  1.00 16.74  ? 93  GLU O HA   1 
ATOM   1411  H  HB2  . GLU A  1 93  ? -62.598 -32.320 -53.536  1.00 25.37  ? 93  GLU O HB2  1 
ATOM   1412  H  HB3  . GLU A  1 93  ? -62.013 -31.155 -54.444  1.00 25.37  ? 93  GLU O HB3  1 
ATOM   1413  H  HG2  . GLU A  1 93  ? -61.511 -32.635 -56.114  1.00 38.41  ? 93  GLU O HG2  1 
ATOM   1414  H  HG3  . GLU A  1 93  ? -61.890 -33.868 -55.190  1.00 38.41  ? 93  GLU O HG3  1 
ATOM   1415  N  N    . TYR A  1 94  ? -59.088 -30.804 -54.861  1.00 12.85  ? 94  TYR O N    1 
ATOM   1416  C  CA   . TYR A  1 94  ? -57.950 -30.475 -55.719  1.00 11.38  ? 94  TYR O CA   1 
ATOM   1417  C  C    . TYR A  1 94  ? -56.836 -29.883 -54.877  1.00 11.82  ? 94  TYR O C    1 
ATOM   1418  O  O    . TYR A  1 94  ? -57.102 -29.153 -53.920  1.00 15.78  ? 94  TYR O O    1 
ATOM   1419  C  CB   . TYR A  1 94  ? -58.319 -29.455 -56.816  1.00 12.15  ? 94  TYR O CB   1 
ATOM   1420  C  CG   . TYR A  1 94  ? -59.353 -29.886 -57.845  1.00 11.71  ? 94  TYR O CG   1 
ATOM   1421  C  CD1  . TYR A  1 94  ? -59.845 -31.174 -57.904  1.00 12.26  ? 94  TYR O CD1  1 
ATOM   1422  C  CD2  . TYR A  1 94  ? -59.822 -28.972 -58.780  1.00 11.74  ? 94  TYR O CD2  1 
ATOM   1423  C  CE1  . TYR A  1 94  ? -60.804 -31.534 -58.866  1.00 17.00  ? 94  TYR O CE1  1 
ATOM   1424  C  CE2  . TYR A  1 94  ? -60.754 -29.311 -59.720  1.00 14.67  ? 94  TYR O CE2  1 
ATOM   1425  C  CZ   . TYR A  1 94  ? -61.245 -30.580 -59.771  1.00 15.77  ? 94  TYR O CZ   1 
ATOM   1426  O  OH   . TYR A  1 94  ? -62.184 -30.869 -60.744  1.00 18.79  ? 94  TYR O OH   1 
ATOM   1427  H  H    . TYR A  1 94  ? -59.514 -30.114 -54.573  1.00 15.42  ? 94  TYR O H    1 
ATOM   1428  H  HA   . TYR A  1 94  ? -57.621 -31.281 -56.145  1.00 13.65  ? 94  TYR O HA   1 
ATOM   1429  H  HB2  . TYR A  1 94  ? -58.664 -28.658 -56.383  1.00 14.58  ? 94  TYR O HB2  1 
ATOM   1430  H  HB3  . TYR A  1 94  ? -57.510 -29.229 -57.302  1.00 14.58  ? 94  TYR O HB3  1 
ATOM   1431  H  HD1  . TYR A  1 94  ? -59.549 -31.807 -57.291  1.00 14.72  ? 94  TYR O HD1  1 
ATOM   1432  H  HD2  . TYR A  1 94  ? -59.502 -28.099 -58.757  1.00 14.09  ? 94  TYR O HD2  1 
ATOM   1433  H  HE1  . TYR A  1 94  ? -61.135 -32.402 -58.898  1.00 20.40  ? 94  TYR O HE1  1 
ATOM   1434  H  HE2  . TYR A  1 94  ? -61.051 -28.674 -60.329  1.00 17.61  ? 94  TYR O HE2  1 
ATOM   1435  H  HH   . TYR A  1 94  ? -62.419 -31.673 -60.687  1.00 22.55  ? 94  TYR O HH   1 
ATOM   1436  N  N    . VAL A  1 95  ? -55.598 -30.188 -55.236  1.00 10.53  ? 95  VAL O N    1 
ATOM   1437  C  CA   . VAL A  1 95  ? -54.454 -29.605 -54.567  1.00 10.16  ? 95  VAL O CA   1 
ATOM   1438  C  C    . VAL A  1 95  ? -53.605 -28.854 -55.586  1.00 11.45  ? 95  VAL O C    1 
ATOM   1439  O  O    . VAL A  1 95  ? -53.242 -29.400 -56.636  1.00 11.73  ? 95  VAL O O    1 
ATOM   1440  C  CB   . VAL A  1 95  ? -53.608 -30.687 -53.850  1.00 13.81  ? 95  VAL O CB   1 
ATOM   1441  C  CG1  . VAL A  1 95  ? -52.264 -30.119 -53.374  1.00 10.08  ? 95  VAL O CG1  1 
ATOM   1442  C  CG2  . VAL A  1 95  ? -54.392 -31.281 -52.683  1.00 13.50  ? 95  VAL O CG2  1 
ATOM   1443  H  H    . VAL A  1 95  ? -55.395 -30.734 -55.868  1.00 12.64  ? 95  VAL O H    1 
ATOM   1444  H  HA   . VAL A  1 95  ? -54.763 -28.970 -53.902  1.00 12.19  ? 95  VAL O HA   1 
ATOM   1445  H  HB   . VAL A  1 95  ? -53.422 -31.403 -54.477  1.00 16.57  ? 95  VAL O HB   1 
ATOM   1446  H  HG11 . VAL A  1 95  ? -51.764 -30.823 -52.932  1.00 12.09  ? 95  VAL O HG11 1 
ATOM   1447  H  HG12 . VAL A  1 95  ? -51.769 -29.793 -54.142  1.00 12.09  ? 95  VAL O HG12 1 
ATOM   1448  H  HG13 . VAL A  1 95  ? -52.431 -29.391 -52.755  1.00 12.09  ? 95  VAL O HG13 1 
ATOM   1449  H  HG21 . VAL A  1 95  ? -53.846 -31.955 -52.248  1.00 16.20  ? 95  VAL O HG21 1 
ATOM   1450  H  HG22 . VAL A  1 95  ? -54.608 -30.574 -52.056  1.00 16.20  ? 95  VAL O HG22 1 
ATOM   1451  H  HG23 . VAL A  1 95  ? -55.206 -31.684 -53.023  1.00 16.20  ? 95  VAL O HG23 1 
ATOM   1452  N  N    . VAL A  1 96  ? -53.318 -27.596 -55.267  1.00 9.36   ? 96  VAL O N    1 
ATOM   1453  C  CA   . VAL A  1 96  ? -52.338 -26.794 -55.998  1.00 9.96   ? 96  VAL O CA   1 
ATOM   1454  C  C    . VAL A  1 96  ? -50.963 -27.075 -55.410  1.00 13.48  ? 96  VAL O C    1 
ATOM   1455  O  O    . VAL A  1 96  ? -50.713 -26.815 -54.240  1.00 13.05  ? 96  VAL O O    1 
ATOM   1456  C  CB   . VAL A  1 96  ? -52.636 -25.281 -55.913  1.00 10.17  ? 96  VAL O CB   1 
ATOM   1457  C  CG1  . VAL A  1 96  ? -51.527 -24.456 -56.606  1.00 14.26  ? 96  VAL O CG1  1 
ATOM   1458  C  CG2  . VAL A  1 96  ? -54.004 -24.961 -56.505  1.00 12.53  ? 96  VAL O CG2  1 
ATOM   1459  H  H    . VAL A  1 96  ? -53.687 -27.173 -54.615  1.00 11.23  ? 96  VAL O H    1 
ATOM   1460  H  HA   . VAL A  1 96  ? -52.335 -27.056 -56.932  1.00 11.95  ? 96  VAL O HA   1 
ATOM   1461  H  HB   . VAL A  1 96  ? -52.654 -25.021 -54.978  1.00 12.20  ? 96  VAL O HB   1 
ATOM   1462  H  HG11 . VAL A  1 96  ? -51.744 -23.513 -56.534  1.00 17.11  ? 96  VAL O HG11 1 
ATOM   1463  H  HG12 . VAL A  1 96  ? -50.681 -24.635 -56.168  1.00 17.11  ? 96  VAL O HG12 1 
ATOM   1464  H  HG13 . VAL A  1 96  ? -51.479 -24.715 -57.539  1.00 17.11  ? 96  VAL O HG13 1 
ATOM   1465  H  HG21 . VAL A  1 96  ? -54.163 -24.007 -56.437  1.00 15.03  ? 96  VAL O HG21 1 
ATOM   1466  H  HG22 . VAL A  1 96  ? -54.016 -25.233 -57.436  1.00 15.03  ? 96  VAL O HG22 1 
ATOM   1467  H  HG23 . VAL A  1 96  ? -54.683 -25.446 -56.010  1.00 15.03  ? 96  VAL O HG23 1 
ATOM   1468  N  N    . GLU A  1 97  ? -50.081 -27.618 -56.236  1.00 10.97  ? 97  GLU O N    1 
ATOM   1469  C  CA   . GLU A  1 97  ? -48.727 -27.926 -55.830  1.00 9.23   ? 97  GLU O CA   1 
ATOM   1470  C  C    . GLU A  1 97  ? -47.833 -26.760 -56.243  1.00 11.75  ? 97  GLU O C    1 
ATOM   1471  O  O    . GLU A  1 97  ? -47.381 -26.651 -57.380  1.00 10.56  ? 97  GLU O O    1 
ATOM   1472  C  CB   . GLU A  1 97  ? -48.293 -29.256 -56.447  1.00 12.40  ? 97  GLU O CB   1 
ATOM   1473  C  CG   . GLU A  1 97  ? -46.856 -29.631 -56.239  1.00 17.40  ? 97  GLU O CG   1 
ATOM   1474  C  CD   . GLU A  1 97  ? -46.378 -29.351 -54.838  1.00 27.64  ? 97  GLU O CD   1 
ATOM   1475  O  OE1  . GLU A  1 97  ? -46.927 -29.941 -53.862  1.00 16.28  ? 97  GLU O OE1  1 
ATOM   1476  O  OE2  . GLU A  1 97  ? -45.443 -28.532 -54.735  1.00 18.20  ? 97  GLU O OE2  1 
ATOM   1477  H  H    . GLU A  1 97  ? -50.251 -27.820 -57.054  1.00 13.17  ? 97  GLU O H    1 
ATOM   1478  H  HA   . GLU A  1 97  ? -48.692 -28.011 -54.864  1.00 11.07  ? 97  GLU O HA   1 
ATOM   1479  H  HB2  . GLU A  1 97  ? -48.836 -29.963 -56.064  1.00 14.89  ? 97  GLU O HB2  1 
ATOM   1480  H  HB3  . GLU A  1 97  ? -48.446 -29.214 -57.404  1.00 14.89  ? 97  GLU O HB3  1 
ATOM   1481  H  HG2  . GLU A  1 97  ? -46.749 -30.580 -56.409  1.00 20.88  ? 97  GLU O HG2  1 
ATOM   1482  H  HG3  . GLU A  1 97  ? -46.304 -29.121 -56.852  1.00 20.88  ? 97  GLU O HG3  1 
ATOM   1483  N  N    . SER A  1 98  ? -47.599 -25.866 -55.294  1.00 8.99   ? 98  SER O N    1 
ATOM   1484  C  CA   . SER A  1 98  ? -46.892 -24.629 -55.576  1.00 13.86  ? 98  SER O CA   1 
ATOM   1485  C  C    . SER A  1 98  ? -45.658 -24.429 -54.696  1.00 15.67  ? 98  SER O C    1 
ATOM   1486  O  O    . SER A  1 98  ? -45.320 -23.290 -54.326  1.00 15.71  ? 98  SER O O    1 
ATOM   1487  C  CB   . SER A  1 98  ? -47.862 -23.453 -55.425  1.00 17.03  ? 98  SER O CB   1 
ATOM   1488  O  OG   . SER A  1 98  ? -48.421 -23.410 -54.127  1.00 21.05  ? 98  SER O OG   1 
ATOM   1489  H  H    . SER A  1 98  ? -47.842 -25.953 -54.473  1.00 10.78  ? 98  SER O H    1 
ATOM   1490  H  HA   . SER A  1 98  ? -46.593 -24.648 -56.499  1.00 16.63  ? 98  SER O HA   1 
ATOM   1491  H  HB2  . SER A  1 98  ? -47.382 -22.626 -55.588  1.00 20.44  ? 98  SER O HB2  1 
ATOM   1492  H  HB3  . SER A  1 98  ? -48.578 -23.551 -56.072  1.00 20.44  ? 98  SER O HB3  1 
ATOM   1493  H  HG   . SER A  1 98  ? -48.842 -24.120 -53.972  1.00 25.26  ? 98  SER O HG   1 
ATOM   1494  N  N    . THR A  1 99  ? -44.981 -25.527 -54.350  1.00 13.53  ? 99  THR O N    1 
ATOM   1495  C  CA   . THR A  1 99  ? -43.750 -25.420 -53.579  1.00 10.13  ? 99  THR O CA   1 
ATOM   1496  C  C    . THR A  1 99  ? -42.556 -25.242 -54.503  1.00 16.43  ? 99  THR O C    1 
ATOM   1497  O  O    . THR A  1 99  ? -41.526 -24.754 -54.079  1.00 20.41  ? 99  THR O O    1 
ATOM   1498  C  CB   . THR A  1 99  ? -43.466 -26.661 -52.697  1.00 13.41  ? 99  THR O CB   1 
ATOM   1499  O  OG1  . THR A  1 99  ? -43.170 -27.774 -53.541  1.00 13.80  ? 99  THR O OG1  1 
ATOM   1500  C  CG2  . THR A  1 99  ? -44.645 -26.975 -51.780  1.00 11.79  ? 99  THR O CG2  1 
ATOM   1501  H  H    . THR A  1 99  ? -45.211 -26.331 -54.548  1.00 16.24  ? 99  THR O H    1 
ATOM   1502  H  HA   . THR A  1 99  ? -43.804 -24.644 -53.001  1.00 12.15  ? 99  THR O HA   1 
ATOM   1503  H  HB   . THR A  1 99  ? -42.694 -26.478 -52.137  1.00 16.09  ? 99  THR O HB   1 
ATOM   1504  H  HG1  . THR A  1 99  ? -43.823 -27.933 -54.045  1.00 16.57  ? 99  THR O HG1  1 
ATOM   1505  H  HG21 . THR A  1 99  ? -44.445 -27.754 -51.237  1.00 14.14  ? 99  THR O HG21 1 
ATOM   1506  H  HG22 . THR A  1 99  ? -44.821 -26.221 -51.196  1.00 14.14  ? 99  THR O HG22 1 
ATOM   1507  H  HG23 . THR A  1 99  ? -45.438 -27.155 -52.310  1.00 14.14  ? 99  THR O HG23 1 
ATOM   1508  N  N    . GLY A  1 100 ? -42.689 -25.686 -55.748  1.00 16.93  ? 100 GLY O N    1 
ATOM   1509  C  CA   . GLY A  1 100 ? -41.574 -25.722 -56.672  1.00 20.56  ? 100 GLY O CA   1 
ATOM   1510  C  C    . GLY A  1 100 ? -40.671 -26.952 -56.609  1.00 25.19  ? 100 GLY O C    1 
ATOM   1511  O  O    . GLY A  1 100 ? -39.781 -27.102 -57.440  1.00 19.31  ? 100 GLY O O    1 
ATOM   1512  H  H    . GLY A  1 100 ? -43.427 -25.976 -56.081  1.00 20.32  ? 100 GLY O H    1 
ATOM   1513  H  HA2  . GLY A  1 100 ? -41.920 -25.660 -57.576  1.00 24.67  ? 100 GLY O HA2  1 
ATOM   1514  H  HA3  . GLY A  1 100 ? -41.017 -24.943 -56.515  1.00 24.67  ? 100 GLY O HA3  1 
ATOM   1515  N  N    . VAL A  1 101 ? -40.889 -27.855 -55.657  1.00 17.47  ? 101 VAL O N    1 
ATOM   1516  C  CA   . VAL A  1 101 ? -39.946 -28.959 -55.494  1.00 18.35  ? 101 VAL O CA   1 
ATOM   1517  C  C    . VAL A  1 101 ? -40.572 -30.310 -55.807  1.00 22.41  ? 101 VAL O C    1 
ATOM   1518  O  O    . VAL A  1 101 ? -39.871 -31.319 -55.829  1.00 21.81  ? 101 VAL O O    1 
ATOM   1519  C  CB   . VAL A  1 101 ? -39.339 -28.973 -54.068  1.00 31.92  ? 101 VAL O CB   1 
ATOM   1520  C  CG1  . VAL A  1 101 ? -38.736 -27.608 -53.743  1.00 37.88  ? 101 VAL O CG1  1 
ATOM   1521  C  CG2  . VAL A  1 101 ? -40.354 -29.336 -53.028  1.00 30.04  ? 101 VAL O CG2  1 
ATOM   1522  H  H    . VAL A  1 101 ? -41.552 -27.855 -55.109  1.00 20.97  ? 101 VAL O H    1 
ATOM   1523  H  HA   . VAL A  1 101 ? -39.215 -28.829 -56.118  1.00 22.02  ? 101 VAL O HA   1 
ATOM   1524  H  HB   . VAL A  1 101 ? -38.627 -29.630 -54.034  1.00 38.31  ? 101 VAL O HB   1 
ATOM   1525  H  HG11 . VAL A  1 101 ? -38.361 -27.634 -52.849  1.00 45.46  ? 101 VAL O HG11 1 
ATOM   1526  H  HG12 . VAL A  1 101 ? -38.040 -27.410 -54.389  1.00 45.46  ? 101 VAL O HG12 1 
ATOM   1527  H  HG13 . VAL A  1 101 ? -39.434 -26.936 -53.791  1.00 45.46  ? 101 VAL O HG13 1 
ATOM   1528  H  HG21 . VAL A  1 101 ? -39.928 -29.331 -52.157  1.00 36.05  ? 101 VAL O HG21 1 
ATOM   1529  H  HG22 . VAL A  1 101 ? -41.073 -28.686 -53.049  1.00 36.05  ? 101 VAL O HG22 1 
ATOM   1530  H  HG23 . VAL A  1 101 ? -40.701 -30.221 -53.222  1.00 36.05  ? 101 VAL O HG23 1 
ATOM   1531  N  N    . PHE A  1 102 ? -41.875 -30.329 -56.087  1.00 19.53  ? 102 PHE O N    1 
ATOM   1532  C  CA   . PHE A  1 102 ? -42.554 -31.579 -56.450  1.00 15.18  ? 102 PHE O CA   1 
ATOM   1533  C  C    . PHE A  1 102 ? -43.234 -31.483 -57.811  1.00 21.02  ? 102 PHE O C    1 
ATOM   1534  O  O    . PHE A  1 102 ? -44.457 -31.537 -57.891  1.00 22.28  ? 102 PHE O O    1 
ATOM   1535  C  CB   . PHE A  1 102 ? -43.582 -31.936 -55.382  1.00 15.13  ? 102 PHE O CB   1 
ATOM   1536  C  CG   . PHE A  1 102 ? -43.030 -31.943 -53.982  1.00 15.44  ? 102 PHE O CG   1 
ATOM   1537  C  CD1  . PHE A  1 102 ? -41.994 -32.798 -53.628  1.00 19.76  ? 102 PHE O CD1  1 
ATOM   1538  C  CD2  . PHE A  1 102 ? -43.564 -31.098 -53.009  1.00 18.19  ? 102 PHE O CD2  1 
ATOM   1539  C  CE1  . PHE A  1 102 ? -41.496 -32.808 -52.325  1.00 24.46  ? 102 PHE O CE1  1 
ATOM   1540  C  CE2  . PHE A  1 102 ? -43.061 -31.105 -51.710  1.00 20.28  ? 102 PHE O CE2  1 
ATOM   1541  C  CZ   . PHE A  1 102 ? -42.029 -31.956 -51.372  1.00 21.44  ? 102 PHE O CZ   1 
ATOM   1542  H  H    . PHE A  1 102 ? -42.387 -29.639 -56.075  1.00 23.43  ? 102 PHE O H    1 
ATOM   1543  H  HA   . PHE A  1 102 ? -41.901 -32.294 -56.491  1.00 18.21  ? 102 PHE O HA   1 
ATOM   1544  H  HB2  . PHE A  1 102 ? -44.303 -31.288 -55.413  1.00 18.16  ? 102 PHE O HB2  1 
ATOM   1545  H  HB3  . PHE A  1 102 ? -43.929 -32.823 -55.567  1.00 18.16  ? 102 PHE O HB3  1 
ATOM   1546  H  HD1  . PHE A  1 102 ? -41.631 -33.371 -54.265  1.00 23.71  ? 102 PHE O HD1  1 
ATOM   1547  H  HD2  . PHE A  1 102 ? -44.258 -30.521 -53.231  1.00 21.83  ? 102 PHE O HD2  1 
ATOM   1548  H  HE1  . PHE A  1 102 ? -40.799 -33.381 -52.099  1.00 29.36  ? 102 PHE O HE1  1 
ATOM   1549  H  HE2  . PHE A  1 102 ? -43.422 -30.535 -51.070  1.00 24.33  ? 102 PHE O HE2  1 
ATOM   1550  H  HZ   . PHE A  1 102 ? -41.695 -31.962 -50.504  1.00 25.73  ? 102 PHE O HZ   1 
ATOM   1551  N  N    . THR A  1 103 ? -42.451 -31.361 -58.884  1.00 13.82  ? 103 THR O N    1 
ATOM   1552  C  CA   . THR A  1 103 ? -43.030 -31.062 -60.193  1.00 16.67  ? 103 THR O CA   1 
ATOM   1553  C  C    . THR A  1 103 ? -43.132 -32.234 -61.171  1.00 18.51  ? 103 THR O C    1 
ATOM   1554  O  O    . THR A  1 103 ? -43.661 -32.054 -62.262  1.00 18.67  ? 103 THR O O    1 
ATOM   1555  C  CB   . THR A  1 103 ? -42.246 -29.966 -60.899  1.00 17.16  ? 103 THR O CB   1 
ATOM   1556  O  OG1  . THR A  1 103 ? -40.934 -30.445 -61.193  1.00 20.06  ? 103 THR O OG1  1 
ATOM   1557  C  CG2  . THR A  1 103 ? -42.178 -28.722 -60.025  1.00 19.82  ? 103 THR O CG2  1 
ATOM   1558  H  H    . THR A  1 103 ? -41.595 -31.444 -58.881  1.00 16.58  ? 103 THR O H    1 
ATOM   1559  H  HA   . THR A  1 103 ? -43.929 -30.728 -60.054  1.00 20.00  ? 103 THR O HA   1 
ATOM   1560  H  HB   . THR A  1 103 ? -42.695 -29.733 -61.726  1.00 20.59  ? 103 THR O HB   1 
ATOM   1561  H  HG1  . THR A  1 103 ? -40.491 -29.848 -61.583  1.00 24.07  ? 103 THR O HG1  1 
ATOM   1562  H  HG21 . THR A  1 103 ? -41.677 -28.026 -60.479  1.00 23.78  ? 103 THR O HG21 1 
ATOM   1563  H  HG22 . THR A  1 103 ? -43.073 -28.397 -59.841  1.00 23.78  ? 103 THR O HG22 1 
ATOM   1564  H  HG23 . THR A  1 103 ? -41.738 -28.930 -59.186  1.00 23.78  ? 103 THR O HG23 1 
ATOM   1565  N  N    . THR A  1 104 ? -42.624 -33.412 -60.822  1.00 14.14  ? 104 THR O N    1 
ATOM   1566  C  CA   . THR A  1 104 ? -42.876 -34.603 -61.642  1.00 11.71  ? 104 THR O CA   1 
ATOM   1567  C  C    . THR A  1 104 ? -44.201 -35.260 -61.230  1.00 15.80  ? 104 THR O C    1 
ATOM   1568  O  O    . THR A  1 104 ? -44.711 -35.021 -60.139  1.00 14.97  ? 104 THR O O    1 
ATOM   1569  C  CB   . THR A  1 104 ? -41.776 -35.661 -61.510  1.00 22.50  ? 104 THR O CB   1 
ATOM   1570  O  OG1  . THR A  1 104 ? -41.734 -36.109 -60.155  1.00 21.29  ? 104 THR O OG1  1 
ATOM   1571  C  CG2  . THR A  1 104 ? -40.422 -35.106 -61.913  1.00 23.79  ? 104 THR O CG2  1 
ATOM   1572  H  H    . THR A  1 104 ? -42.137 -33.552 -60.127  1.00 16.96  ? 104 THR O H    1 
ATOM   1573  H  HA   . THR A  1 104 ? -42.941 -34.343 -62.574  1.00 14.05  ? 104 THR O HA   1 
ATOM   1574  H  HB   . THR A  1 104 ? -41.982 -36.411 -62.089  1.00 26.99  ? 104 THR O HB   1 
ATOM   1575  H  HG1  . THR A  1 104 ? -41.136 -36.690 -60.063  1.00 25.55  ? 104 THR O HG1  1 
ATOM   1576  H  HG21 . THR A  1 104 ? -39.743 -35.792 -61.821  1.00 28.55  ? 104 THR O HG21 1 
ATOM   1577  H  HG22 . THR A  1 104 ? -40.448 -34.808 -62.836  1.00 28.55  ? 104 THR O HG22 1 
ATOM   1578  H  HG23 . THR A  1 104 ? -40.190 -34.354 -61.345  1.00 28.55  ? 104 THR O HG23 1 
ATOM   1579  N  N    . MET A  1 105 ? -44.760 -36.102 -62.089  1.00 16.55  ? 105 MET O N    1 
ATOM   1580  C  CA   . MET A  1 105 ? -46.019 -36.758 -61.751  1.00 20.54  ? 105 MET O CA   1 
ATOM   1581  C  C    . MET A  1 105 ? -45.799 -37.654 -60.540  1.00 17.76  ? 105 MET O C    1 
ATOM   1582  O  O    . MET A  1 105 ? -46.639 -37.744 -59.665  1.00 17.84  ? 105 MET O O    1 
ATOM   1583  C  CB   . MET A  1 105 ? -46.558 -37.559 -62.937  1.00 16.14  ? 105 MET O CB   1 
ATOM   1584  C  CG   . MET A  1 105 ? -47.209 -36.682 -63.986  1.00 17.26  ? 105 MET O CG   1 
ATOM   1585  S  SD   . MET A  1 105 ? -48.180 -37.649 -65.149  1.00 31.35  ? 105 MET O SD   1 
ATOM   1586  C  CE   . MET A  1 105 ? -49.771 -36.906 -65.036  1.00 40.50  ? 105 MET O CE   1 
ATOM   1587  H  H    . MET A  1 105 ? -44.440 -36.308 -62.861  1.00 19.87  ? 105 MET O H    1 
ATOM   1588  H  HA   . MET A  1 105 ? -46.676 -36.081 -61.526  1.00 24.64  ? 105 MET O HA   1 
ATOM   1589  H  HB2  . MET A  1 105 ? -45.825 -38.035 -63.357  1.00 19.37  ? 105 MET O HB2  1 
ATOM   1590  H  HB3  . MET A  1 105 ? -47.223 -38.189 -62.617  1.00 19.37  ? 105 MET O HB3  1 
ATOM   1591  H  HG2  . MET A  1 105 ? -47.801 -36.048 -63.550  1.00 20.71  ? 105 MET O HG2  1 
ATOM   1592  H  HG3  . MET A  1 105 ? -46.521 -36.212 -64.482  1.00 20.71  ? 105 MET O HG3  1 
ATOM   1593  H  HE1  . MET A  1 105 ? -50.377 -37.365 -65.638  1.00 48.60  ? 105 MET O HE1  1 
ATOM   1594  H  HE2  . MET A  1 105 ? -50.089 -36.981 -64.123  1.00 48.60  ? 105 MET O HE2  1 
ATOM   1595  H  HE3  . MET A  1 105 ? -49.701 -35.971 -65.287  1.00 48.60  ? 105 MET O HE3  1 
ATOM   1596  N  N    . GLU A  1 106 ? -44.627 -38.269 -60.468  1.00 16.11  ? 106 GLU O N    1 
ATOM   1597  C  CA   . GLU A  1 106 ? -44.299 -39.118 -59.334  1.00 18.49  ? 106 GLU O CA   1 
ATOM   1598  C  C    . GLU A  1 106 ? -44.306 -38.369 -57.999  1.00 18.19  ? 106 GLU O C    1 
ATOM   1599  O  O    . GLU A  1 106 ? -44.867 -38.846 -57.023  1.00 19.23  ? 106 GLU O O    1 
ATOM   1600  C  CB   . GLU A  1 106 ? -42.930 -39.765 -59.536  1.00 24.93  ? 106 GLU O CB   1 
ATOM   1601  C  CG   . GLU A  1 106 ? -42.440 -40.504 -58.301  1.00 26.76  ? 106 GLU O CG   1 
ATOM   1602  C  CD   . GLU A  1 106 ? -41.173 -41.287 -58.566  1.00 41.34  ? 106 GLU O CD   1 
ATOM   1603  O  OE1  . GLU A  1 106 ? -40.110 -40.651 -58.739  1.00 50.67  ? 106 GLU O OE1  1 
ATOM   1604  O  OE2  . GLU A  1 106 ? -41.244 -42.535 -58.605  1.00 41.98  ? 106 GLU O OE2  1 
ATOM   1605  H  H    . GLU A  1 106 ? -44.006 -38.211 -61.060  1.00 19.33  ? 106 GLU O H    1 
ATOM   1606  H  HA   . GLU A  1 106 ? -44.957 -39.829 -59.277  1.00 22.19  ? 106 GLU O HA   1 
ATOM   1607  H  HB2  . GLU A  1 106 ? -42.987 -40.403 -60.265  1.00 29.92  ? 106 GLU O HB2  1 
ATOM   1608  H  HB3  . GLU A  1 106 ? -42.283 -39.075 -59.749  1.00 29.92  ? 106 GLU O HB3  1 
ATOM   1609  H  HG2  . GLU A  1 106 ? -42.256 -39.861 -57.599  1.00 32.11  ? 106 GLU O HG2  1 
ATOM   1610  H  HG3  . GLU A  1 106 ? -43.125 -41.127 -58.012  1.00 32.11  ? 106 GLU O HG3  1 
ATOM   1611  N  N    . LYS A  1 107 ? -43.649 -37.218 -57.945  1.00 13.13  ? 107 LYS O N    1 
ATOM   1612  C  CA   . LYS A  1 107 ? -43.556 -36.462 -56.699  1.00 17.46  ? 107 LYS O CA   1 
ATOM   1613  C  C    . LYS A  1 107 ? -44.883 -35.758 -56.348  1.00 15.49  ? 107 LYS O C    1 
ATOM   1614  O  O    . LYS A  1 107 ? -45.303 -35.738 -55.195  1.00 15.08  ? 107 LYS O O    1 
ATOM   1615  C  CB   . LYS A  1 107 ? -42.420 -35.444 -56.790  1.00 21.83  ? 107 LYS O CB   1 
ATOM   1616  C  CG   . LYS A  1 107 ? -41.024 -36.081 -56.807  1.00 28.65  ? 107 LYS O CG   1 
ATOM   1617  C  CD   . LYS A  1 107 ? -39.931 -35.016 -56.864  1.00 54.70  ? 107 LYS O CD   1 
ATOM   1618  C  CE   . LYS A  1 107 ? -38.538 -35.614 -56.654  1.00 66.86  ? 107 LYS O CE   1 
ATOM   1619  N  NZ   . LYS A  1 107 ? -37.451 -34.619 -56.895  1.00 65.55  ? 107 LYS O NZ   1 
ATOM   1620  H  H    . LYS A  1 107 ? -43.249 -36.852 -58.612  1.00 15.75  ? 107 LYS O H    1 
ATOM   1621  H  HA   . LYS A  1 107 ? -43.347 -37.076 -55.977  1.00 20.95  ? 107 LYS O HA   1 
ATOM   1622  H  HB2  . LYS A  1 107 ? -42.523 -34.932 -57.608  1.00 26.19  ? 107 LYS O HB2  1 
ATOM   1623  H  HB3  . LYS A  1 107 ? -42.467 -34.852 -56.023  1.00 26.19  ? 107 LYS O HB3  1 
ATOM   1624  H  HG2  . LYS A  1 107 ? -40.899 -36.602 -55.998  1.00 34.38  ? 107 LYS O HG2  1 
ATOM   1625  H  HG3  . LYS A  1 107 ? -40.939 -36.648 -57.589  1.00 34.38  ? 107 LYS O HG3  1 
ATOM   1626  H  HD2  . LYS A  1 107 ? -39.949 -34.589 -57.735  1.00 65.64  ? 107 LYS O HD2  1 
ATOM   1627  H  HD3  . LYS A  1 107 ? -40.088 -34.361 -56.167  1.00 65.64  ? 107 LYS O HD3  1 
ATOM   1628  H  HE2  . LYS A  1 107 ? -38.462 -35.928 -55.739  1.00 80.23  ? 107 LYS O HE2  1 
ATOM   1629  H  HE3  . LYS A  1 107 ? -38.413 -36.352 -57.271  1.00 80.23  ? 107 LYS O HE3  1 
ATOM   1630  H  HZ1  . LYS A  1 107 ? -37.539 -33.932 -56.336  1.00 78.66  ? 107 LYS O HZ1  1 
ATOM   1631  H  HZ2  . LYS A  1 107 ? -36.657 -34.999 -56.765  1.00 78.66  ? 107 LYS O HZ2  1 
ATOM   1632  H  HZ3  . LYS A  1 107 ? -37.494 -34.319 -57.732  1.00 78.66  ? 107 LYS O HZ3  1 
ATOM   1633  N  N    . ALA A  1 108 ? -45.530 -35.191 -57.350  1.00 13.40  ? 108 ALA O N    1 
ATOM   1634  C  CA   . ALA A  1 108 ? -46.806 -34.514 -57.153  1.00 15.12  ? 108 ALA O CA   1 
ATOM   1635  C  C    . ALA A  1 108 ? -47.900 -35.524 -56.796  1.00 14.49  ? 108 ALA O C    1 
ATOM   1636  O  O    . ALA A  1 108 ? -48.849 -35.180 -56.118  1.00 14.26  ? 108 ALA O O    1 
ATOM   1637  C  CB   . ALA A  1 108 ? -47.184 -33.732 -58.395  1.00 17.46  ? 108 ALA O CB   1 
ATOM   1638  H  H    . ALA A  1 108 ? -45.252 -35.183 -58.164  1.00 16.08  ? 108 ALA O H    1 
ATOM   1639  H  HA   . ALA A  1 108 ? -46.722 -33.888 -56.417  1.00 18.14  ? 108 ALA O HA   1 
ATOM   1640  H  HB1  . ALA A  1 108 ? -48.034 -33.290 -58.243  1.00 20.95  ? 108 ALA O HB1  1 
ATOM   1641  H  HB2  . ALA A  1 108 ? -46.495 -33.072 -58.575  1.00 20.95  ? 108 ALA O HB2  1 
ATOM   1642  H  HB3  . ALA A  1 108 ? -47.258 -34.345 -59.143  1.00 20.95  ? 108 ALA O HB3  1 
ATOM   1643  N  N    . GLY A  1 109 ? -47.739 -36.770 -57.235  1.00 14.74  ? 109 GLY O N    1 
ATOM   1644  C  CA   . GLY A  1 109 ? -48.720 -37.813 -56.982  1.00 15.79  ? 109 GLY O CA   1 
ATOM   1645  C  C    . GLY A  1 109 ? -48.818 -38.224 -55.520  1.00 17.71  ? 109 GLY O C    1 
ATOM   1646  O  O    . GLY A  1 109 ? -49.776 -38.884 -55.115  1.00 19.27  ? 109 GLY O O    1 
ATOM   1647  H  H    . GLY A  1 109 ? -47.059 -37.037 -57.689  1.00 17.69  ? 109 GLY O H    1 
ATOM   1648  H  HA2  . GLY A  1 109 ? -49.593 -37.505 -57.269  1.00 18.95  ? 109 GLY O HA2  1 
ATOM   1649  H  HA3  . GLY A  1 109 ? -48.489 -38.599 -57.502  1.00 18.95  ? 109 GLY O HA3  1 
ATOM   1650  N  N    . ALA A  1 110 ? -47.827 -37.833 -54.721  1.00 16.32  ? 110 ALA O N    1 
ATOM   1651  C  CA   . ALA A  1 110 ? -47.849 -38.095 -53.291  1.00 14.55  ? 110 ALA O CA   1 
ATOM   1652  C  C    . ALA A  1 110 ? -49.116 -37.523 -52.649  1.00 16.80  ? 110 ALA O C    1 
ATOM   1653  O  O    . ALA A  1 110 ? -49.613 -38.067 -51.673  1.00 17.28  ? 110 ALA O O    1 
ATOM   1654  C  CB   . ALA A  1 110 ? -46.618 -37.504 -52.610  1.00 19.47  ? 110 ALA O CB   1 
ATOM   1655  H  H    . ALA A  1 110 ? -47.128 -37.411 -54.989  1.00 19.59  ? 110 ALA O H    1 
ATOM   1656  H  HA   . ALA A  1 110 ? -47.843 -39.054 -53.144  1.00 17.46  ? 110 ALA O HA   1 
ATOM   1657  H  HB1  . ALA A  1 110 ? -46.661 -37.694 -51.660  1.00 23.36  ? 110 ALA O HB1  1 
ATOM   1658  H  HB2  . ALA A  1 110 ? -45.822 -37.905 -52.993  1.00 23.36  ? 110 ALA O HB2  1 
ATOM   1659  H  HB3  . ALA A  1 110 ? -46.608 -36.545 -52.756  1.00 23.36  ? 110 ALA O HB3  1 
ATOM   1660  N  N    . HIS A  1 111 ? -49.620 -36.414 -53.183  1.00 12.41  ? 111 HIS O N    1 
ATOM   1661  C  CA   . HIS A  1 111 ? -50.816 -35.795 -52.618  1.00 12.28  ? 111 HIS O CA   1 
ATOM   1662  C  C    . HIS A  1 111 ? -52.021 -36.733 -52.707  1.00 12.81  ? 111 HIS O C    1 
ATOM   1663  O  O    . HIS A  1 111 ? -52.985 -36.587 -51.957  1.00 13.07  ? 111 HIS O O    1 
ATOM   1664  C  CB   . HIS A  1 111 ? -51.124 -34.482 -53.312  1.00 11.55  ? 111 HIS O CB   1 
ATOM   1665  C  CG   . HIS A  1 111 ? -50.107 -33.416 -53.051  1.00 12.85  ? 111 HIS O CG   1 
ATOM   1666  N  ND1  . HIS A  1 111 ? -49.889 -32.884 -51.797  1.00 12.56  ? 111 HIS O ND1  1 
ATOM   1667  C  CD2  . HIS A  1 111 ? -49.250 -32.783 -53.879  1.00 14.72  ? 111 HIS O CD2  1 
ATOM   1668  C  CE1  . HIS A  1 111 ? -48.931 -31.979 -51.862  1.00 12.27  ? 111 HIS O CE1  1 
ATOM   1669  N  NE2  . HIS A  1 111 ? -48.529 -31.890 -53.117  1.00 13.66  ? 111 HIS O NE2  1 
ATOM   1670  H  H    . HIS A  1 111 ? -49.292 -36.003 -53.864  1.00 14.89  ? 111 HIS O H    1 
ATOM   1671  H  HA   . HIS A  1 111 ? -50.657 -35.605 -51.680  1.00 14.74  ? 111 HIS O HA   1 
ATOM   1672  H  HB2  . HIS A  1 111 ? -51.157 -34.634 -54.270  1.00 13.85  ? 111 HIS O HB2  1 
ATOM   1673  H  HB3  . HIS A  1 111 ? -51.983 -34.157 -53.001  1.00 13.85  ? 111 HIS O HB3  1 
ATOM   1674  H  HD2  . HIS A  1 111 ? -49.160 -32.926 -54.794  1.00 17.67  ? 111 HIS O HD2  1 
ATOM   1675  H  HE1  . HIS A  1 111 ? -48.607 -31.477 -51.150  1.00 14.72  ? 111 HIS O HE1  1 
ATOM   1676  N  N    . LEU A  1 112 ? -51.969 -37.701 -53.616  1.00 13.06  ? 112 LEU O N    1 
ATOM   1677  C  CA   . LEU A  1 112 ? -53.078 -38.640 -53.751  1.00 15.27  ? 112 LEU O CA   1 
ATOM   1678  C  C    . LEU A  1 112 ? -53.128 -39.562 -52.541  1.00 16.81  ? 112 LEU O C    1 
ATOM   1679  O  O    . LEU A  1 112 ? -54.190 -40.046 -52.185  1.00 15.09  ? 112 LEU O O    1 
ATOM   1680  C  CB   . LEU A  1 112 ? -52.960 -39.463 -55.029  1.00 16.71  ? 112 LEU O CB   1 
ATOM   1681  C  CG   . LEU A  1 112 ? -52.872 -38.683 -56.342  1.00 13.57  ? 112 LEU O CG   1 
ATOM   1682  C  CD1  . LEU A  1 112 ? -52.742 -39.640 -57.533  1.00 13.44  ? 112 LEU O CD1  1 
ATOM   1683  C  CD2  . LEU A  1 112 ? -54.073 -37.788 -56.485  1.00 16.95  ? 112 LEU O CD2  1 
ATOM   1684  H  H    . LEU A  1 112 ? -51.316 -37.836 -54.158  1.00 15.68  ? 112 LEU O H    1 
ATOM   1685  H  HA   . LEU A  1 112 ? -53.910 -38.144 -53.787  1.00 18.32  ? 112 LEU O HA   1 
ATOM   1686  H  HB2  . LEU A  1 112 ? -52.161 -40.008 -54.965  1.00 20.06  ? 112 LEU O HB2  1 
ATOM   1687  H  HB3  . LEU A  1 112 ? -53.738 -40.040 -55.090  1.00 20.06  ? 112 LEU O HB3  1 
ATOM   1688  H  HG   . LEU A  1 112 ? -52.081 -38.122 -56.322  1.00 16.29  ? 112 LEU O HG   1 
ATOM   1689  H  HD11 . LEU A  1 112 ? -52.689 -39.121 -58.350  1.00 16.12  ? 112 LEU O HD11 1 
ATOM   1690  H  HD12 . LEU A  1 112 ? -51.938 -40.171 -57.424  1.00 16.12  ? 112 LEU O HD12 1 
ATOM   1691  H  HD13 . LEU A  1 112 ? -53.520 -40.219 -57.559  1.00 16.12  ? 112 LEU O HD13 1 
ATOM   1692  H  HD21 . LEU A  1 112 ? -54.005 -37.300 -57.320  1.00 20.34  ? 112 LEU O HD21 1 
ATOM   1693  H  HD22 . LEU A  1 112 ? -54.875 -38.333 -56.484  1.00 20.34  ? 112 LEU O HD22 1 
ATOM   1694  H  HD23 . LEU A  1 112 ? -54.093 -37.167 -55.739  1.00 20.34  ? 112 LEU O HD23 1 
ATOM   1695  N  N    . GLN A  1 113 ? -51.981 -39.819 -51.919  1.00 14.71  ? 113 GLN O N    1 
ATOM   1696  C  CA   . GLN A  1 113 ? -51.948 -40.717 -50.772  1.00 15.64  ? 113 GLN O CA   1 
ATOM   1697  C  C    . GLN A  1 113 ? -52.678 -40.126 -49.571  1.00 15.81  ? 113 GLN O C    1 
ATOM   1698  O  O    . GLN A  1 113 ? -53.206 -40.864 -48.744  1.00 16.69  ? 113 GLN O O    1 
ATOM   1699  C  CB   . GLN A  1 113 ? -50.508 -41.064 -50.404  1.00 19.58  ? 113 GLN O CB   1 
ATOM   1700  C  CG   . GLN A  1 113 ? -49.827 -41.822 -51.513  1.00 16.58  ? 113 GLN O CG   1 
ATOM   1701  C  CD   . GLN A  1 113 ? -48.363 -42.087 -51.266  1.00 29.15  ? 113 GLN O CD   1 
ATOM   1702  O  OE1  . GLN A  1 113 ? -47.931 -42.270 -50.125  1.00 21.11  ? 113 GLN O OE1  1 
ATOM   1703  N  NE2  . GLN A  1 113 ? -47.584 -42.111 -52.348  1.00 34.36  ? 113 GLN O NE2  1 
ATOM   1704  H  H    . GLN A  1 113 ? -51.217 -39.491 -52.139  1.00 17.65  ? 113 GLN O H    1 
ATOM   1705  H  HA   . GLN A  1 113 ? -52.397 -41.543 -51.012  1.00 18.77  ? 113 GLN O HA   1 
ATOM   1706  H  HB2  . GLN A  1 113 ? -50.011 -40.245 -50.246  1.00 23.50  ? 113 GLN O HB2  1 
ATOM   1707  H  HB3  . GLN A  1 113 ? -50.504 -41.619 -49.609  1.00 23.50  ? 113 GLN O HB3  1 
ATOM   1708  H  HG2  . GLN A  1 113 ? -50.269 -42.679 -51.622  1.00 19.90  ? 113 GLN O HG2  1 
ATOM   1709  H  HG3  . GLN A  1 113 ? -49.901 -41.309 -52.333  1.00 19.90  ? 113 GLN O HG3  1 
ATOM   1710  H  HE21 . GLN A  1 113 ? -47.925 -41.980 -53.126  1.00 41.24  ? 113 GLN O HE21 1 
ATOM   1711  H  HE22 . GLN A  1 113 ? -46.740 -42.258 -52.267  1.00 41.24  ? 113 GLN O HE22 1 
ATOM   1712  N  N    . GLY A  1 114 ? -52.726 -38.802 -49.479  1.00 17.15  ? 114 GLY O N    1 
ATOM   1713  C  CA   . GLY A  1 114 ? -53.436 -38.160 -48.382  1.00 16.51  ? 114 GLY O CA   1 
ATOM   1714  C  C    . GLY A  1 114 ? -54.885 -37.833 -48.704  1.00 25.00  ? 114 GLY O C    1 
ATOM   1715  O  O    . GLY A  1 114 ? -55.573 -37.203 -47.891  1.00 15.77  ? 114 GLY O O    1 
ATOM   1716  H  H    . GLY A  1 114 ? -52.359 -38.257 -50.034  1.00 20.58  ? 114 GLY O H    1 
ATOM   1717  H  HA2  . GLY A  1 114 ? -53.422 -38.744 -47.608  1.00 19.81  ? 114 GLY O HA2  1 
ATOM   1718  H  HA3  . GLY A  1 114 ? -52.983 -37.335 -48.148  1.00 19.81  ? 114 GLY O HA3  1 
ATOM   1719  N  N    . GLY A  1 115 ? -55.341 -38.225 -49.896  1.00 21.57  ? 115 GLY O N    1 
ATOM   1720  C  CA   . GLY A  1 115 ? -56.752 -38.127 -50.243  1.00 17.75  ? 115 GLY O CA   1 
ATOM   1721  C  C    . GLY A  1 115 ? -57.174 -37.066 -51.262  1.00 16.22  ? 115 GLY O C    1 
ATOM   1722  O  O    . GLY A  1 115 ? -58.359 -36.936 -51.527  1.00 20.67  ? 115 GLY O O    1 
ATOM   1723  H  H    . GLY A  1 115 ? -54.848 -38.553 -50.520  1.00 25.88  ? 115 GLY O H    1 
ATOM   1724  H  HA2  . GLY A  1 115 ? -57.039 -38.987 -50.588  1.00 21.30  ? 115 GLY O HA2  1 
ATOM   1725  H  HA3  . GLY A  1 115 ? -57.253 -37.958 -49.429  1.00 21.30  ? 115 GLY O HA3  1 
ATOM   1726  N  N    . ALA A  1 116 ? -56.239 -36.325 -51.849  1.00 13.71  ? 116 ALA O N    1 
ATOM   1727  C  CA   . ALA A  1 116 ? -56.595 -35.416 -52.937  1.00 13.12  ? 116 ALA O CA   1 
ATOM   1728  C  C    . ALA A  1 116 ? -57.078 -36.226 -54.126  1.00 13.60  ? 116 ALA O C    1 
ATOM   1729  O  O    . ALA A  1 116 ? -56.619 -37.336 -54.331  1.00 13.71  ? 116 ALA O O    1 
ATOM   1730  C  CB   . ALA A  1 116 ? -55.415 -34.559 -53.339  1.00 15.54  ? 116 ALA O CB   1 
ATOM   1731  H  H    . ALA A  1 116 ? -55.405 -36.328 -51.641  1.00 16.45  ? 116 ALA O H    1 
ATOM   1732  H  HA   . ALA A  1 116 ? -57.315 -34.833 -52.649  1.00 15.74  ? 116 ALA O HA   1 
ATOM   1733  H  HB1  . ALA A  1 116 ? -55.685 -33.970 -54.061  1.00 18.64  ? 116 ALA O HB1  1 
ATOM   1734  H  HB2  . ALA A  1 116 ? -55.129 -34.036 -52.574  1.00 18.64  ? 116 ALA O HB2  1 
ATOM   1735  H  HB3  . ALA A  1 116 ? -54.693 -35.136 -53.635  1.00 18.64  ? 116 ALA O HB3  1 
ATOM   1736  N  N    . LYS A  1 117 ? -58.002 -35.681 -54.906  1.00 13.33  ? 117 LYS O N    1 
ATOM   1737  C  CA   . LYS A  1 117 ? -58.494 -36.375 -56.096  1.00 15.23  ? 117 LYS O CA   1 
ATOM   1738  C  C    . LYS A  1 117 ? -57.685 -35.979 -57.333  1.00 13.86  ? 117 LYS O C    1 
ATOM   1739  O  O    . LYS A  1 117 ? -57.429 -36.801 -58.205  1.00 13.41  ? 117 LYS O O    1 
ATOM   1740  C  CB   . LYS A  1 117 ? -59.975 -36.067 -56.329  1.00 17.25  ? 117 LYS O CB   1 
ATOM   1741  C  CG   . LYS A  1 117 ? -60.905 -36.448 -55.186  1.00 26.23  ? 117 LYS O CG   1 
ATOM   1742  C  CD   . LYS A  1 117 ? -60.940 -37.929 -54.920  1.00 49.77  ? 117 LYS O CD   1 
ATOM   1743  C  CE   . LYS A  1 117 ? -61.911 -38.245 -53.783  1.00 59.40  ? 117 LYS O CE   1 
ATOM   1744  N  NZ   . LYS A  1 117 ? -61.988 -39.704 -53.494  1.00 70.15  ? 117 LYS O NZ   1 
ATOM   1745  H  H    . LYS A  1 117 ? -58.362 -34.912 -54.771  1.00 16.00  ? 117 LYS O H    1 
ATOM   1746  H  HA   . LYS A  1 117 ? -58.401 -37.332 -55.968  1.00 18.28  ? 117 LYS O HA   1 
ATOM   1747  H  HB2  . LYS A  1 117 ? -60.071 -35.114 -56.478  1.00 20.70  ? 117 LYS O HB2  1 
ATOM   1748  H  HB3  . LYS A  1 117 ? -60.269 -36.550 -57.117  1.00 20.70  ? 117 LYS O HB3  1 
ATOM   1749  H  HG2  . LYS A  1 117 ? -60.606 -36.006 -54.376  1.00 31.47  ? 117 LYS O HG2  1 
ATOM   1750  H  HG3  . LYS A  1 117 ? -61.806 -36.162 -55.405  1.00 31.47  ? 117 LYS O HG3  1 
ATOM   1751  H  HD2  . LYS A  1 117 ? -61.240 -38.394 -55.717  1.00 59.72  ? 117 LYS O HD2  1 
ATOM   1752  H  HD3  . LYS A  1 117 ? -60.056 -38.233 -54.662  1.00 59.72  ? 117 LYS O HD3  1 
ATOM   1753  H  HE2  . LYS A  1 117 ? -61.613 -37.793 -52.977  1.00 71.28  ? 117 LYS O HE2  1 
ATOM   1754  H  HE3  . LYS A  1 117 ? -62.798 -37.939 -54.028  1.00 71.28  ? 117 LYS O HE3  1 
ATOM   1755  H  HZ1  . LYS A  1 117 ? -61.185 -40.010 -53.260  1.00 84.18  ? 117 LYS O HZ1  1 
ATOM   1756  H  HZ2  . LYS A  1 117 ? -62.560 -39.853 -52.829  1.00 84.18  ? 117 LYS O HZ2  1 
ATOM   1757  H  HZ3  . LYS A  1 117 ? -62.265 -40.143 -54.217  1.00 84.18  ? 117 LYS O HZ3  1 
ATOM   1758  N  N    . ARG A  1 118 ? -57.297 -34.709 -57.405  1.00 12.35  ? 118 ARG O N    1 
ATOM   1759  C  CA   . ARG A  1 118 ? -56.484 -34.211 -58.512  1.00 11.81  ? 118 ARG O CA   1 
ATOM   1760  C  C    . ARG A  1 118 ? -55.440 -33.235 -58.013  1.00 14.46  ? 118 ARG O C    1 
ATOM   1761  O  O    . ARG A  1 118 ? -55.608 -32.597 -56.977  1.00 12.33  ? 118 ARG O O    1 
ATOM   1762  C  CB   . ARG A  1 118 ? -57.346 -33.521 -59.595  1.00 11.85  ? 118 ARG O CB   1 
ATOM   1763  C  CG   . ARG A  1 118 ? -58.506 -34.358 -60.092  1.00 14.57  ? 118 ARG O CG   1 
ATOM   1764  C  CD   . ARG A  1 118 ? -59.159 -33.800 -61.354  1.00 12.78  ? 118 ARG O CD   1 
ATOM   1765  N  NE   . ARG A  1 118 ? -60.403 -34.508 -61.669  1.00 13.74  ? 118 ARG O NE   1 
ATOM   1766  C  CZ   . ARG A  1 118 ? -60.475 -35.617 -62.396  1.00 16.65  ? 118 ARG O CZ   1 
ATOM   1767  N  NH1  . ARG A  1 118 ? -59.382 -36.143 -62.931  1.00 15.59  ? 118 ARG O NH1  1 
ATOM   1768  N  NH2  . ARG A  1 118 ? -61.644 -36.193 -62.611  1.00 19.07  ? 118 ARG O NH2  1 
ATOM   1769  H  H    . ARG A  1 118 ? -57.493 -34.109 -56.820  1.00 14.82  ? 118 ARG O H    1 
ATOM   1770  H  HA   . ARG A  1 118 ? -56.023 -34.958 -58.926  1.00 14.17  ? 118 ARG O HA   1 
ATOM   1771  H  HB2  . ARG A  1 118 ? -57.710 -32.700 -59.227  1.00 14.22  ? 118 ARG O HB2  1 
ATOM   1772  H  HB3  . ARG A  1 118 ? -56.782 -33.316 -60.358  1.00 14.22  ? 118 ARG O HB3  1 
ATOM   1773  H  HG2  . ARG A  1 118 ? -58.186 -35.251 -60.292  1.00 17.48  ? 118 ARG O HG2  1 
ATOM   1774  H  HG3  . ARG A  1 118 ? -59.184 -34.398 -59.399  1.00 17.48  ? 118 ARG O HG3  1 
ATOM   1775  H  HD2  . ARG A  1 118 ? -59.368 -32.862 -61.219  1.00 15.33  ? 118 ARG O HD2  1 
ATOM   1776  H  HD3  . ARG A  1 118 ? -58.551 -33.905 -62.102  1.00 15.33  ? 118 ARG O HD3  1 
ATOM   1777  H  HE   . ARG A  1 118 ? -61.137 -34.183 -61.361  1.00 16.49  ? 118 ARG O HE   1 
ATOM   1778  H  HH11 . ARG A  1 118 ? -58.617 -35.776 -62.793  1.00 18.70  ? 118 ARG O HH11 1 
ATOM   1779  H  HH12 . ARG A  1 118 ? -59.437 -36.858 -63.405  1.00 18.70  ? 118 ARG O HH12 1 
ATOM   1780  H  HH21 . ARG A  1 118 ? -62.359 -35.854 -62.275  1.00 22.88  ? 118 ARG O HH21 1 
ATOM   1781  H  HH22 . ARG A  1 118 ? -61.691 -36.904 -63.093  1.00 22.88  ? 118 ARG O HH22 1 
ATOM   1782  N  N    . VAL A  1 119 ? -54.368 -33.113 -58.778  1.00 10.83  ? 119 VAL O N    1 
ATOM   1783  C  CA   . VAL A  1 119 ? -53.273 -32.230 -58.437  1.00 10.33  ? 119 VAL O CA   1 
ATOM   1784  C  C    . VAL A  1 119 ? -52.920 -31.344 -59.622  1.00 10.72  ? 119 VAL O C    1 
ATOM   1785  O  O    . VAL A  1 119 ? -52.756 -31.830 -60.731  1.00 10.13  ? 119 VAL O O    1 
ATOM   1786  C  CB   . VAL A  1 119 ? -52.024 -33.019 -58.027  1.00 13.75  ? 119 VAL O CB   1 
ATOM   1787  C  CG1  . VAL A  1 119 ? -50.890 -32.066 -57.603  1.00 13.16  ? 119 VAL O CG1  1 
ATOM   1788  C  CG2  . VAL A  1 119 ? -52.359 -34.014 -56.922  1.00 13.05  ? 119 VAL O CG2  1 
ATOM   1789  H  H    . VAL A  1 119 ? -54.251 -33.541 -59.515  1.00 12.99  ? 119 VAL O H    1 
ATOM   1790  H  HA   . VAL A  1 119 ? -53.535 -31.661 -57.696  1.00 12.39  ? 119 VAL O HA   1 
ATOM   1791  H  HB   . VAL A  1 119 ? -51.712 -33.526 -58.793  1.00 16.50  ? 119 VAL O HB   1 
ATOM   1792  H  HG11 . VAL A  1 119 ? -50.115 -32.591 -57.349  1.00 15.80  ? 119 VAL O HG11 1 
ATOM   1793  H  HG12 . VAL A  1 119 ? -50.668 -31.488 -58.349  1.00 15.80  ? 119 VAL O HG12 1 
ATOM   1794  H  HG13 . VAL A  1 119 ? -51.190 -31.534 -56.849  1.00 15.80  ? 119 VAL O HG13 1 
ATOM   1795  H  HG21 . VAL A  1 119 ? -51.555 -34.500 -56.680  1.00 15.66  ? 119 VAL O HG21 1 
ATOM   1796  H  HG22 . VAL A  1 119 ? -52.697 -33.528 -56.152  1.00 15.66  ? 119 VAL O HG22 1 
ATOM   1797  H  HG23 . VAL A  1 119 ? -53.034 -34.630 -57.246  1.00 15.66  ? 119 VAL O HG23 1 
ATOM   1798  N  N    . ILE A  1 120 ? -52.769 -30.051 -59.358  1.00 9.63   ? 120 ILE O N    1 
ATOM   1799  C  CA   . ILE A  1 120 ? -52.383 -29.077 -60.363  1.00 9.39   ? 120 ILE O CA   1 
ATOM   1800  C  C    . ILE A  1 120 ? -51.013 -28.516 -59.973  1.00 12.07  ? 120 ILE O C    1 
ATOM   1801  O  O    . ILE A  1 120 ? -50.874 -27.820 -58.958  1.00 12.33  ? 120 ILE O O    1 
ATOM   1802  C  CB   . ILE A  1 120 ? -53.413 -27.916 -60.487  1.00 9.87   ? 120 ILE O CB   1 
ATOM   1803  C  CG1  . ILE A  1 120 ? -54.807 -28.423 -60.860  1.00 14.07  ? 120 ILE O CG1  1 
ATOM   1804  C  CG2  . ILE A  1 120 ? -52.954 -26.885 -61.519  1.00 10.57  ? 120 ILE O CG2  1 
ATOM   1805  C  CD1  . ILE A  1 120 ? -55.633 -28.950 -59.704  1.00 19.77  ? 120 ILE O CD1  1 
ATOM   1806  H  H    . ILE A  1 120 ? -52.888 -29.707 -58.579  1.00 11.56  ? 120 ILE O H    1 
ATOM   1807  H  HA   . ILE A  1 120 ? -52.305 -29.514 -61.225  1.00 11.27  ? 120 ILE O HA   1 
ATOM   1808  H  HB   . ILE A  1 120 ? -53.473 -27.474 -59.626  1.00 11.84  ? 120 ILE O HB   1 
ATOM   1809  H  HG12 . ILE A  1 120 ? -55.302 -27.693 -61.263  1.00 16.88  ? 120 ILE O HG12 1 
ATOM   1810  H  HG13 . ILE A  1 120 ? -54.711 -29.143 -61.502  1.00 16.88  ? 120 ILE O HG13 1 
ATOM   1811  H  HG21 . ILE A  1 120 ? -53.615 -26.177 -61.572  1.00 12.69  ? 120 ILE O HG21 1 
ATOM   1812  H  HG22 . ILE A  1 120 ? -52.099 -26.520 -61.241  1.00 12.69  ? 120 ILE O HG22 1 
ATOM   1813  H  HG23 . ILE A  1 120 ? -52.864 -27.320 -62.381  1.00 12.69  ? 120 ILE O HG23 1 
ATOM   1814  H  HD11 . ILE A  1 120 ? -56.493 -29.245 -60.040  1.00 23.72  ? 120 ILE O HD11 1 
ATOM   1815  H  HD12 . ILE A  1 120 ? -55.164 -29.694 -59.295  1.00 23.72  ? 120 ILE O HD12 1 
ATOM   1816  H  HD13 . ILE A  1 120 ? -55.757 -28.239 -59.055  1.00 23.72  ? 120 ILE O HD13 1 
ATOM   1817  N  N    . ILE A  1 121 ? -50.003 -28.826 -60.775  1.00 10.11  ? 121 ILE O N    1 
ATOM   1818  C  CA   . ILE A  1 121 ? -48.639 -28.350 -60.514  1.00 9.00   ? 121 ILE O CA   1 
ATOM   1819  C  C    . ILE A  1 121 ? -48.489 -26.935 -61.057  1.00 9.86   ? 121 ILE O C    1 
ATOM   1820  O  O    . ILE A  1 121 ? -48.706 -26.706 -62.245  1.00 9.91   ? 121 ILE O O    1 
ATOM   1821  C  CB   . ILE A  1 121 ? -47.602 -29.287 -61.158  1.00 9.73   ? 121 ILE O CB   1 
ATOM   1822  C  CG1  . ILE A  1 121 ? -47.767 -30.712 -60.610  1.00 14.01  ? 121 ILE O CG1  1 
ATOM   1823  C  CG2  . ILE A  1 121 ? -46.189 -28.764 -60.940  1.00 13.26  ? 121 ILE O CG2  1 
ATOM   1824  C  CD1  . ILE A  1 121 ? -47.076 -31.769 -61.447  1.00 11.09  ? 121 ILE O CD1  1 
ATOM   1825  H  H    . ILE A  1 121 ? -50.076 -29.312 -61.482  1.00 12.14  ? 121 ILE O H    1 
ATOM   1826  H  HA   . ILE A  1 121 ? -48.482 -28.330 -59.557  1.00 10.80  ? 121 ILE O HA   1 
ATOM   1827  H  HB   . ILE A  1 121 ? -47.769 -29.311 -62.113  1.00 11.68  ? 121 ILE O HB   1 
ATOM   1828  H  HG12 . ILE A  1 121 ? -47.392 -30.749 -59.716  1.00 16.81  ? 121 ILE O HG12 1 
ATOM   1829  H  HG13 . ILE A  1 121 ? -48.712 -30.928 -60.580  1.00 16.81  ? 121 ILE O HG13 1 
ATOM   1830  H  HG21 . ILE A  1 121 ? -45.559 -29.373 -61.356  1.00 15.92  ? 121 ILE O HG21 1 
ATOM   1831  H  HG22 . ILE A  1 121 ? -46.113 -27.884 -61.342  1.00 15.92  ? 121 ILE O HG22 1 
ATOM   1832  H  HG23 . ILE A  1 121 ? -46.017 -28.709 -59.987  1.00 15.92  ? 121 ILE O HG23 1 
ATOM   1833  H  HD11 . ILE A  1 121 ? -47.223 -32.638 -61.041  1.00 13.30  ? 121 ILE O HD11 1 
ATOM   1834  H  HD12 . ILE A  1 121 ? -47.447 -31.755 -62.343  1.00 13.30  ? 121 ILE O HD12 1 
ATOM   1835  H  HD13 . ILE A  1 121 ? -46.126 -31.575 -61.478  1.00 13.30  ? 121 ILE O HD13 1 
ATOM   1836  N  N    . SER A  1 122 ? -48.132 -25.992 -60.193  1.00 11.69  ? 122 SER O N    1 
ATOM   1837  C  CA   . SER A  1 122 ? -48.059 -24.580 -60.593  1.00 15.25  ? 122 SER O CA   1 
ATOM   1838  C  C    . SER A  1 122 ? -46.715 -24.226 -61.244  1.00 14.36  ? 122 SER O C    1 
ATOM   1839  O  O    . SER A  1 122 ? -46.092 -23.231 -60.901  1.00 18.80  ? 122 SER O O    1 
ATOM   1840  C  CB   . SER A  1 122 ? -48.294 -23.683 -59.378  1.00 17.50  ? 122 SER O CB   1 
ATOM   1841  O  OG   . SER A  1 122 ? -47.134 -23.651 -58.546  1.00 20.25  ? 122 SER O OG   1 
ATOM   1842  H  H    . SER A  1 122 ? -47.927 -26.137 -59.371  1.00 14.03  ? 122 SER O H    1 
ATOM   1843  H  HA   . SER A  1 122 ? -48.760 -24.399 -61.239  1.00 18.30  ? 122 SER O HA   1 
ATOM   1844  H  HB2  . SER A  1 122 ? -48.490 -22.783 -59.682  1.00 21.01  ? 122 SER O HB2  1 
ATOM   1845  H  HB3  . SER A  1 122 ? -49.041 -24.031 -58.867  1.00 21.01  ? 122 SER O HB3  1 
ATOM   1846  H  HG   . SER A  1 122 ? -47.271 -23.157 -57.881  1.00 24.30  ? 122 SER O HG   1 
ATOM   1847  N  N    . ALA A  1 123 ? -46.307 -25.034 -62.213  1.00 15.96  ? 123 ALA O N    1 
ATOM   1848  C  CA   . ALA A  1 123 ? -44.995 -24.942 -62.813  1.00 15.79  ? 123 ALA O CA   1 
ATOM   1849  C  C    . ALA A  1 123 ? -44.916 -25.958 -63.951  1.00 9.44   ? 123 ALA O C    1 
ATOM   1850  O  O    . ALA A  1 123 ? -45.711 -26.889 -63.981  1.00 12.91  ? 123 ALA O O    1 
ATOM   1851  C  CB   . ALA A  1 123 ? -43.905 -25.220 -61.774  1.00 21.44  ? 123 ALA O CB   1 
ATOM   1852  H  H    . ALA A  1 123 ? -46.792 -25.661 -62.546  1.00 19.16  ? 123 ALA O H    1 
ATOM   1853  H  HA   . ALA A  1 123 ? -44.861 -24.053 -63.178  1.00 18.95  ? 123 ALA O HA   1 
ATOM   1854  H  HB1  . ALA A  1 123 ? -43.037 -25.153 -62.201  1.00 25.73  ? 123 ALA O HB1  1 
ATOM   1855  H  HB2  . ALA A  1 123 ? -43.975 -24.567 -61.060  1.00 25.73  ? 123 ALA O HB2  1 
ATOM   1856  H  HB3  . ALA A  1 123 ? -44.030 -26.114 -61.418  1.00 25.73  ? 123 ALA O HB3  1 
ATOM   1857  N  N    . PRO A  1 124 ? -43.938 -25.801 -64.863  1.00 12.76  ? 124 PRO O N    1 
ATOM   1858  C  CA   . PRO A  1 124 ? -43.648 -26.826 -65.864  1.00 17.54  ? 124 PRO O CA   1 
ATOM   1859  C  C    . PRO A  1 124 ? -43.354 -28.160 -65.206  1.00 17.38  ? 124 PRO O C    1 
ATOM   1860  O  O    . PRO A  1 124 ? -42.783 -28.197 -64.127  1.00 19.46  ? 124 PRO O O    1 
ATOM   1861  C  CB   . PRO A  1 124 ? -42.401 -26.300 -66.575  1.00 24.38  ? 124 PRO O CB   1 
ATOM   1862  C  CG   . PRO A  1 124 ? -42.361 -24.861 -66.278  1.00 20.88  ? 124 PRO O CG   1 
ATOM   1863  C  CD   . PRO A  1 124 ? -42.973 -24.695 -64.931  1.00 13.49  ? 124 PRO O CD   1 
ATOM   1864  H  HA   . PRO A  1 124 ? -44.379 -26.916 -66.495  1.00 21.05  ? 124 PRO O HA   1 
ATOM   1865  H  HB2  . PRO A  1 124 ? -41.614 -26.744 -66.223  1.00 29.25  ? 124 PRO O HB2  1 
ATOM   1866  H  HB3  . PRO A  1 124 ? -42.482 -26.451 -67.530  1.00 29.25  ? 124 PRO O HB3  1 
ATOM   1867  H  HG2  . PRO A  1 124 ? -41.440 -24.558 -66.273  1.00 25.06  ? 124 PRO O HG2  1 
ATOM   1868  H  HG3  . PRO A  1 124 ? -42.874 -24.379 -66.946  1.00 25.06  ? 124 PRO O HG3  1 
ATOM   1869  H  HD2  . PRO A  1 124 ? -42.300 -24.790 -64.239  1.00 16.19  ? 124 PRO O HD2  1 
ATOM   1870  H  HD3  . PRO A  1 124 ? -43.431 -23.842 -64.869  1.00 16.19  ? 124 PRO O HD3  1 
ATOM   1871  N  N    . SER A  1 125 ? -43.765 -29.234 -65.862  1.00 13.68  ? 125 SER O N    1 
ATOM   1872  C  CA   . SER A  1 125 ? -43.503 -30.582 -65.392  1.00 15.20  ? 125 SER O CA   1 
ATOM   1873  C  C    . SER A  1 125 ? -42.761 -31.319 -66.481  1.00 18.73  ? 125 SER O C    1 
ATOM   1874  O  O    . SER A  1 125 ? -43.072 -31.146 -67.654  1.00 15.60  ? 125 SER O O    1 
ATOM   1875  C  CB   . SER A  1 125 ? -44.811 -31.298 -65.060  1.00 12.02  ? 125 SER O CB   1 
ATOM   1876  O  OG   . SER A  1 125 ? -44.604 -32.654 -64.730  1.00 16.90  ? 125 SER O OG   1 
ATOM   1877  H  H    . SER A  1 125 ? -44.208 -29.206 -66.599  1.00 16.42  ? 125 SER O H    1 
ATOM   1878  H  HA   . SER A  1 125 ? -42.948 -30.553 -64.597  1.00 18.24  ? 125 SER O HA   1 
ATOM   1879  H  HB2  . SER A  1 125 ? -45.227 -30.854 -64.305  1.00 14.43  ? 125 SER O HB2  1 
ATOM   1880  H  HB3  . SER A  1 125 ? -45.397 -31.251 -65.832  1.00 14.43  ? 125 SER O HB3  1 
ATOM   1881  H  HG   . SER A  1 125 ? -44.101 -32.713 -64.061  1.00 20.28  ? 125 SER O HG   1 
ATOM   1882  N  N    . ALA A  1 126 ? -41.789 -32.140 -66.102  1.00 19.04  ? 126 ALA O N    1 
ATOM   1883  C  CA   . ALA A  1 126 ? -41.101 -32.969 -67.077  1.00 20.39  ? 126 ALA O CA   1 
ATOM   1884  C  C    . ALA A  1 126 ? -42.074 -33.952 -67.721  1.00 25.29  ? 126 ALA O C    1 
ATOM   1885  O  O    . ALA A  1 126 ? -41.914 -34.299 -68.881  1.00 21.54  ? 126 ALA O O    1 
ATOM   1886  C  CB   . ALA A  1 126 ? -39.938 -33.714 -66.426  1.00 24.56  ? 126 ALA O CB   1 
ATOM   1887  H  H    . ALA A  1 126 ? -41.512 -32.235 -65.293  1.00 22.85  ? 126 ALA O H    1 
ATOM   1888  H  HA   . ALA A  1 126 ? -40.741 -32.401 -67.776  1.00 24.46  ? 126 ALA O HA   1 
ATOM   1889  H  HB1  . ALA A  1 126 ? -39.497 -34.258 -67.098  1.00 29.47  ? 126 ALA O HB1  1 
ATOM   1890  H  HB2  . ALA A  1 126 ? -39.313 -33.068 -66.062  1.00 29.47  ? 126 ALA O HB2  1 
ATOM   1891  H  HB3  . ALA A  1 126 ? -40.282 -34.278 -65.717  1.00 29.47  ? 126 ALA O HB3  1 
ATOM   1892  N  N    . ASP A  1 127 ? -43.094 -34.399 -66.995  1.00 14.66  ? 127 ASP O N    1 
ATOM   1893  C  CA   . ASP A  1 127 ? -43.972 -35.399 -67.583  1.00 14.92  ? 127 ASP O CA   1 
ATOM   1894  C  C    . ASP A  1 127 ? -45.474 -35.170 -67.422  1.00 16.25  ? 127 ASP O C    1 
ATOM   1895  O  O    . ASP A  1 127 ? -46.257 -35.776 -68.153  1.00 15.98  ? 127 ASP O O    1 
ATOM   1896  C  CB   . ASP A  1 127 ? -43.590 -36.790 -67.052  1.00 18.57  ? 127 ASP O CB   1 
ATOM   1897  C  CG   . ASP A  1 127 ? -43.747 -36.932 -65.544  1.00 31.01  ? 127 ASP O CG   1 
ATOM   1898  O  OD1  . ASP A  1 127 ? -43.863 -35.922 -64.804  1.00 21.12  ? 127 ASP O OD1  1 
ATOM   1899  O  OD2  . ASP A  1 127 ? -43.741 -38.097 -65.097  1.00 29.95  ? 127 ASP O OD2  1 
ATOM   1900  H  H    . ASP A  1 127 ? -43.292 -34.151 -66.196  1.00 17.59  ? 127 ASP O H    1 
ATOM   1901  H  HA   . ASP A  1 127 ? -43.799 -35.410 -68.537  1.00 17.90  ? 127 ASP O HA   1 
ATOM   1902  H  HB2  . ASP A  1 127 ? -44.160 -37.453 -67.473  1.00 22.28  ? 127 ASP O HB2  1 
ATOM   1903  H  HB3  . ASP A  1 127 ? -42.662 -36.966 -67.272  1.00 22.28  ? 127 ASP O HB3  1 
ATOM   1904  N  N    . ALA A  1 128 ? -45.908 -34.303 -66.513  1.00 14.28  ? 128 ALA O N    1 
ATOM   1905  C  CA   . ALA A  1 128 ? -47.352 -34.063 -66.383  1.00 16.38  ? 128 ALA O CA   1 
ATOM   1906  C  C    . ALA A  1 128 ? -47.894 -33.310 -67.611  1.00 19.32  ? 128 ALA O C    1 
ATOM   1907  O  O    . ALA A  1 128 ? -47.213 -32.449 -68.134  1.00 19.53  ? 128 ALA O O    1 
ATOM   1908  C  CB   . ALA A  1 128 ? -47.647 -33.284 -65.122  1.00 15.92  ? 128 ALA O CB   1 
ATOM   1909  H  H    . ALA A  1 128 ? -45.411 -33.852 -65.975  1.00 17.13  ? 128 ALA O H    1 
ATOM   1910  H  HA   . ALA A  1 128 ? -47.811 -34.916 -66.325  1.00 19.65  ? 128 ALA O HA   1 
ATOM   1911  H  HB1  . ALA A  1 128 ? -48.604 -33.139 -65.058  1.00 19.11  ? 128 ALA O HB1  1 
ATOM   1912  H  HB2  . ALA A  1 128 ? -47.338 -33.794 -64.357  1.00 19.11  ? 128 ALA O HB2  1 
ATOM   1913  H  HB3  . ALA A  1 128 ? -47.185 -32.433 -65.162  1.00 19.11  ? 128 ALA O HB3  1 
ATOM   1914  N  N    . PRO A  1 129 ? -49.115 -33.643 -68.080  1.00 18.18  ? 129 PRO O N    1 
ATOM   1915  C  CA   . PRO A  1 129 ? -49.675 -32.862 -69.196  1.00 21.20  ? 129 PRO O CA   1 
ATOM   1916  C  C    . PRO A  1 129 ? -49.840 -31.396 -68.811  1.00 13.12  ? 129 PRO O C    1 
ATOM   1917  O  O    . PRO A  1 129 ? -50.294 -31.109 -67.699  1.00 12.13  ? 129 PRO O O    1 
ATOM   1918  C  CB   . PRO A  1 129 ? -51.040 -33.518 -69.457  1.00 19.49  ? 129 PRO O CB   1 
ATOM   1919  C  CG   . PRO A  1 129 ? -51.024 -34.795 -68.723  1.00 27.99  ? 129 PRO O CG   1 
ATOM   1920  C  CD   . PRO A  1 129 ? -50.047 -34.685 -67.612  1.00 15.52  ? 129 PRO O CD   1 
ATOM   1921  H  HA   . PRO A  1 129 ? -49.117 -32.937 -69.985  1.00 25.44  ? 129 PRO O HA   1 
ATOM   1922  H  HB2  . PRO A  1 129 ? -51.746 -32.942 -69.123  1.00 23.38  ? 129 PRO O HB2  1 
ATOM   1923  H  HB3  . PRO A  1 129 ? -51.149 -33.673 -70.408  1.00 23.38  ? 129 PRO O HB3  1 
ATOM   1924  H  HG2  . PRO A  1 129 ? -51.911 -34.969 -68.370  1.00 33.59  ? 129 PRO O HG2  1 
ATOM   1925  H  HG3  . PRO A  1 129 ? -50.761 -35.505 -69.329  1.00 33.59  ? 129 PRO O HG3  1 
ATOM   1926  H  HD2  . PRO A  1 129 ? -50.491 -34.401 -66.798  1.00 18.63  ? 129 PRO O HD2  1 
ATOM   1927  H  HD3  . PRO A  1 129 ? -49.579 -35.526 -67.488  1.00 18.63  ? 129 PRO O HD3  1 
ATOM   1928  N  N    . MET A  1 130 ? -49.457 -30.489 -69.707  1.00 13.87  ? 130 MET O N    1 
ATOM   1929  C  CA   . MET A  1 130 ? -49.472 -29.066 -69.431  1.00 20.27  ? 130 MET O CA   1 
ATOM   1930  C  C    . MET A  1 130 ? -50.668 -28.443 -70.143  1.00 18.86  ? 130 MET O C    1 
ATOM   1931  O  O    . MET A  1 130 ? -51.018 -28.838 -71.258  1.00 15.09  ? 130 MET O O    1 
ATOM   1932  C  CB   . MET A  1 130 ? -48.147 -28.390 -69.879  1.00 14.35  ? 130 MET O CB   1 
ATOM   1933  C  CG   . MET A  1 130 ? -46.907 -28.791 -69.039  1.00 36.79  ? 130 MET O CG   1 
ATOM   1934  S  SD   . MET A  1 130 ? -45.379 -27.830 -69.327  1.00 30.46  ? 130 MET O SD   1 
ATOM   1935  C  CE   . MET A  1 130 ? -45.108 -28.179 -71.063  1.00 59.33  ? 130 MET O CE   1 
ATOM   1936  H  H    . MET A  1 130 ? -49.179 -30.683 -70.498  1.00 16.64  ? 130 MET O H    1 
ATOM   1937  H  HA   . MET A  1 130 ? -49.568 -28.931 -68.476  1.00 24.32  ? 130 MET O HA   1 
ATOM   1938  H  HB2  . MET A  1 130 ? -47.970 -28.634 -70.801  1.00 17.22  ? 130 MET O HB2  1 
ATOM   1939  H  HB3  . MET A  1 130 ? -48.251 -27.428 -69.810  1.00 17.22  ? 130 MET O HB3  1 
ATOM   1940  H  HG2  . MET A  1 130 ? -47.133 -28.695 -68.100  1.00 44.15  ? 130 MET O HG2  1 
ATOM   1941  H  HG3  . MET A  1 130 ? -46.701 -29.720 -69.226  1.00 44.15  ? 130 MET O HG3  1 
ATOM   1942  H  HE1  . MET A  1 130 ? -44.306 -27.719 -71.356  1.00 71.20  ? 130 MET O HE1  1 
ATOM   1943  H  HE2  . MET A  1 130 ? -45.002 -29.136 -71.179  1.00 71.20  ? 130 MET O HE2  1 
ATOM   1944  H  HE3  . MET A  1 130 ? -45.873 -27.867 -71.571  1.00 71.20  ? 130 MET O HE3  1 
ATOM   1945  N  N    . PHE A  1 131 ? -51.290 -27.472 -69.488  1.00 12.71  ? 131 PHE O N    1 
ATOM   1946  C  CA   . PHE A  1 131 ? -52.436 -26.774 -70.054  1.00 14.64  ? 131 PHE O CA   1 
ATOM   1947  C  C    . PHE A  1 131 ? -52.260 -25.294 -69.884  1.00 14.14  ? 131 PHE O C    1 
ATOM   1948  O  O    . PHE A  1 131 ? -51.693 -24.828 -68.887  1.00 17.91  ? 131 PHE O O    1 
ATOM   1949  C  CB   . PHE A  1 131 ? -53.746 -27.243 -69.413  1.00 17.00  ? 131 PHE O CB   1 
ATOM   1950  C  CG   . PHE A  1 131 ? -54.018 -28.688 -69.642  1.00 15.62  ? 131 PHE O CG   1 
ATOM   1951  C  CD1  . PHE A  1 131 ? -54.571 -29.113 -70.821  1.00 12.59  ? 131 PHE O CD1  1 
ATOM   1952  C  CD2  . PHE A  1 131 ? -53.662 -29.636 -68.696  1.00 13.58  ? 131 PHE O CD2  1 
ATOM   1953  C  CE1  . PHE A  1 131 ? -54.779 -30.457 -71.063  1.00 13.75  ? 131 PHE O CE1  1 
ATOM   1954  C  CE2  . PHE A  1 131 ? -53.877 -30.974 -68.937  1.00 16.73  ? 131 PHE O CE2  1 
ATOM   1955  C  CZ   . PHE A  1 131 ? -54.445 -31.383 -70.117  1.00 15.53  ? 131 PHE O CZ   1 
ATOM   1956  H  H    . PHE A  1 131 ? -51.064 -27.195 -68.706  1.00 15.26  ? 131 PHE O H    1 
ATOM   1957  H  HA   . PHE A  1 131 ? -52.483 -26.962 -71.004  1.00 17.57  ? 131 PHE O HA   1 
ATOM   1958  H  HB2  . PHE A  1 131 ? -53.699 -27.095 -68.456  1.00 20.40  ? 131 PHE O HB2  1 
ATOM   1959  H  HB3  . PHE A  1 131 ? -54.481 -26.737 -69.792  1.00 20.40  ? 131 PHE O HB3  1 
ATOM   1960  H  HD1  . PHE A  1 131 ? -54.799 -28.489 -71.471  1.00 15.11  ? 131 PHE O HD1  1 
ATOM   1961  H  HD2  . PHE A  1 131 ? -53.275 -29.368 -67.895  1.00 16.30  ? 131 PHE O HD2  1 
ATOM   1962  H  HE1  . PHE A  1 131 ? -55.169 -30.729 -71.863  1.00 16.50  ? 131 PHE O HE1  1 
ATOM   1963  H  HE2  . PHE A  1 131 ? -53.647 -31.603 -68.292  1.00 20.07  ? 131 PHE O HE2  1 
ATOM   1964  H  HZ   . PHE A  1 131 ? -54.595 -32.287 -70.275  1.00 18.63  ? 131 PHE O HZ   1 
ATOM   1965  N  N    . VAL A  1 132 ? -52.683 -24.562 -70.908  1.00 12.84  ? 132 VAL O N    1 
ATOM   1966  C  CA   . VAL A  1 132 ? -52.738 -23.115 -70.869  1.00 11.69  ? 132 VAL O CA   1 
ATOM   1967  C  C    . VAL A  1 132 ? -54.166 -22.678 -71.197  1.00 12.83  ? 132 VAL O C    1 
ATOM   1968  O  O    . VAL A  1 132 ? -54.693 -23.009 -72.262  1.00 12.84  ? 132 VAL O O    1 
ATOM   1969  C  CB   . VAL A  1 132 ? -51.748 -22.492 -71.870  1.00 12.03  ? 132 VAL O CB   1 
ATOM   1970  C  CG1  . VAL A  1 132 ? -51.956 -20.993 -71.982  1.00 12.29  ? 132 VAL O CG1  1 
ATOM   1971  C  CG2  . VAL A  1 132 ? -50.315 -22.829 -71.458  1.00 22.40  ? 132 VAL O CG2  1 
ATOM   1972  H  H    . VAL A  1 132 ? -52.950 -24.894 -71.655  1.00 15.41  ? 132 VAL O H    1 
ATOM   1973  H  HA   . VAL A  1 132 ? -52.516 -22.804 -69.977  1.00 14.03  ? 132 VAL O HA   1 
ATOM   1974  H  HB   . VAL A  1 132 ? -51.904 -22.879 -72.745  1.00 14.43  ? 132 VAL O HB   1 
ATOM   1975  H  HG11 . VAL A  1 132 ? -51.318 -20.633 -72.618  1.00 14.75  ? 132 VAL O HG11 1 
ATOM   1976  H  HG12 . VAL A  1 132 ? -52.860 -20.822 -72.287  1.00 14.75  ? 132 VAL O HG12 1 
ATOM   1977  H  HG13 . VAL A  1 132 ? -51.818 -20.589 -71.111  1.00 14.75  ? 132 VAL O HG13 1 
ATOM   1978  H  HG21 . VAL A  1 132 ? -49.702 -22.431 -72.096  1.00 26.88  ? 132 VAL O HG21 1 
ATOM   1979  H  HG22 . VAL A  1 132 ? -50.149 -22.472 -70.572  1.00 26.88  ? 132 VAL O HG22 1 
ATOM   1980  H  HG23 . VAL A  1 132 ? -50.207 -23.793 -71.452  1.00 26.88  ? 132 VAL O HG23 1 
ATOM   1981  N  N    . MET A  1 133 ? -54.776 -21.928 -70.286  1.00 12.99  ? 133 MET O N    1 
ATOM   1982  C  CA   . MET A  1 133 ? -56.118 -21.427 -70.501  1.00 16.00  ? 133 MET O CA   1 
ATOM   1983  C  C    . MET A  1 133 ? -56.167 -20.574 -71.762  1.00 16.77  ? 133 MET O C    1 
ATOM   1984  O  O    . MET A  1 133 ? -55.328 -19.687 -71.976  1.00 14.55  ? 133 MET O O    1 
ATOM   1985  C  CB   . MET A  1 133 ? -56.584 -20.607 -69.294  1.00 13.73  ? 133 MET O CB   1 
ATOM   1986  C  CG   . MET A  1 133 ? -56.757 -21.427 -68.033  1.00 19.31  ? 133 MET O CG   1 
ATOM   1987  S  SD   . MET A  1 133 ? -58.018 -22.723 -68.227  1.00 18.29  ? 133 MET O SD   1 
ATOM   1988  C  CE   . MET A  1 133 ? -59.491 -21.743 -68.459  1.00 19.58  ? 133 MET O CE   1 
ATOM   1989  H  H    . MET A  1 133 ? -54.429 -21.696 -69.533  1.00 15.59  ? 133 MET O H    1 
ATOM   1990  H  HA   . MET A  1 133 ? -56.722 -22.178 -70.604  1.00 19.20  ? 133 MET O HA   1 
ATOM   1991  H  HB2  . MET A  1 133 ? -55.928 -19.917 -69.111  1.00 16.48  ? 133 MET O HB2  1 
ATOM   1992  H  HB3  . MET A  1 133 ? -57.440 -20.200 -69.503  1.00 16.48  ? 133 MET O HB3  1 
ATOM   1993  H  HG2  . MET A  1 133 ? -55.915 -21.855 -67.814  1.00 23.17  ? 133 MET O HG2  1 
ATOM   1994  H  HG3  . MET A  1 133 ? -57.033 -20.843 -67.309  1.00 23.17  ? 133 MET O HG3  1 
ATOM   1995  H  HE1  . MET A  1 133 ? -60.250 -22.337 -68.576  1.00 23.50  ? 133 MET O HE1  1 
ATOM   1996  H  HE2  . MET A  1 133 ? -59.625 -21.185 -67.677  1.00 23.50  ? 133 MET O HE2  1 
ATOM   1997  H  HE3  . MET A  1 133 ? -59.380 -21.189 -69.247  1.00 23.50  ? 133 MET O HE3  1 
ATOM   1998  N  N    . GLY A  1 134 ? -57.186 -20.837 -72.571  1.00 14.16  ? 134 GLY O N    1 
ATOM   1999  C  CA   . GLY A  1 134 ? -57.416 -20.133 -73.815  1.00 15.07  ? 134 GLY O CA   1 
ATOM   2000  C  C    . GLY A  1 134 ? -56.768 -20.824 -74.999  1.00 15.37  ? 134 GLY O C    1 
ATOM   2001  O  O    . GLY A  1 134 ? -57.089 -20.511 -76.136  1.00 16.28  ? 134 GLY O O    1 
ATOM   2002  H  H    . GLY A  1 134 ? -57.776 -21.441 -72.411  1.00 16.99  ? 134 GLY O H    1 
ATOM   2003  H  HA2  . GLY A  1 134 ? -58.370 -20.070 -73.979  1.00 18.09  ? 134 GLY O HA2  1 
ATOM   2004  H  HA3  . GLY A  1 134 ? -57.056 -19.234 -73.748  1.00 18.09  ? 134 GLY O HA3  1 
ATOM   2005  N  N    . VAL A  1 135 ? -55.861 -21.761 -74.737  1.00 14.72  ? 135 VAL O N    1 
ATOM   2006  C  CA   . VAL A  1 135 ? -55.087 -22.371 -75.804  1.00 15.01  ? 135 VAL O CA   1 
ATOM   2007  C  C    . VAL A  1 135 ? -55.366 -23.863 -75.953  1.00 15.01  ? 135 VAL O C    1 
ATOM   2008  O  O    . VAL A  1 135 ? -55.671 -24.305 -77.051  1.00 15.76  ? 135 VAL O O    1 
ATOM   2009  C  CB   . VAL A  1 135 ? -53.584 -22.136 -75.585  1.00 14.48  ? 135 VAL O CB   1 
ATOM   2010  C  CG1  . VAL A  1 135 ? -52.760 -22.780 -76.712  1.00 14.90  ? 135 VAL O CG1  1 
ATOM   2011  C  CG2  . VAL A  1 135 ? -53.318 -20.662 -75.532  1.00 14.62  ? 135 VAL O CG2  1 
ATOM   2012  H  H    . VAL A  1 135 ? -55.677 -22.059 -73.952  1.00 17.66  ? 135 VAL O H    1 
ATOM   2013  H  HA   . VAL A  1 135 ? -55.330 -21.945 -76.641  1.00 18.01  ? 135 VAL O HA   1 
ATOM   2014  H  HB   . VAL A  1 135 ? -53.313 -22.529 -74.741  1.00 17.37  ? 135 VAL O HB   1 
ATOM   2015  H  HG11 . VAL A  1 135 ? -51.818 -22.616 -76.547  1.00 17.88  ? 135 VAL O HG11 1 
ATOM   2016  H  HG12 . VAL A  1 135 ? -52.933 -23.735 -76.723  1.00 17.88  ? 135 VAL O HG12 1 
ATOM   2017  H  HG13 . VAL A  1 135 ? -53.022 -22.387 -77.559  1.00 17.88  ? 135 VAL O HG13 1 
ATOM   2018  H  HG21 . VAL A  1 135 ? -52.369 -20.517 -75.394  1.00 17.54  ? 135 VAL O HG21 1 
ATOM   2019  H  HG22 . VAL A  1 135 ? -53.595 -20.261 -76.371  1.00 17.54  ? 135 VAL O HG22 1 
ATOM   2020  H  HG23 . VAL A  1 135 ? -53.822 -20.277 -74.799  1.00 17.54  ? 135 VAL O HG23 1 
ATOM   2021  N  N    . ASN A  1 136 ? -55.264 -24.645 -74.883  1.00 14.28  ? 136 ASN O N    1 
ATOM   2022  C  CA   . ASN A  1 136 ? -55.547 -26.082 -74.990  1.00 14.97  ? 136 ASN O CA   1 
ATOM   2023  C  C    . ASN A  1 136 ? -56.268 -26.651 -73.776  1.00 14.35  ? 136 ASN O C    1 
ATOM   2024  O  O    . ASN A  1 136 ? -56.267 -27.864 -73.584  1.00 13.89  ? 136 ASN O O    1 
ATOM   2025  C  CB   . ASN A  1 136 ? -54.255 -26.891 -75.205  1.00 14.09  ? 136 ASN O CB   1 
ATOM   2026  C  CG   . ASN A  1 136 ? -53.463 -27.070 -73.926  1.00 13.64  ? 136 ASN O CG   1 
ATOM   2027  O  OD1  . ASN A  1 136 ? -53.517 -26.224 -73.030  1.00 14.34  ? 136 ASN O OD1  1 
ATOM   2028  N  ND2  . ASN A  1 136 ? -52.721 -28.175 -73.827  1.00 15.55  ? 136 ASN O ND2  1 
ATOM   2029  H  H    . ASN A  1 136 ? -55.038 -24.379 -74.097  1.00 17.14  ? 136 ASN O H    1 
ATOM   2030  H  HA   . ASN A  1 136 ? -56.116 -26.227 -75.762  1.00 17.96  ? 136 ASN O HA   1 
ATOM   2031  H  HB2  . ASN A  1 136 ? -54.485 -27.771 -75.543  1.00 16.91  ? 136 ASN O HB2  1 
ATOM   2032  H  HB3  . ASN A  1 136 ? -53.693 -26.425 -75.845  1.00 16.91  ? 136 ASN O HB3  1 
ATOM   2033  H  HD21 . ASN A  1 136 ? -52.255 -28.319 -73.119  1.00 18.66  ? 136 ASN O HD21 1 
ATOM   2034  H  HD22 . ASN A  1 136 ? -52.710 -28.744 -74.472  1.00 18.66  ? 136 ASN O HD22 1 
ATOM   2035  N  N    . HIS A  1 137 ? -56.883 -25.793 -72.965  1.00 13.79  ? 137 HIS O N    1 
ATOM   2036  C  CA   . HIS A  1 137 ? -57.526 -26.279 -71.751  1.00 13.49  ? 137 HIS O CA   1 
ATOM   2037  C  C    . HIS A  1 137 ? -58.702 -27.199 -72.080  1.00 14.16  ? 137 HIS O C    1 
ATOM   2038  O  O    . HIS A  1 137 ? -59.078 -28.029 -71.263  1.00 14.01  ? 137 HIS O O    1 
ATOM   2039  C  CB   . HIS A  1 137 ? -57.978 -25.105 -70.851  1.00 13.27  ? 137 HIS O CB   1 
ATOM   2040  C  CG   . HIS A  1 137 ? -59.109 -24.299 -71.398  1.00 14.08  ? 137 HIS O CG   1 
ATOM   2041  N  ND1  . HIS A  1 137 ? -58.927 -23.277 -72.301  1.00 16.03  ? 137 HIS O ND1  1 
ATOM   2042  C  CD2  . HIS A  1 137 ? -60.442 -24.338 -71.137  1.00 14.66  ? 137 HIS O CD2  1 
ATOM   2043  C  CE1  . HIS A  1 137 ? -60.096 -22.728 -72.585  1.00 24.70  ? 137 HIS O CE1  1 
ATOM   2044  N  NE2  . HIS A  1 137 ? -61.034 -23.360 -71.899  1.00 19.05  ? 137 HIS O NE2  1 
ATOM   2045  H  H    . HIS A  1 137 ? -56.942 -24.944 -73.092  1.00 16.55  ? 137 HIS O H    1 
ATOM   2046  H  HA   . HIS A  1 137 ? -56.880 -26.800 -71.248  1.00 16.18  ? 137 HIS O HA   1 
ATOM   2047  H  HB2  . HIS A  1 137 ? -58.259 -25.462 -69.994  1.00 15.93  ? 137 HIS O HB2  1 
ATOM   2048  H  HB3  . HIS A  1 137 ? -57.225 -24.506 -70.723  1.00 15.93  ? 137 HIS O HB3  1 
ATOM   2049  H  HD2  . HIS A  1 137 ? -60.874 -24.927 -70.562  1.00 17.59  ? 137 HIS O HD2  1 
ATOM   2050  H  HE1  . HIS A  1 137 ? -60.237 -22.025 -73.178  1.00 29.64  ? 137 HIS O HE1  1 
ATOM   2051  N  N    . GLU A  1 138 ? -59.276 -27.086 -73.281  1.00 15.01  ? 138 GLU O N    1 
ATOM   2052  C  CA   . GLU A  1 138 ? -60.385 -27.979 -73.625  1.00 15.78  ? 138 GLU O CA   1 
ATOM   2053  C  C    . GLU A  1 138 ? -59.896 -29.399 -73.918  1.00 16.30  ? 138 GLU O C    1 
ATOM   2054  O  O    . GLU A  1 138 ? -60.710 -30.314 -74.070  1.00 18.31  ? 138 GLU O O    1 
ATOM   2055  C  CB   . GLU A  1 138 ? -61.182 -27.441 -74.817  1.00 19.50  ? 138 GLU O CB   1 
ATOM   2056  C  CG   . GLU A  1 138 ? -61.901 -26.117 -74.541  1.00 29.50  ? 138 GLU O CG   1 
ATOM   2057  C  CD   . GLU A  1 138 ? -63.008 -26.225 -73.486  1.00 25.59  ? 138 GLU O CD   1 
ATOM   2058  O  OE1  . GLU A  1 138 ? -63.561 -25.182 -73.100  1.00 28.55  ? 138 GLU O OE1  1 
ATOM   2059  O  OE2  . GLU A  1 138 ? -63.333 -27.344 -73.035  1.00 21.33  ? 138 GLU O OE2  1 
ATOM   2060  H  H    . GLU A  1 138 ? -59.054 -26.523 -73.892  1.00 18.01  ? 138 GLU O H    1 
ATOM   2061  H  HA   . GLU A  1 138 ? -60.988 -28.028 -72.867  1.00 18.93  ? 138 GLU O HA   1 
ATOM   2062  H  HB2  . GLU A  1 138 ? -60.575 -27.298 -75.559  1.00 23.41  ? 138 GLU O HB2  1 
ATOM   2063  H  HB3  . GLU A  1 138 ? -61.854 -28.096 -75.064  1.00 23.41  ? 138 GLU O HB3  1 
ATOM   2064  H  HG2  . GLU A  1 138 ? -61.253 -25.468 -74.225  1.00 35.40  ? 138 GLU O HG2  1 
ATOM   2065  H  HG3  . GLU A  1 138 ? -62.306 -25.803 -75.365  1.00 35.40  ? 138 GLU O HG3  1 
ATOM   2066  N  N    . LYS A  1 139 ? -58.579 -29.590 -73.986  1.00 18.64  ? 139 LYS O N    1 
ATOM   2067  C  CA   . LYS A  1 139 ? -58.013 -30.937 -74.157  1.00 17.33  ? 139 LYS O CA   1 
ATOM   2068  C  C    . LYS A  1 139 ? -57.970 -31.703 -72.824  1.00 18.30  ? 139 LYS O C    1 
ATOM   2069  O  O    . LYS A  1 139 ? -57.682 -32.888 -72.810  1.00 20.54  ? 139 LYS O O    1 
ATOM   2070  C  CB   . LYS A  1 139 ? -56.594 -30.877 -74.738  1.00 18.11  ? 139 LYS O CB   1 
ATOM   2071  C  CG   . LYS A  1 139 ? -56.486 -30.292 -76.142  1.00 27.59  ? 139 LYS O CG   1 
ATOM   2072  C  CD   . LYS A  1 139 ? -57.160 -31.187 -77.171  1.00 44.52  ? 139 LYS O CD   1 
ATOM   2073  C  CE   . LYS A  1 139 ? -56.960 -30.653 -78.582  1.00 57.92  ? 139 LYS O CE   1 
ATOM   2074  N  NZ   . LYS A  1 139 ? -57.659 -31.483 -79.602  1.00 64.60  ? 139 LYS O NZ   1 
ATOM   2075  H  H    . LYS A  1 139 ? -57.992 -28.963 -73.935  1.00 22.37  ? 139 LYS O H    1 
ATOM   2076  H  HA   . LYS A  1 139 ? -58.569 -31.437 -74.774  1.00 20.80  ? 139 LYS O HA   1 
ATOM   2077  H  HB2  . LYS A  1 139 ? -56.045 -30.332 -74.153  1.00 21.73  ? 139 LYS O HB2  1 
ATOM   2078  H  HB3  . LYS A  1 139 ? -56.237 -31.778 -74.770  1.00 21.73  ? 139 LYS O HB3  1 
ATOM   2079  H  HG2  . LYS A  1 139 ? -56.920 -29.425 -76.162  1.00 33.11  ? 139 LYS O HG2  1 
ATOM   2080  H  HG3  . LYS A  1 139 ? -55.550 -30.204 -76.382  1.00 33.11  ? 139 LYS O HG3  1 
ATOM   2081  H  HD2  . LYS A  1 139 ? -56.775 -32.076 -77.124  1.00 53.43  ? 139 LYS O HD2  1 
ATOM   2082  H  HD3  . LYS A  1 139 ? -58.112 -31.223 -76.991  1.00 53.43  ? 139 LYS O HD3  1 
ATOM   2083  H  HE2  . LYS A  1 139 ? -57.313 -29.751 -78.634  1.00 69.51  ? 139 LYS O HE2  1 
ATOM   2084  H  HE3  . LYS A  1 139 ? -56.012 -30.653 -78.791  1.00 69.51  ? 139 LYS O HE3  1 
ATOM   2085  H  HZ1  . LYS A  1 139 ? -57.523 -31.146 -80.414  1.00 77.53  ? 139 LYS O HZ1  1 
ATOM   2086  H  HZ2  . LYS A  1 139 ? -57.349 -32.317 -79.580  1.00 77.53  ? 139 LYS O HZ2  1 
ATOM   2087  H  HZ3  . LYS A  1 139 ? -58.533 -31.495 -79.437  1.00 77.53  ? 139 LYS O HZ3  1 
ATOM   2088  N  N    . TYR A  1 140 ? -58.229 -31.023 -71.710  1.00 16.28  ? 140 TYR O N    1 
ATOM   2089  C  CA   . TYR A  1 140 ? -58.255 -31.691 -70.409  1.00 16.35  ? 140 TYR O CA   1 
ATOM   2090  C  C    . TYR A  1 140 ? -59.405 -32.678 -70.379  1.00 20.22  ? 140 TYR O C    1 
ATOM   2091  O  O    . TYR A  1 140 ? -60.449 -32.406 -70.929  1.00 16.66  ? 140 TYR O O    1 
ATOM   2092  C  CB   . TYR A  1 140 ? -58.399 -30.686 -69.267  1.00 15.49  ? 140 TYR O CB   1 
ATOM   2093  C  CG   . TYR A  1 140 ? -58.763 -31.326 -67.949  1.00 13.17  ? 140 TYR O CG   1 
ATOM   2094  C  CD1  . TYR A  1 140 ? -57.789 -31.823 -67.109  1.00 13.58  ? 140 TYR O CD1  1 
ATOM   2095  C  CD2  . TYR A  1 140 ? -60.094 -31.469 -67.564  1.00 17.12  ? 140 TYR O CD2  1 
ATOM   2096  C  CE1  . TYR A  1 140 ? -58.115 -32.431 -65.927  1.00 17.31  ? 140 TYR O CE1  1 
ATOM   2097  C  CE2  . TYR A  1 140 ? -60.419 -32.066 -66.380  1.00 18.62  ? 140 TYR O CE2  1 
ATOM   2098  C  CZ   . TYR A  1 140 ? -59.421 -32.543 -65.566  1.00 13.15  ? 140 TYR O CZ   1 
ATOM   2099  O  OH   . TYR A  1 140 ? -59.725 -33.139 -64.375  1.00 18.98  ? 140 TYR O OH   1 
ATOM   2100  H  H    . TYR A  1 140 ? -58.393 -30.179 -71.678  1.00 19.53  ? 140 TYR O H    1 
ATOM   2101  H  HA   . TYR A  1 140 ? -57.428 -32.182 -70.283  1.00 19.62  ? 140 TYR O HA   1 
ATOM   2102  H  HB2  . TYR A  1 140 ? -57.556 -30.221 -69.150  1.00 18.59  ? 140 TYR O HB2  1 
ATOM   2103  H  HB3  . TYR A  1 140 ? -59.097 -30.051 -69.493  1.00 18.59  ? 140 TYR O HB3  1 
ATOM   2104  H  HD1  . TYR A  1 140 ? -56.895 -31.749 -67.353  1.00 16.29  ? 140 TYR O HD1  1 
ATOM   2105  H  HD2  . TYR A  1 140 ? -60.770 -31.145 -68.115  1.00 20.54  ? 140 TYR O HD2  1 
ATOM   2106  H  HE1  . TYR A  1 140 ? -57.446 -32.752 -65.367  1.00 20.77  ? 140 TYR O HE1  1 
ATOM   2107  H  HE2  . TYR A  1 140 ? -61.310 -32.149 -66.127  1.00 22.35  ? 140 TYR O HE2  1 
ATOM   2108  H  HH   . TYR A  1 140 ? -60.558 -33.149 -64.263  1.00 22.77  ? 140 TYR O HH   1 
ATOM   2109  N  N    . ASP A  1 141 ? -59.210 -33.831 -69.751  1.00 18.19  ? 141 ASP O N    1 
ATOM   2110  C  CA   . ASP A  1 141 ? -60.320 -34.751 -69.539  1.00 17.85  ? 141 ASP O CA   1 
ATOM   2111  C  C    . ASP A  1 141 ? -60.189 -35.391 -68.147  1.00 18.72  ? 141 ASP O C    1 
ATOM   2112  O  O    . ASP A  1 141 ? -59.129 -35.315 -67.517  1.00 18.18  ? 141 ASP O O    1 
ATOM   2113  C  CB   . ASP A  1 141 ? -60.362 -35.820 -70.648  1.00 25.67  ? 141 ASP O CB   1 
ATOM   2114  C  CG   . ASP A  1 141 ? -59.277 -36.876 -70.491  1.00 35.17  ? 141 ASP O CG   1 
ATOM   2115  O  OD1  . ASP A  1 141 ? -59.449 -37.794 -69.660  1.00 39.46  ? 141 ASP O OD1  1 
ATOM   2116  O  OD2  . ASP A  1 141 ? -58.258 -36.802 -71.209  1.00 37.70  ? 141 ASP O OD2  1 
ATOM   2117  H  H    . ASP A  1 141 ? -58.455 -34.102 -69.441  1.00 21.83  ? 141 ASP O H    1 
ATOM   2118  H  HA   . ASP A  1 141 ? -61.153 -34.255 -69.566  1.00 21.42  ? 141 ASP O HA   1 
ATOM   2119  H  HB2  . ASP A  1 141 ? -61.222 -36.268 -70.623  1.00 30.80  ? 141 ASP O HB2  1 
ATOM   2120  H  HB3  . ASP A  1 141 ? -60.238 -35.388 -71.508  1.00 30.80  ? 141 ASP O HB3  1 
ATOM   2121  N  N    . ASN A  1 142 ? -61.271 -36.008 -67.682  1.00 18.31  ? 142 ASN O N    1 
ATOM   2122  C  CA   . ASN A  1 142 ? -61.379 -36.532 -66.316  1.00 21.21  ? 142 ASN O CA   1 
ATOM   2123  C  C    . ASN A  1 142 ? -60.435 -37.668 -65.928  1.00 21.44  ? 142 ASN O C    1 
ATOM   2124  O  O    . ASN A  1 142 ? -60.334 -37.986 -64.752  1.00 21.39  ? 142 ASN O O    1 
ATOM   2125  C  CB   . ASN A  1 142 ? -62.805 -37.018 -66.067  1.00 29.36  ? 142 ASN O CB   1 
ATOM   2126  C  CG   . ASN A  1 142 ? -63.802 -35.893 -66.053  1.00 34.73  ? 142 ASN O CG   1 
ATOM   2127  O  OD1  . ASN A  1 142 ? -63.429 -34.730 -65.942  1.00 31.08  ? 142 ASN O OD1  1 
ATOM   2128  N  ND2  . ASN A  1 142 ? -65.083 -36.227 -66.177  1.00 28.92  ? 142 ASN O ND2  1 
ATOM   2129  H  H    . ASN A  1 142 ? -61.980 -36.140 -68.152  1.00 21.97  ? 142 ASN O H    1 
ATOM   2130  H  HA   . ASN A  1 142 ? -61.213 -35.802 -65.700  1.00 25.45  ? 142 ASN O HA   1 
ATOM   2131  H  HB2  . ASN A  1 142 ? -63.057 -37.635 -66.772  1.00 35.23  ? 142 ASN O HB2  1 
ATOM   2132  H  HB3  . ASN A  1 142 ? -62.842 -37.464 -65.206  1.00 35.23  ? 142 ASN O HB3  1 
ATOM   2133  H  HD21 . ASN A  1 142 ? -65.689 -35.617 -66.174  1.00 34.70  ? 142 ASN O HD21 1 
ATOM   2134  H  HD22 . ASN A  1 142 ? -65.306 -37.054 -66.260  1.00 34.70  ? 142 ASN O HD22 1 
ATOM   2135  N  N    . SER A  1 143 ? -59.770 -38.294 -66.893  1.00 16.46  ? 143 SER O N    1 
ATOM   2136  C  CA   . SER A  1 143 ? -58.779 -39.324 -66.581  1.00 24.47  ? 143 SER O CA   1 
ATOM   2137  C  C    . SER A  1 143 ? -57.457 -38.736 -66.051  1.00 21.82  ? 143 SER O C    1 
ATOM   2138  O  O    . SER A  1 143 ? -56.617 -39.459 -65.528  1.00 19.01  ? 143 SER O O    1 
ATOM   2139  C  CB   . SER A  1 143 ? -58.487 -40.168 -67.817  1.00 23.15  ? 143 SER O CB   1 
ATOM   2140  O  OG   . SER A  1 143 ? -57.635 -39.467 -68.715  1.00 24.47  ? 143 SER O OG   1 
ATOM   2141  H  H    . SER A  1 143 ? -59.871 -38.144 -67.733  1.00 19.76  ? 143 SER O H    1 
ATOM   2142  H  HA   . SER A  1 143 ? -59.140 -39.910 -65.897  1.00 29.36  ? 143 SER O HA   1 
ATOM   2143  H  HB2  . SER A  1 143 ? -58.050 -40.990 -67.543  1.00 27.78  ? 143 SER O HB2  1 
ATOM   2144  H  HB3  . SER A  1 143 ? -59.323 -40.370 -68.267  1.00 27.78  ? 143 SER O HB3  1 
ATOM   2145  H  HG   . SER A  1 143 ? -58.001 -38.751 -68.960  1.00 29.36  ? 143 SER O HG   1 
ATOM   2146  N  N    . LEU A  1 144 ? -57.260 -37.430 -66.197  1.00 16.88  ? 144 LEU O N    1 
ATOM   2147  C  CA   . LEU A  1 144 ? -56.000 -36.810 -65.778  1.00 16.12  ? 144 LEU O CA   1 
ATOM   2148  C  C    . LEU A  1 144 ? -56.038 -36.360 -64.324  1.00 19.72  ? 144 LEU O C    1 
ATOM   2149  O  O    . LEU A  1 144 ? -56.657 -35.351 -63.982  1.00 19.52  ? 144 LEU O O    1 
ATOM   2150  C  CB   . LEU A  1 144 ? -55.675 -35.624 -66.673  1.00 15.21  ? 144 LEU O CB   1 
ATOM   2151  C  CG   . LEU A  1 144 ? -55.760 -35.925 -68.174  1.00 14.10  ? 144 LEU O CG   1 
ATOM   2152  C  CD1  . LEU A  1 144 ? -55.385 -34.680 -68.936  1.00 18.18  ? 144 LEU O CD1  1 
ATOM   2153  C  CD2  . LEU A  1 144 ? -54.876 -37.095 -68.579  1.00 21.80  ? 144 LEU O CD2  1 
ATOM   2154  H  H    . LEU A  1 144 ? -57.832 -36.882 -66.533  1.00 20.26  ? 144 LEU O H    1 
ATOM   2155  H  HA   . LEU A  1 144 ? -55.285 -37.459 -65.871  1.00 19.34  ? 144 LEU O HA   1 
ATOM   2156  H  HB2  . LEU A  1 144 ? -56.301 -34.908 -66.480  1.00 18.25  ? 144 LEU O HB2  1 
ATOM   2157  H  HB3  . LEU A  1 144 ? -54.771 -35.328 -66.481  1.00 18.25  ? 144 LEU O HB3  1 
ATOM   2158  H  HG   . LEU A  1 144 ? -56.676 -36.149 -68.399  1.00 16.93  ? 144 LEU O HG   1 
ATOM   2159  H  HD11 . LEU A  1 144 ? -55.437 -34.865 -69.887  1.00 21.81  ? 144 LEU O HD11 1 
ATOM   2160  H  HD12 . LEU A  1 144 ? -56.003 -33.969 -68.703  1.00 21.81  ? 144 LEU O HD12 1 
ATOM   2161  H  HD13 . LEU A  1 144 ? -54.481 -34.424 -68.697  1.00 21.81  ? 144 LEU O HD13 1 
ATOM   2162  H  HD21 . LEU A  1 144 ? -54.966 -37.243 -69.533  1.00 26.15  ? 144 LEU O HD21 1 
ATOM   2163  H  HD22 . LEU A  1 144 ? -53.955 -36.885 -68.362  1.00 26.15  ? 144 LEU O HD22 1 
ATOM   2164  H  HD23 . LEU A  1 144 ? -55.159 -37.886 -68.093  1.00 26.15  ? 144 LEU O HD23 1 
ATOM   2165  N  N    . LYS A  1 145 ? -55.366 -37.107 -63.462  1.00 12.66  ? 145 LYS O N    1 
ATOM   2166  C  CA   . LYS A  1 145 ? -55.372 -36.770 -62.048  1.00 13.41  ? 145 LYS O CA   1 
ATOM   2167  C  C    . LYS A  1 145 ? -54.258 -35.788 -61.660  1.00 11.86  ? 145 LYS O C    1 
ATOM   2168  O  O    . LYS A  1 145 ? -54.335 -35.114 -60.635  1.00 13.63  ? 145 LYS O O    1 
ATOM   2169  C  CB   . LYS A  1 145 ? -55.277 -38.053 -61.233  1.00 12.94  ? 145 LYS O CB   1 
ATOM   2170  C  CG   . LYS A  1 145 ? -56.532 -38.927 -61.375  1.00 14.66  ? 145 LYS O CG   1 
ATOM   2171  C  CD   . LYS A  1 145 ? -56.518 -40.089 -60.420  1.00 26.15  ? 145 LYS O CD   1 
ATOM   2172  C  CE   . LYS A  1 145 ? -57.855 -40.823 -60.458  1.00 53.98  ? 145 LYS O CE   1 
ATOM   2173  N  NZ   . LYS A  1 145 ? -58.130 -41.533 -59.177  1.00 72.92  ? 145 LYS O NZ   1 
ATOM   2174  H  H    . LYS A  1 145 ? -54.906 -37.804 -63.665  1.00 15.19  ? 145 LYS O H    1 
ATOM   2175  H  HA   . LYS A  1 145 ? -56.219 -36.350 -61.834  1.00 16.09  ? 145 LYS O HA   1 
ATOM   2176  H  HB2  . LYS A  1 145 ? -54.515 -38.568 -61.539  1.00 15.53  ? 145 LYS O HB2  1 
ATOM   2177  H  HB3  . LYS A  1 145 ? -55.172 -37.827 -60.296  1.00 15.53  ? 145 LYS O HB3  1 
ATOM   2178  H  HG2  . LYS A  1 145 ? -57.318 -38.390 -61.186  1.00 17.60  ? 145 LYS O HG2  1 
ATOM   2179  H  HG3  . LYS A  1 145 ? -56.576 -39.278 -62.278  1.00 17.60  ? 145 LYS O HG3  1 
ATOM   2180  H  HD2  . LYS A  1 145 ? -55.819 -40.710 -60.676  1.00 31.38  ? 145 LYS O HD2  1 
ATOM   2181  H  HD3  . LYS A  1 145 ? -56.371 -39.765 -59.518  1.00 31.38  ? 145 LYS O HD3  1 
ATOM   2182  H  HE2  . LYS A  1 145 ? -58.567 -40.182 -60.609  1.00 64.78  ? 145 LYS O HE2  1 
ATOM   2183  H  HE3  . LYS A  1 145 ? -57.838 -41.480 -61.172  1.00 64.78  ? 145 LYS O HE3  1 
ATOM   2184  H  HZ1  . LYS A  1 145 ? -58.154 -40.949 -58.506  1.00 87.50  ? 145 LYS O HZ1  1 
ATOM   2185  H  HZ2  . LYS A  1 145 ? -58.913 -41.952 -59.224  1.00 87.50  ? 145 LYS O HZ2  1 
ATOM   2186  H  HZ3  . LYS A  1 145 ? -57.490 -42.131 -59.018  1.00 87.50  ? 145 LYS O HZ3  1 
ATOM   2187  N  N    . ILE A  1 146 ? -53.223 -35.703 -62.481  1.00 13.11  ? 146 ILE O N    1 
ATOM   2188  C  CA   . ILE A  1 146 ? -52.112 -34.825 -62.178  1.00 11.05  ? 146 ILE O CA   1 
ATOM   2189  C  C    . ILE A  1 146 ? -51.768 -34.043 -63.422  1.00 12.71  ? 146 ILE O C    1 
ATOM   2190  O  O    . ILE A  1 146 ? -51.383 -34.621 -64.429  1.00 11.11  ? 146 ILE O O    1 
ATOM   2191  C  CB   . ILE A  1 146 ? -50.867 -35.598 -61.698  1.00 11.42  ? 146 ILE O CB   1 
ATOM   2192  C  CG1  . ILE A  1 146 ? -51.191 -36.538 -60.529  1.00 14.03  ? 146 ILE O CG1  1 
ATOM   2193  C  CG2  . ILE A  1 146 ? -49.760 -34.625 -61.340  1.00 11.04  ? 146 ILE O CG2  1 
ATOM   2194  C  CD1  . ILE A  1 146 ? -50.068 -37.495 -60.216  1.00 17.90  ? 146 ILE O CD1  1 
ATOM   2195  H  H    . ILE A  1 146 ? -53.142 -36.141 -63.217  1.00 15.73  ? 146 ILE O H    1 
ATOM   2196  H  HA   . ILE A  1 146 ? -52.373 -34.201 -61.484  1.00 13.26  ? 146 ILE O HA   1 
ATOM   2197  H  HB   . ILE A  1 146 ? -50.554 -36.143 -62.436  1.00 13.71  ? 146 ILE O HB   1 
ATOM   2198  H  HG12 . ILE A  1 146 ? -51.362 -36.008 -59.735  1.00 16.84  ? 146 ILE O HG12 1 
ATOM   2199  H  HG13 . ILE A  1 146 ? -51.976 -37.061 -60.753  1.00 16.84  ? 146 ILE O HG13 1 
ATOM   2200  H  HG21 . ILE A  1 146 ? -48.985 -35.126 -61.040  1.00 13.25  ? 146 ILE O HG21 1 
ATOM   2201  H  HG22 . ILE A  1 146 ? -49.533 -34.103 -62.125  1.00 13.25  ? 146 ILE O HG22 1 
ATOM   2202  H  HG23 . ILE A  1 146 ? -50.071 -34.040 -60.631  1.00 13.25  ? 146 ILE O HG23 1 
ATOM   2203  H  HD11 . ILE A  1 146 ? -50.332 -38.059 -59.473  1.00 21.48  ? 146 ILE O HD11 1 
ATOM   2204  H  HD12 . ILE A  1 146 ? -49.891 -38.040 -60.999  1.00 21.48  ? 146 ILE O HD12 1 
ATOM   2205  H  HD13 . ILE A  1 146 ? -49.276 -36.986 -59.981  1.00 21.48  ? 146 ILE O HD13 1 
ATOM   2206  N  N    . ILE A  1 147 ? -51.916 -32.723 -63.359  1.00 10.46  ? 147 ILE O N    1 
ATOM   2207  C  CA   . ILE A  1 147 ? -51.601 -31.877 -64.510  1.00 10.36  ? 147 ILE O CA   1 
ATOM   2208  C  C    . ILE A  1 147 ? -50.759 -30.676 -64.099  1.00 11.33  ? 147 ILE O C    1 
ATOM   2209  O  O    . ILE A  1 147 ? -50.533 -30.439 -62.924  1.00 11.33  ? 147 ILE O O    1 
ATOM   2210  C  CB   . ILE A  1 147 ? -52.872 -31.373 -65.209  1.00 11.28  ? 147 ILE O CB   1 
ATOM   2211  C  CG1  . ILE A  1 147 ? -53.698 -30.485 -64.273  1.00 10.36  ? 147 ILE O CG1  1 
ATOM   2212  C  CG2  . ILE A  1 147 ? -53.739 -32.559 -65.673  1.00 14.57  ? 147 ILE O CG2  1 
ATOM   2213  C  CD1  . ILE A  1 147 ? -54.841 -29.786 -64.974  1.00 16.08  ? 147 ILE O CD1  1 
ATOM   2214  H  H    . ILE A  1 147 ? -52.196 -32.294 -62.668  1.00 12.55  ? 147 ILE O H    1 
ATOM   2215  H  HA   . ILE A  1 147 ? -51.091 -32.395 -65.152  1.00 12.43  ? 147 ILE O HA   1 
ATOM   2216  H  HB   . ILE A  1 147 ? -52.614 -30.852 -65.986  1.00 13.54  ? 147 ILE O HB   1 
ATOM   2217  H  HG12 . ILE A  1 147 ? -54.073 -31.035 -63.566  1.00 12.43  ? 147 ILE O HG12 1 
ATOM   2218  H  HG13 . ILE A  1 147 ? -53.121 -29.806 -63.892  1.00 12.43  ? 147 ILE O HG13 1 
ATOM   2219  H  HG21 . ILE A  1 147 ? -54.534 -32.216 -66.111  1.00 17.49  ? 147 ILE O HG21 1 
ATOM   2220  H  HG22 . ILE A  1 147 ? -53.227 -33.101 -66.294  1.00 17.49  ? 147 ILE O HG22 1 
ATOM   2221  H  HG23 . ILE A  1 147 ? -53.989 -33.089 -64.900  1.00 17.49  ? 147 ILE O HG23 1 
ATOM   2222  H  HD11 . ILE A  1 147 ? -55.322 -29.243 -64.329  1.00 19.29  ? 147 ILE O HD11 1 
ATOM   2223  H  HD12 . ILE A  1 147 ? -54.482 -29.224 -65.678  1.00 19.29  ? 147 ILE O HD12 1 
ATOM   2224  H  HD13 . ILE A  1 147 ? -55.434 -30.453 -65.353  1.00 19.29  ? 147 ILE O HD13 1 
ATOM   2225  N  N    . SER A  1 148 ? -50.313 -29.929 -65.098  1.00 9.92   ? 148 SER O N    1 
ATOM   2226  C  CA   . SER A  1 148 ? -49.483 -28.744 -64.923  1.00 9.64   ? 148 SER O CA   1 
ATOM   2227  C  C    . SER A  1 148 ? -50.129 -27.582 -65.643  1.00 9.67   ? 148 SER O C    1 
ATOM   2228  O  O    . SER A  1 148 ? -50.728 -27.746 -66.720  1.00 12.36  ? 148 SER O O    1 
ATOM   2229  C  CB   . SER A  1 148 ? -48.076 -28.979 -65.477  1.00 11.15  ? 148 SER O CB   1 
ATOM   2230  O  OG   . SER A  1 148 ? -47.429 -27.770 -65.869  1.00 10.41  ? 148 SER O OG   1 
ATOM   2231  H  H    . SER A  1 148 ? -50.487 -30.096 -65.923  1.00 11.90  ? 148 SER O H    1 
ATOM   2232  H  HA   . SER A  1 148 ? -49.414 -28.527 -63.980  1.00 11.57  ? 148 SER O HA   1 
ATOM   2233  H  HB2  . SER A  1 148 ? -47.541 -29.409 -64.791  1.00 13.38  ? 148 SER O HB2  1 
ATOM   2234  H  HB3  . SER A  1 148 ? -48.141 -29.561 -66.251  1.00 13.38  ? 148 SER O HB3  1 
ATOM   2235  H  HG   . SER A  1 148 ? -47.358 -27.255 -65.209  1.00 12.49  ? 148 SER O HG   1 
ATOM   2236  N  N    . ASN A  1 149 ? -50.006 -26.407 -65.040  1.00 10.97  ? 149 ASN O N    1 
ATOM   2237  C  CA   . ASN A  1 149 ? -50.463 -25.163 -65.652  1.00 9.76   ? 149 ASN O CA   1 
ATOM   2238  C  C    . ASN A  1 149 ? -49.326 -24.421 -66.367  1.00 13.81  ? 149 ASN O C    1 
ATOM   2239  O  O    . ASN A  1 149 ? -49.448 -23.232 -66.656  1.00 12.87  ? 149 ASN O O    1 
ATOM   2240  C  CB   . ASN A  1 149 ? -51.091 -24.272 -64.577  1.00 10.07  ? 149 ASN O CB   1 
ATOM   2241  C  CG   . ASN A  1 149 ? -51.930 -23.158 -65.157  1.00 19.09  ? 149 ASN O CG   1 
ATOM   2242  O  OD1  . ASN A  1 149 ? -52.736 -23.374 -66.059  1.00 22.59  ? 149 ASN O OD1  1 
ATOM   2243  N  ND2  . ASN A  1 149 ? -51.724 -21.942 -64.658  1.00 20.07  ? 149 ASN O ND2  1 
ATOM   2244  H  H    . ASN A  1 149 ? -49.655 -26.301 -64.262  1.00 13.16  ? 149 ASN O H    1 
ATOM   2245  H  HA   . ASN A  1 149 ? -51.146 -25.368 -66.309  1.00 11.71  ? 149 ASN O HA   1 
ATOM   2246  H  HB2  . ASN A  1 149 ? -51.663 -24.814 -64.012  1.00 12.08  ? 149 ASN O HB2  1 
ATOM   2247  H  HB3  . ASN A  1 149 ? -50.385 -23.870 -64.047  1.00 12.08  ? 149 ASN O HB3  1 
ATOM   2248  H  HD21 . ASN A  1 149 ? -52.176 -21.273 -64.954  1.00 24.08  ? 149 ASN O HD21 1 
ATOM   2249  H  HD22 . ASN A  1 149 ? -51.139 -21.825 -64.039  1.00 24.08  ? 149 ASN O HD22 1 
ATOM   2250  N  N    . ALA A  1 150 ? -48.226 -25.131 -66.644  1.00 11.83  ? 150 ALA O N    1 
ATOM   2251  C  CA   . ALA A  1 150 ? -47.077 -24.588 -67.361  1.00 12.41  ? 150 ALA O CA   1 
ATOM   2252  C  C    . ALA A  1 150 ? -46.400 -23.467 -66.534  1.00 13.59  ? 150 ALA O C    1 
ATOM   2253  O  O    . ALA A  1 150 ? -46.575 -23.394 -65.328  1.00 16.12  ? 150 ALA O O    1 
ATOM   2254  C  CB   . ALA A  1 150 ? -47.510 -24.075 -68.766  1.00 11.49  ? 150 ALA O CB   1 
ATOM   2255  H  H    . ALA A  1 150 ? -48.124 -25.954 -66.418  1.00 14.20  ? 150 ALA O H    1 
ATOM   2256  H  HA   . ALA A  1 150 ? -46.427 -25.296 -67.491  1.00 14.89  ? 150 ALA O HA   1 
ATOM   2257  H  HB1  . ALA A  1 150 ? -46.733 -23.719 -69.224  1.00 13.79  ? 150 ALA O HB1  1 
ATOM   2258  H  HB2  . ALA A  1 150 ? -47.883 -24.815 -69.270  1.00 13.79  ? 150 ALA O HB2  1 
ATOM   2259  H  HB3  . ALA A  1 150 ? -48.177 -23.380 -68.655  1.00 13.79  ? 150 ALA O HB3  1 
ATOM   2260  N  N    . SER A  1 151 ? -45.635 -22.607 -67.184  1.00 14.94  ? 151 SER O N    1 
ATOM   2261  C  CA   . SER A  1 151 ? -45.000 -21.463 -66.520  1.00 15.99  ? 151 SER O CA   1 
ATOM   2262  C  C    . SER A  1 151 ? -45.695 -20.139 -66.821  1.00 16.33  ? 151 SER O C    1 
ATOM   2263  O  O    . SER A  1 151 ? -46.511 -20.056 -67.747  1.00 11.95  ? 151 SER O O    1 
ATOM   2264  C  CB   . SER A  1 151 ? -43.548 -21.353 -66.961  1.00 18.95  ? 151 SER O CB   1 
ATOM   2265  O  OG   . SER A  1 151 ? -43.480 -21.023 -68.335  1.00 14.93  ? 151 SER O OG   1 
ATOM   2266  H  H    . SER A  1 151 ? -45.461 -22.659 -68.025  1.00 17.92  ? 151 SER O H    1 
ATOM   2267  H  HA   . SER A  1 151 ? -45.017 -21.602 -65.560  1.00 19.18  ? 151 SER O HA   1 
ATOM   2268  H  HB2  . SER A  1 151 ? -43.111 -20.658 -66.445  1.00 22.74  ? 151 SER O HB2  1 
ATOM   2269  H  HB3  . SER A  1 151 ? -43.106 -22.204 -66.816  1.00 22.74  ? 151 SER O HB3  1 
ATOM   2270  H  HG   . SER A  1 151 ? -42.678 -20.963 -68.576  1.00 17.92  ? 151 SER O HG   1 
ATOM   2271  N  N    . CYS A  1 152 ? -45.347 -19.106 -66.050  1.00 9.95   ? 152 CYS O N    1 
ATOM   2272  C  CA   A CYS A  1 152 ? -45.843 -17.752 -66.303  0.61 9.70   ? 152 CYS O CA   1 
ATOM   2273  C  CA   B CYS A  1 152 ? -45.824 -17.748 -66.305  0.39 15.11  ? 152 CYS O CA   1 
ATOM   2274  C  C    . CYS A  1 152 ? -45.485 -17.351 -67.730  1.00 10.27  ? 152 CYS O C    1 
ATOM   2275  O  O    . CYS A  1 152 ? -46.328 -16.819 -68.470  1.00 12.85  ? 152 CYS O O    1 
ATOM   2276  C  CB   A CYS A  1 152 ? -45.283 -16.754 -65.270  0.61 18.84  ? 152 CYS O CB   1 
ATOM   2277  C  CB   B CYS A  1 152 ? -45.194 -16.750 -65.312  0.39 20.84  ? 152 CYS O CB   1 
ATOM   2278  S  SG   A CYS A  1 152 ? -43.599 -17.133 -64.613  0.61 13.69  ? 152 CYS O SG   1 
ATOM   2279  S  SG   B CYS A  1 152 ? -43.337 -16.544 -65.415  0.39 13.81  ? 152 CYS O SG   1 
ATOM   2280  H  H    . CYS A  1 152 ? -44.826 -19.167 -65.369  1.00 11.94  ? 152 CYS O H    1 
ATOM   2281  H  HA   . CYS A  1 152 ? -46.799 -17.735 -66.213  0.61 18.13  ? 152 CYS O HA   1 
ATOM   2282  H  HB2  A CYS A  1 152 ? -45.242 -15.878 -65.683  0.61 22.60  ? 152 CYS O HB2  1 
ATOM   2283  H  HB2  B CYS A  1 152 ? -45.589 -15.877 -65.465  0.39 25.01  ? 152 CYS O HB2  1 
ATOM   2284  H  HB3  A CYS A  1 152 ? -45.889 -16.726 -64.513  0.61 22.60  ? 152 CYS O HB3  1 
ATOM   2285  H  HB3  B CYS A  1 152 ? -45.402 -17.044 -64.411  0.39 25.01  ? 152 CYS O HB3  1 
ATOM   2286  H  HG   A CYS A  1 152 ? -43.288 -16.283 -63.825  0.61 16.42  ? 152 CYS O HG   1 
ATOM   2287  H  HG   B CYS A  1 152 ? -42.986 -15.745 -64.592  0.39 16.58  ? 152 CYS O HG   1 
ATOM   2288  N  N    . THR A  1 153 ? -44.254 -17.650 -68.137  1.00 8.80   ? 153 THR O N    1 
ATOM   2289  C  CA   . THR A  1 153 ? -43.780 -17.271 -69.460  1.00 9.45   ? 153 THR O CA   1 
ATOM   2290  C  C    . THR A  1 153 ? -44.492 -18.044 -70.582  1.00 12.33  ? 153 THR O C    1 
ATOM   2291  O  O    . THR A  1 153 ? -44.851 -17.464 -71.625  1.00 9.74   ? 153 THR O O    1 
ATOM   2292  C  CB   . THR A  1 153 ? -42.247 -17.461 -69.573  1.00 12.03  ? 153 THR O CB   1 
ATOM   2293  O  OG1  . THR A  1 153 ? -41.594 -16.696 -68.545  1.00 12.01  ? 153 THR O OG1  1 
ATOM   2294  C  CG2  . THR A  1 153 ? -41.755 -16.973 -70.935  1.00 8.84   ? 153 THR O CG2  1 
ATOM   2295  H  H    . THR A  1 153 ? -43.675 -18.074 -67.663  1.00 10.56  ? 153 THR O H    1 
ATOM   2296  H  HA   . THR A  1 153 ? -43.966 -16.329 -69.593  1.00 11.34  ? 153 THR O HA   1 
ATOM   2297  H  HB   . THR A  1 153 ? -42.024 -18.400 -69.477  1.00 14.44  ? 153 THR O HB   1 
ATOM   2298  H  HG1  . THR A  1 153 ? -41.779 -15.881 -68.632  1.00 14.41  ? 153 THR O HG1  1 
ATOM   2299  H  HG21 . THR A  1 153 ? -40.795 -17.093 -71.003  1.00 10.61  ? 153 THR O HG21 1 
ATOM   2300  H  HG22 . THR A  1 153 ? -42.186 -17.476 -71.643  1.00 10.61  ? 153 THR O HG22 1 
ATOM   2301  H  HG23 . THR A  1 153 ? -41.963 -16.032 -71.045  1.00 10.61  ? 153 THR O HG23 1 
ATOM   2302  N  N    . THR A  1 154 ? -44.727 -19.330 -70.374  1.00 9.15   ? 154 THR O N    1 
ATOM   2303  C  CA   . THR A  1 154 ? -45.468 -20.106 -71.367  1.00 9.40   ? 154 THR O CA   1 
ATOM   2304  C  C    . THR A  1 154 ? -46.909 -19.580 -71.501  1.00 9.60   ? 154 THR O C    1 
ATOM   2305  O  O    . THR A  1 154 ? -47.445 -19.528 -72.612  1.00 10.61  ? 154 THR O O    1 
ATOM   2306  C  CB   . THR A  1 154 ? -45.471 -21.599 -71.024  1.00 12.32  ? 154 THR O CB   1 
ATOM   2307  O  OG1  . THR A  1 154 ? -44.121 -22.088 -71.071  1.00 17.22  ? 154 THR O OG1  1 
ATOM   2308  C  CG2  . THR A  1 154 ? -46.331 -22.393 -72.021  1.00 13.00  ? 154 THR O CG2  1 
ATOM   2309  H  H    . THR A  1 154 ? -44.476 -19.775 -69.682  1.00 10.98  ? 154 THR O H    1 
ATOM   2310  H  HA   . THR A  1 154 ? -45.034 -20.003 -72.228  1.00 11.29  ? 154 THR O HA   1 
ATOM   2311  H  HB   . THR A  1 154 ? -45.833 -21.727 -70.133  1.00 14.78  ? 154 THR O HB   1 
ATOM   2312  H  HG1  . THR A  1 154 ? -43.802 -21.977 -71.840  1.00 20.66  ? 154 THR O HG1  1 
ATOM   2313  H  HG21 . THR A  1 154 ? -46.321 -23.335 -71.789  1.00 15.60  ? 154 THR O HG21 1 
ATOM   2314  H  HG22 . THR A  1 154 ? -47.246 -22.072 -71.999  1.00 15.60  ? 154 THR O HG22 1 
ATOM   2315  H  HG23 . THR A  1 154 ? -45.981 -22.287 -72.919  1.00 15.60  ? 154 THR O HG23 1 
ATOM   2316  N  N    . ASN A  1 155 ? -47.519 -19.179 -70.384  1.00 9.83   ? 155 ASN O N    1 
ATOM   2317  C  CA   . ASN A  1 155 ? -48.869 -18.609 -70.426  1.00 12.37  ? 155 ASN O CA   1 
ATOM   2318  C  C    . ASN A  1 155 ? -48.915 -17.244 -71.109  1.00 12.18  ? 155 ASN O C    1 
ATOM   2319  O  O    . ASN A  1 155 ? -49.954 -16.829 -71.603  1.00 11.70  ? 155 ASN O O    1 
ATOM   2320  C  CB   . ASN A  1 155 ? -49.433 -18.479 -69.022  1.00 10.66  ? 155 ASN O CB   1 
ATOM   2321  C  CG   . ASN A  1 155 ? -50.140 -19.723 -68.568  1.00 14.91  ? 155 ASN O CG   1 
ATOM   2322  O  OD1  . ASN A  1 155 ? -51.366 -19.846 -68.705  1.00 11.96  ? 155 ASN O OD1  1 
ATOM   2323  N  ND2  . ASN A  1 155 ? -49.374 -20.663 -68.024  1.00 14.21  ? 155 ASN O ND2  1 
ATOM   2324  H  H    . ASN A  1 155 ? -47.177 -19.225 -69.596  1.00 11.80  ? 155 ASN O H    1 
ATOM   2325  H  HA   . ASN A  1 155 ? -49.445 -19.209 -70.924  1.00 14.84  ? 155 ASN O HA   1 
ATOM   2326  H  HB2  . ASN A  1 155 ? -48.707 -18.304 -68.403  1.00 12.79  ? 155 ASN O HB2  1 
ATOM   2327  H  HB3  . ASN A  1 155 ? -50.070 -17.748 -69.003  1.00 12.79  ? 155 ASN O HB3  1 
ATOM   2328  H  HD21 . ASN A  1 155 ? -49.726 -21.397 -67.746  1.00 17.06  ? 155 ASN O HD21 1 
ATOM   2329  H  HD22 . ASN A  1 155 ? -48.527 -20.538 -67.949  1.00 17.06  ? 155 ASN O HD22 1 
ATOM   2330  N  N    . CYS A  1 156 ? -47.798 -16.538 -71.115  1.00 11.38  ? 156 CYS O N    1 
ATOM   2331  C  CA   . CYS A  1 156 ? -47.711 -15.300 -71.900  1.00 14.45  ? 156 CYS O CA   1 
ATOM   2332  C  C    . CYS A  1 156 ? -47.536 -15.580 -73.391  1.00 13.54  ? 156 CYS O C    1 
ATOM   2333  O  O    . CYS A  1 156 ? -48.225 -15.028 -74.247  1.00 14.86  ? 156 CYS O O    1 
ATOM   2334  C  CB   . CYS A  1 156 ? -46.556 -14.451 -71.400  1.00 13.50  ? 156 CYS O CB   1 
ATOM   2335  S  SG   . CYS A  1 156 ? -46.361 -12.889 -72.331  1.00 15.26  ? 156 CYS O SG   1 
ATOM   2336  H  H    . CYS A  1 156 ? -47.082 -16.743 -70.684  1.00 13.65  ? 156 CYS O H    1 
ATOM   2337  H  HA   . CYS A  1 156 ? -48.530 -14.793 -71.784  1.00 17.34  ? 156 CYS O HA   1 
ATOM   2338  H  HB2  . CYS A  1 156 ? -46.710 -14.226 -70.469  1.00 16.21  ? 156 CYS O HB2  1 
ATOM   2339  H  HB3  . CYS A  1 156 ? -45.732 -14.956 -71.487  1.00 16.21  ? 156 CYS O HB3  1 
ATOM   2340  H  HG   . CYS A  1 156 ? -45.433 -12.277 -71.878  1.00 18.31  ? 156 CYS O HG   1 
ATOM   2341  N  N    . LEU A  1 157 ? -46.595 -16.446 -73.712  1.00 9.80   ? 157 LEU O N    1 
ATOM   2342  C  CA   . LEU A  1 157 ? -46.255 -16.673 -75.095  1.00 10.79  ? 157 LEU O CA   1 
ATOM   2343  C  C    . LEU A  1 157 ? -47.352 -17.437 -75.837  1.00 11.47  ? 157 LEU O C    1 
ATOM   2344  O  O    . LEU A  1 157 ? -47.633 -17.142 -76.980  1.00 15.45  ? 157 LEU O O    1 
ATOM   2345  C  CB   . LEU A  1 157 ? -44.946 -17.452 -75.184  1.00 8.88   ? 157 LEU O CB   1 
ATOM   2346  C  CG   . LEU A  1 157 ? -44.444 -17.764 -76.593  1.00 16.23  ? 157 LEU O CG   1 
ATOM   2347  C  CD1  . LEU A  1 157 ? -44.358 -16.521 -77.436  1.00 21.65  ? 157 LEU O CD1  1 
ATOM   2348  C  CD2  . LEU A  1 157 ? -43.080 -18.442 -76.517  1.00 27.41  ? 157 LEU O CD2  1 
ATOM   2349  H  H    . LEU A  1 157 ? -46.142 -16.912 -73.149  1.00 11.76  ? 157 LEU O H    1 
ATOM   2350  H  HA   . LEU A  1 157 ? -46.130 -15.818 -75.537  1.00 12.95  ? 157 LEU O HA   1 
ATOM   2351  H  HB2  . LEU A  1 157 ? -44.254 -16.938 -74.739  1.00 10.65  ? 157 LEU O HB2  1 
ATOM   2352  H  HB3  . LEU A  1 157 ? -45.063 -18.299 -74.726  1.00 10.65  ? 157 LEU O HB3  1 
ATOM   2353  H  HG   . LEU A  1 157 ? -45.062 -18.377 -77.022  1.00 19.47  ? 157 LEU O HG   1 
ATOM   2354  H  HD11 . LEU A  1 157 ? -44.037 -16.760 -78.319  1.00 25.98  ? 157 LEU O HD11 1 
ATOM   2355  H  HD12 . LEU A  1 157 ? -45.240 -16.122 -77.501  1.00 25.98  ? 157 LEU O HD12 1 
ATOM   2356  H  HD13 . LEU A  1 157 ? -43.743 -15.898 -77.018  1.00 25.98  ? 157 LEU O HD13 1 
ATOM   2357  H  HD21 . LEU A  1 157 ? -42.773 -18.634 -77.416  1.00 32.89  ? 157 LEU O HD21 1 
ATOM   2358  H  HD22 . LEU A  1 157 ? -42.456 -17.846 -76.074  1.00 32.89  ? 157 LEU O HD22 1 
ATOM   2359  H  HD23 . LEU A  1 157 ? -43.165 -19.266 -76.012  1.00 32.89  ? 157 LEU O HD23 1 
ATOM   2360  N  N    . ALA A  1 158 ? -47.953 -18.434 -75.200  1.00 9.45   ? 158 ALA O N    1 
ATOM   2361  C  CA   . ALA A  1 158 ? -48.813 -19.367 -75.955  1.00 9.84   ? 158 ALA O CA   1 
ATOM   2362  C  C    . ALA A  1 158 ? -50.081 -18.725 -76.557  1.00 10.52  ? 158 ALA O C    1 
ATOM   2363  O  O    . ALA A  1 158 ? -50.432 -19.009 -77.707  1.00 12.23  ? 158 ALA O O    1 
ATOM   2364  C  CB   . ALA A  1 158 ? -49.198 -20.553 -75.079  1.00 17.23  ? 158 ALA O CB   1 
ATOM   2365  H  H    . ALA A  1 158 ? -47.889 -18.598 -74.358  1.00 11.34  ? 158 ALA O H    1 
ATOM   2366  H  HA   . ALA A  1 158 ? -48.294 -19.718 -76.696  1.00 11.81  ? 158 ALA O HA   1 
ATOM   2367  H  HB1  . ALA A  1 158 ? -49.761 -21.153 -75.592  1.00 20.68  ? 158 ALA O HB1  1 
ATOM   2368  H  HB2  . ALA A  1 158 ? -48.391 -21.013 -74.800  1.00 20.68  ? 158 ALA O HB2  1 
ATOM   2369  H  HB3  . ALA A  1 158 ? -49.679 -20.228 -74.303  1.00 20.68  ? 158 ALA O HB3  1 
ATOM   2370  N  N    . PRO A  1 159 ? -50.785 -17.878 -75.785  1.00 11.57  ? 159 PRO O N    1 
ATOM   2371  C  CA   . PRO A  1 159 ? -51.975 -17.240 -76.365  1.00 12.59  ? 159 PRO O CA   1 
ATOM   2372  C  C    . PRO A  1 159 ? -51.645 -16.380 -77.572  1.00 13.37  ? 159 PRO O C    1 
ATOM   2373  O  O    . PRO A  1 159 ? -52.366 -16.405 -78.564  1.00 14.19  ? 159 PRO O O    1 
ATOM   2374  C  CB   . PRO A  1 159 ? -52.512 -16.383 -75.224  1.00 12.78  ? 159 PRO O CB   1 
ATOM   2375  C  CG   . PRO A  1 159 ? -51.975 -17.026 -73.984  1.00 15.91  ? 159 PRO O CG   1 
ATOM   2376  C  CD   . PRO A  1 159 ? -50.632 -17.559 -74.354  1.00 15.52  ? 159 PRO O CD   1 
ATOM   2377  H  HA   . PRO A  1 159 ? -52.636 -17.907 -76.610  1.00 15.11  ? 159 PRO O HA   1 
ATOM   2378  H  HB2  . PRO A  1 159 ? -52.181 -15.475 -75.312  1.00 15.34  ? 159 PRO O HB2  1 
ATOM   2379  H  HB3  . PRO A  1 159 ? -53.482 -16.399 -75.229  1.00 15.34  ? 159 PRO O HB3  1 
ATOM   2380  H  HG2  . PRO A  1 159 ? -51.897 -16.362 -73.280  1.00 19.09  ? 159 PRO O HG2  1 
ATOM   2381  H  HG3  . PRO A  1 159 ? -52.564 -17.746 -73.710  1.00 19.09  ? 159 PRO O HG3  1 
ATOM   2382  H  HD2  . PRO A  1 159 ? -49.951 -16.879 -74.229  1.00 18.63  ? 159 PRO O HD2  1 
ATOM   2383  H  HD3  . PRO A  1 159 ? -50.433 -18.362 -73.847  1.00 18.63  ? 159 PRO O HD3  1 
ATOM   2384  N  N    . LEU A  1 160 ? -50.566 -15.617 -77.476  1.00 13.11  ? 160 LEU O N    1 
ATOM   2385  C  CA   . LEU A  1 160 ? -50.110 -14.822 -78.607  1.00 15.32  ? 160 LEU O CA   1 
ATOM   2386  C  C    . LEU A  1 160 ? -49.655 -15.704 -79.775  1.00 18.88  ? 160 LEU O C    1 
ATOM   2387  O  O    . LEU A  1 160 ? -50.017 -15.455 -80.920  1.00 15.67  ? 160 LEU O O    1 
ATOM   2388  C  CB   . LEU A  1 160 ? -48.979 -13.903 -78.157  1.00 13.23  ? 160 LEU O CB   1 
ATOM   2389  C  CG   . LEU A  1 160 ? -48.337 -13.071 -79.272  1.00 20.73  ? 160 LEU O CG   1 
ATOM   2390  C  CD1  . LEU A  1 160 ? -49.385 -12.142 -79.921  1.00 16.98  ? 160 LEU O CD1  1 
ATOM   2391  C  CD2  . LEU A  1 160 ? -47.136 -12.292 -78.720  1.00 24.09  ? 160 LEU O CD2  1 
ATOM   2392  H  H    . LEU A  1 160 ? -50.081 -15.542 -76.770  1.00 15.73  ? 160 LEU O H    1 
ATOM   2393  H  HA   . LEU A  1 160 ? -50.842 -14.267 -78.918  1.00 18.39  ? 160 LEU O HA   1 
ATOM   2394  H  HB2  . LEU A  1 160 ? -49.329 -13.286 -77.496  1.00 15.87  ? 160 LEU O HB2  1 
ATOM   2395  H  HB3  . LEU A  1 160 ? -48.281 -14.446 -77.758  1.00 15.87  ? 160 LEU O HB3  1 
ATOM   2396  H  HG   . LEU A  1 160 ? -48.009 -13.671 -79.959  1.00 24.88  ? 160 LEU O HG   1 
ATOM   2397  H  HD11 . LEU A  1 160 ? -48.957 -11.626 -80.622  1.00 20.38  ? 160 LEU O HD11 1 
ATOM   2398  H  HD12 . LEU A  1 160 ? -50.097 -12.683 -80.295  1.00 20.38  ? 160 LEU O HD12 1 
ATOM   2399  H  HD13 . LEU A  1 160 ? -49.742 -11.547 -79.243  1.00 20.38  ? 160 LEU O HD13 1 
ATOM   2400  H  HD21 . LEU A  1 160 ? -46.742 -11.771 -79.437  1.00 28.91  ? 160 LEU O HD21 1 
ATOM   2401  H  HD22 . LEU A  1 160 ? -47.440 -11.703 -78.012  1.00 28.91  ? 160 LEU O HD22 1 
ATOM   2402  H  HD23 . LEU A  1 160 ? -46.485 -12.921 -78.371  1.00 28.91  ? 160 LEU O HD23 1 
ATOM   2403  N  N    . ALA A  1 161 ? -48.881 -16.748 -79.491  1.00 12.84  ? 161 ALA O N    1 
ATOM   2404  C  CA   . ALA A  1 161 ? -48.426 -17.648 -80.551  1.00 14.95  ? 161 ALA O CA   1 
ATOM   2405  C  C    . ALA A  1 161 ? -49.600 -18.309 -81.229  1.00 13.58  ? 161 ALA O C    1 
ATOM   2406  O  O    . ALA A  1 161 ? -49.606 -18.494 -82.442  1.00 13.16  ? 161 ALA O O    1 
ATOM   2407  C  CB   . ALA A  1 161 ? -47.498 -18.690 -80.000  1.00 12.23  ? 161 ALA O CB   1 
ATOM   2408  H  H    . ALA A  1 161 ? -48.607 -16.957 -78.703  1.00 15.41  ? 161 ALA O H    1 
ATOM   2409  H  HA   . ALA A  1 161 ? -47.942 -17.135 -81.217  1.00 17.94  ? 161 ALA O HA   1 
ATOM   2410  H  HB1  . ALA A  1 161 ? -47.213 -19.271 -80.721  1.00 14.67  ? 161 ALA O HB1  1 
ATOM   2411  H  HB2  . ALA A  1 161 ? -46.729 -18.250 -79.604  1.00 14.67  ? 161 ALA O HB2  1 
ATOM   2412  H  HB3  . ALA A  1 161 ? -47.968 -19.205 -79.325  1.00 14.67  ? 161 ALA O HB3  1 
ATOM   2413  N  N    . LYS A  1 162 ? -50.605 -18.666 -80.441  1.00 11.45  ? 162 LYS O N    1 
ATOM   2414  C  CA   . LYS A  1 162 ? -51.840 -19.220 -80.988  1.00 11.63  ? 162 LYS O CA   1 
ATOM   2415  C  C    . LYS A  1 162 ? -52.463 -18.306 -82.028  1.00 14.54  ? 162 LYS O C    1 
ATOM   2416  O  O    . LYS A  1 162 ? -52.877 -18.759 -83.102  1.00 14.60  ? 162 LYS O O    1 
ATOM   2417  C  CB   . LYS A  1 162 ? -52.865 -19.482 -79.879  1.00 13.21  ? 162 LYS O CB   1 
ATOM   2418  C  CG   . LYS A  1 162 ? -54.236 -19.924 -80.410  1.00 15.16  ? 162 LYS O CG   1 
ATOM   2419  C  CD   . LYS A  1 162 ? -55.247 -20.104 -79.288  1.00 22.14  ? 162 LYS O CD   1 
ATOM   2420  C  CE   . LYS A  1 162 ? -56.684 -20.136 -79.837  1.00 23.82  ? 162 LYS O CE   1 
ATOM   2421  N  NZ   . LYS A  1 162 ? -56.797 -21.108 -80.943  1.00 24.25  ? 162 LYS O NZ   1 
ATOM   2422  H  H    . LYS A  1 162 ? -50.599 -18.598 -79.583  1.00 13.74  ? 162 LYS O H    1 
ATOM   2423  H  HA   . LYS A  1 162 ? -51.641 -20.067 -81.417  1.00 13.95  ? 162 LYS O HA   1 
ATOM   2424  H  HB2  . LYS A  1 162 ? -52.528 -20.184 -79.300  1.00 15.86  ? 162 LYS O HB2  1 
ATOM   2425  H  HB3  . LYS A  1 162 ? -52.991 -18.666 -79.369  1.00 15.86  ? 162 LYS O HB3  1 
ATOM   2426  H  HG2  . LYS A  1 162 ? -54.575 -19.249 -81.018  1.00 18.20  ? 162 LYS O HG2  1 
ATOM   2427  H  HG3  . LYS A  1 162 ? -54.141 -20.772 -80.871  1.00 18.20  ? 162 LYS O HG3  1 
ATOM   2428  H  HD2  . LYS A  1 162 ? -55.076 -20.943 -78.832  1.00 26.57  ? 162 LYS O HD2  1 
ATOM   2429  H  HD3  . LYS A  1 162 ? -55.174 -19.363 -78.667  1.00 26.57  ? 162 LYS O HD3  1 
ATOM   2430  H  HE2  . LYS A  1 162 ? -57.294 -20.402 -79.131  1.00 28.58  ? 162 LYS O HE2  1 
ATOM   2431  H  HE3  . LYS A  1 162 ? -56.920 -19.258 -80.176  1.00 28.58  ? 162 LYS O HE3  1 
ATOM   2432  H  HZ1  . LYS A  1 162 ? -57.631 -21.119 -81.254  1.00 29.10  ? 162 LYS O HZ1  1 
ATOM   2433  H  HZ2  . LYS A  1 162 ? -56.245 -20.883 -81.604  1.00 29.10  ? 162 LYS O HZ2  1 
ATOM   2434  H  HZ3  . LYS A  1 162 ? -56.586 -21.923 -80.654  1.00 29.10  ? 162 LYS O HZ3  1 
ATOM   2435  N  N    . VAL A  1 163 ? -52.559 -17.024 -81.715  1.00 15.19  ? 163 VAL O N    1 
ATOM   2436  C  CA   . VAL A  1 163 ? -53.205 -16.105 -82.639  1.00 11.86  ? 163 VAL O CA   1 
ATOM   2437  C  C    . VAL A  1 163 ? -52.388 -15.906 -83.910  1.00 14.55  ? 163 VAL O C    1 
ATOM   2438  O  O    . VAL A  1 163 ? -52.949 -15.911 -85.016  1.00 11.87  ? 163 VAL O O    1 
ATOM   2439  C  CB   . VAL A  1 163 ? -53.469 -14.742 -81.989  1.00 12.63  ? 163 VAL O CB   1 
ATOM   2440  C  CG1  . VAL A  1 163 ? -54.003 -13.759 -83.021  1.00 17.79  ? 163 VAL O CG1  1 
ATOM   2441  C  CG2  . VAL A  1 163 ? -54.454 -14.897 -80.845  1.00 16.92  ? 163 VAL O CG2  1 
ATOM   2442  H  H    . VAL A  1 163 ? -52.266 -16.666 -80.990  1.00 18.23  ? 163 VAL O H    1 
ATOM   2443  H  HA   . VAL A  1 163 ? -54.063 -16.478 -82.896  1.00 14.24  ? 163 VAL O HA   1 
ATOM   2444  H  HB   . VAL A  1 163 ? -52.639 -14.390 -81.631  1.00 15.16  ? 163 VAL O HB   1 
ATOM   2445  H  HG11 . VAL A  1 163 ? -54.163 -12.905 -82.590  1.00 21.35  ? 163 VAL O HG11 1 
ATOM   2446  H  HG12 . VAL A  1 163 ? -53.346 -13.655 -83.727  1.00 21.35  ? 163 VAL O HG12 1 
ATOM   2447  H  HG13 . VAL A  1 163 ? -54.831 -14.105 -83.388  1.00 21.35  ? 163 VAL O HG13 1 
ATOM   2448  H  HG21 . VAL A  1 163 ? -54.611 -14.028 -80.444  1.00 20.30  ? 163 VAL O HG21 1 
ATOM   2449  H  HG22 . VAL A  1 163 ? -55.285 -15.257 -81.191  1.00 20.30  ? 163 VAL O HG22 1 
ATOM   2450  H  HG23 . VAL A  1 163 ? -54.079 -15.503 -80.186  1.00 20.30  ? 163 VAL O HG23 1 
ATOM   2451  N  N    . ILE A  1 164 ? -51.080 -15.721 -83.755  1.00 15.38  ? 164 ILE O N    1 
ATOM   2452  C  CA   . ILE A  1 164 ? -50.200 -15.536 -84.909  1.00 13.93  ? 164 ILE O CA   1 
ATOM   2453  C  C    . ILE A  1 164 ? -50.171 -16.780 -85.797  1.00 16.79  ? 164 ILE O C    1 
ATOM   2454  O  O    . ILE A  1 164 ? -50.252 -16.689 -87.027  1.00 14.20  ? 164 ILE O O    1 
ATOM   2455  C  CB   . ILE A  1 164 ? -48.768 -15.167 -84.445  1.00 10.90  ? 164 ILE O CB   1 
ATOM   2456  C  CG1  . ILE A  1 164 ? -48.796 -13.879 -83.599  1.00 11.29  ? 164 ILE O CG1  1 
ATOM   2457  C  CG2  . ILE A  1 164 ? -47.849 -14.972 -85.613  1.00 14.50  ? 164 ILE O CG2  1 
ATOM   2458  C  CD1  . ILE A  1 164 ? -49.493 -12.686 -84.262  1.00 20.79  ? 164 ILE O CD1  1 
ATOM   2459  H  H    . ILE A  1 164 ? -50.677 -15.699 -82.996  1.00 18.45  ? 164 ILE O H    1 
ATOM   2460  H  HA   . ILE A  1 164 ? -50.537 -14.800 -85.442  1.00 16.72  ? 164 ILE O HA   1 
ATOM   2461  H  HB   . ILE A  1 164 ? -48.424 -15.890 -83.898  1.00 13.08  ? 164 ILE O HB   1 
ATOM   2462  H  HG12 . ILE A  1 164 ? -49.261 -14.065 -82.769  1.00 13.54  ? 164 ILE O HG12 1 
ATOM   2463  H  HG13 . ILE A  1 164 ? -47.882 -13.615 -83.408  1.00 13.54  ? 164 ILE O HG13 1 
ATOM   2464  H  HG21 . ILE A  1 164 ? -46.966 -14.743 -85.284  1.00 17.40  ? 164 ILE O HG21 1 
ATOM   2465  H  HG22 . ILE A  1 164 ? -47.809 -15.796 -86.123  1.00 17.40  ? 164 ILE O HG22 1 
ATOM   2466  H  HG23 . ILE A  1 164 ? -48.192 -14.255 -86.168  1.00 17.40  ? 164 ILE O HG23 1 
ATOM   2467  H  HD11 . ILE A  1 164 ? -49.461 -11.927 -83.659  1.00 24.95  ? 164 ILE O HD11 1 
ATOM   2468  H  HD12 . ILE A  1 164 ? -49.033 -12.472 -85.089  1.00 24.95  ? 164 ILE O HD12 1 
ATOM   2469  H  HD13 . ILE A  1 164 ? -50.415 -12.923 -84.448  1.00 24.95  ? 164 ILE O HD13 1 
ATOM   2470  N  N    . HIS A  1 165 ? -50.098 -17.946 -85.181  1.00 12.85  ? 165 HIS O N    1 
ATOM   2471  C  CA   . HIS A  1 165 ? -50.032 -19.181 -85.938  1.00 17.56  ? 165 HIS O CA   1 
ATOM   2472  C  C    . HIS A  1 165 ? -51.348 -19.478 -86.646  1.00 14.74  ? 165 HIS O C    1 
ATOM   2473  O  O    . HIS A  1 165 ? -51.348 -19.927 -87.797  1.00 15.24  ? 165 HIS O O    1 
ATOM   2474  C  CB   . HIS A  1 165 ? -49.649 -20.350 -85.019  1.00 16.12  ? 165 HIS O CB   1 
ATOM   2475  C  CG   . HIS A  1 165 ? -49.461 -21.632 -85.755  1.00 19.10  ? 165 HIS O CG   1 
ATOM   2476  N  ND1  . HIS A  1 165 ? -48.468 -21.806 -86.698  1.00 21.81  ? 165 HIS O ND1  1 
ATOM   2477  C  CD2  . HIS A  1 165 ? -50.167 -22.787 -85.728  1.00 18.91  ? 165 HIS O CD2  1 
ATOM   2478  C  CE1  . HIS A  1 165 ? -48.562 -23.023 -87.212  1.00 27.90  ? 165 HIS O CE1  1 
ATOM   2479  N  NE2  . HIS A  1 165 ? -49.585 -23.639 -86.641  1.00 24.14  ? 165 HIS O NE2  1 
ATOM   2480  H  H    . HIS A  1 165 ? -50.085 -18.050 -84.328  1.00 15.42  ? 165 HIS O H    1 
ATOM   2481  H  HA   . HIS A  1 165 ? -49.342 -19.097 -86.615  1.00 21.07  ? 165 HIS O HA   1 
ATOM   2482  H  HB2  . HIS A  1 165 ? -48.816 -20.138 -84.569  1.00 19.34  ? 165 HIS O HB2  1 
ATOM   2483  H  HB3  . HIS A  1 165 ? -50.354 -20.481 -84.365  1.00 19.34  ? 165 HIS O HB3  1 
ATOM   2484  H  HD2  . HIS A  1 165 ? -50.904 -22.972 -85.192  1.00 22.69  ? 165 HIS O HD2  1 
ATOM   2485  H  HE1  . HIS A  1 165 ? -48.000 -23.385 -87.858  1.00 33.49  ? 165 HIS O HE1  1 
ATOM   2486  N  N    . ASP A  1 166 ? -52.464 -19.209 -85.975  1.00 14.35  ? 166 ASP O N    1 
ATOM   2487  C  CA   . ASP A  1 166 ? -53.798 -19.468 -86.532  1.00 18.52  ? 166 ASP O CA   1 
ATOM   2488  C  C    . ASP A  1 166 ? -54.013 -18.640 -87.789  1.00 21.46  ? 166 ASP O C    1 
ATOM   2489  O  O    . ASP A  1 166 ? -54.683 -19.059 -88.723  1.00 21.98  ? 166 ASP O O    1 
ATOM   2490  C  CB   . ASP A  1 166 ? -54.912 -19.109 -85.528  1.00 15.01  ? 166 ASP O CB   1 
ATOM   2491  C  CG   . ASP A  1 166 ? -55.101 -20.136 -84.424  1.00 27.04  ? 166 ASP O CG   1 
ATOM   2492  O  OD1  . ASP A  1 166 ? -54.500 -21.231 -84.493  1.00 26.50  ? 166 ASP O OD1  1 
ATOM   2493  O  OD2  . ASP A  1 166 ? -55.888 -19.833 -83.481  1.00 26.26  ? 166 ASP O OD2  1 
ATOM   2494  H  H    . ASP A  1 166 ? -52.480 -18.871 -85.184  1.00 17.22  ? 166 ASP O H    1 
ATOM   2495  H  HA   . ASP A  1 166 ? -53.878 -20.407 -86.762  1.00 22.22  ? 166 ASP O HA   1 
ATOM   2496  H  HB2  . ASP A  1 166 ? -54.693 -18.262 -85.109  1.00 18.02  ? 166 ASP O HB2  1 
ATOM   2497  H  HB3  . ASP A  1 166 ? -55.752 -19.032 -86.007  1.00 18.02  ? 166 ASP O HB3  1 
ATOM   2498  N  N    . ASN A  1 167 ? -53.458 -17.437 -87.792  1.00 15.07  ? 167 ASN O N    1 
ATOM   2499  C  CA   . ASN A  1 167 ? -53.707 -16.499 -88.889  1.00 16.86  ? 167 ASN O CA   1 
ATOM   2500  C  C    . ASN A  1 167 ? -52.643 -16.456 -89.972  1.00 23.17  ? 167 ASN O C    1 
ATOM   2501  O  O    . ASN A  1 167 ? -52.971 -16.316 -91.145  1.00 22.49  ? 167 ASN O O    1 
ATOM   2502  C  CB   . ASN A  1 167 ? -53.881 -15.104 -88.321  1.00 16.16  ? 167 ASN O CB   1 
ATOM   2503  C  CG   . ASN A  1 167 ? -55.208 -14.944 -87.617  1.00 15.48  ? 167 ASN O CG   1 
ATOM   2504  O  OD1  . ASN A  1 167 ? -56.206 -14.663 -88.245  1.00 21.18  ? 167 ASN O OD1  1 
ATOM   2505  N  ND2  . ASN A  1 167 ? -55.217 -15.125 -86.304  1.00 13.38  ? 167 ASN O ND2  1 
ATOM   2506  H  H    . ASN A  1 167 ? -52.937 -17.136 -87.178  1.00 18.08  ? 167 ASN O H    1 
ATOM   2507  H  HA   . ASN A  1 167 ? -54.543 -16.745 -89.316  1.00 20.23  ? 167 ASN O HA   1 
ATOM   2508  H  HB2  . ASN A  1 167 ? -53.175 -14.931 -87.679  1.00 19.40  ? 167 ASN O HB2  1 
ATOM   2509  H  HB3  . ASN A  1 167 ? -53.842 -14.458 -89.044  1.00 19.40  ? 167 ASN O HB3  1 
ATOM   2510  H  HD21 . ASN A  1 167 ? -55.952 -15.044 -85.864  1.00 16.06  ? 167 ASN O HD21 1 
ATOM   2511  H  HD22 . ASN A  1 167 ? -54.489 -15.324 -85.892  1.00 16.06  ? 167 ASN O HD22 1 
ATOM   2512  N  N    . PHE A  1 168 ? -51.375 -16.563 -89.584  1.00 16.26  ? 168 PHE O N    1 
ATOM   2513  C  CA   . PHE A  1 168 ? -50.292 -16.381 -90.534  1.00 15.68  ? 168 PHE O CA   1 
ATOM   2514  C  C    . PHE A  1 168 ? -49.346 -17.565 -90.590  1.00 20.11  ? 168 PHE O C    1 
ATOM   2515  O  O    . PHE A  1 168 ? -48.613 -17.749 -91.580  1.00 21.93  ? 168 PHE O O    1 
ATOM   2516  C  CB   . PHE A  1 168 ? -49.521 -15.122 -90.180  1.00 20.15  ? 168 PHE O CB   1 
ATOM   2517  C  CG   . PHE A  1 168 ? -50.397 -13.949 -89.946  1.00 15.83  ? 168 PHE O CG   1 
ATOM   2518  C  CD1  . PHE A  1 168 ? -51.163 -13.437 -90.975  1.00 25.01  ? 168 PHE O CD1  1 
ATOM   2519  C  CD2  . PHE A  1 168 ? -50.463 -13.350 -88.702  1.00 17.56  ? 168 PHE O CD2  1 
ATOM   2520  C  CE1  . PHE A  1 168 ? -51.977 -12.358 -90.769  1.00 21.72  ? 168 PHE O CE1  1 
ATOM   2521  C  CE2  . PHE A  1 168 ? -51.276 -12.269 -88.494  1.00 20.76  ? 168 PHE O CE2  1 
ATOM   2522  C  CZ   . PHE A  1 168 ? -52.031 -11.769 -89.529  1.00 22.76  ? 168 PHE O CZ   1 
ATOM   2523  H  H    . PHE A  1 168 ? -51.120 -16.738 -88.782  1.00 19.52  ? 168 PHE O H    1 
ATOM   2524  H  HA   . PHE A  1 168 ? -50.669 -16.261 -91.420  1.00 18.82  ? 168 PHE O HA   1 
ATOM   2525  H  HB2  . PHE A  1 168 ? -49.013 -15.282 -89.370  1.00 24.17  ? 168 PHE O HB2  1 
ATOM   2526  H  HB3  . PHE A  1 168 ? -48.921 -14.905 -90.910  1.00 24.17  ? 168 PHE O HB3  1 
ATOM   2527  H  HD1  . PHE A  1 168 ? -51.128 -13.833 -91.816  1.00 30.01  ? 168 PHE O HD1  1 
ATOM   2528  H  HD2  . PHE A  1 168 ? -49.952 -13.685 -88.000  1.00 21.08  ? 168 PHE O HD2  1 
ATOM   2529  H  HE1  . PHE A  1 168 ? -52.488 -12.020 -91.468  1.00 26.07  ? 168 PHE O HE1  1 
ATOM   2530  H  HE2  . PHE A  1 168 ? -51.315 -11.870 -87.655  1.00 24.92  ? 168 PHE O HE2  1 
ATOM   2531  H  HZ   . PHE A  1 168 ? -52.584 -11.035 -89.388  1.00 27.31  ? 168 PHE O HZ   1 
ATOM   2532  N  N    . GLY A  1 169 ? -49.356 -18.361 -89.529  1.00 17.30  ? 169 GLY O N    1 
ATOM   2533  C  CA   . GLY A  1 169 ? -48.475 -19.507 -89.438  1.00 15.46  ? 169 GLY O CA   1 
ATOM   2534  C  C    . GLY A  1 169 ? -47.089 -19.071 -88.991  1.00 20.10  ? 169 GLY O C    1 
ATOM   2535  O  O    . GLY A  1 169 ? -46.562 -18.075 -89.470  1.00 19.46  ? 169 GLY O O    1 
ATOM   2536  H  H    . GLY A  1 169 ? -49.868 -18.256 -88.846  1.00 20.76  ? 169 GLY O H    1 
ATOM   2537  H  HA2  . GLY A  1 169 ? -48.827 -20.144 -88.797  1.00 18.55  ? 169 GLY O HA2  1 
ATOM   2538  H  HA3  . GLY A  1 169 ? -48.405 -19.939 -90.304  1.00 18.55  ? 169 GLY O HA3  1 
ATOM   2539  N  N    . ILE A  1 170 ? -46.524 -19.792 -88.036  1.00 13.33  ? 170 ILE O N    1 
ATOM   2540  C  CA   . ILE A  1 170 ? -45.167 -19.535 -87.561  1.00 12.16  ? 170 ILE O CA   1 
ATOM   2541  C  C    . ILE A  1 170 ? -44.238 -20.607 -88.086  1.00 24.03  ? 170 ILE O C    1 
ATOM   2542  O  O    . ILE A  1 170 ? -44.357 -21.757 -87.690  1.00 19.29  ? 170 ILE O O    1 
ATOM   2543  C  CB   . ILE A  1 170 ? -45.090 -19.530 -86.041  1.00 15.64  ? 170 ILE O CB   1 
ATOM   2544  C  CG1  . ILE A  1 170 ? -45.870 -18.342 -85.474  1.00 20.21  ? 170 ILE O CG1  1 
ATOM   2545  C  CG2  . ILE A  1 170 ? -43.627 -19.487 -85.566  1.00 14.81  ? 170 ILE O CG2  1 
ATOM   2546  C  CD1  . ILE A  1 170 ? -45.952 -18.340 -83.954  1.00 14.07  ? 170 ILE O CD1  1 
ATOM   2547  H  H    . ILE A  1 170 ? -46.910 -20.449 -87.639  1.00 16.00  ? 170 ILE O H    1 
ATOM   2548  H  HA   . ILE A  1 170 ? -44.864 -18.674 -87.890  1.00 14.59  ? 170 ILE O HA   1 
ATOM   2549  H  HB   . ILE A  1 170 ? -45.495 -20.347 -85.711  1.00 18.77  ? 170 ILE O HB   1 
ATOM   2550  H  HG12 . ILE A  1 170 ? -45.434 -17.521 -85.750  1.00 24.26  ? 170 ILE O HG12 1 
ATOM   2551  H  HG13 . ILE A  1 170 ? -46.775 -18.368 -85.821  1.00 24.26  ? 170 ILE O HG13 1 
ATOM   2552  H  HG21 . ILE A  1 170 ? -43.610 -19.485 -84.596  1.00 17.77  ? 170 ILE O HG21 1 
ATOM   2553  H  HG22 . ILE A  1 170 ? -43.163 -20.269 -85.904  1.00 17.77  ? 170 ILE O HG22 1 
ATOM   2554  H  HG23 . ILE A  1 170 ? -43.209 -18.681 -85.907  1.00 17.77  ? 170 ILE O HG23 1 
ATOM   2555  H  HD11 . ILE A  1 170 ? -46.458 -17.564 -83.666  1.00 16.89  ? 170 ILE O HD11 1 
ATOM   2556  H  HD12 . ILE A  1 170 ? -46.396 -19.152 -83.661  1.00 16.89  ? 170 ILE O HD12 1 
ATOM   2557  H  HD13 . ILE A  1 170 ? -45.054 -18.304 -83.589  1.00 16.89  ? 170 ILE O HD13 1 
ATOM   2558  N  N    . VAL A  1 171 ? -43.306 -20.229 -88.953  1.00 13.26  ? 171 VAL O N    1 
ATOM   2559  C  CA   . VAL A  1 171 ? -42.313 -21.170 -89.459  1.00 14.50  ? 171 VAL O CA   1 
ATOM   2560  C  C    . VAL A  1 171 ? -41.293 -21.523 -88.385  1.00 13.77  ? 171 VAL O C    1 
ATOM   2561  O  O    . VAL A  1 171 ? -40.971 -22.680 -88.189  1.00 16.13  ? 171 VAL O O    1 
ATOM   2562  C  CB   . VAL A  1 171 ? -41.591 -20.593 -90.678  1.00 14.76  ? 171 VAL O CB   1 
ATOM   2563  C  CG1  . VAL A  1 171 ? -40.435 -21.503 -91.127  1.00 27.57  ? 171 VAL O CG1  1 
ATOM   2564  C  CG2  . VAL A  1 171 ? -42.585 -20.381 -91.796  1.00 19.98  ? 171 VAL O CG2  1 
ATOM   2565  H  H    . VAL A  1 171 ? -43.227 -19.432 -89.266  1.00 15.91  ? 171 VAL O H    1 
ATOM   2566  H  HA   . VAL A  1 171 ? -42.759 -21.988 -89.731  1.00 17.40  ? 171 VAL O HA   1 
ATOM   2567  H  HB   . VAL A  1 171 ? -41.217 -19.730 -90.443  1.00 17.71  ? 171 VAL O HB   1 
ATOM   2568  H  HG11 . VAL A  1 171 ? -40.003 -21.106 -91.900  1.00 33.08  ? 171 VAL O HG11 1 
ATOM   2569  H  HG12 . VAL A  1 171 ? -39.800 -21.588 -90.400  1.00 33.08  ? 171 VAL O HG12 1 
ATOM   2570  H  HG13 . VAL A  1 171 ? -40.792 -22.375 -91.359  1.00 33.08  ? 171 VAL O HG13 1 
ATOM   2571  H  HG21 . VAL A  1 171 ? -42.121 -20.015 -92.565  1.00 23.97  ? 171 VAL O HG21 1 
ATOM   2572  H  HG22 . VAL A  1 171 ? -42.988 -21.233 -92.026  1.00 23.97  ? 171 VAL O HG22 1 
ATOM   2573  H  HG23 . VAL A  1 171 ? -43.269 -19.761 -91.496  1.00 23.97  ? 171 VAL O HG23 1 
ATOM   2574  N  N    . GLU A  1 172 ? -40.778 -20.500 -87.713  1.00 14.32  ? 172 GLU O N    1 
ATOM   2575  C  CA   . GLU A  1 172 ? -39.775 -20.652 -86.662  1.00 15.85  ? 172 GLU O CA   1 
ATOM   2576  C  C    . GLU A  1 172 ? -39.774 -19.377 -85.839  1.00 16.70  ? 172 GLU O C    1 
ATOM   2577  O  O    . GLU A  1 172 ? -40.060 -18.293 -86.351  1.00 18.41  ? 172 GLU O O    1 
ATOM   2578  C  CB   . GLU A  1 172 ? -38.382 -20.912 -87.251  1.00 16.39  ? 172 GLU O CB   1 
ATOM   2579  C  CG   . GLU A  1 172 ? -38.009 -19.935 -88.347  1.00 20.81  ? 172 GLU O CG   1 
ATOM   2580  C  CD   . GLU A  1 172 ? -36.717 -20.297 -89.099  1.00 36.67  ? 172 GLU O CD   1 
ATOM   2581  O  OE1  . GLU A  1 172 ? -36.186 -21.414 -88.909  1.00 27.60  ? 172 GLU O OE1  1 
ATOM   2582  O  OE2  . GLU A  1 172 ? -36.234 -19.452 -89.892  1.00 35.27  ? 172 GLU O OE2  1 
ATOM   2583  H  H    . GLU A  1 172 ? -41.002 -19.681 -87.851  1.00 17.19  ? 172 GLU O H    1 
ATOM   2584  H  HA   . GLU A  1 172 ? -40.013 -21.395 -86.086  1.00 19.03  ? 172 GLU O HA   1 
ATOM   2585  H  HB2  . GLU A  1 172 ? -37.722 -20.836 -86.545  1.00 19.67  ? 172 GLU O HB2  1 
ATOM   2586  H  HB3  . GLU A  1 172 ? -38.362 -21.806 -87.629  1.00 19.67  ? 172 GLU O HB3  1 
ATOM   2587  H  HG2  . GLU A  1 172 ? -38.730 -19.903 -88.995  1.00 24.98  ? 172 GLU O HG2  1 
ATOM   2588  H  HG3  . GLU A  1 172 ? -37.884 -19.057 -87.952  1.00 24.98  ? 172 GLU O HG3  1 
ATOM   2589  N  N    . GLY A  1 173 ? -39.467 -19.504 -84.562  1.00 11.92  ? 173 GLY O N    1 
ATOM   2590  C  CA   . GLY A  1 173 ? -39.416 -18.358 -83.686  1.00 13.43  ? 173 GLY O CA   1 
ATOM   2591  C  C    . GLY A  1 173 ? -38.403 -18.531 -82.580  1.00 13.74  ? 173 GLY O C    1 
ATOM   2592  O  O    . GLY A  1 173 ? -38.160 -19.639 -82.100  1.00 14.44  ? 173 GLY O O    1 
ATOM   2593  H  H    . GLY A  1 173 ? -39.283 -20.251 -84.177  1.00 14.30  ? 173 GLY O H    1 
ATOM   2594  H  HA2  . GLY A  1 173 ? -39.182 -17.569 -84.198  1.00 16.11  ? 173 GLY O HA2  1 
ATOM   2595  H  HA3  . GLY A  1 173 ? -40.288 -18.217 -83.285  1.00 16.11  ? 173 GLY O HA3  1 
ATOM   2596  N  N    . LEU A  1 174 ? -37.818 -17.414 -82.175  1.00 10.66  ? 174 LEU O N    1 
ATOM   2597  C  CA   . LEU A  1 174 ? -36.945 -17.347 -81.017  1.00 10.34  ? 174 LEU O CA   1 
ATOM   2598  C  C    . LEU A  1 174 ? -37.447 -16.265 -80.060  1.00 12.65  ? 174 LEU O C    1 
ATOM   2599  O  O    . LEU A  1 174 ? -37.764 -15.157 -80.483  1.00 15.71  ? 174 LEU O O    1 
ATOM   2600  C  CB   . LEU A  1 174 ? -35.518 -17.047 -81.456  1.00 11.25  ? 174 LEU O CB   1 
ATOM   2601  C  CG   . LEU A  1 174 ? -34.767 -18.249 -82.034  1.00 15.45  ? 174 LEU O CG   1 
ATOM   2602  C  CD1  . LEU A  1 174 ? -33.553 -17.797 -82.830  1.00 22.60  ? 174 LEU O CD1  1 
ATOM   2603  C  CD2  . LEU A  1 174 ? -34.350 -19.175 -80.907  1.00 27.39  ? 174 LEU O CD2  1 
ATOM   2604  H  H    . LEU A  1 174 ? -37.917 -16.656 -82.569  1.00 12.79  ? 174 LEU O H    1 
ATOM   2605  H  HA   . LEU A  1 174 ? -36.953 -18.199 -80.553  1.00 12.41  ? 174 LEU O HA   1 
ATOM   2606  H  HB2  . LEU A  1 174 ? -35.542 -16.359 -82.139  1.00 13.50  ? 174 LEU O HB2  1 
ATOM   2607  H  HB3  . LEU A  1 174 ? -35.018 -16.729 -80.688  1.00 13.50  ? 174 LEU O HB3  1 
ATOM   2608  H  HG   . LEU A  1 174 ? -35.356 -18.739 -82.629  1.00 18.54  ? 174 LEU O HG   1 
ATOM   2609  H  HD11 . LEU A  1 174 ? -33.099 -18.578 -83.183  1.00 27.12  ? 174 LEU O HD11 1 
ATOM   2610  H  HD12 . LEU A  1 174 ? -33.848 -17.228 -83.558  1.00 27.12  ? 174 LEU O HD12 1 
ATOM   2611  H  HD13 . LEU A  1 174 ? -32.958 -17.304 -82.244  1.00 27.12  ? 174 LEU O HD13 1 
ATOM   2612  H  HD21 . LEU A  1 174 ? -33.875 -19.933 -81.282  1.00 32.87  ? 174 LEU O HD21 1 
ATOM   2613  H  HD22 . LEU A  1 174 ? -33.772 -18.691 -80.298  1.00 32.87  ? 174 LEU O HD22 1 
ATOM   2614  H  HD23 . LEU A  1 174 ? -35.143 -19.480 -80.440  1.00 32.87  ? 174 LEU O HD23 1 
ATOM   2615  N  N    . MET A  1 175 ? -37.517 -16.604 -78.780  1.00 10.47  ? 175 MET O N    1 
ATOM   2616  C  CA   . MET A  1 175 ? -38.089 -15.743 -77.756  1.00 10.71  ? 175 MET O CA   1 
ATOM   2617  C  C    . MET A  1 175 ? -37.017 -15.298 -76.767  1.00 15.77  ? 175 MET O C    1 
ATOM   2618  O  O    . MET A  1 175 ? -36.139 -16.074 -76.389  1.00 12.17  ? 175 MET O O    1 
ATOM   2619  C  CB   . MET A  1 175 ? -39.208 -16.498 -77.014  1.00 17.80  ? 175 MET O CB   1 
ATOM   2620  C  CG   . MET A  1 175 ? -39.808 -15.767 -75.817  1.00 27.88  ? 175 MET O CG   1 
ATOM   2621  S  SD   . MET A  1 175 ? -40.238 -16.873 -74.453  1.00 40.16  ? 175 MET O SD   1 
ATOM   2622  C  CE   . MET A  1 175 ? -38.596 -17.269 -73.807  1.00 22.02  ? 175 MET O CE   1 
ATOM   2623  H  H    . MET A  1 175 ? -37.231 -17.353 -78.471  1.00 12.56  ? 175 MET O H    1 
ATOM   2624  H  HA   . MET A  1 175 ? -38.478 -14.961 -78.178  1.00 12.85  ? 175 MET O HA   1 
ATOM   2625  H  HB2  . MET A  1 175 ? -39.929 -16.671 -77.640  1.00 21.36  ? 175 MET O HB2  1 
ATOM   2626  H  HB3  . MET A  1 175 ? -38.850 -17.339 -76.692  1.00 21.36  ? 175 MET O HB3  1 
ATOM   2627  H  HG2  . MET A  1 175 ? -39.163 -15.122 -75.486  1.00 33.45  ? 175 MET O HG2  1 
ATOM   2628  H  HG3  . MET A  1 175 ? -40.617 -15.311 -76.099  1.00 33.45  ? 175 MET O HG3  1 
ATOM   2629  H  HE1  . MET A  1 175 ? -38.690 -17.872 -73.053  1.00 26.43  ? 175 MET O HE1  1 
ATOM   2630  H  HE2  . MET A  1 175 ? -38.076 -17.695 -74.507  1.00 26.43  ? 175 MET O HE2  1 
ATOM   2631  H  HE3  . MET A  1 175 ? -38.162 -16.449 -73.524  1.00 26.43  ? 175 MET O HE3  1 
ATOM   2632  N  N    . THR A  1 176 ? -37.103 -14.041 -76.350  1.00 9.46   ? 176 THR O N    1 
ATOM   2633  C  CA   . THR A  1 176 ? -36.414 -13.571 -75.161  1.00 12.94  ? 176 THR O CA   1 
ATOM   2634  C  C    . THR A  1 176 ? -37.457 -13.071 -74.172  1.00 11.68  ? 176 THR O C    1 
ATOM   2635  O  O    . THR A  1 176 ? -38.396 -12.363 -74.552  1.00 13.13  ? 176 THR O O    1 
ATOM   2636  C  CB   . THR A  1 176 ? -35.435 -12.445 -75.464  1.00 20.85  ? 176 THR O CB   1 
ATOM   2637  O  OG1  . THR A  1 176 ? -34.393 -12.929 -76.307  1.00 29.10  ? 176 THR O OG1  1 
ATOM   2638  C  CG2  . THR A  1 176 ? -34.805 -11.910 -74.183  1.00 25.56  ? 176 THR O CG2  1 
ATOM   2639  H  H    . THR A  1 176 ? -37.563 -13.433 -76.747  1.00 11.36  ? 176 THR O H    1 
ATOM   2640  H  HA   . THR A  1 176 ? -35.927 -14.305 -74.755  1.00 15.52  ? 176 THR O HA   1 
ATOM   2641  H  HB   . THR A  1 176 ? -35.901 -11.719 -75.907  1.00 25.02  ? 176 THR O HB   1 
ATOM   2642  H  HG1  . THR A  1 176 ? -33.850 -12.311 -76.477  1.00 34.92  ? 176 THR O HG1  1 
ATOM   2643  H  HG21 . THR A  1 176 ? -34.185 -11.194 -74.392  1.00 30.67  ? 176 THR O HG21 1 
ATOM   2644  H  HG22 . THR A  1 176 ? -35.495 -11.567 -73.593  1.00 30.67  ? 176 THR O HG22 1 
ATOM   2645  H  HG23 . THR A  1 176 ? -34.326 -12.620 -73.728  1.00 30.67  ? 176 THR O HG23 1 
ATOM   2646  N  N    . THR A  1 177 ? -37.304 -13.427 -72.908  1.00 11.85  ? 177 THR O N    1 
ATOM   2647  C  CA   . THR A  1 177 ? -38.107 -12.768 -71.871  1.00 10.95  ? 177 THR O CA   1 
ATOM   2648  C  C    . THR A  1 177 ? -37.205 -11.946 -70.951  1.00 11.27  ? 177 THR O C    1 
ATOM   2649  O  O    . THR A  1 177 ? -36.155 -12.406 -70.519  1.00 14.37  ? 177 THR O O    1 
ATOM   2650  C  CB   . THR A  1 177 ? -38.934 -13.777 -71.069  1.00 10.12  ? 177 THR O CB   1 
ATOM   2651  O  OG1  . THR A  1 177 ? -39.670 -13.097 -70.039  1.00 16.08  ? 177 THR O OG1  1 
ATOM   2652  C  CG2  . THR A  1 177 ? -38.074 -14.844 -70.423  1.00 17.51  ? 177 THR O CG2  1 
ATOM   2653  H  H    . THR A  1 177 ? -36.760 -14.029 -72.622  1.00 14.22  ? 177 THR O H    1 
ATOM   2654  H  HA   . THR A  1 177 ? -38.725 -12.156 -72.300  1.00 13.14  ? 177 THR O HA   1 
ATOM   2655  H  HB   . THR A  1 177 ? -39.559 -14.217 -71.665  1.00 12.14  ? 177 THR O HB   1 
ATOM   2656  H  HG1  . THR A  1 177 ? -40.187 -12.531 -70.382  1.00 19.30  ? 177 THR O HG1  1 
ATOM   2657  H  HG21 . THR A  1 177 ? -38.631 -15.462 -69.926  1.00 21.01  ? 177 THR O HG21 1 
ATOM   2658  H  HG22 . THR A  1 177 ? -37.588 -15.335 -71.104  1.00 21.01  ? 177 THR O HG22 1 
ATOM   2659  H  HG23 . THR A  1 177 ? -37.438 -14.434 -69.816  1.00 21.01  ? 177 THR O HG23 1 
ATOM   2660  N  N    . VAL A  1 178 ? -37.601 -10.706 -70.722  1.00 8.56   ? 178 VAL O N    1 
ATOM   2661  C  CA   . VAL A  1 178 ? -37.003 -9.856  -69.708  1.00 8.19   ? 178 VAL O CA   1 
ATOM   2662  C  C    . VAL A  1 178 ? -37.892 -9.996  -68.478  1.00 9.99   ? 178 VAL O C    1 
ATOM   2663  O  O    . VAL A  1 178 ? -39.045 -9.565  -68.471  1.00 10.35  ? 178 VAL O O    1 
ATOM   2664  C  CB   . VAL A  1 178 ? -36.916 -8.433  -70.167  1.00 9.05   ? 178 VAL O CB   1 
ATOM   2665  C  CG1  . VAL A  1 178 ? -36.237 -7.561  -69.106  1.00 12.37  ? 178 VAL O CG1  1 
ATOM   2666  C  CG2  . VAL A  1 178 ? -36.183 -8.367  -71.520  1.00 14.35  ? 178 VAL O CG2  1 
ATOM   2667  H  H    . VAL A  1 178 ? -38.235 -10.322 -71.157  1.00 10.27  ? 178 VAL O H    1 
ATOM   2668  H  HA   . VAL A  1 178 ? -36.113 -10.173 -69.492  1.00 9.83   ? 178 VAL O HA   1 
ATOM   2669  H  HB   . VAL A  1 178 ? -37.814 -8.091  -70.300  1.00 10.86  ? 178 VAL O HB   1 
ATOM   2670  H  HG11 . VAL A  1 178 ? -36.193 -6.648  -69.429  1.00 14.85  ? 178 VAL O HG11 1 
ATOM   2671  H  HG12 . VAL A  1 178 ? -36.756 -7.599  -68.288  1.00 14.85  ? 178 VAL O HG12 1 
ATOM   2672  H  HG13 . VAL A  1 178 ? -35.341 -7.899  -68.947  1.00 14.85  ? 178 VAL O HG13 1 
ATOM   2673  H  HG21 . VAL A  1 178 ? -36.132 -7.441  -71.806  1.00 17.22  ? 178 VAL O HG21 1 
ATOM   2674  H  HG22 . VAL A  1 178 ? -35.290 -8.730  -71.412  1.00 17.22  ? 178 VAL O HG22 1 
ATOM   2675  H  HG23 . VAL A  1 178 ? -36.676 -8.889  -72.171  1.00 17.22  ? 178 VAL O HG23 1 
ATOM   2676  N  N    . HIS A  1 179 ? -37.357 -10.640 -67.461  1.00 8.39   ? 179 HIS O N    1 
ATOM   2677  C  CA   . HIS A  1 179 ? -38.174 -11.210 -66.410  1.00 9.20   ? 179 HIS O CA   1 
ATOM   2678  C  C    . HIS A  1 179 ? -37.808 -10.603 -65.074  1.00 14.95  ? 179 HIS O C    1 
ATOM   2679  O  O    . HIS A  1 179 ? -36.624 -10.393 -64.769  1.00 7.74   ? 179 HIS O O    1 
ATOM   2680  C  CB   . HIS A  1 179 ? -37.980 -12.724 -66.378  1.00 13.98  ? 179 HIS O CB   1 
ATOM   2681  C  CG   . HIS A  1 179 ? -39.063 -13.464 -65.663  1.00 16.35  ? 179 HIS O CG   1 
ATOM   2682  N  ND1  . HIS A  1 179 ? -39.191 -13.461 -64.290  1.00 16.57  ? 179 HIS O ND1  1 
ATOM   2683  C  CD2  . HIS A  1 179 ? -40.076 -14.228 -66.133  1.00 16.51  ? 179 HIS O CD2  1 
ATOM   2684  C  CE1  . HIS A  1 179 ? -40.240 -14.189 -63.947  1.00 17.47  ? 179 HIS O CE1  1 
ATOM   2685  N  NE2  . HIS A  1 179 ? -40.794 -14.665 -65.047  1.00 19.53  ? 179 HIS O NE2  1 
ATOM   2686  H  H    . HIS A  1 179 ? -36.512 -10.762 -67.355  1.00 10.07  ? 179 HIS O H    1 
ATOM   2687  H  HA   . HIS A  1 179 ? -39.109 -11.023 -66.588  1.00 11.04  ? 179 HIS O HA   1 
ATOM   2688  H  HB2  . HIS A  1 179 ? -37.949 -13.054 -67.290  1.00 16.77  ? 179 HIS O HB2  1 
ATOM   2689  H  HB3  . HIS A  1 179 ? -37.142 -12.921 -65.930  1.00 16.77  ? 179 HIS O HB3  1 
ATOM   2690  H  HD2  . HIS A  1 179 ? -40.256 -14.417 -67.026  1.00 19.81  ? 179 HIS O HD2  1 
ATOM   2691  H  HE1  . HIS A  1 179 ? -40.535 -14.344 -63.078  1.00 20.96  ? 179 HIS O HE1  1 
ATOM   2692  N  N    . ALA A  1 180 ? -38.836 -10.320 -64.285  1.00 7.39   ? 180 ALA O N    1 
ATOM   2693  C  CA   . ALA A  1 180 ? -38.670 -9.824  -62.926  1.00 7.56   ? 180 ALA O CA   1 
ATOM   2694  C  C    . ALA A  1 180 ? -37.925 -10.853 -62.073  1.00 7.40   ? 180 ALA O C    1 
ATOM   2695  O  O    . ALA A  1 180 ? -37.904 -12.048 -62.408  1.00 10.13  ? 180 ALA O O    1 
ATOM   2696  C  CB   . ALA A  1 180 ? -40.026 -9.522  -62.314  1.00 8.90   ? 180 ALA O CB   1 
ATOM   2697  H  H    . ALA A  1 180 ? -39.658 -10.410 -64.519  1.00 8.86   ? 180 ALA O H    1 
ATOM   2698  H  HA   . ALA A  1 180 ? -38.151 -9.005  -62.942  1.00 9.07   ? 180 ALA O HA   1 
ATOM   2699  H  HB1  . ALA A  1 180 ? -39.898 -9.193  -61.411  1.00 10.68  ? 180 ALA O HB1  1 
ATOM   2700  H  HB2  . ALA A  1 180 ? -40.471 -8.849  -62.852  1.00 10.68  ? 180 ALA O HB2  1 
ATOM   2701  H  HB3  . ALA A  1 180 ? -40.553 -10.336 -62.299  1.00 10.68  ? 180 ALA O HB3  1 
ATOM   2702  N  N    . ILE A  1 181 ? -37.336 -10.406 -60.969  1.00 9.00   ? 181 ILE O N    1 
ATOM   2703  C  CA   . ILE A  1 181 ? -36.655 -11.334 -60.069  1.00 11.61  ? 181 ILE O CA   1 
ATOM   2704  C  C    . ILE A  1 181 ? -37.655 -12.217 -59.334  1.00 15.06  ? 181 ILE O C    1 
ATOM   2705  O  O    . ILE A  1 181 ? -38.842 -11.899 -59.235  1.00 11.65  ? 181 ILE O O    1 
ATOM   2706  C  CB   . ILE A  1 181 ? -35.752 -10.609 -59.054  1.00 13.87  ? 181 ILE O CB   1 
ATOM   2707  C  CG1  . ILE A  1 181 ? -36.562 -9.792  -58.043  1.00 18.04  ? 181 ILE O CG1  1 
ATOM   2708  C  CG2  . ILE A  1 181 ? -34.719 -9.768  -59.798  1.00 22.80  ? 181 ILE O CG2  1 
ATOM   2709  C  CD1  . ILE A  1 181 ? -35.692 -8.941  -57.115  1.00 33.96  ? 181 ILE O CD1  1 
ATOM   2710  H  H    . ILE A  1 181 ? -37.315 -9.583  -60.720  1.00 10.81  ? 181 ILE O H    1 
ATOM   2711  H  HA   . ILE A  1 181 ? -36.089 -11.916 -60.599  1.00 13.93  ? 181 ILE O HA   1 
ATOM   2712  H  HB   . ILE A  1 181 ? -35.270 -11.289 -58.557  1.00 16.64  ? 181 ILE O HB   1 
ATOM   2713  H  HG12 . ILE A  1 181 ? -37.156 -9.195  -58.525  1.00 21.65  ? 181 ILE O HG12 1 
ATOM   2714  H  HG13 . ILE A  1 181 ? -37.081 -10.398 -57.492  1.00 21.65  ? 181 ILE O HG13 1 
ATOM   2715  H  HG21 . ILE A  1 181 ? -34.155 -9.316  -59.150  1.00 27.36  ? 181 ILE O HG21 1 
ATOM   2716  H  HG22 . ILE A  1 181 ? -34.180 -10.351 -60.356  1.00 27.36  ? 181 ILE O HG22 1 
ATOM   2717  H  HG23 . ILE A  1 181 ? -35.180 -9.116  -60.348  1.00 27.36  ? 181 ILE O HG23 1 
ATOM   2718  H  HD11 . ILE A  1 181 ? -36.266 -8.453  -56.505  1.00 40.76  ? 181 ILE O HD11 1 
ATOM   2719  H  HD12 . ILE A  1 181 ? -35.099 -9.525  -56.617  1.00 40.76  ? 181 ILE O HD12 1 
ATOM   2720  H  HD13 . ILE A  1 181 ? -35.174 -8.321  -57.651  1.00 40.76  ? 181 ILE O HD13 1 
ATOM   2721  N  N    . THR A  1 182 ? -37.173 -13.357 -58.855  1.00 11.25  ? 182 THR O N    1 
ATOM   2722  C  CA   . THR A  1 182 ? -38.025 -14.283 -58.121  1.00 15.02  ? 182 THR O CA   1 
ATOM   2723  C  C    . THR A  1 182 ? -37.316 -14.795 -56.881  1.00 8.89   ? 182 THR O C    1 
ATOM   2724  O  O    . THR A  1 182 ? -36.131 -14.494 -56.625  1.00 10.91  ? 182 THR O O    1 
ATOM   2725  C  CB   . THR A  1 182 ? -38.467 -15.505 -58.988  1.00 20.38  ? 182 THR O CB   1 
ATOM   2726  O  OG1  . THR A  1 182 ? -37.329 -16.316 -59.299  1.00 19.28  ? 182 THR O OG1  1 
ATOM   2727  C  CG2  . THR A  1 182 ? -39.161 -15.051 -60.275  1.00 24.42  ? 182 THR O CG2  1 
ATOM   2728  H  H    . THR A  1 182 ? -36.358 -13.618 -58.942  1.00 13.50  ? 182 THR O H    1 
ATOM   2729  H  HA   . THR A  1 182 ? -38.825 -13.814 -57.835  1.00 18.02  ? 182 THR O HA   1 
ATOM   2730  H  HB   . THR A  1 182 ? -39.100 -16.036 -58.481  1.00 24.45  ? 182 THR O HB   1 
ATOM   2731  H  HG1  . THR A  1 182 ? -37.563 -16.974 -59.765  1.00 23.13  ? 182 THR O HG1  1 
ATOM   2732  H  HG21 . THR A  1 182 ? -39.427 -15.823 -60.798  1.00 29.31  ? 182 THR O HG21 1 
ATOM   2733  H  HG22 . THR A  1 182 ? -39.950 -14.529 -60.059  1.00 29.31  ? 182 THR O HG22 1 
ATOM   2734  H  HG23 . THR A  1 182 ? -38.557 -14.505 -60.802  1.00 29.31  ? 182 THR O HG23 1 
ATOM   2735  N  N    . ALA A  1 183 ? -38.070 -15.548 -56.101  1.00 9.60   ? 183 ALA O N    1 
ATOM   2736  C  CA   . ALA A  1 183 ? -37.610 -16.044 -54.824  1.00 10.20  ? 183 ALA O CA   1 
ATOM   2737  C  C    . ALA A  1 183 ? -36.434 -17.017 -54.935  1.00 13.98  ? 183 ALA O C    1 
ATOM   2738  O  O    . ALA A  1 183 ? -35.764 -17.243 -53.952  1.00 15.48  ? 183 ALA O O    1 
ATOM   2739  C  CB   . ALA A  1 183 ? -38.763 -16.698 -54.091  1.00 11.09  ? 183 ALA O CB   1 
ATOM   2740  H  H    . ALA A  1 183 ? -38.872 -15.791 -56.296  1.00 11.53  ? 183 ALA O H    1 
ATOM   2741  H  HA   . ALA A  1 183 ? -37.314 -15.290 -54.290  1.00 12.24  ? 183 ALA O HA   1 
ATOM   2742  H  HB1  . ALA A  1 183 ? -38.447 -17.028 -53.236  1.00 13.30  ? 183 ALA O HB1  1 
ATOM   2743  H  HB2  . ALA A  1 183 ? -39.463 -16.040 -53.954  1.00 13.30  ? 183 ALA O HB2  1 
ATOM   2744  H  HB3  . ALA A  1 183 ? -39.100 -17.433 -54.626  1.00 13.30  ? 183 ALA O HB3  1 
ATOM   2745  N  N    . THR A  1 184 ? -36.170 -17.572 -56.118  1.00 9.80   ? 184 THR O N    1 
ATOM   2746  C  CA   . THR A  1 184 ? -35.027 -18.468 -56.282  1.00 13.66  ? 184 THR O CA   1 
ATOM   2747  C  C    . THR A  1 184 ? -33.707 -17.687 -56.401  1.00 14.33  ? 184 THR O C    1 
ATOM   2748  O  O    . THR A  1 184 ? -32.611 -18.242 -56.231  1.00 13.37  ? 184 THR O O    1 
ATOM   2749  C  CB   . THR A  1 184 ? -35.184 -19.369 -57.533  1.00 23.51  ? 184 THR O CB   1 
ATOM   2750  O  OG1  . THR A  1 184 ? -35.289 -18.556 -58.697  1.00 18.27  ? 184 THR O OG1  1 
ATOM   2751  C  CG2  . THR A  1 184 ? -36.419 -20.230 -57.450  1.00 31.68  ? 184 THR O CG2  1 
ATOM   2752  H  H    . THR A  1 184 ? -36.632 -17.446 -56.833  1.00 11.76  ? 184 THR O H    1 
ATOM   2753  H  HA   . THR A  1 184 ? -34.965 -19.044 -55.504  1.00 16.39  ? 184 THR O HA   1 
ATOM   2754  H  HB   . THR A  1 184 ? -34.411 -19.949 -57.613  1.00 28.21  ? 184 THR O HB   1 
ATOM   2755  H  HG1  . THR A  1 184 ? -35.957 -18.051 -58.636  1.00 21.92  ? 184 THR O HG1  1 
ATOM   2756  H  HG21 . THR A  1 184 ? -36.492 -20.782 -58.245  1.00 38.01  ? 184 THR O HG21 1 
ATOM   2757  H  HG22 . THR A  1 184 ? -36.371 -20.804 -56.670  1.00 38.01  ? 184 THR O HG22 1 
ATOM   2758  H  HG23 . THR A  1 184 ? -37.209 -19.671 -57.382  1.00 38.01  ? 184 THR O HG23 1 
ATOM   2759  N  N    . GLN A  1 185 ? -33.801 -16.392 -56.656  1.00 12.04  ? 185 GLN O N    1 
ATOM   2760  C  CA   . GLN A  1 185 ? -32.598 -15.565 -56.766  1.00 12.17  ? 185 GLN O CA   1 
ATOM   2761  C  C    . GLN A  1 185 ? -32.066 -15.098 -55.407  1.00 15.76  ? 185 GLN O C    1 
ATOM   2762  O  O    . GLN A  1 185 ? -32.688 -15.332 -54.375  1.00 12.14  ? 185 GLN O O    1 
ATOM   2763  C  CB   . GLN A  1 185 ? -32.886 -14.381 -57.678  1.00 9.16   ? 185 GLN O CB   1 
ATOM   2764  C  CG   . GLN A  1 185 ? -32.943 -14.803 -59.140  1.00 11.71  ? 185 GLN O CG   1 
ATOM   2765  C  CD   . GLN A  1 185 ? -33.071 -13.619 -60.057  1.00 14.67  ? 185 GLN O CD   1 
ATOM   2766  O  OE1  . GLN A  1 185 ? -34.156 -13.333 -60.547  1.00 17.16  ? 185 GLN O OE1  1 
ATOM   2767  N  NE2  . GLN A  1 185 ? -31.971 -12.905 -60.271  1.00 16.28  ? 185 GLN O NE2  1 
ATOM   2768  H  H    . GLN A  1 185 ? -34.539 -15.966 -56.771  1.00 14.45  ? 185 GLN O H    1 
ATOM   2769  H  HA   . GLN A  1 185 ? -31.901 -16.093 -57.185  1.00 14.61  ? 185 GLN O HA   1 
ATOM   2770  H  HB2  . GLN A  1 185 ? -33.743 -13.994 -57.440  1.00 10.99  ? 185 GLN O HB2  1 
ATOM   2771  H  HB3  . GLN A  1 185 ? -32.181 -13.722 -57.579  1.00 10.99  ? 185 GLN O HB3  1 
ATOM   2772  H  HG2  . GLN A  1 185 ? -32.127 -15.276 -59.368  1.00 14.05  ? 185 GLN O HG2  1 
ATOM   2773  H  HG3  . GLN A  1 185 ? -33.712 -15.377 -59.277  1.00 14.05  ? 185 GLN O HG3  1 
ATOM   2774  H  HE21 . GLN A  1 185 ? -31.232 -13.129 -59.891  1.00 19.54  ? 185 GLN O HE21 1 
ATOM   2775  H  HE22 . GLN A  1 185 ? -31.998 -12.219 -60.788  1.00 19.54  ? 185 GLN O HE22 1 
ATOM   2776  N  N    . LYS A  1 186 ? -30.892 -14.456 -55.434  1.00 10.16  ? 186 LYS O N    1 
ATOM   2777  C  CA   . LYS A  1 186 ? -30.142 -14.055 -54.252  1.00 13.63  ? 186 LYS O CA   1 
ATOM   2778  C  C    . LYS A  1 186 ? -29.996 -12.538 -54.190  1.00 12.22  ? 186 LYS O C    1 
ATOM   2779  O  O    . LYS A  1 186 ? -29.810 -11.903 -55.210  1.00 10.70  ? 186 LYS O O    1 
ATOM   2780  C  CB   . LYS A  1 186 ? -28.730 -14.675 -54.263  1.00 13.79  ? 186 LYS O CB   1 
ATOM   2781  C  CG   . LYS A  1 186 ? -28.696 -16.192 -54.356  1.00 12.86  ? 186 LYS O CG   1 
ATOM   2782  C  CD   . LYS A  1 186 ? -29.061 -16.821 -53.049  1.00 26.28  ? 186 LYS O CD   1 
ATOM   2783  C  CE   . LYS A  1 186 ? -28.928 -18.346 -53.085  1.00 39.41  ? 186 LYS O CE   1 
ATOM   2784  N  NZ   . LYS A  1 186 ? -29.993 -18.983 -53.906  1.00 45.43  ? 186 LYS O NZ   1 
ATOM   2785  H  H    . LYS A  1 186 ? -30.499 -14.234 -56.166  1.00 12.19  ? 186 LYS O H    1 
ATOM   2786  H  HA   . LYS A  1 186 ? -30.605 -14.355 -53.455  1.00 16.36  ? 186 LYS O HA   1 
ATOM   2787  H  HB2  . LYS A  1 186 ? -28.245 -14.324 -55.027  1.00 16.54  ? 186 LYS O HB2  1 
ATOM   2788  H  HB3  . LYS A  1 186 ? -28.276 -14.421 -53.445  1.00 16.54  ? 186 LYS O HB3  1 
ATOM   2789  H  HG2  . LYS A  1 186 ? -29.333 -16.488 -55.025  1.00 15.43  ? 186 LYS O HG2  1 
ATOM   2790  H  HG3  . LYS A  1 186 ? -27.800 -16.480 -54.593  1.00 15.43  ? 186 LYS O HG3  1 
ATOM   2791  H  HD2  . LYS A  1 186 ? -28.472 -16.483 -52.357  1.00 31.54  ? 186 LYS O HD2  1 
ATOM   2792  H  HD3  . LYS A  1 186 ? -29.983 -16.604 -52.838  1.00 31.54  ? 186 LYS O HD3  1 
ATOM   2793  H  HE2  . LYS A  1 186 ? -28.069 -18.581 -53.469  1.00 47.29  ? 186 LYS O HE2  1 
ATOM   2794  H  HE3  . LYS A  1 186 ? -28.995 -18.692 -52.181  1.00 47.29  ? 186 LYS O HE3  1 
ATOM   2795  H  HZ1  . LYS A  1 186 ? -29.888 -19.867 -53.907  1.00 54.51  ? 186 LYS O HZ1  1 
ATOM   2796  H  HZ2  . LYS A  1 186 ? -30.793 -18.787 -53.571  1.00 54.51  ? 186 LYS O HZ2  1 
ATOM   2797  H  HZ3  . LYS A  1 186 ? -29.949 -18.685 -54.744  1.00 54.51  ? 186 LYS O HZ3  1 
ATOM   2798  N  N    . THR A  1 187 ? -30.043 -11.984 -52.983  1.00 11.01  ? 187 THR O N    1 
ATOM   2799  C  CA   . THR A  1 187 ? -29.835 -10.557 -52.770  1.00 14.12  ? 187 THR O CA   1 
ATOM   2800  C  C    . THR A  1 187 ? -28.392 -10.105 -53.037  1.00 12.27  ? 187 THR O C    1 
ATOM   2801  O  O    . THR A  1 187 ? -28.169 -8.996  -53.506  1.00 16.53  ? 187 THR O O    1 
ATOM   2802  C  CB   . THR A  1 187 ? -30.219 -10.178 -51.326  1.00 11.85  ? 187 THR O CB   1 
ATOM   2803  O  OG1  . THR A  1 187 ? -29.593 -11.091 -50.415  1.00 13.20  ? 187 THR O OG1  1 
ATOM   2804  C  CG2  . THR A  1 187 ? -31.730 -10.238 -51.134  1.00 8.87   ? 187 THR O CG2  1 
ATOM   2805  H  H    . THR A  1 187 ? -30.198 -12.421 -52.259  1.00 13.21  ? 187 THR O H    1 
ATOM   2806  H  HA   . THR A  1 187 ? -30.415 -10.064 -53.370  1.00 16.94  ? 187 THR O HA   1 
ATOM   2807  H  HB   . THR A  1 187 ? -29.919 -9.275  -51.137  1.00 14.22  ? 187 THR O HB   1 
ATOM   2808  H  HG1  . THR A  1 187 ? -29.796 -10.892 -49.624  1.00 15.84  ? 187 THR O HG1  1 
ATOM   2809  H  HG21 . THR A  1 187 ? -31.958 -9.998  -50.222  1.00 10.64  ? 187 THR O HG21 1 
ATOM   2810  H  HG22 . THR A  1 187 ? -32.166 -9.620  -51.741  1.00 10.64  ? 187 THR O HG22 1 
ATOM   2811  H  HG23 . THR A  1 187 ? -32.051 -11.136 -51.313  1.00 10.64  ? 187 THR O HG23 1 
ATOM   2812  N  N    . VAL A  1 188 ? -27.422 -10.952 -52.702  1.00 12.37  ? 188 VAL O N    1 
ATOM   2813  C  CA   . VAL A  1 188 ? -26.011 -10.706 -53.005  1.00 10.93  ? 188 VAL O CA   1 
ATOM   2814  C  C    . VAL A  1 188 ? -25.407 -12.008 -53.535  1.00 12.82  ? 188 VAL O C    1 
ATOM   2815  O  O    . VAL A  1 188 ? -26.033 -13.048 -53.402  1.00 14.70  ? 188 VAL O O    1 
ATOM   2816  C  CB   . VAL A  1 188 ? -25.211 -10.231 -51.772  1.00 18.20  ? 188 VAL O CB   1 
ATOM   2817  C  CG1  . VAL A  1 188 ? -25.767 -8.906  -51.251  1.00 19.90  ? 188 VAL O CG1  1 
ATOM   2818  C  CG2  . VAL A  1 188 ? -25.217 -11.285 -50.679  1.00 18.52  ? 188 VAL O CG2  1 
ATOM   2819  H  H    . VAL A  1 188 ? -27.558 -11.693 -52.288  1.00 14.84  ? 188 VAL O H    1 
ATOM   2820  H  HA   . VAL A  1 188 ? -25.941 -10.030 -53.696  1.00 13.11  ? 188 VAL O HA   1 
ATOM   2821  H  HB   . VAL A  1 188 ? -24.289 -10.083 -52.035  1.00 21.84  ? 188 VAL O HB   1 
ATOM   2822  H  HG11 . VAL A  1 188 ? -25.250 -8.628  -50.479  1.00 23.88  ? 188 VAL O HG11 1 
ATOM   2823  H  HG12 . VAL A  1 188 ? -25.700 -8.239  -51.952  1.00 23.88  ? 188 VAL O HG12 1 
ATOM   2824  H  HG13 . VAL A  1 188 ? -26.696 -9.031  -51.001  1.00 23.88  ? 188 VAL O HG13 1 
ATOM   2825  H  HG21 . VAL A  1 188 ? -24.708 -10.957 -49.921  1.00 22.22  ? 188 VAL O HG21 1 
ATOM   2826  H  HG22 . VAL A  1 188 ? -26.134 -11.457 -50.412  1.00 22.22  ? 188 VAL O HG22 1 
ATOM   2827  H  HG23 . VAL A  1 188 ? -24.814 -12.098 -51.022  1.00 22.22  ? 188 VAL O HG23 1 
ATOM   2828  N  N    . ASP A  1 189 ? -24.226 -11.938 -54.152  1.00 9.01   ? 189 ASP O N    1 
ATOM   2829  C  CA   . ASP A  1 189 ? -23.569 -13.124 -54.726  1.00 7.53   ? 189 ASP O CA   1 
ATOM   2830  C  C    . ASP A  1 189 ? -23.546 -14.245 -53.716  1.00 11.55  ? 189 ASP O C    1 
ATOM   2831  O  O    . ASP A  1 189 ? -22.887 -14.127 -52.672  1.00 14.12  ? 189 ASP O O    1 
ATOM   2832  C  CB   . ASP A  1 189 ? -22.112 -12.845 -55.148  1.00 9.41   ? 189 ASP O CB   1 
ATOM   2833  C  CG   . ASP A  1 189 ? -21.982 -11.922 -56.355  1.00 12.20  ? 189 ASP O CG   1 
ATOM   2834  O  OD1  . ASP A  1 189 ? -22.988 -11.554 -56.992  1.00 12.42  ? 189 ASP O OD1  1 
ATOM   2835  O  OD2  . ASP A  1 189 ? -20.826 -11.605 -56.714  1.00 11.57  ? 189 ASP O OD2  1 
ATOM   2836  H  H    . ASP A  1 189 ? -23.778 -11.211 -54.254  1.00 10.82  ? 189 ASP O H    1 
ATOM   2837  H  HA   . ASP A  1 189 ? -24.063 -13.422 -55.505  1.00 9.04   ? 189 ASP O HA   1 
ATOM   2838  H  HB2  . ASP A  1 189 ? -21.647 -12.428 -54.406  1.00 11.29  ? 189 ASP O HB2  1 
ATOM   2839  H  HB3  . ASP A  1 189 ? -21.685 -13.687 -55.372  1.00 11.29  ? 189 ASP O HB3  1 
ATOM   2840  N  N    . GLY A  1 190 ? -24.212 -15.344 -54.041  1.00 13.08  ? 190 GLY O N    1 
ATOM   2841  C  CA   . GLY A  1 190 ? -24.228 -16.508 -53.170  1.00 13.19  ? 190 GLY O CA   1 
ATOM   2842  C  C    . GLY A  1 190 ? -24.300 -17.814 -53.950  1.00 16.94  ? 190 GLY O C    1 
ATOM   2843  O  O    . GLY A  1 190 ? -24.335 -17.796 -55.173  1.00 14.94  ? 190 GLY O O    1 
ATOM   2844  H  H    . GLY A  1 190 ? -24.665 -15.441 -54.766  1.00 15.70  ? 190 GLY O H    1 
ATOM   2845  H  HA2  . GLY A  1 190 ? -23.424 -16.517 -52.628  1.00 15.83  ? 190 GLY O HA2  1 
ATOM   2846  H  HA3  . GLY A  1 190 ? -24.997 -16.459 -52.580  1.00 15.83  ? 190 GLY O HA3  1 
ATOM   2847  N  N    . PRO A  1 191 ? -24.301 -18.949 -53.242  1.00 21.88  ? 191 PRO O N    1 
ATOM   2848  C  CA   . PRO A  1 191 ? -24.194 -20.270 -53.870  1.00 19.85  ? 191 PRO O CA   1 
ATOM   2849  C  C    . PRO A  1 191 ? -25.427 -20.692 -54.648  1.00 21.42  ? 191 PRO O C    1 
ATOM   2850  O  O    . PRO A  1 191 ? -26.542 -20.554 -54.168  1.00 20.75  ? 191 PRO O O    1 
ATOM   2851  C  CB   . PRO A  1 191 ? -23.973 -21.212 -52.677  1.00 28.49  ? 191 PRO O CB   1 
ATOM   2852  C  CG   . PRO A  1 191 ? -23.479 -20.349 -51.577  1.00 35.42  ? 191 PRO O CG   1 
ATOM   2853  C  CD   . PRO A  1 191 ? -24.204 -19.048 -51.777  1.00 33.35  ? 191 PRO O CD   1 
ATOM   2854  H  HA   . PRO A  1 191 ? -23.419 -20.304 -54.453  1.00 23.82  ? 191 PRO O HA   1 
ATOM   2855  H  HB2  . PRO A  1 191 ? -24.813 -21.630 -52.432  1.00 34.19  ? 191 PRO O HB2  1 
ATOM   2856  H  HB3  . PRO A  1 191 ? -23.312 -21.882 -52.909  1.00 34.19  ? 191 PRO O HB3  1 
ATOM   2857  H  HG2  . PRO A  1 191 ? -23.706 -20.744 -50.721  1.00 42.50  ? 191 PRO O HG2  1 
ATOM   2858  H  HG3  . PRO A  1 191 ? -22.520 -20.227 -51.660  1.00 42.50  ? 191 PRO O HG3  1 
ATOM   2859  H  HD2  . PRO A  1 191 ? -25.088 -19.087 -51.379  1.00 40.02  ? 191 PRO O HD2  1 
ATOM   2860  H  HD3  . PRO A  1 191 ? -23.684 -18.311 -51.420  1.00 40.02  ? 191 PRO O HD3  1 
ATOM   2861  N  N    . SER A  1 192 ? -25.195 -21.198 -55.852  1.00 17.52  ? 192 SER O N    1 
ATOM   2862  C  CA   . SER A  1 192 ? -26.239 -21.759 -56.705  1.00 17.55  ? 192 SER O CA   1 
ATOM   2863  C  C    . SER A  1 192 ? -25.540 -22.778 -57.624  1.00 28.63  ? 192 SER O C    1 
ATOM   2864  O  O    . SER A  1 192 ? -25.411 -22.571 -58.827  1.00 22.44  ? 192 SER O O    1 
ATOM   2865  C  CB   . SER A  1 192 ? -26.943 -20.649 -57.485  1.00 18.93  ? 192 SER O CB   1 
ATOM   2866  O  OG   . SER A  1 192 ? -27.747 -21.178 -58.530  1.00 23.36  ? 192 SER O OG   1 
ATOM   2867  H  H    . SER A  1 192 ? -24.414 -21.230 -56.210  1.00 21.03  ? 192 SER O H    1 
ATOM   2868  H  HA   . SER A  1 192 ? -26.894 -22.225 -56.162  1.00 21.05  ? 192 SER O HA   1 
ATOM   2869  H  HB2  . SER A  1 192 ? -27.509 -20.148 -56.877  1.00 22.72  ? 192 SER O HB2  1 
ATOM   2870  H  HB3  . SER A  1 192 ? -26.274 -20.062 -57.871  1.00 22.72  ? 192 SER O HB3  1 
ATOM   2871  H  HG   . SER A  1 192 ? -27.270 -21.614 -59.067  1.00 28.03  ? 192 SER O HG   1 
ATOM   2872  N  N    . GLY A  1 193 ? -25.067 -23.872 -57.032  1.00 25.75  ? 193 GLY O N    1 
ATOM   2873  C  CA   . GLY A  1 193 ? -24.107 -24.761 -57.682  1.00 21.85  ? 193 GLY O CA   1 
ATOM   2874  C  C    . GLY A  1 193 ? -24.519 -25.395 -58.998  1.00 22.14  ? 193 GLY O C    1 
ATOM   2875  O  O    . GLY A  1 193 ? -23.676 -25.798 -59.804  1.00 26.57  ? 193 GLY O O    1 
ATOM   2876  H  H    . GLY A  1 193 ? -25.290 -24.125 -56.241  1.00 30.90  ? 193 GLY O H    1 
ATOM   2877  H  HA2  . GLY A  1 193 ? -23.291 -24.263 -57.843  1.00 26.22  ? 193 GLY O HA2  1 
ATOM   2878  H  HA3  . GLY A  1 193 ? -23.894 -25.481 -57.068  1.00 26.22  ? 193 GLY O HA3  1 
ATOM   2879  N  N    . LYS A  1 194 ? -25.812 -25.523 -59.219  1.00 19.49  ? 194 LYS O N    1 
ATOM   2880  C  CA   . LYS A  1 194 ? -26.300 -26.112 -60.454  1.00 31.44  ? 194 LYS O CA   1 
ATOM   2881  C  C    . LYS A  1 194 ? -26.412 -25.046 -61.548  1.00 37.28  ? 194 LYS O C    1 
ATOM   2882  O  O    . LYS A  1 194 ? -26.367 -25.353 -62.727  1.00 35.63  ? 194 LYS O O    1 
ATOM   2883  C  CB   . LYS A  1 194 ? -27.651 -26.785 -60.215  1.00 39.88  ? 194 LYS O CB   1 
ATOM   2884  C  CG   . LYS A  1 194 ? -27.568 -27.962 -59.250  1.00 51.54  ? 194 LYS O CG   1 
ATOM   2885  C  CD   . LYS A  1 194 ? -28.922 -28.605 -58.999  1.00 66.22  ? 194 LYS O CD   1 
ATOM   2886  C  CE   . LYS A  1 194 ? -28.801 -29.761 -58.013  1.00 78.30  ? 194 LYS O CE   1 
ATOM   2887  N  NZ   . LYS A  1 194 ? -30.125 -30.341 -57.653  1.00 81.10  ? 194 LYS O NZ   1 
ATOM   2888  H  H    . LYS A  1 194 ? -26.430 -25.278 -58.673  1.00 23.39  ? 194 LYS O H    1 
ATOM   2889  H  HA   . LYS A  1 194 ? -25.673 -26.789 -60.754  1.00 37.73  ? 194 LYS O HA   1 
ATOM   2890  H  HB2  . LYS A  1 194 ? -28.265 -26.134 -59.840  1.00 47.86  ? 194 LYS O HB2  1 
ATOM   2891  H  HB3  . LYS A  1 194 ? -27.993 -27.115 -61.060  1.00 47.86  ? 194 LYS O HB3  1 
ATOM   2892  H  HG2  . LYS A  1 194 ? -26.979 -28.636 -59.623  1.00 61.84  ? 194 LYS O HG2  1 
ATOM   2893  H  HG3  . LYS A  1 194 ? -27.220 -27.650 -58.399  1.00 61.84  ? 194 LYS O HG3  1 
ATOM   2894  H  HD2  . LYS A  1 194 ? -29.527 -27.946 -58.625  1.00 79.47  ? 194 LYS O HD2  1 
ATOM   2895  H  HD3  . LYS A  1 194 ? -29.273 -28.951 -59.834  1.00 79.47  ? 194 LYS O HD3  1 
ATOM   2896  H  HE2  . LYS A  1 194 ? -28.263 -30.463 -58.412  1.00 93.96  ? 194 LYS O HE2  1 
ATOM   2897  H  HE3  . LYS A  1 194 ? -28.381 -29.442 -57.199  1.00 93.96  ? 194 LYS O HE3  1 
ATOM   2898  H  HZ1  . LYS A  1 194 ? -30.017 -31.011 -57.077  1.00 97.31  ? 194 LYS O HZ1  1 
ATOM   2899  H  HZ2  . LYS A  1 194 ? -30.638 -29.718 -57.278  1.00 97.31  ? 194 LYS O HZ2  1 
ATOM   2900  H  HZ3  . LYS A  1 194 ? -30.531 -30.649 -58.382  1.00 97.31  ? 194 LYS O HZ3  1 
ATOM   2901  N  N    . LEU A  1 195 ? -26.543 -23.788 -61.138  1.00 20.24  ? 195 LEU O N    1 
ATOM   2902  C  CA   . LEU A  1 195 ? -26.783 -22.687 -62.068  1.00 15.90  ? 195 LEU O CA   1 
ATOM   2903  C  C    . LEU A  1 195 ? -26.029 -21.468 -61.604  1.00 10.85  ? 195 LEU O C    1 
ATOM   2904  O  O    . LEU A  1 195 ? -26.590 -20.621 -60.905  1.00 15.92  ? 195 LEU O O    1 
ATOM   2905  C  CB   . LEU A  1 195 ? -28.269 -22.377 -62.149  1.00 18.30  ? 195 LEU O CB   1 
ATOM   2906  C  CG   . LEU A  1 195 ? -29.154 -23.517 -62.644  1.00 29.30  ? 195 LEU O CG   1 
ATOM   2907  C  CD1  . LEU A  1 195 ? -30.611 -23.214 -62.367  1.00 38.95  ? 195 LEU O CD1  1 
ATOM   2908  C  CD2  . LEU A  1 195 ? -28.908 -23.717 -64.119  1.00 19.55  ? 195 LEU O CD2  1 
ATOM   2909  H  H    . LEU A  1 195 ? -26.497 -23.543 -60.315  1.00 24.29  ? 195 LEU O H    1 
ATOM   2910  H  HA   . LEU A  1 195 ? -26.467 -22.930 -62.952  1.00 19.08  ? 195 LEU O HA   1 
ATOM   2911  H  HB2  . LEU A  1 195 ? -28.579 -22.132 -61.263  1.00 21.96  ? 195 LEU O HB2  1 
ATOM   2912  H  HB3  . LEU A  1 195 ? -28.393 -21.629 -62.753  1.00 21.96  ? 195 LEU O HB3  1 
ATOM   2913  H  HG   . LEU A  1 195 ? -28.917 -24.335 -62.179  1.00 35.16  ? 195 LEU O HG   1 
ATOM   2914  H  HD11 . LEU A  1 195 ? -31.153 -23.951 -62.690  1.00 46.74  ? 195 LEU O HD11 1 
ATOM   2915  H  HD12 . LEU A  1 195 ? -30.735 -23.106 -61.411  1.00 46.74  ? 195 LEU O HD12 1 
ATOM   2916  H  HD13 . LEU A  1 195 ? -30.856 -22.397 -62.828  1.00 46.74  ? 195 LEU O HD13 1 
ATOM   2917  H  HD21 . LEU A  1 195 ? -29.469 -24.441 -64.437  1.00 23.46  ? 195 LEU O HD21 1 
ATOM   2918  H  HD22 . LEU A  1 195 ? -29.127 -22.897 -64.588  1.00 23.46  ? 195 LEU O HD22 1 
ATOM   2919  H  HD23 . LEU A  1 195 ? -27.973 -23.937 -64.255  1.00 23.46  ? 195 LEU O HD23 1 
ATOM   2920  N  N    . TRP A  1 196 ? -24.771 -21.367 -61.996  1.00 14.47  ? 196 TRP O N    1 
ATOM   2921  C  CA   . TRP A  1 196 ? -23.891 -20.399 -61.347  1.00 12.72  ? 196 TRP O CA   1 
ATOM   2922  C  C    . TRP A  1 196 ? -24.354 -18.962 -61.540  1.00 11.43  ? 196 TRP O C    1 
ATOM   2923  O  O    . TRP A  1 196 ? -24.208 -18.145 -60.643  1.00 13.02  ? 196 TRP O O    1 
ATOM   2924  C  CB   . TRP A  1 196 ? -22.467 -20.558 -61.856  1.00 11.12  ? 196 TRP O CB   1 
ATOM   2925  C  CG   . TRP A  1 196 ? -21.790 -21.824 -61.426  1.00 12.21  ? 196 TRP O CG   1 
ATOM   2926  C  CD1  . TRP A  1 196 ? -22.307 -22.820 -60.651  1.00 12.74  ? 196 TRP O CD1  1 
ATOM   2927  C  CD2  . TRP A  1 196 ? -20.452 -22.220 -61.751  1.00 13.08  ? 196 TRP O CD2  1 
ATOM   2928  N  NE1  . TRP A  1 196 ? -21.358 -23.822 -60.467  1.00 15.16  ? 196 TRP O NE1  1 
ATOM   2929  C  CE2  . TRP A  1 196 ? -20.212 -23.466 -61.127  1.00 14.13  ? 196 TRP O CE2  1 
ATOM   2930  C  CE3  . TRP A  1 196 ? -19.423 -21.628 -62.489  1.00 17.28  ? 196 TRP O CE3  1 
ATOM   2931  C  CZ2  . TRP A  1 196 ? -18.997 -24.139 -61.245  1.00 15.29  ? 196 TRP O CZ2  1 
ATOM   2932  C  CZ3  . TRP A  1 196 ? -18.214 -22.299 -62.601  1.00 17.14  ? 196 TRP O CZ3  1 
ATOM   2933  C  CH2  . TRP A  1 196 ? -18.012 -23.542 -61.985  1.00 21.14  ? 196 TRP O CH2  1 
ATOM   2934  H  H    . TRP A  1 196 ? -24.404 -21.833 -62.619  1.00 17.36  ? 196 TRP O H    1 
ATOM   2935  H  HA   . TRP A  1 196 ? -23.884 -20.579 -60.394  1.00 15.26  ? 196 TRP O HA   1 
ATOM   2936  H  HB2  . TRP A  1 196 ? -22.482 -20.547 -62.826  1.00 13.34  ? 196 TRP O HB2  1 
ATOM   2937  H  HB3  . TRP A  1 196 ? -21.936 -19.815 -61.530  1.00 13.34  ? 196 TRP O HB3  1 
ATOM   2938  H  HD1  . TRP A  1 196 ? -23.166 -22.828 -60.296  1.00 15.28  ? 196 TRP O HD1  1 
ATOM   2939  H  HE1  . TRP A  1 196 ? -21.473 -24.544 -60.013  1.00 18.19  ? 196 TRP O HE1  1 
ATOM   2940  H  HE3  . TRP A  1 196 ? -19.549 -20.805 -62.904  1.00 20.74  ? 196 TRP O HE3  1 
ATOM   2941  H  HZ2  . TRP A  1 196 ? -18.860 -24.963 -60.835  1.00 18.35  ? 196 TRP O HZ2  1 
ATOM   2942  H  HZ3  . TRP A  1 196 ? -17.525 -21.918 -63.096  1.00 20.56  ? 196 TRP O HZ3  1 
ATOM   2943  H  HH2  . TRP A  1 196 ? -17.189 -23.967 -62.076  1.00 25.37  ? 196 TRP O HH2  1 
ATOM   2944  N  N    . ARG A  1 197 ? -24.917 -18.626 -62.691  1.00 14.21  ? 197 ARG O N    1 
ATOM   2945  C  CA   . ARG A  1 197 ? -25.273 -17.235 -62.907  1.00 10.85  ? 197 ARG O CA   1 
ATOM   2946  C  C    . ARG A  1 197 ? -26.407 -16.833 -61.951  1.00 9.72   ? 197 ARG O C    1 
ATOM   2947  O  O    . ARG A  1 197 ? -26.503 -15.672 -61.556  1.00 9.34   ? 197 ARG O O    1 
ATOM   2948  C  CB   . ARG A  1 197 ? -25.681 -16.981 -64.357  1.00 9.54   ? 197 ARG O CB   1 
ATOM   2949  C  CG   . ARG A  1 197 ? -24.636 -17.406 -65.383  1.00 9.79   ? 197 ARG O CG   1 
ATOM   2950  C  CD   . ARG A  1 197 ? -25.015 -16.878 -66.729  1.00 9.88   ? 197 ARG O CD   1 
ATOM   2951  N  NE   . ARG A  1 197 ? -24.427 -17.606 -67.850  1.00 14.95  ? 197 ARG O NE   1 
ATOM   2952  C  CZ   . ARG A  1 197 ? -23.927 -17.059 -68.957  1.00 14.81  ? 197 ARG O CZ   1 
ATOM   2953  N  NH1  . ARG A  1 197 ? -23.839 -15.748 -69.097  1.00 13.07  ? 197 ARG O NH1  1 
ATOM   2954  N  NH2  . ARG A  1 197 ? -23.492 -17.838 -69.938  1.00 16.25  ? 197 ARG O NH2  1 
ATOM   2955  H  H    . ARG A  1 197 ? -25.097 -19.161 -63.340  1.00 17.06  ? 197 ARG O H    1 
ATOM   2956  H  HA   . ARG A  1 197 ? -24.504 -16.677 -62.710  1.00 13.02  ? 197 ARG O HA   1 
ATOM   2957  H  HB2  . ARG A  1 197 ? -26.495 -17.475 -64.543  1.00 11.45  ? 197 ARG O HB2  1 
ATOM   2958  H  HB3  . ARG A  1 197 ? -25.840 -16.031 -64.474  1.00 11.45  ? 197 ARG O HB3  1 
ATOM   2959  H  HG2  . ARG A  1 197 ? -23.771 -17.041 -65.139  1.00 11.75  ? 197 ARG O HG2  1 
ATOM   2960  H  HG3  . ARG A  1 197 ? -24.598 -18.374 -65.429  1.00 11.75  ? 197 ARG O HG3  1 
ATOM   2961  H  HD2  . ARG A  1 197 ? -25.980 -16.925 -66.820  1.00 11.85  ? 197 ARG O HD2  1 
ATOM   2962  H  HD3  . ARG A  1 197 ? -24.725 -15.955 -66.793  1.00 11.85  ? 197 ARG O HD3  1 
ATOM   2963  H  HE   . ARG A  1 197 ? -24.403 -18.464 -67.791  1.00 17.94  ? 197 ARG O HE   1 
ATOM   2964  H  HH11 . ARG A  1 197 ? -24.134 -15.229 -68.478  1.00 15.68  ? 197 ARG O HH11 1 
ATOM   2965  H  HH12 . ARG A  1 197 ? -23.501 -15.414 -69.813  1.00 15.68  ? 197 ARG O HH12 1 
ATOM   2966  H  HH21 . ARG A  1 197 ? -23.523 -18.693 -69.853  1.00 19.50  ? 197 ARG O HH21 1 
ATOM   2967  H  HH22 . ARG A  1 197 ? -23.134 -17.488 -70.637  1.00 19.50  ? 197 ARG O HH22 1 
ATOM   2968  N  N    . ASP A  1 198 ? -27.254 -17.796 -61.593  1.00 10.32  ? 198 ASP O N    1 
ATOM   2969  C  CA   . ASP A  1 198 ? -28.439 -17.510 -60.777  1.00 10.03  ? 198 ASP O CA   1 
ATOM   2970  C  C    . ASP A  1 198 ? -28.100 -17.200 -59.320  1.00 12.65  ? 198 ASP O C    1 
ATOM   2971  O  O    . ASP A  1 198 ? -28.959 -16.766 -58.571  1.00 15.10  ? 198 ASP O O    1 
ATOM   2972  C  CB   . ASP A  1 198 ? -29.423 -18.684 -60.811  1.00 21.40  ? 198 ASP O CB   1 
ATOM   2973  C  CG   . ASP A  1 198 ? -30.189 -18.798 -62.142  1.00 40.43  ? 198 ASP O CG   1 
ATOM   2974  O  OD1  . ASP A  1 198 ? -30.310 -17.803 -62.892  1.00 32.50  ? 198 ASP O OD1  1 
ATOM   2975  O  OD2  . ASP A  1 198 ? -30.694 -19.903 -62.426  1.00 58.07  ? 198 ASP O OD2  1 
ATOM   2976  H  H    . ASP A  1 198 ? -27.167 -18.624 -61.808  1.00 12.38  ? 198 ASP O H    1 
ATOM   2977  H  HA   . ASP A  1 198 ? -28.891 -16.735 -61.145  1.00 12.03  ? 198 ASP O HA   1 
ATOM   2978  H  HB2  . ASP A  1 198 ? -28.932 -19.510 -60.678  1.00 25.68  ? 198 ASP O HB2  1 
ATOM   2979  H  HB3  . ASP A  1 198 ? -30.075 -18.570 -60.101  1.00 25.68  ? 198 ASP O HB3  1 
ATOM   2980  N  N    . GLY A  1 199 ? -26.858 -17.454 -58.912  1.00 10.65  ? 199 GLY O N    1 
ATOM   2981  C  CA   . GLY A  1 199 ? -26.407 -17.105 -57.573  1.00 11.78  ? 199 GLY O CA   1 
ATOM   2982  C  C    . GLY A  1 199 ? -25.903 -15.677 -57.453  1.00 10.89  ? 199 GLY O C    1 
ATOM   2983  O  O    . GLY A  1 199 ? -25.739 -15.151 -56.359  1.00 13.80  ? 199 GLY O O    1 
ATOM   2984  H  H    . GLY A  1 199 ? -26.256 -17.830 -59.397  1.00 12.79  ? 199 GLY O H    1 
ATOM   2985  H  HA2  . GLY A  1 199 ? -27.140 -17.221 -56.949  1.00 14.14  ? 199 GLY O HA2  1 
ATOM   2986  H  HA3  . GLY A  1 199 ? -25.688 -17.702 -57.313  1.00 14.14  ? 199 GLY O HA3  1 
ATOM   2987  N  N    . ARG A  1 200 ? -25.662 -15.038 -58.586  1.00 9.50   ? 200 ARG O N    1 
ATOM   2988  C  CA   . ARG A  1 200 ? -25.121 -13.683 -58.585  1.00 8.18   ? 200 ARG O CA   1 
ATOM   2989  C  C    . ARG A  1 200 ? -26.189 -12.679 -58.118  1.00 8.55   ? 200 ARG O C    1 
ATOM   2990  O  O    . ARG A  1 200 ? -27.387 -12.892 -58.312  1.00 12.72  ? 200 ARG O O    1 
ATOM   2991  C  CB   . ARG A  1 200 ? -24.593 -13.348 -59.982  1.00 7.75   ? 200 ARG O CB   1 
ATOM   2992  C  CG   . ARG A  1 200 ? -23.459 -14.321 -60.456  1.00 9.31   ? 200 ARG O CG   1 
ATOM   2993  C  CD   . ARG A  1 200 ? -22.165 -14.261 -59.586  1.00 9.68   ? 200 ARG O CD   1 
ATOM   2994  N  NE   . ARG A  1 200 ? -21.518 -12.955 -59.706  1.00 9.28   ? 200 ARG O NE   1 
ATOM   2995  C  CZ   . ARG A  1 200 ? -20.743 -12.566 -60.705  1.00 12.81  ? 200 ARG O CZ   1 
ATOM   2996  N  NH1  . ARG A  1 200 ? -20.454 -13.398 -61.707  1.00 8.55   ? 200 ARG O NH1  1 
ATOM   2997  N  NH2  . ARG A  1 200 ? -20.271 -11.321 -60.712  1.00 13.79  ? 200 ARG O NH2  1 
ATOM   2998  H  H    . ARG A  1 200 ? -25.801 -15.364 -59.370  1.00 11.40  ? 200 ARG O H    1 
ATOM   2999  H  HA   . ARG A  1 200 ? -24.377 -13.640 -57.965  1.00 9.81   ? 200 ARG O HA   1 
ATOM   3000  H  HB2  . ARG A  1 200 ? -25.323 -13.406 -60.618  1.00 9.30   ? 200 ARG O HB2  1 
ATOM   3001  H  HB3  . ARG A  1 200 ? -24.231 -12.448 -59.974  1.00 9.30   ? 200 ARG O HB3  1 
ATOM   3002  H  HG2  . ARG A  1 200 ? -23.795 -15.230 -60.424  1.00 11.18  ? 200 ARG O HG2  1 
ATOM   3003  H  HG3  . ARG A  1 200 ? -23.214 -14.093 -61.366  1.00 11.18  ? 200 ARG O HG3  1 
ATOM   3004  H  HD2  . ARG A  1 200 ? -22.396 -14.404 -58.655  1.00 11.61  ? 200 ARG O HD2  1 
ATOM   3005  H  HD3  . ARG A  1 200 ? -21.542 -14.940 -59.888  1.00 11.61  ? 200 ARG O HD3  1 
ATOM   3006  H  HE   . ARG A  1 200 ? -21.654 -12.390 -59.071  1.00 11.14  ? 200 ARG O HE   1 
ATOM   3007  H  HH11 . ARG A  1 200 ? -20.774 -14.196 -61.709  1.00 10.26  ? 200 ARG O HH11 1 
ATOM   3008  H  HH12 . ARG A  1 200 ? -19.945 -13.137 -62.349  1.00 10.26  ? 200 ARG O HH12 1 
ATOM   3009  H  HH21 . ARG A  1 200 ? -20.452 -10.790 -60.060  1.00 16.54  ? 200 ARG O HH21 1 
ATOM   3010  H  HH22 . ARG A  1 200 ? -19.749 -11.063 -61.344  1.00 16.54  ? 200 ARG O HH22 1 
ATOM   3011  N  N    . GLY A  1 201 ? -25.754 -11.608 -57.468  1.00 9.29   ? 201 GLY O N    1 
ATOM   3012  C  CA   . GLY A  1 201 ? -26.668 -10.674 -56.833  1.00 9.94   ? 201 GLY O CA   1 
ATOM   3013  C  C    . GLY A  1 201 ? -27.734 -10.149 -57.795  1.00 12.30  ? 201 GLY O C    1 
ATOM   3014  O  O    . GLY A  1 201 ? -27.417 -9.556  -58.828  1.00 12.94  ? 201 GLY O O    1 
ATOM   3015  H  H    . GLY A  1 201 ? -24.924 -11.398 -57.380  1.00 11.15  ? 201 GLY O H    1 
ATOM   3016  H  HA2  . GLY A  1 201 ? -27.113 -11.113 -56.092  1.00 11.93  ? 201 GLY O HA2  1 
ATOM   3017  H  HA3  . GLY A  1 201 ? -26.168 -9.918  -56.487  1.00 11.93  ? 201 GLY O HA3  1 
ATOM   3018  N  N    . ALA A  1 202 ? -28.994 -10.338 -57.420  1.00 11.09  ? 202 ALA O N    1 
ATOM   3019  C  CA   . ALA A  1 202 ? -30.131 -10.048 -58.290  1.00 13.55  ? 202 ALA O CA   1 
ATOM   3020  C  C    . ALA A  1 202 ? -30.405 -8.574  -58.413  1.00 17.82  ? 202 ALA O C    1 
ATOM   3021  O  O    . ALA A  1 202 ? -31.004 -8.136  -59.387  1.00 18.24  ? 202 ALA O O    1 
ATOM   3022  C  CB   . ALA A  1 202 ? -31.388 -10.746 -57.774  1.00 15.45  ? 202 ALA O CB   1 
ATOM   3023  H  H    . ALA A  1 202 ? -29.222 -10.640 -56.648  1.00 13.31  ? 202 ALA O H    1 
ATOM   3024  H  HA   . ALA A  1 202 ? -29.943 -10.391 -59.177  1.00 16.26  ? 202 ALA O HA   1 
ATOM   3025  H  HB1  . ALA A  1 202 ? -32.129 -10.540 -58.366  1.00 18.54  ? 202 ALA O HB1  1 
ATOM   3026  H  HB2  . ALA A  1 202 ? -31.233 -11.704 -57.759  1.00 18.54  ? 202 ALA O HB2  1 
ATOM   3027  H  HB3  . ALA A  1 202 ? -31.581 -10.428 -56.879  1.00 18.54  ? 202 ALA O HB3  1 
ATOM   3028  N  N    . LEU A  1 203 ? -30.002 -7.810  -57.413  1.00 11.88  ? 203 LEU O N    1 
ATOM   3029  C  CA   . LEU A  1 203 ? -30.239 -6.372  -57.436  1.00 13.52  ? 203 LEU O CA   1 
ATOM   3030  C  C    . LEU A  1 203 ? -29.220 -5.646  -58.315  1.00 13.95  ? 203 LEU O C    1 
ATOM   3031  O  O    . LEU A  1 203 ? -29.473 -4.572  -58.831  1.00 17.23  ? 203 LEU O O    1 
ATOM   3032  C  CB   . LEU A  1 203 ? -30.187 -5.811  -56.017  1.00 18.40  ? 203 LEU O CB   1 
ATOM   3033  C  CG   . LEU A  1 203 ? -31.520 -5.993  -55.277  1.00 51.09  ? 203 LEU O CG   1 
ATOM   3034  C  CD1  . LEU A  1 203 ? -31.643 -7.381  -54.676  1.00 51.03  ? 203 LEU O CD1  1 
ATOM   3035  C  CD2  . LEU A  1 203 ? -31.704 -4.909  -54.217  1.00 62.45  ? 203 LEU O CD2  1 
ATOM   3036  H  H    . LEU A  1 203 ? -29.592 -8.093  -56.712  1.00 14.25  ? 203 LEU O H    1 
ATOM   3037  H  HA   . LEU A  1 203 ? -31.123 -6.202  -57.796  1.00 16.22  ? 203 LEU O HA   1 
ATOM   3038  H  HB2  . LEU A  1 203 ? -29.498 -6.275  -55.516  1.00 22.08  ? 203 LEU O HB2  1 
ATOM   3039  H  HB3  . LEU A  1 203 ? -29.990 -4.862  -56.056  1.00 22.08  ? 203 LEU O HB3  1 
ATOM   3040  H  HG   . LEU A  1 203 ? -32.240 -5.892  -55.919  1.00 61.31  ? 203 LEU O HG   1 
ATOM   3041  H  HD11 . LEU A  1 203 ? -32.496 -7.453  -54.220  1.00 61.23  ? 203 LEU O HD11 1 
ATOM   3042  H  HD12 . LEU A  1 203 ? -31.592 -8.038  -55.388  1.00 61.23  ? 203 LEU O HD12 1 
ATOM   3043  H  HD13 . LEU A  1 203 ? -30.918 -7.518  -54.047  1.00 61.23  ? 203 LEU O HD13 1 
ATOM   3044  H  HD21 . LEU A  1 203 ? -32.552 -5.049  -53.767  1.00 74.94  ? 203 LEU O HD21 1 
ATOM   3045  H  HD22 . LEU A  1 203 ? -30.977 -4.966  -53.578  1.00 74.94  ? 203 LEU O HD22 1 
ATOM   3046  H  HD23 . LEU A  1 203 ? -31.698 -4.041  -54.649  1.00 74.94  ? 203 LEU O HD23 1 
ATOM   3047  N  N    . GLN A  1 204 ? -28.055 -6.243  -58.470  1.00 13.41  ? 204 GLN O N    1 
ATOM   3048  C  CA   . GLN A  1 204 ? -26.953 -5.608  -59.185  1.00 12.10  ? 204 GLN O CA   1 
ATOM   3049  C  C    . GLN A  1 204 ? -26.841 -5.977  -60.679  1.00 11.84  ? 204 GLN O C    1 
ATOM   3050  O  O    . GLN A  1 204 ? -26.150 -5.299  -61.428  1.00 18.47  ? 204 GLN O O    1 
ATOM   3051  C  CB   . GLN A  1 204 ? -25.644 -5.977  -58.493  1.00 13.85  ? 204 GLN O CB   1 
ATOM   3052  C  CG   . GLN A  1 204 ? -25.459 -5.396  -57.121  1.00 11.79  ? 204 GLN O CG   1 
ATOM   3053  C  CD   . GLN A  1 204 ? -24.434 -6.202  -56.332  1.00 16.56  ? 204 GLN O CD   1 
ATOM   3054  O  OE1  . GLN A  1 204 ? -24.695 -7.323  -55.931  1.00 14.92  ? 204 GLN O OE1  1 
ATOM   3055  N  NE2  . GLN A  1 204 ? -23.261 -5.628  -56.128  1.00 12.08  ? 204 GLN O NE2  1 
ATOM   3056  H  H    . GLN A  1 204 ? -27.869 -7.026  -58.169  1.00 16.09  ? 204 GLN O H    1 
ATOM   3057  H  HA   . GLN A  1 204 ? -27.058 -4.645  -59.126  1.00 14.52  ? 204 GLN O HA   1 
ATOM   3058  H  HB2  . GLN A  1 204 ? -25.602 -6.943  -58.409  1.00 16.62  ? 204 GLN O HB2  1 
ATOM   3059  H  HB3  . GLN A  1 204 ? -24.907 -5.667  -59.043  1.00 16.62  ? 204 GLN O HB3  1 
ATOM   3060  H  HG2  . GLN A  1 204 ? -25.139 -4.484  -57.197  1.00 14.15  ? 204 GLN O HG2  1 
ATOM   3061  H  HG3  . GLN A  1 204 ? -26.302 -5.421  -56.643  1.00 14.15  ? 204 GLN O HG3  1 
ATOM   3062  H  HE21 . GLN A  1 204 ? -23.109 -4.839  -56.435  1.00 14.49  ? 204 GLN O HE21 1 
ATOM   3063  H  HE22 . GLN A  1 204 ? -22.650 -6.043  -55.687  1.00 14.49  ? 204 GLN O HE22 1 
ATOM   3064  N  N    . ASN A  1 205 ? -27.491 -7.054  -61.095  1.00 9.65   ? 205 ASN O N    1 
ATOM   3065  C  CA   . ASN A  1 205 ? -27.148 -7.711  -62.361  1.00 9.79   ? 205 ASN O CA   1 
ATOM   3066  C  C    . ASN A  1 205 ? -28.303 -7.977  -63.298  1.00 13.25  ? 205 ASN O C    1 
ATOM   3067  O  O    . ASN A  1 205 ? -29.436 -8.251  -62.877  1.00 10.39  ? 205 ASN O O    1 
ATOM   3068  C  CB   . ASN A  1 205 ? -26.467 -9.055  -62.083  1.00 8.66   ? 205 ASN O CB   1 
ATOM   3069  C  CG   . ASN A  1 205 ? -25.097 -8.908  -61.453  1.00 7.57   ? 205 ASN O CG   1 
ATOM   3070  O  OD1  . ASN A  1 205 ? -24.159 -8.417  -62.091  1.00 10.58  ? 205 ASN O OD1  1 
ATOM   3071  N  ND2  . ASN A  1 205 ? -24.945 -9.408  -60.239  1.00 7.43   ? 205 ASN O ND2  1 
ATOM   3072  H  H    . ASN A  1 205 ? -28.135 -7.429  -60.667  1.00 11.58  ? 205 ASN O H    1 
ATOM   3073  H  HA   . ASN A  1 205 ? -26.512 -7.153  -62.834  1.00 11.75  ? 205 ASN O HA   1 
ATOM   3074  H  HB2  . ASN A  1 205 ? -27.021 -9.569  -61.475  1.00 10.39  ? 205 ASN O HB2  1 
ATOM   3075  H  HB3  . ASN A  1 205 ? -26.361 -9.534  -62.919  1.00 10.39  ? 205 ASN O HB3  1 
ATOM   3076  H  HD21 . ASN A  1 205 ? -24.185 -9.348  -59.841  1.00 8.91   ? 205 ASN O HD21 1 
ATOM   3077  H  HD22 . ASN A  1 205 ? -25.607 -9.792  -59.847  1.00 8.91   ? 205 ASN O HD22 1 
ATOM   3078  N  N    . ILE A  1 206 ? -27.987 -7.883  -64.584  1.00 9.36   ? 206 ILE O N    1 
ATOM   3079  C  CA   . ILE A  1 206 ? -28.746 -8.539  -65.618  1.00 6.90   ? 206 ILE O CA   1 
ATOM   3080  C  C    . ILE A  1 206 ? -28.154 -9.944  -65.715  1.00 10.48  ? 206 ILE O C    1 
ATOM   3081  O  O    . ILE A  1 206 ? -26.938 -10.110 -65.898  1.00 8.77   ? 206 ILE O O    1 
ATOM   3082  C  CB   . ILE A  1 206 ? -28.652 -7.813  -66.986  1.00 7.28   ? 206 ILE O CB   1 
ATOM   3083  C  CG1  . ILE A  1 206 ? -29.145 -6.373  -66.896  1.00 10.39  ? 206 ILE O CG1  1 
ATOM   3084  C  CG2  . ILE A  1 206 ? -29.412 -8.591  -68.056  1.00 8.41   ? 206 ILE O CG2  1 
ATOM   3085  C  CD1  . ILE A  1 206 ? -28.741 -5.523  -68.087  1.00 11.51  ? 206 ILE O CD1  1 
ATOM   3086  H  H    . ILE A  1 206 ? -27.319 -7.430  -64.882  1.00 11.24  ? 206 ILE O H    1 
ATOM   3087  H  HA   . ILE A  1 206 ? -29.677 -8.605  -65.356  1.00 8.28   ? 206 ILE O HA   1 
ATOM   3088  H  HB   . ILE A  1 206 ? -27.718 -7.790  -67.245  1.00 8.73   ? 206 ILE O HB   1 
ATOM   3089  H  HG12 . ILE A  1 206 ? -30.114 -6.375  -66.846  1.00 12.47  ? 206 ILE O HG12 1 
ATOM   3090  H  HG13 . ILE A  1 206 ? -28.775 -5.964  -66.098  1.00 12.47  ? 206 ILE O HG13 1 
ATOM   3091  H  HG21 . ILE A  1 206 ? -29.339 -8.119  -68.901  1.00 10.10  ? 206 ILE O HG21 1 
ATOM   3092  H  HG22 . ILE A  1 206 ? -29.024 -9.477  -68.138  1.00 10.10  ? 206 ILE O HG22 1 
ATOM   3093  H  HG23 . ILE A  1 206 ? -30.343 -8.660  -67.794  1.00 10.10  ? 206 ILE O HG23 1 
ATOM   3094  H  HD11 . ILE A  1 206 ? -29.086 -4.624  -67.964  1.00 13.82  ? 206 ILE O HD11 1 
ATOM   3095  H  HD12 . ILE A  1 206 ? -27.773 -5.501  -68.145  1.00 13.82  ? 206 ILE O HD12 1 
ATOM   3096  H  HD13 . ILE A  1 206 ? -29.113 -5.913  -68.893  1.00 13.82  ? 206 ILE O HD13 1 
ATOM   3097  N  N    . ILE A  1 207 ? -29.008 -10.952 -65.605  1.00 8.06   ? 207 ILE O N    1 
ATOM   3098  C  CA   . ILE A  1 207 ? -28.567 -12.345 -65.474  1.00 6.95   ? 207 ILE O CA   1 
ATOM   3099  C  C    . ILE A  1 207 ? -29.225 -13.209 -66.547  1.00 10.78  ? 207 ILE O C    1 
ATOM   3100  O  O    . ILE A  1 207 ? -30.430 -13.428 -66.519  1.00 11.41  ? 207 ILE O O    1 
ATOM   3101  C  CB   . ILE A  1 207 ? -28.914 -12.906 -64.078  1.00 10.49  ? 207 ILE O CB   1 
ATOM   3102  C  CG1  . ILE A  1 207 ? -28.269 -12.040 -62.996  1.00 9.50   ? 207 ILE O CG1  1 
ATOM   3103  C  CG2  . ILE A  1 207 ? -28.499 -14.381 -63.956  1.00 13.30  ? 207 ILE O CG2  1 
ATOM   3104  C  CD1  . ILE A  1 207 ? -28.586 -12.475 -61.577  1.00 9.22   ? 207 ILE O CD1  1 
ATOM   3105  H  H    . ILE A  1 207 ? -29.863 -10.859 -65.602  1.00 9.67   ? 207 ILE O H    1 
ATOM   3106  H  HA   . ILE A  1 207 ? -27.605 -12.391 -65.592  1.00 8.34   ? 207 ILE O HA   1 
ATOM   3107  H  HB   . ILE A  1 207 ? -29.876 -12.856 -63.966  1.00 12.59  ? 207 ILE O HB   1 
ATOM   3108  H  HG12 . ILE A  1 207 ? -27.306 -12.071 -63.106  1.00 11.40  ? 207 ILE O HG12 1 
ATOM   3109  H  HG13 . ILE A  1 207 ? -28.581 -11.127 -63.102  1.00 11.40  ? 207 ILE O HG13 1 
ATOM   3110  H  HG21 . ILE A  1 207 ? -28.731 -14.701 -63.070  1.00 15.97  ? 207 ILE O HG21 1 
ATOM   3111  H  HG22 . ILE A  1 207 ? -28.970 -14.898 -64.628  1.00 15.97  ? 207 ILE O HG22 1 
ATOM   3112  H  HG23 . ILE A  1 207 ? -27.542 -14.451 -64.094  1.00 15.97  ? 207 ILE O HG23 1 
ATOM   3113  H  HD11 . ILE A  1 207 ? -28.140 -11.876 -60.957  1.00 11.06  ? 207 ILE O HD11 1 
ATOM   3114  H  HD12 . ILE A  1 207 ? -29.546 -12.437 -61.442  1.00 11.06  ? 207 ILE O HD12 1 
ATOM   3115  H  HD13 . ILE A  1 207 ? -28.269 -13.382 -61.447  1.00 11.06  ? 207 ILE O HD13 1 
ATOM   3116  N  N    . PRO A  1 208 ? -28.439 -13.706 -67.503  1.00 7.42   ? 208 PRO O N    1 
ATOM   3117  C  CA   . PRO A  1 208 ? -29.033 -14.612 -68.476  1.00 8.37   ? 208 PRO O CA   1 
ATOM   3118  C  C    . PRO A  1 208 ? -29.403 -15.931 -67.829  1.00 11.26  ? 208 PRO O C    1 
ATOM   3119  O  O    . PRO A  1 208 ? -28.714 -16.404 -66.912  1.00 11.22  ? 208 PRO O O    1 
ATOM   3120  C  CB   . PRO A  1 208 ? -27.931 -14.798 -69.520  1.00 13.64  ? 208 PRO O CB   1 
ATOM   3121  C  CG   . PRO A  1 208 ? -26.718 -14.348 -68.915  1.00 28.35  ? 208 PRO O CG   1 
ATOM   3122  C  CD   . PRO A  1 208 ? -27.020 -13.440 -67.784  1.00 16.34  ? 208 PRO O CD   1 
ATOM   3123  H  HA   . PRO A  1 208 ? -29.816 -14.214 -68.888  1.00 10.04  ? 208 PRO O HA   1 
ATOM   3124  H  HB2  . PRO A  1 208 ? -27.864 -15.737 -69.754  1.00 16.37  ? 208 PRO O HB2  1 
ATOM   3125  H  HB3  . PRO A  1 208 ? -28.136 -14.267 -70.304  1.00 16.37  ? 208 PRO O HB3  1 
ATOM   3126  H  HG2  . PRO A  1 208 ? -26.225 -15.118 -68.593  1.00 34.02  ? 208 PRO O HG2  1 
ATOM   3127  H  HG3  . PRO A  1 208 ? -26.194 -13.877 -69.581  1.00 34.02  ? 208 PRO O HG3  1 
ATOM   3128  H  HD2  . PRO A  1 208 ? -26.475 -13.666 -67.014  1.00 19.60  ? 208 PRO O HD2  1 
ATOM   3129  H  HD3  . PRO A  1 208 ? -26.896 -12.516 -68.049  1.00 19.60  ? 208 PRO O HD3  1 
ATOM   3130  N  N    . ALA A  1 209 ? -30.494 -16.515 -68.306  1.00 10.83  ? 209 ALA O N    1 
ATOM   3131  C  CA   . ALA A  1 209 ? -30.972 -17.787 -67.780  1.00 14.87  ? 209 ALA O CA   1 
ATOM   3132  C  C    . ALA A  1 209 ? -31.644 -18.602 -68.874  1.00 14.73  ? 209 ALA O C    1 
ATOM   3133  O  O    . ALA A  1 209 ? -32.241 -18.064 -69.810  1.00 13.91  ? 209 ALA O O    1 
ATOM   3134  C  CB   . ALA A  1 209 ? -31.922 -17.563 -66.628  1.00 17.57  ? 209 ALA O CB   1 
ATOM   3135  H  H    . ALA A  1 209 ? -30.979 -16.193 -68.939  1.00 13.00  ? 209 ALA O H    1 
ATOM   3136  H  HA   . ALA A  1 209 ? -30.216 -18.296 -67.450  1.00 17.84  ? 209 ALA O HA   1 
ATOM   3137  H  HB1  . ALA A  1 209 ? -32.225 -18.423 -66.297  1.00 21.08  ? 209 ALA O HB1  1 
ATOM   3138  H  HB2  . ALA A  1 209 ? -31.457 -17.083 -65.925  1.00 21.08  ? 209 ALA O HB2  1 
ATOM   3139  H  HB3  . ALA A  1 209 ? -32.679 -17.043 -66.940  1.00 21.08  ? 209 ALA O HB3  1 
ATOM   3140  N  N    . SER A  1 210 ? -31.484 -19.913 -68.782  1.00 18.09  ? 210 SER O N    1 
ATOM   3141  C  CA   . SER A  1 210 ? -32.194 -20.828 -69.658  1.00 18.28  ? 210 SER O CA   1 
ATOM   3142  C  C    . SER A  1 210 ? -33.666 -20.909 -69.285  1.00 25.17  ? 210 SER O C    1 
ATOM   3143  O  O    . SER A  1 210 ? -34.031 -20.725 -68.128  1.00 27.07  ? 210 SER O O    1 
ATOM   3144  C  CB   . SER A  1 210 ? -31.564 -22.212 -69.582  1.00 22.10  ? 210 SER O CB   1 
ATOM   3145  O  OG   . SER A  1 210 ? -30.243 -22.154 -70.073  1.00 26.12  ? 210 SER O OG   1 
ATOM   3146  H  H    . SER A  1 210 ? -30.966 -20.300 -68.216  1.00 21.71  ? 210 SER O H    1 
ATOM   3147  H  HA   . SER A  1 210 ? -32.128 -20.513 -70.573  1.00 21.93  ? 210 SER O HA   1 
ATOM   3148  H  HB2  . SER A  1 210 ? -31.550 -22.508 -68.658  1.00 26.52  ? 210 SER O HB2  1 
ATOM   3149  H  HB3  . SER A  1 210 ? -32.081 -22.829 -70.124  1.00 26.52  ? 210 SER O HB3  1 
ATOM   3150  H  HG   . SER A  1 210 ? -29.889 -22.915 -70.034  1.00 31.35  ? 210 SER O HG   1 
ATOM   3151  N  N    . THR A  1 211 ? -34.516 -21.177 -70.268  1.00 25.96  ? 211 THR O N    1 
ATOM   3152  C  CA   . THR A  1 211 ? -35.923 -21.451 -69.981  1.00 24.61  ? 211 THR O CA   1 
ATOM   3153  C  C    . THR A  1 211 ? -36.499 -22.356 -71.054  1.00 23.30  ? 211 THR O C    1 
ATOM   3154  O  O    . THR A  1 211 ? -36.186 -22.220 -72.240  1.00 20.57  ? 211 THR O O    1 
ATOM   3155  C  CB   . THR A  1 211 ? -36.779 -20.156 -69.888  1.00 31.50  ? 211 THR O CB   1 
ATOM   3156  O  OG1  . THR A  1 211 ? -38.158 -20.502 -69.683  1.00 30.58  ? 211 THR O OG1  1 
ATOM   3157  C  CG2  . THR A  1 211 ? -36.657 -19.320 -71.153  1.00 32.66  ? 211 THR O CG2  1 
ATOM   3158  H  H    . THR A  1 211 ? -34.309 -21.206 -71.102  1.00 31.15  ? 211 THR O H    1 
ATOM   3159  H  HA   . THR A  1 211 ? -35.988 -21.914 -69.131  1.00 29.54  ? 211 THR O HA   1 
ATOM   3160  H  HB   . THR A  1 211 ? -36.469 -19.622 -69.140  1.00 37.80  ? 211 THR O HB   1 
ATOM   3161  H  HG1  . THR A  1 211 ? -38.624 -19.806 -69.632  1.00 36.70  ? 211 THR O HG1  1 
ATOM   3162  H  HG21 . THR A  1 211 ? -37.197 -18.518 -71.073  1.00 39.19  ? 211 THR O HG21 1 
ATOM   3163  H  HG22 . THR A  1 211 ? -35.731 -19.063 -71.292  1.00 39.19  ? 211 THR O HG22 1 
ATOM   3164  H  HG23 . THR A  1 211 ? -36.961 -19.831 -71.919  1.00 39.19  ? 211 THR O HG23 1 
ATOM   3165  N  N    . GLY A  1 212 ? -37.337 -23.289 -70.630  1.00 18.43  ? 212 GLY O N    1 
ATOM   3166  C  CA   . GLY A  1 212 ? -37.982 -24.198 -71.555  1.00 17.41  ? 212 GLY O CA   1 
ATOM   3167  C  C    . GLY A  1 212 ? -39.334 -23.675 -72.000  1.00 14.98  ? 212 GLY O C    1 
ATOM   3168  O  O    . GLY A  1 212 ? -40.071 -24.377 -72.686  1.00 14.09  ? 212 GLY O O    1 
ATOM   3169  H  H    . GLY A  1 212 ? -37.549 -23.416 -69.806  1.00 22.12  ? 212 GLY O H    1 
ATOM   3170  H  HA2  . GLY A  1 212 ? -37.423 -24.317 -72.339  1.00 20.89  ? 212 GLY O HA2  1 
ATOM   3171  H  HA3  . GLY A  1 212 ? -38.108 -25.061 -71.130  1.00 20.89  ? 212 GLY O HA3  1 
ATOM   3172  N  N    . ALA A  1 213 ? -39.658 -22.436 -71.646  1.00 13.57  ? 213 ALA O N    1 
ATOM   3173  C  CA   . ALA A  1 213 ? -41.014 -21.938 -71.869  1.00 14.97  ? 213 ALA O CA   1 
ATOM   3174  C  C    . ALA A  1 213 ? -41.405 -21.893 -73.341  1.00 19.68  ? 213 ALA O C    1 
ATOM   3175  O  O    . ALA A  1 213 ? -42.534 -22.225 -73.685  1.00 18.37  ? 213 ALA O O    1 
ATOM   3176  C  CB   . ALA A  1 213 ? -41.183 -20.572 -71.253  1.00 17.67  ? 213 ALA O CB   1 
ATOM   3177  H  H    . ALA A  1 213 ? -39.123 -21.870 -71.281  1.00 16.29  ? 213 ALA O H    1 
ATOM   3178  H  HA   . ALA A  1 213 ? -41.635 -22.536 -71.424  1.00 17.96  ? 213 ALA O HA   1 
ATOM   3179  H  HB1  . ALA A  1 213 ? -42.089 -20.263 -71.414  1.00 21.21  ? 213 ALA O HB1  1 
ATOM   3180  H  HB2  . ALA A  1 213 ? -41.019 -20.634 -70.299  1.00 21.21  ? 213 ALA O HB2  1 
ATOM   3181  H  HB3  . ALA A  1 213 ? -40.548 -19.961 -71.659  1.00 21.21  ? 213 ALA O HB3  1 
ATOM   3182  N  N    . ALA A  1 214 ? -40.497 -21.480 -74.222  1.00 14.00  ? 214 ALA O N    1 
ATOM   3183  C  CA   . ALA A  1 214 ? -40.850 -21.377 -75.638  1.00 9.49   ? 214 ALA O CA   1 
ATOM   3184  C  C    . ALA A  1 214 ? -40.972 -22.770 -76.235  1.00 16.39  ? 214 ALA O C    1 
ATOM   3185  O  O    . ALA A  1 214 ? -41.863 -23.053 -77.043  1.00 20.19  ? 214 ALA O O    1 
ATOM   3186  C  CB   . ALA A  1 214 ? -39.827 -20.545 -76.394  1.00 18.02  ? 214 ALA O CB   1 
ATOM   3187  H  H    . ALA A  1 214 ? -39.688 -21.258 -74.034  1.00 16.79  ? 214 ALA O H    1 
ATOM   3188  H  HA   . ALA A  1 214 ? -41.712 -20.939 -75.718  1.00 11.39  ? 214 ALA O HA   1 
ATOM   3189  H  HB1  . ALA A  1 214 ? -40.088 -20.495 -77.327  1.00 21.62  ? 214 ALA O HB1  1 
ATOM   3190  H  HB2  . ALA A  1 214 ? -39.799 -19.654 -76.010  1.00 21.62  ? 214 ALA O HB2  1 
ATOM   3191  H  HB3  . ALA A  1 214 ? -38.957 -20.967 -76.316  1.00 21.62  ? 214 ALA O HB3  1 
ATOM   3192  N  N    . LYS A  1 215 ? -40.087 -23.664 -75.829  1.00 13.56  ? 215 LYS O N    1 
ATOM   3193  C  CA   . LYS A  1 215 ? -40.196 -25.041 -76.279  1.00 15.72  ? 215 LYS O CA   1 
ATOM   3194  C  C    . LYS A  1 215 ? -41.533 -25.654 -75.818  1.00 21.49  ? 215 LYS O C    1 
ATOM   3195  O  O    . LYS A  1 215 ? -42.153 -26.427 -76.551  1.00 17.52  ? 215 LYS O O    1 
ATOM   3196  C  CB   . LYS A  1 215 ? -39.021 -25.857 -75.750  1.00 29.71  ? 215 LYS O CB   1 
ATOM   3197  C  CG   . LYS A  1 215 ? -38.971 -27.287 -76.249  1.00 55.87  ? 215 LYS O CG   1 
ATOM   3198  C  CD   . LYS A  1 215 ? -37.848 -28.081 -75.582  1.00 75.97  ? 215 LYS O CD   1 
ATOM   3199  C  CE   . LYS A  1 215 ? -36.472 -27.467 -75.822  1.00 84.71  ? 215 LYS O CE   1 
ATOM   3200  N  NZ   . LYS A  1 215 ? -36.177 -27.300 -77.274  1.00 93.74  ? 215 LYS O NZ   1 
ATOM   3201  H  H    . LYS A  1 215 ? -39.425 -23.505 -75.303  1.00 16.27  ? 215 LYS O H    1 
ATOM   3202  H  HA   . LYS A  1 215 ? -40.170 -25.064 -77.248  1.00 18.87  ? 215 LYS O HA   1 
ATOM   3203  H  HB2  . LYS A  1 215 ? -38.196 -25.423 -76.018  1.00 35.66  ? 215 LYS O HB2  1 
ATOM   3204  H  HB3  . LYS A  1 215 ? -39.075 -25.886 -74.782  1.00 35.66  ? 215 LYS O HB3  1 
ATOM   3205  H  HG2  . LYS A  1 215 ? -39.813 -27.725 -76.048  1.00 67.05  ? 215 LYS O HG2  1 
ATOM   3206  H  HG3  . LYS A  1 215 ? -38.814 -27.285 -77.206  1.00 67.05  ? 215 LYS O HG3  1 
ATOM   3207  H  HD2  . LYS A  1 215 ? -38.003 -28.106 -74.625  1.00 91.17  ? 215 LYS O HD2  1 
ATOM   3208  H  HD3  . LYS A  1 215 ? -37.841 -28.982 -75.941  1.00 91.17  ? 215 LYS O HD3  1 
ATOM   3209  H  HE2  . LYS A  1 215 ? -36.437 -26.592 -75.404  1.00 101.65 ? 215 LYS O HE2  1 
ATOM   3210  H  HE3  . LYS A  1 215 ? -35.794 -28.047 -75.441  1.00 101.65 ? 215 LYS O HE3  1 
ATOM   3211  H  HZ1  . LYS A  1 215 ? -35.370 -26.940 -77.381  1.00 112.49 ? 215 LYS O HZ1  1 
ATOM   3212  H  HZ2  . LYS A  1 215 ? -36.198 -28.091 -77.682  1.00 112.49 ? 215 LYS O HZ2  1 
ATOM   3213  H  HZ3  . LYS A  1 215 ? -36.784 -26.766 -77.648  1.00 112.49 ? 215 LYS O HZ3  1 
ATOM   3214  N  N    . ALA A  1 216 ? -41.966 -25.299 -74.611  1.00 13.10  ? 216 ALA O N    1 
ATOM   3215  C  CA   . ALA A  1 216 ? -43.218 -25.830 -74.037  1.00 17.74  ? 216 ALA O CA   1 
ATOM   3216  C  C    . ALA A  1 216 ? -44.444 -25.387 -74.822  1.00 14.05  ? 216 ALA O C    1 
ATOM   3217  O  O    . ALA A  1 216 ? -45.478 -26.063 -74.818  1.00 16.66  ? 216 ALA O O    1 
ATOM   3218  C  CB   . ALA A  1 216 ? -43.364 -25.397 -72.575  1.00 16.26  ? 216 ALA O CB   1 
ATOM   3219  H  H    . ALA A  1 216 ? -41.555 -24.748 -74.094  1.00 15.72  ? 216 ALA O H    1 
ATOM   3220  H  HA   . ALA A  1 216 ? -43.185 -26.800 -74.058  1.00 21.29  ? 216 ALA O HA   1 
ATOM   3221  H  HB1  . ALA A  1 216 ? -44.192 -25.758 -72.221  1.00 19.51  ? 216 ALA O HB1  1 
ATOM   3222  H  HB2  . ALA A  1 216 ? -42.610 -25.738 -72.068  1.00 19.51  ? 216 ALA O HB2  1 
ATOM   3223  H  HB3  . ALA A  1 216 ? -43.380 -24.428 -72.534  1.00 19.51  ? 216 ALA O HB3  1 
ATOM   3224  N  N    . VAL A  1 217 ? -44.344 -24.241 -75.482  1.00 11.55  ? 217 VAL O N    1 
ATOM   3225  C  CA   . VAL A  1 217 ? -45.431 -23.797 -76.352  1.00 12.82  ? 217 VAL O CA   1 
ATOM   3226  C  C    . VAL A  1 217 ? -45.717 -24.872 -77.398  1.00 20.56  ? 217 VAL O C    1 
ATOM   3227  O  O    . VAL A  1 217 ? -46.869 -25.097 -77.766  1.00 18.55  ? 217 VAL O O    1 
ATOM   3228  C  CB   . VAL A  1 217 ? -45.115 -22.441 -77.014  1.00 14.09  ? 217 VAL O CB   1 
ATOM   3229  C  CG1  . VAL A  1 217 ? -46.156 -22.083 -78.072  1.00 20.26  ? 217 VAL O CG1  1 
ATOM   3230  C  CG2  . VAL A  1 217 ? -45.084 -21.372 -75.958  1.00 18.08  ? 217 VAL O CG2  1 
ATOM   3231  H  H    . VAL A  1 217 ? -43.670 -23.708 -75.447  1.00 13.86  ? 217 VAL O H    1 
ATOM   3232  H  HA   . VAL A  1 217 ? -46.232 -23.685 -75.817  1.00 15.38  ? 217 VAL O HA   1 
ATOM   3233  H  HB   . VAL A  1 217 ? -44.243 -22.481 -77.438  1.00 16.91  ? 217 VAL O HB   1 
ATOM   3234  H  HG11 . VAL A  1 217 ? -45.925 -21.227 -78.465  1.00 24.31  ? 217 VAL O HG11 1 
ATOM   3235  H  HG12 . VAL A  1 217 ? -46.161 -22.771 -78.755  1.00 24.31  ? 217 VAL O HG12 1 
ATOM   3236  H  HG13 . VAL A  1 217 ? -47.028 -22.029 -77.650  1.00 24.31  ? 217 VAL O HG13 1 
ATOM   3237  H  HG21 . VAL A  1 217 ? -44.885 -20.521 -76.377  1.00 21.70  ? 217 VAL O HG21 1 
ATOM   3238  H  HG22 . VAL A  1 217 ? -45.950 -21.333 -75.523  1.00 21.70  ? 217 VAL O HG22 1 
ATOM   3239  H  HG23 . VAL A  1 217 ? -44.397 -21.590 -75.308  1.00 21.70  ? 217 VAL O HG23 1 
ATOM   3240  N  N    . GLY A  1 218 ? -44.685 -25.593 -77.820  1.00 17.58  ? 218 GLY O N    1 
ATOM   3241  C  CA   . GLY A  1 218 ? -44.868 -26.686 -78.757  1.00 18.53  ? 218 GLY O CA   1 
ATOM   3242  C  C    . GLY A  1 218 ? -45.565 -27.920 -78.199  1.00 22.50  ? 218 GLY O C    1 
ATOM   3243  O  O    . GLY A  1 218 ? -45.905 -28.838 -78.947  1.00 24.46  ? 218 GLY O O    1 
ATOM   3244  H  H    . GLY A  1 218 ? -43.869 -25.467 -77.577  1.00 21.10  ? 218 GLY O H    1 
ATOM   3245  H  HA2  . GLY A  1 218 ? -45.388 -26.367 -79.511  1.00 22.24  ? 218 GLY O HA2  1 
ATOM   3246  H  HA3  . GLY A  1 218 ? -43.999 -26.962 -79.089  1.00 22.24  ? 218 GLY O HA3  1 
ATOM   3247  N  N    . LYS A  1 219 ? -45.758 -27.968 -76.885  1.00 19.47  ? 219 LYS O N    1 
ATOM   3248  C  CA   . LYS A  1 219 ? -46.535 -29.034 -76.281  1.00 18.57  ? 219 LYS O CA   1 
ATOM   3249  C  C    . LYS A  1 219 ? -48.009 -28.619 -76.206  1.00 24.22  ? 219 LYS O C    1 
ATOM   3250  O  O    . LYS A  1 219 ? -48.887 -29.449 -76.386  1.00 18.27  ? 219 LYS O O    1 
ATOM   3251  C  CB   . LYS A  1 219 ? -46.026 -29.391 -74.883  1.00 22.01  ? 219 LYS O CB   1 
ATOM   3252  C  CG   . LYS A  1 219 ? -44.772 -30.235 -74.856  1.00 41.09  ? 219 LYS O CG   1 
ATOM   3253  C  CD   . LYS A  1 219 ? -44.692 -31.029 -73.544  1.00 71.63  ? 219 LYS O CD   1 
ATOM   3254  C  CE   . LYS A  1 219 ? -43.357 -30.860 -72.829  1.00 82.82  ? 219 LYS O CE   1 
ATOM   3255  N  NZ   . LYS A  1 219 ? -42.214 -31.386 -73.626  1.00 91.90  ? 219 LYS O NZ   1 
ATOM   3256  H  H    . LYS A  1 219 ? -45.449 -27.395 -76.324  1.00 23.36  ? 219 LYS O H    1 
ATOM   3257  H  HA   . LYS A  1 219 ? -46.472 -29.827 -76.836  1.00 22.28  ? 219 LYS O HA   1 
ATOM   3258  H  HB2  . LYS A  1 219 ? -45.836 -28.568 -74.405  1.00 26.41  ? 219 LYS O HB2  1 
ATOM   3259  H  HB3  . LYS A  1 219 ? -46.721 -29.883 -74.419  1.00 26.41  ? 219 LYS O HB3  1 
ATOM   3260  H  HG2  . LYS A  1 219 ? -44.788 -30.863 -75.595  1.00 49.31  ? 219 LYS O HG2  1 
ATOM   3261  H  HG3  . LYS A  1 219 ? -43.993 -29.660 -74.915  1.00 49.31  ? 219 LYS O HG3  1 
ATOM   3262  H  HD2  . LYS A  1 219 ? -45.393 -30.723 -72.947  1.00 85.96  ? 219 LYS O HD2  1 
ATOM   3263  H  HD3  . LYS A  1 219 ? -44.811 -31.972 -73.738  1.00 85.96  ? 219 LYS O HD3  1 
ATOM   3264  H  HE2  . LYS A  1 219 ? -43.201 -29.917 -72.666  1.00 99.38  ? 219 LYS O HE2  1 
ATOM   3265  H  HE3  . LYS A  1 219 ? -43.384 -31.343 -71.988  1.00 99.38  ? 219 LYS O HE3  1 
ATOM   3266  H  HZ1  . LYS A  1 219 ? -41.453 -31.271 -73.178  1.00 110.28 ? 219 LYS O HZ1  1 
ATOM   3267  H  HZ2  . LYS A  1 219 ? -42.328 -32.254 -73.784  1.00 110.28 ? 219 LYS O HZ2  1 
ATOM   3268  H  HZ3  . LYS A  1 219 ? -42.162 -30.955 -74.402  1.00 110.28 ? 219 LYS O HZ3  1 
ATOM   3269  N  N    . VAL A  1 220 ? -48.287 -27.343 -75.941  1.00 13.18  ? 220 VAL O N    1 
ATOM   3270  C  CA   . VAL A  1 220 ? -49.677 -26.930 -75.823  1.00 16.01  ? 220 VAL O CA   1 
ATOM   3271  C  C    . VAL A  1 220 ? -50.236 -26.580 -77.193  1.00 18.73  ? 220 VAL O C    1 
ATOM   3272  O  O    . VAL A  1 220 ? -51.444 -26.587 -77.373  1.00 17.73  ? 220 VAL O O    1 
ATOM   3273  C  CB   . VAL A  1 220 ? -49.871 -25.732 -74.840  1.00 18.02  ? 220 VAL O CB   1 
ATOM   3274  C  CG1  . VAL A  1 220 ? -49.327 -26.106 -73.460  1.00 28.15  ? 220 VAL O CG1  1 
ATOM   3275  C  CG2  . VAL A  1 220 ? -49.216 -24.491 -75.334  1.00 27.64  ? 220 VAL O CG2  1 
ATOM   3276  H  H    . VAL A  1 220 ? -47.707 -26.718 -75.828  1.00 15.82  ? 220 VAL O H    1 
ATOM   3277  H  HA   . VAL A  1 220 ? -50.192 -27.676 -75.479  1.00 19.21  ? 220 VAL O HA   1 
ATOM   3278  H  HB   . VAL A  1 220 ? -50.820 -25.552 -74.748  1.00 21.62  ? 220 VAL O HB   1 
ATOM   3279  H  HG11 . VAL A  1 220 ? -49.452 -25.356 -72.857  1.00 33.77  ? 220 VAL O HG11 1 
ATOM   3280  H  HG12 . VAL A  1 220 ? -49.809 -26.880 -73.130  1.00 33.77  ? 220 VAL O HG12 1 
ATOM   3281  H  HG13 . VAL A  1 220 ? -48.382 -26.313 -73.538  1.00 33.77  ? 220 VAL O HG13 1 
ATOM   3282  H  HG21 . VAL A  1 220 ? -49.364 -23.779 -74.692  1.00 33.17  ? 220 VAL O HG21 1 
ATOM   3283  H  HG22 . VAL A  1 220 ? -48.265 -24.654 -75.433  1.00 33.17  ? 220 VAL O HG22 1 
ATOM   3284  H  HG23 . VAL A  1 220 ? -49.602 -24.249 -76.190  1.00 33.17  ? 220 VAL O HG23 1 
ATOM   3285  N  N    . ILE A  1 221 ? -49.362 -26.260 -78.147  1.00 13.41  ? 221 ILE O N    1 
ATOM   3286  C  CA   . ILE A  1 221 ? -49.755 -26.086 -79.541  1.00 15.57  ? 221 ILE O CA   1 
ATOM   3287  C  C    . ILE A  1 221 ? -48.917 -27.068 -80.354  1.00 19.26  ? 221 ILE O C    1 
ATOM   3288  O  O    . ILE A  1 221 ? -47.802 -26.729 -80.768  1.00 16.90  ? 221 ILE O O    1 
ATOM   3289  C  CB   . ILE A  1 221 ? -49.531 -24.635 -80.059  1.00 14.10  ? 221 ILE O CB   1 
ATOM   3290  C  CG1  . ILE A  1 221 ? -50.237 -23.620 -79.169  1.00 17.85  ? 221 ILE O CG1  1 
ATOM   3291  C  CG2  . ILE A  1 221 ? -50.054 -24.496 -81.488  1.00 15.89  ? 221 ILE O CG2  1 
ATOM   3292  C  CD1  . ILE A  1 221 ? -49.921 -22.176 -79.534  1.00 17.14  ? 221 ILE O CD1  1 
ATOM   3293  H  H    . ILE A  1 221 ? -48.522 -26.136 -78.008  1.00 16.09  ? 221 ILE O H    1 
ATOM   3294  H  HA   . ILE A  1 221 ? -50.692 -26.314 -79.648  1.00 18.69  ? 221 ILE O HA   1 
ATOM   3295  H  HB   . ILE A  1 221 ? -48.580 -24.445 -80.054  1.00 16.92  ? 221 ILE O HB   1 
ATOM   3296  H  HG12 . ILE A  1 221 ? -51.195 -23.745 -79.250  1.00 21.42  ? 221 ILE O HG12 1 
ATOM   3297  H  HG13 . ILE A  1 221 ? -49.962 -23.763 -78.250  1.00 21.42  ? 221 ILE O HG13 1 
ATOM   3298  H  HG21 . ILE A  1 221 ? -49.905 -23.587 -81.791  1.00 19.06  ? 221 ILE O HG21 1 
ATOM   3299  H  HG22 . ILE A  1 221 ? -49.577 -25.118 -82.060  1.00 19.06  ? 221 ILE O HG22 1 
ATOM   3300  H  HG23 . ILE A  1 221 ? -51.003 -24.697 -81.498  1.00 19.06  ? 221 ILE O HG23 1 
ATOM   3301  H  HD11 . ILE A  1 221 ? -50.401 -21.587 -78.931  1.00 20.57  ? 221 ILE O HD11 1 
ATOM   3302  H  HD12 . ILE A  1 221 ? -48.966 -22.031 -79.448  1.00 20.57  ? 221 ILE O HD12 1 
ATOM   3303  H  HD13 . ILE A  1 221 ? -50.200 -22.014 -80.448  1.00 20.57  ? 221 ILE O HD13 1 
ATOM   3304  N  N    . PRO A  1 222 ? -49.424 -28.300 -80.543  1.00 20.93  ? 222 PRO O N    1 
ATOM   3305  C  CA   . PRO A  1 222 ? -48.629 -29.376 -81.148  1.00 20.24  ? 222 PRO O CA   1 
ATOM   3306  C  C    . PRO A  1 222 ? -48.016 -28.998 -82.498  1.00 18.48  ? 222 PRO O C    1 
ATOM   3307  O  O    . PRO A  1 222 ? -46.921 -29.455 -82.805  1.00 23.81  ? 222 PRO O O    1 
ATOM   3308  C  CB   . PRO A  1 222 ? -49.644 -30.515 -81.316  1.00 23.76  ? 222 PRO O CB   1 
ATOM   3309  C  CG   . PRO A  1 222 ? -50.618 -30.294 -80.215  1.00 28.83  ? 222 PRO O CG   1 
ATOM   3310  C  CD   . PRO A  1 222 ? -50.729 -28.792 -80.062  1.00 18.19  ? 222 PRO O CD   1 
ATOM   3311  H  HA   . PRO A  1 222 ? -47.926 -29.658 -80.542  1.00 24.29  ? 222 PRO O HA   1 
ATOM   3312  H  HB2  . PRO A  1 222 ? -50.077 -30.447 -82.181  1.00 28.51  ? 222 PRO O HB2  1 
ATOM   3313  H  HB3  . PRO A  1 222 ? -49.198 -31.371 -81.218  1.00 28.51  ? 222 PRO O HB3  1 
ATOM   3314  H  HG2  . PRO A  1 222 ? -51.476 -30.677 -80.457  1.00 34.60  ? 222 PRO O HG2  1 
ATOM   3315  H  HG3  . PRO A  1 222 ? -50.283 -30.697 -79.398  1.00 34.60  ? 222 PRO O HG3  1 
ATOM   3316  H  HD2  . PRO A  1 222 ? -51.445 -28.448 -80.618  1.00 21.83  ? 222 PRO O HD2  1 
ATOM   3317  H  HD3  . PRO A  1 222 ? -50.856 -28.555 -79.130  1.00 21.83  ? 222 PRO O HD3  1 
ATOM   3318  N  N    . GLU A  1 223 ? -48.707 -28.186 -83.285  1.00 15.16  ? 223 GLU O N    1 
ATOM   3319  C  CA   . GLU A  1 223 ? -48.197 -27.793 -84.592  1.00 21.29  ? 223 GLU O CA   1 
ATOM   3320  C  C    . GLU A  1 223 ? -46.922 -26.953 -84.499  1.00 20.83  ? 223 GLU O C    1 
ATOM   3321  O  O    . GLU A  1 223 ? -46.220 -26.801 -85.485  1.00 18.89  ? 223 GLU O O    1 
ATOM   3322  C  CB   . GLU A  1 223 ? -49.259 -27.022 -85.374  1.00 23.47  ? 223 GLU O CB   1 
ATOM   3323  C  CG   . GLU A  1 223 ? -50.360 -27.908 -85.952  1.00 39.04  ? 223 GLU O CG   1 
ATOM   3324  C  CD   . GLU A  1 223 ? -51.387 -27.123 -86.753  1.00 58.68  ? 223 GLU O CD   1 
ATOM   3325  O  OE1  . GLU A  1 223 ? -52.483 -27.667 -87.023  1.00 58.71  ? 223 GLU O OE1  1 
ATOM   3326  O  OE2  . GLU A  1 223 ? -51.095 -25.959 -87.115  1.00 64.75  ? 223 GLU O OE2  1 
ATOM   3327  H  H    . GLU A  1 223 ? -49.473 -27.848 -83.087  1.00 18.19  ? 223 GLU O H    1 
ATOM   3328  H  HA   . GLU A  1 223 ? -47.985 -28.595 -85.095  1.00 25.55  ? 223 GLU O HA   1 
ATOM   3329  H  HB2  . GLU A  1 223 ? -49.677 -26.378 -84.781  1.00 28.16  ? 223 GLU O HB2  1 
ATOM   3330  H  HB3  . GLU A  1 223 ? -48.830 -26.561 -86.112  1.00 28.16  ? 223 GLU O HB3  1 
ATOM   3331  H  HG2  . GLU A  1 223 ? -49.960 -28.566 -86.542  1.00 46.84  ? 223 GLU O HG2  1 
ATOM   3332  H  HG3  . GLU A  1 223 ? -50.824 -28.353 -85.225  1.00 46.84  ? 223 GLU O HG3  1 
ATOM   3333  N  N    . LEU A  1 224 ? -46.605 -26.431 -83.319  1.00 16.60  ? 224 LEU O N    1 
ATOM   3334  C  CA   . LEU A  1 224 ? -45.376 -25.661 -83.141  1.00 12.73  ? 224 LEU O CA   1 
ATOM   3335  C  C    . LEU A  1 224 ? -44.256 -26.444 -82.469  1.00 18.28  ? 224 LEU O C    1 
ATOM   3336  O  O    . LEU A  1 224 ? -43.193 -25.888 -82.128  1.00 15.05  ? 224 LEU O O    1 
ATOM   3337  C  CB   . LEU A  1 224 ? -45.683 -24.397 -82.349  1.00 13.90  ? 224 LEU O CB   1 
ATOM   3338  C  CG   . LEU A  1 224 ? -46.648 -23.461 -83.078  1.00 20.44  ? 224 LEU O CG   1 
ATOM   3339  C  CD1  . LEU A  1 224 ? -46.937 -22.250 -82.245  1.00 20.69  ? 224 LEU O CD1  1 
ATOM   3340  C  CD2  . LEU A  1 224 ? -46.091 -23.022 -84.422  1.00 25.49  ? 224 LEU O CD2  1 
ATOM   3341  H  H    . LEU A  1 224 ? -47.081 -26.508 -82.607  1.00 19.92  ? 224 LEU O H    1 
ATOM   3342  H  HA   . LEU A  1 224 ? -45.056 -25.387 -84.015  1.00 15.28  ? 224 LEU O HA   1 
ATOM   3343  H  HB2  . LEU A  1 224 ? -46.087 -24.645 -81.503  1.00 16.68  ? 224 LEU O HB2  1 
ATOM   3344  H  HB3  . LEU A  1 224 ? -44.857 -23.914 -82.193  1.00 16.68  ? 224 LEU O HB3  1 
ATOM   3345  H  HG   . LEU A  1 224 ? -47.485 -23.926 -83.235  1.00 24.53  ? 224 LEU O HG   1 
ATOM   3346  H  HD11 . LEU A  1 224 ? -47.550 -21.674 -82.728  1.00 24.82  ? 224 LEU O HD11 1 
ATOM   3347  H  HD12 . LEU A  1 224 ? -47.338 -22.532 -81.408  1.00 24.82  ? 224 LEU O HD12 1 
ATOM   3348  H  HD13 . LEU A  1 224 ? -46.106 -21.780 -82.073  1.00 24.82  ? 224 LEU O HD13 1 
ATOM   3349  H  HD21 . LEU A  1 224 ? -46.731 -22.432 -84.851  1.00 30.59  ? 224 LEU O HD21 1 
ATOM   3350  H  HD22 . LEU A  1 224 ? -45.253 -22.555 -84.279  1.00 30.59  ? 224 LEU O HD22 1 
ATOM   3351  H  HD23 . LEU A  1 224 ? -45.943 -23.807 -84.973  1.00 30.59  ? 224 LEU O HD23 1 
ATOM   3352  N  N    . ASN A  1 225 ? -44.482 -27.737 -82.285  1.00 16.40  ? 225 ASN O N    1 
ATOM   3353  C  CA   . ASN A  1 225 ? -43.447 -28.618 -81.739  1.00 15.53  ? 225 ASN O CA   1 
ATOM   3354  C  C    . ASN A  1 225 ? -42.157 -28.499 -82.553  1.00 16.62  ? 225 ASN O C    1 
ATOM   3355  O  O    . ASN A  1 225 ? -42.165 -28.684 -83.767  1.00 17.99  ? 225 ASN O O    1 
ATOM   3356  C  CB   . ASN A  1 225 ? -43.941 -30.066 -81.723  1.00 18.71  ? 225 ASN O CB   1 
ATOM   3357  C  CG   . ASN A  1 225 ? -43.053 -30.984 -80.900  1.00 35.64  ? 225 ASN O CG   1 
ATOM   3358  O  OD1  . ASN A  1 225 ? -42.500 -30.586 -79.882  1.00 38.26  ? 225 ASN O OD1  1 
ATOM   3359  N  ND2  . ASN A  1 225 ? -42.917 -32.218 -81.344  1.00 45.01  ? 225 ASN O ND2  1 
ATOM   3360  H  H    . ASN A  1 225 ? -45.223 -28.133 -82.467  1.00 19.68  ? 225 ASN O H    1 
ATOM   3361  H  HA   . ASN A  1 225 ? -43.254 -28.354 -80.826  1.00 18.64  ? 225 ASN O HA   1 
ATOM   3362  H  HB2  . ASN A  1 225 ? -44.832 -30.091 -81.342  1.00 22.45  ? 225 ASN O HB2  1 
ATOM   3363  H  HB3  . ASN A  1 225 ? -43.959 -30.403 -82.632  1.00 22.45  ? 225 ASN O HB3  1 
ATOM   3364  H  HD21 . ASN A  1 225 ? -42.425 -32.777 -80.915  1.00 54.02  ? 225 ASN O HD21 1 
ATOM   3365  H  HD22 . ASN A  1 225 ? -43.321 -32.463 -82.063  1.00 54.02  ? 225 ASN O HD22 1 
ATOM   3366  N  N    . GLY A  1 226 ? -41.066 -28.132 -81.885  1.00 18.52  ? 226 GLY O N    1 
ATOM   3367  C  CA   . GLY A  1 226 ? -39.771 -27.984 -82.528  1.00 22.97  ? 226 GLY O CA   1 
ATOM   3368  C  C    . GLY A  1 226 ? -39.537 -26.675 -83.273  1.00 23.57  ? 226 GLY O C    1 
ATOM   3369  O  O    . GLY A  1 226 ? -38.496 -26.503 -83.885  1.00 24.61  ? 226 GLY O O    1 
ATOM   3370  H  H    . GLY A  1 226 ? -41.054 -27.962 -81.042  1.00 22.23  ? 226 GLY O H    1 
ATOM   3371  H  HA2  . GLY A  1 226 ? -39.079 -28.066 -81.853  1.00 27.56  ? 226 GLY O HA2  1 
ATOM   3372  H  HA3  . GLY A  1 226 ? -39.655 -28.709 -83.162  1.00 27.56  ? 226 GLY O HA3  1 
ATOM   3373  N  N    . LYS A  1 227 ? -40.495 -25.756 -83.225  1.00 13.58  ? 227 LYS O N    1 
ATOM   3374  C  CA   . LYS A  1 227 ? -40.432 -24.552 -84.030  1.00 13.23  ? 227 LYS O CA   1 
ATOM   3375  C  C    . LYS A  1 227 ? -40.077 -23.315 -83.212  1.00 16.15  ? 227 LYS O C    1 
ATOM   3376  O  O    . LYS A  1 227 ? -39.872 -22.248 -83.777  1.00 14.25  ? 227 LYS O O    1 
ATOM   3377  C  CB   . LYS A  1 227 ? -41.756 -24.343 -84.756  1.00 13.11  ? 227 LYS O CB   1 
ATOM   3378  C  CG   . LYS A  1 227 ? -42.064 -25.456 -85.784  1.00 22.56  ? 227 LYS O CG   1 
ATOM   3379  C  CD   . LYS A  1 227 ? -43.247 -25.103 -86.676  1.00 26.15  ? 227 LYS O CD   1 
ATOM   3380  C  CE   . LYS A  1 227 ? -43.716 -26.302 -87.508  1.00 38.71  ? 227 LYS O CE   1 
ATOM   3381  N  NZ   . LYS A  1 227 ? -42.581 -27.003 -88.153  1.00 45.96  ? 227 LYS O NZ   1 
ATOM   3382  H  H    . LYS A  1 227 ? -41.195 -25.810 -82.729  1.00 16.30  ? 227 LYS O H    1 
ATOM   3383  H  HA   . LYS A  1 227 ? -39.743 -24.666 -84.702  1.00 15.88  ? 227 LYS O HA   1 
ATOM   3384  H  HB2  . LYS A  1 227 ? -42.475 -24.330 -84.105  1.00 15.73  ? 227 LYS O HB2  1 
ATOM   3385  H  HB3  . LYS A  1 227 ? -41.725 -23.497 -85.231  1.00 15.73  ? 227 LYS O HB3  1 
ATOM   3386  H  HG2  . LYS A  1 227 ? -41.288 -25.589 -86.351  1.00 27.07  ? 227 LYS O HG2  1 
ATOM   3387  H  HG3  . LYS A  1 227 ? -42.276 -26.276 -85.311  1.00 27.07  ? 227 LYS O HG3  1 
ATOM   3388  H  HD2  . LYS A  1 227 ? -43.988 -24.811 -86.121  1.00 31.38  ? 227 LYS O HD2  1 
ATOM   3389  H  HD3  . LYS A  1 227 ? -42.986 -24.395 -87.285  1.00 31.38  ? 227 LYS O HD3  1 
ATOM   3390  H  HE2  . LYS A  1 227 ? -44.173 -26.932 -86.930  1.00 46.45  ? 227 LYS O HE2  1 
ATOM   3391  H  HE3  . LYS A  1 227 ? -44.315 -25.991 -88.205  1.00 46.45  ? 227 LYS O HE3  1 
ATOM   3392  H  HZ1  . LYS A  1 227 ? -42.146 -26.446 -88.693  1.00 55.16  ? 227 LYS O HZ1  1 
ATOM   3393  H  HZ2  . LYS A  1 227 ? -42.017 -27.303 -87.532  1.00 55.16  ? 227 LYS O HZ2  1 
ATOM   3394  H  HZ3  . LYS A  1 227 ? -42.880 -27.693 -88.628  1.00 55.16  ? 227 LYS O HZ3  1 
ATOM   3395  N  N    . LEU A  1 228 ? -39.974 -23.471 -81.890  1.00 16.22  ? 228 LEU O N    1 
ATOM   3396  C  CA   . LEU A  1 228 ? -39.724 -22.351 -80.977  1.00 13.49  ? 228 LEU O CA   1 
ATOM   3397  C  C    . LEU A  1 228 ? -38.716 -22.686 -79.908  1.00 20.52  ? 228 LEU O C    1 
ATOM   3398  O  O    . LEU A  1 228 ? -38.761 -23.761 -79.337  1.00 15.06  ? 228 LEU O O    1 
ATOM   3399  C  CB   . LEU A  1 228 ? -41.004 -21.932 -80.251  1.00 17.94  ? 228 LEU O CB   1 
ATOM   3400  C  CG   . LEU A  1 228 ? -42.161 -21.431 -81.101  1.00 26.76  ? 228 LEU O CG   1 
ATOM   3401  C  CD1  . LEU A  1 228 ? -43.400 -21.276 -80.243  1.00 31.44  ? 228 LEU O CD1  1 
ATOM   3402  C  CD2  . LEU A  1 228 ? -41.778 -20.110 -81.677  1.00 23.01  ? 228 LEU O CD2  1 
ATOM   3403  H  H    . LEU A  1 228 ? -40.047 -24.229 -81.491  1.00 19.47  ? 228 LEU O H    1 
ATOM   3404  H  HA   . LEU A  1 228 ? -39.394 -21.591 -81.482  1.00 16.19  ? 228 LEU O HA   1 
ATOM   3405  H  HB2  . LEU A  1 228 ? -41.330 -22.697 -79.752  1.00 21.53  ? 228 LEU O HB2  1 
ATOM   3406  H  HB3  . LEU A  1 228 ? -40.778 -21.221 -79.631  1.00 21.53  ? 228 LEU O HB3  1 
ATOM   3407  H  HG   . LEU A  1 228 ? -42.345 -22.054 -81.822  1.00 32.11  ? 228 LEU O HG   1 
ATOM   3408  H  HD11 . LEU A  1 228 ? -44.129 -20.956 -80.797  1.00 37.73  ? 228 LEU O HD11 1 
ATOM   3409  H  HD12 . LEU A  1 228 ? -43.628 -22.138 -79.861  1.00 37.73  ? 228 LEU O HD12 1 
ATOM   3410  H  HD13 . LEU A  1 228 ? -43.217 -20.638 -79.536  1.00 37.73  ? 228 LEU O HD13 1 
ATOM   3411  H  HD21 . LEU A  1 228 ? -42.510 -19.780 -82.222  1.00 27.61  ? 228 LEU O HD21 1 
ATOM   3412  H  HD22 . LEU A  1 228 ? -41.599 -19.490 -80.952  1.00 27.61  ? 228 LEU O HD22 1 
ATOM   3413  H  HD23 . LEU A  1 228 ? -40.983 -20.222 -82.221  1.00 27.61  ? 228 LEU O HD23 1 
ATOM   3414  N  N    . THR A  1 229 ? -37.837 -21.752 -79.589  1.00 11.31  ? 229 THR O N    1 
ATOM   3415  C  CA   . THR A  1 229 ? -37.118 -21.851 -78.335  1.00 12.59  ? 229 THR O CA   1 
ATOM   3416  C  C    . THR A  1 229 ? -36.723 -20.457 -77.916  1.00 9.58   ? 229 THR O C    1 
ATOM   3417  O  O    . THR A  1 229 ? -37.086 -19.487 -78.570  1.00 12.21  ? 229 THR O O    1 
ATOM   3418  C  CB   . THR A  1 229 ? -35.893 -22.795 -78.412  1.00 18.80  ? 229 THR O CB   1 
ATOM   3419  O  OG1  . THR A  1 229 ? -35.387 -22.993 -77.090  1.00 28.47  ? 229 THR O OG1  1 
ATOM   3420  C  CG2  . THR A  1 229 ? -34.812 -22.257 -79.316  1.00 18.38  ? 229 THR O CG2  1 
ATOM   3421  H  H    . THR A  1 229 ? -37.642 -21.066 -80.069  1.00 13.57  ? 229 THR O H    1 
ATOM   3422  H  HA   . THR A  1 229 ? -37.719 -22.204 -77.660  1.00 15.11  ? 229 THR O HA   1 
ATOM   3423  H  HB   . THR A  1 229 ? -36.179 -23.651 -78.769  1.00 22.56  ? 229 THR O HB   1 
ATOM   3424  H  HG1  . THR A  1 229 ? -34.721 -23.504 -77.110  1.00 34.17  ? 229 THR O HG1  1 
ATOM   3425  H  HG21 . THR A  1 229 ? -34.063 -22.873 -79.340  1.00 22.06  ? 229 THR O HG21 1 
ATOM   3426  H  HG22 . THR A  1 229 ? -35.158 -22.147 -80.216  1.00 22.06  ? 229 THR O HG22 1 
ATOM   3427  H  HG23 . THR A  1 229 ? -34.504 -21.398 -78.989  1.00 22.06  ? 229 THR O HG23 1 
ATOM   3428  N  N    . GLY A  1 230 ? -36.033 -20.337 -76.802  1.00 9.41   ? 230 GLY O N    1 
ATOM   3429  C  CA   . GLY A  1 230 ? -35.717 -19.012 -76.302  1.00 13.55  ? 230 GLY O CA   1 
ATOM   3430  C  C    . GLY A  1 230 ? -34.882 -19.011 -75.049  1.00 14.34  ? 230 GLY O C    1 
ATOM   3431  O  O    . GLY A  1 230 ? -34.387 -20.053 -74.616  1.00 11.55  ? 230 GLY O O    1 
ATOM   3432  H  H    . GLY A  1 230 ? -35.740 -20.988 -76.323  1.00 11.30  ? 230 GLY O H    1 
ATOM   3433  H  HA2  . GLY A  1 230 ? -35.235 -18.521 -76.986  1.00 16.26  ? 230 GLY O HA2  1 
ATOM   3434  H  HA3  . GLY A  1 230 ? -36.542 -18.538 -76.114  1.00 16.26  ? 230 GLY O HA3  1 
ATOM   3435  N  N    . MET A  1 231 ? -34.719 -17.823 -74.469  1.00 13.98  ? 231 MET O N    1 
ATOM   3436  C  CA   . MET A  1 231 ? -33.980 -17.692 -73.234  1.00 14.77  ? 231 MET O CA   1 
ATOM   3437  C  C    . MET A  1 231 ? -34.474 -16.473 -72.477  1.00 12.60  ? 231 MET O C    1 
ATOM   3438  O  O    . MET A  1 231 ? -35.398 -15.789 -72.908  1.00 11.24  ? 231 MET O O    1 
ATOM   3439  C  CB   . MET A  1 231 ? -32.469 -17.631 -73.504  1.00 14.15  ? 231 MET O CB   1 
ATOM   3440  C  CG   . MET A  1 231 ? -32.006 -16.627 -74.554  1.00 26.46  ? 231 MET O CG   1 
ATOM   3441  S  SD   . MET A  1 231 ? -31.840 -14.955 -73.925  1.00 24.53  ? 231 MET O SD   1 
ATOM   3442  C  CE   . MET A  1 231 ? -30.469 -15.155 -72.759  1.00 20.98  ? 231 MET O CE   1 
ATOM   3443  H  H    . MET A  1 231 ? -35.029 -17.082 -74.776  1.00 16.78  ? 231 MET O H    1 
ATOM   3444  H  HA   . MET A  1 231 ? -34.147 -18.479 -72.691  1.00 17.73  ? 231 MET O HA   1 
ATOM   3445  H  HB2  . MET A  1 231 ? -32.022 -17.405 -72.673  1.00 16.98  ? 231 MET O HB2  1 
ATOM   3446  H  HB3  . MET A  1 231 ? -32.177 -18.508 -73.796  1.00 16.98  ? 231 MET O HB3  1 
ATOM   3447  H  HG2  . MET A  1 231 ? -31.140 -16.905 -74.892  1.00 31.75  ? 231 MET O HG2  1 
ATOM   3448  H  HG3  . MET A  1 231 ? -32.652 -16.610 -75.277  1.00 31.75  ? 231 MET O HG3  1 
ATOM   3449  H  HE1  . MET A  1 231 ? -30.280 -14.299 -72.344  1.00 25.18  ? 231 MET O HE1  1 
ATOM   3450  H  HE2  . MET A  1 231 ? -30.722 -15.803 -72.083  1.00 25.18  ? 231 MET O HE2  1 
ATOM   3451  H  HE3  . MET A  1 231 ? -29.688 -15.469 -73.242  1.00 25.18  ? 231 MET O HE3  1 
ATOM   3452  N  N    . ALA A  1 232 ? -33.886 -16.230 -71.324  1.00 12.24  ? 232 ALA O N    1 
ATOM   3453  C  CA   . ALA A  1 232 ? -34.388 -15.207 -70.433  1.00 10.68  ? 232 ALA O CA   1 
ATOM   3454  C  C    . ALA A  1 232 ? -33.267 -14.346 -69.914  1.00 9.14   ? 232 ALA O C    1 
ATOM   3455  O  O    . ALA A  1 232 ? -32.121 -14.803 -69.797  1.00 10.12  ? 232 ALA O O    1 
ATOM   3456  C  CB   . ALA A  1 232 ? -35.128 -15.856 -69.270  1.00 13.54  ? 232 ALA O CB   1 
ATOM   3457  H  H    . ALA A  1 232 ? -33.192 -16.645 -71.032  1.00 14.69  ? 232 ALA O H    1 
ATOM   3458  H  HA   . ALA A  1 232 ? -35.011 -14.640 -70.914  1.00 12.82  ? 232 ALA O HA   1 
ATOM   3459  H  HB1  . ALA A  1 232 ? -35.460 -15.161 -68.680  1.00 16.24  ? 232 ALA O HB1  1 
ATOM   3460  H  HB2  . ALA A  1 232 ? -35.869 -16.376 -69.619  1.00 16.24  ? 232 ALA O HB2  1 
ATOM   3461  H  HB3  . ALA A  1 232 ? -34.516 -16.435 -68.790  1.00 16.24  ? 232 ALA O HB3  1 
ATOM   3462  N  N    . PHE A  1 233 ? -33.620 -13.107 -69.578  1.00 8.73   ? 233 PHE O N    1 
ATOM   3463  C  CA   . PHE A  1 233 ? -32.778 -12.233 -68.781  1.00 7.74   ? 233 PHE O CA   1 
ATOM   3464  C  C    . PHE A  1 233 ? -33.515 -11.852 -67.513  1.00 11.54  ? 233 PHE O C    1 
ATOM   3465  O  O    . PHE A  1 233 ? -34.593 -11.287 -67.593  1.00 13.47  ? 233 PHE O O    1 
ATOM   3466  C  CB   . PHE A  1 233 ? -32.406 -10.960 -69.530  1.00 8.96   ? 233 PHE O CB   1 
ATOM   3467  C  CG   . PHE A  1 233 ? -31.499 -11.172 -70.692  1.00 9.30   ? 233 PHE O CG   1 
ATOM   3468  C  CD1  . PHE A  1 233 ? -30.134 -11.357 -70.495  1.00 9.98   ? 233 PHE O CD1  1 
ATOM   3469  C  CD2  . PHE A  1 233 ? -31.993 -11.163 -71.987  1.00 13.07  ? 233 PHE O CD2  1 
ATOM   3470  C  CE1  . PHE A  1 233 ? -29.276 -11.522 -71.569  1.00 11.35  ? 233 PHE O CE1  1 
ATOM   3471  C  CE2  . PHE A  1 233 ? -31.128 -11.344 -73.078  1.00 18.28  ? 233 PHE O CE2  1 
ATOM   3472  C  CZ   . PHE A  1 233 ? -29.772 -11.520 -72.862  1.00 14.52  ? 233 PHE O CZ   1 
ATOM   3473  H  H    . PHE A  1 233 ? -34.364 -12.744 -69.810  1.00 10.47  ? 233 PHE O H    1 
ATOM   3474  H  HA   . PHE A  1 233 ? -31.963 -12.699 -68.538  1.00 9.28   ? 233 PHE O HA   1 
ATOM   3475  H  HB2  . PHE A  1 233 ? -33.218 -10.546 -69.862  1.00 10.75  ? 233 PHE O HB2  1 
ATOM   3476  H  HB3  . PHE A  1 233 ? -31.959 -10.357 -68.914  1.00 10.75  ? 233 PHE O HB3  1 
ATOM   3477  H  HD1  . PHE A  1 233 ? -29.790 -11.352 -69.631  1.00 11.98  ? 233 PHE O HD1  1 
ATOM   3478  H  HD2  . PHE A  1 233 ? -32.903 -11.039 -72.133  1.00 15.68  ? 233 PHE O HD2  1 
ATOM   3479  H  HE1  . PHE A  1 233 ? -28.367 -11.649 -71.421  1.00 13.62  ? 233 PHE O HE1  1 
ATOM   3480  H  HE2  . PHE A  1 233 ? -31.465 -11.340 -73.945  1.00 21.94  ? 233 PHE O HE2  1 
ATOM   3481  H  HZ   . PHE A  1 233 ? -29.197 -11.644 -73.583  1.00 17.43  ? 233 PHE O HZ   1 
ATOM   3482  N  N    . ARG A  1 234 ? -32.939 -12.141 -66.350  1.00 9.41   ? 234 ARG O N    1 
ATOM   3483  C  CA   . ARG A  1 234 ? -33.480 -11.635 -65.089  1.00 7.19   ? 234 ARG O CA   1 
ATOM   3484  C  C    . ARG A  1 234 ? -32.940 -10.240 -64.829  1.00 7.76   ? 234 ARG O C    1 
ATOM   3485  O  O    . ARG A  1 234 ? -31.730 -10.016 -64.949  1.00 8.79   ? 234 ARG O O    1 
ATOM   3486  C  CB   . ARG A  1 234 ? -33.123 -12.553 -63.920  1.00 7.42   ? 234 ARG O CB   1 
ATOM   3487  C  CG   . ARG A  1 234 ? -33.740 -13.930 -63.993  1.00 15.85  ? 234 ARG O CG   1 
ATOM   3488  C  CD   . ARG A  1 234 ? -35.271 -13.815 -63.863  1.00 28.21  ? 234 ARG O CD   1 
ATOM   3489  N  NE   . ARG A  1 234 ? -35.963 -15.101 -63.864  1.00 32.54  ? 234 ARG O NE   1 
ATOM   3490  C  CZ   . ARG A  1 234 ? -36.211 -15.827 -62.777  1.00 45.42  ? 234 ARG O CZ   1 
ATOM   3491  N  NH1  . ARG A  1 234 ? -35.822 -15.408 -61.577  1.00 37.85  ? 234 ARG O NH1  1 
ATOM   3492  N  NH2  . ARG A  1 234 ? -36.854 -16.979 -62.892  1.00 45.49  ? 234 ARG O NH2  1 
ATOM   3493  H  H    . ARG A  1 234 ? -32.235 -12.628 -66.263  1.00 11.29  ? 234 ARG O H    1 
ATOM   3494  H  HA   . ARG A  1 234 ? -34.446 -11.582 -65.152  1.00 8.63   ? 234 ARG O HA   1 
ATOM   3495  H  HB2  . ARG A  1 234 ? -32.159 -12.663 -63.895  1.00 8.91   ? 234 ARG O HB2  1 
ATOM   3496  H  HB3  . ARG A  1 234 ? -33.425 -12.138 -63.097  1.00 8.91   ? 234 ARG O HB3  1 
ATOM   3497  H  HG2  . ARG A  1 234 ? -33.530 -14.337 -64.848  1.00 19.02  ? 234 ARG O HG2  1 
ATOM   3498  H  HG3  . ARG A  1 234 ? -33.407 -14.476 -63.263  1.00 19.02  ? 234 ARG O HG3  1 
ATOM   3499  H  HD2  . ARG A  1 234 ? -35.481 -13.366 -63.029  1.00 33.85  ? 234 ARG O HD2  1 
ATOM   3500  H  HD3  . ARG A  1 234 ? -35.610 -13.296 -64.609  1.00 33.85  ? 234 ARG O HD3  1 
ATOM   3501  H  HE   . ARG A  1 234 ? -36.229 -15.411 -64.621  1.00 39.05  ? 234 ARG O HE   1 
ATOM   3502  H  HH11 . ARG A  1 234 ? -35.406 -14.660 -61.496  1.00 45.42  ? 234 ARG O HH11 1 
ATOM   3503  H  HH12 . ARG A  1 234 ? -35.987 -15.885 -60.880  1.00 45.42  ? 234 ARG O HH12 1 
ATOM   3504  H  HH21 . ARG A  1 234 ? -37.107 -17.255 -63.666  1.00 54.59  ? 234 ARG O HH21 1 
ATOM   3505  H  HH22 . ARG A  1 234 ? -37.015 -17.453 -62.193  1.00 54.59  ? 234 ARG O HH22 1 
ATOM   3506  N  N    . VAL A  1 235 ? -33.826 -9.308  -64.471  1.00 7.04   ? 235 VAL O N    1 
ATOM   3507  C  CA   . VAL A  1 235 ? -33.431 -7.910  -64.227  1.00 7.18   ? 235 VAL O CA   1 
ATOM   3508  C  C    . VAL A  1 235 ? -34.028 -7.433  -62.903  1.00 10.42  ? 235 VAL O C    1 
ATOM   3509  O  O    . VAL A  1 235 ? -34.987 -8.012  -62.408  1.00 11.42  ? 235 VAL O O    1 
ATOM   3510  C  CB   . VAL A  1 235 ? -33.856 -6.965  -65.384  1.00 8.14   ? 235 VAL O CB   1 
ATOM   3511  C  CG1  . VAL A  1 235 ? -33.276 -7.451  -66.708  1.00 9.13   ? 235 VAL O CG1  1 
ATOM   3512  C  CG2  . VAL A  1 235 ? -35.379 -6.847  -65.496  1.00 11.56  ? 235 VAL O CG2  1 
ATOM   3513  H  H    . VAL A  1 235 ? -34.666 -9.456  -64.362  1.00 8.44   ? 235 VAL O H    1 
ATOM   3514  H  HA   . VAL A  1 235 ? -32.465 -7.867  -64.149  1.00 8.62   ? 235 VAL O HA   1 
ATOM   3515  H  HB   . VAL A  1 235 ? -33.501 -6.079  -65.211  1.00 9.77   ? 235 VAL O HB   1 
ATOM   3516  H  HG11 . VAL A  1 235 ? -33.554 -6.847  -67.415  1.00 10.96  ? 235 VAL O HG11 1 
ATOM   3517  H  HG12 . VAL A  1 235 ? -32.308 -7.461  -66.644  1.00 10.96  ? 235 VAL O HG12 1 
ATOM   3518  H  HG13 . VAL A  1 235 ? -33.606 -8.345  -66.888  1.00 10.96  ? 235 VAL O HG13 1 
ATOM   3519  H  HG21 . VAL A  1 235 ? -35.596 -6.250  -66.229  1.00 13.87  ? 235 VAL O HG21 1 
ATOM   3520  H  HG22 . VAL A  1 235 ? -35.752 -7.727  -65.664  1.00 13.87  ? 235 VAL O HG22 1 
ATOM   3521  H  HG23 . VAL A  1 235 ? -35.730 -6.492  -64.665  1.00 13.87  ? 235 VAL O HG23 1 
ATOM   3522  N  N    . PRO A  1 236 ? -33.446 -6.396  -62.307  1.00 11.79  ? 236 PRO O N    1 
ATOM   3523  C  CA   . PRO A  1 236 ? -33.839 -5.992  -60.951  1.00 17.14  ? 236 PRO O CA   1 
ATOM   3524  C  C    . PRO A  1 236 ? -35.158 -5.205  -60.867  1.00 18.78  ? 236 PRO O C    1 
ATOM   3525  O  O    . PRO A  1 236 ? -35.153 -4.009  -60.569  1.00 15.64  ? 236 PRO O O    1 
ATOM   3526  C  CB   . PRO A  1 236 ? -32.662 -5.109  -60.488  1.00 12.84  ? 236 PRO O CB   1 
ATOM   3527  C  CG   . PRO A  1 236 ? -31.606 -5.278  -61.470  1.00 15.37  ? 236 PRO O CG   1 
ATOM   3528  C  CD   . PRO A  1 236 ? -32.255 -5.662  -62.762  1.00 15.58  ? 236 PRO O CD   1 
ATOM   3529  H  HA   . PRO A  1 236 ? -33.897 -6.771  -60.375  1.00 20.57  ? 236 PRO O HA   1 
ATOM   3530  H  HB2  . PRO A  1 236 ? -32.948 -4.183  -60.454  1.00 15.40  ? 236 PRO O HB2  1 
ATOM   3531  H  HB3  . PRO A  1 236 ? -32.362 -5.404  -59.614  1.00 15.40  ? 236 PRO O HB3  1 
ATOM   3532  H  HG2  . PRO A  1 236 ? -31.126 -4.442  -61.570  1.00 18.44  ? 236 PRO O HG2  1 
ATOM   3533  H  HG3  . PRO A  1 236 ? -31.004 -5.979  -61.175  1.00 18.44  ? 236 PRO O HG3  1 
ATOM   3534  H  HD2  . PRO A  1 236 ? -32.511 -4.873  -63.264  1.00 18.70  ? 236 PRO O HD2  1 
ATOM   3535  H  HD3  . PRO A  1 236 ? -31.673 -6.243  -63.277  1.00 18.70  ? 236 PRO O HD3  1 
ATOM   3536  N  N    . THR A  1 237 ? -36.271 -5.874  -61.143  1.00 12.20  ? 237 THR O N    1 
ATOM   3537  C  CA   . THR A  1 237 ? -37.602 -5.368  -60.803  1.00 16.83  ? 237 THR O CA   1 
ATOM   3538  C  C    . THR A  1 237 ? -38.291 -6.482  -60.032  1.00 12.30  ? 237 THR O C    1 
ATOM   3539  O  O    . THR A  1 237 ? -38.003 -7.656  -60.265  1.00 12.72  ? 237 THR O O    1 
ATOM   3540  C  CB   . THR A  1 237 ? -38.425 -4.975  -62.053  1.00 17.49  ? 237 THR O CB   1 
ATOM   3541  O  OG1  . THR A  1 237 ? -38.475 -6.090  -62.959  1.00 21.68  ? 237 THR O OG1  1 
ATOM   3542  C  CG2  . THR A  1 237 ? -37.767 -3.819  -62.759  1.00 31.77  ? 237 THR O CG2  1 
ATOM   3543  H  H    . THR A  1 237 ? -36.285 -6.639  -61.536  1.00 14.64  ? 237 THR O H    1 
ATOM   3544  H  HA   . THR A  1 237 ? -37.521 -4.593  -60.226  1.00 20.20  ? 237 THR O HA   1 
ATOM   3545  H  HB   . THR A  1 237 ? -39.323 -4.717  -61.793  1.00 20.98  ? 237 THR O HB   1 
ATOM   3546  H  HG1  . THR A  1 237 ? -38.920 -5.886  -63.641  1.00 26.02  ? 237 THR O HG1  1 
ATOM   3547  H  HG21 . THR A  1 237 ? -38.282 -3.573  -63.543  1.00 38.12  ? 237 THR O HG21 1 
ATOM   3548  H  HG22 . THR A  1 237 ? -37.712 -3.055  -62.164  1.00 38.12  ? 237 THR O HG22 1 
ATOM   3549  H  HG23 . THR A  1 237 ? -36.871 -4.068  -63.037  1.00 38.12  ? 237 THR O HG23 1 
ATOM   3550  N  N    . ALA A  1 238 ? -39.175 -6.128  -59.103  1.00 15.28  ? 238 ALA O N    1 
ATOM   3551  C  CA   . ALA A  1 238 ? -39.745 -7.111  -58.172  1.00 16.22  ? 238 ALA O CA   1 
ATOM   3552  C  C    . ALA A  1 238 ? -40.917 -7.887  -58.791  1.00 13.08  ? 238 ALA O C    1 
ATOM   3553  O  O    . ALA A  1 238 ? -41.283 -8.961  -58.313  1.00 11.95  ? 238 ALA O O    1 
ATOM   3554  C  CB   . ALA A  1 238 ? -40.195 -6.411  -56.893  1.00 19.95  ? 238 ALA O CB   1 
ATOM   3555  H  H    . ALA A  1 238 ? -39.464 -5.326  -58.988  1.00 18.34  ? 238 ALA O H    1 
ATOM   3556  H  HA   . ALA A  1 238 ? -39.058 -7.752  -57.933  1.00 19.46  ? 238 ALA O HA   1 
ATOM   3557  H  HB1  . ALA A  1 238 ? -40.569 -7.070  -56.288  1.00 23.94  ? 238 ALA O HB1  1 
ATOM   3558  H  HB2  . ALA A  1 238 ? -39.428 -5.982  -56.482  1.00 23.94  ? 238 ALA O HB2  1 
ATOM   3559  H  HB3  . ALA A  1 238 ? -40.867 -5.748  -57.116  1.00 23.94  ? 238 ALA O HB3  1 
ATOM   3560  N  N    . ASN A  1 239 ? -41.490 -7.335  -59.856  1.00 10.87  ? 239 ASN O N    1 
ATOM   3561  C  CA   . ASN A  1 239 ? -42.606 -7.985  -60.550  1.00 9.43   ? 239 ASN O CA   1 
ATOM   3562  C  C    . ASN A  1 239 ? -42.874 -7.363  -61.920  1.00 6.18   ? 239 ASN O C    1 
ATOM   3563  O  O    . ASN A  1 239 ? -42.511 -6.208  -62.166  1.00 9.24   ? 239 ASN O O    1 
ATOM   3564  C  CB   . ASN A  1 239 ? -43.869 -7.901  -59.691  1.00 9.11   ? 239 ASN O CB   1 
ATOM   3565  C  CG   . ASN A  1 239 ? -44.949 -8.873  -60.136  1.00 10.15  ? 239 ASN O CG   1 
ATOM   3566  O  OD1  . ASN A  1 239 ? -44.672 -10.012 -60.487  1.00 14.71  ? 239 ASN O OD1  1 
ATOM   3567  N  ND2  . ASN A  1 239 ? -46.186 -8.413  -60.129  1.00 12.66  ? 239 ASN O ND2  1 
ATOM   3568  H  H    . ASN A  1 239 ? -41.254 -6.583  -60.200  1.00 13.05  ? 239 ASN O H    1 
ATOM   3569  H  HA   . ASN A  1 239 ? -42.393 -8.923  -60.682  1.00 11.32  ? 239 ASN O HA   1 
ATOM   3570  H  HB2  . ASN A  1 239 ? -43.639 -8.108  -58.771  1.00 10.94  ? 239 ASN O HB2  1 
ATOM   3571  H  HB3  . ASN A  1 239 ? -44.231 -7.003  -59.748  1.00 10.94  ? 239 ASN O HB3  1 
ATOM   3572  H  HD21 . ASN A  1 239 ? -46.836 -8.922  -60.372  1.00 15.19  ? 239 ASN O HD21 1 
ATOM   3573  H  HD22 . ASN A  1 239 ? -46.343 -7.605  -59.881  1.00 15.19  ? 239 ASN O HD22 1 
ATOM   3574  N  N    . VAL A  1 240 ? -43.545 -8.143  -62.762  1.00 6.06   ? 240 VAL O N    1 
ATOM   3575  C  CA   . VAL A  1 240 ? -43.908 -7.845  -64.143  1.00 6.00   ? 240 VAL O CA   1 
ATOM   3576  C  C    . VAL A  1 240 ? -42.738 -8.100  -65.085  1.00 8.61   ? 240 VAL O C    1 
ATOM   3577  O  O    . VAL A  1 240 ? -41.638 -7.613  -64.891  1.00 8.90   ? 240 VAL O O    1 
ATOM   3578  C  CB   . VAL A  1 240 ? -44.420 -6.419  -64.360  1.00 6.16   ? 240 VAL O CB   1 
ATOM   3579  C  CG1  . VAL A  1 240 ? -44.845 -6.241  -65.779  1.00 6.27   ? 240 VAL O CG1  1 
ATOM   3580  C  CG2  . VAL A  1 240 ? -45.618 -6.139  -63.447  1.00 9.20   ? 240 VAL O CG2  1 
ATOM   3581  H  H    . VAL A  1 240 ? -43.824 -8.922  -62.527  1.00 7.27   ? 240 VAL O H    1 
ATOM   3582  H  HA   . VAL A  1 240 ? -44.623 -8.448  -64.403  1.00 7.20   ? 240 VAL O HA   1 
ATOM   3583  H  HB   . VAL A  1 240 ? -43.716 -5.782  -64.160  1.00 7.39   ? 240 VAL O HB   1 
ATOM   3584  H  HG11 . VAL A  1 240 ? -45.166 -5.333  -65.900  1.00 7.52   ? 240 VAL O HG11 1 
ATOM   3585  H  HG12 . VAL A  1 240 ? -44.084 -6.403  -66.359  1.00 7.52   ? 240 VAL O HG12 1 
ATOM   3586  H  HG13 . VAL A  1 240 ? -45.554 -6.872  -65.977  1.00 7.52   ? 240 VAL O HG13 1 
ATOM   3587  H  HG21 . VAL A  1 240 ? -45.926 -5.232  -63.600  1.00 11.05  ? 240 VAL O HG21 1 
ATOM   3588  H  HG22 . VAL A  1 240 ? -46.326 -6.769  -63.653  1.00 11.05  ? 240 VAL O HG22 1 
ATOM   3589  H  HG23 . VAL A  1 240 ? -45.342 -6.243  -62.523  1.00 11.05  ? 240 VAL O HG23 1 
ATOM   3590  N  N    . SER A  1 241 ? -43.050 -8.843  -66.133  1.00 9.93   ? 241 SER O N    1 
ATOM   3591  C  CA   . SER A  1 241 ? -42.087 -9.323  -67.103  1.00 6.42   ? 241 SER O CA   1 
ATOM   3592  C  C    . SER A  1 241 ? -42.592 -9.037  -68.498  1.00 9.01   ? 241 SER O C    1 
ATOM   3593  O  O    . SER A  1 241 ? -43.756 -8.621  -68.686  1.00 6.38   ? 241 SER O O    1 
ATOM   3594  C  CB   . SER A  1 241 ? -41.854 -10.830 -66.904  1.00 9.89   ? 241 SER O CB   1 
ATOM   3595  O  OG   . SER A  1 241 ? -41.424 -11.086 -65.578  1.00 7.59   ? 241 SER O OG   1 
ATOM   3596  H  H    . SER A  1 241 ? -43.854 -9.092  -66.309  1.00 11.91  ? 241 SER O H    1 
ATOM   3597  H  HA   . SER A  1 241 ? -41.243 -8.861  -66.979  1.00 7.70   ? 241 SER O HA   1 
ATOM   3598  H  HB2  . SER A  1 241 ? -42.684 -11.304 -67.066  1.00 11.87  ? 241 SER O HB2  1 
ATOM   3599  H  HB3  . SER A  1 241 ? -41.170 -11.130 -67.523  1.00 11.87  ? 241 SER O HB3  1 
ATOM   3600  H  HG   . SER A  1 241 ? -42.008 -10.827 -65.032  1.00 9.11   ? 241 SER O HG   1 
ATOM   3601  N  N    . VAL A  1 242 ? -41.745 -9.288  -69.494  1.00 6.53   ? 242 VAL O N    1 
ATOM   3602  C  CA   . VAL A  1 242 ? -42.129 -9.014  -70.865  1.00 6.10   ? 242 VAL O CA   1 
ATOM   3603  C  C    . VAL A  1 242 ? -41.483 -10.021 -71.822  1.00 7.66   ? 242 VAL O C    1 
ATOM   3604  O  O    . VAL A  1 242 ? -40.344 -10.440 -71.621  1.00 11.21  ? 242 VAL O O    1 
ATOM   3605  C  CB   . VAL A  1 242 ? -41.784 -7.546  -71.246  1.00 7.11   ? 242 VAL O CB   1 
ATOM   3606  C  CG1  . VAL A  1 242 ? -40.299 -7.260  -71.185  1.00 13.21  ? 242 VAL O CG1  1 
ATOM   3607  C  CG2  . VAL A  1 242 ? -42.332 -7.189  -72.643  1.00 9.10   ? 242 VAL O CG2  1 
ATOM   3608  H  H    . VAL A  1 242 ? -40.953 -9.611  -69.400  1.00 7.84   ? 242 VAL O H    1 
ATOM   3609  H  HA   . VAL A  1 242 ? -43.091 -9.116  -70.941  1.00 7.33   ? 242 VAL O HA   1 
ATOM   3610  H  HB   . VAL A  1 242 ? -42.216 -6.957  -70.608  1.00 8.53   ? 242 VAL O HB   1 
ATOM   3611  H  HG11 . VAL A  1 242 ? -40.145 -6.335  -71.431  1.00 15.86  ? 242 VAL O HG11 1 
ATOM   3612  H  HG12 . VAL A  1 242 ? -39.984 -7.420  -70.281  1.00 15.86  ? 242 VAL O HG12 1 
ATOM   3613  H  HG13 . VAL A  1 242 ? -39.839 -7.848  -71.804  1.00 15.86  ? 242 VAL O HG13 1 
ATOM   3614  H  HG21 . VAL A  1 242 ? -42.099 -6.270  -72.848  1.00 10.92  ? 242 VAL O HG21 1 
ATOM   3615  H  HG22 . VAL A  1 242 ? -41.936 -7.785  -73.298  1.00 10.92  ? 242 VAL O HG22 1 
ATOM   3616  H  HG23 . VAL A  1 242 ? -43.296 -7.294  -72.640  1.00 10.92  ? 242 VAL O HG23 1 
ATOM   3617  N  N    . VAL A  1 243 ? -42.257 -10.447 -72.815  1.00 9.83   ? 243 VAL O N    1 
ATOM   3618  C  CA   . VAL A  1 243 ? -41.821 -11.403 -73.839  1.00 7.49   ? 243 VAL O CA   1 
ATOM   3619  C  C    . VAL A  1 243 ? -41.550 -10.652 -75.126  1.00 11.84  ? 243 VAL O C    1 
ATOM   3620  O  O    . VAL A  1 243 ? -42.270 -9.726  -75.493  1.00 12.26  ? 243 VAL O O    1 
ATOM   3621  C  CB   . VAL A  1 243 ? -42.893 -12.520 -74.082  1.00 14.09  ? 243 VAL O CB   1 
ATOM   3622  C  CG1  . VAL A  1 243 ? -42.827 -13.093 -75.503  1.00 27.05  ? 243 VAL O CG1  1 
ATOM   3623  C  CG2  . VAL A  1 243 ? -42.724 -13.621 -73.061  1.00 19.05  ? 243 VAL O CG2  1 
ATOM   3624  H  H    . VAL A  1 243 ? -43.070 -10.188 -72.922  1.00 11.80  ? 243 VAL O H    1 
ATOM   3625  H  HA   . VAL A  1 243 ? -40.997 -11.828 -73.553  1.00 8.98   ? 243 VAL O HA   1 
ATOM   3626  H  HB   . VAL A  1 243 ? -43.776 -12.136 -73.959  1.00 16.91  ? 243 VAL O HB   1 
ATOM   3627  H  HG11 . VAL A  1 243 ? -43.509 -13.777 -75.599  1.00 32.46  ? 243 VAL O HG11 1 
ATOM   3628  H  HG12 . VAL A  1 243 ? -42.984 -12.378 -76.139  1.00 32.46  ? 243 VAL O HG12 1 
ATOM   3629  H  HG13 . VAL A  1 243 ? -41.949 -13.478 -75.647  1.00 32.46  ? 243 VAL O HG13 1 
ATOM   3630  H  HG21 . VAL A  1 243 ? -43.393 -14.305 -73.222  1.00 22.86  ? 243 VAL O HG21 1 
ATOM   3631  H  HG22 . VAL A  1 243 ? -41.835 -13.999 -73.150  1.00 22.86  ? 243 VAL O HG22 1 
ATOM   3632  H  HG23 . VAL A  1 243 ? -42.838 -13.248 -72.173  1.00 22.86  ? 243 VAL O HG23 1 
ATOM   3633  N  N    . ASP A  1 244 ? -40.497 -11.078 -75.798  1.00 9.53   ? 244 ASP O N    1 
ATOM   3634  C  CA   . ASP A  1 244 ? -40.045 -10.535 -77.063  1.00 13.08  ? 244 ASP O CA   1 
ATOM   3635  C  C    . ASP A  1 244 ? -39.973 -11.735 -78.000  1.00 17.67  ? 244 ASP O C    1 
ATOM   3636  O  O    . ASP A  1 244 ? -39.032 -12.526 -77.897  1.00 16.85  ? 244 ASP O O    1 
ATOM   3637  C  CB   . ASP A  1 244 ? -38.695 -9.839  -76.848  1.00 29.06  ? 244 ASP O CB   1 
ATOM   3638  C  CG   . ASP A  1 244 ? -38.005 -9.420  -78.125  1.00 62.51  ? 244 ASP O CG   1 
ATOM   3639  O  OD1  . ASP A  1 244 ? -38.049 -10.150 -79.136  1.00 75.56  ? 244 ASP O OD1  1 
ATOM   3640  O  OD2  . ASP A  1 244 ? -37.354 -8.355  -78.085  1.00 77.46  ? 244 ASP O OD2  1 
ATOM   3641  H  H    . ASP A  1 244 ? -39.999 -11.723 -75.521  1.00 11.44  ? 244 ASP O H    1 
ATOM   3642  H  HA   . ASP A  1 244 ? -40.688 -9.895  -77.406  1.00 15.70  ? 244 ASP O HA   1 
ATOM   3643  H  HB2  . ASP A  1 244 ? -38.837 -9.042  -76.314  1.00 34.88  ? 244 ASP O HB2  1 
ATOM   3644  H  HB3  . ASP A  1 244 ? -38.103 -10.447 -76.378  1.00 34.88  ? 244 ASP O HB3  1 
ATOM   3645  N  N    . LEU A  1 245 ? -40.981 -11.901 -78.864  1.00 12.19  ? 245 LEU O N    1 
ATOM   3646  C  CA   . LEU A  1 245 ? -41.044 -13.035 -79.786  1.00 11.16  ? 245 LEU O CA   1 
ATOM   3647  C  C    . LEU A  1 245 ? -40.631 -12.623 -81.195  1.00 15.18  ? 245 LEU O C    1 
ATOM   3648  O  O    . LEU A  1 245 ? -41.316 -11.832 -81.836  1.00 13.43  ? 245 LEU O O    1 
ATOM   3649  C  CB   . LEU A  1 245 ? -42.450 -13.632 -79.831  1.00 14.06  ? 245 LEU O CB   1 
ATOM   3650  C  CG   . LEU A  1 245 ? -42.669 -14.724 -80.892  1.00 22.92  ? 245 LEU O CG   1 
ATOM   3651  C  CD1  . LEU A  1 245 ? -41.779 -15.944 -80.673  1.00 22.34  ? 245 LEU O CD1  1 
ATOM   3652  C  CD2  . LEU A  1 245 ? -44.124 -15.156 -80.949  1.00 21.59  ? 245 LEU O CD2  1 
ATOM   3653  H  H    . LEU A  1 245 ? -41.648 -11.362 -78.935  1.00 14.63  ? 245 LEU O H    1 
ATOM   3654  H  HA   . LEU A  1 245 ? -40.433 -13.725 -79.482  1.00 13.39  ? 245 LEU O HA   1 
ATOM   3655  H  HB2  . LEU A  1 245 ? -42.646 -14.023 -78.966  1.00 16.87  ? 245 LEU O HB2  1 
ATOM   3656  H  HB3  . LEU A  1 245 ? -43.081 -12.918 -80.014  1.00 16.87  ? 245 LEU O HB3  1 
ATOM   3657  H  HG   . LEU A  1 245 ? -42.444 -14.355 -81.760  1.00 27.50  ? 245 LEU O HG   1 
ATOM   3658  H  HD11 . LEU A  1 245 ? -41.960 -16.595 -81.369  1.00 26.81  ? 245 LEU O HD11 1 
ATOM   3659  H  HD12 . LEU A  1 245 ? -40.850 -15.667 -80.712  1.00 26.81  ? 245 LEU O HD12 1 
ATOM   3660  H  HD13 . LEU A  1 245 ? -41.974 -16.325 -79.803  1.00 26.81  ? 245 LEU O HD13 1 
ATOM   3661  H  HD21 . LEU A  1 245 ? -44.222 -15.843 -81.627  1.00 25.90  ? 245 LEU O HD21 1 
ATOM   3662  H  HD22 . LEU A  1 245 ? -44.383 -15.506 -80.083  1.00 25.90  ? 245 LEU O HD22 1 
ATOM   3663  H  HD23 . LEU A  1 245 ? -44.672 -14.388 -81.174  1.00 25.90  ? 245 LEU O HD23 1 
ATOM   3664  N  N    . THR A  1 246 ? -39.516 -13.174 -81.665  1.00 8.99   ? 246 THR O N    1 
ATOM   3665  C  CA   . THR A  1 246 ? -39.002 -12.902 -83.005  1.00 10.54  ? 246 THR O CA   1 
ATOM   3666  C  C    . THR A  1 246 ? -39.315 -14.103 -83.863  1.00 20.32  ? 246 THR O C    1 
ATOM   3667  O  O    . THR A  1 246 ? -38.736 -15.174 -83.642  1.00 17.69  ? 246 THR O O    1 
ATOM   3668  C  CB   . THR A  1 246 ? -37.492 -12.634 -82.980  1.00 15.62  ? 246 THR O CB   1 
ATOM   3669  O  OG1  . THR A  1 246 ? -37.246 -11.434 -82.237  1.00 24.30  ? 246 THR O OG1  1 
ATOM   3670  C  CG2  . THR A  1 246 ? -36.918 -12.475 -84.390  1.00 19.04  ? 246 THR O CG2  1 
ATOM   3671  H  H    . THR A  1 246 ? -39.027 -13.721 -81.216  1.00 10.79  ? 246 THR O H    1 
ATOM   3672  H  HA   . THR A  1 246 ? -39.451 -12.127 -83.377  1.00 12.65  ? 246 THR O HA   1 
ATOM   3673  H  HB   . THR A  1 246 ? -37.041 -13.377 -82.549  1.00 18.74  ? 246 THR O HB   1 
ATOM   3674  H  HG1  . THR A  1 246 ? -36.421 -11.274 -82.215  1.00 29.15  ? 246 THR O HG1  1 
ATOM   3675  H  HG21 . THR A  1 246 ? -35.964 -12.307 -84.342  1.00 22.84  ? 246 THR O HG21 1 
ATOM   3676  H  HG22 . THR A  1 246 ? -37.071 -13.284 -84.903  1.00 22.84  ? 246 THR O HG22 1 
ATOM   3677  H  HG23 . THR A  1 246 ? -37.347 -11.731 -84.840  1.00 22.84  ? 246 THR O HG23 1 
ATOM   3678  N  N    . CYS A  1 247 ? -40.229 -13.950 -84.827  1.00 12.96  ? 247 CYS O N    1 
ATOM   3679  C  CA   . CYS A  1 247 ? -40.634 -15.096 -85.632  1.00 16.15  ? 247 CYS O CA   1 
ATOM   3680  C  C    . CYS A  1 247 ? -40.731 -14.846 -87.123  1.00 13.79  ? 247 CYS O C    1 
ATOM   3681  O  O    . CYS A  1 247 ? -40.923 -13.715 -87.597  1.00 12.51  ? 247 CYS O O    1 
ATOM   3682  C  CB   . CYS A  1 247 ? -41.968 -15.650 -85.134  1.00 28.34  ? 247 CYS O CB   1 
ATOM   3683  S  SG   . CYS A  1 247 ? -43.287 -14.462 -85.036  1.00 33.80  ? 247 CYS O SG   1 
ATOM   3684  H  H    . CYS A  1 247 ? -40.620 -13.211 -85.027  1.00 15.56  ? 247 CYS O H    1 
ATOM   3685  H  HA   . CYS A  1 247 ? -39.973 -15.795 -85.507  1.00 19.38  ? 247 CYS O HA   1 
ATOM   3686  H  HB2  . CYS A  1 247 ? -42.254 -16.355 -85.736  1.00 34.01  ? 247 CYS O HB2  1 
ATOM   3687  H  HB3  . CYS A  1 247 ? -41.838 -16.015 -84.244  1.00 34.01  ? 247 CYS O HB3  1 
ATOM   3688  H  HG   . CYS A  1 247 ? -44.277 -15.009 -84.635  1.00 40.56  ? 247 CYS O HG   1 
ATOM   3689  N  N    . ARG A  1 248 ? -40.567 -15.942 -87.850  1.00 12.51  ? 248 ARG O N    1 
ATOM   3690  C  CA   . ARG A  1 248 ? -40.772 -15.956 -89.286  1.00 13.99  ? 248 ARG O CA   1 
ATOM   3691  C  C    . ARG A  1 248 ? -42.163 -16.526 -89.593  1.00 13.72  ? 248 ARG O C    1 
ATOM   3692  O  O    . ARG A  1 248 ? -42.517 -17.604 -89.128  1.00 14.41  ? 248 ARG O O    1 
ATOM   3693  C  CB   . ARG A  1 248 ? -39.682 -16.762 -89.994  1.00 19.56  ? 248 ARG O CB   1 
ATOM   3694  C  CG   . ARG A  1 248 ? -39.907 -16.792 -91.501  1.00 31.57  ? 248 ARG O CG   1 
ATOM   3695  C  CD   . ARG A  1 248 ? -38.691 -17.176 -92.313  1.00 48.97  ? 248 ARG O CD   1 
ATOM   3696  N  NE   . ARG A  1 248 ? -38.697 -16.442 -93.579  1.00 64.64  ? 248 ARG O NE   1 
ATOM   3697  C  CZ   . ARG A  1 248 ? -39.606 -16.597 -94.543  1.00 65.30  ? 248 ARG O CZ   1 
ATOM   3698  N  NH1  . ARG A  1 248 ? -40.601 -17.474 -94.409  1.00 62.20  ? 248 ARG O NH1  1 
ATOM   3699  N  NH2  . ARG A  1 248 ? -39.521 -15.866 -95.650  1.00 56.10  ? 248 ARG O NH2  1 
ATOM   3700  H  H    . ARG A  1 248 ? -40.334 -16.704 -87.527  1.00 15.01  ? 248 ARG O H    1 
ATOM   3701  H  HA   . ARG A  1 248 ? -40.738 -15.046 -89.620  1.00 16.79  ? 248 ARG O HA   1 
ATOM   3702  H  HB2  . ARG A  1 248 ? -38.819 -16.354 -89.822  1.00 23.47  ? 248 ARG O HB2  1 
ATOM   3703  H  HB3  . ARG A  1 248 ? -39.694 -17.675 -89.666  1.00 23.47  ? 248 ARG O HB3  1 
ATOM   3704  H  HG2  . ARG A  1 248 ? -40.606 -17.435 -91.697  1.00 37.88  ? 248 ARG O HG2  1 
ATOM   3705  H  HG3  . ARG A  1 248 ? -40.186 -15.909 -91.790  1.00 37.88  ? 248 ARG O HG3  1 
ATOM   3706  H  HD2  . ARG A  1 248 ? -37.886 -16.944 -91.824  1.00 58.76  ? 248 ARG O HD2  1 
ATOM   3707  H  HD3  . ARG A  1 248 ? -38.713 -18.126 -92.505  1.00 58.76  ? 248 ARG O HD3  1 
ATOM   3708  H  HE   . ARG A  1 248 ? -38.070 -15.868 -93.711  1.00 77.56  ? 248 ARG O HE   1 
ATOM   3709  H  HH11 . ARG A  1 248 ? -40.664 -17.948 -93.694  1.00 74.64  ? 248 ARG O HH11 1 
ATOM   3710  H  HH12 . ARG A  1 248 ? -41.181 -17.567 -95.038  1.00 74.64  ? 248 ARG O HH12 1 
ATOM   3711  H  HH21 . ARG A  1 248 ? -38.880 -15.300 -95.743  1.00 67.32  ? 248 ARG O HH21 1 
ATOM   3712  H  HH22 . ARG A  1 248 ? -40.101 -15.966 -96.276  1.00 67.32  ? 248 ARG O HH22 1 
ATOM   3713  N  N    . LEU A  1 249 ? -42.939 -15.773 -90.362  1.00 15.01  ? 249 LEU O N    1 
ATOM   3714  C  CA   . LEU A  1 249 ? -44.323 -16.116 -90.672  1.00 15.32  ? 249 LEU O CA   1 
ATOM   3715  C  C    . LEU A  1 249 ? -44.385 -16.886 -91.973  1.00 16.54  ? 249 LEU O C    1 
ATOM   3716  O  O    . LEU A  1 249 ? -43.650 -16.562 -92.902  1.00 14.88  ? 249 LEU O O    1 
ATOM   3717  C  CB   . LEU A  1 249 ? -45.177 -14.854 -90.790  1.00 19.59  ? 249 LEU O CB   1 
ATOM   3718  C  CG   . LEU A  1 249 ? -45.110 -13.886 -89.608  1.00 21.51  ? 249 LEU O CG   1 
ATOM   3719  C  CD1  . LEU A  1 249 ? -46.001 -12.676 -89.837  1.00 19.17  ? 249 LEU O CD1  1 
ATOM   3720  C  CD2  . LEU A  1 249 ? -45.491 -14.601 -88.354  1.00 18.56  ? 249 LEU O CD2  1 
ATOM   3721  H  H    . LEU A  1 249 ? -42.681 -15.038 -90.726  1.00 18.01  ? 249 LEU O H    1 
ATOM   3722  H  HA   . LEU A  1 249 ? -44.687 -16.671 -89.965  1.00 18.39  ? 249 LEU O HA   1 
ATOM   3723  H  HB2  . LEU A  1 249 ? -44.892 -14.366 -91.579  1.00 23.51  ? 249 LEU O HB2  1 
ATOM   3724  H  HB3  . LEU A  1 249 ? -46.103 -15.121 -90.893  1.00 23.51  ? 249 LEU O HB3  1 
ATOM   3725  H  HG   . LEU A  1 249 ? -44.198 -13.572 -89.508  1.00 25.81  ? 249 LEU O HG   1 
ATOM   3726  H  HD11 . LEU A  1 249 ? -45.935 -12.086 -89.070  1.00 23.01  ? 249 LEU O HD11 1 
ATOM   3727  H  HD12 . LEU A  1 249 ? -45.705 -12.214 -90.637  1.00 23.01  ? 249 LEU O HD12 1 
ATOM   3728  H  HD13 . LEU A  1 249 ? -46.917 -12.975 -89.947  1.00 23.01  ? 249 LEU O HD13 1 
ATOM   3729  H  HD21 . LEU A  1 249 ? -45.446 -13.980 -87.610  1.00 22.28  ? 249 LEU O HD21 1 
ATOM   3730  H  HD22 . LEU A  1 249 ? -46.395 -14.941 -88.447  1.00 22.28  ? 249 LEU O HD22 1 
ATOM   3731  H  HD23 . LEU A  1 249 ? -44.874 -15.335 -88.210  1.00 22.28  ? 249 LEU O HD23 1 
ATOM   3732  N  N    . GLU A  1 250 ? -45.254 -17.891 -92.091  1.00 17.85  ? 250 GLU O N    1 
ATOM   3733  C  CA   . GLU A  1 250 ? -45.300 -18.574 -93.374  1.00 20.12  ? 250 GLU O CA   1 
ATOM   3734  C  C    . GLU A  1 250 ? -46.101 -17.762 -94.376  1.00 16.82  ? 250 GLU O C    1 
ATOM   3735  O  O    . GLU A  1 250 ? -45.786 -17.798 -95.557  1.00 18.18  ? 250 GLU O O    1 
ATOM   3736  C  CB   . GLU A  1 250 ? -45.852 -20.008 -93.296  1.00 34.54  ? 250 GLU O CB   1 
ATOM   3737  C  CG   . GLU A  1 250 ? -46.758 -20.360 -92.181  1.00 45.18  ? 250 GLU O CG   1 
ATOM   3738  C  CD   . GLU A  1 250 ? -47.103 -21.851 -92.198  1.00 56.11  ? 250 GLU O CD   1 
ATOM   3739  O  OE1  . GLU A  1 250 ? -47.618 -22.325 -93.235  1.00 60.76  ? 250 GLU O OE1  1 
ATOM   3740  O  OE2  . GLU A  1 250 ? -46.841 -22.549 -91.192  1.00 44.89  ? 250 GLU O OE2  1 
ATOM   3741  H  H    . GLU A  1 250 ? -45.793 -18.179 -91.486  1.00 21.43  ? 250 GLU O H    1 
ATOM   3742  H  HA   . GLU A  1 250 ? -44.394 -18.636 -93.714  1.00 24.14  ? 250 GLU O HA   1 
ATOM   3743  H  HB2  . GLU A  1 250 ? -46.338 -20.181 -94.118  1.00 41.45  ? 250 GLU O HB2  1 
ATOM   3744  H  HB3  . GLU A  1 250 ? -45.096 -20.613 -93.244  1.00 41.45  ? 250 GLU O HB3  1 
ATOM   3745  H  HG2  . GLU A  1 250 ? -46.324 -20.157 -91.338  1.00 54.21  ? 250 GLU O HG2  1 
ATOM   3746  H  HG3  . GLU A  1 250 ? -47.583 -19.856 -92.266  1.00 54.21  ? 250 GLU O HG3  1 
ATOM   3747  N  N    . LYS A  1 251 ? -47.130 -17.043 -93.931  1.00 15.77  ? 251 LYS O N    1 
ATOM   3748  C  CA   . LYS A  1 251 ? -47.870 -16.175 -94.835  1.00 17.61  ? 251 LYS O CA   1 
ATOM   3749  C  C    . LYS A  1 251 ? -47.595 -14.723 -94.461  1.00 17.47  ? 251 LYS O C    1 
ATOM   3750  O  O    . LYS A  1 251 ? -47.430 -14.404 -93.287  1.00 17.72  ? 251 LYS O O    1 
ATOM   3751  C  CB   . LYS A  1 251 ? -49.362 -16.500 -94.802  1.00 25.05  ? 251 LYS O CB   1 
ATOM   3752  C  CG   . LYS A  1 251 ? -49.676 -17.879 -95.396  1.00 35.24  ? 251 LYS O CG   1 
ATOM   3753  C  CD   . LYS A  1 251 ? -50.996 -18.447 -94.907  1.00 55.99  ? 251 LYS O CD   1 
ATOM   3754  C  CE   . LYS A  1 251 ? -52.164 -17.559 -95.282  1.00 76.18  ? 251 LYS O CE   1 
ATOM   3755  N  NZ   . LYS A  1 251 ? -53.477 -18.202 -94.985  1.00 86.20  ? 251 LYS O NZ   1 
ATOM   3756  H  H    . LYS A  1 251 ? -47.415 -17.041 -93.119  1.00 18.92  ? 251 LYS O H    1 
ATOM   3757  H  HA   . LYS A  1 251 ? -47.552 -16.317 -95.740  1.00 21.13  ? 251 LYS O HA   1 
ATOM   3758  H  HB2  . LYS A  1 251 ? -49.668 -16.492 -93.881  1.00 30.06  ? 251 LYS O HB2  1 
ATOM   3759  H  HB3  . LYS A  1 251 ? -49.843 -15.833 -95.317  1.00 30.06  ? 251 LYS O HB3  1 
ATOM   3760  H  HG2  . LYS A  1 251 ? -49.722 -17.803 -96.362  1.00 42.29  ? 251 LYS O HG2  1 
ATOM   3761  H  HG3  . LYS A  1 251 ? -48.972 -18.498 -95.145  1.00 42.29  ? 251 LYS O HG3  1 
ATOM   3762  H  HD2  . LYS A  1 251 ? -51.137 -19.319 -95.308  1.00 67.19  ? 251 LYS O HD2  1 
ATOM   3763  H  HD3  . LYS A  1 251 ? -50.972 -18.524 -93.940  1.00 67.19  ? 251 LYS O HD3  1 
ATOM   3764  H  HE2  . LYS A  1 251 ? -52.111 -16.733 -94.776  1.00 91.42  ? 251 LYS O HE2  1 
ATOM   3765  H  HE3  . LYS A  1 251 ? -52.128 -17.370 -96.233  1.00 91.42  ? 251 LYS O HE3  1 
ATOM   3766  H  HZ1  . LYS A  1 251 ? -53.554 -18.962 -95.443  1.00 103.43 ? 251 LYS O HZ1  1 
ATOM   3767  H  HZ2  . LYS A  1 251 ? -53.538 -18.381 -94.116  1.00 103.43 ? 251 LYS O HZ2  1 
ATOM   3768  H  HZ3  . LYS A  1 251 ? -54.142 -17.657 -95.216  1.00 103.43 ? 251 LYS O HZ3  1 
ATOM   3769  N  N    . PRO A  1 252 ? -47.492 -13.845 -95.464  1.00 16.60  ? 252 PRO O N    1 
ATOM   3770  C  CA   . PRO A  1 252 ? -47.094 -12.472 -95.140  1.00 16.69  ? 252 PRO O CA   1 
ATOM   3771  C  C    . PRO A  1 252 ? -48.173 -11.698 -94.387  1.00 16.98  ? 252 PRO O C    1 
ATOM   3772  O  O    . PRO A  1 252 ? -49.358 -11.906 -94.630  1.00 16.37  ? 252 PRO O O    1 
ATOM   3773  C  CB   . PRO A  1 252 ? -46.846 -11.848 -96.507  1.00 19.31  ? 252 PRO O CB   1 
ATOM   3774  C  CG   . PRO A  1 252 ? -47.736 -12.632 -97.444  1.00 20.33  ? 252 PRO O CG   1 
ATOM   3775  C  CD   . PRO A  1 252 ? -47.770 -14.028 -96.901  1.00 17.70  ? 252 PRO O CD   1 
ATOM   3776  H  HA   . PRO A  1 252 ? -46.271 -12.467 -94.626  1.00 20.03  ? 252 PRO O HA   1 
ATOM   3777  H  HB2  . PRO A  1 252 ? -47.100 -10.912 -96.492  1.00 23.17  ? 252 PRO O HB2  1 
ATOM   3778  H  HB3  . PRO A  1 252 ? -45.913 -11.950 -96.751  1.00 23.17  ? 252 PRO O HB3  1 
ATOM   3779  H  HG2  . PRO A  1 252 ? -48.626 -12.246 -97.447  1.00 24.40  ? 252 PRO O HG2  1 
ATOM   3780  H  HG3  . PRO A  1 252 ? -47.357 -12.623 -98.337  1.00 24.40  ? 252 PRO O HG3  1 
ATOM   3781  H  HD2  . PRO A  1 252 ? -48.648 -14.419 -97.028  1.00 21.24  ? 252 PRO O HD2  1 
ATOM   3782  H  HD3  . PRO A  1 252 ? -47.077 -14.567 -97.313  1.00 21.24  ? 252 PRO O HD3  1 
ATOM   3783  N  N    . ALA A  1 253 ? -47.746 -10.816 -93.493  1.00 20.07  ? 253 ALA O N    1 
ATOM   3784  C  CA   . ALA A  1 253 ? -48.656 -9.961  -92.740  1.00 19.67  ? 253 ALA O CA   1 
ATOM   3785  C  C    . ALA A  1 253 ? -48.027 -8.594  -92.550  1.00 19.53  ? 253 ALA O C    1 
ATOM   3786  O  O    . ALA A  1 253 ? -46.869 -8.504  -92.160  1.00 23.48  ? 253 ALA O O    1 
ATOM   3787  C  CB   . ALA A  1 253 ? -48.973 -10.582 -91.398  1.00 18.35  ? 253 ALA O CB   1 
ATOM   3788  H  H    . ALA A  1 253 ? -46.918 -10.691 -93.300  1.00 24.09  ? 253 ALA O H    1 
ATOM   3789  H  HA   . ALA A  1 253 ? -49.485 -9.853  -93.234  1.00 23.60  ? 253 ALA O HA   1 
ATOM   3790  H  HB1  . ALA A  1 253 ? -49.578 -9.997  -90.915  1.00 22.01  ? 253 ALA O HB1  1 
ATOM   3791  H  HB2  . ALA A  1 253 ? -49.389 -11.446 -91.540  1.00 22.01  ? 253 ALA O HB2  1 
ATOM   3792  H  HB3  . ALA A  1 253 ? -48.148 -10.690 -90.898  1.00 22.01  ? 253 ALA O HB3  1 
ATOM   3793  N  N    . LYS A  1 254 ? -48.781 -7.541  -92.844  1.00 15.34  ? 254 LYS O N    1 
ATOM   3794  C  CA   . LYS A  1 254 ? -48.390 -6.202  -92.469  1.00 17.22  ? 254 LYS O CA   1 
ATOM   3795  C  C    . LYS A  1 254 ? -48.576 -6.090  -90.966  1.00 20.28  ? 254 LYS O C    1 
ATOM   3796  O  O    . LYS A  1 254 ? -49.398 -6.798  -90.369  1.00 17.71  ? 254 LYS O O    1 
ATOM   3797  C  CB   . LYS A  1 254 ? -49.223 -5.138  -93.197  1.00 16.66  ? 254 LYS O CB   1 
ATOM   3798  C  CG   . LYS A  1 254 ? -49.214 -5.242  -94.718  1.00 31.13  ? 254 LYS O CG   1 
ATOM   3799  C  CD   . LYS A  1 254 ? -47.885 -4.831  -95.309  1.00 49.30  ? 254 LYS O CD   1 
ATOM   3800  C  CE   . LYS A  1 254 ? -47.918 -4.895  -96.836  1.00 62.21  ? 254 LYS O CE   1 
ATOM   3801  N  NZ   . LYS A  1 254 ? -46.583 -4.620  -97.442  1.00 66.73  ? 254 LYS O NZ   1 
ATOM   3802  H  H    . LYS A  1 254 ? -49.529 -7.583  -93.265  1.00 18.41  ? 254 LYS O H    1 
ATOM   3803  H  HA   . LYS A  1 254 ? -47.454 -6.062  -92.679  1.00 20.67  ? 254 LYS O HA   1 
ATOM   3804  H  HB2  . LYS A  1 254 ? -50.145 -5.214  -92.905  1.00 19.99  ? 254 LYS O HB2  1 
ATOM   3805  H  HB3  . LYS A  1 254 ? -48.878 -4.263  -92.962  1.00 19.99  ? 254 LYS O HB3  1 
ATOM   3806  H  HG2  . LYS A  1 254 ? -49.387 -6.161  -94.975  1.00 37.36  ? 254 LYS O HG2  1 
ATOM   3807  H  HG3  . LYS A  1 254 ? -49.899 -4.659  -95.081  1.00 37.36  ? 254 LYS O HG3  1 
ATOM   3808  H  HD2  . LYS A  1 254 ? -47.685 -3.919  -95.046  1.00 59.16  ? 254 LYS O HD2  1 
ATOM   3809  H  HD3  . LYS A  1 254 ? -47.193 -5.433  -94.993  1.00 59.16  ? 254 LYS O HD3  1 
ATOM   3810  H  HE2  . LYS A  1 254 ? -48.197 -5.782  -97.111  1.00 74.65  ? 254 LYS O HE2  1 
ATOM   3811  H  HE3  . LYS A  1 254 ? -48.543 -4.231  -97.168  1.00 74.65  ? 254 LYS O HE3  1 
ATOM   3812  H  HZ1  . LYS A  1 254 ? -46.636 -4.665  -98.329  1.00 80.08  ? 254 LYS O HZ1  1 
ATOM   3813  H  HZ2  . LYS A  1 254 ? -46.305 -3.807  -97.210  1.00 80.08  ? 254 LYS O HZ2  1 
ATOM   3814  H  HZ3  . LYS A  1 254 ? -45.990 -5.220  -97.157  1.00 80.08  ? 254 LYS O HZ3  1 
ATOM   3815  N  N    . TYR A  1 255 ? -47.810 -5.211  -90.341  1.00 17.28  ? 255 TYR O N    1 
ATOM   3816  C  CA   . TYR A  1 255 ? -47.892 -5.094  -88.886  1.00 16.04  ? 255 TYR O CA   1 
ATOM   3817  C  C    . TYR A  1 255 ? -49.317 -4.709  -88.472  1.00 13.97  ? 255 TYR O C    1 
ATOM   3818  O  O    . TYR A  1 255 ? -49.827 -5.163  -87.447  1.00 17.88  ? 255 TYR O O    1 
ATOM   3819  C  CB   . TYR A  1 255 ? -46.887 -4.082  -88.375  1.00 17.92  ? 255 TYR O CB   1 
ATOM   3820  C  CG   . TYR A  1 255 ? -46.709 -4.157  -86.885  1.00 17.21  ? 255 TYR O CG   1 
ATOM   3821  C  CD1  . TYR A  1 255 ? -45.978 -5.195  -86.299  1.00 17.79  ? 255 TYR O CD1  1 
ATOM   3822  C  CD2  . TYR A  1 255 ? -47.283 -3.210  -86.059  1.00 19.56  ? 255 TYR O CD2  1 
ATOM   3823  C  CE1  . TYR A  1 255 ? -45.824 -5.274  -84.921  1.00 18.18  ? 255 TYR O CE1  1 
ATOM   3824  C  CE2  . TYR A  1 255 ? -47.130 -3.276  -84.681  1.00 26.10  ? 255 TYR O CE2  1 
ATOM   3825  C  CZ   . TYR A  1 255 ? -46.402 -4.307  -84.122  1.00 16.39  ? 255 TYR O CZ   1 
ATOM   3826  O  OH   . TYR A  1 255 ? -46.252 -4.359  -82.763  1.00 20.46  ? 255 TYR O OH   1 
ATOM   3827  H  H    . TYR A  1 255 ? -47.248 -4.682  -90.719  1.00 20.74  ? 255 TYR O H    1 
ATOM   3828  H  HA   . TYR A  1 255 ? -47.684 -5.953  -88.486  1.00 19.25  ? 255 TYR O HA   1 
ATOM   3829  H  HB2  . TYR A  1 255 ? -46.026 -4.251  -88.790  1.00 21.50  ? 255 TYR O HB2  1 
ATOM   3830  H  HB3  . TYR A  1 255 ? -47.194 -3.189  -88.597  1.00 21.50  ? 255 TYR O HB3  1 
ATOM   3831  H  HD1  . TYR A  1 255 ? -45.590 -5.844  -86.841  1.00 21.34  ? 255 TYR O HD1  1 
ATOM   3832  H  HD2  . TYR A  1 255 ? -47.774 -2.514  -86.433  1.00 23.47  ? 255 TYR O HD2  1 
ATOM   3833  H  HE1  . TYR A  1 255 ? -45.330 -5.964  -84.541  1.00 21.82  ? 255 TYR O HE1  1 
ATOM   3834  H  HE2  . TYR A  1 255 ? -47.517 -2.629  -84.137  1.00 31.32  ? 255 TYR O HE2  1 
ATOM   3835  H  HH   . TYR A  1 255 ? -46.653 -3.714  -82.404  1.00 24.55  ? 255 TYR O HH   1 
ATOM   3836  N  N    . ASP A  1 256 ? -49.974 -3.905  -89.298  1.00 15.89  ? 256 ASP O N    1 
ATOM   3837  C  CA   . ASP A  1 256 ? -51.364 -3.549  -89.037  1.00 21.23  ? 256 ASP O CA   1 
ATOM   3838  C  C    . ASP A  1 256 ? -52.306 -4.756  -89.095  1.00 25.94  ? 256 ASP O C    1 
ATOM   3839  O  O    . ASP A  1 256 ? -53.304 -4.780  -88.369  1.00 18.84  ? 256 ASP O O    1 
ATOM   3840  C  CB   . ASP A  1 256 ? -51.837 -2.476  -90.017  1.00 33.43  ? 256 ASP O CB   1 
ATOM   3841  C  CG   . ASP A  1 256 ? -51.187 -1.122  -89.764  1.00 60.30  ? 256 ASP O CG   1 
ATOM   3842  O  OD1  . ASP A  1 256 ? -50.833 -0.817  -88.601  1.00 63.12  ? 256 ASP O OD1  1 
ATOM   3843  O  OD2  . ASP A  1 256 ? -51.030 -0.356  -90.737  1.00 78.57  ? 256 ASP O OD2  1 
ATOM   3844  H  H    . ASP A  1 256 ? -49.642 -3.555  -90.010  1.00 19.07  ? 256 ASP O H    1 
ATOM   3845  H  HA   . ASP A  1 256 ? -51.423 -3.176  -88.143  1.00 25.48  ? 256 ASP O HA   1 
ATOM   3846  H  HB2  . ASP A  1 256 ? -51.614 -2.752  -90.920  1.00 40.12  ? 256 ASP O HB2  1 
ATOM   3847  H  HB3  . ASP A  1 256 ? -52.797 -2.369  -89.929  1.00 40.12  ? 256 ASP O HB3  1 
ATOM   3848  N  N    . ASP A  1 257 ? -52.010 -5.736  -89.953  1.00 21.65  ? 257 ASP O N    1 
ATOM   3849  C  CA   . ASP A  1 257 ? -52.796 -6.989  -90.002  1.00 19.60  ? 257 ASP O CA   1 
ATOM   3850  C  C    . ASP A  1 257 ? -52.640 -7.762  -88.695  1.00 13.70  ? 257 ASP O C    1 
ATOM   3851  O  O    . ASP A  1 257 ? -53.588 -8.363  -88.181  1.00 18.15  ? 257 ASP O O    1 
ATOM   3852  C  CB   . ASP A  1 257 ? -52.363 -7.919  -91.156  1.00 26.31  ? 257 ASP O CB   1 
ATOM   3853  C  CG   . ASP A  1 257 ? -52.513 -7.291  -92.536  1.00 41.14  ? 257 ASP O CG   1 
ATOM   3854  O  OD1  . ASP A  1 257 ? -53.400 -6.432  -92.700  1.00 31.37  ? 257 ASP O OD1  1 
ATOM   3855  O  OD2  . ASP A  1 257 ? -51.742 -7.679  -93.458  1.00 34.46  ? 257 ASP O OD2  1 
ATOM   3856  H  H    . ASP A  1 257 ? -51.363 -5.707  -90.519  1.00 25.98  ? 257 ASP O H    1 
ATOM   3857  H  HA   . ASP A  1 257 ? -53.735 -6.775  -90.119  1.00 23.52  ? 257 ASP O HA   1 
ATOM   3858  H  HB2  . ASP A  1 257 ? -51.429 -8.153  -91.036  1.00 31.57  ? 257 ASP O HB2  1 
ATOM   3859  H  HB3  . ASP A  1 257 ? -52.908 -8.721  -91.134  1.00 31.57  ? 257 ASP O HB3  1 
ATOM   3860  N  N    . ILE A  1 258 ? -51.422 -7.779  -88.179  1.00 13.07  ? 258 ILE O N    1 
ATOM   3861  C  CA   . ILE A  1 258 ? -51.150 -8.471  -86.934  1.00 13.03  ? 258 ILE O CA   1 
ATOM   3862  C  C    . ILE A  1 258 ? -51.914 -7.800  -85.793  1.00 14.25  ? 258 ILE O C    1 
ATOM   3863  O  O    . ILE A  1 258 ? -52.592 -8.474  -85.001  1.00 13.48  ? 258 ILE O O    1 
ATOM   3864  C  CB   . ILE A  1 258 ? -49.637 -8.497  -86.618  1.00 18.44  ? 258 ILE O CB   1 
ATOM   3865  C  CG1  . ILE A  1 258 ? -48.906 -9.341  -87.668  1.00 15.96  ? 258 ILE O CG1  1 
ATOM   3866  C  CG2  . ILE A  1 258 ? -49.392 -9.085  -85.236  1.00 15.62  ? 258 ILE O CG2  1 
ATOM   3867  C  CD1  . ILE A  1 258 ? -47.392 -9.275  -87.585  1.00 20.67  ? 258 ILE O CD1  1 
ATOM   3868  H  H    . ILE A  1 258 ? -50.736 -7.398  -88.530  1.00 15.69  ? 258 ILE O H    1 
ATOM   3869  H  HA   . ILE A  1 258 ? -51.459 -9.388  -87.005  1.00 15.63  ? 258 ILE O HA   1 
ATOM   3870  H  HB   . ILE A  1 258 ? -49.292 -7.591  -86.643  1.00 22.13  ? 258 ILE O HB   1 
ATOM   3871  H  HG12 . ILE A  1 258 ? -49.166 -10.269 -87.556  1.00 19.15  ? 258 ILE O HG12 1 
ATOM   3872  H  HG13 . ILE A  1 258 ? -49.166 -9.033  -88.550  1.00 19.15  ? 258 ILE O HG13 1 
ATOM   3873  H  HG21 . ILE A  1 258 ? -48.438 -9.091  -85.061  1.00 18.74  ? 258 ILE O HG21 1 
ATOM   3874  H  HG22 . ILE A  1 258 ? -49.847 -8.539  -84.576  1.00 18.74  ? 258 ILE O HG22 1 
ATOM   3875  H  HG23 . ILE A  1 258 ? -49.739 -9.991  -85.213  1.00 18.74  ? 258 ILE O HG23 1 
ATOM   3876  H  HD11 . ILE A  1 258 ? -47.014 -9.834  -88.281  1.00 24.80  ? 258 ILE O HD11 1 
ATOM   3877  H  HD12 . ILE A  1 258 ? -47.110 -8.355  -87.709  1.00 24.80  ? 258 ILE O HD12 1 
ATOM   3878  H  HD13 . ILE A  1 258 ? -47.110 -9.593  -86.713  1.00 24.80  ? 258 ILE O HD13 1 
ATOM   3879  N  N    . LYS A  1 259 ? -51.801 -6.478  -85.704  1.00 12.11  ? 259 LYS O N    1 
ATOM   3880  C  CA   . LYS A  1 259 ? -52.534 -5.728  -84.691  1.00 13.01  ? 259 LYS O CA   1 
ATOM   3881  C  C    . LYS A  1 259 ? -54.032 -6.058  -84.747  1.00 14.84  ? 259 LYS O C    1 
ATOM   3882  O  O    . LYS A  1 259 ? -54.663 -6.272  -83.719  1.00 14.91  ? 259 LYS O O    1 
ATOM   3883  C  CB   . LYS A  1 259 ? -52.319 -4.227  -84.875  1.00 13.26  ? 259 LYS O CB   1 
ATOM   3884  C  CG   . LYS A  1 259 ? -50.970 -3.738  -84.326  1.00 16.21  ? 259 LYS O CG   1 
ATOM   3885  C  CD   . LYS A  1 259 ? -50.614 -2.356  -84.867  1.00 18.52  ? 259 LYS O CD   1 
ATOM   3886  C  CE   . LYS A  1 259 ? -51.697 -1.347  -84.596  1.00 23.34  ? 259 LYS O CE   1 
ATOM   3887  N  NZ   . LYS A  1 259 ? -51.316 -0.011  -85.093  1.00 22.33  ? 259 LYS O NZ   1 
ATOM   3888  H  H    . LYS A  1 259 ? -51.309 -5.993  -86.217  1.00 14.54  ? 259 LYS O H    1 
ATOM   3889  H  HA   . LYS A  1 259 ? -52.203 -5.975  -83.813  1.00 15.62  ? 259 LYS O HA   1 
ATOM   3890  H  HB2  . LYS A  1 259 ? -52.349 -4.018  -85.822  1.00 15.91  ? 259 LYS O HB2  1 
ATOM   3891  H  HB3  . LYS A  1 259 ? -53.022 -3.749  -84.409  1.00 15.91  ? 259 LYS O HB3  1 
ATOM   3892  H  HG2  . LYS A  1 259 ? -51.019 -3.682  -83.359  1.00 19.45  ? 259 LYS O HG2  1 
ATOM   3893  H  HG3  . LYS A  1 259 ? -50.272 -4.357  -84.592  1.00 19.45  ? 259 LYS O HG3  1 
ATOM   3894  H  HD2  . LYS A  1 259 ? -49.799 -2.047  -84.440  1.00 22.23  ? 259 LYS O HD2  1 
ATOM   3895  H  HD3  . LYS A  1 259 ? -50.487 -2.413  -85.827  1.00 22.23  ? 259 LYS O HD3  1 
ATOM   3896  H  HE2  . LYS A  1 259 ? -52.510 -1.620  -85.048  1.00 28.01  ? 259 LYS O HE2  1 
ATOM   3897  H  HE3  . LYS A  1 259 ? -51.846 -1.286  -83.640  1.00 28.01  ? 259 LYS O HE3  1 
ATOM   3898  H  HZ1  . LYS A  1 259 ? -51.175 -0.042  -85.971  1.00 26.80  ? 259 LYS O HZ1  1 
ATOM   3899  H  HZ2  . LYS A  1 259 ? -51.966 0.572   -84.925  1.00 26.80  ? 259 LYS O HZ2  1 
ATOM   3900  H  HZ3  . LYS A  1 259 ? -50.570 0.262   -84.690  1.00 26.80  ? 259 LYS O HZ3  1 
ATOM   3901  N  N    . LYS A  1 260 ? -54.589 -6.096  -85.954  1.00 15.04  ? 260 LYS O N    1 
ATOM   3902  C  CA   . LYS A  1 260 ? -56.013 -6.353  -86.126  1.00 14.11  ? 260 LYS O CA   1 
ATOM   3903  C  C    . LYS A  1 260 ? -56.446 -7.708  -85.549  1.00 19.07  ? 260 LYS O C    1 
ATOM   3904  O  O    . LYS A  1 260 ? -57.435 -7.783  -84.807  1.00 13.55  ? 260 LYS O O    1 
ATOM   3905  C  CB   . LYS A  1 260 ? -56.374 -6.253  -87.614  1.00 19.33  ? 260 LYS O CB   1 
ATOM   3906  C  CG   . LYS A  1 260 ? -57.824 -6.503  -87.925  1.00 36.75  ? 260 LYS O CG   1 
ATOM   3907  C  CD   . LYS A  1 260 ? -58.105 -6.349  -89.415  1.00 53.71  ? 260 LYS O CD   1 
ATOM   3908  C  CE   . LYS A  1 260 ? -59.568 -6.642  -89.728  1.00 65.26  ? 260 LYS O CE   1 
ATOM   3909  N  NZ   . LYS A  1 260 ? -59.867 -6.587  -91.187  1.00 69.76  ? 260 LYS O NZ   1 
ATOM   3910  H  H    . LYS A  1 260 ? -54.161 -5.975  -86.691  1.00 18.04  ? 260 LYS O H    1 
ATOM   3911  H  HA   . LYS A  1 260 ? -56.509 -5.664  -85.657  1.00 16.93  ? 260 LYS O HA   1 
ATOM   3912  H  HB2  . LYS A  1 260 ? -56.156 -5.361  -87.927  1.00 23.19  ? 260 LYS O HB2  1 
ATOM   3913  H  HB3  . LYS A  1 260 ? -55.851 -6.907  -88.104  1.00 23.19  ? 260 LYS O HB3  1 
ATOM   3914  H  HG2  . LYS A  1 260 ? -58.057 -7.407  -87.663  1.00 44.10  ? 260 LYS O HG2  1 
ATOM   3915  H  HG3  . LYS A  1 260 ? -58.370 -5.862  -87.444  1.00 44.10  ? 260 LYS O HG3  1 
ATOM   3916  H  HD2  . LYS A  1 260 ? -57.911 -5.438  -89.687  1.00 64.45  ? 260 LYS O HD2  1 
ATOM   3917  H  HD3  . LYS A  1 260 ? -57.555 -6.974  -89.912  1.00 64.45  ? 260 LYS O HD3  1 
ATOM   3918  H  HE2  . LYS A  1 260 ? -59.788 -7.532  -89.410  1.00 78.31  ? 260 LYS O HE2  1 
ATOM   3919  H  HE3  . LYS A  1 260 ? -60.125 -5.984  -89.282  1.00 78.31  ? 260 LYS O HE3  1 
ATOM   3920  H  HZ1  . LYS A  1 260 ? -60.728 -6.762  -91.328  1.00 83.71  ? 260 LYS O HZ1  1 
ATOM   3921  H  HZ2  . LYS A  1 260 ? -59.682 -5.776  -91.505  1.00 83.71  ? 260 LYS O HZ2  1 
ATOM   3922  H  HZ3  . LYS A  1 260 ? -59.374 -7.187  -91.621  1.00 83.71  ? 260 LYS O HZ3  1 
ATOM   3923  N  N    . VAL A  1 261 ? -55.719 -8.780  -85.856  1.00 15.19  ? 261 VAL O N    1 
ATOM   3924  C  CA   . VAL A  1 261 ? -56.165 -10.100 -85.406  1.00 16.85  ? 261 VAL O CA   1 
ATOM   3925  C  C    . VAL A  1 261 ? -55.891 -10.301 -83.914  1.00 12.19  ? 261 VAL O C    1 
ATOM   3926  O  O    . VAL A  1 261 ? -56.672 -10.968 -83.233  1.00 12.17  ? 261 VAL O O    1 
ATOM   3927  C  CB   . VAL A  1 261 ? -55.529 -11.268 -86.236  1.00 17.25  ? 261 VAL O CB   1 
ATOM   3928  C  CG1  . VAL A  1 261 ? -55.867 -11.112 -87.731  1.00 20.26  ? 261 VAL O CG1  1 
ATOM   3929  C  CG2  . VAL A  1 261 ? -54.052 -11.353 -86.050  1.00 17.61  ? 261 VAL O CG2  1 
ATOM   3930  H  H    . VAL A  1 261 ? -54.987 -8.775  -86.308  1.00 18.23  ? 261 VAL O H    1 
ATOM   3931  H  HA   . VAL A  1 261 ? -57.126 -10.152 -85.530  1.00 20.22  ? 261 VAL O HA   1 
ATOM   3932  H  HB   . VAL A  1 261 ? -55.912 -12.107 -85.935  1.00 20.69  ? 261 VAL O HB   1 
ATOM   3933  H  HG11 . VAL A  1 261 ? -55.464 -11.844 -88.224  1.00 24.31  ? 261 VAL O HG11 1 
ATOM   3934  H  HG12 . VAL A  1 261 ? -56.831 -11.130 -87.840  1.00 24.31  ? 261 VAL O HG12 1 
ATOM   3935  H  HG13 . VAL A  1 261 ? -55.514 -10.266 -88.048  1.00 24.31  ? 261 VAL O HG13 1 
ATOM   3936  H  HG21 . VAL A  1 261 ? -53.709 -12.087 -86.583  1.00 21.13  ? 261 VAL O HG21 1 
ATOM   3937  H  HG22 . VAL A  1 261 ? -53.650 -10.518 -86.339  1.00 21.13  ? 261 VAL O HG22 1 
ATOM   3938  H  HG23 . VAL A  1 261 ? -53.861 -11.506 -85.112  1.00 21.13  ? 261 VAL O HG23 1 
ATOM   3939  N  N    . VAL A  1 262 ? -54.830 -9.692  -83.376  1.00 14.50  ? 262 VAL O N    1 
ATOM   3940  C  CA   . VAL A  1 262 ? -54.610 -9.789  -81.948  1.00 15.61  ? 262 VAL O CA   1 
ATOM   3941  C  C    . VAL A  1 262 ? -55.709 -9.033  -81.188  1.00 14.46  ? 262 VAL O C    1 
ATOM   3942  O  O    . VAL A  1 262 ? -56.256 -9.546  -80.214  1.00 12.69  ? 262 VAL O O    1 
ATOM   3943  C  CB   . VAL A  1 262 ? -53.237 -9.257  -81.537  1.00 11.70  ? 262 VAL O CB   1 
ATOM   3944  C  CG1  . VAL A  1 262 ? -53.131 -9.185  -80.016  1.00 12.15  ? 262 VAL O CG1  1 
ATOM   3945  C  CG2  . VAL A  1 262 ? -52.154 -10.146 -82.086  1.00 15.82  ? 262 VAL O CG2  1 
ATOM   3946  H  H    . VAL A  1 262 ? -54.244 -9.233  -83.807  1.00 17.40  ? 262 VAL O H    1 
ATOM   3947  H  HA   . VAL A  1 262 ? -54.656 -10.722 -81.688  1.00 18.73  ? 262 VAL O HA   1 
ATOM   3948  H  HB   . VAL A  1 262 ? -53.114 -8.364  -81.897  1.00 14.05  ? 262 VAL O HB   1 
ATOM   3949  H  HG11 . VAL A  1 262 ? -52.255 -8.846  -79.776  1.00 14.57  ? 262 VAL O HG11 1 
ATOM   3950  H  HG12 . VAL A  1 262 ? -53.820 -8.591  -79.679  1.00 14.57  ? 262 VAL O HG12 1 
ATOM   3951  H  HG13 . VAL A  1 262 ? -53.253 -10.075 -79.649  1.00 14.57  ? 262 VAL O HG13 1 
ATOM   3952  H  HG21 . VAL A  1 262 ? -51.291 -9.795  -81.817  1.00 18.98  ? 262 VAL O HG21 1 
ATOM   3953  H  HG22 . VAL A  1 262 ? -52.273 -11.042 -81.733  1.00 18.98  ? 262 VAL O HG22 1 
ATOM   3954  H  HG23 . VAL A  1 262 ? -52.219 -10.160 -83.054  1.00 18.98  ? 262 VAL O HG23 1 
ATOM   3955  N  N    . LYS A  1 263 ? -56.025 -7.824  -81.635  1.00 11.60  ? 263 LYS O N    1 
ATOM   3956  C  CA   . LYS A  1 263 ? -57.091 -7.050  -81.008  1.00 11.95  ? 263 LYS O CA   1 
ATOM   3957  C  C    . LYS A  1 263 ? -58.419 -7.789  -81.049  1.00 15.16  ? 263 LYS O C    1 
ATOM   3958  O  O    . LYS A  1 263 ? -59.129 -7.831  -80.059  1.00 12.95  ? 263 LYS O O    1 
ATOM   3959  C  CB   . LYS A  1 263 ? -57.246 -5.692  -81.678  1.00 12.53  ? 263 LYS O CB   1 
ATOM   3960  C  CG   . LYS A  1 263 ? -58.292 -4.805  -81.014  1.00 12.98  ? 263 LYS O CG   1 
ATOM   3961  C  CD   . LYS A  1 263 ? -58.370 -3.418  -81.646  1.00 24.56  ? 263 LYS O CD   1 
ATOM   3962  C  CE   . LYS A  1 263 ? -59.484 -2.575  -81.012  1.00 30.02  ? 263 LYS O CE   1 
ATOM   3963  N  NZ   . LYS A  1 263 ? -59.414 -1.149  -81.436  1.00 45.86  ? 263 LYS O NZ   1 
ATOM   3964  H  H    . LYS A  1 263 ? -55.641 -7.431  -82.297  1.00 13.92  ? 263 LYS O H    1 
ATOM   3965  H  HA   . LYS A  1 263 ? -56.862 -6.898  -80.077  1.00 14.34  ? 263 LYS O HA   1 
ATOM   3966  H  HB2  . LYS A  1 263 ? -56.396 -5.227  -81.645  1.00 15.04  ? 263 LYS O HB2  1 
ATOM   3967  H  HB3  . LYS A  1 263 ? -57.513 -5.827  -82.601  1.00 15.04  ? 263 LYS O HB3  1 
ATOM   3968  H  HG2  . LYS A  1 263 ? -59.162 -5.224  -81.099  1.00 15.58  ? 263 LYS O HG2  1 
ATOM   3969  H  HG3  . LYS A  1 263 ? -58.065 -4.696  -80.077  1.00 15.58  ? 263 LYS O HG3  1 
ATOM   3970  H  HD2  . LYS A  1 263 ? -57.527 -2.958  -81.513  1.00 29.48  ? 263 LYS O HD2  1 
ATOM   3971  H  HD3  . LYS A  1 263 ? -58.559 -3.508  -82.593  1.00 29.48  ? 263 LYS O HD3  1 
ATOM   3972  H  HE2  . LYS A  1 263 ? -60.346 -2.929  -81.283  1.00 36.02  ? 263 LYS O HE2  1 
ATOM   3973  H  HE3  . LYS A  1 263 ? -59.398 -2.608  -80.046  1.00 36.02  ? 263 LYS O HE3  1 
ATOM   3974  H  HZ1  . LYS A  1 263 ? -60.070 -0.686  -81.054  1.00 55.03  ? 263 LYS O HZ1  1 
ATOM   3975  H  HZ2  . LYS A  1 263 ? -58.633 -0.799  -81.194  1.00 55.03  ? 263 LYS O HZ2  1 
ATOM   3976  H  HZ3  . LYS A  1 263 ? -59.495 -1.091  -82.320  1.00 55.03  ? 263 LYS O HZ3  1 
ATOM   3977  N  N    . GLN A  1 264 ? -58.749 -8.371  -82.201  1.00 15.15  ? 264 GLN O N    1 
ATOM   3978  C  CA   . GLN A  1 264 ? -59.983 -9.125  -82.341  1.00 16.75  ? 264 GLN O CA   1 
ATOM   3979  C  C    . GLN A  1 264 ? -60.020 -10.325 -81.374  1.00 15.56  ? 264 GLN O C    1 
ATOM   3980  O  O    . GLN A  1 264 ? -61.046 -10.598 -80.749  1.00 16.73  ? 264 GLN O O    1 
ATOM   3981  C  CB   . GLN A  1 264 ? -60.141 -9.593  -83.791  1.00 18.89  ? 264 GLN O CB   1 
ATOM   3982  C  CG   . GLN A  1 264 ? -61.393 -10.367 -84.096  1.00 46.44  ? 264 GLN O CG   1 
ATOM   3983  C  CD   . GLN A  1 264 ? -61.472 -10.733 -85.571  1.00 72.02  ? 264 GLN O CD   1 
ATOM   3984  O  OE1  . GLN A  1 264 ? -60.666 -10.265 -86.383  1.00 76.00  ? 264 GLN O OE1  1 
ATOM   3985  N  NE2  . GLN A  1 264 ? -62.439 -11.572 -85.924  1.00 77.74  ? 264 GLN O NE2  1 
ATOM   3986  H  H    . GLN A  1 264 ? -58.271 -8.342  -82.915  1.00 18.19  ? 264 GLN O H    1 
ATOM   3987  H  HA   . GLN A  1 264 ? -60.732 -8.547  -82.129  1.00 20.10  ? 264 GLN O HA   1 
ATOM   3988  H  HB2  . GLN A  1 264 ? -60.135 -8.813  -84.367  1.00 22.66  ? 264 GLN O HB2  1 
ATOM   3989  H  HB3  . GLN A  1 264 ? -59.388 -10.163 -84.013  1.00 22.66  ? 264 GLN O HB3  1 
ATOM   3990  H  HG2  . GLN A  1 264 ? -61.398 -11.187 -83.578  1.00 55.73  ? 264 GLN O HG2  1 
ATOM   3991  H  HG3  . GLN A  1 264 ? -62.167 -9.825  -83.875  1.00 55.73  ? 264 GLN O HG3  1 
ATOM   3992  H  HE21 . GLN A  1 264 ? -62.980 -11.879 -85.330  1.00 93.29  ? 264 GLN O HE21 1 
ATOM   3993  H  HE22 . GLN A  1 264 ? -62.524 -11.809 -86.746  1.00 93.29  ? 264 GLN O HE22 1 
ATOM   3994  N  N    . ALA A  1 265 ? -58.911 -11.037 -81.248  1.00 13.55  ? 265 ALA O N    1 
ATOM   3995  C  CA   . ALA A  1 265 ? -58.826 -12.148 -80.285  1.00 13.97  ? 265 ALA O CA   1 
ATOM   3996  C  C    . ALA A  1 265 ? -59.027 -11.701 -78.824  1.00 13.39  ? 265 ALA O C    1 
ATOM   3997  O  O    . ALA A  1 265 ? -59.662 -12.413 -78.022  1.00 16.04  ? 265 ALA O O    1 
ATOM   3998  C  CB   . ALA A  1 265 ? -57.481 -12.858 -80.408  1.00 19.99  ? 265 ALA O CB   1 
ATOM   3999  H  H    . ALA A  1 265 ? -58.192 -10.906 -81.702  1.00 16.26  ? 265 ALA O H    1 
ATOM   4000  H  HA   . ALA A  1 265 ? -59.520 -12.793 -80.493  1.00 16.76  ? 265 ALA O HA   1 
ATOM   4001  H  HB1  . ALA A  1 265 ? -57.447 -13.585 -79.766  1.00 23.99  ? 265 ALA O HB1  1 
ATOM   4002  H  HB2  . ALA A  1 265 ? -57.391 -13.208 -81.309  1.00 23.99  ? 265 ALA O HB2  1 
ATOM   4003  H  HB3  . ALA A  1 265 ? -56.771 -12.223 -80.227  1.00 23.99  ? 265 ALA O HB3  1 
ATOM   4004  N  N    . SER A  1 266 ? -58.460 -10.554 -78.474  1.00 11.34  ? 266 SER O N    1 
ATOM   4005  C  CA   . SER A  1 266 ? -58.558 -10.022 -77.127  1.00 11.06  ? 266 SER O CA   1 
ATOM   4006  C  C    . SER A  1 266 ? -59.967 -9.568  -76.771  1.00 13.06  ? 266 SER O C    1 
ATOM   4007  O  O    . SER A  1 266 ? -60.302 -9.522  -75.595  1.00 14.50  ? 266 SER O O    1 
ATOM   4008  C  CB   . SER A  1 266 ? -57.601 -8.830  -76.919  1.00 11.96  ? 266 SER O CB   1 
ATOM   4009  O  OG   . SER A  1 266 ? -58.145 -7.626  -77.430  1.00 23.58  ? 266 SER O OG   1 
ATOM   4010  H  H    . SER A  1 266 ? -58.006 -10.059 -79.009  1.00 13.61  ? 266 SER O H    1 
ATOM   4011  H  HA   . SER A  1 266 ? -58.305 -10.718 -76.500  1.00 13.27  ? 266 SER O HA   1 
ATOM   4012  H  HB2  . SER A  1 266 ? -57.439 -8.722  -75.969  1.00 14.35  ? 266 SER O HB2  1 
ATOM   4013  H  HB3  . SER A  1 266 ? -56.766 -9.016  -77.377  1.00 14.35  ? 266 SER O HB3  1 
ATOM   4014  H  HG   . SER A  1 266 ? -58.289 -7.703  -78.254  1.00 28.30  ? 266 SER O HG   1 
ATOM   4015  N  N    . GLU A  1 267 ? -60.762 -9.192  -77.771  1.00 13.41  ? 267 GLU O N    1 
ATOM   4016  C  CA   . GLU A  1 267 ? -62.148 -8.761  -77.541  1.00 21.38  ? 267 GLU O CA   1 
ATOM   4017  C  C    . GLU A  1 267 ? -63.140 -9.906  -77.607  1.00 21.56  ? 267 GLU O C    1 
ATOM   4018  O  O    . GLU A  1 267 ? -64.276 -9.770  -77.157  1.00 25.07  ? 267 GLU O O    1 
ATOM   4019  C  CB   . GLU A  1 267 ? -62.547 -7.684  -78.556  1.00 20.99  ? 267 GLU O CB   1 
ATOM   4020  C  CG   . GLU A  1 267 ? -61.794 -6.376  -78.358  1.00 32.97  ? 267 GLU O CG   1 
ATOM   4021  C  CD   . GLU A  1 267 ? -62.175 -5.315  -79.384  1.00 55.51  ? 267 GLU O CD   1 
ATOM   4022  O  OE1  . GLU A  1 267 ? -63.060 -5.582  -80.228  1.00 65.04  ? 267 GLU O OE1  1 
ATOM   4023  O  OE2  . GLU A  1 267 ? -61.584 -4.214  -79.343  1.00 58.84  ? 267 GLU O OE2  1 
ATOM   4024  H  H    . GLU A  1 267 ? -60.525 -9.176  -78.597  1.00 16.09  ? 267 GLU O H    1 
ATOM   4025  H  HA   . GLU A  1 267 ? -62.209 -8.369  -76.656  1.00 25.65  ? 267 GLU O HA   1 
ATOM   4026  H  HB2  . GLU A  1 267 ? -62.355 -8.007  -79.451  1.00 25.19  ? 267 GLU O HB2  1 
ATOM   4027  H  HB3  . GLU A  1 267 ? -63.495 -7.501  -78.466  1.00 25.19  ? 267 GLU O HB3  1 
ATOM   4028  H  HG2  . GLU A  1 267 ? -61.995 -6.027  -77.476  1.00 39.56  ? 267 GLU O HG2  1 
ATOM   4029  H  HG3  . GLU A  1 267 ? -60.842 -6.544  -78.439  1.00 39.56  ? 267 GLU O HG3  1 
ATOM   4030  N  N    . GLY A  1 268 ? -62.709 -11.037 -78.157  1.00 19.01  ? 268 GLY O N    1 
ATOM   4031  C  CA   . GLY A  1 268 ? -63.583 -12.179 -78.358  1.00 19.53  ? 268 GLY O CA   1 
ATOM   4032  C  C    . GLY A  1 268 ? -63.141 -13.399 -77.576  1.00 16.49  ? 268 GLY O C    1 
ATOM   4033  O  O    . GLY A  1 268 ? -63.180 -13.390 -76.343  1.00 21.39  ? 268 GLY O O    1 
ATOM   4034  H  H    . GLY A  1 268 ? -61.902 -11.166 -78.425  1.00 22.82  ? 268 GLY O H    1 
ATOM   4035  H  HA2  . GLY A  1 268 ? -64.483 -11.948 -78.081  1.00 23.43  ? 268 GLY O HA2  1 
ATOM   4036  H  HA3  . GLY A  1 268 ? -63.601 -12.410 -79.300  1.00 23.43  ? 268 GLY O HA3  1 
ATOM   4037  N  N    . PRO A  1 269 ? -62.693 -14.457 -78.275  1.00 21.58  ? 269 PRO O N    1 
ATOM   4038  C  CA   . PRO A  1 269 ? -62.421 -15.746 -77.619  1.00 27.81  ? 269 PRO O CA   1 
ATOM   4039  C  C    . PRO A  1 269 ? -61.301 -15.752 -76.561  1.00 25.01  ? 269 PRO O C    1 
ATOM   4040  O  O    . PRO A  1 269 ? -61.294 -16.619 -75.704  1.00 19.39  ? 269 PRO O O    1 
ATOM   4041  C  CB   . PRO A  1 269 ? -62.035 -16.656 -78.792  1.00 32.14  ? 269 PRO O CB   1 
ATOM   4042  C  CG   . PRO A  1 269 ? -61.611 -15.740 -79.876  1.00 33.29  ? 269 PRO O CG   1 
ATOM   4043  C  CD   . PRO A  1 269 ? -62.469 -14.528 -79.728  1.00 24.11  ? 269 PRO O CD   1 
ATOM   4044  H  HA   . PRO A  1 269 ? -63.234 -16.086 -77.213  1.00 33.38  ? 269 PRO O HA   1 
ATOM   4045  H  HB2  . PRO A  1 269 ? -61.304 -17.236 -78.528  1.00 38.56  ? 269 PRO O HB2  1 
ATOM   4046  H  HB3  . PRO A  1 269 ? -62.806 -17.178 -79.066  1.00 38.56  ? 269 PRO O HB3  1 
ATOM   4047  H  HG2  . PRO A  1 269 ? -60.675 -15.513 -79.763  1.00 39.95  ? 269 PRO O HG2  1 
ATOM   4048  H  HG3  . PRO A  1 269 ? -61.761 -16.162 -80.736  1.00 39.95  ? 269 PRO O HG3  1 
ATOM   4049  H  HD2  . PRO A  1 269 ? -61.998 -13.739 -80.038  1.00 28.94  ? 269 PRO O HD2  1 
ATOM   4050  H  HD3  . PRO A  1 269 ? -63.310 -14.648 -80.196  1.00 28.94  ? 269 PRO O HD3  1 
ATOM   4051  N  N    . LEU A  1 270 ? -60.359 -14.823 -76.612  1.00 18.82  ? 270 LEU O N    1 
ATOM   4052  C  CA   . LEU A  1 270 ? -59.321 -14.798 -75.595  1.00 12.32  ? 270 LEU O CA   1 
ATOM   4053  C  C    . LEU A  1 270 ? -59.495 -13.635 -74.613  1.00 15.72  ? 270 LEU O C    1 
ATOM   4054  O  O    . LEU A  1 270 ? -58.553 -13.232 -73.954  1.00 11.25  ? 270 LEU O O    1 
ATOM   4055  C  CB   . LEU A  1 270 ? -57.949 -14.740 -76.258  1.00 14.26  ? 270 LEU O CB   1 
ATOM   4056  C  CG   . LEU A  1 270 ? -57.552 -16.035 -76.959  1.00 22.02  ? 270 LEU O CG   1 
ATOM   4057  C  CD1  . LEU A  1 270 ? -56.315 -15.815 -77.836  1.00 21.89  ? 270 LEU O CD1  1 
ATOM   4058  C  CD2  . LEU A  1 270 ? -57.297 -17.100 -75.898  1.00 27.87  ? 270 LEU O CD2  1 
ATOM   4059  H  H    . LEU A  1 270 ? -60.298 -14.209 -77.211  1.00 22.59  ? 270 LEU O H    1 
ATOM   4060  H  HA   . LEU A  1 270 ? -59.367 -15.622 -75.086  1.00 14.78  ? 270 LEU O HA   1 
ATOM   4061  H  HB2  . LEU A  1 270 ? -57.952 -14.032 -76.922  1.00 17.11  ? 270 LEU O HB2  1 
ATOM   4062  H  HB3  . LEU A  1 270 ? -57.282 -14.552 -75.580  1.00 17.11  ? 270 LEU O HB3  1 
ATOM   4063  H  HG   . LEU A  1 270 ? -58.281 -16.334 -77.525  1.00 26.42  ? 270 LEU O HG   1 
ATOM   4064  H  HD11 . LEU A  1 270 ? -56.083 -16.651 -78.269  1.00 26.27  ? 270 LEU O HD11 1 
ATOM   4065  H  HD12 . LEU A  1 270 ? -56.517 -15.141 -78.503  1.00 26.27  ? 270 LEU O HD12 1 
ATOM   4066  H  HD13 . LEU A  1 270 ? -55.581 -15.517 -77.276  1.00 26.27  ? 270 LEU O HD13 1 
ATOM   4067  H  HD21 . LEU A  1 270 ? -57.044 -17.927 -76.336  1.00 33.45  ? 270 LEU O HD21 1 
ATOM   4068  H  HD22 . LEU A  1 270 ? -56.580 -16.800 -75.317  1.00 33.45  ? 270 LEU O HD22 1 
ATOM   4069  H  HD23 . LEU A  1 270 ? -58.108 -17.233 -75.383  1.00 33.45  ? 270 LEU O HD23 1 
ATOM   4070  N  N    . LYS A  1 271 ? -60.699 -13.098 -74.513  1.00 13.24  ? 271 LYS O N    1 
ATOM   4071  C  CA   . LYS A  1 271 ? -60.963 -11.989 -73.591  1.00 14.13  ? 271 LYS O CA   1 
ATOM   4072  C  C    . LYS A  1 271 ? -60.583 -12.374 -72.177  1.00 13.09  ? 271 LYS O C    1 
ATOM   4073  O  O    . LYS A  1 271 ? -60.924 -13.459 -71.711  1.00 15.49  ? 271 LYS O O    1 
ATOM   4074  C  CB   . LYS A  1 271 ? -62.440 -11.595 -73.648  1.00 21.58  ? 271 LYS O CB   1 
ATOM   4075  C  CG   . LYS A  1 271 ? -62.791 -10.314 -72.911  1.00 29.29  ? 271 LYS O CG   1 
ATOM   4076  C  CD   . LYS A  1 271 ? -64.296 -10.023 -73.052  1.00 45.05  ? 271 LYS O CD   1 
ATOM   4077  C  CE   . LYS A  1 271 ? -64.705 -8.727  -72.351  1.00 65.87  ? 271 LYS O CE   1 
ATOM   4078  N  NZ   . LYS A  1 271 ? -64.055 -7.523  -72.952  1.00 76.37  ? 271 LYS O NZ   1 
ATOM   4079  H  H    . LYS A  1 271 ? -61.385 -13.353 -74.964  1.00 15.89  ? 271 LYS O H    1 
ATOM   4080  H  HA   . LYS A  1 271 ? -60.431 -11.221 -73.852  1.00 16.96  ? 271 LYS O HA   1 
ATOM   4081  H  HB2  . LYS A  1 271 ? -62.692 -11.477 -74.577  1.00 25.89  ? 271 LYS O HB2  1 
ATOM   4082  H  HB3  . LYS A  1 271 ? -62.965 -12.311 -73.257  1.00 25.89  ? 271 LYS O HB3  1 
ATOM   4083  H  HG2  . LYS A  1 271 ? -62.583 -10.413 -71.969  1.00 35.15  ? 271 LYS O HG2  1 
ATOM   4084  H  HG3  . LYS A  1 271 ? -62.296 -9.573  -73.294  1.00 35.15  ? 271 LYS O HG3  1 
ATOM   4085  H  HD2  . LYS A  1 271 ? -64.516 -9.939  -73.993  1.00 54.06  ? 271 LYS O HD2  1 
ATOM   4086  H  HD3  . LYS A  1 271 ? -64.798 -10.752 -72.656  1.00 54.06  ? 271 LYS O HD3  1 
ATOM   4087  H  HE2  . LYS A  1 271 ? -65.666 -8.618  -72.424  1.00 79.05  ? 271 LYS O HE2  1 
ATOM   4088  H  HE3  . LYS A  1 271 ? -64.445 -8.776  -71.418  1.00 79.05  ? 271 LYS O HE3  1 
ATOM   4089  H  HZ1  . LYS A  1 271 ? -64.315 -6.790  -72.521  1.00 91.65  ? 271 LYS O HZ1  1 
ATOM   4090  H  HZ2  . LYS A  1 271 ? -63.169 -7.595  -72.893  1.00 91.65  ? 271 LYS O HZ2  1 
ATOM   4091  H  HZ3  . LYS A  1 271 ? -64.282 -7.451  -73.810  1.00 91.65  ? 271 LYS O HZ3  1 
ATOM   4092  N  N    . GLY A  1 272 ? -59.850 -11.502 -71.497  1.00 16.98  ? 272 GLY O N    1 
ATOM   4093  C  CA   . GLY A  1 272 ? -59.420 -11.773 -70.138  1.00 16.13  ? 272 GLY O CA   1 
ATOM   4094  C  C    . GLY A  1 272 ? -58.130 -12.568 -70.062  1.00 17.56  ? 272 GLY O C    1 
ATOM   4095  O  O    . GLY A  1 272 ? -57.477 -12.615 -69.019  1.00 16.04  ? 272 GLY O O    1 
ATOM   4096  H  H    . GLY A  1 272 ? -59.589 -10.742 -71.804  1.00 20.38  ? 272 GLY O H    1 
ATOM   4097  H  HA2  . GLY A  1 272 ? -59.288 -10.933 -69.671  1.00 19.35  ? 272 GLY O HA2  1 
ATOM   4098  H  HA3  . GLY A  1 272 ? -60.112 -12.272 -69.677  1.00 19.35  ? 272 GLY O HA3  1 
ATOM   4099  N  N    . ILE A  1 273 ? -57.759 -13.190 -71.174  1.00 17.85  ? 273 ILE O N    1 
ATOM   4100  C  CA   . ILE A  1 273 ? -56.522 -13.960 -71.249  1.00 12.22  ? 273 ILE O CA   1 
ATOM   4101  C  C    . ILE A  1 273 ? -55.470 -13.197 -72.040  1.00 10.76  ? 273 ILE O C    1 
ATOM   4102  O  O    . ILE A  1 273 ? -54.383 -12.912 -71.525  1.00 11.91  ? 273 ILE O O    1 
ATOM   4103  C  CB   . ILE A  1 273 ? -56.774 -15.335 -71.890  1.00 13.11  ? 273 ILE O CB   1 
ATOM   4104  C  CG1  . ILE A  1 273 ? -57.719 -16.130 -70.982  1.00 16.33  ? 273 ILE O CG1  1 
ATOM   4105  C  CG2  . ILE A  1 273 ? -55.455 -16.071 -72.100  1.00 11.75  ? 273 ILE O CG2  1 
ATOM   4106  C  CD1  . ILE A  1 273 ? -58.095 -17.462 -71.492  1.00 27.46  ? 273 ILE O CD1  1 
ATOM   4107  H  H    . ILE A  1 273 ? -58.210 -13.182 -71.907  1.00 21.42  ? 273 ILE O H    1 
ATOM   4108  H  HA   . ILE A  1 273 ? -56.181 -14.103 -70.352  1.00 14.67  ? 273 ILE O HA   1 
ATOM   4109  H  HB   . ILE A  1 273 ? -57.201 -15.206 -72.751  1.00 15.73  ? 273 ILE O HB   1 
ATOM   4110  H  HG12 . ILE A  1 273 ? -57.288 -16.256 -70.122  1.00 19.59  ? 273 ILE O HG12 1 
ATOM   4111  H  HG13 . ILE A  1 273 ? -58.536 -15.620 -70.864  1.00 19.59  ? 273 ILE O HG13 1 
ATOM   4112  H  HG21 . ILE A  1 273 ? -55.636 -16.934 -72.504  1.00 14.10  ? 273 ILE O HG21 1 
ATOM   4113  H  HG22 . ILE A  1 273 ? -54.889 -15.543 -72.685  1.00 14.10  ? 273 ILE O HG22 1 
ATOM   4114  H  HG23 . ILE A  1 273 ? -55.022 -16.192 -71.240  1.00 14.10  ? 273 ILE O HG23 1 
ATOM   4115  H  HD11 . ILE A  1 273 ? -58.690 -17.887 -70.855  1.00 32.95  ? 273 ILE O HD11 1 
ATOM   4116  H  HD12 . ILE A  1 273 ? -58.543 -17.357 -72.346  1.00 32.95  ? 273 ILE O HD12 1 
ATOM   4117  H  HD13 . ILE A  1 273 ? -57.292 -17.995 -71.602  1.00 32.95  ? 273 ILE O HD13 1 
ATOM   4118  N  N    . LEU A  1 274 ? -55.796 -12.875 -73.286  1.00 9.73   ? 274 LEU O N    1 
ATOM   4119  C  CA   . LEU A  1 274 ? -54.924 -12.052 -74.120  1.00 11.10  ? 274 LEU O CA   1 
ATOM   4120  C  C    . LEU A  1 274 ? -55.457 -10.626 -74.191  1.00 10.38  ? 274 LEU O C    1 
ATOM   4121  O  O    . LEU A  1 274 ? -56.581 -10.405 -74.604  1.00 14.58  ? 274 LEU O O    1 
ATOM   4122  C  CB   . LEU A  1 274 ? -54.816 -12.629 -75.521  1.00 12.79  ? 274 LEU O CB   1 
ATOM   4123  C  CG   . LEU A  1 274 ? -53.968 -11.838 -76.523  1.00 18.52  ? 274 LEU O CG   1 
ATOM   4124  C  CD1  . LEU A  1 274 ? -52.506 -11.750 -76.089  1.00 17.12  ? 274 LEU O CD1  1 
ATOM   4125  C  CD2  . LEU A  1 274 ? -54.086 -12.491 -77.896  1.00 21.48  ? 274 LEU O CD2  1 
ATOM   4126  H  H    . LEU A  1 274 ? -56.521 -13.121 -73.676  1.00 11.68  ? 274 LEU O H    1 
ATOM   4127  H  HA   . LEU A  1 274 ? -54.036 -12.027 -73.731  1.00 13.32  ? 274 LEU O HA   1 
ATOM   4128  H  HB2  . LEU A  1 274 ? -54.429 -13.516 -75.455  1.00 15.34  ? 274 LEU O HB2  1 
ATOM   4129  H  HB3  . LEU A  1 274 ? -55.710 -12.696 -75.891  1.00 15.34  ? 274 LEU O HB3  1 
ATOM   4130  H  HG   . LEU A  1 274 ? -54.317 -10.935 -76.589  1.00 22.22  ? 274 LEU O HG   1 
ATOM   4131  H  HD11 . LEU A  1 274 ? -52.011 -11.242 -76.751  1.00 20.55  ? 274 LEU O HD11 1 
ATOM   4132  H  HD12 . LEU A  1 274 ? -52.459 -11.306 -75.228  1.00 20.55  ? 274 LEU O HD12 1 
ATOM   4133  H  HD13 . LEU A  1 274 ? -52.143 -12.647 -76.020  1.00 20.55  ? 274 LEU O HD13 1 
ATOM   4134  H  HD21 . LEU A  1 274 ? -53.549 -11.990 -78.531  1.00 25.78  ? 274 LEU O HD21 1 
ATOM   4135  H  HD22 . LEU A  1 274 ? -53.765 -13.405 -77.839  1.00 25.78  ? 274 LEU O HD22 1 
ATOM   4136  H  HD23 . LEU A  1 274 ? -55.016 -12.483 -78.171  1.00 25.78  ? 274 LEU O HD23 1 
ATOM   4137  N  N    . GLY A  1 275 ? -54.652 -9.680  -73.745  1.00 11.89  ? 275 GLY O N    1 
ATOM   4138  C  CA   . GLY A  1 275 ? -54.981 -8.270  -73.829  1.00 9.09   ? 275 GLY O CA   1 
ATOM   4139  C  C    . GLY A  1 275 ? -54.298 -7.611  -75.014  1.00 10.84  ? 275 GLY O C    1 
ATOM   4140  O  O    . GLY A  1 275 ? -53.403 -8.184  -75.640  1.00 10.90  ? 275 GLY O O    1 
ATOM   4141  H  H    . GLY A  1 275 ? -53.888 -9.833  -73.381  1.00 14.26  ? 275 GLY O H    1 
ATOM   4142  H  HA2  . GLY A  1 275 ? -55.940 -8.164  -73.924  1.00 10.91  ? 275 GLY O HA2  1 
ATOM   4143  H  HA3  . GLY A  1 275 ? -54.698 -7.820  -73.018  1.00 10.91  ? 275 GLY O HA3  1 
ATOM   4144  N  N    . TYR A  1 276 ? -54.735 -6.403  -75.324  1.00 10.65  ? 276 TYR O N    1 
ATOM   4145  C  CA   . TYR A  1 276 ? -54.217 -5.634  -76.452  1.00 10.97  ? 276 TYR O CA   1 
ATOM   4146  C  C    . TYR A  1 276 ? -54.155 -4.175  -76.053  1.00 12.45  ? 276 TYR O C    1 
ATOM   4147  O  O    . TYR A  1 276 ? -55.142 -3.625  -75.575  1.00 13.35  ? 276 TYR O O    1 
ATOM   4148  C  CB   . TYR A  1 276 ? -55.102 -5.804  -77.690  1.00 13.46  ? 276 TYR O CB   1 
ATOM   4149  C  CG   . TYR A  1 276 ? -54.726 -4.918  -78.864  1.00 12.34  ? 276 TYR O CG   1 
ATOM   4150  C  CD1  . TYR A  1 276 ? -55.282 -3.651  -79.024  1.00 11.25  ? 276 TYR O CD1  1 
ATOM   4151  C  CD2  . TYR A  1 276 ? -53.825 -5.358  -79.815  1.00 13.20  ? 276 TYR O CD2  1 
ATOM   4152  C  CE1  . TYR A  1 276 ? -54.912 -2.843  -80.094  1.00 12.22  ? 276 TYR O CE1  1 
ATOM   4153  C  CE2  . TYR A  1 276 ? -53.453 -4.577  -80.870  1.00 11.98  ? 276 TYR O CE2  1 
ATOM   4154  C  CZ   . TYR A  1 276 ? -54.003 -3.322  -81.020  1.00 12.90  ? 276 TYR O CZ   1 
ATOM   4155  O  OH   . TYR A  1 276 ? -53.612 -2.562  -82.091  1.00 17.69  ? 276 TYR O OH   1 
ATOM   4156  H  H    . TYR A  1 276 ? -55.349 -5.991  -74.885  1.00 12.78  ? 276 TYR O H    1 
ATOM   4157  H  HA   . TYR A  1 276 ? -53.320 -5.935  -76.667  1.00 13.16  ? 276 TYR O HA   1 
ATOM   4158  H  HB2  . TYR A  1 276 ? -55.044 -6.726  -77.987  1.00 16.15  ? 276 TYR O HB2  1 
ATOM   4159  H  HB3  . TYR A  1 276 ? -56.018 -5.597  -77.446  1.00 16.15  ? 276 TYR O HB3  1 
ATOM   4160  H  HD1  . TYR A  1 276 ? -55.888 -3.332  -78.395  1.00 13.51  ? 276 TYR O HD1  1 
ATOM   4161  H  HD2  . TYR A  1 276 ? -53.444 -6.201  -79.720  1.00 15.85  ? 276 TYR O HD2  1 
ATOM   4162  H  HE1  . TYR A  1 276 ? -55.284 -1.996  -80.194  1.00 14.67  ? 276 TYR O HE1  1 
ATOM   4163  H  HE2  . TYR A  1 276 ? -52.842 -4.896  -81.494  1.00 14.37  ? 276 TYR O HE2  1 
ATOM   4164  H  HH   . TYR A  1 276 ? -54.000 -1.817  -82.072  1.00 21.23  ? 276 TYR O HH   1 
ATOM   4165  N  N    . THR A  1 277 ? -53.015 -3.529  -76.261  1.00 10.23  ? 277 THR O N    1 
ATOM   4166  C  CA   . THR A  1 277 ? -52.954 -2.092  -76.039  1.00 12.85  ? 277 THR O CA   1 
ATOM   4167  C  C    . THR A  1 277 ? -52.119 -1.358  -77.083  1.00 14.17  ? 277 THR O C    1 
ATOM   4168  O  O    . THR A  1 277 ? -51.199 -1.916  -77.664  1.00 13.48  ? 277 THR O O    1 
ATOM   4169  C  CB   . THR A  1 277 ? -52.392 -1.771  -74.634  1.00 14.31  ? 277 THR O CB   1 
ATOM   4170  O  OG1  . THR A  1 277 ? -52.538 -0.368  -74.382  1.00 14.80  ? 277 THR O OG1  1 
ATOM   4171  C  CG2  . THR A  1 277 ? -50.931 -2.144  -74.529  1.00 12.41  ? 277 THR O CG2  1 
ATOM   4172  H  H    . THR A  1 277 ? -52.280 -3.888  -76.524  1.00 12.28  ? 277 THR O H    1 
ATOM   4173  H  HA   . THR A  1 277 ? -53.855 -1.736  -76.082  1.00 15.42  ? 277 THR O HA   1 
ATOM   4174  H  HB   . THR A  1 277 ? -52.886 -2.273  -73.967  1.00 17.17  ? 277 THR O HB   1 
ATOM   4175  H  HG1  . THR A  1 277 ? -52.236 -0.180  -73.621  1.00 17.76  ? 277 THR O HG1  1 
ATOM   4176  H  HG21 . THR A  1 277 ? -50.599 -1.935  -73.642  1.00 14.89  ? 277 THR O HG21 1 
ATOM   4177  H  HG22 . THR A  1 277 ? -50.819 -3.094  -74.692  1.00 14.89  ? 277 THR O HG22 1 
ATOM   4178  H  HG23 . THR A  1 277 ? -50.415 -1.649  -75.184  1.00 14.89  ? 277 THR O HG23 1 
ATOM   4179  N  N    . GLU A  1 278 ? -52.476 -0.097  -77.308  1.00 12.18  ? 278 GLU O N    1 
ATOM   4180  C  CA   . GLU A  1 278 ? -51.686 0.831   -78.093  1.00 14.98  ? 278 GLU O CA   1 
ATOM   4181  C  C    . GLU A  1 278 ? -51.174 1.950   -77.198  1.00 15.07  ? 278 GLU O C    1 
ATOM   4182  O  O    . GLU A  1 278 ? -50.547 2.878   -77.682  1.00 12.25  ? 278 GLU O O    1 
ATOM   4183  C  CB   . GLU A  1 278 ? -52.518 1.415   -79.264  1.00 18.14  ? 278 GLU O CB   1 
ATOM   4184  C  CG   . GLU A  1 278 ? -52.912 0.320   -80.266  1.00 19.91  ? 278 GLU O CG   1 
ATOM   4185  C  CD   . GLU A  1 278 ? -53.874 0.780   -81.343  1.00 27.03  ? 278 GLU O CD   1 
ATOM   4186  O  OE1  . GLU A  1 278 ? -54.226 1.972   -81.364  1.00 24.24  ? 278 GLU O OE1  1 
ATOM   4187  O  OE2  . GLU A  1 278 ? -54.281 -0.063  -82.166  1.00 20.21  ? 278 GLU O OE2  1 
ATOM   4188  H  H    . GLU A  1 278 ? -53.200 0.252   -77.001  1.00 14.61  ? 278 GLU O H    1 
ATOM   4189  H  HA   . GLU A  1 278 ? -50.921 0.365   -78.465  1.00 17.98  ? 278 GLU O HA   1 
ATOM   4190  H  HB2  . GLU A  1 278 ? -53.330 1.814   -78.914  1.00 21.76  ? 278 GLU O HB2  1 
ATOM   4191  H  HB3  . GLU A  1 278 ? -51.990 2.081   -79.732  1.00 21.76  ? 278 GLU O HB3  1 
ATOM   4192  H  HG2  . GLU A  1 278 ? -52.109 -0.003  -80.705  1.00 23.89  ? 278 GLU O HG2  1 
ATOM   4193  H  HG3  . GLU A  1 278 ? -53.335 -0.406  -79.782  1.00 23.89  ? 278 GLU O HG3  1 
ATOM   4194  N  N    . HIS A  1 279 ? -51.432 1.882   -75.895  1.00 11.68  ? 279 HIS O N    1 
ATOM   4195  C  CA   . HIS A  1 279 ? -50.957 2.964   -75.019  1.00 12.92  ? 279 HIS O CA   1 
ATOM   4196  C  C    . HIS A  1 279 ? -49.433 2.891   -74.801  1.00 15.11  ? 279 HIS O C    1 
ATOM   4197  O  O    . HIS A  1 279 ? -48.823 1.854   -75.032  1.00 14.44  ? 279 HIS O O    1 
ATOM   4198  C  CB   . HIS A  1 279 ? -51.673 2.910   -73.679  1.00 14.25  ? 279 HIS O CB   1 
ATOM   4199  C  CG   . HIS A  1 279 ? -53.133 3.225   -73.769  1.00 23.90  ? 279 HIS O CG   1 
ATOM   4200  N  ND1  . HIS A  1 279 ? -53.637 4.166   -74.639  1.00 43.53  ? 279 HIS O ND1  1 
ATOM   4201  C  CD2  . HIS A  1 279 ? -54.199 2.707   -73.116  1.00 44.21  ? 279 HIS O CD2  1 
ATOM   4202  C  CE1  . HIS A  1 279 ? -54.951 4.225   -74.509  1.00 40.74  ? 279 HIS O CE1  1 
ATOM   4203  N  NE2  . HIS A  1 279 ? -55.318 3.346   -73.596  1.00 38.88  ? 279 HIS O NE2  1 
ATOM   4204  H  H    . HIS A  1 279 ? -51.862 1.250   -75.501  1.00 14.02  ? 279 HIS O H    1 
ATOM   4205  H  HA   . HIS A  1 279 ? -51.160 3.817   -75.434  1.00 15.51  ? 279 HIS O HA   1 
ATOM   4206  H  HB2  . HIS A  1 279 ? -51.584 2.017   -73.311  1.00 17.10  ? 279 HIS O HB2  1 
ATOM   4207  H  HB3  . HIS A  1 279 ? -51.266 3.555   -73.080  1.00 17.10  ? 279 HIS O HB3  1 
ATOM   4208  H  HD2  . HIS A  1 279 ? -54.179 2.044   -72.464  1.00 53.05  ? 279 HIS O HD2  1 
ATOM   4209  H  HE1  . HIS A  1 279 ? -55.521 4.785   -74.985  1.00 48.88  ? 279 HIS O HE1  1 
ATOM   4210  N  N    . GLN A  1 280 ? -48.844 3.985   -74.319  1.00 10.74  ? 280 GLN O N    1 
ATOM   4211  C  CA   . GLN A  1 280 ? -47.405 4.063   -74.106  1.00 10.43  ? 280 GLN O CA   1 
ATOM   4212  C  C    . GLN A  1 280 ? -47.037 3.490   -72.742  1.00 9.84   ? 280 GLN O C    1 
ATOM   4213  O  O    . GLN A  1 280 ? -46.645 4.216   -71.826  1.00 10.76  ? 280 GLN O O    1 
ATOM   4214  C  CB   . GLN A  1 280 ? -46.915 5.509   -74.222  1.00 11.97  ? 280 GLN O CB   1 
ATOM   4215  C  CG   . GLN A  1 280 ? -47.185 6.153   -75.568  1.00 20.12  ? 280 GLN O CG   1 
ATOM   4216  C  CD   . GLN A  1 280 ? -46.413 5.499   -76.682  1.00 37.54  ? 280 GLN O CD   1 
ATOM   4217  O  OE1  . GLN A  1 280 ? -45.194 5.290   -76.584  1.00 37.36  ? 280 GLN O OE1  1 
ATOM   4218  N  NE2  . GLN A  1 280 ? -47.116 5.154   -77.751  1.00 49.72  ? 280 GLN O NE2  1 
ATOM   4219  H  H    . GLN A  1 280 ? -49.265 4.704   -74.107  1.00 12.89  ? 280 GLN O H    1 
ATOM   4220  H  HA   . GLN A  1 280 ? -46.954 3.538   -74.785  1.00 12.52  ? 280 GLN O HA   1 
ATOM   4221  H  HB2  . GLN A  1 280 ? -47.360 6.043   -73.545  1.00 14.36  ? 280 GLN O HB2  1 
ATOM   4222  H  HB3  . GLN A  1 280 ? -45.957 5.526   -74.074  1.00 14.36  ? 280 GLN O HB3  1 
ATOM   4223  H  HG2  . GLN A  1 280 ? -48.131 6.077   -75.772  1.00 24.14  ? 280 GLN O HG2  1 
ATOM   4224  H  HG3  . GLN A  1 280 ? -46.927 7.087   -75.530  1.00 24.14  ? 280 GLN O HG3  1 
ATOM   4225  H  HE21 . GLN A  1 280 ? -47.962 5.308   -77.778  1.00 59.66  ? 280 GLN O HE21 1 
ATOM   4226  H  HE22 . GLN A  1 280 ? -46.727 4.777   -78.419  1.00 59.66  ? 280 GLN O HE22 1 
ATOM   4227  N  N    . VAL A  1 281 ? -47.177 2.179   -72.628  1.00 9.37   ? 281 VAL O N    1 
ATOM   4228  C  CA   . VAL A  1 281 ? -47.077 1.489   -71.355  1.00 11.31  ? 281 VAL O CA   1 
ATOM   4229  C  C    . VAL A  1 281 ? -45.645 1.162   -70.954  1.00 10.01  ? 281 VAL O C    1 
ATOM   4230  O  O    . VAL A  1 281 ? -44.759 1.048   -71.787  1.00 8.92   ? 281 VAL O O    1 
ATOM   4231  C  CB   . VAL A  1 281 ? -47.890 0.170   -71.377  1.00 10.05  ? 281 VAL O CB   1 
ATOM   4232  C  CG1  . VAL A  1 281 ? -49.365 0.462   -71.557  1.00 16.18  ? 281 VAL O CG1  1 
ATOM   4233  C  CG2  . VAL A  1 281 ? -47.400 -0.783  -72.463  1.00 12.62  ? 281 VAL O CG2  1 
ATOM   4234  H  H    . VAL A  1 281 ? -47.335 1.654   -73.291  1.00 11.24  ? 281 VAL O H    1 
ATOM   4235  H  HA   . VAL A  1 281 ? -47.454 2.057   -70.664  1.00 13.57  ? 281 VAL O HA   1 
ATOM   4236  H  HB   . VAL A  1 281 ? -47.781 -0.276  -70.523  1.00 12.06  ? 281 VAL O HB   1 
ATOM   4237  H  HG11 . VAL A  1 281 ? -49.853 -0.376  -71.568  1.00 19.42  ? 281 VAL O HG11 1 
ATOM   4238  H  HG12 . VAL A  1 281 ? -49.670 1.013   -70.819  1.00 19.42  ? 281 VAL O HG12 1 
ATOM   4239  H  HG13 . VAL A  1 281 ? -49.493 0.932   -72.396  1.00 19.42  ? 281 VAL O HG13 1 
ATOM   4240  H  HG21 . VAL A  1 281 ? -47.936 -1.591  -72.439  1.00 15.15  ? 281 VAL O HG21 1 
ATOM   4241  H  HG22 . VAL A  1 281 ? -47.491 -0.351  -73.326  1.00 15.15  ? 281 VAL O HG22 1 
ATOM   4242  H  HG23 . VAL A  1 281 ? -46.469 -0.998  -72.296  1.00 15.15  ? 281 VAL O HG23 1 
ATOM   4243  N  N    . VAL A  1 282 ? -45.453 1.035   -69.652  1.00 8.19   ? 282 VAL O N    1 
ATOM   4244  C  CA   . VAL A  1 282 ? -44.234 0.522   -69.063  1.00 10.54  ? 282 VAL O CA   1 
ATOM   4245  C  C    . VAL A  1 282 ? -44.635 -0.577  -68.083  1.00 11.38  ? 282 VAL O C    1 
ATOM   4246  O  O    . VAL A  1 282 ? -45.842 -0.813  -67.866  1.00 7.49   ? 282 VAL O O    1 
ATOM   4247  C  CB   . VAL A  1 282 ? -43.449 1.637   -68.374  1.00 8.11   ? 282 VAL O CB   1 
ATOM   4248  C  CG1  . VAL A  1 282 ? -42.959 2.637   -69.420  1.00 8.56   ? 282 VAL O CG1  1 
ATOM   4249  C  CG2  . VAL A  1 282 ? -44.326 2.341   -67.325  1.00 8.39   ? 282 VAL O CG2  1 
ATOM   4250  H  H    . VAL A  1 282 ? -46.044 1.251   -69.066  1.00 9.83   ? 282 VAL O H    1 
ATOM   4251  H  HA   . VAL A  1 282 ? -43.677 0.132   -69.755  1.00 12.64  ? 282 VAL O HA   1 
ATOM   4252  H  HB   . VAL A  1 282 ? -42.676 1.259   -67.924  1.00 9.74   ? 282 VAL O HB   1 
ATOM   4253  H  HG11 . VAL A  1 282 ? -42.462 3.341   -68.976  1.00 10.27  ? 282 VAL O HG11 1 
ATOM   4254  H  HG12 . VAL A  1 282 ? -42.386 2.176   -70.053  1.00 10.27  ? 282 VAL O HG12 1 
ATOM   4255  H  HG13 . VAL A  1 282 ? -43.726 3.013   -69.881  1.00 10.27  ? 282 VAL O HG13 1 
ATOM   4256  H  HG21 . VAL A  1 282 ? -43.809 3.044   -66.901  1.00 10.07  ? 282 VAL O HG21 1 
ATOM   4257  H  HG22 . VAL A  1 282 ? -45.102 2.722   -67.767  1.00 10.07  ? 282 VAL O HG22 1 
ATOM   4258  H  HG23 . VAL A  1 282 ? -44.608 1.692   -66.662  1.00 10.07  ? 282 VAL O HG23 1 
ATOM   4259  N  N    . SER A  1 283 ? -43.662 -1.255  -67.482  1.00 7.43   ? 283 SER O N    1 
ATOM   4260  C  CA   . SER A  1 283 ? -43.994 -2.494  -66.780  1.00 9.34   ? 283 SER O CA   1 
ATOM   4261  C  C    . SER A  1 283 ? -44.930 -2.259  -65.589  1.00 10.04  ? 283 SER O C    1 
ATOM   4262  O  O    . SER A  1 283 ? -45.836 -3.059  -65.362  1.00 8.47   ? 283 SER O O    1 
ATOM   4263  C  CB   . SER A  1 283 ? -42.726 -3.225  -66.325  1.00 8.90   ? 283 SER O CB   1 
ATOM   4264  O  OG   . SER A  1 283 ? -41.976 -2.424  -65.457  1.00 9.01   ? 283 SER O OG   1 
ATOM   4265  H  H    . SER A  1 283 ? -42.832 -1.031  -67.463  1.00 8.91   ? 283 SER O H    1 
ATOM   4266  H  HA   . SER A  1 283 ? -44.458 -3.080  -67.399  1.00 11.21  ? 283 SER O HA   1 
ATOM   4267  H  HB2  . SER A  1 283 ? -42.979 -4.040  -65.864  1.00 10.68  ? 283 SER O HB2  1 
ATOM   4268  H  HB3  . SER A  1 283 ? -42.188 -3.437  -67.103  1.00 10.68  ? 283 SER O HB3  1 
ATOM   4269  H  HG   . SER A  1 283 ? -41.284 -2.834  -65.214  1.00 10.81  ? 283 SER O HG   1 
ATOM   4270  N  N    . SER A  1 284 ? -44.775 -1.147  -64.869  1.00 7.24   ? 284 SER O N    1 
ATOM   4271  C  CA   . SER A  1 284 ? -45.594 -0.931  -63.680  1.00 13.61  ? 284 SER O CA   1 
ATOM   4272  C  C    . SER A  1 284 ? -47.086 -0.780  -64.020  1.00 15.51  ? 284 SER O C    1 
ATOM   4273  O  O    . SER A  1 284 ? -47.928 -0.988  -63.157  1.00 9.60   ? 284 SER O O    1 
ATOM   4274  C  CB   . SER A  1 284 ? -45.119 0.303   -62.905  1.00 13.02  ? 284 SER O CB   1 
ATOM   4275  O  OG   . SER A  1 284 ? -45.237 1.474   -63.701  1.00 17.15  ? 284 SER O OG   1 
ATOM   4276  H  H    . SER A  1 284 ? -44.216 -0.517  -65.044  1.00 8.68   ? 284 SER O H    1 
ATOM   4277  H  HA   . SER A  1 284 ? -45.501 -1.699  -63.096  1.00 16.33  ? 284 SER O HA   1 
ATOM   4278  H  HB2  . SER A  1 284 ? -45.664 0.406   -62.109  1.00 15.62  ? 284 SER O HB2  1 
ATOM   4279  H  HB3  . SER A  1 284 ? -44.189 0.182   -62.657  1.00 15.62  ? 284 SER O HB3  1 
ATOM   4280  H  HG   . SER A  1 284 ? -44.974 2.144   -63.268  1.00 20.58  ? 284 SER O HG   1 
ATOM   4281  N  N    . ASP A  1 285 ? -47.410 -0.444  -65.270  1.00 7.80   ? 285 ASP O N    1 
ATOM   4282  C  CA   . ASP A  1 285 ? -48.800 -0.329  -65.695  1.00 8.11   ? 285 ASP O CA   1 
ATOM   4283  C  C    . ASP A  1 285 ? -49.519 -1.678  -65.689  1.00 8.70   ? 285 ASP O C    1 
ATOM   4284  O  O    . ASP A  1 285 ? -50.738 -1.728  -65.763  1.00 8.58   ? 285 ASP O O    1 
ATOM   4285  C  CB   . ASP A  1 285 ? -48.870 0.328   -67.072  1.00 8.37   ? 285 ASP O CB   1 
ATOM   4286  C  CG   . ASP A  1 285 ? -48.345 1.779   -67.056  1.00 15.42  ? 285 ASP O CG   1 
ATOM   4287  O  OD1  . ASP A  1 285 ? -48.471 2.472   -66.013  1.00 13.00  ? 285 ASP O OD1  1 
ATOM   4288  O  OD2  . ASP A  1 285 ? -47.790 2.224   -68.074  1.00 14.37  ? 285 ASP O OD2  1 
ATOM   4289  H  H    . ASP A  1 285 ? -46.839 -0.278  -65.891  1.00 9.36   ? 285 ASP O H    1 
ATOM   4290  H  HA   . ASP A  1 285 ? -49.265 0.251   -65.072  1.00 9.74   ? 285 ASP O HA   1 
ATOM   4291  H  HB2  . ASP A  1 285 ? -48.328 -0.182  -67.695  1.00 10.04  ? 285 ASP O HB2  1 
ATOM   4292  H  HB3  . ASP A  1 285 ? -49.793 0.344   -67.369  1.00 10.04  ? 285 ASP O HB3  1 
ATOM   4293  N  N    . PHE A  1 286 ? -48.759 -2.763  -65.563  1.00 7.42   ? 286 PHE O N    1 
ATOM   4294  C  CA   . PHE A  1 286 ? -49.327 -4.100  -65.536  1.00 7.24   ? 286 PHE O CA   1 
ATOM   4295  C  C    . PHE A  1 286 ? -49.284 -4.736  -64.161  1.00 7.15   ? 286 PHE O C    1 
ATOM   4296  O  O    . PHE A  1 286 ? -49.597 -5.910  -64.011  1.00 7.19   ? 286 PHE O O    1 
ATOM   4297  C  CB   . PHE A  1 286 ? -48.612 -4.987  -66.546  1.00 6.91   ? 286 PHE O CB   1 
ATOM   4298  C  CG   . PHE A  1 286 ? -48.821 -4.533  -67.945  1.00 7.99   ? 286 PHE O CG   1 
ATOM   4299  C  CD1  . PHE A  1 286 ? -49.995 -4.834  -68.616  1.00 7.89   ? 286 PHE O CD1  1 
ATOM   4300  C  CD2  . PHE A  1 286 ? -47.867 -3.763  -68.584  1.00 7.08   ? 286 PHE O CD2  1 
ATOM   4301  C  CE1  . PHE A  1 286 ? -50.206 -4.366  -69.900  1.00 13.18  ? 286 PHE O CE1  1 
ATOM   4302  C  CE2  . PHE A  1 286 ? -48.076 -3.297  -69.861  1.00 11.41  ? 286 PHE O CE2  1 
ATOM   4303  C  CZ   . PHE A  1 286 ? -49.243 -3.595  -70.522  1.00 11.44  ? 286 PHE O CZ   1 
ATOM   4304  H  H    . PHE A  1 286 ? -47.902 -2.747  -65.491  1.00 8.90   ? 286 PHE O H    1 
ATOM   4305  H  HA   . PHE A  1 286 ? -50.258 -4.044  -65.802  1.00 8.68   ? 286 PHE O HA   1 
ATOM   4306  H  HB2  . PHE A  1 286 ? -47.660 -4.972  -66.364  1.00 8.29   ? 286 PHE O HB2  1 
ATOM   4307  H  HB3  . PHE A  1 286 ? -48.952 -5.892  -66.470  1.00 8.29   ? 286 PHE O HB3  1 
ATOM   4308  H  HD1  . PHE A  1 286 ? -50.652 -5.340  -68.194  1.00 9.47   ? 286 PHE O HD1  1 
ATOM   4309  H  HD2  . PHE A  1 286 ? -47.081 -3.543  -68.138  1.00 8.50   ? 286 PHE O HD2  1 
ATOM   4310  H  HE1  . PHE A  1 286 ? -50.993 -4.576  -70.348  1.00 15.82  ? 286 PHE O HE1  1 
ATOM   4311  H  HE2  . PHE A  1 286 ? -47.423 -2.784  -70.280  1.00 13.69  ? 286 PHE O HE2  1 
ATOM   4312  H  HZ   . PHE A  1 286 ? -49.375 -3.295  -71.393  1.00 13.72  ? 286 PHE O HZ   1 
ATOM   4313  N  N    . ASN A  1 287 ? -48.922 -3.974  -63.143  1.00 7.60   ? 287 ASN O N    1 
ATOM   4314  C  CA   . ASN A  1 287 ? -48.900 -4.574  -61.821  1.00 11.97  ? 287 ASN O CA   1 
ATOM   4315  C  C    . ASN A  1 287 ? -50.321 -4.902  -61.387  1.00 18.08  ? 287 ASN O C    1 
ATOM   4316  O  O    . ASN A  1 287 ? -51.204 -4.063  -61.462  1.00 8.39   ? 287 ASN O O    1 
ATOM   4317  C  CB   . ASN A  1 287 ? -48.214 -3.678  -60.796  1.00 17.80  ? 287 ASN O CB   1 
ATOM   4318  C  CG   . ASN A  1 287 ? -47.790 -4.474  -59.561  1.00 33.64  ? 287 ASN O CG   1 
ATOM   4319  O  OD1  . ASN A  1 287 ? -47.135 -5.530  -59.671  1.00 20.48  ? 287 ASN O OD1  1 
ATOM   4320  N  ND2  . ASN A  1 287 ? -48.223 -4.022  -58.397  1.00 34.12  ? 287 ASN O ND2  1 
ATOM   4321  H  H    . ASN A  1 287 ? -48.695 -3.145  -63.184  1.00 9.12   ? 287 ASN O H    1 
ATOM   4322  H  HA   . ASN A  1 287 ? -48.404 -5.406  -61.864  1.00 14.36  ? 287 ASN O HA   1 
ATOM   4323  H  HB2  . ASN A  1 287 ? -47.421 -3.285  -61.193  1.00 21.36  ? 287 ASN O HB2  1 
ATOM   4324  H  HB3  . ASN A  1 287 ? -48.830 -2.983  -60.514  1.00 21.36  ? 287 ASN O HB3  1 
ATOM   4325  H  HD21 . ASN A  1 287 ? -48.013 -4.432  -57.671  1.00 40.95  ? 287 ASN O HD21 1 
ATOM   4326  H  HD22 . ASN A  1 287 ? -48.715 -3.317  -58.366  1.00 40.95  ? 287 ASN O HD22 1 
ATOM   4327  N  N    . SER A  1 288 ? -50.516 -6.154  -60.976  1.00 11.49  ? 288 SER O N    1 
ATOM   4328  C  CA   . SER A  1 288 ? -51.804 -6.733  -60.582  1.00 15.17  ? 288 SER O CA   1 
ATOM   4329  C  C    . SER A  1 288 ? -52.800 -6.872  -61.747  1.00 12.11  ? 288 SER O C    1 
ATOM   4330  O  O    . SER A  1 288 ? -53.988 -7.033  -61.533  1.00 16.79  ? 288 SER O O    1 
ATOM   4331  C  CB   . SER A  1 288 ? -52.425 -5.920  -59.436  1.00 18.60  ? 288 SER O CB   1 
ATOM   4332  O  OG   . SER A  1 288 ? -51.536 -5.915  -58.314  1.00 13.39  ? 288 SER O OG   1 
ATOM   4333  H  H    . SER A  1 288 ? -49.874 -6.723  -60.913  1.00 13.79  ? 288 SER O H    1 
ATOM   4334  H  HA   . SER A  1 288 ? -51.640 -7.626  -60.241  1.00 18.20  ? 288 SER O HA   1 
ATOM   4335  H  HB2  . SER A  1 288 ? -52.569 -5.008  -59.732  1.00 22.31  ? 288 SER O HB2  1 
ATOM   4336  H  HB3  . SER A  1 288 ? -53.267 -6.325  -59.175  1.00 22.31  ? 288 SER O HB3  1 
ATOM   4337  H  HG   . SER A  1 288 ? -51.401 -6.702  -58.052  1.00 16.06  ? 288 SER O HG   1 
ATOM   4338  N  N    . ASP A  1 289 ? -52.302 -6.847  -62.976  1.00 10.60  ? 289 ASP O N    1 
ATOM   4339  C  CA   . ASP A  1 289 ? -53.124 -7.067  -64.159  1.00 11.35  ? 289 ASP O CA   1 
ATOM   4340  C  C    . ASP A  1 289 ? -53.350 -8.569  -64.302  1.00 7.92   ? 289 ASP O C    1 
ATOM   4341  O  O    . ASP A  1 289 ? -52.407 -9.344  -64.204  1.00 16.26  ? 289 ASP O O    1 
ATOM   4342  C  CB   . ASP A  1 289 ? -52.429 -6.483  -65.392  1.00 9.58   ? 289 ASP O CB   1 
ATOM   4343  C  CG   . ASP A  1 289 ? -53.292 -6.542  -66.644  1.00 21.85  ? 289 ASP O CG   1 
ATOM   4344  O  OD1  . ASP A  1 289 ? -53.727 -7.651  -66.992  1.00 20.18  ? 289 ASP O OD1  1 
ATOM   4345  O  OD2  . ASP A  1 289 ? -53.506 -5.488  -67.295  1.00 22.91  ? 289 ASP O OD2  1 
ATOM   4346  H  H    . ASP A  1 289 ? -51.473 -6.702  -63.155  1.00 12.72  ? 289 ASP O H    1 
ATOM   4347  H  HA   . ASP A  1 289 ? -53.983 -6.630  -64.047  1.00 13.62  ? 289 ASP O HA   1 
ATOM   4348  H  HB2  . ASP A  1 289 ? -52.213 -5.553  -65.221  1.00 11.49  ? 289 ASP O HB2  1 
ATOM   4349  H  HB3  . ASP A  1 289 ? -51.618 -6.985  -65.563  1.00 11.49  ? 289 ASP O HB3  1 
ATOM   4350  N  N    . THR A  1 290 ? -54.590 -8.997  -64.524  1.00 9.61   ? 290 THR O N    1 
ATOM   4351  C  CA   . THR A  1 290 ? -54.890 -10.436 -64.484  1.00 11.59  ? 290 THR O CA   1 
ATOM   4352  C  C    . THR A  1 290 ? -54.806 -11.145 -65.844  1.00 11.10  ? 290 THR O C    1 
ATOM   4353  O  O    . THR A  1 290 ? -55.083 -12.339 -65.934  1.00 13.19  ? 290 THR O O    1 
ATOM   4354  C  CB   . THR A  1 290 ? -56.301 -10.699 -63.933  1.00 13.32  ? 290 THR O CB   1 
ATOM   4355  O  OG1  . THR A  1 290 ? -57.235 -9.987  -64.726  1.00 16.62  ? 290 THR O OG1  1 
ATOM   4356  C  CG2  . THR A  1 290 ? -56.421 -10.238 -62.480  1.00 16.04  ? 290 THR O CG2  1 
ATOM   4357  H  H    . THR A  1 290 ? -55.264 -8.491  -64.696  1.00 11.53  ? 290 THR O H    1 
ATOM   4358  H  HA   . THR A  1 290 ? -54.257 -10.867 -63.889  1.00 13.91  ? 290 THR O HA   1 
ATOM   4359  H  HB   . THR A  1 290 ? -56.495 -11.649 -63.974  1.00 15.98  ? 290 THR O HB   1 
ATOM   4360  H  HG1  . THR A  1 290 ? -58.014 -10.119 -64.440  1.00 19.95  ? 290 THR O HG1  1 
ATOM   4361  H  HG21 . THR A  1 290 ? -57.316 -10.412 -62.150  1.00 19.25  ? 290 THR O HG21 1 
ATOM   4362  H  HG22 . THR A  1 290 ? -55.783 -10.715 -61.927  1.00 19.25  ? 290 THR O HG22 1 
ATOM   4363  H  HG23 . THR A  1 290 ? -56.242 -9.287  -62.419  1.00 19.25  ? 290 THR O HG23 1 
ATOM   4364  N  N    . HIS A  1 291 ? -54.469 -10.426 -66.904  1.00 12.07  ? 291 HIS O N    1 
ATOM   4365  C  CA   . HIS A  1 291 ? -54.263 -11.083 -68.192  1.00 8.74   ? 291 HIS O CA   1 
ATOM   4366  C  C    . HIS A  1 291 ? -53.040 -12.003 -68.128  1.00 10.05  ? 291 HIS O C    1 
ATOM   4367  O  O    . HIS A  1 291 ? -52.127 -11.792 -67.333  1.00 10.83  ? 291 HIS O O    1 
ATOM   4368  C  CB   . HIS A  1 291 ? -54.075 -10.058 -69.310  1.00 10.93  ? 291 HIS O CB   1 
ATOM   4369  C  CG   . HIS A  1 291 ? -55.306 -9.282  -69.633  1.00 8.58   ? 291 HIS O CG   1 
ATOM   4370  N  ND1  . HIS A  1 291 ? -55.632 -8.097  -69.004  1.00 24.12  ? 291 HIS O ND1  1 
ATOM   4371  C  CD2  . HIS A  1 291 ? -56.297 -9.519  -70.527  1.00 15.08  ? 291 HIS O CD2  1 
ATOM   4372  C  CE1  . HIS A  1 291 ? -56.771 -7.643  -69.496  1.00 27.13  ? 291 HIS O CE1  1 
ATOM   4373  N  NE2  . HIS A  1 291 ? -57.196 -8.489  -70.417  1.00 17.97  ? 291 HIS O NE2  1 
ATOM   4374  H  H    . HIS A  1 291 ? -54.354 -9.574  -66.909  1.00 14.49  ? 291 HIS O H    1 
ATOM   4375  H  HA   . HIS A  1 291 ? -55.040 -11.624 -68.403  1.00 10.49  ? 291 HIS O HA   1 
ATOM   4376  H  HB2  . HIS A  1 291 ? -53.389 -9.427  -69.042  1.00 13.12  ? 291 HIS O HB2  1 
ATOM   4377  H  HB3  . HIS A  1 291 ? -53.797 -10.522 -70.115  1.00 13.12  ? 291 HIS O HB3  1 
ATOM   4378  H  HD2  . HIS A  1 291 ? -56.359 -10.248 -71.102  1.00 18.09  ? 291 HIS O HD2  1 
ATOM   4379  H  HE1  . HIS A  1 291 ? -57.202 -6.861  -69.235  1.00 32.56  ? 291 HIS O HE1  1 
ATOM   4380  N  N    . SER A  1 292 ? -53.046 -13.021 -68.972  1.00 8.76   ? 292 SER O N    1 
ATOM   4381  C  CA   . SER A  1 292 ? -51.894 -13.879 -69.182  1.00 7.88   ? 292 SER O CA   1 
ATOM   4382  C  C    . SER A  1 292 ? -50.843 -13.174 -70.024  1.00 9.06   ? 292 SER O C    1 
ATOM   4383  O  O    . SER A  1 292 ? -49.648 -13.415 -69.883  1.00 10.35  ? 292 SER O O    1 
ATOM   4384  C  CB   . SER A  1 292 ? -52.320 -15.179 -69.881  1.00 7.67   ? 292 SER O CB   1 
ATOM   4385  O  OG   . SER A  1 292 ? -53.192 -15.930 -69.051  1.00 10.90  ? 292 SER O OG   1 
ATOM   4386  H  H    . SER A  1 292 ? -53.727 -13.241 -69.449  1.00 10.51  ? 292 SER O H    1 
ATOM   4387  H  HA   . SER A  1 292 ? -51.500 -14.105 -68.325  1.00 9.46   ? 292 SER O HA   1 
ATOM   4388  H  HB2  . SER A  1 292 ? -52.780 -14.959 -70.706  1.00 9.20   ? 292 SER O HB2  1 
ATOM   4389  H  HB3  . SER A  1 292 ? -51.531 -15.710 -70.072  1.00 9.20   ? 292 SER O HB3  1 
ATOM   4390  H  HG   . SER A  1 292 ? -53.420 -16.639 -69.440  1.00 13.08  ? 292 SER O HG   1 
ATOM   4391  N  N    . SER A  1 293 ? -51.312 -12.287 -70.889  1.00 8.89   ? 293 SER O N    1 
ATOM   4392  C  CA   . SER A  1 293 ? -50.506 -11.729 -71.956  1.00 8.31   ? 293 SER O CA   1 
ATOM   4393  C  C    . SER A  1 293 ? -51.165 -10.448 -72.434  1.00 11.42  ? 293 SER O C    1 
ATOM   4394  O  O    . SER A  1 293 ? -52.367 -10.461 -72.676  1.00 12.58  ? 293 SER O O    1 
ATOM   4395  C  CB   . SER A  1 293 ? -50.425 -12.764 -73.096  1.00 16.63  ? 293 SER O CB   1 
ATOM   4396  O  OG   . SER A  1 293 ? -49.450 -12.450 -74.059  1.00 17.05  ? 293 SER O OG   1 
ATOM   4397  H  H    . SER A  1 293 ? -52.118 -11.986 -70.875  1.00 10.67  ? 293 SER O H    1 
ATOM   4398  H  HA   . SER A  1 293 ? -49.611 -11.531 -71.636  1.00 9.97   ? 293 SER O HA   1 
ATOM   4399  H  HB2  . SER A  1 293 ? -50.212 -13.629 -72.712  1.00 19.96  ? 293 SER O HB2  1 
ATOM   4400  H  HB3  . SER A  1 293 ? -51.289 -12.807 -73.534  1.00 19.96  ? 293 SER O HB3  1 
ATOM   4401  H  HG   . SER A  1 293 ? -49.440 -13.038 -74.659  1.00 20.47  ? 293 SER O HG   1 
ATOM   4402  N  N    . THR A  1 294 ? -50.419 -9.349  -72.564  1.00 7.24   ? 294 THR O N    1 
ATOM   4403  C  CA   . THR A  1 294 ? -50.958 -8.141  -73.184  1.00 7.57   ? 294 THR O CA   1 
ATOM   4404  C  C    . THR A  1 294 ? -50.009 -7.637  -74.271  1.00 8.69   ? 294 THR O C    1 
ATOM   4405  O  O    . THR A  1 294 ? -48.919 -7.137  -73.999  1.00 9.19   ? 294 THR O O    1 
ATOM   4406  C  CB   . THR A  1 294 ? -51.211 -7.037  -72.157  1.00 10.68  ? 294 THR O CB   1 
ATOM   4407  O  OG1  . THR A  1 294 ? -52.147 -7.503  -71.185  1.00 13.43  ? 294 THR O OG1  1 
ATOM   4408  C  CG2  . THR A  1 294 ? -51.782 -5.748  -72.852  1.00 12.93  ? 294 THR O CG2  1 
ATOM   4409  H  H    . THR A  1 294 ? -49.603 -9.278  -72.303  1.00 8.68   ? 294 THR O H    1 
ATOM   4410  H  HA   . THR A  1 294 ? -51.805 -8.356  -73.605  1.00 9.09   ? 294 THR O HA   1 
ATOM   4411  H  HB   . THR A  1 294 ? -50.378 -6.806  -71.719  1.00 12.82  ? 294 THR O HB   1 
ATOM   4412  H  HG1  . THR A  1 294 ? -52.292 -6.903  -70.615  1.00 16.12  ? 294 THR O HG1  1 
ATOM   4413  H  HG21 . THR A  1 294 ? -51.938 -5.057  -72.189  1.00 15.51  ? 294 THR O HG21 1 
ATOM   4414  H  HG22 . THR A  1 294 ? -51.149 -5.418  -73.509  1.00 15.51  ? 294 THR O HG22 1 
ATOM   4415  H  HG23 . THR A  1 294 ? -52.619 -5.954  -73.296  1.00 15.51  ? 294 THR O HG23 1 
ATOM   4416  N  N    . PHE A  1 295 ? -50.457 -7.789  -75.508  1.00 9.24   ? 295 PHE O N    1 
ATOM   4417  C  CA   . PHE A  1 295 ? -49.747 -7.341  -76.683  1.00 10.55  ? 295 PHE O CA   1 
ATOM   4418  C  C    . PHE A  1 295 ? -49.572 -5.832  -76.667  1.00 11.17  ? 295 PHE O C    1 
ATOM   4419  O  O    . PHE A  1 295 ? -50.534 -5.093  -76.485  1.00 8.63   ? 295 PHE O O    1 
ATOM   4420  C  CB   . PHE A  1 295 ? -50.523 -7.766  -77.921  1.00 11.75  ? 295 PHE O CB   1 
ATOM   4421  C  CG   . PHE A  1 295 ? -49.872 -7.424  -79.221  1.00 8.87   ? 295 PHE O CG   1 
ATOM   4422  C  CD1  . PHE A  1 295 ? -48.914 -8.235  -79.760  1.00 12.12  ? 295 PHE O CD1  1 
ATOM   4423  C  CD2  . PHE A  1 295 ? -50.293 -6.338  -79.944  1.00 9.57   ? 295 PHE O CD2  1 
ATOM   4424  C  CE1  . PHE A  1 295 ? -48.358 -7.947  -80.991  1.00 17.01  ? 295 PHE O CE1  1 
ATOM   4425  C  CE2  . PHE A  1 295 ? -49.738 -6.040  -81.167  1.00 12.39  ? 295 PHE O CE2  1 
ATOM   4426  C  CZ   . PHE A  1 295 ? -48.769 -6.849  -81.685  1.00 12.09  ? 295 PHE O CZ   1 
ATOM   4427  H  H    . PHE A  1 295 ? -51.206 -8.168  -75.693  1.00 11.08  ? 295 PHE O H    1 
ATOM   4428  H  HA   . PHE A  1 295 ? -48.870 -7.754  -76.711  1.00 12.66  ? 295 PHE O HA   1 
ATOM   4429  H  HB2  . PHE A  1 295 ? -50.639 -8.729  -77.897  1.00 14.10  ? 295 PHE O HB2  1 
ATOM   4430  H  HB3  . PHE A  1 295 ? -51.390 -7.333  -77.906  1.00 14.10  ? 295 PHE O HB3  1 
ATOM   4431  H  HD1  . PHE A  1 295 ? -48.632 -8.988  -79.293  1.00 14.55  ? 295 PHE O HD1  1 
ATOM   4432  H  HD2  . PHE A  1 295 ? -50.956 -5.786  -79.595  1.00 11.49  ? 295 PHE O HD2  1 
ATOM   4433  H  HE1  . PHE A  1 295 ? -47.693 -8.495  -81.340  1.00 20.41  ? 295 PHE O HE1  1 
ATOM   4434  H  HE2  . PHE A  1 295 ? -50.021 -5.290  -81.639  1.00 14.87  ? 295 PHE O HE2  1 
ATOM   4435  H  HZ   . PHE A  1 295 ? -48.386 -6.648  -82.508  1.00 14.51  ? 295 PHE O HZ   1 
ATOM   4436  N  N    . ASP A  1 296 ? -48.326 -5.409  -76.847  1.00 11.54  ? 296 ASP O N    1 
ATOM   4437  C  CA   . ASP A  1 296 ? -47.922 -3.991  -76.865  1.00 12.50  ? 296 ASP O CA   1 
ATOM   4438  C  C    . ASP A  1 296 ? -47.727 -3.615  -78.322  1.00 12.09  ? 296 ASP O C    1 
ATOM   4439  O  O    . ASP A  1 296 ? -46.675 -3.893  -78.914  1.00 10.53  ? 296 ASP O O    1 
ATOM   4440  C  CB   . ASP A  1 296 ? -46.629 -3.806  -76.050  1.00 10.88  ? 296 ASP O CB   1 
ATOM   4441  C  CG   . ASP A  1 296 ? -46.165 -2.345  -75.935  1.00 14.78  ? 296 ASP O CG   1 
ATOM   4442  O  OD1  . ASP A  1 296 ? -46.511 -1.478  -76.775  1.00 10.16  ? 296 ASP O OD1  1 
ATOM   4443  O  OD2  . ASP A  1 296 ? -45.418 -2.083  -74.976  1.00 16.25  ? 296 ASP O OD2  1 
ATOM   4444  H  H    . ASP A  1 296 ? -47.663 -5.944  -76.967  1.00 13.85  ? 296 ASP O H    1 
ATOM   4445  H  HA   . ASP A  1 296 ? -48.622 -3.439  -76.483  1.00 14.99  ? 296 ASP O HA   1 
ATOM   4446  H  HB2  . ASP A  1 296 ? -46.776 -4.141  -75.151  1.00 13.05  ? 296 ASP O HB2  1 
ATOM   4447  H  HB3  . ASP A  1 296 ? -45.917 -4.309  -76.475  1.00 13.05  ? 296 ASP O HB3  1 
ATOM   4448  N  N    . ALA A  1 297 ? -48.731 -2.984  -78.908  1.00 9.48   ? 297 ALA O N    1 
ATOM   4449  C  CA   . ALA A  1 297 ? -48.696 -2.717  -80.341  1.00 16.85  ? 297 ALA O CA   1 
ATOM   4450  C  C    . ALA A  1 297 ? -47.586 -1.736  -80.703  1.00 19.86  ? 297 ALA O C    1 
ATOM   4451  O  O    . ALA A  1 297 ? -46.912 -1.905  -81.713  1.00 17.77  ? 297 ALA O O    1 
ATOM   4452  C  CB   . ALA A  1 297 ? -50.017 -2.191  -80.806  1.00 13.10  ? 297 ALA O CB   1 
ATOM   4453  H  H    . ALA A  1 297 ? -49.438 -2.702  -78.507  1.00 11.38  ? 297 ALA O H    1 
ATOM   4454  H  HA   . ALA A  1 297 ? -48.524 -3.547  -80.811  1.00 20.23  ? 297 ALA O HA   1 
ATOM   4455  H  HB1  . ALA A  1 297 ? -49.971 -2.020  -81.760  1.00 15.72  ? 297 ALA O HB1  1 
ATOM   4456  H  HB2  . ALA A  1 297 ? -50.703 -2.852  -80.620  1.00 15.72  ? 297 ALA O HB2  1 
ATOM   4457  H  HB3  . ALA A  1 297 ? -50.214 -1.368  -80.331  1.00 15.72  ? 297 ALA O HB3  1 
ATOM   4458  N  N    . GLY A  1 298 ? -47.388 -0.716  -79.879  1.00 14.13  ? 298 GLY O N    1 
ATOM   4459  C  CA   . GLY A  1 298 ? -46.378 0.291   -80.181  1.00 13.31  ? 298 GLY O CA   1 
ATOM   4460  C  C    . GLY A  1 298 ? -44.938 -0.172  -80.013  1.00 12.72  ? 298 GLY O C    1 
ATOM   4461  O  O    . GLY A  1 298 ? -44.027 0.405   -80.605  1.00 20.21  ? 298 GLY O O    1 
ATOM   4462  H  H    . GLY A  1 298 ? -47.819 -0.584  -79.147  1.00 16.96  ? 298 GLY O H    1 
ATOM   4463  H  HA2  . GLY A  1 298 ? -46.492 0.585   -81.098  1.00 15.97  ? 298 GLY O HA2  1 
ATOM   4464  H  HA3  . GLY A  1 298 ? -46.515 1.057   -79.601  1.00 15.97  ? 298 GLY O HA3  1 
ATOM   4465  N  N    . ALA A  1 299 ? -44.709 -1.212  -79.220  1.00 11.89  ? 299 ALA O N    1 
ATOM   4466  C  CA   . ALA A  1 299 ? -43.336 -1.593  -78.889  1.00 16.20  ? 299 ALA O CA   1 
ATOM   4467  C  C    . ALA A  1 299 ? -42.730 -2.520  -79.933  1.00 22.69  ? 299 ALA O C    1 
ATOM   4468  O  O    . ALA A  1 299 ? -41.515 -2.583  -80.063  1.00 17.35  ? 299 ALA O O    1 
ATOM   4469  C  CB   . ALA A  1 299 ? -43.285 -2.247  -77.518  1.00 13.18  ? 299 ALA O CB   1 
ATOM   4470  H  H    . ALA A  1 299 ? -45.316 -1.707  -78.864  1.00 14.27  ? 299 ALA O H    1 
ATOM   4471  H  HA   . ALA A  1 299 ? -42.791 -0.792  -78.854  1.00 19.44  ? 299 ALA O HA   1 
ATOM   4472  H  HB1  . ALA A  1 299 ? -42.368 -2.492  -77.319  1.00 15.81  ? 299 ALA O HB1  1 
ATOM   4473  H  HB2  . ALA A  1 299 ? -43.611 -1.618  -76.856  1.00 15.81  ? 299 ALA O HB2  1 
ATOM   4474  H  HB3  . ALA A  1 299 ? -43.845 -3.040  -77.525  1.00 15.81  ? 299 ALA O HB3  1 
ATOM   4475  N  N    . GLY A  1 300 ? -43.576 -3.244  -80.657  1.00 13.39  ? 300 GLY O N    1 
ATOM   4476  C  CA   . GLY A  1 300 ? -43.113 -4.228  -81.617  1.00 19.60  ? 300 GLY O CA   1 
ATOM   4477  C  C    . GLY A  1 300 ? -42.560 -3.606  -82.882  1.00 14.78  ? 300 GLY O C    1 
ATOM   4478  O  O    . GLY A  1 300 ? -42.746 -2.414  -83.132  1.00 18.82  ? 300 GLY O O    1 
ATOM   4479  H  H    . GLY A  1 300 ? -44.433 -3.180  -80.609  1.00 16.07  ? 300 GLY O H    1 
ATOM   4480  H  HA2  . GLY A  1 300 ? -42.416 -4.768  -81.213  1.00 23.52  ? 300 GLY O HA2  1 
ATOM   4481  H  HA3  . GLY A  1 300 ? -43.849 -4.811  -81.860  1.00 23.52  ? 300 GLY O HA3  1 
ATOM   4482  N  N    . ILE A  1 301 ? -41.886 -4.419  -83.688  1.00 12.56  ? 301 ILE O N    1 
ATOM   4483  C  CA   . ILE A  1 301 ? -41.342 -3.934  -84.948  1.00 13.15  ? 301 ILE O CA   1 
ATOM   4484  C  C    . ILE A  1 301 ? -41.289 -5.055  -85.981  1.00 21.72  ? 301 ILE O C    1 
ATOM   4485  O  O    . ILE A  1 301 ? -41.061 -6.221  -85.654  1.00 18.04  ? 301 ILE O O    1 
ATOM   4486  C  CB   . ILE A  1 301 ? -39.936 -3.276  -84.734  1.00 18.10  ? 301 ILE O CB   1 
ATOM   4487  C  CG1  . ILE A  1 301 ? -39.435 -2.630  -86.031  1.00 32.08  ? 301 ILE O CG1  1 
ATOM   4488  C  CG2  . ILE A  1 301 ? -38.918 -4.269  -84.175  1.00 20.31  ? 301 ILE O CG2  1 
ATOM   4489  C  CD1  . ILE A  1 301 ? -38.368 -1.522  -85.810  1.00 34.61  ? 301 ILE O CD1  1 
ATOM   4490  H  H    . ILE A  1 301 ? -41.730 -5.249  -83.528  1.00 15.08  ? 301 ILE O H    1 
ATOM   4491  H  HA   . ILE A  1 301 ? -41.935 -3.248  -85.294  1.00 15.78  ? 301 ILE O HA   1 
ATOM   4492  H  HB   . ILE A  1 301 ? -40.042 -2.569  -84.079  1.00 21.72  ? 301 ILE O HB   1 
ATOM   4493  H  HG12 . ILE A  1 301 ? -39.037 -3.317  -86.589  1.00 38.49  ? 301 ILE O HG12 1 
ATOM   4494  H  HG13 . ILE A  1 301 ? -40.188 -2.228  -86.491  1.00 38.49  ? 301 ILE O HG13 1 
ATOM   4495  H  HG21 . ILE A  1 301 ? -38.067 -3.817  -84.061  1.00 24.38  ? 301 ILE O HG21 1 
ATOM   4496  H  HG22 . ILE A  1 301 ? -39.235 -4.599  -83.320  1.00 24.38  ? 301 ILE O HG22 1 
ATOM   4497  H  HG23 . ILE A  1 301 ? -38.820 -5.006  -84.799  1.00 24.38  ? 301 ILE O HG23 1 
ATOM   4498  H  HD11 . ILE A  1 301 ? -38.102 -1.165  -86.672  1.00 41.54  ? 301 ILE O HD11 1 
ATOM   4499  H  HD12 . ILE A  1 301 ? -38.752 -0.819  -85.264  1.00 41.54  ? 301 ILE O HD12 1 
ATOM   4500  H  HD13 . ILE A  1 301 ? -37.600 -1.909  -85.361  1.00 41.54  ? 301 ILE O HD13 1 
ATOM   4501  N  N    . ALA A  1 302 ? -41.573 -4.694  -87.230  1.00 17.65  ? 302 ALA O N    1 
ATOM   4502  C  CA   . ALA A  1 302 ? -41.464 -5.614  -88.356  1.00 19.46  ? 302 ALA O CA   1 
ATOM   4503  C  C    . ALA A  1 302 ? -40.295 -5.229  -89.257  1.00 24.31  ? 302 ALA O C    1 
ATOM   4504  O  O    . ALA A  1 302 ? -40.146 -4.069  -89.605  1.00 20.65  ? 302 ALA O O    1 
ATOM   4505  C  CB   . ALA A  1 302 ? -42.763 -5.627  -89.164  1.00 23.03  ? 302 ALA O CB   1 
ATOM   4506  H  H    . ALA A  1 302 ? -41.836 -3.907  -87.454  1.00 21.17  ? 302 ALA O H    1 
ATOM   4507  H  HA   . ALA A  1 302 ? -41.307 -6.511  -88.021  1.00 23.35  ? 302 ALA O HA   1 
ATOM   4508  H  HB1  . ALA A  1 302 ? -42.667 -6.245  -89.905  1.00 27.63  ? 302 ALA O HB1  1 
ATOM   4509  H  HB2  . ALA A  1 302 ? -43.490 -5.912  -88.588  1.00 27.63  ? 302 ALA O HB2  1 
ATOM   4510  H  HB3  . ALA A  1 302 ? -42.936 -4.733  -89.497  1.00 27.63  ? 302 ALA O HB3  1 
ATOM   4511  N  N    . LEU A  1 303 ? -39.470 -6.195  -89.648  1.00 17.27  ? 303 LEU O N    1 
ATOM   4512  C  CA   . LEU A  1 303 ? -38.455 -5.927  -90.676  1.00 15.55  ? 303 LEU O CA   1 
ATOM   4513  C  C    . LEU A  1 303 ? -39.073 -6.007  -92.065  1.00 19.02  ? 303 LEU O C    1 
ATOM   4514  O  O    . LEU A  1 303 ? -38.799 -5.193  -92.936  1.00 15.55  ? 303 LEU O O    1 
ATOM   4515  C  CB   . LEU A  1 303 ? -37.305 -6.910  -90.561  1.00 15.82  ? 303 LEU O CB   1 
ATOM   4516  C  CG   . LEU A  1 303 ? -36.166 -6.696  -91.546  1.00 18.09  ? 303 LEU O CG   1 
ATOM   4517  C  CD1  . LEU A  1 303 ? -35.394 -5.428  -91.188  1.00 21.47  ? 303 LEU O CD1  1 
ATOM   4518  C  CD2  . LEU A  1 303 ? -35.254 -7.904  -91.559  1.00 25.41  ? 303 LEU O CD2  1 
ATOM   4519  H  H    . LEU A  1 303 ? -39.472 -6.999  -89.343  1.00 20.72  ? 303 LEU O H    1 
ATOM   4520  H  HA   . LEU A  1 303 ? -38.103 -5.032  -90.552  1.00 18.66  ? 303 LEU O HA   1 
ATOM   4521  H  HB2  . LEU A  1 303 ? -36.934 -6.845  -89.668  1.00 18.98  ? 303 LEU O HB2  1 
ATOM   4522  H  HB3  . LEU A  1 303 ? -37.650 -7.805  -90.705  1.00 18.98  ? 303 LEU O HB3  1 
ATOM   4523  H  HG   . LEU A  1 303 ? -36.533 -6.585  -92.437  1.00 21.71  ? 303 LEU O HG   1 
ATOM   4524  H  HD11 . LEU A  1 303 ? -34.673 -5.307  -91.825  1.00 25.76  ? 303 LEU O HD11 1 
ATOM   4525  H  HD12 . LEU A  1 303 ? -35.998 -4.670  -91.224  1.00 25.76  ? 303 LEU O HD12 1 
ATOM   4526  H  HD13 . LEU A  1 303 ? -35.033 -5.521  -90.293  1.00 25.76  ? 303 LEU O HD13 1 
ATOM   4527  H  HD21 . LEU A  1 303 ? -34.535 -7.750  -92.191  1.00 30.50  ? 303 LEU O HD21 1 
ATOM   4528  H  HD22 . LEU A  1 303 ? -34.891 -8.034  -90.669  1.00 30.50  ? 303 LEU O HD22 1 
ATOM   4529  H  HD23 . LEU A  1 303 ? -35.767 -8.683  -91.824  1.00 30.50  ? 303 LEU O HD23 1 
ATOM   4530  N  N    . ASN A  1 304 ? -39.899 -7.017  -92.271  1.00 15.54  ? 304 ASN O N    1 
ATOM   4531  C  CA   . ASN A  1 304 ? -40.640 -7.161  -93.516  1.00 16.35  ? 304 ASN O CA   1 
ATOM   4532  C  C    . ASN A  1 304 ? -41.893 -7.963  -93.224  1.00 15.06  ? 304 ASN O C    1 
ATOM   4533  O  O    . ASN A  1 304 ? -42.139 -8.311  -92.069  1.00 17.66  ? 304 ASN O O    1 
ATOM   4534  C  CB   . ASN A  1 304 ? -39.809 -7.852  -94.593  1.00 21.53  ? 304 ASN O CB   1 
ATOM   4535  C  CG   . ASN A  1 304 ? -39.246 -9.170  -94.127  1.00 25.06  ? 304 ASN O CG   1 
ATOM   4536  O  OD1  . ASN A  1 304 ? -39.985 -10.098 -93.813  1.00 17.87  ? 304 ASN O OD1  1 
ATOM   4537  N  ND2  . ASN A  1 304 ? -37.929 -9.259  -94.075  1.00 22.38  ? 304 ASN O ND2  1 
ATOM   4538  H  H    . ASN A  1 304 ? -40.051 -7.642  -91.700  1.00 18.64  ? 304 ASN O H    1 
ATOM   4539  H  HA   . ASN A  1 304 ? -40.902 -6.285  -93.841  1.00 19.62  ? 304 ASN O HA   1 
ATOM   4540  H  HB2  . ASN A  1 304 ? -40.369 -8.021  -95.367  1.00 25.84  ? 304 ASN O HB2  1 
ATOM   4541  H  HB3  . ASN A  1 304 ? -39.067 -7.278  -94.839  1.00 25.84  ? 304 ASN O HB3  1 
ATOM   4542  H  HD21 . ASN A  1 304 ? -37.558 -9.990  -93.815  1.00 26.85  ? 304 ASN O HD21 1 
ATOM   4543  H  HD22 . ASN A  1 304 ? -37.443 -8.586  -94.301  1.00 26.85  ? 304 ASN O HD22 1 
ATOM   4544  N  N    . ASP A  1 305 ? -42.660 -8.271  -94.268  1.00 15.73  ? 305 ASP O N    1 
ATOM   4545  C  CA   . ASP A  1 305 ? -43.940 -8.948  -94.096  1.00 15.55  ? 305 ASP O CA   1 
ATOM   4546  C  C    . ASP A  1 305 ? -43.839 -10.370 -93.501  1.00 17.00  ? 305 ASP O C    1 
ATOM   4547  O  O    . ASP A  1 305 ? -44.853 -10.937 -93.101  1.00 18.36  ? 305 ASP O O    1 
ATOM   4548  C  CB   . ASP A  1 305 ? -44.659 -9.005  -95.438  1.00 22.61  ? 305 ASP O CB   1 
ATOM   4549  C  CG   . ASP A  1 305 ? -45.269 -7.661  -95.831  1.00 36.73  ? 305 ASP O CG   1 
ATOM   4550  O  OD1  . ASP A  1 305 ? -44.998 -6.653  -95.140  1.00 33.03  ? 305 ASP O OD1  1 
ATOM   4551  O  OD2  . ASP A  1 305 ? -46.011 -7.616  -96.831  1.00 42.35  ? 305 ASP O OD2  1 
ATOM   4552  H  H    . ASP A  1 305 ? -42.460 -8.099  -95.086  1.00 18.87  ? 305 ASP O H    1 
ATOM   4553  H  HA   . ASP A  1 305 ? -44.487 -8.420  -93.494  1.00 18.66  ? 305 ASP O HA   1 
ATOM   4554  H  HB2  . ASP A  1 305 ? -44.026 -9.261  -96.126  1.00 27.13  ? 305 ASP O HB2  1 
ATOM   4555  H  HB3  . ASP A  1 305 ? -45.376 -9.657  -95.386  1.00 27.13  ? 305 ASP O HB3  1 
ATOM   4556  N  N    . HIS A  1 306 ? -42.635 -10.944 -93.459  1.00 18.93  ? 306 HIS O N    1 
ATOM   4557  C  CA   . HIS A  1 306 ? -42.429 -12.317 -92.948  1.00 14.62  ? 306 HIS O CA   1 
ATOM   4558  C  C    . HIS A  1 306 ? -41.623 -12.418 -91.671  1.00 15.31  ? 306 HIS O C    1 
ATOM   4559  O  O    . HIS A  1 306 ? -41.463 -13.513 -91.127  1.00 19.32  ? 306 HIS O O    1 
ATOM   4560  C  CB   . HIS A  1 306 ? -41.711 -13.173 -93.995  1.00 16.43  ? 306 HIS O CB   1 
ATOM   4561  C  CG   . HIS A  1 306 ? -42.614 -13.684 -95.053  1.00 17.13  ? 306 HIS O CG   1 
ATOM   4562  N  ND1  . HIS A  1 306 ? -43.495 -14.718 -94.835  1.00 16.84  ? 306 HIS O ND1  1 
ATOM   4563  C  CD2  . HIS A  1 306 ? -42.813 -13.276 -96.326  1.00 17.01  ? 306 HIS O CD2  1 
ATOM   4564  C  CE1  . HIS A  1 306 ? -44.174 -14.948 -95.940  1.00 18.25  ? 306 HIS O CE1  1 
ATOM   4565  N  NE2  . HIS A  1 306 ? -43.785 -14.081 -96.853  1.00 17.51  ? 306 HIS O NE2  1 
ATOM   4566  H  H    . HIS A  1 306 ? -41.911 -10.562 -93.722  1.00 22.72  ? 306 HIS O H    1 
ATOM   4567  H  HA   . HIS A  1 306 ? -43.296 -12.719 -92.782  1.00 17.55  ? 306 HIS O HA   1 
ATOM   4568  H  HB2  . HIS A  1 306 ? -41.025 -12.636 -94.422  1.00 19.72  ? 306 HIS O HB2  1 
ATOM   4569  H  HB3  . HIS A  1 306 ? -41.307 -13.936 -93.554  1.00 19.72  ? 306 HIS O HB3  1 
ATOM   4570  H  HD2  . HIS A  1 306 ? -42.367 -12.587 -96.763  1.00 20.42  ? 306 HIS O HD2  1 
ATOM   4571  H  HE1  . HIS A  1 306 ? -44.828 -15.600 -96.052  1.00 21.90  ? 306 HIS O HE1  1 
ATOM   4572  N  N    . PHE A  1 307 ? -41.096 -11.299 -91.194  1.00 13.57  ? 307 PHE O N    1 
ATOM   4573  C  CA   . PHE A  1 307 ? -40.139 -11.355 -90.103  1.00 12.99  ? 307 PHE O CA   1 
ATOM   4574  C  C    . PHE A  1 307 ? -40.397 -10.197 -89.164  1.00 13.62  ? 307 PHE O C    1 
ATOM   4575  O  O    . PHE A  1 307 ? -40.222 -9.032  -89.539  1.00 12.74  ? 307 PHE O O    1 
ATOM   4576  C  CB   . PHE A  1 307 ? -38.715 -11.334 -90.666  1.00 14.62  ? 307 PHE O CB   1 
ATOM   4577  C  CG   . PHE A  1 307 ? -37.644 -11.704 -89.666  1.00 13.89  ? 307 PHE O CG   1 
ATOM   4578  C  CD1  . PHE A  1 307 ? -37.722 -12.876 -88.937  1.00 20.03  ? 307 PHE O CD1  1 
ATOM   4579  C  CD2  . PHE A  1 307 ? -36.530 -10.899 -89.508  1.00 15.06  ? 307 PHE O CD2  1 
ATOM   4580  C  CE1  . PHE A  1 307 ? -36.720 -13.232 -88.047  1.00 23.59  ? 307 PHE O CE1  1 
ATOM   4581  C  CE2  . PHE A  1 307 ? -35.527 -11.247 -88.619  1.00 19.98  ? 307 PHE O CE2  1 
ATOM   4582  C  CZ   . PHE A  1 307 ? -35.620 -12.412 -87.889  1.00 19.05  ? 307 PHE O CZ   1 
ATOM   4583  H  H    . PHE A  1 307 ? -41.273 -10.507 -91.480  1.00 16.28  ? 307 PHE O H    1 
ATOM   4584  H  HA   . PHE A  1 307 ? -40.260 -12.181 -89.610  1.00 15.59  ? 307 PHE O HA   1 
ATOM   4585  H  HB2  . PHE A  1 307 ? -38.663 -11.964 -91.402  1.00 17.54  ? 307 PHE O HB2  1 
ATOM   4586  H  HB3  . PHE A  1 307 ? -38.521 -10.440 -90.988  1.00 17.54  ? 307 PHE O HB3  1 
ATOM   4587  H  HD1  . PHE A  1 307 ? -38.459 -13.433 -89.044  1.00 24.03  ? 307 PHE O HD1  1 
ATOM   4588  H  HD2  . PHE A  1 307 ? -36.458 -10.113 -89.999  1.00 18.07  ? 307 PHE O HD2  1 
ATOM   4589  H  HE1  . PHE A  1 307 ? -36.790 -14.018 -87.554  1.00 28.30  ? 307 PHE O HE1  1 
ATOM   4590  H  HE2  . PHE A  1 307 ? -34.789 -10.691 -88.514  1.00 23.98  ? 307 PHE O HE2  1 
ATOM   4591  H  HZ   . PHE A  1 307 ? -34.949 -12.641 -87.288  1.00 22.86  ? 307 PHE O HZ   1 
ATOM   4592  N  N    . VAL A  1 308 ? -40.825 -10.539 -87.949  1.00 11.72  ? 308 VAL O N    1 
ATOM   4593  C  CA   . VAL A  1 308 ? -41.378 -9.578  -86.992  1.00 11.21  ? 308 VAL O CA   1 
ATOM   4594  C  C    . VAL A  1 308 ? -40.970 -9.876  -85.572  1.00 12.24  ? 308 VAL O C    1 
ATOM   4595  O  O    . VAL A  1 308 ? -40.698 -11.029 -85.226  1.00 12.79  ? 308 VAL O O    1 
ATOM   4596  C  CB   . VAL A  1 308 ? -42.939 -9.563  -87.029  1.00 15.08  ? 308 VAL O CB   1 
ATOM   4597  C  CG1  . VAL A  1 308 ? -43.438 -9.158  -88.386  1.00 25.38  ? 308 VAL O CG1  1 
ATOM   4598  C  CG2  . VAL A  1 308 ? -43.503 -10.943 -86.670  1.00 14.82  ? 308 VAL O CG2  1 
ATOM   4599  H  H    . VAL A  1 308 ? -40.804 -11.344 -87.647  1.00 14.06  ? 308 VAL O H    1 
ATOM   4600  H  HA   . VAL A  1 308 ? -41.062 -8.689  -87.217  1.00 13.46  ? 308 VAL O HA   1 
ATOM   4601  H  HB   . VAL A  1 308 ? -43.269 -8.921  -86.380  1.00 18.10  ? 308 VAL O HB   1 
ATOM   4602  H  HG11 . VAL A  1 308 ? -44.408 -9.158  -88.379  1.00 30.46  ? 308 VAL O HG11 1 
ATOM   4603  H  HG12 . VAL A  1 308 ? -43.108 -8.269  -88.592  1.00 30.46  ? 308 VAL O HG12 1 
ATOM   4604  H  HG13 . VAL A  1 308 ? -43.112 -9.792  -89.044  1.00 30.46  ? 308 VAL O HG13 1 
ATOM   4605  H  HG21 . VAL A  1 308 ? -44.472 -10.905 -86.700  1.00 17.79  ? 308 VAL O HG21 1 
ATOM   4606  H  HG22 . VAL A  1 308 ? -43.177 -11.593 -87.311  1.00 17.79  ? 308 VAL O HG22 1 
ATOM   4607  H  HG23 . VAL A  1 308 ? -43.209 -11.181 -85.777  1.00 17.79  ? 308 VAL O HG23 1 
ATOM   4608  N  N    . LYS A  1 309 ? -40.937 -8.827  -84.753  1.00 10.93  ? 309 LYS O N    1 
ATOM   4609  C  CA   . LYS A  1 309 ? -40.702 -8.945  -83.320  1.00 12.04  ? 309 LYS O CA   1 
ATOM   4610  C  C    . LYS A  1 309 ? -41.910 -8.399  -82.564  1.00 16.31  ? 309 LYS O C    1 
ATOM   4611  O  O    . LYS A  1 309 ? -42.254 -7.228  -82.694  1.00 12.68  ? 309 LYS O O    1 
ATOM   4612  C  CB   . LYS A  1 309 ? -39.441 -8.202  -82.915  1.00 12.21  ? 309 LYS O CB   1 
ATOM   4613  C  CG   . LYS A  1 309 ? -39.082 -8.315  -81.434  1.00 17.76  ? 309 LYS O CG   1 
ATOM   4614  C  CD   . LYS A  1 309 ? -37.900 -7.388  -81.079  1.00 18.68  ? 309 LYS O CD   1 
ATOM   4615  C  CE   . LYS A  1 309 ? -36.603 -7.811  -81.710  1.00 20.83  ? 309 LYS O CE   1 
ATOM   4616  N  NZ   . LYS A  1 309 ? -36.036 -9.056  -81.130  1.00 30.14  ? 309 LYS O NZ   1 
ATOM   4617  H  H    . LYS A  1 309 ? -41.052 -8.015  -85.013  1.00 13.11  ? 309 LYS O H    1 
ATOM   4618  H  HA   . LYS A  1 309 ? -40.594 -9.881  -83.088  1.00 14.44  ? 309 LYS O HA   1 
ATOM   4619  H  HB2  . LYS A  1 309 ? -38.696 -8.556  -83.425  1.00 14.65  ? 309 LYS O HB2  1 
ATOM   4620  H  HB3  . LYS A  1 309 ? -39.558 -7.261  -83.118  1.00 14.65  ? 309 LYS O HB3  1 
ATOM   4621  H  HG2  . LYS A  1 309 ? -39.846 -8.054  -80.897  1.00 21.31  ? 309 LYS O HG2  1 
ATOM   4622  H  HG3  . LYS A  1 309 ? -38.824 -9.228  -81.234  1.00 21.31  ? 309 LYS O HG3  1 
ATOM   4623  H  HD2  . LYS A  1 309 ? -38.102 -6.490  -81.386  1.00 22.42  ? 309 LYS O HD2  1 
ATOM   4624  H  HD3  . LYS A  1 309 ? -37.778 -7.388  -80.117  1.00 22.42  ? 309 LYS O HD3  1 
ATOM   4625  H  HE2  . LYS A  1 309 ? -36.751 -7.965  -82.657  1.00 25.00  ? 309 LYS O HE2  1 
ATOM   4626  H  HE3  . LYS A  1 309 ? -35.951 -7.103  -81.590  1.00 25.00  ? 309 LYS O HE3  1 
ATOM   4627  H  HZ1  . LYS A  1 309 ? -35.272 -9.261  -81.538  1.00 36.17  ? 309 LYS O HZ1  1 
ATOM   4628  H  HZ2  . LYS A  1 309 ? -35.879 -8.943  -80.262  1.00 36.17  ? 309 LYS O HZ2  1 
ATOM   4629  H  HZ3  . LYS A  1 309 ? -36.609 -9.729  -81.236  1.00 36.17  ? 309 LYS O HZ3  1 
ATOM   4630  N  N    . LEU A  1 310 ? -42.543 -9.283  -81.801  1.00 11.20  ? 310 LEU O N    1 
ATOM   4631  C  CA   . LEU A  1 310 ? -43.795 -9.007  -81.106  1.00 12.07  ? 310 LEU O CA   1 
ATOM   4632  C  C    . LEU A  1 310 ? -43.543 -8.991  -79.607  1.00 12.03  ? 310 LEU O C    1 
ATOM   4633  O  O    . LEU A  1 310 ? -42.822 -9.841  -79.069  1.00 11.72  ? 310 LEU O O    1 
ATOM   4634  C  CB   . LEU A  1 310 ? -44.859 -10.054 -81.461  1.00 10.43  ? 310 LEU O CB   1 
ATOM   4635  C  CG   . LEU A  1 310 ? -45.145 -10.223 -82.963  1.00 13.77  ? 310 LEU O CG   1 
ATOM   4636  C  CD1  . LEU A  1 310 ? -46.196 -11.296 -83.203  1.00 18.36  ? 310 LEU O CD1  1 
ATOM   4637  C  CD2  . LEU A  1 310 ? -45.583 -8.920  -83.574  1.00 19.42  ? 310 LEU O CD2  1 
ATOM   4638  H  H    . LEU A  1 310 ? -42.254 -10.081 -81.666  1.00 13.44  ? 310 LEU O H    1 
ATOM   4639  H  HA   . LEU A  1 310 ? -44.124 -8.134  -81.371  1.00 14.48  ? 310 LEU O HA   1 
ATOM   4640  H  HB2  . LEU A  1 310 ? -44.569 -10.915 -81.122  1.00 12.52  ? 310 LEU O HB2  1 
ATOM   4641  H  HB3  . LEU A  1 310 ? -45.692 -9.801  -81.034  1.00 12.52  ? 310 LEU O HB3  1 
ATOM   4642  H  HG   . LEU A  1 310 ? -44.329 -10.500 -83.408  1.00 16.52  ? 310 LEU O HG   1 
ATOM   4643  H  HD11 . LEU A  1 310 ? -46.352 -11.377 -84.157  1.00 22.04  ? 310 LEU O HD11 1 
ATOM   4644  H  HD12 . LEU A  1 310 ? -45.873 -12.139 -82.848  1.00 22.04  ? 310 LEU O HD12 1 
ATOM   4645  H  HD13 . LEU A  1 310 ? -47.017 -11.040 -82.754  1.00 22.04  ? 310 LEU O HD13 1 
ATOM   4646  H  HD21 . LEU A  1 310 ? -45.756 -9.057  -84.518  1.00 23.30  ? 310 LEU O HD21 1 
ATOM   4647  H  HD22 . LEU A  1 310 ? -46.392 -8.620  -83.130  1.00 23.30  ? 310 LEU O HD22 1 
ATOM   4648  H  HD23 . LEU A  1 310 ? -44.878 -8.264  -83.457  1.00 23.30  ? 310 LEU O HD23 1 
ATOM   4649  N  N    . ILE A  1 311 ? -44.144 -8.012  -78.949  1.00 7.96   ? 311 ILE O N    1 
ATOM   4650  C  CA   . ILE A  1 311 ? -43.878 -7.721  -77.555  1.00 9.91   ? 311 ILE O CA   1 
ATOM   4651  C  C    . ILE A  1 311 ? -45.143 -7.921  -76.736  1.00 11.49  ? 311 ILE O C    1 
ATOM   4652  O  O    . ILE A  1 311 ? -46.190 -7.366  -77.066  1.00 8.48   ? 311 ILE O O    1 
ATOM   4653  C  CB   . ILE A  1 311 ? -43.391 -6.259  -77.369  1.00 10.07  ? 311 ILE O CB   1 
ATOM   4654  C  CG1  . ILE A  1 311 ? -42.148 -5.965  -78.234  1.00 17.62  ? 311 ILE O CG1  1 
ATOM   4655  C  CG2  . ILE A  1 311 ? -43.079 -5.951  -75.897  1.00 9.64   ? 311 ILE O CG2  1 
ATOM   4656  C  CD1  . ILE A  1 311 ? -40.979 -6.869  -77.941  1.00 13.01  ? 311 ILE O CD1  1 
ATOM   4657  H  H    . ILE A  1 311 ? -44.727 -7.488  -79.302  1.00 9.55   ? 311 ILE O H    1 
ATOM   4658  H  HA   . ILE A  1 311 ? -43.193 -8.322  -77.221  1.00 11.90  ? 311 ILE O HA   1 
ATOM   4659  H  HB   . ILE A  1 311 ? -44.104 -5.666  -77.656  1.00 12.09  ? 311 ILE O HB   1 
ATOM   4660  H  HG12 . ILE A  1 311 ? -42.383 -6.077  -79.168  1.00 21.15  ? 311 ILE O HG12 1 
ATOM   4661  H  HG13 . ILE A  1 311 ? -41.864 -5.052  -78.073  1.00 21.15  ? 311 ILE O HG13 1 
ATOM   4662  H  HG21 . ILE A  1 311 ? -42.780 -5.032  -75.824  1.00 11.57  ? 311 ILE O HG21 1 
ATOM   4663  H  HG22 . ILE A  1 311 ? -43.884 -6.080  -75.371  1.00 11.57  ? 311 ILE O HG22 1 
ATOM   4664  H  HG23 . ILE A  1 311 ? -42.382 -6.552  -75.591  1.00 11.57  ? 311 ILE O HG23 1 
ATOM   4665  H  HD11 . ILE A  1 311 ? -40.240 -6.626  -78.520  1.00 15.61  ? 311 ILE O HD11 1 
ATOM   4666  H  HD12 . ILE A  1 311 ? -40.722 -6.762  -77.012  1.00 15.61  ? 311 ILE O HD12 1 
ATOM   4667  H  HD13 . ILE A  1 311 ? -41.242 -7.788  -78.108  1.00 15.61  ? 311 ILE O HD13 1 
ATOM   4668  N  N    . SER A  1 312 ? -45.047 -8.674  -75.651  1.00 8.44   ? 312 SER O N    1 
ATOM   4669  C  CA   . SER A  1 312 ? -46.195 -8.873  -74.777  1.00 10.71  ? 312 SER O CA   1 
ATOM   4670  C  C    . SER A  1 312 ? -45.803 -8.866  -73.305  1.00 11.19  ? 312 SER O C    1 
ATOM   4671  O  O    . SER A  1 312 ? -44.845 -9.498  -72.912  1.00 9.18   ? 312 SER O O    1 
ATOM   4672  C  CB   . SER A  1 312 ? -46.899 -10.178 -75.127  1.00 9.20   ? 312 SER O CB   1 
ATOM   4673  O  OG   . SER A  1 312 ? -48.157 -10.281 -74.477  1.00 14.36  ? 312 SER O OG   1 
ATOM   4674  H  H    . SER A  1 312 ? -44.332 -9.080  -75.397  1.00 10.13  ? 312 SER O H    1 
ATOM   4675  H  HA   . SER A  1 312 ? -46.824 -8.149  -74.920  1.00 12.85  ? 312 SER O HA   1 
ATOM   4676  H  HB2  . SER A  1 312 ? -47.039 -10.211 -76.087  1.00 11.04  ? 312 SER O HB2  1 
ATOM   4677  H  HB3  . SER A  1 312 ? -46.340 -10.920 -74.850  1.00 11.04  ? 312 SER O HB3  1 
ATOM   4678  H  HG   . SER A  1 312 ? -48.528 -11.006 -74.682  1.00 17.23  ? 312 SER O HG   1 
ATOM   4679  N  N    . TRP A  1 313 ? -46.577 -8.130  -72.513  1.00 8.92   ? 313 TRP O N    1 
ATOM   4680  C  CA   . TRP A  1 313 ? -46.362 -7.958  -71.084  1.00 6.42   ? 313 TRP O CA   1 
ATOM   4681  C  C    . TRP A  1 313 ? -47.127 -8.974  -70.251  1.00 10.17  ? 313 TRP O C    1 
ATOM   4682  O  O    . TRP A  1 313 ? -48.228 -9.374  -70.619  1.00 10.10  ? 313 TRP O O    1 
ATOM   4683  C  CB   . TRP A  1 313 ? -46.813 -6.563  -70.634  1.00 10.00  ? 313 TRP O CB   1 
ATOM   4684  C  CG   . TRP A  1 313 ? -46.073 -5.472  -71.272  1.00 7.03   ? 313 TRP O CG   1 
ATOM   4685  C  CD1  . TRP A  1 313 ? -46.408 -4.814  -72.417  1.00 8.54   ? 313 TRP O CD1  1 
ATOM   4686  C  CD2  . TRP A  1 313 ? -44.855 -4.892  -70.817  1.00 6.66   ? 313 TRP O CD2  1 
ATOM   4687  N  NE1  . TRP A  1 313 ? -45.477 -3.856  -72.694  1.00 13.29  ? 313 TRP O NE1  1 
ATOM   4688  C  CE2  . TRP A  1 313 ? -44.499 -3.899  -71.738  1.00 13.54  ? 313 TRP O CE2  1 
ATOM   4689  C  CE3  . TRP A  1 313 ? -44.013 -5.140  -69.733  1.00 11.40  ? 313 TRP O CE3  1 
ATOM   4690  C  CZ2  . TRP A  1 313 ? -43.363 -3.112  -71.584  1.00 10.94  ? 313 TRP O CZ2  1 
ATOM   4691  C  CZ3  . TRP A  1 313 ? -42.869 -4.379  -69.598  1.00 9.16   ? 313 TRP O CZ3  1 
ATOM   4692  C  CH2  . TRP A  1 313 ? -42.556 -3.380  -70.513  1.00 11.08  ? 313 TRP O CH2  1 
ATOM   4693  H  H    . TRP A  1 313 ? -47.265 -7.702  -72.799  1.00 10.71  ? 313 TRP O H    1 
ATOM   4694  H  HA   . TRP A  1 313 ? -45.417 -8.052  -70.887  1.00 7.71   ? 313 TRP O HA   1 
ATOM   4695  H  HB2  . TRP A  1 313 ? -47.752 -6.453  -70.852  1.00 12.01  ? 313 TRP O HB2  1 
ATOM   4696  H  HB3  . TRP A  1 313 ? -46.687 -6.488  -69.675  1.00 12.01  ? 313 TRP O HB3  1 
ATOM   4697  H  HD1  . TRP A  1 313 ? -47.170 -4.979  -72.924  1.00 10.25  ? 313 TRP O HD1  1 
ATOM   4698  H  HE1  . TRP A  1 313 ? -45.494 -3.323  -73.368  1.00 15.95  ? 313 TRP O HE1  1 
ATOM   4699  H  HE3  . TRP A  1 313 ? -44.217 -5.803  -69.115  1.00 13.68  ? 313 TRP O HE3  1 
ATOM   4700  H  HZ2  . TRP A  1 313 ? -43.141 -2.455  -72.204  1.00 13.12  ? 313 TRP O HZ2  1 
ATOM   4701  H  HZ3  . TRP A  1 313 ? -42.306 -4.526  -68.873  1.00 10.99  ? 313 TRP O HZ3  1 
ATOM   4702  H  HH2  . TRP A  1 313 ? -41.780 -2.881  -70.393  1.00 13.30  ? 313 TRP O HH2  1 
ATOM   4703  N  N    . TYR A  1 314 ? -46.579 -9.329  -69.095  1.00 9.17   ? 314 TYR O N    1 
ATOM   4704  C  CA   . TYR A  1 314 ? -47.308 -10.157 -68.153  1.00 9.86   ? 314 TYR O CA   1 
ATOM   4705  C  C    . TYR A  1 314 ? -46.903 -9.928  -66.712  1.00 7.98   ? 314 TYR O C    1 
ATOM   4706  O  O    . TYR A  1 314 ? -45.729 -9.844  -66.374  1.00 7.07   ? 314 TYR O O    1 
ATOM   4707  C  CB   . TYR A  1 314 ? -47.160 -11.656 -68.520  1.00 11.02  ? 314 TYR O CB   1 
ATOM   4708  C  CG   . TYR A  1 314 ? -45.775 -12.257 -68.575  1.00 6.04   ? 314 TYR O CG   1 
ATOM   4709  C  CD1  . TYR A  1 314 ? -44.837 -11.850 -69.518  1.00 9.62   ? 314 TYR O CD1  1 
ATOM   4710  C  CD2  . TYR A  1 314 ? -45.425 -13.274 -67.713  1.00 14.34  ? 314 TYR O CD2  1 
ATOM   4711  C  CE1  . TYR A  1 314 ? -43.588 -12.434 -69.585  1.00 10.15  ? 314 TYR O CE1  1 
ATOM   4712  C  CE2  . TYR A  1 314 ? -44.182 -13.866 -67.767  1.00 13.94  ? 314 TYR O CE2  1 
ATOM   4713  C  CZ   . TYR A  1 314 ? -43.266 -13.453 -68.714  1.00 15.07  ? 314 TYR O CZ   1 
ATOM   4714  O  OH   . TYR A  1 314 ? -42.025 -14.046 -68.767  1.00 10.03  ? 314 TYR O OH   1 
ATOM   4715  H  H    . TYR A  1 314 ? -45.790 -9.103  -68.835  1.00 11.01  ? 314 TYR O H    1 
ATOM   4716  H  HA   . TYR A  1 314 ? -48.250 -9.936  -68.223  1.00 11.83  ? 314 TYR O HA   1 
ATOM   4717  H  HB2  . TYR A  1 314 ? -47.662 -12.171 -67.870  1.00 13.23  ? 314 TYR O HB2  1 
ATOM   4718  H  HB3  . TYR A  1 314 ? -47.555 -11.786 -69.397  1.00 13.23  ? 314 TYR O HB3  1 
ATOM   4719  H  HD1  . TYR A  1 314 ? -45.057 -11.174 -70.117  1.00 11.55  ? 314 TYR O HD1  1 
ATOM   4720  H  HD2  . TYR A  1 314 ? -46.043 -13.568 -67.083  1.00 17.20  ? 314 TYR O HD2  1 
ATOM   4721  H  HE1  . TYR A  1 314 ? -42.972 -12.150 -70.221  1.00 12.18  ? 314 TYR O HE1  1 
ATOM   4722  H  HE2  . TYR A  1 314 ? -43.965 -14.551 -67.176  1.00 16.73  ? 314 TYR O HE2  1 
ATOM   4723  H  HH   . TYR A  1 314 ? -41.564 -13.693 -69.374  1.00 12.03  ? 314 TYR O HH   1 
ATOM   4724  N  N    . ASP A  1 315 ? -47.907 -9.819  -65.847  1.00 7.84   ? 315 ASP O N    1 
ATOM   4725  C  CA   . ASP A  1 315 ? -47.657 -9.866  -64.428  1.00 10.36  ? 315 ASP O CA   1 
ATOM   4726  C  C    . ASP A  1 315 ? -47.454 -11.334 -64.093  1.00 7.80   ? 315 ASP O C    1 
ATOM   4727  O  O    . ASP A  1 315 ? -48.427 -12.091 -64.034  1.00 11.15  ? 315 ASP O O    1 
ATOM   4728  C  CB   . ASP A  1 315 ? -48.805 -9.249  -63.641  1.00 6.54   ? 315 ASP O CB   1 
ATOM   4729  C  CG   . ASP A  1 315 ? -48.569 -9.288  -62.147  1.00 10.22  ? 315 ASP O CG   1 
ATOM   4730  O  OD1  . ASP A  1 315 ? -47.928 -10.253 -61.652  1.00 9.48   ? 315 ASP O OD1  1 
ATOM   4731  O  OD2  . ASP A  1 315 ? -49.004 -8.333  -61.460  1.00 14.37  ? 315 ASP O OD2  1 
ATOM   4732  H  H    . ASP A  1 315 ? -48.734 -9.719  -66.061  1.00 9.41   ? 315 ASP O H    1 
ATOM   4733  H  HA   . ASP A  1 315 ? -46.841 -9.382  -64.222  1.00 12.44  ? 315 ASP O HA   1 
ATOM   4734  H  HB2  . ASP A  1 315 ? -48.907 -8.321  -63.904  1.00 7.85   ? 315 ASP O HB2  1 
ATOM   4735  H  HB3  . ASP A  1 315 ? -49.619 -9.741  -63.830  1.00 7.85   ? 315 ASP O HB3  1 
ATOM   4736  N  N    . ASN A  1 316 ? -46.191 -11.716 -63.871  1.00 11.41  ? 316 ASN O N    1 
ATOM   4737  C  CA   . ASN A  1 316 ? -45.818 -13.119 -63.754  1.00 10.87  ? 316 ASN O CA   1 
ATOM   4738  C  C    . ASN A  1 316 ? -46.397 -13.758 -62.497  1.00 11.13  ? 316 ASN O C    1 
ATOM   4739  O  O    . ASN A  1 316 ? -46.542 -14.967 -62.434  1.00 17.17  ? 316 ASN O O    1 
ATOM   4740  C  CB   . ASN A  1 316 ? -44.282 -13.275 -63.787  1.00 14.47  ? 316 ASN O CB   1 
ATOM   4741  C  CG   . ASN A  1 316 ? -43.566 -12.217 -62.984  1.00 11.08  ? 316 ASN O CG   1 
ATOM   4742  O  OD1  . ASN A  1 316 ? -43.429 -11.064 -63.411  1.00 9.05   ? 316 ASN O OD1  1 
ATOM   4743  N  ND2  . ASN A  1 316 ? -43.130 -12.588 -61.791  1.00 9.82   ? 316 ASN O ND2  1 
ATOM   4744  H  H    . ASN A  1 316 ? -45.530 -11.172 -63.785  1.00 13.70  ? 316 ASN O H    1 
ATOM   4745  H  HA   . ASN A  1 316 ? -46.177 -13.598 -64.517  1.00 13.05  ? 316 ASN O HA   1 
ATOM   4746  H  HB2  . ASN A  1 316 ? -44.045 -14.141 -63.420  1.00 17.36  ? 316 ASN O HB2  1 
ATOM   4747  H  HB3  . ASN A  1 316 ? -43.978 -13.211 -64.706  1.00 17.36  ? 316 ASN O HB3  1 
ATOM   4748  H  HD21 . ASN A  1 316 ? -42.715 -12.026 -61.290  1.00 11.78  ? 316 ASN O HD21 1 
ATOM   4749  H  HD22 . ASN A  1 316 ? -43.262 -13.393 -61.517  1.00 11.78  ? 316 ASN O HD22 1 
ATOM   4750  N  N    . GLU A  1 317 ? -46.745 -12.953 -61.501  1.00 12.09  ? 317 GLU O N    1 
ATOM   4751  C  CA   . GLU A  1 317 ? -47.373 -13.471 -60.280  1.00 11.54  ? 317 GLU O CA   1 
ATOM   4752  C  C    . GLU A  1 317 ? -48.900 -13.546 -60.422  1.00 10.02  ? 317 GLU O C    1 
ATOM   4753  O  O    . GLU A  1 317 ? -49.543 -14.571 -60.152  1.00 14.14  ? 317 GLU O O    1 
ATOM   4754  C  CB   . GLU A  1 317 ? -47.017 -12.573 -59.078  1.00 15.78  ? 317 GLU O CB   1 
ATOM   4755  C  CG   . GLU A  1 317 ? -45.544 -12.574 -58.706  1.00 17.90  ? 317 GLU O CG   1 
ATOM   4756  C  CD   . GLU A  1 317 ? -45.235 -11.751 -57.454  1.00 16.78  ? 317 GLU O CD   1 
ATOM   4757  O  OE1  . GLU A  1 317 ? -46.042 -10.860 -57.098  1.00 13.73  ? 317 GLU O OE1  1 
ATOM   4758  O  OE2  . GLU A  1 317 ? -44.174 -12.004 -56.836  1.00 15.45  ? 317 GLU O OE2  1 
ATOM   4759  H  H    . GLU A  1 317 ? -46.630 -12.100 -61.503  1.00 14.51  ? 317 GLU O H    1 
ATOM   4760  H  HA   . GLU A  1 317 ? -47.039 -14.364 -60.102  1.00 13.84  ? 317 GLU O HA   1 
ATOM   4761  H  HB2  . GLU A  1 317 ? -47.266 -11.660 -59.288  1.00 18.93  ? 317 GLU O HB2  1 
ATOM   4762  H  HB3  . GLU A  1 317 ? -47.516 -12.879 -58.304  1.00 18.93  ? 317 GLU O HB3  1 
ATOM   4763  H  HG2  . GLU A  1 317 ? -45.263 -13.488 -58.540  1.00 21.49  ? 317 GLU O HG2  1 
ATOM   4764  H  HG3  . GLU A  1 317 ? -45.034 -12.201 -59.442  1.00 21.49  ? 317 GLU O HG3  1 
ATOM   4765  N  N    . PHE A  1 318 ? -49.480 -12.438 -60.841  1.00 10.07  ? 318 PHE O N    1 
ATOM   4766  C  CA   . PHE A  1 318 ? -50.932 -12.251 -60.774  1.00 11.61  ? 318 PHE O CA   1 
ATOM   4767  C  C    . PHE A  1 318 ? -51.728 -12.885 -61.929  1.00 12.86  ? 318 PHE O C    1 
ATOM   4768  O  O    . PHE A  1 318 ? -52.802 -13.453 -61.713  1.00 12.74  ? 318 PHE O O    1 
ATOM   4769  C  CB   . PHE A  1 318 ? -51.219 -10.751 -60.702  1.00 15.47  ? 318 PHE O CB   1 
ATOM   4770  C  CG   . PHE A  1 318 ? -52.240 -10.371 -59.667  1.00 15.71  ? 318 PHE O CG   1 
ATOM   4771  C  CD1  . PHE A  1 318 ? -53.559 -10.172 -60.018  1.00 32.23  ? 318 PHE O CD1  1 
ATOM   4772  C  CD2  . PHE A  1 318 ? -51.866 -10.187 -58.351  1.00 32.82  ? 318 PHE O CD2  1 
ATOM   4773  C  CE1  . PHE A  1 318 ? -54.497 -9.817  -59.064  1.00 31.59  ? 318 PHE O CE1  1 
ATOM   4774  C  CE2  . PHE A  1 318 ? -52.792 -9.817  -57.395  1.00 30.02  ? 318 PHE O CE2  1 
ATOM   4775  C  CZ   . PHE A  1 318 ? -54.111 -9.633  -57.756  1.00 32.10  ? 318 PHE O CZ   1 
ATOM   4776  H  H    . PHE A  1 318 ? -49.057 -11.768 -61.174  1.00 12.08  ? 318 PHE O H    1 
ATOM   4777  H  HA   . PHE A  1 318 ? -51.253 -12.649 -59.949  1.00 13.93  ? 318 PHE O HA   1 
ATOM   4778  H  HB2  . PHE A  1 318 ? -50.395 -10.285 -60.489  1.00 18.56  ? 318 PHE O HB2  1 
ATOM   4779  H  HB3  . PHE A  1 318 ? -51.549 -10.455 -61.565  1.00 18.56  ? 318 PHE O HB3  1 
ATOM   4780  H  HD1  . PHE A  1 318 ? -53.823 -10.294 -60.901  1.00 38.67  ? 318 PHE O HD1  1 
ATOM   4781  H  HD2  . PHE A  1 318 ? -50.977 -10.308 -58.105  1.00 39.39  ? 318 PHE O HD2  1 
ATOM   4782  H  HE1  . PHE A  1 318 ? -55.385 -9.688  -59.309  1.00 37.91  ? 318 PHE O HE1  1 
ATOM   4783  H  HE2  . PHE A  1 318 ? -52.530 -9.702  -56.510  1.00 36.02  ? 318 PHE O HE2  1 
ATOM   4784  H  HZ   . PHE A  1 318 ? -54.740 -9.393  -57.114  1.00 38.52  ? 318 PHE O HZ   1 
ATOM   4785  N  N    . GLY A  1 319 ? -51.221 -12.780 -63.151  1.00 9.81   ? 319 GLY O N    1 
ATOM   4786  C  CA   . GLY A  1 319 ? -51.857 -13.431 -64.285  1.00 11.63  ? 319 GLY O CA   1 
ATOM   4787  C  C    . GLY A  1 319 ? -51.918 -14.939 -64.057  1.00 7.53   ? 319 GLY O C    1 
ATOM   4788  O  O    . GLY A  1 319 ? -52.983 -15.551 -64.079  1.00 13.29  ? 319 GLY O O    1 
ATOM   4789  H  H    . GLY A  1 319 ? -50.511 -12.338 -63.349  1.00 11.77  ? 319 GLY O H    1 
ATOM   4790  H  HA2  . GLY A  1 319 ? -52.759 -13.092 -64.397  1.00 13.95  ? 319 GLY O HA2  1 
ATOM   4791  H  HA3  . GLY A  1 319 ? -51.351 -13.254 -65.093  1.00 13.95  ? 319 GLY O HA3  1 
ATOM   4792  N  N    . TYR A  1 320 ? -50.754 -15.519 -63.802  1.00 9.42   ? 320 TYR O N    1 
ATOM   4793  C  CA   . TYR A  1 320 ? -50.612 -16.947 -63.595  1.00 10.65  ? 320 TYR O CA   1 
ATOM   4794  C  C    . TYR A  1 320 ? -51.500 -17.480 -62.466  1.00 13.54  ? 320 TYR O C    1 
ATOM   4795  O  O    . TYR A  1 320 ? -52.136 -18.510 -62.615  1.00 12.61  ? 320 TYR O O    1 
ATOM   4796  C  CB   . TYR A  1 320 ? -49.156 -17.280 -63.294  1.00 8.96   ? 320 TYR O CB   1 
ATOM   4797  C  CG   . TYR A  1 320 ? -48.893 -18.758 -63.301  1.00 7.48   ? 320 TYR O CG   1 
ATOM   4798  C  CD1  . TYR A  1 320 ? -48.711 -19.436 -64.491  1.00 7.51   ? 320 TYR O CD1  1 
ATOM   4799  C  CD2  . TYR A  1 320 ? -48.827 -19.484 -62.114  1.00 12.09  ? 320 TYR O CD2  1 
ATOM   4800  C  CE1  . TYR A  1 320 ? -48.465 -20.799 -64.516  1.00 8.49   ? 320 TYR O CE1  1 
ATOM   4801  C  CE2  . TYR A  1 320 ? -48.586 -20.861 -62.128  1.00 16.33  ? 320 TYR O CE2  1 
ATOM   4802  C  CZ   . TYR A  1 320 ? -48.401 -21.504 -63.330  1.00 16.61  ? 320 TYR O CZ   1 
ATOM   4803  O  OH   . TYR A  1 320 ? -48.143 -22.852 -63.359  1.00 11.21  ? 320 TYR O OH   1 
ATOM   4804  H  H    . TYR A  1 320 ? -50.011 -15.091 -63.743  1.00 11.30  ? 320 TYR O H    1 
ATOM   4805  H  HA   . TYR A  1 320 ? -50.861 -17.408 -64.411  1.00 12.77  ? 320 TYR O HA   1 
ATOM   4806  H  HB2  . TYR A  1 320 ? -48.592 -16.870 -63.968  1.00 10.75  ? 320 TYR O HB2  1 
ATOM   4807  H  HB3  . TYR A  1 320 ? -48.928 -16.937 -62.416  1.00 10.75  ? 320 TYR O HB3  1 
ATOM   4808  H  HD1  . TYR A  1 320 ? -48.749 -18.966 -65.292  1.00 9.02   ? 320 TYR O HD1  1 
ATOM   4809  H  HD2  . TYR A  1 320 ? -48.950 -19.048 -61.302  1.00 14.51  ? 320 TYR O HD2  1 
ATOM   4810  H  HE1  . TYR A  1 320 ? -48.339 -21.236 -65.327  1.00 10.19  ? 320 TYR O HE1  1 
ATOM   4811  H  HE2  . TYR A  1 320 ? -48.537 -21.336 -61.330  1.00 19.60  ? 320 TYR O HE2  1 
ATOM   4812  H  HH   . TYR A  1 320 ? -48.047 -23.110 -64.153  1.00 13.46  ? 320 TYR O HH   1 
ATOM   4813  N  N    . SER A  1 321 ? -51.541 -16.763 -61.347  1.00 12.02  ? 321 SER O N    1 
ATOM   4814  C  CA   . SER A  1 321 ? -52.300 -17.189 -60.182  1.00 12.91  ? 321 SER O CA   1 
ATOM   4815  C  C    . SER A  1 321 ? -53.780 -17.247 -60.519  1.00 10.94  ? 321 SER O C    1 
ATOM   4816  O  O    . SER A  1 321 ? -54.505 -18.168 -60.125  1.00 10.26  ? 321 SER O O    1 
ATOM   4817  C  CB   . SER A  1 321 ? -52.049 -16.238 -59.003  1.00 18.09  ? 321 SER O CB   1 
ATOM   4818  O  OG   . SER A  1 321 ? -50.771 -16.476 -58.447  1.00 21.06  ? 321 SER O OG   1 
ATOM   4819  H  H    . SER A  1 321 ? -51.130 -16.015 -61.239  1.00 14.43  ? 321 SER O H    1 
ATOM   4820  H  HA   . SER A  1 321 ? -52.013 -18.079 -59.921  1.00 15.50  ? 321 SER O HA   1 
ATOM   4821  H  HB2  . SER A  1 321 ? -52.093 -15.322 -59.318  1.00 21.70  ? 321 SER O HB2  1 
ATOM   4822  H  HB3  . SER A  1 321 ? -52.724 -16.390 -58.323  1.00 21.70  ? 321 SER O HB3  1 
ATOM   4823  H  HG   . SER A  1 321 ? -50.177 -16.350 -59.028  1.00 25.27  ? 321 SER O HG   1 
ATOM   4824  N  N    . ASN A  1 322 ? -54.237 -16.264 -61.274  1.00 8.62   ? 322 ASN O N    1 
ATOM   4825  C  CA   . ASN A  1 322 ? -55.608 -16.306 -61.744  1.00 14.58  ? 322 ASN O CA   1 
ATOM   4826  C  C    . ASN A  1 322 ? -55.875 -17.444 -62.729  1.00 9.36   ? 322 ASN O C    1 
ATOM   4827  O  O    . ASN A  1 322 ? -56.966 -17.991 -62.727  1.00 9.76   ? 322 ASN O O    1 
ATOM   4828  C  CB   . ASN A  1 322 ? -55.996 -14.965 -62.362  1.00 18.67  ? 322 ASN O CB   1 
ATOM   4829  C  CG   . ASN A  1 322 ? -56.450 -13.976 -61.311  1.00 18.20  ? 322 ASN O CG   1 
ATOM   4830  O  OD1  . ASN A  1 322 ? -57.616 -13.935 -60.971  1.00 20.36  ? 322 ASN O OD1  1 
ATOM   4831  N  ND2  . ASN A  1 322 ? -55.505 -13.237 -60.728  1.00 15.69  ? 322 ASN O ND2  1 
ATOM   4832  H  H    . ASN A  1 322 ? -53.786 -15.575 -61.523  1.00 10.34  ? 322 ASN O H    1 
ATOM   4833  H  HA   . ASN A  1 322 ? -56.187 -16.448 -60.979  1.00 17.50  ? 322 ASN O HA   1 
ATOM   4834  H  HB2  . ASN A  1 322 ? -55.227 -14.590 -62.820  1.00 22.40  ? 322 ASN O HB2  1 
ATOM   4835  H  HB3  . ASN A  1 322 ? -56.725 -15.100 -62.987  1.00 22.40  ? 322 ASN O HB3  1 
ATOM   4836  H  HD21 . ASN A  1 322 ? -55.720 -12.662 -60.125  1.00 18.82  ? 322 ASN O HD21 1 
ATOM   4837  H  HD22 . ASN A  1 322 ? -54.681 -13.335 -60.954  1.00 18.82  ? 322 ASN O HD22 1 
ATOM   4838  N  N    . ARG A  1 323 ? -54.891 -17.808 -63.549  1.00 9.90   ? 323 ARG O N    1 
ATOM   4839  C  CA   . ARG A  1 323 ? -55.087 -18.886 -64.492  1.00 9.92   ? 323 ARG O CA   1 
ATOM   4840  C  C    . ARG A  1 323 ? -55.165 -20.224 -63.740  1.00 9.45   ? 323 ARG O C    1 
ATOM   4841  O  O    . ARG A  1 323 ? -55.885 -21.107 -64.156  1.00 11.07  ? 323 ARG O O    1 
ATOM   4842  C  CB   . ARG A  1 323 ? -53.979 -18.932 -65.538  1.00 10.07  ? 323 ARG O CB   1 
ATOM   4843  C  CG   . ARG A  1 323 ? -53.990 -17.790 -66.591  1.00 8.35   ? 323 ARG O CG   1 
ATOM   4844  C  CD   . ARG A  1 323 ? -55.304 -17.631 -67.359  1.00 10.14  ? 323 ARG O CD   1 
ATOM   4845  N  NE   . ARG A  1 323 ? -56.252 -16.783 -66.651  1.00 10.17  ? 323 ARG O NE   1 
ATOM   4846  C  CZ   . ARG A  1 323 ? -56.150 -15.467 -66.569  1.00 11.02  ? 323 ARG O CZ   1 
ATOM   4847  N  NH1  . ARG A  1 323 ? -55.126 -14.837 -67.150  1.00 10.84  ? 323 ARG O NH1  1 
ATOM   4848  N  NH2  . ARG A  1 323 ? -57.057 -14.787 -65.888  1.00 12.85  ? 323 ARG O NH2  1 
ATOM   4849  H  H    . ARG A  1 323 ? -54.112 -17.446 -63.574  1.00 11.88  ? 323 ARG O H    1 
ATOM   4850  H  HA   . ARG A  1 323 ? -55.929 -18.752 -64.954  1.00 11.91  ? 323 ARG O HA   1 
ATOM   4851  H  HB2  . ARG A  1 323 ? -53.125 -18.894 -65.080  1.00 12.08  ? 323 ARG O HB2  1 
ATOM   4852  H  HB3  . ARG A  1 323 ? -54.049 -19.770 -66.021  1.00 12.08  ? 323 ARG O HB3  1 
ATOM   4853  H  HG2  . ARG A  1 323 ? -53.813 -16.950 -66.137  1.00 10.02  ? 323 ARG O HG2  1 
ATOM   4854  H  HG3  . ARG A  1 323 ? -53.290 -17.962 -67.240  1.00 10.02  ? 323 ARG O HG3  1 
ATOM   4855  H  HD2  . ARG A  1 323 ? -55.121 -17.226 -68.221  1.00 12.17  ? 323 ARG O HD2  1 
ATOM   4856  H  HD3  . ARG A  1 323 ? -55.709 -18.504 -67.479  1.00 12.17  ? 323 ARG O HD3  1 
ATOM   4857  H  HE   . ARG A  1 323 ? -56.880 -17.167 -66.207  1.00 12.20  ? 323 ARG O HE   1 
ATOM   4858  H  HH11 . ARG A  1 323 ? -54.536 -15.286 -67.587  1.00 13.00  ? 323 ARG O HH11 1 
ATOM   4859  H  HH12 . ARG A  1 323 ? -55.060 -13.981 -67.094  1.00 13.00  ? 323 ARG O HH12 1 
ATOM   4860  H  HH21 . ARG A  1 323 ? -57.714 -15.200 -65.516  1.00 15.42  ? 323 ARG O HH21 1 
ATOM   4861  H  HH22 . ARG A  1 323 ? -57.000 -13.931 -65.831  1.00 15.42  ? 323 ARG O HH22 1 
ATOM   4862  N  N    . VAL A  1 324 ? -54.420 -20.373 -62.647  1.00 11.36  ? 324 VAL O N    1 
ATOM   4863  C  CA   . VAL A  1 324 ? -54.496 -21.599 -61.848  1.00 9.83   ? 324 VAL O CA   1 
ATOM   4864  C  C    . VAL A  1 324 ? -55.930 -21.766 -61.344  1.00 10.47  ? 324 VAL O C    1 
ATOM   4865  O  O    . VAL A  1 324 ? -56.504 -22.843 -61.438  1.00 11.03  ? 324 VAL O O    1 
ATOM   4866  C  CB   . VAL A  1 324 ? -53.515 -21.589 -60.663  1.00 11.65  ? 324 VAL O CB   1 
ATOM   4867  C  CG1  . VAL A  1 324 ? -53.733 -22.804 -59.764  1.00 14.37  ? 324 VAL O CG1  1 
ATOM   4868  C  CG2  . VAL A  1 324 ? -52.076 -21.585 -61.163  1.00 19.22  ? 324 VAL O CG2  1 
ATOM   4869  H  H    . VAL A  1 324 ? -53.867 -19.787 -62.346  1.00 13.63  ? 324 VAL O H    1 
ATOM   4870  H  HA   . VAL A  1 324 ? -54.283 -22.360 -62.411  1.00 11.80  ? 324 VAL O HA   1 
ATOM   4871  H  HB   . VAL A  1 324 ? -53.657 -20.788 -60.134  1.00 13.98  ? 324 VAL O HB   1 
ATOM   4872  H  HG11 . VAL A  1 324 ? -53.102 -22.769 -59.029  1.00 17.25  ? 324 VAL O HG11 1 
ATOM   4873  H  HG12 . VAL A  1 324 ? -54.641 -22.785 -59.423  1.00 17.25  ? 324 VAL O HG12 1 
ATOM   4874  H  HG13 . VAL A  1 324 ? -53.591 -23.610 -60.285  1.00 17.25  ? 324 VAL O HG13 1 
ATOM   4875  H  HG21 . VAL A  1 324 ? -51.477 -21.579 -60.400  1.00 23.07  ? 324 VAL O HG21 1 
ATOM   4876  H  HG22 . VAL A  1 324 ? -51.925 -22.382 -61.695  1.00 23.07  ? 324 VAL O HG22 1 
ATOM   4877  H  HG23 . VAL A  1 324 ? -51.932 -20.793 -61.703  1.00 23.07  ? 324 VAL O HG23 1 
ATOM   4878  N  N    . VAL A  1 325 ? -56.524 -20.693 -60.833  1.00 10.48  ? 325 VAL O N    1 
ATOM   4879  C  CA   . VAL A  1 325 ? -57.920 -20.754 -60.388  1.00 12.55  ? 325 VAL O CA   1 
ATOM   4880  C  C    . VAL A  1 325 ? -58.901 -21.056 -61.538  1.00 11.50  ? 325 VAL O C    1 
ATOM   4881  O  O    . VAL A  1 325 ? -59.818 -21.867 -61.384  1.00 12.20  ? 325 VAL O O    1 
ATOM   4882  C  CB   . VAL A  1 325 ? -58.324 -19.433 -59.697  1.00 11.18  ? 325 VAL O CB   1 
ATOM   4883  C  CG1  . VAL A  1 325 ? -59.823 -19.352 -59.490  1.00 13.19  ? 325 VAL O CG1  1 
ATOM   4884  C  CG2  . VAL A  1 325 ? -57.594 -19.320 -58.371  1.00 12.92  ? 325 VAL O CG2  1 
ATOM   4885  H  H    . VAL A  1 325 ? -56.149 -19.926 -60.732  1.00 12.57  ? 325 VAL O H    1 
ATOM   4886  H  HA   . VAL A  1 325 ? -58.006 -21.466 -59.735  1.00 15.06  ? 325 VAL O HA   1 
ATOM   4887  H  HB   . VAL A  1 325 ? -58.055 -18.687 -60.255  1.00 13.42  ? 325 VAL O HB   1 
ATOM   4888  H  HG11 . VAL A  1 325 ? -60.036 -18.512 -59.055  1.00 15.82  ? 325 VAL O HG11 1 
ATOM   4889  H  HG12 . VAL A  1 325 ? -60.263 -19.400 -60.353  1.00 15.82  ? 325 VAL O HG12 1 
ATOM   4890  H  HG13 . VAL A  1 325 ? -60.105 -20.095 -58.933  1.00 15.82  ? 325 VAL O HG13 1 
ATOM   4891  H  HG21 . VAL A  1 325 ? -57.850 -18.490 -57.940  1.00 15.51  ? 325 VAL O HG21 1 
ATOM   4892  H  HG22 . VAL A  1 325 ? -57.838 -20.073 -57.811  1.00 15.51  ? 325 VAL O HG22 1 
ATOM   4893  H  HG23 . VAL A  1 325 ? -56.638 -19.326 -58.536  1.00 15.51  ? 325 VAL O HG23 1 
ATOM   4894  N  N    . ASP A  1 326 ? -58.722 -20.377 -62.671  1.00 11.08  ? 326 ASP O N    1 
ATOM   4895  C  CA   . ASP A  1 326 ? -59.546 -20.591 -63.846  1.00 11.40  ? 326 ASP O CA   1 
ATOM   4896  C  C    . ASP A  1 326 ? -59.470 -22.043 -64.302  1.00 17.05  ? 326 ASP O C    1 
ATOM   4897  O  O    . ASP A  1 326 ? -60.463 -22.643 -64.670  1.00 14.13  ? 326 ASP O O    1 
ATOM   4898  C  CB   . ASP A  1 326 ? -59.105 -19.701 -65.006  1.00 13.16  ? 326 ASP O CB   1 
ATOM   4899  C  CG   . ASP A  1 326 ? -59.373 -18.212 -64.768  1.00 25.32  ? 326 ASP O CG   1 
ATOM   4900  O  OD1  . ASP A  1 326 ? -60.188 -17.854 -63.887  1.00 18.77  ? 326 ASP O OD1  1 
ATOM   4901  O  OD2  . ASP A  1 326 ? -58.770 -17.394 -65.497  1.00 16.44  ? 326 ASP O OD2  1 
ATOM   4902  H  H    . ASP A  1 326 ? -58.116 -19.776 -62.779  1.00 13.29  ? 326 ASP O H    1 
ATOM   4903  H  HA   . ASP A  1 326 ? -60.470 -20.384 -63.634  1.00 13.68  ? 326 ASP O HA   1 
ATOM   4904  H  HB2  . ASP A  1 326 ? -58.151 -19.813 -65.143  1.00 15.79  ? 326 ASP O HB2  1 
ATOM   4905  H  HB3  . ASP A  1 326 ? -59.586 -19.966 -65.806  1.00 15.79  ? 326 ASP O HB3  1 
ATOM   4906  N  N    . LEU A  1 327 ? -58.267 -22.584 -64.317  1.00 11.52  ? 327 LEU O N    1 
ATOM   4907  C  CA   . LEU A  1 327 ? -58.069 -23.971 -64.717  1.00 11.68  ? 327 LEU O CA   1 
ATOM   4908  C  C    . LEU A  1 327 ? -58.845 -24.905 -63.797  1.00 12.46  ? 327 LEU O C    1 
ATOM   4909  O  O    . LEU A  1 327 ? -59.571 -25.782 -64.250  1.00 13.10  ? 327 LEU O O    1 
ATOM   4910  C  CB   . LEU A  1 327 ? -56.563 -24.307 -64.697  1.00 11.18  ? 327 LEU O CB   1 
ATOM   4911  C  CG   . LEU A  1 327 ? -56.174 -25.738 -65.078  1.00 13.62  ? 327 LEU O CG   1 
ATOM   4912  C  CD1  . LEU A  1 327 ? -56.687 -26.092 -66.477  1.00 16.83  ? 327 LEU O CD1  1 
ATOM   4913  C  CD2  . LEU A  1 327 ? -54.652 -25.914 -64.995  1.00 16.13  ? 327 LEU O CD2  1 
ATOM   4914  H  H    . LEU A  1 327 ? -57.544 -22.172 -64.100  1.00 13.83  ? 327 LEU O H    1 
ATOM   4915  H  HA   . LEU A  1 327 ? -58.396 -24.093 -65.622  1.00 14.01  ? 327 LEU O HA   1 
ATOM   4916  H  HB2  . LEU A  1 327 ? -56.112 -23.713 -65.317  1.00 13.42  ? 327 LEU O HB2  1 
ATOM   4917  H  HB3  . LEU A  1 327 ? -56.229 -24.148 -63.801  1.00 13.42  ? 327 LEU O HB3  1 
ATOM   4918  H  HG   . LEU A  1 327 ? -56.581 -26.353 -64.447  1.00 16.34  ? 327 LEU O HG   1 
ATOM   4919  H  HD11 . LEU A  1 327 ? -56.426 -27.002 -66.688  1.00 20.20  ? 327 LEU O HD11 1 
ATOM   4920  H  HD12 . LEU A  1 327 ? -57.654 -26.014 -66.487  1.00 20.20  ? 327 LEU O HD12 1 
ATOM   4921  H  HD13 . LEU A  1 327 ? -56.298 -25.478 -67.119  1.00 20.20  ? 327 LEU O HD13 1 
ATOM   4922  H  HD21 . LEU A  1 327 ? -54.427 -26.825 -65.239  1.00 19.36  ? 327 LEU O HD21 1 
ATOM   4923  H  HD22 . LEU A  1 327 ? -54.229 -25.292 -65.608  1.00 19.36  ? 327 LEU O HD22 1 
ATOM   4924  H  HD23 . LEU A  1 327 ? -54.363 -25.733 -64.087  1.00 19.36  ? 327 LEU O HD23 1 
ATOM   4925  N  N    . MET A  1 328 ? -58.722 -24.711 -62.492  1.00 12.48  ? 328 MET O N    1 
ATOM   4926  C  CA   . MET A  1 328 ? -59.418 -25.605 -61.579  1.00 13.30  ? 328 MET O CA   1 
ATOM   4927  C  C    . MET A  1 328 ? -60.931 -25.481 -61.738  1.00 13.98  ? 328 MET O C    1 
ATOM   4928  O  O    . MET A  1 328 ? -61.649 -26.471 -61.640  1.00 14.78  ? 328 MET O O    1 
ATOM   4929  C  CB   . MET A  1 328 ? -59.023 -25.335 -60.141  1.00 13.26  ? 328 MET O CB   1 
ATOM   4930  C  CG   . MET A  1 328 ? -57.576 -25.734 -59.854  1.00 14.41  ? 328 MET O CG   1 
ATOM   4931  S  SD   . MET A  1 328 ? -57.158 -25.620 -58.110  1.00 15.96  ? 328 MET O SD   1 
ATOM   4932  C  CE   . MET A  1 328 ? -57.268 -23.854 -57.897  1.00 12.42  ? 328 MET O CE   1 
ATOM   4933  H  H    . MET A  1 328 ? -58.258 -24.091 -62.119  1.00 14.98  ? 328 MET O H    1 
ATOM   4934  H  HA   . MET A  1 328 ? -59.161 -26.518 -61.786  1.00 15.96  ? 328 MET O HA   1 
ATOM   4935  H  HB2  . MET A  1 328 ? -59.116 -24.387 -59.958  1.00 15.91  ? 328 MET O HB2  1 
ATOM   4936  H  HB3  . MET A  1 328 ? -59.599 -25.846 -59.551  1.00 15.91  ? 328 MET O HB3  1 
ATOM   4937  H  HG2  . MET A  1 328 ? -57.439 -26.652 -60.137  1.00 17.30  ? 328 MET O HG2  1 
ATOM   4938  H  HG3  . MET A  1 328 ? -56.982 -25.144 -60.344  1.00 17.30  ? 328 MET O HG3  1 
ATOM   4939  H  HE1  . MET A  1 328 ? -57.061 -23.634 -56.975  1.00 14.90  ? 328 MET O HE1  1 
ATOM   4940  H  HE2  . MET A  1 328 ? -56.632 -23.424 -58.491  1.00 14.90  ? 328 MET O HE2  1 
ATOM   4941  H  HE3  . MET A  1 328 ? -58.169 -23.566 -58.113  1.00 14.90  ? 328 MET O HE3  1 
ATOM   4942  N  N    . ALA A  1 329 ? -61.408 -24.275 -62.002  1.00 13.73  ? 329 ALA O N    1 
ATOM   4943  C  CA   . ALA A  1 329 ? -62.838 -24.086 -62.186  1.00 14.44  ? 329 ALA O CA   1 
ATOM   4944  C  C    . ALA A  1 329 ? -63.298 -24.854 -63.406  1.00 14.82  ? 329 ALA O C    1 
ATOM   4945  O  O    . ALA A  1 329 ? -64.354 -25.461 -63.403  1.00 15.70  ? 329 ALA O O    1 
ATOM   4946  C  CB   . ALA A  1 329 ? -63.182 -22.603 -62.327  1.00 19.81  ? 329 ALA O CB   1 
ATOM   4947  H  H    . ALA A  1 329 ? -60.936 -23.560 -62.079  1.00 16.47  ? 329 ALA O H    1 
ATOM   4948  H  HA   . ALA A  1 329 ? -63.308 -24.434 -61.413  1.00 17.32  ? 329 ALA O HA   1 
ATOM   4949  H  HB1  . ALA A  1 329 ? -64.140 -22.511 -62.448  1.00 23.77  ? 329 ALA O HB1  1 
ATOM   4950  H  HB2  . ALA A  1 329 ? -62.903 -22.137 -61.523  1.00 23.77  ? 329 ALA O HB2  1 
ATOM   4951  H  HB3  . ALA A  1 329 ? -62.715 -22.242 -63.097  1.00 23.77  ? 329 ALA O HB3  1 
ATOM   4952  N  N    . HIS A  1 330 ? -62.507 -24.809 -64.467  1.00 14.74  ? 330 HIS O N    1 
ATOM   4953  C  CA   . HIS A  1 330 ? -62.865 -25.539 -65.668  1.00 14.63  ? 330 HIS O CA   1 
ATOM   4954  C  C    . HIS A  1 330 ? -62.841 -27.052 -65.425  1.00 15.25  ? 330 HIS O C    1 
ATOM   4955  O  O    . HIS A  1 330 ? -63.746 -27.775 -65.838  1.00 16.08  ? 330 HIS O O    1 
ATOM   4956  C  CB   . HIS A  1 330 ? -61.924 -25.179 -66.804  1.00 14.34  ? 330 HIS O CB   1 
ATOM   4957  C  CG   . HIS A  1 330 ? -62.256 -25.890 -68.064  1.00 17.02  ? 330 HIS O CG   1 
ATOM   4958  N  ND1  . HIS A  1 330 ? -61.555 -26.993 -68.495  1.00 16.39  ? 330 HIS O ND1  1 
ATOM   4959  C  CD2  . HIS A  1 330 ? -63.249 -25.694 -68.963  1.00 14.84  ? 330 HIS O CD2  1 
ATOM   4960  C  CE1  . HIS A  1 330 ? -62.100 -27.445 -69.610  1.00 15.37  ? 330 HIS O CE1  1 
ATOM   4961  N  NE2  . HIS A  1 330 ? -63.129 -26.677 -69.911  1.00 22.65  ? 330 HIS O NE2  1 
ATOM   4962  H  H    . HIS A  1 330 ? -61.770 -24.370 -64.517  1.00 17.69  ? 330 HIS O H    1 
ATOM   4963  H  HA   . HIS A  1 330 ? -63.765 -25.292 -65.933  1.00 17.55  ? 330 HIS O HA   1 
ATOM   4964  H  HB2  . HIS A  1 330 ? -61.982 -24.226 -66.972  1.00 17.21  ? 330 HIS O HB2  1 
ATOM   4965  H  HB3  . HIS A  1 330 ? -61.018 -25.419 -66.553  1.00 17.21  ? 330 HIS O HB3  1 
ATOM   4966  H  HD2  . HIS A  1 330 ? -63.896 -25.026 -68.937  1.00 17.81  ? 330 HIS O HD2  1 
ATOM   4967  H  HE1  . HIS A  1 330 ? -61.802 -28.173 -70.105  1.00 18.45  ? 330 HIS O HE1  1 
ATOM   4968  N  N    . MET A  1 331 ? -61.821 -27.534 -64.727  1.00 14.96  ? 331 MET O N    1 
ATOM   4969  C  CA   . MET A  1 331 ? -61.769 -28.943 -64.357  1.00 15.64  ? 331 MET O CA   1 
ATOM   4970  C  C    . MET A  1 331 ? -63.024 -29.372 -63.604  1.00 16.63  ? 331 MET O C    1 
ATOM   4971  O  O    . MET A  1 331 ? -63.595 -30.424 -63.890  1.00 17.48  ? 331 MET O O    1 
ATOM   4972  C  CB   . MET A  1 331 ? -60.537 -29.230 -63.500  1.00 15.24  ? 331 MET O CB   1 
ATOM   4973  C  CG   . MET A  1 331 ? -59.232 -29.008 -64.226  1.00 14.43  ? 331 MET O CG   1 
ATOM   4974  S  SD   . MET A  1 331 ? -57.844 -28.875 -63.085  1.00 18.92  ? 331 MET O SD   1 
ATOM   4975  C  CE   . MET A  1 331 ? -57.835 -30.494 -62.338  1.00 14.86  ? 331 MET O CE   1 
ATOM   4976  H  H    . MET A  1 331 ? -61.149 -27.070 -64.457  1.00 17.95  ? 331 MET O H    1 
ATOM   4977  H  HA   . MET A  1 331 ? -61.696 -29.473 -65.166  1.00 18.76  ? 331 MET O HA   1 
ATOM   4978  H  HB2  . MET A  1 331 ? -60.551 -28.646 -62.726  1.00 18.29  ? 331 MET O HB2  1 
ATOM   4979  H  HB3  . MET A  1 331 ? -60.564 -30.157 -63.213  1.00 18.29  ? 331 MET O HB3  1 
ATOM   4980  H  HG2  . MET A  1 331 ? -59.065 -29.756 -64.820  1.00 17.31  ? 331 MET O HG2  1 
ATOM   4981  H  HG3  . MET A  1 331 ? -59.286 -28.183 -64.734  1.00 17.31  ? 331 MET O HG3  1 
ATOM   4982  H  HE1  . MET A  1 331 ? -57.112 -30.539 -61.692  1.00 17.83  ? 331 MET O HE1  1 
ATOM   4983  H  HE2  . MET A  1 331 ? -58.685 -30.642 -61.895  1.00 17.83  ? 331 MET O HE2  1 
ATOM   4984  H  HE3  . MET A  1 331 ? -57.702 -31.161 -63.030  1.00 17.83  ? 331 MET O HE3  1 
ATOM   4985  N  N    . ALA A  1 332 ? -63.444 -28.560 -62.640  1.00 16.60  ? 332 ALA O N    1 
ATOM   4986  C  CA   . ALA A  1 332 ? -64.582 -28.918 -61.800  1.00 17.59  ? 332 ALA O CA   1 
ATOM   4987  C  C    . ALA A  1 332 ? -65.863 -28.986 -62.614  1.00 18.32  ? 332 ALA O C    1 
ATOM   4988  O  O    . ALA A  1 332 ? -66.734 -29.784 -62.305  1.00 19.36  ? 332 ALA O O    1 
ATOM   4989  C  CB   . ALA A  1 332 ? -64.738 -27.926 -60.666  1.00 20.29  ? 332 ALA O CB   1 
ATOM   4990  H  H    . ALA A  1 332 ? -63.089 -27.800 -62.452  1.00 19.92  ? 332 ALA O H    1 
ATOM   4991  H  HA   . ALA A  1 332 ? -64.426 -29.793 -61.414  1.00 21.11  ? 332 ALA O HA   1 
ATOM   4992  H  HB1  . ALA A  1 332 ? -65.499 -28.185 -60.123  1.00 24.34  ? 332 ALA O HB1  1 
ATOM   4993  H  HB2  . ALA A  1 332 ? -63.930 -27.933 -60.128  1.00 24.34  ? 332 ALA O HB2  1 
ATOM   4994  H  HB3  . ALA A  1 332 ? -64.881 -27.042 -61.037  1.00 24.34  ? 332 ALA O HB3  1 
ATOM   4995  N  N    . SER A  1 333 ? -65.971 -28.132 -63.632  1.00 17.85  ? 333 SER O N    1 
ATOM   4996  C  CA   . SER A  1 333 ? -67.149 -28.090 -64.498  1.00 24.98  ? 333 SER O CA   1 
ATOM   4997  C  C    . SER A  1 333 ? -67.278 -29.379 -65.312  1.00 32.97  ? 333 SER O C    1 
ATOM   4998  O  O    . SER A  1 333 ? -68.360 -29.724 -65.769  1.00 20.08  ? 333 SER O O    1 
ATOM   4999  C  CB   . SER A  1 333 ? -67.088 -26.886 -65.437  1.00 25.18  ? 333 SER O CB   1 
ATOM   5000  O  OG   . SER A  1 333 ? -66.163 -27.096 -66.491  1.00 25.97  ? 333 SER O OG   1 
ATOM   5001  H  H    . SER A  1 333 ? -65.366 -27.559 -63.845  1.00 21.42  ? 333 SER O H    1 
ATOM   5002  H  HA   . SER A  1 333 ? -67.942 -28.002 -63.948  1.00 29.97  ? 333 SER O HA   1 
ATOM   5003  H  HB2  . SER A  1 333 ? -67.969 -26.739 -65.817  1.00 30.21  ? 333 SER O HB2  1 
ATOM   5004  H  HB3  . SER A  1 333 ? -66.814 -26.106 -64.930  1.00 30.21  ? 333 SER O HB3  1 
ATOM   5005  H  HG   . SER A  1 333 ? -65.394 -27.223 -66.178  1.00 31.16  ? 333 SER O HG   1 
ATOM   5006  N  N    . LYS A  1 334 ? -66.167 -30.092 -65.468  1.00 21.34  ? 334 LYS O N    1 
ATOM   5007  C  CA   . LYS A  1 334 ? -66.114 -31.328 -66.254  1.00 25.62  ? 334 LYS O CA   1 
ATOM   5008  C  C    . LYS A  1 334 ? -66.413 -32.598 -65.438  1.00 37.80  ? 334 LYS O C    1 
ATOM   5009  O  O    . LYS A  1 334 ? -66.707 -33.646 -66.014  1.00 34.15  ? 334 LYS O O    1 
ATOM   5010  C  CB   . LYS A  1 334 ? -64.725 -31.473 -66.898  1.00 28.96  ? 334 LYS O CB   1 
ATOM   5011  C  CG   . LYS A  1 334 ? -64.557 -30.888 -68.298  1.00 40.59  ? 334 LYS O CG   1 
ATOM   5012  C  CD   . LYS A  1 334 ? -63.874 -31.896 -69.242  1.00 49.66  ? 334 LYS O CD   1 
ATOM   5013  C  CE   . LYS A  1 334 ? -64.517 -31.917 -70.615  1.00 57.03  ? 334 LYS O CE   1 
ATOM   5014  N  NZ   . LYS A  1 334 ? -63.946 -32.991 -71.483  1.00 70.98  ? 334 LYS O NZ   1 
ATOM   5015  H  H    . LYS A  1 334 ? -65.411 -29.876 -65.120  1.00 25.61  ? 334 LYS O H    1 
ATOM   5016  H  HA   . LYS A  1 334 ? -66.768 -31.272 -66.967  1.00 30.74  ? 334 LYS O HA   1 
ATOM   5017  H  HB2  . LYS A  1 334 ? -64.077 -31.035 -66.325  1.00 34.76  ? 334 LYS O HB2  1 
ATOM   5018  H  HB3  . LYS A  1 334 ? -64.515 -32.419 -66.955  1.00 34.76  ? 334 LYS O HB3  1 
ATOM   5019  H  HG2  . LYS A  1 334 ? -65.429 -30.672 -68.663  1.00 48.71  ? 334 LYS O HG2  1 
ATOM   5020  H  HG3  . LYS A  1 334 ? -64.005 -30.092 -68.250  1.00 48.71  ? 334 LYS O HG3  1 
ATOM   5021  H  HD2  . LYS A  1 334 ? -62.941 -31.650 -69.350  1.00 59.59  ? 334 LYS O HD2  1 
ATOM   5022  H  HD3  . LYS A  1 334 ? -63.943 -32.785 -68.862  1.00 59.59  ? 334 LYS O HD3  1 
ATOM   5023  H  HE2  . LYS A  1 334 ? -65.468 -32.081 -70.518  1.00 68.43  ? 334 LYS O HE2  1 
ATOM   5024  H  HE3  . LYS A  1 334 ? -64.367 -31.064 -71.051  1.00 68.43  ? 334 LYS O HE3  1 
ATOM   5025  H  HZ1  . LYS A  1 334 ? -64.341 -32.979 -72.280  1.00 85.17  ? 334 LYS O HZ1  1 
ATOM   5026  H  HZ2  . LYS A  1 334 ? -63.072 -32.860 -71.592  1.00 85.17  ? 334 LYS O HZ2  1 
ATOM   5027  H  HZ3  . LYS A  1 334 ? -64.075 -33.787 -71.107  1.00 85.17  ? 334 LYS O HZ3  1 
ATOM   5028  N  N    . GLU A  1 335 ? -66.318 -32.525 -64.110  1.00 30.26  ? 335 GLU O N    1 
ATOM   5029  C  CA   . GLU A  1 335 ? -66.503 -33.715 -63.283  1.00 34.30  ? 335 GLU O CA   1 
ATOM   5030  C  C    . GLU A  1 335 ? -67.884 -34.300 -63.537  1.00 55.51  ? 335 GLU O C    1 
ATOM   5031  O  O    . GLU A  1 335 ? -68.053 -35.521 -63.595  1.00 52.13  ? 335 GLU O O    1 
ATOM   5032  C  CB   . GLU A  1 335 ? -66.346 -33.406 -61.794  1.00 30.22  ? 335 GLU O CB   1 
ATOM   5033  C  CG   . GLU A  1 335 ? -64.994 -32.825 -61.387  1.00 26.50  ? 335 GLU O CG   1 
ATOM   5034  C  CD   . GLU A  1 335 ? -63.881 -33.865 -61.215  1.00 41.21  ? 335 GLU O CD   1 
ATOM   5035  O  OE1  . GLU A  1 335 ? -62.773 -33.453 -60.790  1.00 25.71  ? 335 GLU O OE1  1 
ATOM   5036  O  OE2  . GLU A  1 335 ? -64.096 -35.072 -61.503  1.00 31.74  ? 335 GLU O OE2  1 
ATOM   5037  O  OXT  . GLU A  1 335 ? -68.849 -33.547 -63.697  1.00 64.85  ? 335 GLU O OXT  1 
ATOM   5038  H  H    . GLU A  1 335 ? -66.149 -31.806 -63.669  1.00 36.32  ? 335 GLU O H    1 
ATOM   5039  H  HA   . GLU A  1 335 ? -65.841 -34.380 -63.527  1.00 41.16  ? 335 GLU O HA   1 
ATOM   5040  H  HB2  . GLU A  1 335 ? -67.028 -32.765 -61.540  1.00 36.27  ? 335 GLU O HB2  1 
ATOM   5041  H  HB3  . GLU A  1 335 ? -66.472 -34.229 -61.295  1.00 36.27  ? 335 GLU O HB3  1 
ATOM   5042  H  HG2  . GLU A  1 335 ? -64.708 -32.198 -62.070  1.00 31.80  ? 335 GLU O HG2  1 
ATOM   5043  H  HG3  . GLU A  1 335 ? -65.098 -32.362 -60.541  1.00 31.80  ? 335 GLU O HG3  1 
ATOM   5044  N  N    . LYS B  1 3   ? 0.640   -57.716 -126.358 1.00 22.44  ? 3   LYS A N    1 
ATOM   5045  C  CA   . LYS B  1 3   ? 0.914   -59.147 -126.259 1.00 29.29  ? 3   LYS A CA   1 
ATOM   5046  C  C    . LYS B  1 3   ? -0.181  -60.035 -126.875 1.00 19.90  ? 3   LYS A C    1 
ATOM   5047  O  O    . LYS B  1 3   ? 0.072   -60.574 -127.920 1.00 18.44  ? 3   LYS A O    1 
ATOM   5048  C  CB   . LYS B  1 3   ? 1.142   -59.589 -124.820 1.00 22.31  ? 3   LYS A CB   1 
ATOM   5049  C  CG   . LYS B  1 3   ? 1.786   -60.894 -124.760 1.00 22.95  ? 3   LYS A CG   1 
ATOM   5050  C  CD   . LYS B  1 3   ? 1.981   -61.447 -123.372 1.00 42.66  ? 3   LYS A CD   1 
ATOM   5051  C  CE   . LYS B  1 3   ? 2.811   -62.722 -123.441 1.00 56.79  ? 3   LYS A CE   1 
ATOM   5052  N  NZ   . LYS B  1 3   ? 3.435   -63.080 -122.131 1.00 75.27  ? 3   LYS A NZ   1 
ATOM   5053  H  HA   . LYS B  1 3   ? 1.733   -59.328 -126.745 1.00 35.15  ? 3   LYS A HA   1 
ATOM   5054  H  HB2  . LYS B  1 3   ? 1.715   -58.946 -124.375 1.00 26.77  ? 3   LYS A HB2  1 
ATOM   5055  H  HB3  . LYS B  1 3   ? 0.288   -59.650 -124.365 1.00 26.77  ? 3   LYS A HB3  1 
ATOM   5056  H  HG2  . LYS B  1 3   ? 1.244   -61.528 -125.254 1.00 27.54  ? 3   LYS A HG2  1 
ATOM   5057  H  HG3  . LYS B  1 3   ? 2.662   -60.825 -125.173 1.00 27.54  ? 3   LYS A HG3  1 
ATOM   5058  H  HD2  . LYS B  1 3   ? 2.453   -60.799 -122.826 1.00 51.19  ? 3   LYS A HD2  1 
ATOM   5059  H  HD3  . LYS B  1 3   ? 1.119   -61.660 -122.981 1.00 51.19  ? 3   LYS A HD3  1 
ATOM   5060  H  HE2  . LYS B  1 3   ? 2.239   -63.457 -123.711 1.00 68.15  ? 3   LYS A HE2  1 
ATOM   5061  H  HE3  . LYS B  1 3   ? 3.523   -62.600 -124.089 1.00 68.15  ? 3   LYS A HE3  1 
ATOM   5062  H  HZ1  . LYS B  1 3   ? 3.910   -63.829 -122.215 1.00 90.32  ? 3   LYS A HZ1  1 
ATOM   5063  H  HZ2  . LYS B  1 3   ? 3.974   -62.425 -121.862 1.00 90.32  ? 3   LYS A HZ2  1 
ATOM   5064  H  HZ3  . LYS B  1 3   ? 2.803   -63.206 -121.517 1.00 90.32  ? 3   LYS A HZ3  1 
ATOM   5065  N  N    . VAL B  1 4   ? -1.354  -60.243 -126.258 1.00 14.02  ? 4   VAL A N    1 
ATOM   5066  C  CA   . VAL B  1 4   ? -2.283  -61.234 -126.852 1.00 12.49  ? 4   VAL A CA   1 
ATOM   5067  C  C    . VAL B  1 4   ? -2.848  -60.694 -128.166 1.00 11.32  ? 4   VAL A C    1 
ATOM   5068  O  O    . VAL B  1 4   ? -3.129  -59.495 -128.317 1.00 10.40  ? 4   VAL A O    1 
ATOM   5069  C  CB   . VAL B  1 4   ? -3.444  -61.670 -125.891 1.00 12.25  ? 4   VAL A CB   1 
ATOM   5070  C  CG1  . VAL B  1 4   ? -4.432  -60.565 -125.635 1.00 9.45   ? 4   VAL A CG1  1 
ATOM   5071  C  CG2  . VAL B  1 4   ? -4.191  -62.905 -126.456 1.00 16.27  ? 4   VAL A CG2  1 
ATOM   5072  H  H    . VAL B  1 4   ? -1.627  -59.854 -125.541 1.00 16.83  ? 4   VAL A H    1 
ATOM   5073  H  HA   . VAL B  1 4   ? -1.775  -62.032 -127.066 1.00 14.99  ? 4   VAL A HA   1 
ATOM   5074  H  HB   . VAL B  1 4   ? -3.060  -61.924 -125.038 1.00 14.70  ? 4   VAL A HB   1 
ATOM   5075  H  HG11 . VAL B  1 4   ? -5.122  -60.891 -125.038 1.00 11.34  ? 4   VAL A HG11 1 
ATOM   5076  H  HG12 . VAL B  1 4   ? -3.968  -59.816 -125.227 1.00 11.34  ? 4   VAL A HG12 1 
ATOM   5077  H  HG13 . VAL B  1 4   ? -4.825  -60.291 -126.478 1.00 11.34  ? 4   VAL A HG13 1 
ATOM   5078  H  HG21 . VAL B  1 4   ? -4.901  -63.151 -125.843 1.00 19.53  ? 4   VAL A HG21 1 
ATOM   5079  H  HG22 . VAL B  1 4   ? -4.564  -62.679 -127.322 1.00 19.53  ? 4   VAL A HG22 1 
ATOM   5080  H  HG23 . VAL B  1 4   ? -3.563  -63.639 -126.547 1.00 19.53  ? 4   VAL A HG23 1 
ATOM   5081  N  N    . LYS B  1 5   ? -2.967  -61.581 -129.146 1.00 10.19  ? 5   LYS A N    1 
ATOM   5082  C  CA   . LYS B  1 5   ? -3.513  -61.207 -130.438 1.00 9.96   ? 5   LYS A CA   1 
ATOM   5083  C  C    . LYS B  1 5   ? -5.006  -61.524 -130.486 1.00 9.46   ? 5   LYS A C    1 
ATOM   5084  O  O    . LYS B  1 5   ? -5.442  -62.619 -130.083 1.00 9.54   ? 5   LYS A O    1 
ATOM   5085  C  CB   . LYS B  1 5   ? -2.789  -61.926 -131.567 1.00 10.53  ? 5   LYS A CB   1 
ATOM   5086  C  CG   . LYS B  1 5   ? -1.306  -61.591 -131.684 1.00 14.30  ? 5   LYS A CG   1 
ATOM   5087  C  CD   . LYS B  1 5   ? -0.678  -62.358 -132.812 1.00 17.77  ? 5   LYS A CD   1 
ATOM   5088  C  CE   . LYS B  1 5   ? 0.812   -62.576 -132.612 1.00 31.36  ? 5   LYS A CE   1 
ATOM   5089  N  NZ   . LYS B  1 5   ? 1.538   -61.351 -132.265 1.00 29.60  ? 5   LYS A NZ   1 
ATOM   5090  H  H    . LYS B  1 5   ? -2.739  -62.408 -129.085 1.00 12.23  ? 5   LYS A H    1 
ATOM   5091  H  HA   . LYS B  1 5   ? -3.401  -60.252 -130.567 1.00 11.95  ? 5   LYS A HA   1 
ATOM   5092  H  HB2  . LYS B  1 5   ? -2.864  -62.883 -131.423 1.00 12.64  ? 5   LYS A HB2  1 
ATOM   5093  H  HB3  . LYS B  1 5   ? -3.212  -61.689 -132.407 1.00 12.64  ? 5   LYS A HB3  1 
ATOM   5094  H  HG2  . LYS B  1 5   ? -1.203  -60.643 -131.862 1.00 17.16  ? 5   LYS A HG2  1 
ATOM   5095  H  HG3  . LYS B  1 5   ? -0.855  -61.832 -130.860 1.00 17.16  ? 5   LYS A HG3  1 
ATOM   5096  H  HD2  . LYS B  1 5   ? -1.103  -63.228 -132.879 1.00 21.32  ? 5   LYS A HD2  1 
ATOM   5097  H  HD3  . LYS B  1 5   ? -0.801  -61.864 -133.638 1.00 21.32  ? 5   LYS A HD3  1 
ATOM   5098  H  HE2  . LYS B  1 5   ? 0.943   -63.214 -131.893 1.00 37.64  ? 5   LYS A HE2  1 
ATOM   5099  H  HE3  . LYS B  1 5   ? 1.192   -62.924 -133.435 1.00 37.64  ? 5   LYS A HE3  1 
ATOM   5100  H  HZ1  . LYS B  1 5   ? 1.444   -60.748 -132.913 1.00 35.52  ? 5   LYS A HZ1  1 
ATOM   5101  H  HZ2  . LYS B  1 5   ? 1.217   -61.012 -131.506 1.00 35.52  ? 5   LYS A HZ2  1 
ATOM   5102  H  HZ3  . LYS B  1 5   ? 2.403   -61.529 -132.158 1.00 35.52  ? 5   LYS A HZ3  1 
ATOM   5103  N  N    . VAL B  1 6   ? -5.760  -60.578 -131.027 1.00 9.08   ? 6   VAL A N    1 
ATOM   5104  C  CA   . VAL B  1 6   ? -7.219  -60.560 -130.935 1.00 8.68   ? 6   VAL A CA   1 
ATOM   5105  C  C    . VAL B  1 6   ? -7.913  -60.482 -132.291 1.00 8.75   ? 6   VAL A C    1 
ATOM   5106  O  O    . VAL B  1 6   ? -7.508  -59.714 -133.181 1.00 9.38   ? 6   VAL A O    1 
ATOM   5107  C  CB   . VAL B  1 6   ? -7.650  -59.370 -130.057 1.00 10.56  ? 6   VAL A CB   1 
ATOM   5108  C  CG1  . VAL B  1 6   ? -9.161  -59.227 -129.953 1.00 14.69  ? 6   VAL A CG1  1 
ATOM   5109  C  CG2  . VAL B  1 6   ? -7.056  -59.548 -128.667 1.00 10.68  ? 6   VAL A CG2  1 
ATOM   5110  H  H    . VAL B  1 6   ? -5.441  -59.913 -131.469 1.00 10.90  ? 6   VAL A H    1 
ATOM   5111  H  HA   . VAL B  1 6   ? -7.515  -61.374 -130.497 1.00 10.42  ? 6   VAL A HA   1 
ATOM   5112  H  HB   . VAL B  1 6   ? -7.294  -58.550 -130.435 1.00 12.68  ? 6   VAL A HB   1 
ATOM   5113  H  HG11 . VAL B  1 6   ? -9.367  -58.464 -129.390 1.00 17.63  ? 6   VAL A HG11 1 
ATOM   5114  H  HG12 . VAL B  1 6   ? -9.527  -59.092 -130.841 1.00 17.63  ? 6   VAL A HG12 1 
ATOM   5115  H  HG13 . VAL B  1 6   ? -9.528  -60.035 -129.562 1.00 17.63  ? 6   VAL A HG13 1 
ATOM   5116  H  HG21 . VAL B  1 6   ? -7.325  -58.800 -128.111 1.00 12.81  ? 6   VAL A HG21 1 
ATOM   5117  H  HG22 . VAL B  1 6   ? -7.385  -60.378 -128.288 1.00 12.81  ? 6   VAL A HG22 1 
ATOM   5118  H  HG23 . VAL B  1 6   ? -6.089  -59.576 -128.738 1.00 12.81  ? 6   VAL A HG23 1 
ATOM   5119  N  N    . GLY B  1 7   ? -8.973  -61.278 -132.436 1.00 8.70   ? 7   GLY A N    1 
ATOM   5120  C  CA   . GLY B  1 7   ? -9.943  -61.105 -133.507 1.00 13.18  ? 7   GLY A CA   1 
ATOM   5121  C  C    . GLY B  1 7   ? -11.247 -60.482 -133.012 1.00 10.21  ? 7   GLY A C    1 
ATOM   5122  O  O    . GLY B  1 7   ? -11.661 -60.678 -131.860 1.00 10.26  ? 7   GLY A O    1 
ATOM   5123  H  H    . GLY B  1 7   ? -9.153  -61.937 -131.913 1.00 10.44  ? 7   GLY A H    1 
ATOM   5124  H  HA2  . GLY B  1 7   ? -9.568  -60.532 -134.193 1.00 15.82  ? 7   GLY A HA2  1 
ATOM   5125  H  HA3  . GLY B  1 7   ? -10.144 -61.968 -133.902 1.00 15.82  ? 7   GLY A HA3  1 
ATOM   5126  N  N    . VAL B  1 8   ? -11.873 -59.686 -133.862 1.00 9.68   ? 8   VAL A N    1 
ATOM   5127  C  CA   . VAL B  1 8   ? -13.125 -59.032 -133.525 1.00 8.32   ? 8   VAL A CA   1 
ATOM   5128  C  C    . VAL B  1 8   ? -14.200 -59.548 -134.473 1.00 11.98  ? 8   VAL A C    1 
ATOM   5129  O  O    . VAL B  1 8   ? -14.077 -59.440 -135.699 1.00 10.40  ? 8   VAL A O    1 
ATOM   5130  C  CB   . VAL B  1 8   ? -13.019 -57.507 -133.621 1.00 8.39   ? 8   VAL A CB   1 
ATOM   5131  C  CG1  . VAL B  1 8   ? -14.379 -56.844 -133.297 1.00 8.14   ? 8   VAL A CG1  1 
ATOM   5132  C  CG2  . VAL B  1 8   ? -11.922 -56.984 -132.704 1.00 12.89  ? 8   VAL A CG2  1 
ATOM   5133  H  H    . VAL B  1 8   ? -11.588 -59.506 -134.654 1.00 11.61  ? 8   VAL A H    1 
ATOM   5134  H  HA   . VAL B  1 8   ? -13.377 -59.266 -132.618 1.00 9.99   ? 8   VAL A HA   1 
ATOM   5135  H  HB   . VAL B  1 8   ? -12.783 -57.267 -134.530 1.00 10.07  ? 8   VAL A HB   1 
ATOM   5136  H  HG11 . VAL B  1 8   ? -14.285 -55.881 -133.365 1.00 9.77   ? 8   VAL A HG11 1 
ATOM   5137  H  HG12 . VAL B  1 8   ? -15.041 -57.157 -133.933 1.00 9.77   ? 8   VAL A HG12 1 
ATOM   5138  H  HG13 . VAL B  1 8   ? -14.643 -57.089 -132.397 1.00 9.77   ? 8   VAL A HG13 1 
ATOM   5139  H  HG21 . VAL B  1 8   ? -11.878 -56.018 -132.784 1.00 15.47  ? 8   VAL A HG21 1 
ATOM   5140  H  HG22 . VAL B  1 8   ? -12.131 -57.231 -131.789 1.00 15.47  ? 8   VAL A HG22 1 
ATOM   5141  H  HG23 . VAL B  1 8   ? -11.076 -57.377 -132.968 1.00 15.47  ? 8   VAL A HG23 1 
ATOM   5142  N  N    . ASN B  1 9   ? -15.244 -60.154 -133.915 1.00 8.91   ? 9   ASN A N    1 
ATOM   5143  C  CA   . ASN B  1 9   ? -16.380 -60.548 -134.728 1.00 9.43   ? 9   ASN A CA   1 
ATOM   5144  C  C    . ASN B  1 9   ? -17.509 -59.551 -134.566 1.00 15.49  ? 9   ASN A C    1 
ATOM   5145  O  O    . ASN B  1 9   ? -18.060 -59.417 -133.480 1.00 11.34  ? 9   ASN A O    1 
ATOM   5146  C  CB   . ASN B  1 9   ? -16.866 -61.947 -134.365 1.00 10.82  ? 9   ASN A CB   1 
ATOM   5147  C  CG   . ASN B  1 9   ? -17.723 -62.549 -135.443 1.00 12.05  ? 9   ASN A CG   1 
ATOM   5148  O  OD1  . ASN B  1 9   ? -17.491 -62.311 -136.622 1.00 16.14  ? 9   ASN A OD1  1 
ATOM   5149  N  ND2  . ASN B  1 9   ? -18.748 -63.297 -135.052 1.00 11.91  ? 9   ASN A ND2  1 
ATOM   5150  H  H    . ASN B  1 9   ? -15.317 -60.344 -133.079 1.00 10.69  ? 9   ASN A H    1 
ATOM   5151  H  HA   . ASN B  1 9   ? -16.115 -60.554 -135.661 1.00 11.32  ? 9   ASN A HA   1 
ATOM   5152  H  HB2  . ASN B  1 9   ? -16.099 -62.525 -134.230 1.00 12.98  ? 9   ASN A HB2  1 
ATOM   5153  H  HB3  . ASN B  1 9   ? -17.394 -61.898 -133.552 1.00 12.98  ? 9   ASN A HB3  1 
ATOM   5154  H  HD21 . ASN B  1 9   ? -19.263 -63.660 -135.637 1.00 14.30  ? 9   ASN A HD21 1 
ATOM   5155  H  HD22 . ASN B  1 9   ? -18.897 -63.418 -134.214 1.00 14.30  ? 9   ASN A HD22 1 
ATOM   5156  N  N    . GLY B  1 10  ? -17.858 -58.871 -135.653 1.00 12.59  ? 10  GLY A N    1 
ATOM   5157  C  CA   . GLY B  1 10  ? -18.860 -57.815 -135.614 1.00 12.10  ? 10  GLY A CA   1 
ATOM   5158  C  C    . GLY B  1 10  ? -18.192 -56.460 -135.424 1.00 19.58  ? 10  GLY A C    1 
ATOM   5159  O  O    . GLY B  1 10  ? -17.802 -56.094 -134.314 1.00 20.71  ? 10  GLY A O    1 
ATOM   5160  H  H    . GLY B  1 10  ? -17.524 -59.005 -136.435 1.00 15.11  ? 10  GLY A H    1 
ATOM   5161  H  HA2  . GLY B  1 10  ? -19.361 -57.805 -136.445 1.00 14.52  ? 10  GLY A HA2  1 
ATOM   5162  H  HA3  . GLY B  1 10  ? -19.473 -57.970 -134.879 1.00 14.52  ? 10  GLY A HA3  1 
ATOM   5163  N  N    . PHE B  1 11  ? -18.096 -55.704 -136.510 1.00 13.56  ? 11  PHE A N    1 
ATOM   5164  C  CA   . PHE B  1 11  ? -17.383 -54.423 -136.513 1.00 18.57  ? 11  PHE A CA   1 
ATOM   5165  C  C    . PHE B  1 11  ? -18.368 -53.256 -136.343 1.00 22.29  ? 11  PHE A C    1 
ATOM   5166  O  O    . PHE B  1 11  ? -18.446 -52.370 -137.190 1.00 12.24  ? 11  PHE A O    1 
ATOM   5167  C  CB   . PHE B  1 11  ? -16.603 -54.306 -137.825 1.00 12.89  ? 11  PHE A CB   1 
ATOM   5168  C  CG   . PHE B  1 11  ? -15.431 -53.363 -137.777 1.00 10.24  ? 11  PHE A CG   1 
ATOM   5169  C  CD1  . PHE B  1 11  ? -14.470 -53.470 -136.802 1.00 9.14   ? 11  PHE A CD1  1 
ATOM   5170  C  CD2  . PHE B  1 11  ? -15.297 -52.375 -138.736 1.00 13.03  ? 11  PHE A CD2  1 
ATOM   5171  C  CE1  . PHE B  1 11  ? -13.376 -52.608 -136.777 1.00 14.15  ? 11  PHE A CE1  1 
ATOM   5172  C  CE2  . PHE B  1 11  ? -14.220 -51.520 -138.724 1.00 11.52  ? 11  PHE A CE2  1 
ATOM   5173  C  CZ   . PHE B  1 11  ? -13.245 -51.645 -137.766 1.00 12.33  ? 11  PHE A CZ   1 
ATOM   5174  H  H    . PHE B  1 11  ? -18.440 -55.910 -137.271 1.00 16.27  ? 11  PHE A H    1 
ATOM   5175  H  HA   . PHE B  1 11  ? -16.751 -54.403 -135.777 1.00 22.28  ? 11  PHE A HA   1 
ATOM   5176  H  HB2  . PHE B  1 11  ? -16.265 -55.183 -138.064 1.00 15.47  ? 11  PHE A HB2  1 
ATOM   5177  H  HB3  . PHE B  1 11  ? -17.206 -53.989 -138.516 1.00 15.47  ? 11  PHE A HB3  1 
ATOM   5178  H  HD1  . PHE B  1 11  ? -14.545 -54.134 -136.155 1.00 10.97  ? 11  PHE A HD1  1 
ATOM   5179  H  HD2  . PHE B  1 11  ? -15.937 -52.297 -139.406 1.00 15.64  ? 11  PHE A HD2  1 
ATOM   5180  H  HE1  . PHE B  1 11  ? -12.727 -52.694 -136.117 1.00 16.98  ? 11  PHE A HE1  1 
ATOM   5181  H  HE2  . PHE B  1 11  ? -14.141 -50.866 -139.380 1.00 13.83  ? 11  PHE A HE2  1 
ATOM   5182  H  HZ   . PHE B  1 11  ? -12.529 -51.051 -137.747 1.00 14.80  ? 11  PHE A HZ   1 
ATOM   5183  N  N    . GLY B  1 12  ? -19.115 -53.270 -135.238 1.00 17.08  ? 12  GLY A N    1 
ATOM   5184  C  CA   . GLY B  1 12  ? -20.168 -52.305 -134.997 1.00 13.53  ? 12  GLY A CA   1 
ATOM   5185  C  C    . GLY B  1 12  ? -19.701 -51.263 -134.028 1.00 17.27  ? 12  GLY A C    1 
ATOM   5186  O  O    . GLY B  1 12  ? -18.515 -51.007 -133.935 1.00 18.26  ? 12  GLY A O    1 
ATOM   5187  H  H    . GLY B  1 12  ? -19.023 -53.844 -134.605 1.00 20.49  ? 12  GLY A H    1 
ATOM   5188  H  HA2  . GLY B  1 12  ? -20.417 -51.872 -135.828 1.00 16.24  ? 12  GLY A HA2  1 
ATOM   5189  H  HA3  . GLY B  1 12  ? -20.947 -52.751 -134.628 1.00 16.24  ? 12  GLY A HA3  1 
ATOM   5190  N  N    . ARG B  1 13  ? -20.623 -50.640 -133.304 1.00 12.37  ? 13  ARG A N    1 
ATOM   5191  C  CA   . ARG B  1 13  ? -20.196 -49.633 -132.352 1.00 10.93  ? 13  ARG A CA   1 
ATOM   5192  C  C    . ARG B  1 13  ? -19.157 -50.239 -131.437 1.00 14.18  ? 13  ARG A C    1 
ATOM   5193  O  O    . ARG B  1 13  ? -18.084 -49.663 -131.249 1.00 15.29  ? 13  ARG A O    1 
ATOM   5194  C  CB   . ARG B  1 13  ? -21.371 -49.087 -131.550 1.00 15.00  ? 13  ARG A CB   1 
ATOM   5195  C  CG   . ARG B  1 13  ? -22.447 -48.446 -132.409 1.00 21.93  ? 13  ARG A CG   1 
ATOM   5196  C  CD   . ARG B  1 13  ? -21.911 -47.304 -133.249 1.00 21.06  ? 13  ARG A CD   1 
ATOM   5197  N  NE   . ARG B  1 13  ? -21.387 -46.216 -132.427 1.00 16.59  ? 13  ARG A NE   1 
ATOM   5198  C  CZ   . ARG B  1 13  ? -20.435 -45.379 -132.825 1.00 17.49  ? 13  ARG A CZ   1 
ATOM   5199  N  NH1  . ARG B  1 13  ? -19.905 -45.498 -134.045 1.00 19.36  ? 13  ARG A NH1  1 
ATOM   5200  N  NH2  . ARG B  1 13  ? -19.998 -44.429 -132.002 1.00 17.49  ? 13  ARG A NH2  1 
ATOM   5201  H  H    . ARG B  1 13  ? -21.472 -50.776 -133.344 1.00 14.84  ? 13  ARG A H    1 
ATOM   5202  H  HA   . ARG B  1 13  ? -19.787 -48.894 -132.830 1.00 13.11  ? 13  ARG A HA   1 
ATOM   5203  H  HB2  . ARG B  1 13  ? -21.780 -49.816 -131.057 1.00 18.00  ? 13  ARG A HB2  1 
ATOM   5204  H  HB3  . ARG B  1 13  ? -21.044 -48.415 -130.932 1.00 18.00  ? 13  ARG A HB3  1 
ATOM   5205  H  HG2  . ARG B  1 13  ? -22.815 -49.114 -133.009 1.00 26.32  ? 13  ARG A HG2  1 
ATOM   5206  H  HG3  . ARG B  1 13  ? -23.145 -48.094 -131.834 1.00 26.32  ? 13  ARG A HG3  1 
ATOM   5207  H  HD2  . ARG B  1 13  ? -21.192 -47.633 -133.810 1.00 25.27  ? 13  ARG A HD2  1 
ATOM   5208  H  HD3  . ARG B  1 13  ? -22.628 -46.949 -133.798 1.00 25.27  ? 13  ARG A HD3  1 
ATOM   5209  H  HE   . ARG B  1 13  ? -21.650 -46.167 -131.609 1.00 19.90  ? 13  ARG A HE   1 
ATOM   5210  H  HH11 . ARG B  1 13  ? -20.181 -46.116 -134.575 1.00 23.23  ? 13  ARG A HH11 1 
ATOM   5211  H  HH12 . ARG B  1 13  ? -19.290 -44.954 -134.300 1.00 23.23  ? 13  ARG A HH12 1 
ATOM   5212  H  HH21 . ARG B  1 13  ? -20.340 -44.349 -131.217 1.00 20.99  ? 13  ARG A HH21 1 
ATOM   5213  H  HH22 . ARG B  1 13  ? -19.387 -43.882 -132.262 1.00 20.99  ? 13  ARG A HH22 1 
ATOM   5214  N  N    . ILE B  1 14  ? -19.455 -51.406 -130.880 1.00 11.47  ? 14  ILE A N    1 
ATOM   5215  C  CA   . ILE B  1 14  ? -18.531 -52.005 -129.916 1.00 13.15  ? 14  ILE A CA   1 
ATOM   5216  C  C    . ILE B  1 14  ? -17.291 -52.588 -130.596 1.00 8.54   ? 14  ILE A C    1 
ATOM   5217  O  O    . ILE B  1 14  ? -16.171 -52.365 -130.141 1.00 11.94  ? 14  ILE A O    1 
ATOM   5218  C  CB   . ILE B  1 14  ? -19.224 -53.095 -129.073 1.00 16.55  ? 14  ILE A CB   1 
ATOM   5219  C  CG1  . ILE B  1 14  ? -20.367 -52.476 -128.262 1.00 26.20  ? 14  ILE A CG1  1 
ATOM   5220  C  CG2  . ILE B  1 14  ? -18.223 -53.750 -128.113 1.00 17.78  ? 14  ILE A CG2  1 
ATOM   5221  C  CD1  . ILE B  1 14  ? -19.930 -51.292 -127.371 1.00 24.44  ? 14  ILE A CD1  1 
ATOM   5222  H  H    . ILE B  1 14  ? -20.167 -51.864 -131.035 1.00 13.76  ? 14  ILE A H    1 
ATOM   5223  H  HA   . ILE B  1 14  ? -18.231 -51.312 -129.308 1.00 15.78  ? 14  ILE A HA   1 
ATOM   5224  H  HB   . ILE B  1 14  ? -19.585 -53.772 -129.666 1.00 19.86  ? 14  ILE A HB   1 
ATOM   5225  H  HG12 . ILE B  1 14  ? -21.045 -52.152 -128.876 1.00 31.44  ? 14  ILE A HG12 1 
ATOM   5226  H  HG13 . ILE B  1 14  ? -20.746 -53.158 -127.685 1.00 31.44  ? 14  ILE A HG13 1 
ATOM   5227  H  HG21 . ILE B  1 14  ? -18.681 -54.430 -127.595 1.00 21.34  ? 14  ILE A HG21 1 
ATOM   5228  H  HG22 . ILE B  1 14  ? -17.508 -54.153 -128.630 1.00 21.34  ? 14  ILE A HG22 1 
ATOM   5229  H  HG23 . ILE B  1 14  ? -17.862 -53.071 -127.522 1.00 21.34  ? 14  ILE A HG23 1 
ATOM   5230  H  HD11 . ILE B  1 14  ? -20.704 -50.956 -126.892 1.00 29.33  ? 14  ILE A HD11 1 
ATOM   5231  H  HD12 . ILE B  1 14  ? -19.260 -51.601 -126.742 1.00 29.33  ? 14  ILE A HD12 1 
ATOM   5232  H  HD13 . ILE B  1 14  ? -19.560 -50.594 -127.934 1.00 29.33  ? 14  ILE A HD13 1 
ATOM   5233  N  N    . GLY B  1 15  ? -17.475 -53.319 -131.684 1.00 13.12  ? 15  GLY A N    1 
ATOM   5234  C  CA   . GLY B  1 15  ? -16.326 -53.845 -132.405 1.00 10.17  ? 15  GLY A CA   1 
ATOM   5235  C  C    . GLY B  1 15  ? -15.356 -52.774 -132.824 1.00 13.78  ? 15  GLY A C    1 
ATOM   5236  O  O    . GLY B  1 15  ? -14.156 -52.910 -132.628 1.00 11.82  ? 15  GLY A O    1 
ATOM   5237  H  H    . GLY B  1 15  ? -18.240 -53.522 -132.021 1.00 15.75  ? 15  GLY A H    1 
ATOM   5238  H  HA2  . GLY B  1 15  ? -15.855 -54.479 -131.841 1.00 12.20  ? 15  GLY A HA2  1 
ATOM   5239  H  HA3  . GLY B  1 15  ? -16.630 -54.310 -133.200 1.00 12.20  ? 15  GLY A HA3  1 
ATOM   5240  N  N    . ARG B  1 16  ? -15.871 -51.685 -133.386 1.00 10.00  ? 16  ARG A N    1 
ATOM   5241  C  CA   . ARG B  1 16  ? -14.984 -50.595 -133.822 1.00 8.75   ? 16  ARG A CA   1 
ATOM   5242  C  C    . ARG B  1 16  ? -14.330 -49.881 -132.657 1.00 10.40  ? 16  ARG A C    1 
ATOM   5243  O  O    . ARG B  1 16  ? -13.153 -49.518 -132.707 1.00 12.67  ? 16  ARG A O    1 
ATOM   5244  C  CB   . ARG B  1 16  ? -15.752 -49.585 -134.690 1.00 9.41   ? 16  ARG A CB   1 
ATOM   5245  C  CG   . ARG B  1 16  ? -16.281 -50.205 -135.959 1.00 11.57  ? 16  ARG A CG   1 
ATOM   5246  C  CD   . ARG B  1 16  ? -16.602 -49.191 -137.059 1.00 12.48  ? 16  ARG A CD   1 
ATOM   5247  N  NE   . ARG B  1 16  ? -17.698 -48.264 -136.748 1.00 10.82  ? 16  ARG A NE   1 
ATOM   5248  C  CZ   . ARG B  1 16  ? -18.994 -48.556 -136.765 1.00 13.15  ? 16  ARG A CZ   1 
ATOM   5249  N  NH1  . ARG B  1 16  ? -19.421 -49.788 -137.028 1.00 12.88  ? 16  ARG A NH1  1 
ATOM   5250  N  NH2  . ARG B  1 16  ? -19.889 -47.600 -136.506 1.00 14.35  ? 16  ARG A NH2  1 
ATOM   5251  H  H    . ARG B  1 16  ? -16.708 -51.548 -133.527 1.00 12.00  ? 16  ARG A H    1 
ATOM   5252  H  HA   . ARG B  1 16  ? -14.277 -50.972 -134.368 1.00 10.50  ? 16  ARG A HA   1 
ATOM   5253  H  HB2  . ARG B  1 16  ? -16.506 -49.241 -134.186 1.00 11.29  ? 16  ARG A HB2  1 
ATOM   5254  H  HB3  . ARG B  1 16  ? -15.157 -48.859 -134.935 1.00 11.29  ? 16  ARG A HB3  1 
ATOM   5255  H  HG2  . ARG B  1 16  ? -15.615 -50.819 -136.307 1.00 13.88  ? 16  ARG A HG2  1 
ATOM   5256  H  HG3  . ARG B  1 16  ? -17.097 -50.688 -135.754 1.00 13.88  ? 16  ARG A HG3  1 
ATOM   5257  H  HD2  . ARG B  1 16  ? -15.809 -48.659 -137.230 1.00 14.98  ? 16  ARG A HD2  1 
ATOM   5258  H  HD3  . ARG B  1 16  ? -16.848 -49.675 -137.863 1.00 14.98  ? 16  ARG A HD3  1 
ATOM   5259  H  HE   . ARG B  1 16  ? -17.481 -47.460 -136.535 1.00 12.98  ? 16  ARG A HE   1 
ATOM   5260  H  HH11 . ARG B  1 16  ? -18.855 -50.410 -137.208 1.00 15.46  ? 16  ARG A HH11 1 
ATOM   5261  H  HH12 . ARG B  1 16  ? -20.263 -49.960 -137.026 1.00 15.46  ? 16  ARG A HH12 1 
ATOM   5262  H  HH21 . ARG B  1 16  ? -19.625 -46.802 -136.322 1.00 17.23  ? 16  ARG A HH21 1 
ATOM   5263  H  HH22 . ARG B  1 16  ? -20.727 -47.788 -136.493 1.00 17.23  ? 16  ARG A HH22 1 
ATOM   5264  N  N    . LEU B  1 17  ? -15.077 -49.676 -131.582 1.00 11.08  ? 17  LEU A N    1 
ATOM   5265  C  CA   . LEU B  1 17  ? -14.492 -48.961 -130.467 1.00 12.56  ? 17  LEU A CA   1 
ATOM   5266  C  C    . LEU B  1 17  ? -13.547 -49.834 -129.636 1.00 8.92   ? 17  LEU A C    1 
ATOM   5267  O  O    . LEU B  1 17  ? -12.615 -49.329 -129.027 1.00 12.41  ? 17  LEU A O    1 
ATOM   5268  C  CB   . LEU B  1 17  ? -15.606 -48.362 -129.611 1.00 17.42  ? 17  LEU A CB   1 
ATOM   5269  C  CG   . LEU B  1 17  ? -16.347 -47.273 -130.417 1.00 18.07  ? 17  LEU A CG   1 
ATOM   5270  C  CD1  . LEU B  1 17  ? -17.559 -46.737 -129.662 1.00 20.81  ? 17  LEU A CD1  1 
ATOM   5271  C  CD2  . LEU B  1 17  ? -15.425 -46.128 -130.821 1.00 23.21  ? 17  LEU A CD2  1 
ATOM   5272  H  H    . LEU B  1 17  ? -15.892 -49.930 -131.477 1.00 13.30  ? 17  LEU A H    1 
ATOM   5273  H  HA   . LEU B  1 17  ? -13.969 -48.223 -130.818 1.00 15.07  ? 17  LEU A HA   1 
ATOM   5274  H  HB2  . LEU B  1 17  ? -16.241 -49.054 -129.369 1.00 20.91  ? 17  LEU A HB2  1 
ATOM   5275  H  HB3  . LEU B  1 17  ? -15.225 -47.955 -128.817 1.00 20.91  ? 17  LEU A HB3  1 
ATOM   5276  H  HG   . LEU B  1 17  ? -16.676 -47.677 -131.235 1.00 21.68  ? 17  LEU A HG   1 
ATOM   5277  H  HD11 . LEU B  1 17  ? -17.993 -46.059 -130.203 1.00 24.98  ? 17  LEU A HD11 1 
ATOM   5278  H  HD12 . LEU B  1 17  ? -18.174 -47.468 -129.493 1.00 24.98  ? 17  LEU A HD12 1 
ATOM   5279  H  HD13 . LEU B  1 17  ? -17.264 -46.352 -128.822 1.00 24.98  ? 17  LEU A HD13 1 
ATOM   5280  H  HD21 . LEU B  1 17  ? -15.937 -45.474 -131.323 1.00 27.85  ? 17  LEU A HD21 1 
ATOM   5281  H  HD22 . LEU B  1 17  ? -15.060 -45.720 -130.021 1.00 27.85  ? 17  LEU A HD22 1 
ATOM   5282  H  HD23 . LEU B  1 17  ? -14.708 -46.480 -131.371 1.00 27.85  ? 17  LEU A HD23 1 
ATOM   5283  N  N    . VAL B  1 18  ? -13.774 -51.136 -129.627 1.00 9.63   ? 18  VAL A N    1 
ATOM   5284  C  CA   . VAL B  1 18  ? -12.816 -52.060 -129.025 1.00 7.90   ? 18  VAL A CA   1 
ATOM   5285  C  C    . VAL B  1 18  ? -11.505 -51.958 -129.788 1.00 7.85   ? 18  VAL A C    1 
ATOM   5286  O  O    . VAL B  1 18  ? -10.431 -51.888 -129.190 1.00 10.04  ? 18  VAL A O    1 
ATOM   5287  C  CB   . VAL B  1 18  ? -13.353 -53.520 -129.031 1.00 11.09  ? 18  VAL A CB   1 
ATOM   5288  C  CG1  . VAL B  1 18  ? -12.240 -54.528 -128.809 1.00 15.92  ? 18  VAL A CG1  1 
ATOM   5289  C  CG2  . VAL B  1 18  ? -14.417 -53.689 -127.955 1.00 10.75  ? 18  VAL A CG2  1 
ATOM   5290  H  H    . VAL B  1 18  ? -14.471 -51.514 -129.960 1.00 11.56  ? 18  VAL A H    1 
ATOM   5291  H  HA   . VAL B  1 18  ? -12.653 -51.800 -128.105 1.00 9.48   ? 18  VAL A HA   1 
ATOM   5292  H  HB   . VAL B  1 18  ? -13.761 -53.706 -129.891 1.00 13.31  ? 18  VAL A HB   1 
ATOM   5293  H  HG11 . VAL B  1 18  ? -12.617 -55.422 -128.820 1.00 19.11  ? 18  VAL A HG11 1 
ATOM   5294  H  HG12 . VAL B  1 18  ? -11.585 -54.436 -129.520 1.00 19.11  ? 18  VAL A HG12 1 
ATOM   5295  H  HG13 . VAL B  1 18  ? -11.823 -54.355 -127.951 1.00 19.11  ? 18  VAL A HG13 1 
ATOM   5296  H  HG21 . VAL B  1 18  ? -14.740 -54.604 -127.973 1.00 12.90  ? 18  VAL A HG21 1 
ATOM   5297  H  HG22 . VAL B  1 18  ? -14.025 -53.493 -127.090 1.00 12.90  ? 18  VAL A HG22 1 
ATOM   5298  H  HG23 . VAL B  1 18  ? -15.147 -53.076 -128.135 1.00 12.90  ? 18  VAL A HG23 1 
ATOM   5299  N  N    . THR B  1 19  ? -11.595 -51.912 -131.112 1.00 11.00  ? 19  THR A N    1 
ATOM   5300  C  CA   . THR B  1 19  ? -10.408 -51.742 -131.947 1.00 8.29   ? 19  THR A CA   1 
ATOM   5301  C  C    . THR B  1 19  ? -9.703  -50.426 -131.676 1.00 11.70  ? 19  THR A C    1 
ATOM   5302  O  O    . THR B  1 19  ? -8.475  -50.392 -131.538 1.00 9.95   ? 19  THR A O    1 
ATOM   5303  C  CB   . THR B  1 19  ? -10.794 -51.865 -133.438 1.00 13.88  ? 19  THR A CB   1 
ATOM   5304  O  OG1  . THR B  1 19  ? -11.372 -53.146 -133.647 1.00 10.71  ? 19  THR A OG1  1 
ATOM   5305  C  CG2  . THR B  1 19  ? -9.580  -51.763 -134.345 1.00 13.16  ? 19  THR A CG2  1 
ATOM   5306  H  H    . THR B  1 19  ? -12.330 -51.977 -131.553 1.00 13.20  ? 19  THR A H    1 
ATOM   5307  H  HA   . THR B  1 19  ? -9.783  -52.457 -131.746 1.00 9.95   ? 19  THR A HA   1 
ATOM   5308  H  HB   . THR B  1 19  ? -11.428 -51.171 -133.677 1.00 16.65  ? 19  THR A HB   1 
ATOM   5309  H  HG1  . THR B  1 19  ? -12.056 -53.234 -133.168 1.00 12.85  ? 19  THR A HG1  1 
ATOM   5310  H  HG21 . THR B  1 19  ? -9.852  -51.843 -135.273 1.00 15.80  ? 19  THR A HG21 1 
ATOM   5311  H  HG22 . THR B  1 19  ? -9.142  -50.908 -134.217 1.00 15.80  ? 19  THR A HG22 1 
ATOM   5312  H  HG23 . THR B  1 19  ? -8.952  -52.473 -134.138 1.00 15.80  ? 19  THR A HG23 1 
ATOM   5313  N  N    . ARG B  1 20  ? -10.463 -49.328 -131.575 1.00 11.94  ? 20  ARG A N    1 
ATOM   5314  C  CA   . ARG B  1 20  ? -9.873  -48.056 -131.193 1.00 12.16  ? 20  ARG A CA   1 
ATOM   5315  C  C    . ARG B  1 20  ? -9.189  -48.136 -129.854 1.00 9.67   ? 20  ARG A C    1 
ATOM   5316  O  O    . ARG B  1 20  ? -8.103  -47.613 -129.699 1.00 11.74  ? 20  ARG A O    1 
ATOM   5317  C  CB   . ARG B  1 20  ? -10.917 -46.936 -131.104 1.00 19.19  ? 20  ARG A CB   1 
ATOM   5318  C  CG   . ARG B  1 20  ? -11.172 -46.251 -132.389 1.00 18.76  ? 20  ARG A CG   1 
ATOM   5319  C  CD   . ARG B  1 20  ? -11.855 -44.911 -132.173 1.00 19.49  ? 20  ARG A CD   1 
ATOM   5320  N  NE   . ARG B  1 20  ? -12.345 -44.437 -133.455 1.00 20.87  ? 20  ARG A NE   1 
ATOM   5321  C  CZ   . ARG B  1 20  ? -12.657 -43.180 -133.723 1.00 11.63  ? 20  ARG A CZ   1 
ATOM   5322  N  NH1  . ARG B  1 20  ? -12.515 -42.247 -132.798 1.00 13.51  ? 20  ARG A NH1  1 
ATOM   5323  N  NH2  . ARG B  1 20  ? -13.073 -42.870 -134.938 1.00 17.11  ? 20  ARG A NH2  1 
ATOM   5324  H  H    . ARG B  1 20  ? -11.310 -49.300 -131.722 1.00 14.33  ? 20  ARG A H    1 
ATOM   5325  H  HA   . ARG B  1 20  ? -9.212  -47.801 -131.856 1.00 14.59  ? 20  ARG A HA   1 
ATOM   5326  H  HB2  . ARG B  1 20  ? -11.755 -47.315 -130.798 1.00 23.02  ? 20  ARG A HB2  1 
ATOM   5327  H  HB3  . ARG B  1 20  ? -10.607 -46.271 -130.470 1.00 23.02  ? 20  ARG A HB3  1 
ATOM   5328  H  HG2  . ARG B  1 20  ? -10.329 -46.093 -132.842 1.00 22.51  ? 20  ARG A HG2  1 
ATOM   5329  H  HG3  . ARG B  1 20  ? -11.751 -46.803 -132.937 1.00 22.51  ? 20  ARG A HG3  1 
ATOM   5330  H  HD2  . ARG B  1 20  ? -12.607 -45.017 -131.570 1.00 23.39  ? 20  ARG A HD2  1 
ATOM   5331  H  HD3  . ARG B  1 20  ? -11.218 -44.269 -131.824 1.00 23.39  ? 20  ARG A HD3  1 
ATOM   5332  H  HE   . ARG B  1 20  ? -12.440 -45.015 -134.085 1.00 25.04  ? 20  ARG A HE   1 
ATOM   5333  H  HH11 . ARG B  1 20  ? -12.235 -42.459 -132.013 1.00 16.21  ? 20  ARG A HH11 1 
ATOM   5334  H  HH12 . ARG B  1 20  ? -12.716 -41.431 -132.977 1.00 16.21  ? 20  ARG A HH12 1 
ATOM   5335  H  HH21 . ARG B  1 20  ? -13.159 -43.485 -135.533 1.00 20.53  ? 20  ARG A HH21 1 
ATOM   5336  H  HH22 . ARG B  1 20  ? -13.280 -42.057 -135.127 1.00 20.53  ? 20  ARG A HH22 1 
ATOM   5337  N  N    . ALA B  1 21  ? -9.850  -48.753 -128.875 1.00 10.26  ? 21  ALA A N    1 
ATOM   5338  C  CA   . ALA B  1 21  ? -9.292  -48.830 -127.519 1.00 13.79  ? 21  ALA A CA   1 
ATOM   5339  C  C    . ALA B  1 21  ? -7.997  -49.636 -127.496 1.00 13.35  ? 21  ALA A C    1 
ATOM   5340  O  O    . ALA B  1 21  ? -7.047  -49.302 -126.782 1.00 13.86  ? 21  ALA A O    1 
ATOM   5341  C  CB   . ALA B  1 21  ? -10.292 -49.450 -126.583 1.00 12.69  ? 21  ALA A CB   1 
ATOM   5342  H  H    . ALA B  1 21  ? -10.617 -49.133 -128.966 1.00 12.32  ? 21  ALA A H    1 
ATOM   5343  H  HA   . ALA B  1 21  ? -9.097  -47.934 -127.203 1.00 16.54  ? 21  ALA A HA   1 
ATOM   5344  H  HB1  . ALA B  1 21  ? -9.908  -49.493 -125.694 1.00 15.23  ? 21  ALA A HB1  1 
ATOM   5345  H  HB2  . ALA B  1 21  ? -11.094 -48.903 -126.571 1.00 15.23  ? 21  ALA A HB2  1 
ATOM   5346  H  HB3  . ALA B  1 21  ? -10.505 -50.343 -126.896 1.00 15.23  ? 21  ALA A HB3  1 
ATOM   5347  N  N    . ALA B  1 22  ? -7.969  -50.701 -128.289 1.00 11.32  ? 22  ALA A N    1 
ATOM   5348  C  CA   . ALA B  1 22  ? -6.788  -51.562 -128.378 1.00 10.40  ? 22  ALA A CA   1 
ATOM   5349  C  C    . ALA B  1 22  ? -5.605  -50.799 -128.938 1.00 13.68  ? 22  ALA A C    1 
ATOM   5350  O  O    . ALA B  1 22  ? -4.491  -50.894 -128.426 1.00 16.06  ? 22  ALA A O    1 
ATOM   5351  C  CB   . ALA B  1 22  ? -7.089  -52.771 -129.241 1.00 12.77  ? 22  ALA A CB   1 
ATOM   5352  H  H    . ALA B  1 22  ? -8.622  -50.950 -128.790 1.00 13.58  ? 22  ALA A H    1 
ATOM   5353  H  HA   . ALA B  1 22  ? -6.553  -51.875 -127.490 1.00 12.48  ? 22  ALA A HA   1 
ATOM   5354  H  HB1  . ALA B  1 22  ? -6.298  -53.330 -129.288 1.00 15.32  ? 22  ALA A HB1  1 
ATOM   5355  H  HB2  . ALA B  1 22  ? -7.822  -53.267 -128.843 1.00 15.32  ? 22  ALA A HB2  1 
ATOM   5356  H  HB3  . ALA B  1 22  ? -7.336  -52.470 -130.129 1.00 15.32  ? 22  ALA A HB3  1 
ATOM   5357  N  N    . PHE B  1 23  ? -5.828  -50.027 -129.996 1.00 12.29  ? 23  PHE A N    1 
ATOM   5358  C  CA   . PHE B  1 23  ? -4.718  -49.277 -130.581 1.00 12.48  ? 23  PHE A CA   1 
ATOM   5359  C  C    . PHE B  1 23  ? -4.286  -48.107 -129.675 1.00 12.94  ? 23  PHE A C    1 
ATOM   5360  O  O    . PHE B  1 23  ? -3.116  -47.766 -129.619 1.00 18.75  ? 23  PHE A O    1 
ATOM   5361  C  CB   . PHE B  1 23  ? -5.092  -48.791 -131.994 1.00 15.92  ? 23  PHE A CB   1 
ATOM   5362  C  CG   . PHE B  1 23  ? -4.897  -49.857 -133.039 1.00 12.47  ? 23  PHE A CG   1 
ATOM   5363  C  CD1  . PHE B  1 23  ? -3.641  -50.072 -133.595 1.00 18.03  ? 23  PHE A CD1  1 
ATOM   5364  C  CD2  . PHE B  1 23  ? -5.925  -50.692 -133.402 1.00 9.52   ? 23  PHE A CD2  1 
ATOM   5365  C  CE1  . PHE B  1 23  ? -3.439  -51.075 -134.519 1.00 19.08  ? 23  PHE A CE1  1 
ATOM   5366  C  CE2  . PHE B  1 23  ? -5.727  -51.709 -134.336 1.00 15.74  ? 23  PHE A CE2  1 
ATOM   5367  C  CZ   . PHE B  1 23  ? -4.485  -51.893 -134.891 1.00 20.30  ? 23  PHE A CZ   1 
ATOM   5368  H  H    . PHE B  1 23  ? -6.587  -49.921 -130.386 1.00 14.75  ? 23  PHE A H    1 
ATOM   5369  H  HA   . PHE B  1 23  ? -3.958  -49.872 -130.670 1.00 14.98  ? 23  PHE A HA   1 
ATOM   5370  H  HB2  . PHE B  1 23  ? -6.026  -48.529 -132.002 1.00 19.10  ? 23  PHE A HB2  1 
ATOM   5371  H  HB3  . PHE B  1 23  ? -4.532  -48.034 -132.228 1.00 19.10  ? 23  PHE A HB3  1 
ATOM   5372  H  HD1  . PHE B  1 23  ? -2.930  -49.526 -133.348 1.00 21.63  ? 23  PHE A HD1  1 
ATOM   5373  H  HD2  . PHE B  1 23  ? -6.767  -50.571 -133.027 1.00 11.43  ? 23  PHE A HD2  1 
ATOM   5374  H  HE1  . PHE B  1 23  ? -2.597  -51.198 -134.895 1.00 22.89  ? 23  PHE A HE1  1 
ATOM   5375  H  HE2  . PHE B  1 23  ? -6.436  -52.257 -134.586 1.00 18.89  ? 23  PHE A HE2  1 
ATOM   5376  H  HZ   . PHE B  1 23  ? -4.350  -52.565 -135.519 1.00 24.36  ? 23  PHE A HZ   1 
ATOM   5377  N  N    . ASN B  1 24  ? -5.228  -47.520 -128.954 1.00 14.01  ? 24  ASN A N    1 
ATOM   5378  C  CA   . ASN B  1 24  ? -4.910  -46.425 -128.050 1.00 14.80  ? 24  ASN A CA   1 
ATOM   5379  C  C    . ASN B  1 24  ? -4.122  -46.883 -126.819 1.00 19.31  ? 24  ASN A C    1 
ATOM   5380  O  O    . ASN B  1 24  ? -3.185  -46.214 -126.400 1.00 18.18  ? 24  ASN A O    1 
ATOM   5381  C  CB   . ASN B  1 24  ? -6.196  -45.717 -127.612 1.00 23.41  ? 24  ASN A CB   1 
ATOM   5382  C  CG   . ASN B  1 24  ? -5.920  -44.434 -126.850 1.00 56.06  ? 24  ASN A CG   1 
ATOM   5383  O  OD1  . ASN B  1 24  ? -6.078  -44.374 -125.631 1.00 59.99  ? 24  ASN A OD1  1 
ATOM   5384  N  ND2  . ASN B  1 24  ? -5.499  -43.400 -127.569 1.00 70.02  ? 24  ASN A ND2  1 
ATOM   5385  H  H    . ASN B  1 24  ? -6.060  -47.736 -128.969 1.00 16.82  ? 24  ASN A H    1 
ATOM   5386  H  HA   . ASN B  1 24  ? -4.365  -45.779 -128.525 1.00 17.76  ? 24  ASN A HA   1 
ATOM   5387  H  HB2  . ASN B  1 24  ? -6.719  -45.494 -128.398 1.00 28.10  ? 24  ASN A HB2  1 
ATOM   5388  H  HB3  . ASN B  1 24  ? -6.702  -46.308 -127.032 1.00 28.10  ? 24  ASN A HB3  1 
ATOM   5389  H  HD21 . ASN B  1 24  ? -5.329  -42.650 -127.185 1.00 84.02  ? 24  ASN A HD21 1 
ATOM   5390  H  HD22 . ASN B  1 24  ? -5.397  -43.481 -128.420 1.00 84.02  ? 24  ASN A HD22 1 
ATOM   5391  N  N    . SER B  1 25  ? -4.497  -48.019 -126.239 1.00 19.24  ? 25  SER A N    1 
ATOM   5392  C  CA   . SER B  1 25  ? -3.887  -48.457 -124.989 1.00 17.15  ? 25  SER A CA   1 
ATOM   5393  C  C    . SER B  1 25  ? -2.680  -49.345 -125.209 1.00 19.04  ? 25  SER A C    1 
ATOM   5394  O  O    . SER B  1 25  ? -1.855  -49.480 -124.330 1.00 15.98  ? 25  SER A O    1 
ATOM   5395  C  CB   . SER B  1 25  ? -4.902  -49.216 -124.150 1.00 18.90  ? 25  SER A CB   1 
ATOM   5396  O  OG   . SER B  1 25  ? -5.111  -50.511 -124.702 1.00 18.15  ? 25  SER A OG   1 
ATOM   5397  H  H    . SER B  1 25  ? -5.098  -48.551 -126.548 1.00 23.08  ? 25  SER A H    1 
ATOM   5398  H  HA   . SER B  1 25  ? -3.601  -47.678 -124.485 1.00 20.59  ? 25  SER A HA   1 
ATOM   5399  H  HB2  . SER B  1 25  ? -4.564  -49.306 -123.245 1.00 22.68  ? 25  SER A HB2  1 
ATOM   5400  H  HB3  . SER B  1 25  ? -5.741  -48.731 -124.148 1.00 22.68  ? 25  SER A HB3  1 
ATOM   5401  H  HG   . SER B  1 25  ? -5.400  -50.445 -125.488 1.00 21.78  ? 25  SER A HG   1 
ATOM   5402  N  N    . GLY B  1 26  ? -2.615  -49.995 -126.370 1.00 14.72  ? 26  GLY A N    1 
ATOM   5403  C  CA   . GLY B  1 26  ? -1.557  -50.937 -126.668 1.00 17.17  ? 26  GLY A CA   1 
ATOM   5404  C  C    . GLY B  1 26  ? -1.598  -52.209 -125.827 1.00 13.32  ? 26  GLY A C    1 
ATOM   5405  O  O    . GLY B  1 26  ? -0.652  -52.963 -125.842 1.00 12.87  ? 26  GLY A O    1 
ATOM   5406  H  H    . GLY B  1 26  ? -3.185  -49.900 -127.008 1.00 17.67  ? 26  GLY A H    1 
ATOM   5407  H  HA2  . GLY B  1 26  ? -1.612  -51.191 -127.602 1.00 20.61  ? 26  GLY A HA2  1 
ATOM   5408  H  HA3  . GLY B  1 26  ? -0.700  -50.507 -126.522 1.00 20.61  ? 26  GLY A HA3  1 
ATOM   5409  N  N    . LYS B  1 27  ? -2.683  -52.465 -125.101 1.00 12.73  ? 27  LYS A N    1 
ATOM   5410  C  CA   . LYS B  1 27  ? -2.708  -53.618 -124.192 1.00 12.01  ? 27  LYS A CA   1 
ATOM   5411  C  C    . LYS B  1 27  ? -2.849  -54.978 -124.895 1.00 10.19  ? 27  LYS A C    1 
ATOM   5412  O  O    . LYS B  1 27  ? -2.435  -56.004 -124.346 1.00 12.43  ? 27  LYS A O    1 
ATOM   5413  C  CB   . LYS B  1 27  ? -3.841  -53.471 -123.184 1.00 10.27  ? 27  LYS A CB   1 
ATOM   5414  C  CG   . LYS B  1 27  ? -3.649  -52.317 -122.206 1.00 15.59  ? 27  LYS A CG   1 
ATOM   5415  C  CD   . LYS B  1 27  ? -4.712  -52.385 -121.118 1.00 16.65  ? 27  LYS A CD   1 
ATOM   5416  C  CE   . LYS B  1 27  ? -4.660  -51.199 -120.189 1.00 25.39  ? 27  LYS A CE   1 
ATOM   5417  N  NZ   . LYS B  1 27  ? -5.723  -51.311 -119.155 1.00 27.38  ? 27  LYS A NZ   1 
ATOM   5418  H  H    . LYS B  1 27  ? -3.406  -52.000 -125.112 1.00 15.27  ? 27  LYS A H    1 
ATOM   5419  H  HA   . LYS B  1 27  ? -1.875  -53.634 -123.695 1.00 14.41  ? 27  LYS A HA   1 
ATOM   5420  H  HB2  . LYS B  1 27  ? -4.669  -53.318 -123.666 1.00 12.32  ? 27  LYS A HB2  1 
ATOM   5421  H  HB3  . LYS B  1 27  ? -3.907  -54.289 -122.668 1.00 12.32  ? 27  LYS A HB3  1 
ATOM   5422  H  HG2  . LYS B  1 27  ? -2.775  -52.383 -121.791 1.00 18.71  ? 27  LYS A HG2  1 
ATOM   5423  H  HG3  . LYS B  1 27  ? -3.740  -51.473 -122.676 1.00 18.71  ? 27  LYS A HG3  1 
ATOM   5424  H  HD2  . LYS B  1 27  ? -5.589  -52.406 -121.531 1.00 19.98  ? 27  LYS A HD2  1 
ATOM   5425  H  HD3  . LYS B  1 27  ? -4.574  -53.187 -120.590 1.00 19.98  ? 27  LYS A HD3  1 
ATOM   5426  H  HE2  . LYS B  1 27  ? -3.798  -51.173 -119.745 1.00 30.47  ? 27  LYS A HE2  1 
ATOM   5427  H  HE3  . LYS B  1 27  ? -4.807  -50.385 -120.695 1.00 30.47  ? 27  LYS A HE3  1 
ATOM   5428  H  HZ1  . LYS B  1 27  ? -5.607  -52.054 -118.679 1.00 32.85  ? 27  LYS A HZ1  1 
ATOM   5429  H  HZ2  . LYS B  1 27  ? -5.689  -50.609 -118.608 1.00 32.85  ? 27  LYS A HZ2  1 
ATOM   5430  H  HZ3  . LYS B  1 27  ? -6.523  -51.338 -119.543 1.00 32.85  ? 27  LYS A HZ3  1 
ATOM   5431  N  N    . VAL B  1 28  ? -3.442  -54.972 -126.085 1.00 10.44  ? 28  VAL A N    1 
ATOM   5432  C  CA   . VAL B  1 28  ? -3.627  -56.170 -126.912 1.00 9.51   ? 28  VAL A CA   1 
ATOM   5433  C  C    . VAL B  1 28  ? -3.372  -55.759 -128.366 1.00 12.61  ? 28  VAL A C    1 
ATOM   5434  O  O    . VAL B  1 28  ? -3.362  -54.570 -128.666 1.00 11.85  ? 28  VAL A O    1 
ATOM   5435  C  CB   . VAL B  1 28  ? -5.061  -56.796 -126.779 1.00 8.95   ? 28  VAL A CB   1 
ATOM   5436  C  CG1  . VAL B  1 28  ? -5.428  -57.060 -125.300 1.00 10.41  ? 28  VAL A CG1  1 
ATOM   5437  C  CG2  . VAL B  1 28  ? -6.136  -55.913 -127.428 1.00 18.08  ? 28  VAL A CG2  1 
ATOM   5438  H  H    . VAL B  1 28  ? -3.759  -54.261 -126.451 1.00 12.53  ? 28  VAL A H    1 
ATOM   5439  H  HA   . VAL B  1 28  ? -2.973  -56.841 -126.662 1.00 11.41  ? 28  VAL A HA   1 
ATOM   5440  H  HB   . VAL B  1 28  ? -5.068  -57.650 -127.238 1.00 10.74  ? 28  VAL A HB   1 
ATOM   5441  H  HG11 . VAL B  1 28  ? -6.317  -57.445 -125.260 1.00 12.50  ? 28  VAL A HG11 1 
ATOM   5442  H  HG12 . VAL B  1 28  ? -4.782  -57.677 -124.921 1.00 12.50  ? 28  VAL A HG12 1 
ATOM   5443  H  HG13 . VAL B  1 28  ? -5.408  -56.220 -124.816 1.00 12.50  ? 28  VAL A HG13 1 
ATOM   5444  H  HG21 . VAL B  1 28  ? -7.001  -56.339 -127.321 1.00 21.70  ? 28  VAL A HG21 1 
ATOM   5445  H  HG22 . VAL B  1 28  ? -6.137  -55.046 -126.992 1.00 21.70  ? 28  VAL A HG22 1 
ATOM   5446  H  HG23 . VAL B  1 28  ? -5.932  -55.810 -128.371 1.00 21.70  ? 28  VAL A HG23 1 
ATOM   5447  N  N    . ASP B  1 29  ? -3.215  -56.730 -129.262 1.00 13.34  ? 29  ASP A N    1 
ATOM   5448  C  CA   . ASP B  1 29  ? -3.028  -56.458 -130.701 1.00 14.50  ? 29  ASP A CA   1 
ATOM   5449  C  C    . ASP B  1 29  ? -4.182  -57.012 -131.527 1.00 9.21   ? 29  ASP A C    1 
ATOM   5450  O  O    . ASP B  1 29  ? -4.410  -58.224 -131.527 1.00 16.35  ? 29  ASP A O    1 
ATOM   5451  C  CB   . ASP B  1 29  ? -1.733  -57.087 -131.212 1.00 24.69  ? 29  ASP A CB   1 
ATOM   5452  C  CG   . ASP B  1 29  ? -0.520  -56.178 -131.046 1.00 61.83  ? 29  ASP A CG   1 
ATOM   5453  O  OD1  . ASP B  1 29  ? -0.692  -54.962 -130.795 1.00 77.21  ? 29  ASP A OD1  1 
ATOM   5454  O  OD2  . ASP B  1 29  ? 0.614   -56.689 -131.188 1.00 63.03  ? 29  ASP A OD2  1 
ATOM   5455  H  H    . ASP B  1 29  ? -3.211  -57.567 -129.066 1.00 16.01  ? 29  ASP A H    1 
ATOM   5456  H  HA   . ASP B  1 29  ? -2.981  -55.500 -130.845 1.00 17.40  ? 29  ASP A HA   1 
ATOM   5457  H  HB2  . ASP B  1 29  ? -1.563  -57.905 -130.718 1.00 29.63  ? 29  ASP A HB2  1 
ATOM   5458  H  HB3  . ASP B  1 29  ? -1.830  -57.286 -132.157 1.00 29.63  ? 29  ASP A HB3  1 
ATOM   5459  N  N    . ILE B  1 30  ? -4.884  -56.143 -132.239 1.00 13.09  ? 30  ILE A N    1 
ATOM   5460  C  CA   . ILE B  1 30  ? -5.964  -56.577 -133.131 1.00 11.38  ? 30  ILE A CA   1 
ATOM   5461  C  C    . ILE B  1 30  ? -5.327  -57.101 -134.400 1.00 11.50  ? 30  ILE A C    1 
ATOM   5462  O  O    . ILE B  1 30  ? -4.573  -56.371 -135.055 1.00 11.19  ? 30  ILE A O    1 
ATOM   5463  C  CB   . ILE B  1 30  ? -6.935  -55.442 -133.479 1.00 19.13  ? 30  ILE A CB   1 
ATOM   5464  C  CG1  . ILE B  1 30  ? -7.489  -54.779 -132.206 1.00 19.48  ? 30  ILE A CG1  1 
ATOM   5465  C  CG2  . ILE B  1 30  ? -8.075  -55.981 -134.377 1.00 11.22  ? 30  ILE A CG2  1 
ATOM   5466  C  CD1  . ILE B  1 30  ? -8.297  -55.678 -131.280 1.00 13.86  ? 30  ILE A CD1  1 
ATOM   5467  H  H    . ILE B  1 30  ? -4.759  -55.292 -132.227 1.00 15.70  ? 30  ILE A H    1 
ATOM   5468  H  HA   . ILE B  1 30  ? -6.464  -57.296 -132.714 1.00 13.65  ? 30  ILE A HA   1 
ATOM   5469  H  HB   . ILE B  1 30  ? -6.447  -54.771 -133.981 1.00 22.96  ? 30  ILE A HB   1 
ATOM   5470  H  HG12 . ILE B  1 30  ? -6.741  -54.433 -131.693 1.00 23.38  ? 30  ILE A HG12 1 
ATOM   5471  H  HG13 . ILE B  1 30  ? -8.064  -54.044 -132.470 1.00 23.38  ? 30  ILE A HG13 1 
ATOM   5472  H  HG21 . ILE B  1 30  ? -8.680  -55.253 -134.588 1.00 13.46  ? 30  ILE A HG21 1 
ATOM   5473  H  HG22 . ILE B  1 30  ? -7.691  -56.340 -135.192 1.00 13.46  ? 30  ILE A HG22 1 
ATOM   5474  H  HG23 . ILE B  1 30  ? -8.550  -56.679 -133.899 1.00 13.46  ? 30  ILE A HG23 1 
ATOM   5475  H  HD11 . ILE B  1 30  ? -8.594  -55.158 -130.516 1.00 16.63  ? 30  ILE A HD11 1 
ATOM   5476  H  HD12 . ILE B  1 30  ? -9.064  -56.021 -131.765 1.00 16.63  ? 30  ILE A HD12 1 
ATOM   5477  H  HD13 . ILE B  1 30  ? -7.736  -56.412 -130.984 1.00 16.63  ? 30  ILE A HD13 1 
ATOM   5478  N  N    . VAL B  1 31  ? -5.591  -58.353 -134.749 1.00 9.21   ? 31  VAL A N    1 
ATOM   5479  C  CA   . VAL B  1 31  ? -4.986  -58.939 -135.953 1.00 9.94   ? 31  VAL A CA   1 
ATOM   5480  C  C    . VAL B  1 31  ? -6.020  -59.435 -136.973 1.00 9.74   ? 31  VAL A C    1 
ATOM   5481  O  O    . VAL B  1 31  ? -5.674  -59.777 -138.077 1.00 10.19  ? 31  VAL A O    1 
ATOM   5482  C  CB   . VAL B  1 31  ? -4.035  -60.108 -135.609 1.00 10.23  ? 31  VAL A CB   1 
ATOM   5483  C  CG1  . VAL B  1 31  ? -2.860  -59.624 -134.742 1.00 16.25  ? 31  VAL A CG1  1 
ATOM   5484  C  CG2  . VAL B  1 31  ? -4.781  -61.269 -134.965 1.00 13.53  ? 31  VAL A CG2  1 
ATOM   5485  H  H    . VAL B  1 31  ? -6.109  -58.885 -134.316 1.00 11.05  ? 31  VAL A H    1 
ATOM   5486  H  HA   . VAL B  1 31  ? -4.455  -58.254 -136.390 1.00 11.93  ? 31  VAL A HA   1 
ATOM   5487  H  HB   . VAL B  1 31  ? -3.657  -60.440 -136.439 1.00 12.28  ? 31  VAL A HB   1 
ATOM   5488  H  HG11 . VAL B  1 31  ? -2.283  -60.378 -134.544 1.00 19.50  ? 31  VAL A HG11 1 
ATOM   5489  H  HG12 . VAL B  1 31  ? -2.365  -58.948 -135.230 1.00 19.50  ? 31  VAL A HG12 1 
ATOM   5490  H  HG13 . VAL B  1 31  ? -3.209  -59.249 -133.919 1.00 19.50  ? 31  VAL A HG13 1 
ATOM   5491  H  HG21 . VAL B  1 31  ? -4.150  -61.978 -134.766 1.00 16.24  ? 31  VAL A HG21 1 
ATOM   5492  H  HG22 . VAL B  1 31  ? -5.200  -60.959 -134.146 1.00 16.24  ? 31  VAL A HG22 1 
ATOM   5493  H  HG23 . VAL B  1 31  ? -5.457  -61.590 -135.581 1.00 16.24  ? 31  VAL A HG23 1 
ATOM   5494  N  N    . ALA B  1 32  ? -7.294  -59.471 -136.610 1.00 9.36   ? 32  ALA A N    1 
ATOM   5495  C  CA   . ALA B  1 32  ? -8.292  -59.967 -137.528 1.00 9.53   ? 32  ALA A CA   1 
ATOM   5496  C  C    . ALA B  1 32  ? -9.666  -59.409 -137.182 1.00 14.32  ? 32  ALA A C    1 
ATOM   5497  O  O    . ALA B  1 32  ? -9.988  -59.211 -136.009 1.00 9.05   ? 32  ALA A O    1 
ATOM   5498  C  CB   . ALA B  1 32  ? -8.311  -61.502 -137.516 1.00 11.32  ? 32  ALA A CB   1 
ATOM   5499  H  H    . ALA B  1 32  ? -7.599  -59.217 -135.847 1.00 11.23  ? 32  ALA A H    1 
ATOM   5500  H  HA   . ALA B  1 32  ? -8.067  -59.677 -138.426 1.00 11.44  ? 32  ALA A HA   1 
ATOM   5501  H  HB1  . ALA B  1 32  ? -8.986  -61.814 -138.138 1.00 13.58  ? 32  ALA A HB1  1 
ATOM   5502  H  HB2  . ALA B  1 32  ? -7.438  -61.830 -137.783 1.00 13.58  ? 32  ALA A HB2  1 
ATOM   5503  H  HB3  . ALA B  1 32  ? -8.519  -61.808 -136.619 1.00 13.58  ? 32  ALA A HB3  1 
ATOM   5504  N  N    . ILE B  1 33  ? -10.457 -59.138 -138.218 1.00 9.31   ? 33  ILE A N    1 
ATOM   5505  C  CA   . ILE B  1 33  ? -11.813 -58.645 -138.049 1.00 9.15   ? 33  ILE A CA   1 
ATOM   5506  C  C    . ILE B  1 33  ? -12.717 -59.371 -139.014 1.00 10.26  ? 33  ILE A C    1 
ATOM   5507  O  O    . ILE B  1 33  ? -12.373 -59.514 -140.188 1.00 12.02  ? 33  ILE A O    1 
ATOM   5508  C  CB   . ILE B  1 33  ? -11.933 -57.136 -138.308 1.00 8.92   ? 33  ILE A CB   1 
ATOM   5509  C  CG1  . ILE B  1 33  ? -11.051 -56.350 -137.353 1.00 12.21  ? 33  ILE A CG1  1 
ATOM   5510  C  CG2  . ILE B  1 33  ? -13.426 -56.687 -138.187 1.00 11.58  ? 33  ILE A CG2  1 
ATOM   5511  C  CD1  . ILE B  1 33  ? -10.819 -54.921 -137.797 1.00 13.65  ? 33  ILE A CD1  1 
ATOM   5512  H  H    . ILE B  1 33  ? -10.223 -59.235 -139.040 1.00 11.17  ? 33  ILE A H    1 
ATOM   5513  H  HA   . ILE B  1 33  ? -12.115 -58.828 -137.145 1.00 10.98  ? 33  ILE A HA   1 
ATOM   5514  H  HB   . ILE B  1 33  ? -11.634 -56.958 -139.214 1.00 10.70  ? 33  ILE A HB   1 
ATOM   5515  H  HG12 . ILE B  1 33  ? -11.475 -56.326 -136.480 1.00 14.65  ? 33  ILE A HG12 1 
ATOM   5516  H  HG13 . ILE B  1 33  ? -10.188 -56.787 -137.289 1.00 14.65  ? 33  ILE A HG13 1 
ATOM   5517  H  HG21 . ILE B  1 33  ? -13.483 -55.733 -138.354 1.00 13.89  ? 33  ILE A HG21 1 
ATOM   5518  H  HG22 . ILE B  1 33  ? -13.955 -57.170 -138.842 1.00 13.89  ? 33  ILE A HG22 1 
ATOM   5519  H  HG23 . ILE B  1 33  ? -13.744 -56.887 -137.292 1.00 13.89  ? 33  ILE A HG23 1 
ATOM   5520  H  HD11 . ILE B  1 33  ? -10.252 -54.477 -137.148 1.00 16.38  ? 33  ILE A HD11 1 
ATOM   5521  H  HD12 . ILE B  1 33  ? -10.386 -54.928 -138.666 1.00 16.38  ? 33  ILE A HD12 1 
ATOM   5522  H  HD13 . ILE B  1 33  ? -11.674 -54.467 -137.857 1.00 16.38  ? 33  ILE A HD13 1 
ATOM   5523  N  N    . ASN B  1 34  ? -13.869 -59.820 -138.521 1.00 10.25  ? 34  ASN A N    1 
ATOM   5524  C  CA   . ASN B  1 34  ? -14.929 -60.383 -139.365 1.00 10.51  ? 34  ASN A CA   1 
ATOM   5525  C  C    . ASN B  1 34  ? -16.219 -59.570 -139.315 1.00 11.92  ? 34  ASN A C    1 
ATOM   5526  O  O    . ASN B  1 34  ? -16.712 -59.273 -138.229 1.00 11.39  ? 34  ASN A O    1 
ATOM   5527  C  CB   . ASN B  1 34  ? -15.244 -61.821 -138.944 1.00 12.22  ? 34  ASN A CB   1 
ATOM   5528  C  CG   . ASN B  1 34  ? -16.293 -62.470 -139.837 1.00 18.05  ? 34  ASN A CG   1 
ATOM   5529  O  OD1  . ASN B  1 34  ? -16.068 -62.646 -141.040 1.00 18.66  ? 34  ASN A OD1  1 
ATOM   5530  N  ND2  . ASN B  1 34  ? -17.454 -62.815 -139.261 1.00 13.09  ? 34  ASN A ND2  1 
ATOM   5531  H  H    . ASN B  1 34  ? -14.066 -59.810 -137.684 1.00 12.30  ? 34  ASN A H    1 
ATOM   5532  H  HA   . ASN B  1 34  ? -14.623 -60.401 -140.285 1.00 12.61  ? 34  ASN A HA   1 
ATOM   5533  H  HB2  . ASN B  1 34  ? -14.434 -62.352 -138.997 1.00 14.66  ? 34  ASN A HB2  1 
ATOM   5534  H  HB3  . ASN B  1 34  ? -15.582 -61.819 -138.035 1.00 14.66  ? 34  ASN A HB3  1 
ATOM   5535  H  HD21 . ASN B  1 34  ? -18.074 -63.184 -139.729 1.00 15.71  ? 34  ASN A HD21 1 
ATOM   5536  H  HD22 . ASN B  1 34  ? -17.578 -62.667 -138.423 1.00 15.71  ? 34  ASN A HD22 1 
ATOM   5537  N  N    . ASP B  1 35  ? -16.780 -59.247 -140.486 1.00 13.21  ? 35  ASP A N    1 
ATOM   5538  C  CA   . ASP B  1 35  ? -18.114 -58.641 -140.575 1.00 21.11  ? 35  ASP A CA   1 
ATOM   5539  C  C    . ASP B  1 35  ? -18.618 -58.803 -142.008 1.00 21.99  ? 35  ASP A C    1 
ATOM   5540  O  O    . ASP B  1 35  ? -18.076 -58.185 -142.922 1.00 18.74  ? 35  ASP A O    1 
ATOM   5541  C  CB   . ASP B  1 35  ? -18.089 -57.158 -140.171 1.00 15.17  ? 35  ASP A CB   1 
ATOM   5542  C  CG   . ASP B  1 35  ? -19.481 -56.601 -139.870 1.00 21.45  ? 35  ASP A CG   1 
ATOM   5543  O  OD1  . ASP B  1 35  ? -20.431 -56.912 -140.628 1.00 16.97  ? 35  ASP A OD1  1 
ATOM   5544  O  OD2  . ASP B  1 35  ? -19.631 -55.848 -138.870 1.00 18.59  ? 35  ASP A OD2  1 
ATOM   5545  H  H    . ASP B  1 35  ? -16.404 -59.369 -141.249 1.00 15.85  ? 35  ASP A H    1 
ATOM   5546  H  HA   . ASP B  1 35  ? -18.721 -59.110 -139.981 1.00 25.34  ? 35  ASP A HA   1 
ATOM   5547  H  HB2  . ASP B  1 35  ? -17.548 -57.058 -139.372 1.00 18.20  ? 35  ASP A HB2  1 
ATOM   5548  H  HB3  . ASP B  1 35  ? -17.709 -56.640 -140.897 1.00 18.20  ? 35  ASP A HB3  1 
ATOM   5549  N  N    . PRO B  1 36  ? -19.641 -59.654 -142.222 1.00 23.28  ? 36  PRO A N    1 
ATOM   5550  C  CA   . PRO B  1 36  ? -20.149 -59.863 -143.588 1.00 22.14  ? 36  PRO A CA   1 
ATOM   5551  C  C    . PRO B  1 36  ? -20.873 -58.671 -144.207 1.00 13.95  ? 36  PRO A C    1 
ATOM   5552  O  O    . PRO B  1 36  ? -21.188 -58.729 -145.378 1.00 20.20  ? 36  PRO A O    1 
ATOM   5553  C  CB   . PRO B  1 36  ? -21.150 -61.014 -143.434 1.00 27.97  ? 36  PRO A CB   1 
ATOM   5554  C  CG   . PRO B  1 36  ? -21.197 -61.369 -142.008 1.00 29.47  ? 36  PRO A CG   1 
ATOM   5555  C  CD   . PRO B  1 36  ? -20.494 -60.311 -141.219 1.00 21.04  ? 36  PRO A CD   1 
ATOM   5556  H  HA   . PRO B  1 36  ? -19.429 -60.142 -144.175 1.00 26.57  ? 36  PRO A HA   1 
ATOM   5557  H  HB2  . PRO B  1 36  ? -22.024 -60.721 -143.736 1.00 33.56  ? 36  PRO A HB2  1 
ATOM   5558  H  HB3  . PRO B  1 36  ? -20.849 -61.773 -143.959 1.00 33.56  ? 36  PRO A HB3  1 
ATOM   5559  H  HG2  . PRO B  1 36  ? -22.124 -61.430 -141.729 1.00 35.36  ? 36  PRO A HG2  1 
ATOM   5560  H  HG3  . PRO B  1 36  ? -20.756 -62.224 -141.881 1.00 35.36  ? 36  PRO A HG3  1 
ATOM   5561  H  HD2  . PRO B  1 36  ? -21.134 -59.680 -140.853 1.00 25.25  ? 36  PRO A HD2  1 
ATOM   5562  H  HD3  . PRO B  1 36  ? -19.951 -60.712 -140.522 1.00 25.25  ? 36  PRO A HD3  1 
ATOM   5563  N  N    . PHE B  1 37  ? -21.161 -57.631 -143.438 1.00 24.58  ? 37  PHE A N    1 
ATOM   5564  C  CA   . PHE B  1 37  ? -21.954 -56.507 -143.938 1.00 28.93  ? 37  PHE A CA   1 
ATOM   5565  C  C    . PHE B  1 37  ? -21.122 -55.247 -144.143 1.00 28.36  ? 37  PHE A C    1 
ATOM   5566  O  O    . PHE B  1 37  ? -21.653 -54.193 -144.464 1.00 25.55  ? 37  PHE A O    1 
ATOM   5567  C  CB   . PHE B  1 37  ? -23.103 -56.221 -142.969 1.00 18.04  ? 37  PHE A CB   1 
ATOM   5568  C  CG   . PHE B  1 37  ? -24.004 -57.410 -142.754 1.00 30.76  ? 37  PHE A CG   1 
ATOM   5569  C  CD1  . PHE B  1 37  ? -24.975 -57.743 -143.692 1.00 35.21  ? 37  PHE A CD1  1 
ATOM   5570  C  CD2  . PHE B  1 37  ? -23.853 -58.215 -141.643 1.00 30.60  ? 37  PHE A CD2  1 
ATOM   5571  C  CE1  . PHE B  1 37  ? -25.786 -58.853 -143.501 1.00 31.72  ? 37  PHE A CE1  1 
ATOM   5572  C  CE2  . PHE B  1 37  ? -24.660 -59.314 -141.450 1.00 35.74  ? 37  PHE A CE2  1 
ATOM   5573  C  CZ   . PHE B  1 37  ? -25.631 -59.632 -142.380 1.00 28.37  ? 37  PHE A CZ   1 
ATOM   5574  H  H    . PHE B  1 37  ? -20.909 -57.548 -142.620 1.00 29.49  ? 37  PHE A H    1 
ATOM   5575  H  HA   . PHE B  1 37  ? -22.340 -56.751 -144.793 1.00 34.72  ? 37  PHE A HA   1 
ATOM   5576  H  HB2  . PHE B  1 37  ? -22.733 -55.967 -142.108 1.00 21.65  ? 37  PHE A HB2  1 
ATOM   5577  H  HB3  . PHE B  1 37  ? -23.642 -55.497 -143.324 1.00 21.65  ? 37  PHE A HB3  1 
ATOM   5578  H  HD1  . PHE B  1 37  ? -25.084 -57.217 -144.450 1.00 42.25  ? 37  PHE A HD1  1 
ATOM   5579  H  HD2  . PHE B  1 37  ? -23.203 -58.007 -141.011 1.00 36.73  ? 37  PHE A HD2  1 
ATOM   5580  H  HE1  . PHE B  1 37  ? -26.441 -59.064 -144.128 1.00 38.07  ? 37  PHE A HE1  1 
ATOM   5581  H  HE2  . PHE B  1 37  ? -24.552 -59.842 -140.692 1.00 42.89  ? 37  PHE A HE2  1 
ATOM   5582  H  HZ   . PHE B  1 37  ? -26.176 -60.375 -142.249 1.00 34.04  ? 37  PHE A HZ   1 
ATOM   5583  N  N    . ILE B  1 38  ? -19.818 -55.358 -143.930 1.00 19.00  ? 38  ILE A N    1 
ATOM   5584  C  CA   . ILE B  1 38  ? -18.908 -54.233 -144.097 1.00 15.43  ? 38  ILE A CA   1 
ATOM   5585  C  C    . ILE B  1 38  ? -17.663 -54.748 -144.790 1.00 19.86  ? 38  ILE A C    1 
ATOM   5586  O  O    . ILE B  1 38  ? -16.858 -55.435 -144.155 1.00 18.54  ? 38  ILE A O    1 
ATOM   5587  C  CB   . ILE B  1 38  ? -18.514 -53.587 -142.749 1.00 14.15  ? 38  ILE A CB   1 
ATOM   5588  C  CG1  . ILE B  1 38  ? -19.755 -53.345 -141.871 1.00 20.94  ? 38  ILE A CG1  1 
ATOM   5589  C  CG2  . ILE B  1 38  ? -17.771 -52.291 -143.000 1.00 15.69  ? 38  ILE A CG2  1 
ATOM   5590  C  CD1  . ILE B  1 38  ? -19.425 -52.896 -140.432 1.00 18.55  ? 38  ILE A CD1  1 
ATOM   5591  H  H    . ILE B  1 38  ? -19.430 -56.085 -143.685 1.00 22.80  ? 38  ILE A H    1 
ATOM   5592  H  HA   . ILE B  1 38  ? -19.321 -53.557 -144.658 1.00 18.52  ? 38  ILE A HA   1 
ATOM   5593  H  HB   . ILE B  1 38  ? -17.920 -54.195 -142.281 1.00 16.99  ? 38  ILE A HB   1 
ATOM   5594  H  HG12 . ILE B  1 38  ? -20.297 -52.653 -142.280 1.00 25.13  ? 38  ILE A HG12 1 
ATOM   5595  H  HG13 . ILE B  1 38  ? -20.263 -54.170 -141.815 1.00 25.13  ? 38  ILE A HG13 1 
ATOM   5596  H  HG21 . ILE B  1 38  ? -17.529 -51.896 -142.148 1.00 18.83  ? 38  ILE A HG21 1 
ATOM   5597  H  HG22 . ILE B  1 38  ? -16.972 -52.480 -143.516 1.00 18.83  ? 38  ILE A HG22 1 
ATOM   5598  H  HG23 . ILE B  1 38  ? -18.348 -51.687 -143.493 1.00 18.83  ? 38  ILE A HG23 1 
ATOM   5599  H  HD11 . ILE B  1 38  ? -20.254 -52.765 -139.945 1.00 22.26  ? 38  ILE A HD11 1 
ATOM   5600  H  HD12 . ILE B  1 38  ? -18.893 -53.583 -140.001 1.00 22.26  ? 38  ILE A HD12 1 
ATOM   5601  H  HD13 . ILE B  1 38  ? -18.927 -52.065 -140.467 1.00 22.26  ? 38  ILE A HD13 1 
ATOM   5602  N  N    . ASP B  1 39  ? -17.513 -54.461 -146.082 1.00 13.74  ? 39  ASP A N    1 
ATOM   5603  C  CA   . ASP B  1 39  ? -16.329 -54.916 -146.807 1.00 21.73  ? 39  ASP A CA   1 
ATOM   5604  C  C    . ASP B  1 39  ? -15.125 -54.030 -146.489 1.00 22.68  ? 39  ASP A C    1 
ATOM   5605  O  O    . ASP B  1 39  ? -15.264 -53.019 -145.810 1.00 15.25  ? 39  ASP A O    1 
ATOM   5606  C  CB   . ASP B  1 39  ? -16.585 -54.985 -148.309 1.00 19.28  ? 39  ASP A CB   1 
ATOM   5607  C  CG   . ASP B  1 39  ? -16.726 -53.621 -148.989 1.00 30.27  ? 39  ASP A CG   1 
ATOM   5608  O  OD1  . ASP B  1 39  ? -16.206 -52.594 -148.517 1.00 23.51  ? 39  ASP A OD1  1 
ATOM   5609  O  OD2  . ASP B  1 39  ? -17.347 -53.594 -150.072 1.00 57.49  ? 39  ASP A OD2  1 
ATOM   5610  H  H    . ASP B  1 39  ? -18.073 -54.011 -146.555 1.00 16.49  ? 39  ASP A H    1 
ATOM   5611  H  HA   . ASP B  1 39  ? -16.115 -55.814 -146.509 1.00 26.07  ? 39  ASP A HA   1 
ATOM   5612  H  HB2  . ASP B  1 39  ? -15.844 -55.448 -148.730 1.00 23.14  ? 39  ASP A HB2  1 
ATOM   5613  H  HB3  . ASP B  1 39  ? -17.407 -55.477 -148.462 1.00 23.14  ? 39  ASP A HB3  1 
ATOM   5614  N  N    . LEU B  1 40  ? -13.947 -54.408 -146.982 1.00 17.59  ? 40  LEU A N    1 
ATOM   5615  C  CA   . LEU B  1 40  ? -12.704 -53.753 -146.572 1.00 13.61  ? 40  LEU A CA   1 
ATOM   5616  C  C    . LEU B  1 40  ? -12.725 -52.233 -146.771 1.00 14.85  ? 40  LEU A C    1 
ATOM   5617  O  O    . LEU B  1 40  ? -12.398 -51.494 -145.846 1.00 13.35  ? 40  LEU A O    1 
ATOM   5618  C  CB   . LEU B  1 40  ? -11.521 -54.369 -147.315 1.00 17.78  ? 40  LEU A CB   1 
ATOM   5619  C  CG   . LEU B  1 40  ? -10.165 -53.689 -147.159 1.00 17.69  ? 40  LEU A CG   1 
ATOM   5620  C  CD1  . LEU B  1 40  ? -9.766  -53.596 -145.702 1.00 19.92  ? 40  LEU A CD1  1 
ATOM   5621  C  CD2  . LEU B  1 40  ? -9.085  -54.441 -147.996 1.00 16.84  ? 40  LEU A CD2  1 
ATOM   5622  H  H    . LEU B  1 40  ? -13.840 -55.041 -147.554 1.00 21.11  ? 40  LEU A H    1 
ATOM   5623  H  HA   . LEU B  1 40  ? -12.569 -53.918 -145.626 1.00 16.33  ? 40  LEU A HA   1 
ATOM   5624  H  HB2  . LEU B  1 40  ? -11.417 -55.284 -147.010 1.00 21.34  ? 40  LEU A HB2  1 
ATOM   5625  H  HB3  . LEU B  1 40  ? -11.730 -54.372 -148.263 1.00 21.34  ? 40  LEU A HB3  1 
ATOM   5626  H  HG   . LEU B  1 40  ? -10.230 -52.785 -147.505 1.00 21.23  ? 40  LEU A HG   1 
ATOM   5627  H  HD11 . LEU B  1 40  ? -8.902  -53.160 -145.639 1.00 23.90  ? 40  LEU A HD11 1 
ATOM   5628  H  HD12 . LEU B  1 40  ? -10.434 -53.080 -145.225 1.00 23.90  ? 40  LEU A HD12 1 
ATOM   5629  H  HD13 . LEU B  1 40  ? -9.713  -54.492 -145.333 1.00 23.90  ? 40  LEU A HD13 1 
ATOM   5630  H  HD21 . LEU B  1 40  ? -8.232  -53.994 -147.883 1.00 20.21  ? 40  LEU A HD21 1 
ATOM   5631  H  HD22 . LEU B  1 40  ? -9.024  -55.356 -147.681 1.00 20.21  ? 40  LEU A HD22 1 
ATOM   5632  H  HD23 . LEU B  1 40  ? -9.345  -54.428 -148.930 1.00 20.21  ? 40  LEU A HD23 1 
ATOM   5633  N  N    . ASN B  1 41  ? -13.104 -51.746 -147.947 1.00 12.56  ? 41  ASN A N    1 
ATOM   5634  C  CA   . ASN B  1 41  ? -13.060 -50.309 -148.166 1.00 13.65  ? 41  ASN A CA   1 
ATOM   5635  C  C    . ASN B  1 41  ? -14.037 -49.567 -147.269 1.00 13.22  ? 41  ASN A C    1 
ATOM   5636  O  O    . ASN B  1 41  ? -13.779 -48.446 -146.824 1.00 11.04  ? 41  ASN A O    1 
ATOM   5637  C  CB   . ASN B  1 41  ? -13.350 -49.979 -149.630 1.00 17.14  ? 41  ASN A CB   1 
ATOM   5638  C  CG   . ASN B  1 41  ? -12.219 -50.396 -150.556 1.00 38.27  ? 41  ASN A CG   1 
ATOM   5639  O  OD1  . ASN B  1 41  ? -11.044 -50.301 -150.202 1.00 27.79  ? 41  ASN A OD1  1 
ATOM   5640  N  ND2  . ASN B  1 41  ? -12.572 -50.859 -151.748 1.00 39.91  ? 41  ASN A ND2  1 
ATOM   5641  H  H    . ASN B  1 41  ? -13.382 -52.211 -148.615 1.00 15.07  ? 41  ASN A H    1 
ATOM   5642  H  HA   . ASN B  1 41  ? -12.168 -49.989 -147.961 1.00 16.38  ? 41  ASN A HA   1 
ATOM   5643  H  HB2  . ASN B  1 41  ? -14.154 -50.447 -149.907 1.00 20.57  ? 41  ASN A HB2  1 
ATOM   5644  H  HB3  . ASN B  1 41  ? -13.475 -49.022 -149.721 1.00 20.57  ? 41  ASN A HB3  1 
ATOM   5645  H  HD21 . ASN B  1 41  ? -11.969 -51.108 -152.309 1.00 47.89  ? 41  ASN A HD21 1 
ATOM   5646  H  HD22 . ASN B  1 41  ? -13.404 -50.910 -151.961 1.00 47.89  ? 41  ASN A HD22 1 
ATOM   5647  N  N    . TYR B  1 42  ? -15.162 -50.207 -146.990 1.00 11.34  ? 42  TYR A N    1 
ATOM   5648  C  CA   . TYR B  1 42  ? -16.181 -49.611 -146.149 1.00 11.74  ? 42  TYR A CA   1 
ATOM   5649  C  C    . TYR B  1 42  ? -15.681 -49.607 -144.713 1.00 12.34  ? 42  TYR A C    1 
ATOM   5650  O  O    . TYR B  1 42  ? -15.940 -48.666 -143.956 1.00 11.50  ? 42  TYR A O    1 
ATOM   5651  C  CB   . TYR B  1 42  ? -17.498 -50.392 -146.309 1.00 12.66  ? 42  TYR A CB   1 
ATOM   5652  C  CG   . TYR B  1 42  ? -18.731 -49.737 -145.761 1.00 11.98  ? 42  TYR A CG   1 
ATOM   5653  C  CD1  . TYR B  1 42  ? -18.767 -48.385 -145.434 1.00 13.58  ? 42  TYR A CD1  1 
ATOM   5654  C  CD2  . TYR B  1 42  ? -19.880 -50.477 -145.580 1.00 12.45  ? 42  TYR A CD2  1 
ATOM   5655  C  CE1  . TYR B  1 42  ? -19.927 -47.799 -144.923 1.00 12.19  ? 42  TYR A CE1  1 
ATOM   5656  C  CE2  . TYR B  1 42  ? -21.031 -49.908 -145.075 1.00 16.52  ? 42  TYR A CE2  1 
ATOM   5657  C  CZ   . TYR B  1 42  ? -21.050 -48.573 -144.741 1.00 17.85  ? 42  TYR A CZ   1 
ATOM   5658  O  OH   . TYR B  1 42  ? -22.208 -48.033 -144.236 1.00 15.43  ? 42  TYR A OH   1 
ATOM   5659  H  H    . TYR B  1 42  ? -15.359 -50.993 -147.278 1.00 13.60  ? 42  TYR A H    1 
ATOM   5660  H  HA   . TYR B  1 42  ? -16.332 -48.694 -146.425 1.00 14.09  ? 42  TYR A HA   1 
ATOM   5661  H  HB2  . TYR B  1 42  ? -17.649 -50.543 -147.255 1.00 15.19  ? 42  TYR A HB2  1 
ATOM   5662  H  HB3  . TYR B  1 42  ? -17.402 -51.246 -145.859 1.00 15.19  ? 42  TYR A HB3  1 
ATOM   5663  H  HD1  . TYR B  1 42  ? -18.004 -47.865 -145.549 1.00 16.29  ? 42  TYR A HD1  1 
ATOM   5664  H  HD2  . TYR B  1 42  ? -19.876 -51.382 -145.792 1.00 14.94  ? 42  TYR A HD2  1 
ATOM   5665  H  HE1  . TYR B  1 42  ? -19.938 -46.896 -144.699 1.00 14.63  ? 42  TYR A HE1  1 
ATOM   5666  H  HE2  . TYR B  1 42  ? -21.792 -50.428 -144.952 1.00 19.82  ? 42  TYR A HE2  1 
ATOM   5667  H  HH   . TYR B  1 42  ? -22.099 -47.215 -144.079 1.00 18.52  ? 42  TYR A HH   1 
ATOM   5668  N  N    . MET B  1 43  ? -14.925 -50.633 -144.330 1.00 10.93  ? 43  MET A N    1 
ATOM   5669  C  CA   . MET B  1 43  ? -14.376 -50.654 -142.971 1.00 9.80   ? 43  MET A CA   1 
ATOM   5670  C  C    . MET B  1 43  ? -13.441 -49.490 -142.738 1.00 9.58   ? 43  MET A C    1 
ATOM   5671  O  O    . MET B  1 43  ? -13.410 -48.951 -141.649 1.00 12.75  ? 43  MET A O    1 
ATOM   5672  C  CB   . MET B  1 43  ? -13.603 -51.932 -142.674 1.00 13.63  ? 43  MET A CB   1 
ATOM   5673  C  CG   . MET B  1 43  ? -14.406 -53.130 -142.309 1.00 21.58  ? 43  MET A CG   1 
ATOM   5674  S  SD   . MET B  1 43  ? -13.283 -54.510 -141.909 1.00 22.74  ? 43  MET A SD   1 
ATOM   5675  C  CE   . MET B  1 43  ? -14.500 -55.781 -141.637 1.00 17.74  ? 43  MET A CE   1 
ATOM   5676  H  H    . MET B  1 43  ? -14.719 -51.311 -144.818 1.00 13.12  ? 43  MET A H    1 
ATOM   5677  H  HA   . MET B  1 43  ? -15.110 -50.598 -142.338 1.00 11.76  ? 43  MET A HA   1 
ATOM   5678  H  HB2  . MET B  1 43  ? -13.085 -52.162 -143.462 1.00 16.35  ? 43  MET A HB2  1 
ATOM   5679  H  HB3  . MET B  1 43  ? -12.999 -51.755 -141.935 1.00 16.35  ? 43  MET A HB3  1 
ATOM   5680  H  HG2  . MET B  1 43  ? -14.949 -52.935 -141.530 1.00 25.90  ? 43  MET A HG2  1 
ATOM   5681  H  HG3  . MET B  1 43  ? -14.964 -53.391 -143.059 1.00 25.90  ? 43  MET A HG3  1 
ATOM   5682  H  HE1  . MET B  1 43  ? -14.046 -56.607 -141.407 1.00 21.29  ? 43  MET A HE1  1 
ATOM   5683  H  HE2  . MET B  1 43  ? -15.083 -55.510 -140.911 1.00 21.29  ? 43  MET A HE2  1 
ATOM   5684  H  HE3  . MET B  1 43  ? -15.016 -55.902 -142.449 1.00 21.29  ? 43  MET A HE3  1 
ATOM   5685  N  N    . VAL B  1 44  ? -12.652 -49.132 -143.746 1.00 10.28  ? 44  VAL A N    1 
ATOM   5686  C  CA   . VAL B  1 44  ? -11.760 -47.981 -143.617 1.00 9.73   ? 44  VAL A CA   1 
ATOM   5687  C  C    . VAL B  1 44  ? -12.591 -46.757 -143.226 1.00 13.66  ? 44  VAL A C    1 
ATOM   5688  O  O    . VAL B  1 44  ? -12.266 -46.032 -142.266 1.00 11.09  ? 44  VAL A O    1 
ATOM   5689  C  CB   . VAL B  1 44  ? -10.992 -47.701 -144.924 1.00 11.24  ? 44  VAL A CB   1 
ATOM   5690  C  CG1  . VAL B  1 44  ? -10.210 -46.374 -144.847 1.00 12.99  ? 44  VAL A CG1  1 
ATOM   5691  C  CG2  . VAL B  1 44  ? -10.032 -48.852 -145.238 1.00 12.17  ? 44  VAL A CG2  1 
ATOM   5692  H  H    . VAL B  1 44  ? -12.613 -49.531 -144.507 1.00 12.34  ? 44  VAL A H    1 
ATOM   5693  H  HA   . VAL B  1 44  ? -11.115 -48.151 -142.914 1.00 11.67  ? 44  VAL A HA   1 
ATOM   5694  H  HB   . VAL B  1 44  ? -11.627 -47.633 -145.654 1.00 13.49  ? 44  VAL A HB   1 
ATOM   5695  H  HG11 . VAL B  1 44  ? -9.742  -46.235 -145.685 1.00 15.58  ? 44  VAL A HG11 1 
ATOM   5696  H  HG12 . VAL B  1 44  ? -10.835 -45.649 -144.692 1.00 15.58  ? 44  VAL A HG12 1 
ATOM   5697  H  HG13 . VAL B  1 44  ? -9.574  -46.425 -144.116 1.00 15.58  ? 44  VAL A HG13 1 
ATOM   5698  H  HG21 . VAL B  1 44  ? -9.561  -48.653 -146.062 1.00 14.60  ? 44  VAL A HG21 1 
ATOM   5699  H  HG22 . VAL B  1 44  ? -9.399  -48.942 -144.508 1.00 14.60  ? 44  VAL A HG22 1 
ATOM   5700  H  HG23 . VAL B  1 44  ? -10.543 -49.670 -145.337 1.00 14.60  ? 44  VAL A HG23 1 
ATOM   5701  N  N    . TYR B  1 45  ? -13.671 -46.546 -143.960 1.00 10.09  ? 45  TYR A N    1 
ATOM   5702  C  CA   . TYR B  1 45  ? -14.519 -45.371 -143.756 1.00 10.31  ? 45  TYR A CA   1 
ATOM   5703  C  C    . TYR B  1 45  ? -15.206 -45.394 -142.383 1.00 10.13  ? 45  TYR A C    1 
ATOM   5704  O  O    . TYR B  1 45  ? -15.190 -44.398 -141.659 1.00 10.16  ? 45  TYR A O    1 
ATOM   5705  C  CB   . TYR B  1 45  ? -15.546 -45.282 -144.881 1.00 10.83  ? 45  TYR A CB   1 
ATOM   5706  C  CG   . TYR B  1 45  ? -16.666 -44.273 -144.650 1.00 11.20  ? 45  TYR A CG   1 
ATOM   5707  C  CD1  . TYR B  1 45  ? -16.477 -42.930 -144.921 1.00 11.45  ? 45  TYR A CD1  1 
ATOM   5708  C  CD2  . TYR B  1 45  ? -17.908 -44.680 -144.168 1.00 11.42  ? 45  TYR A CD2  1 
ATOM   5709  C  CE1  . TYR B  1 45  ? -17.500 -42.010 -144.705 1.00 11.91  ? 45  TYR A CE1  1 
ATOM   5710  C  CE2  . TYR B  1 45  ? -18.931 -43.778 -143.959 1.00 11.91  ? 45  TYR A CE2  1 
ATOM   5711  C  CZ   . TYR B  1 45  ? -18.727 -42.439 -144.232 1.00 12.16  ? 45  TYR A CZ   1 
ATOM   5712  O  OH   . TYR B  1 45  ? -19.743 -41.545 -144.004 1.00 12.75  ? 45  TYR A OH   1 
ATOM   5713  H  H    . TYR B  1 45  ? -13.940 -47.068 -144.588 1.00 12.11  ? 45  TYR A H    1 
ATOM   5714  H  HA   . TYR B  1 45  ? -13.966 -44.575 -143.796 1.00 12.37  ? 45  TYR A HA   1 
ATOM   5715  H  HB2  . TYR B  1 45  ? -15.087 -45.028 -145.697 1.00 12.99  ? 45  TYR A HB2  1 
ATOM   5716  H  HB3  . TYR B  1 45  ? -15.955 -46.153 -144.995 1.00 12.99  ? 45  TYR A HB3  1 
ATOM   5717  H  HD1  . TYR B  1 45  ? -15.654 -42.638 -145.241 1.00 13.74  ? 45  TYR A HD1  1 
ATOM   5718  H  HD2  . TYR B  1 45  ? -18.051 -45.581 -143.985 1.00 13.71  ? 45  TYR A HD2  1 
ATOM   5719  H  HE1  . TYR B  1 45  ? -17.361 -41.108 -144.888 1.00 14.30  ? 45  TYR A HE1  1 
ATOM   5720  H  HE2  . TYR B  1 45  ? -19.751 -44.069 -143.633 1.00 14.29  ? 45  TYR A HE2  1 
ATOM   5721  H  HH   . TYR B  1 45  ? -19.489 -40.767 -144.192 1.00 15.30  ? 45  TYR A HH   1 
ATOM   5722  N  N    . MET B  1 46  ? -15.767 -46.542 -142.012 1.00 10.02  ? 46  MET A N    1 
ATOM   5723  C  CA   . MET B  1 46  ? -16.519 -46.654 -140.767 1.00 9.95   ? 46  MET A CA   1 
ATOM   5724  C  C    . MET B  1 46  ? -15.598 -46.515 -139.574 1.00 10.64  ? 46  MET A C    1 
ATOM   5725  O  O    . MET B  1 46  ? -16.023 -46.025 -138.539 1.00 12.24  ? 46  MET A O    1 
ATOM   5726  C  CB   . MET B  1 46  ? -17.267 -47.979 -140.693 1.00 14.43  ? 46  MET A CB   1 
ATOM   5727  C  CG   . MET B  1 46  ? -18.407 -48.082 -141.734 1.00 20.47  ? 46  MET A CG   1 
ATOM   5728  S  SD   . MET B  1 46  ? -19.526 -49.469 -141.464 1.00 23.79  ? 46  MET A SD   1 
ATOM   5729  C  CE   . MET B  1 46  ? -20.718 -48.733 -140.327 1.00 18.62  ? 46  MET A CE   1 
ATOM   5730  H  H    . MET B  1 46  ? -15.726 -47.271 -142.465 1.00 12.03  ? 46  MET A H    1 
ATOM   5731  H  HA   . MET B  1 46  ? -17.177 -45.942 -140.736 1.00 11.94  ? 46  MET A HA   1 
ATOM   5732  H  HB2  . MET B  1 46  ? -16.644 -48.704 -140.859 1.00 17.32  ? 46  MET A HB2  1 
ATOM   5733  H  HB3  . MET B  1 46  ? -17.658 -48.073 -139.810 1.00 17.32  ? 46  MET A HB3  1 
ATOM   5734  H  HG2  . MET B  1 46  ? -18.932 -47.267 -141.702 1.00 24.56  ? 46  MET A HG2  1 
ATOM   5735  H  HG3  . MET B  1 46  ? -18.015 -48.185 -142.616 1.00 24.56  ? 46  MET A HG3  1 
ATOM   5736  H  HE1  . MET B  1 46  ? -21.388 -49.396 -140.100 1.00 22.35  ? 46  MET A HE1  1 
ATOM   5737  H  HE2  . MET B  1 46  ? -20.253 -48.444 -139.526 1.00 22.35  ? 46  MET A HE2  1 
ATOM   5738  H  HE3  . MET B  1 46  ? -21.137 -47.972 -140.759 1.00 22.35  ? 46  MET A HE3  1 
ATOM   5739  N  N    . PHE B  1 47  ? -14.348 -46.956 -139.715 1.00 9.84   ? 47  PHE A N    1 
ATOM   5740  C  CA   . PHE B  1 47  ? -13.409 -46.872 -138.606 1.00 10.53  ? 47  PHE A CA   1 
ATOM   5741  C  C    . PHE B  1 47  ? -12.869 -45.469 -138.495 1.00 11.50  ? 47  PHE A C    1 
ATOM   5742  O  O    . PHE B  1 47  ? -12.653 -44.945 -137.395 1.00 11.96  ? 47  PHE A O    1 
ATOM   5743  C  CB   . PHE B  1 47  ? -12.265 -47.870 -138.762 1.00 10.53  ? 47  PHE A CB   1 
ATOM   5744  C  CG   . PHE B  1 47  ? -11.342 -47.904 -137.580 1.00 8.69   ? 47  PHE A CG   1 
ATOM   5745  C  CD1  . PHE B  1 47  ? -11.737 -48.500 -136.391 1.00 9.81   ? 47  PHE A CD1  1 
ATOM   5746  C  CD2  . PHE B  1 47  ? -10.100 -47.287 -137.642 1.00 9.38   ? 47  PHE A CD2  1 
ATOM   5747  C  CE1  . PHE B  1 47  ? -10.888 -48.520 -135.291 1.00 16.54  ? 47  PHE A CE1  1 
ATOM   5748  C  CE2  . PHE B  1 47  ? -9.252  -47.293 -136.561 1.00 11.49  ? 47  PHE A CE2  1 
ATOM   5749  C  CZ   . PHE B  1 47  ? -9.637  -47.909 -135.379 1.00 12.09  ? 47  PHE A CZ   1 
ATOM   5750  H  H    . PHE B  1 47  ? -14.025 -47.302 -140.433 1.00 11.80  ? 47  PHE A H    1 
ATOM   5751  H  HA   . PHE B  1 47  ? -13.876 -47.079 -137.781 1.00 12.64  ? 47  PHE A HA   1 
ATOM   5752  H  HB2  . PHE B  1 47  ? -12.636 -48.759 -138.875 1.00 12.64  ? 47  PHE A HB2  1 
ATOM   5753  H  HB3  . PHE B  1 47  ? -11.741 -47.629 -139.542 1.00 12.64  ? 47  PHE A HB3  1 
ATOM   5754  H  HD1  . PHE B  1 47  ? -12.570 -48.912 -136.337 1.00 11.78  ? 47  PHE A HD1  1 
ATOM   5755  H  HD2  . PHE B  1 47  ? -9.832  -46.876 -138.432 1.00 11.26  ? 47  PHE A HD2  1 
ATOM   5756  H  HE1  . PHE B  1 47  ? -11.154 -48.932 -134.500 1.00 19.85  ? 47  PHE A HE1  1 
ATOM   5757  H  HE2  . PHE B  1 47  ? -8.418  -46.886 -136.623 1.00 13.79  ? 47  PHE A HE2  1 
ATOM   5758  H  HZ   . PHE B  1 47  ? -9.063  -47.913 -134.647 1.00 14.50  ? 47  PHE A HZ   1 
ATOM   5759  N  N    . GLN B  1 48  ? -12.654 -44.838 -139.637 1.00 9.42   ? 48  GLN A N    1 
ATOM   5760  C  CA   . GLN B  1 48  ? -12.025 -43.542 -139.621 1.00 12.99  ? 48  GLN A CA   1 
ATOM   5761  C  C    . GLN B  1 48  ? -12.937 -42.420 -139.129 1.00 11.82  ? 48  GLN A C    1 
ATOM   5762  O  O    . GLN B  1 48  ? -12.480 -41.550 -138.414 1.00 14.50  ? 48  GLN A O    1 
ATOM   5763  C  CB   . GLN B  1 48  ? -11.526 -43.197 -141.001 1.00 14.46  ? 48  GLN A CB   1 
ATOM   5764  C  CG   . GLN B  1 48  ? -10.774 -41.876 -141.062 1.00 29.73  ? 48  GLN A CG   1 
ATOM   5765  C  CD   . GLN B  1 48  ? -9.750  -41.903 -142.161 1.00 33.17  ? 48  GLN A CD   1 
ATOM   5766  O  OE1  . GLN B  1 48  ? -8.592  -41.535 -141.962 1.00 32.04  ? 48  GLN A OE1  1 
ATOM   5767  N  NE2  . GLN B  1 48  ? -10.164 -42.383 -143.329 1.00 27.69  ? 48  GLN A NE2  1 
ATOM   5768  H  H    . GLN B  1 48  ? -12.860 -45.135 -140.417 1.00 11.31  ? 48  GLN A H    1 
ATOM   5769  H  HA   . GLN B  1 48  ? -11.257 -43.577 -139.030 1.00 15.58  ? 48  GLN A HA   1 
ATOM   5770  H  HB2  . GLN B  1 48  ? -10.925 -43.896 -141.301 1.00 17.35  ? 48  GLN A HB2  1 
ATOM   5771  H  HB3  . GLN B  1 48  ? -12.285 -43.135 -141.602 1.00 17.35  ? 48  GLN A HB3  1 
ATOM   5772  H  HG2  . GLN B  1 48  ? -11.399 -41.156 -141.242 1.00 35.67  ? 48  GLN A HG2  1 
ATOM   5773  H  HG3  . GLN B  1 48  ? -10.317 -41.725 -140.220 1.00 35.67  ? 48  GLN A HG3  1 
ATOM   5774  H  HE21 . GLN B  1 48  ? -10.975 -42.654 -143.420 1.00 33.22  ? 48  GLN A HE21 1 
ATOM   5775  H  HE22 . GLN B  1 48  ? -9.620  -42.422 -143.994 1.00 33.22  ? 48  GLN A HE22 1 
ATOM   5776  N  N    . TYR B  1 49  ? -14.206 -42.440 -139.519 1.00 10.18  ? 49  TYR A N    1 
ATOM   5777  C  CA   . TYR B  1 49  ? -15.136 -41.374 -139.165 1.00 10.65  ? 49  TYR A CA   1 
ATOM   5778  C  C    . TYR B  1 49  ? -16.151 -41.879 -138.178 1.00 10.76  ? 49  TYR A C    1 
ATOM   5779  O  O    . TYR B  1 49  ? -16.763 -42.914 -138.404 1.00 16.14  ? 49  TYR A O    1 
ATOM   5780  C  CB   . TYR B  1 49  ? -15.850 -40.855 -140.405 1.00 11.07  ? 49  TYR A CB   1 
ATOM   5781  C  CG   . TYR B  1 49  ? -14.920 -40.190 -141.365 1.00 14.24  ? 49  TYR A CG   1 
ATOM   5782  C  CD1  . TYR B  1 49  ? -14.395 -38.931 -141.081 1.00 20.87  ? 49  TYR A CD1  1 
ATOM   5783  C  CD2  . TYR B  1 49  ? -14.544 -40.813 -142.550 1.00 20.83  ? 49  TYR A CD2  1 
ATOM   5784  C  CE1  . TYR B  1 49  ? -13.518 -38.303 -141.958 1.00 24.38  ? 49  TYR A CE1  1 
ATOM   5785  C  CE2  . TYR B  1 49  ? -13.663 -40.191 -143.439 1.00 22.40  ? 49  TYR A CE2  1 
ATOM   5786  C  CZ   . TYR B  1 49  ? -13.163 -38.937 -143.134 1.00 39.22  ? 49  TYR A CZ   1 
ATOM   5787  O  OH   . TYR B  1 49  ? -12.305 -38.313 -143.997 1.00 52.87  ? 49  TYR A OH   1 
ATOM   5788  H  H    . TYR B  1 49  ? -14.556 -43.065 -139.994 1.00 12.22  ? 49  TYR A H    1 
ATOM   5789  H  HA   . TYR B  1 49  ? -14.650 -40.640 -138.759 1.00 12.78  ? 49  TYR A HA   1 
ATOM   5790  H  HB2  . TYR B  1 49  ? -16.272 -41.600 -140.862 1.00 13.29  ? 49  TYR A HB2  1 
ATOM   5791  H  HB3  . TYR B  1 49  ? -16.520 -40.207 -140.136 1.00 13.29  ? 49  TYR A HB3  1 
ATOM   5792  H  HD1  . TYR B  1 49  ? -14.634 -38.504 -140.291 1.00 25.05  ? 49  TYR A HD1  1 
ATOM   5793  H  HD2  . TYR B  1 49  ? -14.882 -41.655 -142.752 1.00 24.99  ? 49  TYR A HD2  1 
ATOM   5794  H  HE1  . TYR B  1 49  ? -13.179 -37.460 -141.759 1.00 29.26  ? 49  TYR A HE1  1 
ATOM   5795  H  HE2  . TYR B  1 49  ? -13.421 -40.613 -144.232 1.00 26.88  ? 49  TYR A HE2  1 
ATOM   5796  H  HH   . TYR B  1 49  ? -12.170 -38.798 -144.669 1.00 63.44  ? 49  TYR A HH   1 
ATOM   5797  N  N    . ASP B  1 50  ? -16.352 -41.143 -137.096 1.00 10.92  ? 50  ASP A N    1 
ATOM   5798  C  CA   . ASP B  1 50  ? -17.304 -41.545 -136.079 1.00 11.02  ? 50  ASP A CA   1 
ATOM   5799  C  C    . ASP B  1 50  ? -18.081 -40.318 -135.644 1.00 12.11  ? 50  ASP A C    1 
ATOM   5800  O  O    . ASP B  1 50  ? -17.481 -39.359 -135.158 1.00 12.01  ? 50  ASP A O    1 
ATOM   5801  C  CB   . ASP B  1 50  ? -16.580 -42.173 -134.894 1.00 10.62  ? 50  ASP A CB   1 
ATOM   5802  C  CG   . ASP B  1 50  ? -17.514 -42.956 -133.982 1.00 12.50  ? 50  ASP A CG   1 
ATOM   5803  O  OD1  . ASP B  1 50  ? -18.170 -42.339 -133.123 1.00 13.75  ? 50  ASP A OD1  1 
ATOM   5804  O  OD2  . ASP B  1 50  ? -17.582 -44.196 -134.136 1.00 21.25  ? 50  ASP A OD2  1 
ATOM   5805  H  H    . ASP B  1 50  ? -15.947 -40.403 -136.928 1.00 13.10  ? 50  ASP A H    1 
ATOM   5806  H  HA   . ASP B  1 50  ? -17.924 -42.194 -136.447 1.00 13.23  ? 50  ASP A HA   1 
ATOM   5807  H  HB2  . ASP B  1 50  ? -15.903 -42.783 -135.224 1.00 12.74  ? 50  ASP A HB2  1 
ATOM   5808  H  HB3  . ASP B  1 50  ? -16.167 -41.471 -134.368 1.00 12.74  ? 50  ASP A HB3  1 
ATOM   5809  N  N    . SER B  1 51  ? -19.404 -40.346 -135.801 1.00 12.22  ? 51  SER A N    1 
ATOM   5810  C  CA   . SER B  1 51  ? -20.238 -39.213 -135.426 1.00 13.07  ? 51  SER A CA   1 
ATOM   5811  C  C    . SER B  1 51  ? -20.105 -38.860 -133.946 1.00 13.28  ? 51  SER A C    1 
ATOM   5812  O  O    . SER B  1 51  ? -20.201 -37.697 -133.586 1.00 13.95  ? 51  SER A O    1 
ATOM   5813  C  CB   . SER B  1 51  ? -21.722 -39.484 -135.750 1.00 13.65  ? 51  SER A CB   1 
ATOM   5814  O  OG   . SER B  1 51  ? -21.925 -39.694 -137.142 1.00 13.66  ? 51  SER A OG   1 
ATOM   5815  H  H    . SER B  1 51  ? -19.841 -41.013 -136.123 1.00 14.67  ? 51  SER A H    1 
ATOM   5816  H  HA   . SER B  1 51  ? -19.959 -38.439 -135.940 1.00 15.69  ? 51  SER A HA   1 
ATOM   5817  H  HB2  . SER B  1 51  ? -22.008 -40.276 -135.268 1.00 16.38  ? 51  SER A HB2  1 
ATOM   5818  H  HB3  . SER B  1 51  ? -22.249 -38.719 -135.468 1.00 16.38  ? 51  SER A HB3  1 
ATOM   5819  H  HG   . SER B  1 51  ? -21.477 -40.355 -137.401 1.00 16.39  ? 51  SER A HG   1 
ATOM   5820  N  N    . THR B  1 52  ? -19.912 -39.863 -133.098 1.00 12.81  ? 52  THR A N    1 
ATOM   5821  C  CA   . THR B  1 52  ? -19.950 -39.665 -131.654 1.00 13.09  ? 52  THR A CA   1 
ATOM   5822  C  C    . THR B  1 52  ? -18.573 -39.329 -131.085 1.00 14.22  ? 52  THR A C    1 
ATOM   5823  O  O    . THR B  1 52  ? -18.439 -38.448 -130.235 1.00 13.41  ? 52  THR A O    1 
ATOM   5824  C  CB   . THR B  1 52  ? -20.494 -40.927 -130.946 1.00 12.82  ? 52  THR A CB   1 
ATOM   5825  O  OG1  . THR B  1 52  ? -21.792 -41.224 -131.467 1.00 14.04  ? 52  THR A OG1  1 
ATOM   5826  C  CG2  . THR B  1 52  ? -20.602 -40.728 -129.421 1.00 13.21  ? 52  THR A CG2  1 
ATOM   5827  H  H    . THR B  1 52  ? -19.755 -40.675 -133.335 1.00 15.37  ? 52  THR A H    1 
ATOM   5828  H  HA   . THR B  1 52  ? -20.546 -38.927 -131.452 1.00 15.71  ? 52  THR A HA   1 
ATOM   5829  H  HB   . THR B  1 52  ? -19.900 -41.674 -131.116 1.00 15.39  ? 52  THR A HB   1 
ATOM   5830  H  HG1  . THR B  1 52  ? -22.102 -41.909 -131.091 1.00 16.84  ? 52  THR A HG1  1 
ATOM   5831  H  HG21 . THR B  1 52  ? -20.946 -41.534 -129.006 1.00 15.85  ? 52  THR A HG21 1 
ATOM   5832  H  HG22 . THR B  1 52  ? -19.728 -40.529 -129.050 1.00 15.85  ? 52  THR A HG22 1 
ATOM   5833  H  HG23 . THR B  1 52  ? -21.203 -39.991 -129.225 1.00 15.85  ? 52  THR A HG23 1 
ATOM   5834  N  N    . HIS B  1 53  ? -17.555 -40.045 -131.539 1.00 12.08  ? 53  HIS A N    1 
ATOM   5835  C  CA   . HIS B  1 53  ? -16.243 -39.940 -130.911 1.00 12.64  ? 53  HIS A CA   1 
ATOM   5836  C  C    . HIS B  1 53  ? -15.211 -39.253 -131.821 1.00 14.39  ? 53  HIS A C    1 
ATOM   5837  O  O    . HIS B  1 53  ? -14.056 -39.121 -131.459 1.00 15.09  ? 53  HIS A O    1 
ATOM   5838  C  CB   . HIS B  1 53  ? -15.776 -41.330 -130.500 1.00 11.21  ? 53  HIS A CB   1 
ATOM   5839  C  CG   . HIS B  1 53  ? -16.707 -42.010 -129.548 1.00 14.66  ? 53  HIS A CG   1 
ATOM   5840  N  ND1  . HIS B  1 53  ? -16.819 -41.639 -128.221 1.00 11.72  ? 53  HIS A ND1  1 
ATOM   5841  C  CD2  . HIS B  1 53  ? -17.595 -43.015 -129.735 1.00 12.06  ? 53  HIS A CD2  1 
ATOM   5842  C  CE1  . HIS B  1 53  ? -17.718 -42.407 -127.626 1.00 13.89  ? 53  HIS A CE1  1 
ATOM   5843  N  NE2  . HIS B  1 53  ? -18.216 -43.240 -128.525 1.00 11.33  ? 53  HIS A NE2  1 
ATOM   5844  H  H    . HIS B  1 53  ? -17.594 -40.594 -132.201 1.00 14.50  ? 53  HIS A H    1 
ATOM   5845  H  HA   . HIS B  1 53  ? -16.326 -39.407 -130.105 1.00 15.17  ? 53  HIS A HA   1 
ATOM   5846  H  HB2  . HIS B  1 53  ? -15.704 -41.884 -131.293 1.00 13.45  ? 53  HIS A HB2  1 
ATOM   5847  H  HB3  . HIS B  1 53  ? -14.910 -41.256 -130.069 1.00 13.45  ? 53  HIS A HB3  1 
ATOM   5848  H  HD2  . HIS B  1 53  ? -17.755 -43.469 -130.531 1.00 14.47  ? 53  HIS A HD2  1 
ATOM   5849  H  HE1  . HIS B  1 53  ? -17.972 -42.354 -126.733 1.00 16.67  ? 53  HIS A HE1  1 
ATOM   5850  N  N    . GLY B  1 54  ? -15.642 -38.806 -132.993 1.00 12.03  ? 54  GLY A N    1 
ATOM   5851  C  CA   . GLY B  1 54  ? -14.781 -38.052 -133.885 1.00 12.15  ? 54  GLY A CA   1 
ATOM   5852  C  C    . GLY B  1 54  ? -13.842 -38.906 -134.709 1.00 11.51  ? 54  GLY A C    1 
ATOM   5853  O  O    . GLY B  1 54  ? -13.805 -40.124 -134.577 1.00 10.96  ? 54  GLY A O    1 
ATOM   5854  H  H    . GLY B  1 54  ? -16.438 -38.929 -133.296 1.00 14.43  ? 54  GLY A H    1 
ATOM   5855  H  HA2  . GLY B  1 54  ? -15.331 -37.534 -134.494 1.00 14.58  ? 54  GLY A HA2  1 
ATOM   5856  H  HA3  . GLY B  1 54  ? -14.246 -37.434 -133.362 1.00 14.58  ? 54  GLY A HA3  1 
ATOM   5857  N  N    . LYS B  1 55  ? -13.084 -38.255 -135.577 1.00 11.68  ? 55  LYS A N    1 
ATOM   5858  C  CA   . LYS B  1 55  ? -12.205 -38.960 -136.488 1.00 12.49  ? 55  LYS A CA   1 
ATOM   5859  C  C    . LYS B  1 55  ? -11.099 -39.689 -135.734 1.00 12.13  ? 55  LYS A C    1 
ATOM   5860  O  O    . LYS B  1 55  ? -10.585 -39.197 -134.730 1.00 12.66  ? 55  LYS A O    1 
ATOM   5861  C  CB   . LYS B  1 55  ? -11.593 -37.986 -137.499 1.00 16.08  ? 55  LYS A CB   1 
ATOM   5862  C  CG   . LYS B  1 55  ? -10.638 -38.671 -138.457 1.00 34.93  ? 55  LYS A CG   1 
ATOM   5863  C  CD   . LYS B  1 55  ? -10.518 -37.957 -139.802 1.00 58.61  ? 55  LYS A CD   1 
ATOM   5864  C  CE   . LYS B  1 55  ? -9.735  -36.667 -139.697 1.00 74.49  ? 55  LYS A CE   1 
ATOM   5865  N  NZ   . LYS B  1 55  ? -9.762  -35.905 -140.980 1.00 82.31  ? 55  LYS A NZ   1 
ATOM   5866  H  H    . LYS B  1 55  ? -13.061 -37.400 -135.658 1.00 14.02  ? 55  LYS A H    1 
ATOM   5867  H  HA   . LYS B  1 55  ? -12.720 -39.619 -136.979 1.00 14.99  ? 55  LYS A HA   1 
ATOM   5868  H  HB2  . LYS B  1 55  ? -12.305 -37.582 -138.021 1.00 19.30  ? 55  LYS A HB2  1 
ATOM   5869  H  HB3  . LYS B  1 55  ? -11.101 -37.300 -137.021 1.00 19.30  ? 55  LYS A HB3  1 
ATOM   5870  H  HG2  . LYS B  1 55  ? -9.756  -38.699 -138.054 1.00 41.92  ? 55  LYS A HG2  1 
ATOM   5871  H  HG3  . LYS B  1 55  ? -10.954 -39.572 -138.624 1.00 41.92  ? 55  LYS A HG3  1 
ATOM   5872  H  HD2  . LYS B  1 55  ? -10.060 -38.537 -140.430 1.00 70.34  ? 55  LYS A HD2  1 
ATOM   5873  H  HD3  . LYS B  1 55  ? -11.406 -37.745 -140.130 1.00 70.34  ? 55  LYS A HD3  1 
ATOM   5874  H  HE2  . LYS B  1 55  ? -10.126 -36.111 -139.005 1.00 89.39  ? 55  LYS A HE2  1 
ATOM   5875  H  HE3  . LYS B  1 55  ? -8.811  -36.870 -139.483 1.00 89.39  ? 55  LYS A HE3  1 
ATOM   5876  H  HZ1  . LYS B  1 55  ? -9.296  -35.151 -140.896 1.00 98.78  ? 55  LYS A HZ1  1 
ATOM   5877  H  HZ2  . LYS B  1 55  ? -9.404  -36.394 -141.632 1.00 98.78  ? 55  LYS A HZ2  1 
ATOM   5878  H  HZ3  . LYS B  1 55  ? -10.601 -35.703 -141.197 1.00 98.78  ? 55  LYS A HZ3  1 
ATOM   5879  N  N    . PHE B  1 56  ? -10.741 -40.866 -136.222 1.00 12.20  ? 56  PHE A N    1 
ATOM   5880  C  CA   . PHE B  1 56  ? -9.653  -41.648 -135.646 1.00 10.82  ? 56  PHE A CA   1 
ATOM   5881  C  C    . PHE B  1 56  ? -8.354  -40.842 -135.703 1.00 11.81  ? 56  PHE A C    1 
ATOM   5882  O  O    . PHE B  1 56  ? -7.995  -40.339 -136.749 1.00 13.60  ? 56  PHE A O    1 
ATOM   5883  C  CB   . PHE B  1 56  ? -9.494  -42.978 -136.386 1.00 12.25  ? 56  PHE A CB   1 
ATOM   5884  C  CG   . PHE B  1 56  ? -8.345  -43.823 -135.880 1.00 14.84  ? 56  PHE A CG   1 
ATOM   5885  C  CD1  . PHE B  1 56  ? -8.335  -44.298 -134.586 1.00 9.69   ? 56  PHE A CD1  1 
ATOM   5886  C  CD2  . PHE B  1 56  ? -7.284  -44.129 -136.703 1.00 14.69  ? 56  PHE A CD2  1 
ATOM   5887  C  CE1  . PHE B  1 56  ? -7.299  -45.060 -134.124 1.00 18.37  ? 56  PHE A CE1  1 
ATOM   5888  C  CE2  . PHE B  1 56  ? -6.246  -44.899 -136.241 1.00 17.81  ? 56  PHE A CE2  1 
ATOM   5889  C  CZ   . PHE B  1 56  ? -6.253  -45.358 -134.957 1.00 12.10  ? 56  PHE A CZ   1 
ATOM   5890  H  H    . PHE B  1 56  ? -11.119 -41.242 -136.898 1.00 14.64  ? 56  PHE A H    1 
ATOM   5891  H  HA   . PHE B  1 56  ? -9.853  -41.840 -134.716 1.00 12.99  ? 56  PHE A HA   1 
ATOM   5892  H  HB2  . PHE B  1 56  ? -10.309 -43.493 -136.283 1.00 14.70  ? 56  PHE A HB2  1 
ATOM   5893  H  HB3  . PHE B  1 56  ? -9.336  -42.795 -137.326 1.00 14.70  ? 56  PHE A HB3  1 
ATOM   5894  H  HD1  . PHE B  1 56  ? -9.044  -44.097 -134.018 1.00 11.63  ? 56  PHE A HD1  1 
ATOM   5895  H  HD2  . PHE B  1 56  ? -7.275  -43.819 -137.579 1.00 17.62  ? 56  PHE A HD2  1 
ATOM   5896  H  HE1  . PHE B  1 56  ? -7.305  -45.375 -133.249 1.00 22.04  ? 56  PHE A HE1  1 
ATOM   5897  H  HE2  . PHE B  1 56  ? -5.532  -45.102 -136.802 1.00 21.37  ? 56  PHE A HE2  1 
ATOM   5898  H  HZ   . PHE B  1 56  ? -5.547  -45.877 -134.646 1.00 14.52  ? 56  PHE A HZ   1 
ATOM   5899  N  N    . HIS B  1 57  ? -7.709  -40.697 -134.548 1.00 16.76  ? 57  HIS A N    1 
ATOM   5900  C  CA   . HIS B  1 57  ? -6.396  -40.079 -134.442 1.00 27.71  ? 57  HIS A CA   1 
ATOM   5901  C  C    . HIS B  1 57  ? -5.355  -41.168 -134.718 1.00 30.74  ? 57  HIS A C    1 
ATOM   5902  O  O    . HIS B  1 57  ? -5.015  -41.972 -133.849 1.00 33.68  ? 57  HIS A O    1 
ATOM   5903  C  CB   . HIS B  1 57  ? -6.194  -39.453 -133.060 1.00 41.15  ? 57  HIS A CB   1 
ATOM   5904  C  CG   . HIS B  1 57  ? -7.090  -38.278 -132.789 1.00 66.11  ? 57  HIS A CG   1 
ATOM   5905  N  ND1  . HIS B  1 57  ? -7.528  -37.949 -131.523 1.00 67.69  ? 57  HIS A ND1  1 
ATOM   5906  C  CD2  . HIS B  1 57  ? -7.621  -37.350 -133.622 1.00 67.74  ? 57  HIS A CD2  1 
ATOM   5907  C  CE1  . HIS B  1 57  ? -8.294  -36.874 -131.589 1.00 64.71  ? 57  HIS A CE1  1 
ATOM   5908  N  NE2  . HIS B  1 57  ? -8.365  -36.490 -132.851 1.00 65.09  ? 57  HIS A NE2  1 
ATOM   5909  H  H    . HIS B  1 57  ? -8.024  -40.958 -133.791 1.00 20.12  ? 57  HIS A H    1 
ATOM   5910  H  HA   . HIS B  1 57  ? -6.307  -39.385 -135.113 1.00 33.26  ? 57  HIS A HA   1 
ATOM   5911  H  HB2  . HIS B  1 57  ? -6.374  -40.125 -132.383 1.00 49.39  ? 57  HIS A HB2  1 
ATOM   5912  H  HB3  . HIS B  1 57  ? -5.276  -39.150 -132.985 1.00 49.39  ? 57  HIS A HB3  1 
ATOM   5913  H  HD2  . HIS B  1 57  ? -7.505  -37.305 -134.544 1.00 81.29  ? 57  HIS A HD2  1 
ATOM   5914  H  HE1  . HIS B  1 57  ? -8.710  -36.457 -130.869 1.00 77.65  ? 57  HIS A HE1  1 
ATOM   5915  N  N    . GLY B  1 58  ? -4.886  -41.201 -135.950 1.00 23.21  ? 58  GLY A N    1 
ATOM   5916  C  CA   . GLY B  1 58  ? -3.994  -42.254 -136.407 1.00 18.71  ? 58  GLY A CA   1 
ATOM   5917  C  C    . GLY B  1 58  ? -4.238  -42.419 -137.883 1.00 21.22  ? 58  GLY A C    1 
ATOM   5918  O  O    . GLY B  1 58  ? -4.943  -41.608 -138.475 1.00 20.32  ? 58  GLY A O    1 
ATOM   5919  H  H    . GLY B  1 58  ? -5.071  -40.617 -136.553 1.00 27.86  ? 58  GLY A H    1 
ATOM   5920  H  HA2  . GLY B  1 58  ? -3.068  -42.006 -136.256 1.00 22.46  ? 58  GLY A HA2  1 
ATOM   5921  H  HA3  . GLY B  1 58  ? -4.187  -43.087 -135.950 1.00 22.46  ? 58  GLY A HA3  1 
ATOM   5922  N  N    . THR B  1 59  ? -3.681  -43.475 -138.469 1.00 14.64  ? 59  THR A N    1 
ATOM   5923  C  CA   . THR B  1 59  ? -3.813  -43.717 -139.897 1.00 14.20  ? 59  THR A CA   1 
ATOM   5924  C  C    . THR B  1 59  ? -4.609  -44.983 -140.150 1.00 19.63  ? 59  THR A C    1 
ATOM   5925  O  O    . THR B  1 59  ? -4.490  -45.963 -139.411 1.00 15.47  ? 59  THR A O    1 
ATOM   5926  C  CB   . THR B  1 59  ? -2.435  -43.840 -140.565 1.00 19.84  ? 59  THR A CB   1 
ATOM   5927  O  OG1  . THR B  1 59  ? -1.749  -44.973 -140.014 1.00 17.71  ? 59  THR A OG1  1 
ATOM   5928  C  CG2  . THR B  1 59  ? -1.618  -42.577 -140.331 1.00 24.63  ? 59  THR A CG2  1 
ATOM   5929  H  H    . THR B  1 59  ? -3.218  -44.071 -138.056 1.00 17.57  ? 59  THR A H    1 
ATOM   5930  H  HA   . THR B  1 59  ? -4.285  -42.973 -140.305 1.00 17.04  ? 59  THR A HA   1 
ATOM   5931  H  HB   . THR B  1 59  ? -2.548  -43.962 -141.521 1.00 23.80  ? 59  THR A HB   1 
ATOM   5932  H  HG1  . THR B  1 59  ? -0.992  -45.052 -140.372 1.00 21.25  ? 59  THR A HG1  1 
ATOM   5933  H  HG21 . THR B  1 59  ? -0.749  -42.661 -140.755 1.00 29.56  ? 59  THR A HG21 1 
ATOM   5934  H  HG22 . THR B  1 59  ? -2.079  -41.810 -140.706 1.00 29.56  ? 59  THR A HG22 1 
ATOM   5935  H  HG23 . THR B  1 59  ? -1.492  -42.436 -139.380 1.00 29.56  ? 59  THR A HG23 1 
ATOM   5936  N  N    . VAL B  1 60  ? -5.447  -44.961 -141.180 1.00 10.84  ? 60  VAL A N    1 
ATOM   5937  C  CA   . VAL B  1 60  ? -6.166  -46.163 -141.550 1.00 10.06  ? 60  VAL A CA   1 
ATOM   5938  C  C    . VAL B  1 60  ? -6.303  -46.194 -143.053 1.00 14.51  ? 60  VAL A C    1 
ATOM   5939  O  O    . VAL B  1 60  ? -6.659  -45.200 -143.672 1.00 15.17  ? 60  VAL A O    1 
ATOM   5940  C  CB   . VAL B  1 60  ? -7.544  -46.263 -140.812 1.00 15.96  ? 60  VAL A CB   1 
ATOM   5941  C  CG1  . VAL B  1 60  ? -8.387  -45.047 -141.018 1.00 21.71  ? 60  VAL A CG1  1 
ATOM   5942  C  CG2  . VAL B  1 60  ? -8.281  -47.523 -141.202 1.00 11.67  ? 60  VAL A CG2  1 
ATOM   5943  H  H    . VAL B  1 60  ? -5.612  -44.275 -141.671 1.00 13.01  ? 60  VAL A H    1 
ATOM   5944  H  HA   . VAL B  1 60  ? -5.638  -46.933 -141.287 1.00 12.07  ? 60  VAL A HA   1 
ATOM   5945  H  HB   . VAL B  1 60  ? -7.367  -46.324 -139.861 1.00 19.15  ? 60  VAL A HB   1 
ATOM   5946  H  HG11 . VAL B  1 60  ? -9.225  -45.160 -140.543 1.00 26.05  ? 60  VAL A HG11 1 
ATOM   5947  H  HG12 . VAL B  1 60  ? -7.914  -44.273 -140.675 1.00 26.05  ? 60  VAL A HG12 1 
ATOM   5948  H  HG13 . VAL B  1 60  ? -8.557  -44.937 -141.967 1.00 26.05  ? 60  VAL A HG13 1 
ATOM   5949  H  HG21 . VAL B  1 60  ? -9.127  -47.553 -140.729 1.00 14.00  ? 60  VAL A HG21 1 
ATOM   5950  H  HG22 . VAL B  1 60  ? -8.437  -47.514 -142.159 1.00 14.00  ? 60  VAL A HG22 1 
ATOM   5951  H  HG23 . VAL B  1 60  ? -7.740  -48.292 -140.962 1.00 14.00  ? 60  VAL A HG23 1 
ATOM   5952  N  N    . LYS B  1 61  ? -5.939  -47.332 -143.643 1.00 13.28  ? 61  LYS A N    1 
ATOM   5953  C  CA   . LYS B  1 61  ? -6.123  -47.539 -145.065 1.00 10.71  ? 61  LYS A CA   1 
ATOM   5954  C  C    . LYS B  1 61  ? -6.331  -49.009 -145.394 1.00 10.73  ? 61  LYS A C    1 
ATOM   5955  O  O    . LYS B  1 61  ? -6.132  -49.883 -144.539 1.00 14.90  ? 61  LYS A O    1 
ATOM   5956  C  CB   . LYS B  1 61  ? -4.923  -47.007 -145.834 1.00 14.27  ? 61  LYS A CB   1 
ATOM   5957  C  CG   . LYS B  1 61  ? -3.649  -47.791 -145.584 1.00 18.34  ? 61  LYS A CG   1 
ATOM   5958  C  CD   . LYS B  1 61  ? -2.432  -47.178 -146.294 1.00 33.01  ? 61  LYS A CD   1 
ATOM   5959  C  CE   . LYS B  1 61  ? -1.205  -48.052 -146.073 1.00 51.07  ? 61  LYS A CE   1 
ATOM   5960  N  NZ   . LYS B  1 61  ? 0.065   -47.446 -146.567 1.00 70.07  ? 61  LYS A NZ   1 
ATOM   5961  H  H    . LYS B  1 61  ? -5.582  -48.000 -143.234 1.00 15.93  ? 61  LYS A H    1 
ATOM   5962  H  HA   . LYS B  1 61  ? -6.909  -47.051 -145.357 1.00 12.85  ? 61  LYS A HA   1 
ATOM   5963  H  HB2  . LYS B  1 61  ? -5.116  -47.048 -146.784 1.00 17.13  ? 61  LYS A HB2  1 
ATOM   5964  H  HB3  . LYS B  1 61  ? -4.764  -46.088 -145.570 1.00 17.13  ? 61  LYS A HB3  1 
ATOM   5965  H  HG2  . LYS B  1 61  ? -3.467  -47.803 -144.632 1.00 22.00  ? 61  LYS A HG2  1 
ATOM   5966  H  HG3  . LYS B  1 61  ? -3.765  -48.696 -145.913 1.00 22.00  ? 61  LYS A HG3  1 
ATOM   5967  H  HD2  . LYS B  1 61  ? -2.605  -47.125 -147.247 1.00 39.61  ? 61  LYS A HD2  1 
ATOM   5968  H  HD3  . LYS B  1 61  ? -2.254  -46.297 -145.930 1.00 39.61  ? 61  LYS A HD3  1 
ATOM   5969  H  HE2  . LYS B  1 61  ? -1.105  -48.214 -145.122 1.00 61.28  ? 61  LYS A HE2  1 
ATOM   5970  H  HE3  . LYS B  1 61  ? -1.332  -48.894 -146.538 1.00 61.28  ? 61  LYS A HE3  1 
ATOM   5971  H  HZ1  . LYS B  1 61  ? 0.009   -47.295 -147.443 1.00 84.08  ? 61  LYS A HZ1  1 
ATOM   5972  H  HZ2  . LYS B  1 61  ? 0.217   -46.675 -146.150 1.00 84.08  ? 61  LYS A HZ2  1 
ATOM   5973  H  HZ3  . LYS B  1 61  ? 0.746   -47.998 -146.412 1.00 84.08  ? 61  LYS A HZ3  1 
ATOM   5974  N  N    . ALA B  1 62  ? -6.726  -49.270 -146.639 1.00 11.05  ? 62  ALA A N    1 
ATOM   5975  C  CA   . ALA B  1 62  ? -6.806  -50.614 -147.182 1.00 14.71  ? 62  ALA A CA   1 
ATOM   5976  C  C    . ALA B  1 62  ? -5.605  -50.852 -148.058 1.00 21.09  ? 62  ALA A C    1 
ATOM   5977  O  O    . ALA B  1 62  ? -5.305  -50.040 -148.921 1.00 18.60  ? 62  ALA A O    1 
ATOM   5978  C  CB   . ALA B  1 62  ? -8.098  -50.805 -147.976 1.00 17.73  ? 62  ALA A CB   1 
ATOM   5979  H  H    . ALA B  1 62  ? -6.958  -48.662 -147.201 1.00 13.26  ? 62  ALA A H    1 
ATOM   5980  H  HA   . ALA B  1 62  ? -6.791  -51.258 -146.457 1.00 17.65  ? 62  ALA A HA   1 
ATOM   5981  H  HB1  . ALA B  1 62  ? -8.123  -51.710 -148.325 1.00 21.27  ? 62  ALA A HB1  1 
ATOM   5982  H  HB2  . ALA B  1 62  ? -8.855  -50.657 -147.388 1.00 21.27  ? 62  ALA A HB2  1 
ATOM   5983  H  HB3  . ALA B  1 62  ? -8.116  -50.167 -148.707 1.00 21.27  ? 62  ALA A HB3  1 
ATOM   5984  N  N    . GLU B  1 63  ? -4.890  -51.944 -147.839 1.00 15.12  ? 63  GLU A N    1 
ATOM   5985  C  CA   . GLU B  1 63  ? -3.830  -52.299 -148.770 1.00 12.97  ? 63  GLU A CA   1 
ATOM   5986  C  C    . GLU B  1 63  ? -3.585  -53.782 -148.830 1.00 17.66  ? 63  GLU A C    1 
ATOM   5987  O  O    . GLU B  1 63  ? -3.546  -54.452 -147.807 1.00 15.56  ? 63  GLU A O    1 
ATOM   5988  C  CB   . GLU B  1 63  ? -2.528  -51.581 -148.410 1.00 19.13  ? 63  GLU A CB   1 
ATOM   5989  C  CG   . GLU B  1 63  ? -1.436  -51.822 -149.446 1.00 33.44  ? 63  GLU A CG   1 
ATOM   5990  C  CD   . GLU B  1 63  ? -0.332  -50.783 -149.401 1.00 50.76  ? 63  GLU A CD   1 
ATOM   5991  O  OE1  . GLU B  1 63  ? 0.420   -50.672 -150.398 1.00 52.93  ? 63  GLU A OE1  1 
ATOM   5992  O  OE2  . GLU B  1 63  ? -0.216  -50.080 -148.374 1.00 46.12  ? 63  GLU A OE2  1 
ATOM   5993  H  H    . GLU B  1 63  ? -4.992  -52.484 -147.177 1.00 18.14  ? 63  GLU A H    1 
ATOM   5994  H  HA   . GLU B  1 63  ? -4.089  -52.009 -149.659 1.00 15.56  ? 63  GLU A HA   1 
ATOM   5995  H  HB2  . GLU B  1 63  ? -2.694  -50.627 -148.361 1.00 22.95  ? 63  GLU A HB2  1 
ATOM   5996  H  HB3  . GLU B  1 63  ? -2.211  -51.909 -147.554 1.00 22.95  ? 63  GLU A HB3  1 
ATOM   5997  H  HG2  . GLU B  1 63  ? -1.035  -52.690 -149.285 1.00 40.13  ? 63  GLU A HG2  1 
ATOM   5998  H  HG3  . GLU B  1 63  ? -1.831  -51.799 -150.332 1.00 40.13  ? 63  GLU A HG3  1 
ATOM   5999  N  N    . ASN B  1 64  ? -3.419  -54.288 -150.048 1.00 17.61  ? 64  ASN A N    1 
ATOM   6000  C  CA   . ASN B  1 64  ? -3.187  -55.710 -150.268 1.00 23.44  ? 64  ASN A CA   1 
ATOM   6001  C  C    . ASN B  1 64  ? -4.264  -56.566 -149.612 1.00 17.56  ? 64  ASN A C    1 
ATOM   6002  O  O    . ASN B  1 64  ? -3.973  -57.641 -149.135 1.00 18.91  ? 64  ASN A O    1 
ATOM   6003  C  CB   . ASN B  1 64  ? -1.816  -56.120 -149.719 1.00 30.56  ? 64  ASN A CB   1 
ATOM   6004  C  CG   . ASN B  1 64  ? -0.687  -55.290 -150.294 1.00 46.08  ? 64  ASN A CG   1 
ATOM   6005  O  OD1  . ASN B  1 64  ? -0.700  -54.946 -151.477 1.00 35.35  ? 64  ASN A OD1  1 
ATOM   6006  N  ND2  . ASN B  1 64  ? 0.296   -54.954 -149.455 1.00 40.97  ? 64  ASN A ND2  1 
ATOM   6007  H  H    . ASN B  1 64  ? -3.438  -53.823 -150.772 1.00 21.14  ? 64  ASN A H    1 
ATOM   6008  H  HA   . ASN B  1 64  ? -3.197  -55.891 -151.221 1.00 28.12  ? 64  ASN A HA   1 
ATOM   6009  H  HB2  . ASN B  1 64  ? -1.814  -56.005 -148.756 1.00 36.67  ? 64  ASN A HB2  1 
ATOM   6010  H  HB3  . ASN B  1 64  ? -1.650  -57.049 -149.943 1.00 36.67  ? 64  ASN A HB3  1 
ATOM   6011  H  HD21 . ASN B  1 64  ? 0.959   -54.483 -149.735 1.00 49.16  ? 64  ASN A HD21 1 
ATOM   6012  H  HD22 . ASN B  1 64  ? 0.266   -55.208 -148.634 1.00 49.16  ? 64  ASN A HD22 1 
ATOM   6013  N  N    . GLY B  1 65  ? -5.492  -56.059 -149.545 1.00 14.67  ? 65  GLY A N    1 
ATOM   6014  C  CA   . GLY B  1 65  ? -6.600  -56.818 -148.998 1.00 18.55  ? 65  GLY A CA   1 
ATOM   6015  C  C    . GLY B  1 65  ? -6.641  -56.856 -147.478 1.00 13.66  ? 65  GLY A C    1 
ATOM   6016  O  O    . GLY B  1 65  ? -7.471  -57.550 -146.896 1.00 16.26  ? 65  GLY A O    1 
ATOM   6017  H  H    . GLY B  1 65  ? -5.706  -55.270 -149.813 1.00 17.60  ? 65  GLY A H    1 
ATOM   6018  H  HA2  . GLY B  1 65  ? -7.433  -56.434 -149.312 1.00 22.26  ? 65  GLY A HA2  1 
ATOM   6019  H  HA3  . GLY B  1 65  ? -6.548  -57.731 -149.320 1.00 22.26  ? 65  GLY A HA3  1 
ATOM   6020  N  N    . LYS B  1 66  ? -5.752  -56.104 -146.849 1.00 12.35  ? 66  LYS A N    1 
ATOM   6021  C  CA   . LYS B  1 66  ? -5.719  -55.953 -145.396 1.00 12.14  ? 66  LYS A CA   1 
ATOM   6022  C  C    . LYS B  1 66  ? -6.171  -54.554 -144.997 1.00 17.59  ? 66  LYS A C    1 
ATOM   6023  O  O    . LYS B  1 66  ? -5.986  -53.578 -145.730 1.00 12.24  ? 66  LYS A O    1 
ATOM   6024  C  CB   . LYS B  1 66  ? -4.306  -56.199 -144.863 1.00 14.55  ? 66  LYS A CB   1 
ATOM   6025  C  CG   . LYS B  1 66  ? -3.713  -57.580 -145.196 1.00 17.37  ? 66  LYS A CG   1 
ATOM   6026  C  CD   . LYS B  1 66  ? -3.831  -58.499 -144.012 1.00 15.52  ? 66  LYS A CD   1 
ATOM   6027  C  CE   . LYS B  1 66  ? -3.495  -59.936 -144.350 1.00 31.64  ? 66  LYS A CE   1 
ATOM   6028  N  NZ   . LYS B  1 66  ? -2.156  -60.024 -144.912 1.00 42.94  ? 66  LYS A NZ   1 
ATOM   6029  H  H    . LYS B  1 66  ? -5.138  -55.657 -147.251 1.00 14.82  ? 66  LYS A H    1 
ATOM   6030  H  HA   . LYS B  1 66  ? -6.319  -56.598 -144.989 1.00 14.57  ? 66  LYS A HA   1 
ATOM   6031  H  HB2  . LYS B  1 66  ? -3.714  -55.529 -145.239 1.00 17.46  ? 66  LYS A HB2  1 
ATOM   6032  H  HB3  . LYS B  1 66  ? -4.322  -56.113 -143.897 1.00 17.46  ? 66  LYS A HB3  1 
ATOM   6033  H  HG2  . LYS B  1 66  ? -4.200  -57.971 -145.938 1.00 20.84  ? 66  LYS A HG2  1 
ATOM   6034  H  HG3  . LYS B  1 66  ? -2.774  -57.484 -145.420 1.00 20.84  ? 66  LYS A HG3  1 
ATOM   6035  H  HD2  . LYS B  1 66  ? -3.218  -58.202 -143.320 1.00 18.63  ? 66  LYS A HD2  1 
ATOM   6036  H  HD3  . LYS B  1 66  ? -4.742  -58.473 -143.681 1.00 18.63  ? 66  LYS A HD3  1 
ATOM   6037  H  HE2  . LYS B  1 66  ? -3.527  -60.474 -143.544 1.00 37.97  ? 66  LYS A HE2  1 
ATOM   6038  H  HE3  . LYS B  1 66  ? -4.127  -60.270 -145.007 1.00 37.97  ? 66  LYS A HE3  1 
ATOM   6039  H  HZ1  . LYS B  1 66  ? -1.559  -59.722 -144.325 1.00 51.53  ? 66  LYS A HZ1  1 
ATOM   6040  H  HZ2  . LYS B  1 66  ? -1.964  -60.871 -145.109 1.00 51.53  ? 66  LYS A HZ2  1 
ATOM   6041  H  HZ3  . LYS B  1 66  ? -2.104  -59.536 -145.654 1.00 51.53  ? 66  LYS A HZ3  1 
ATOM   6042  N  N    . LEU B  1 67  ? -6.763  -54.458 -143.824 1.00 11.08  ? 67  LEU A N    1 
ATOM   6043  C  CA   . LEU B  1 67  ? -7.017  -53.171 -143.186 1.00 10.13  ? 67  LEU A CA   1 
ATOM   6044  C  C    . LEU B  1 67  ? -5.765  -52.808 -142.426 1.00 14.30  ? 67  LEU A C    1 
ATOM   6045  O  O    . LEU B  1 67  ? -5.294  -53.607 -141.637 1.00 19.38  ? 67  LEU A O    1 
ATOM   6046  C  CB   . LEU B  1 67  ? -8.217  -53.278 -142.246 1.00 9.65   ? 67  LEU A CB   1 
ATOM   6047  C  CG   . LEU B  1 67  ? -8.639  -52.011 -141.502 1.00 11.40  ? 67  LEU A CG   1 
ATOM   6048  C  CD1  . LEU B  1 67  ? -9.175  -50.982 -142.496 1.00 13.57  ? 67  LEU A CD1  1 
ATOM   6049  C  CD2  . LEU B  1 67  ? -9.687  -52.340 -140.459 1.00 16.41  ? 67  LEU A CD2  1 
ATOM   6050  H  H    . LEU B  1 67  ? -7.035  -55.132 -143.364 1.00 13.30  ? 67  LEU A H    1 
ATOM   6051  H  HA   . LEU B  1 67  ? -7.194  -52.492 -143.855 1.00 12.16  ? 67  LEU A HA   1 
ATOM   6052  H  HB2  . LEU B  1 67  ? -8.981  -53.571 -142.766 1.00 11.58  ? 67  LEU A HB2  1 
ATOM   6053  H  HB3  . LEU B  1 67  ? -8.013  -53.948 -141.574 1.00 11.58  ? 67  LEU A HB3  1 
ATOM   6054  H  HG   . LEU B  1 67  ? -7.869  -51.630 -141.053 1.00 13.68  ? 67  LEU A HG   1 
ATOM   6055  H  HD11 . LEU B  1 67  ? -9.439  -50.184 -142.012 1.00 16.29  ? 67  LEU A HD11 1 
ATOM   6056  H  HD12 . LEU B  1 67  ? -8.476  -50.767 -143.134 1.00 16.29  ? 67  LEU A HD12 1 
ATOM   6057  H  HD13 . LEU B  1 67  ? -9.940  -51.359 -142.958 1.00 16.29  ? 67  LEU A HD13 1 
ATOM   6058  H  HD21 . LEU B  1 67  ? -9.941  -51.525 -139.999 1.00 19.70  ? 67  LEU A HD21 1 
ATOM   6059  H  HD22 . LEU B  1 67  ? -10.460 -52.727 -140.899 1.00 19.70  ? 67  LEU A HD22 1 
ATOM   6060  H  HD23 . LEU B  1 67  ? -9.314  -52.974 -139.827 1.00 19.70  ? 67  LEU A HD23 1 
ATOM   6061  N  N    . VAL B  1 68  ? -5.203  -51.631 -142.667 1.00 10.31  ? 68  VAL A N    1 
ATOM   6062  C  CA   . VAL B  1 68  ? -3.949  -51.257 -142.049 1.00 10.55  ? 68  VAL A CA   1 
ATOM   6063  C  C    . VAL B  1 68  ? -4.167  -50.057 -141.133 1.00 10.26  ? 68  VAL A C    1 
ATOM   6064  O  O    . VAL B  1 68  ? -4.417  -48.953 -141.598 1.00 10.31  ? 68  VAL A O    1 
ATOM   6065  C  CB   . VAL B  1 68  ? -2.892  -50.935 -143.113 1.00 11.22  ? 68  VAL A CB   1 
ATOM   6066  C  CG1  . VAL B  1 68  ? -1.511  -50.696 -142.468 1.00 15.07  ? 68  VAL A CG1  1 
ATOM   6067  C  CG2  . VAL B  1 68  ? -2.810  -52.090 -144.121 1.00 22.74  ? 68  VAL A CG2  1 
ATOM   6068  H  H    . VAL B  1 68  ? -5.533  -51.032 -143.188 1.00 12.37  ? 68  VAL A H    1 
ATOM   6069  H  HA   . VAL B  1 68  ? -3.624  -51.995 -141.511 1.00 12.65  ? 68  VAL A HA   1 
ATOM   6070  H  HB   . VAL B  1 68  ? -3.150  -50.131 -143.589 1.00 13.46  ? 68  VAL A HB   1 
ATOM   6071  H  HG11 . VAL B  1 68  ? -0.867  -50.496 -143.165 1.00 18.08  ? 68  VAL A HG11 1 
ATOM   6072  H  HG12 . VAL B  1 68  ? -1.576  -49.948 -141.852 1.00 18.08  ? 68  VAL A HG12 1 
ATOM   6073  H  HG13 . VAL B  1 68  ? -1.243  -51.496 -141.989 1.00 18.08  ? 68  VAL A HG13 1 
ATOM   6074  H  HG21 . VAL B  1 68  ? -2.140  -51.878 -144.790 1.00 27.28  ? 68  VAL A HG21 1 
ATOM   6075  H  HG22 . VAL B  1 68  ? -2.565  -52.903 -143.652 1.00 27.28  ? 68  VAL A HG22 1 
ATOM   6076  H  HG23 . VAL B  1 68  ? -3.676  -52.201 -144.544 1.00 27.28  ? 68  VAL A HG23 1 
ATOM   6077  N  N    . ILE B  1 69  ? -4.063  -50.288 -139.829 1.00 14.63  ? 69  ILE A N    1 
ATOM   6078  C  CA   . ILE B  1 69  ? -4.300  -49.253 -138.830 1.00 9.87   ? 69  ILE A CA   1 
ATOM   6079  C  C    . ILE B  1 69  ? -2.970  -48.951 -138.152 1.00 12.37  ? 69  ILE A C    1 
ATOM   6080  O  O    . ILE B  1 69  ? -2.336  -49.849 -137.594 1.00 11.96  ? 69  ILE A O    1 
ATOM   6081  C  CB   . ILE B  1 69  ? -5.360  -49.684 -137.796 1.00 10.11  ? 69  ILE A CB   1 
ATOM   6082  C  CG1  . ILE B  1 69  ? -6.717  -49.878 -138.486 1.00 12.48  ? 69  ILE A CG1  1 
ATOM   6083  C  CG2  . ILE B  1 69  ? -5.468  -48.641 -136.665 1.00 12.70  ? 69  ILE A CG2  1 
ATOM   6084  C  CD1  . ILE B  1 69  ? -7.862  -50.375 -137.555 1.00 15.64  ? 69  ILE A CD1  1 
ATOM   6085  H  H    . ILE B  1 69  ? -3.853  -51.051 -139.492 1.00 17.56  ? 69  ILE A H    1 
ATOM   6086  H  HA   . ILE B  1 69  ? -4.611  -48.446 -139.269 1.00 11.85  ? 69  ILE A HA   1 
ATOM   6087  H  HB   . ILE B  1 69  ? -5.087  -50.531 -137.409 1.00 12.13  ? 69  ILE A HB   1 
ATOM   6088  H  HG12 . ILE B  1 69  ? -6.994  -49.029 -138.864 1.00 14.98  ? 69  ILE A HG12 1 
ATOM   6089  H  HG13 . ILE B  1 69  ? -6.611  -50.531 -139.195 1.00 14.98  ? 69  ILE A HG13 1 
ATOM   6090  H  HG21 . ILE B  1 69  ? -6.139  -48.933 -136.029 1.00 15.24  ? 69  ILE A HG21 1 
ATOM   6091  H  HG22 . ILE B  1 69  ? -4.606  -48.562 -136.226 1.00 15.24  ? 69  ILE A HG22 1 
ATOM   6092  H  HG23 . ILE B  1 69  ? -5.724  -47.787 -137.048 1.00 15.24  ? 69  ILE A HG23 1 
ATOM   6093  H  HD11 . ILE B  1 69  ? -8.675  -50.467 -138.077 1.00 18.76  ? 69  ILE A HD11 1 
ATOM   6094  H  HD12 . ILE B  1 69  ? -7.612  -51.233 -137.178 1.00 18.76  ? 69  ILE A HD12 1 
ATOM   6095  H  HD13 . ILE B  1 69  ? -7.995  -49.727 -136.846 1.00 18.76  ? 69  ILE A HD13 1 
ATOM   6096  N  N    . ASN B  1 70  ? -2.553  -47.687 -138.222 1.00 14.65  ? 70  ASN A N    1 
ATOM   6097  C  CA   . ASN B  1 70  ? -1.263  -47.253 -137.691 1.00 16.04  ? 70  ASN A CA   1 
ATOM   6098  C  C    . ASN B  1 70  ? -0.134  -48.167 -138.164 1.00 24.24  ? 70  ASN A C    1 
ATOM   6099  O  O    . ASN B  1 70  ? 0.747   -48.522 -137.381 1.00 20.27  ? 70  ASN A O    1 
ATOM   6100  C  CB   . ASN B  1 70  ? -1.295  -47.220 -136.165 1.00 13.63  ? 70  ASN A CB   1 
ATOM   6101  C  CG   . ASN B  1 70  ? -2.149  -46.089 -135.617 1.00 21.05  ? 70  ASN A CG   1 
ATOM   6102  O  OD1  . ASN B  1 70  ? -2.490  -45.137 -136.327 1.00 21.20  ? 70  ASN A OD1  1 
ATOM   6103  N  ND2  . ASN B  1 70  ? -2.477  -46.180 -134.340 1.00 21.10  ? 70  ASN A ND2  1 
ATOM   6104  H  H    . ASN B  1 70  ? -3.009  -47.051 -138.578 1.00 17.58  ? 70  ASN A H    1 
ATOM   6105  H  HA   . ASN B  1 70  ? -1.076  -46.356 -138.008 1.00 19.25  ? 70  ASN A HA   1 
ATOM   6106  H  HB2  . ASN B  1 70  ? -1.660  -48.057 -135.839 1.00 16.36  ? 70  ASN A HB2  1 
ATOM   6107  H  HB3  . ASN B  1 70  ? -0.391  -47.100 -135.833 1.00 16.36  ? 70  ASN A HB3  1 
ATOM   6108  H  HD21 . ASN B  1 70  ? -2.959  -45.568 -133.975 1.00 25.32  ? 70  ASN A HD21 1 
ATOM   6109  H  HD22 . ASN B  1 70  ? -2.207  -46.850 -133.874 1.00 25.32  ? 70  ASN A HD22 1 
ATOM   6110  N  N    . GLY B  1 71  ? -0.180  -48.546 -139.442 1.00 18.13  ? 71  GLY A N    1 
ATOM   6111  C  CA   . GLY B  1 71  ? 0.839   -49.395 -140.044 1.00 17.20  ? 71  GLY A CA   1 
ATOM   6112  C  C    . GLY B  1 71  ? 0.698   -50.889 -139.775 1.00 13.74  ? 71  GLY A C    1 
ATOM   6113  O  O    . GLY B  1 71  ? 1.476   -51.680 -140.290 1.00 18.58  ? 71  GLY A O    1 
ATOM   6114  H  H    . GLY B  1 71  ? -0.804  -48.319 -139.988 1.00 21.75  ? 71  GLY A H    1 
ATOM   6115  H  HA2  . GLY B  1 71  ? 0.825   -49.265 -141.005 1.00 20.64  ? 71  GLY A HA2  1 
ATOM   6116  H  HA3  . GLY B  1 71  ? 1.709   -49.117 -139.719 1.00 20.64  ? 71  GLY A HA3  1 
ATOM   6117  N  N    . ASN B  1 72  ? -0.276  -51.284 -138.965 1.00 15.27  ? 72  ASN A N    1 
ATOM   6118  C  CA   . ASN B  1 72  ? -0.454  -52.698 -138.600 1.00 16.97  ? 72  ASN A CA   1 
ATOM   6119  C  C    . ASN B  1 72  ? -1.509  -53.369 -139.477 1.00 14.94  ? 72  ASN A C    1 
ATOM   6120  O  O    . ASN B  1 72  ? -2.667  -52.939 -139.475 1.00 13.34  ? 72  ASN A O    1 
ATOM   6121  C  CB   . ASN B  1 72  ? -0.864  -52.825 -137.132 1.00 23.46  ? 72  ASN A CB   1 
ATOM   6122  C  CG   . ASN B  1 72  ? 0.122   -52.170 -136.209 1.00 30.73  ? 72  ASN A CG   1 
ATOM   6123  O  OD1  . ASN B  1 72  ? 1.189   -52.699 -135.972 1.00 30.29  ? 72  ASN A OD1  1 
ATOM   6124  N  ND2  . ASN B  1 72  ? -0.214  -50.995 -135.714 1.00 38.53  ? 72  ASN A ND2  1 
ATOM   6125  H  H    . ASN B  1 72  ? -0.853  -50.755 -138.609 1.00 18.32  ? 72  ASN A H    1 
ATOM   6126  H  HA   . ASN B  1 72  ? 0.386   -53.167 -138.722 1.00 20.36  ? 72  ASN A HA   1 
ATOM   6127  H  HB2  . ASN B  1 72  ? -1.726  -52.400 -137.004 1.00 28.16  ? 72  ASN A HB2  1 
ATOM   6128  H  HB3  . ASN B  1 72  ? -0.918  -53.765 -136.897 1.00 28.16  ? 72  ASN A HB3  1 
ATOM   6129  H  HD21 . ASN B  1 72  ? 0.322   -50.584 -135.181 1.00 46.23  ? 72  ASN A HD21 1 
ATOM   6130  H  HD22 . ASN B  1 72  ? -0.968  -50.639 -135.923 1.00 46.23  ? 72  ASN A HD22 1 
ATOM   6131  N  N    . PRO B  1 73  ? -1.120  -54.409 -140.231 1.00 19.00  ? 73  PRO A N    1 
ATOM   6132  C  CA   . PRO B  1 73  ? -2.106  -55.055 -141.105 1.00 19.61  ? 73  PRO A CA   1 
ATOM   6133  C  C    . PRO B  1 73  ? -3.049  -55.985 -140.336 1.00 18.47  ? 73  PRO A C    1 
ATOM   6134  O  O    . PRO B  1 73  ? -2.628  -56.727 -139.449 1.00 15.79  ? 73  PRO A O    1 
ATOM   6135  C  CB   . PRO B  1 73  ? -1.235  -55.834 -142.096 1.00 21.69  ? 73  PRO A CB   1 
ATOM   6136  C  CG   . PRO B  1 73  ? 0.003   -56.155 -141.322 1.00 29.02  ? 73  PRO A CG   1 
ATOM   6137  C  CD   . PRO B  1 73  ? 0.235   -54.973 -140.419 1.00 17.50  ? 73  PRO A CD   1 
ATOM   6138  H  HA   . PRO B  1 73  ? -2.624  -54.389 -141.583 1.00 23.53  ? 73  PRO A HA   1 
ATOM   6139  H  HB2  . PRO B  1 73  ? -1.692  -56.645 -142.370 1.00 26.03  ? 73  PRO A HB2  1 
ATOM   6140  H  HB3  . PRO B  1 73  ? -1.029  -55.277 -142.863 1.00 26.03  ? 73  PRO A HB3  1 
ATOM   6141  H  HG2  . PRO B  1 73  ? -0.139  -56.960 -140.800 1.00 34.82  ? 73  PRO A HG2  1 
ATOM   6142  H  HG3  . PRO B  1 73  ? 0.748   -56.270 -141.932 1.00 34.82  ? 73  PRO A HG3  1 
ATOM   6143  H  HD2  . PRO B  1 73  ? 0.600   -55.263 -139.569 1.00 21.00  ? 73  PRO A HD2  1 
ATOM   6144  H  HD3  . PRO B  1 73  ? 0.813   -54.325 -140.852 1.00 21.00  ? 73  PRO A HD3  1 
ATOM   6145  N  N    . ILE B  1 74  ? -4.322  -55.929 -140.694 1.00 10.51  ? 74  ILE A N    1 
ATOM   6146  C  CA   . ILE B  1 74  ? -5.366  -56.721 -140.068 1.00 10.15  ? 74  ILE A CA   1 
ATOM   6147  C  C    . ILE B  1 74  ? -6.041  -57.553 -141.143 1.00 10.45  ? 74  ILE A C    1 
ATOM   6148  O  O    . ILE B  1 74  ? -6.409  -57.027 -142.184 1.00 10.58  ? 74  ILE A O    1 
ATOM   6149  C  CB   . ILE B  1 74  ? -6.390  -55.814 -139.360 1.00 9.54   ? 74  ILE A CB   1 
ATOM   6150  C  CG1  . ILE B  1 74  ? -5.680  -54.963 -138.306 1.00 17.43  ? 74  ILE A CG1  1 
ATOM   6151  C  CG2  . ILE B  1 74  ? -7.528  -56.627 -138.758 1.00 9.27   ? 74  ILE A CG2  1 
ATOM   6152  C  CD1  . ILE B  1 74  ? -6.507  -53.854 -137.759 1.00 17.35  ? 74  ILE A CD1  1 
ATOM   6153  H  H    . ILE B  1 74  ? -4.615  -55.420 -141.322 1.00 12.62  ? 74  ILE A H    1 
ATOM   6154  H  HA   . ILE B  1 74  ? -4.974  -57.319 -139.412 1.00 12.17  ? 74  ILE A HA   1 
ATOM   6155  H  HB   . ILE B  1 74  ? -6.768  -55.216 -140.023 1.00 11.45  ? 74  ILE A HB   1 
ATOM   6156  H  HG12 . ILE B  1 74  ? -5.425  -55.534 -137.565 1.00 20.92  ? 74  ILE A HG12 1 
ATOM   6157  H  HG13 . ILE B  1 74  ? -4.888  -54.571 -138.705 1.00 20.92  ? 74  ILE A HG13 1 
ATOM   6158  H  HG21 . ILE B  1 74  ? -8.150  -56.024 -138.322 1.00 11.12  ? 74  ILE A HG21 1 
ATOM   6159  H  HG22 . ILE B  1 74  ? -7.979  -57.112 -139.467 1.00 11.12  ? 74  ILE A HG22 1 
ATOM   6160  H  HG23 . ILE B  1 74  ? -7.163  -57.250 -138.111 1.00 11.12  ? 74  ILE A HG23 1 
ATOM   6161  H  HD11 . ILE B  1 74  ? -5.986  -53.367 -137.102 1.00 20.82  ? 74  ILE A HD11 1 
ATOM   6162  H  HD12 . ILE B  1 74  ? -6.762  -53.263 -138.485 1.00 20.82  ? 74  ILE A HD12 1 
ATOM   6163  H  HD13 . ILE B  1 74  ? -7.300  -54.228 -137.343 1.00 20.82  ? 74  ILE A HD13 1 
ATOM   6164  N  N    . THR B  1 75  ? -6.149  -58.856 -140.912 1.00 10.67  ? 75  THR A N    1 
ATOM   6165  C  CA   . THR B  1 75  ? -6.857  -59.749 -141.810 1.00 11.08  ? 75  THR A CA   1 
ATOM   6166  C  C    . THR B  1 75  ? -8.369  -59.552 -141.695 1.00 12.67  ? 75  THR A C    1 
ATOM   6167  O  O    . THR B  1 75  ? -8.918  -59.510 -140.601 1.00 11.16  ? 75  THR A O    1 
ATOM   6168  C  CB   . THR B  1 75  ? -6.486  -61.220 -141.519 1.00 15.23  ? 75  THR A CB   1 
ATOM   6169  O  OG1  . THR B  1 75  ? -5.075  -61.369 -141.687 1.00 13.47  ? 75  THR A OG1  1 
ATOM   6170  C  CG2  . THR B  1 75  ? -7.222  -62.191 -142.454 1.00 15.62  ? 75  THR A CG2  1 
ATOM   6171  H  H    . THR B  1 75  ? -5.814  -59.252 -140.226 1.00 12.80  ? 75  THR A H    1 
ATOM   6172  H  HA   . THR B  1 75  ? -6.598  -59.549 -142.723 1.00 13.29  ? 75  THR A HA   1 
ATOM   6173  H  HB   . THR B  1 75  ? -6.725  -61.437 -140.604 1.00 18.27  ? 75  THR A HB   1 
ATOM   6174  H  HG1  . THR B  1 75  ? -4.849  -62.163 -141.533 1.00 16.16  ? 75  THR A HG1  1 
ATOM   6175  H  HG21 . THR B  1 75  ? -6.970  -63.105 -142.248 1.00 18.74  ? 75  THR A HG21 1 
ATOM   6176  H  HG22 . THR B  1 75  ? -8.181  -62.096 -142.341 1.00 18.74  ? 75  THR A HG22 1 
ATOM   6177  H  HG23 . THR B  1 75  ? -6.992  -62.001 -143.377 1.00 18.74  ? 75  THR A HG23 1 
ATOM   6178  N  N    . ILE B  1 76  ? -9.030  -59.444 -142.843 1.00 11.05  ? 76  ILE A N    1 
ATOM   6179  C  CA   . ILE B  1 76  ? -10.455 -59.177 -142.899 1.00 10.92  ? 76  ILE A CA   1 
ATOM   6180  C  C    . ILE B  1 76  ? -11.214 -60.397 -143.426 1.00 17.66  ? 76  ILE A C    1 
ATOM   6181  O  O    . ILE B  1 76  ? -10.922 -60.912 -144.494 1.00 13.40  ? 76  ILE A O    1 
ATOM   6182  C  CB   . ILE B  1 76  ? -10.765 -57.953 -143.796 1.00 10.92  ? 76  ILE A CB   1 
ATOM   6183  C  CG1  . ILE B  1 76  ? -9.993  -56.714 -143.301 1.00 10.42  ? 76  ILE A CG1  1 
ATOM   6184  C  CG2  . ILE B  1 76  ? -12.261 -57.653 -143.819 1.00 12.95  ? 76  ILE A CG2  1 
ATOM   6185  C  CD1  . ILE B  1 76  ? -10.230 -56.351 -141.847 1.00 13.93  ? 76  ILE A CD1  1 
ATOM   6186  H  H    . ILE B  1 76  ? -8.663  -59.523 -143.617 1.00 13.27  ? 76  ILE A H    1 
ATOM   6187  H  HA   . ILE B  1 76  ? -10.777 -58.985 -142.004 1.00 13.10  ? 76  ILE A HA   1 
ATOM   6188  H  HB   . ILE B  1 76  ? -10.478 -58.154 -144.701 1.00 13.10  ? 76  ILE A HB   1 
ATOM   6189  H  HG12 . ILE B  1 76  ? -9.043  -56.879 -143.410 1.00 12.50  ? 76  ILE A HG12 1 
ATOM   6190  H  HG13 . ILE B  1 76  ? -10.255 -55.952 -143.840 1.00 12.50  ? 76  ILE A HG13 1 
ATOM   6191  H  HG21 . ILE B  1 76  ? -12.420 -56.884 -144.388 1.00 15.53  ? 76  ILE A HG21 1 
ATOM   6192  H  HG22 . ILE B  1 76  ? -12.733 -58.426 -144.167 1.00 15.53  ? 76  ILE A HG22 1 
ATOM   6193  H  HG23 . ILE B  1 76  ? -12.558 -57.463 -142.915 1.00 15.53  ? 76  ILE A HG23 1 
ATOM   6194  H  HD11 . ILE B  1 76  ? -9.705  -55.564 -141.629 1.00 16.71  ? 76  ILE A HD11 1 
ATOM   6195  H  HD12 . ILE B  1 76  ? -11.173 -56.166 -141.717 1.00 16.71  ? 76  ILE A HD12 1 
ATOM   6196  H  HD13 . ILE B  1 76  ? -9.958  -57.095 -141.287 1.00 16.71  ? 76  ILE A HD13 1 
ATOM   6197  N  N    . PHE B  1 77  ? -12.191 -60.843 -142.653 1.00 14.76  ? 77  PHE A N    1 
ATOM   6198  C  CA   . PHE B  1 77  ? -13.069 -61.931 -143.053 1.00 12.10  ? 77  PHE A CA   1 
ATOM   6199  C  C    . PHE B  1 77  ? -14.470 -61.409 -143.318 1.00 12.81  ? 77  PHE A C    1 
ATOM   6200  O  O    . PHE B  1 77  ? -14.854 -60.336 -142.839 1.00 12.73  ? 77  PHE A O    1 
ATOM   6201  C  CB   . PHE B  1 77  ? -13.109 -63.006 -141.981 1.00 12.07  ? 77  PHE A CB   1 
ATOM   6202  C  CG   . PHE B  1 77  ? -11.786 -63.645 -141.702 1.00 13.38  ? 77  PHE A CG   1 
ATOM   6203  C  CD1  . PHE B  1 77  ? -11.207 -64.490 -142.625 1.00 20.76  ? 77  PHE A CD1  1 
ATOM   6204  C  CD2  . PHE B  1 77  ? -11.143 -63.448 -140.488 1.00 14.93  ? 77  PHE A CD2  1 
ATOM   6205  C  CE1  . PHE B  1 77  ? -9.984  -65.113 -142.360 1.00 18.77  ? 77  PHE A CE1  1 
ATOM   6206  C  CE2  . PHE B  1 77  ? -9.927  -64.074 -140.224 1.00 18.93  ? 77  PHE A CE2  1 
ATOM   6207  C  CZ   . PHE B  1 77  ? -9.357  -64.905 -141.157 1.00 17.28  ? 77  PHE A CZ   1 
ATOM   6208  H  H    . PHE B  1 77  ? -12.369 -60.525 -141.874 1.00 17.71  ? 77  PHE A H    1 
ATOM   6209  H  HA   . PHE B  1 77  ? -12.733 -62.330 -143.871 1.00 14.52  ? 77  PHE A HA   1 
ATOM   6210  H  HB2  . PHE B  1 77  ? -13.424 -62.608 -141.154 1.00 14.48  ? 77  PHE A HB2  1 
ATOM   6211  H  HB3  . PHE B  1 77  ? -13.721 -63.704 -142.262 1.00 14.48  ? 77  PHE A HB3  1 
ATOM   6212  H  HD1  . PHE B  1 77  ? -11.630 -64.639 -143.439 1.00 24.92  ? 77  PHE A HD1  1 
ATOM   6213  H  HD2  . PHE B  1 77  ? -11.525 -62.891 -139.848 1.00 17.92  ? 77  PHE A HD2  1 
ATOM   6214  H  HE1  . PHE B  1 77  ? -9.601  -65.674 -142.995 1.00 22.52  ? 77  PHE A HE1  1 
ATOM   6215  H  HE2  . PHE B  1 77  ? -9.499  -63.928 -139.411 1.00 22.71  ? 77  PHE A HE2  1 
ATOM   6216  H  HZ   . PHE B  1 77  ? -8.541  -65.313 -140.980 1.00 20.74  ? 77  PHE A HZ   1 
ATOM   6217  N  N    . GLN B  1 78  ? -15.233 -62.181 -144.079 1.00 16.92  ? 78  GLN A N    1 
ATOM   6218  C  CA   . GLN B  1 78  ? -16.581 -61.810 -144.457 1.00 15.52  ? 78  GLN A CA   1 
ATOM   6219  C  C    . GLN B  1 78  ? -17.546 -62.978 -144.297 1.00 21.71  ? 78  GLN A C    1 
ATOM   6220  O  O    . GLN B  1 78  ? -18.295 -63.280 -145.221 1.00 27.88  ? 78  GLN A O    1 
ATOM   6221  C  CB   . GLN B  1 78  ? -16.592 -61.313 -145.920 1.00 14.75  ? 78  GLN A CB   1 
ATOM   6222  C  CG   . GLN B  1 78  ? -15.649 -60.142 -146.196 1.00 17.92  ? 78  GLN A CG   1 
ATOM   6223  C  CD   . GLN B  1 78  ? -16.255 -58.791 -145.859 1.00 33.99  ? 78  GLN A CD   1 
ATOM   6224  O  OE1  . GLN B  1 78  ? -17.050 -58.246 -146.635 1.00 26.12  ? 78  GLN A OE1  1 
ATOM   6225  N  NE2  . GLN B  1 78  ? -15.870 -58.231 -144.705 1.00 22.27  ? 78  GLN A NE2  1 
ATOM   6226  H  H    . GLN B  1 78  ? -14.984 -62.942 -144.393 1.00 20.31  ? 78  GLN A H    1 
ATOM   6227  H  HA   . GLN B  1 78  ? -16.884 -61.085 -143.888 1.00 18.62  ? 78  GLN A HA   1 
ATOM   6228  H  HB2  . GLN B  1 78  ? -16.329 -62.045 -146.499 1.00 17.69  ? 78  GLN A HB2  1 
ATOM   6229  H  HB3  . GLN B  1 78  ? -17.491 -61.026 -146.144 1.00 17.69  ? 78  GLN A HB3  1 
ATOM   6230  H  HG2  . GLN B  1 78  ? -14.848 -60.251 -145.661 1.00 21.50  ? 78  GLN A HG2  1 
ATOM   6231  H  HG3  . GLN B  1 78  ? -15.419 -60.139 -147.138 1.00 21.50  ? 78  GLN A HG3  1 
ATOM   6232  H  HE21 . GLN B  1 78  ? -15.306 -58.636 -144.198 1.00 26.72  ? 78  GLN A HE21 1 
ATOM   6233  H  HE22 . GLN B  1 78  ? -16.186 -57.466 -144.472 1.00 26.72  ? 78  GLN A HE22 1 
ATOM   6234  N  N    . GLU B  1 79  ? -17.536 -63.625 -143.129 1.00 18.78  ? 79  GLU A N    1 
ATOM   6235  C  CA   . GLU B  1 79  ? -18.303 -64.861 -142.904 1.00 19.01  ? 79  GLU A CA   1 
ATOM   6236  C  C    . GLU B  1 79  ? -19.533 -64.629 -142.040 1.00 21.42  ? 79  GLU A C    1 
ATOM   6237  O  O    . GLU B  1 79  ? -19.442 -64.030 -140.973 1.00 18.59  ? 79  GLU A O    1 
ATOM   6238  C  CB   . GLU B  1 79  ? -17.440 -65.919 -142.211 1.00 20.27  ? 79  GLU A CB   1 
ATOM   6239  C  CG   . GLU B  1 79  ? -16.159 -66.259 -142.904 1.00 28.79  ? 79  GLU A CG   1 
ATOM   6240  C  CD   . GLU B  1 79  ? -16.367 -67.058 -144.172 1.00 44.00  ? 79  GLU A CD   1 
ATOM   6241  O  OE1  . GLU B  1 79  ? -17.450 -67.686 -144.330 1.00 29.34  ? 79  GLU A OE1  1 
ATOM   6242  O  OE2  . GLU B  1 79  ? -15.432 -67.045 -145.007 1.00 45.87  ? 79  GLU A OE2  1 
ATOM   6243  H  H    . GLU B  1 79  ? -17.089 -63.367 -142.441 1.00 22.54  ? 79  GLU A H    1 
ATOM   6244  H  HA   . GLU B  1 79  ? -18.593 -65.217 -143.758 1.00 22.81  ? 79  GLU A HA   1 
ATOM   6245  H  HB2  . GLU B  1 79  ? -17.215 -65.599 -141.324 1.00 24.32  ? 79  GLU A HB2  1 
ATOM   6246  H  HB3  . GLU B  1 79  ? -17.957 -66.737 -142.138 1.00 24.32  ? 79  GLU A HB3  1 
ATOM   6247  H  HG2  . GLU B  1 79  ? -15.700 -65.438 -143.139 1.00 34.55  ? 79  GLU A HG2  1 
ATOM   6248  H  HG3  . GLU B  1 79  ? -15.607 -66.787 -142.305 1.00 34.55  ? 79  GLU A HG3  1 
ATOM   6249  N  N    . ARG B  1 80  ? -20.676 -65.134 -142.476 1.00 19.08  ? 80  ARG A N    1 
ATOM   6250  C  CA   . ARG B  1 80  ? -21.881 -65.057 -141.664 1.00 18.66  ? 80  ARG A CA   1 
ATOM   6251  C  C    . ARG B  1 80  ? -21.832 -66.075 -140.525 1.00 20.49  ? 80  ARG A C    1 
ATOM   6252  O  O    . ARG B  1 80  ? -22.295 -65.806 -139.416 1.00 21.07  ? 80  ARG A O    1 
ATOM   6253  C  CB   . ARG B  1 80  ? -23.123 -65.289 -142.530 1.00 21.04  ? 80  ARG A CB   1 
ATOM   6254  C  CG   . ARG B  1 80  ? -23.380 -64.156 -143.514 1.00 33.62  ? 80  ARG A CG   1 
ATOM   6255  C  CD   . ARG B  1 80  ? -24.456 -64.507 -144.531 1.00 43.87  ? 80  ARG A CD   1 
ATOM   6256  N  NE   . ARG B  1 80  ? -24.647 -63.437 -145.508 1.00 51.94  ? 80  ARG A NE   1 
ATOM   6257  C  CZ   . ARG B  1 80  ? -25.521 -62.441 -145.380 1.00 60.05  ? 80  ARG A CZ   1 
ATOM   6258  N  NH1  . ARG B  1 80  ? -26.301 -62.355 -144.309 1.00 62.21  ? 80  ARG A NH1  1 
ATOM   6259  N  NH2  . ARG B  1 80  ? -25.617 -61.523 -146.333 1.00 61.28  ? 80  ARG A NH2  1 
ATOM   6260  H  H    . ARG B  1 80  ? -20.783 -65.524 -143.235 1.00 22.90  ? 80  ARG A H    1 
ATOM   6261  H  HA   . ARG B  1 80  ? -21.946 -64.171 -141.274 1.00 22.39  ? 80  ARG A HA   1 
ATOM   6262  H  HB2  . ARG B  1 80  ? -23.003 -66.106 -143.039 1.00 25.24  ? 80  ARG A HB2  1 
ATOM   6263  H  HB3  . ARG B  1 80  ? -23.899 -65.368 -141.954 1.00 25.24  ? 80  ARG A HB3  1 
ATOM   6264  H  HG2  . ARG B  1 80  ? -23.672 -63.371 -143.025 1.00 40.34  ? 80  ARG A HG2  1 
ATOM   6265  H  HG3  . ARG B  1 80  ? -22.561 -63.962 -143.996 1.00 40.34  ? 80  ARG A HG3  1 
ATOM   6266  H  HD2  . ARG B  1 80  ? -24.195 -65.310 -145.008 1.00 52.65  ? 80  ARG A HD2  1 
ATOM   6267  H  HD3  . ARG B  1 80  ? -25.297 -64.650 -144.069 1.00 52.65  ? 80  ARG A HD3  1 
ATOM   6268  H  HE   . ARG B  1 80  ? -24.160 -63.452 -146.216 1.00 62.32  ? 80  ARG A HE   1 
ATOM   6269  H  HH11 . ARG B  1 80  ? -26.246 -62.948 -143.688 1.00 74.65  ? 80  ARG A HH11 1 
ATOM   6270  H  HH12 . ARG B  1 80  ? -26.862 -61.707 -144.236 1.00 74.65  ? 80  ARG A HH12 1 
ATOM   6271  H  HH21 . ARG B  1 80  ? -25.114 -61.572 -147.029 1.00 73.54  ? 80  ARG A HH21 1 
ATOM   6272  H  HH22 . ARG B  1 80  ? -26.179 -60.877 -146.253 1.00 73.54  ? 80  ARG A HH22 1 
ATOM   6273  N  N    . ASP B  1 81  ? -21.274 -67.240 -140.830 1.00 16.28  ? 81  ASP A N    1 
ATOM   6274  C  CA   . ASP B  1 81  ? -21.207 -68.374 -139.909 1.00 16.43  ? 81  ASP A CA   1 
ATOM   6275  C  C    . ASP B  1 81  ? -19.905 -68.339 -139.116 1.00 23.71  ? 81  ASP A C    1 
ATOM   6276  O  O    . ASP B  1 81  ? -18.850 -68.567 -139.688 1.00 19.97  ? 81  ASP A O    1 
ATOM   6277  C  CB   . ASP B  1 81  ? -21.294 -69.668 -140.703 1.00 17.67  ? 81  ASP A CB   1 
ATOM   6278  C  CG   . ASP B  1 81  ? -21.334 -70.906 -139.835 1.00 35.69  ? 81  ASP A CG   1 
ATOM   6279  O  OD1  . ASP B  1 81  ? -21.049 -70.830 -138.620 1.00 28.14  ? 81  ASP A OD1  1 
ATOM   6280  O  OD2  . ASP B  1 81  ? -21.644 -71.974 -140.401 1.00 26.32  ? 81  ASP A OD2  1 
ATOM   6281  H  H    . ASP B  1 81  ? -20.913 -67.406 -141.593 1.00 19.53  ? 81  ASP A H    1 
ATOM   6282  H  HA   . ASP B  1 81  ? -21.952 -68.337 -139.289 1.00 19.72  ? 81  ASP A HA   1 
ATOM   6283  H  HB2  . ASP B  1 81  ? -22.103 -69.654 -141.239 1.00 21.21  ? 81  ASP A HB2  1 
ATOM   6284  H  HB3  . ASP B  1 81  ? -20.517 -69.734 -141.281 1.00 21.21  ? 81  ASP A HB3  1 
ATOM   6285  N  N    . PRO B  1 82  ? -19.978 -68.099 -137.797 1.00 22.14  ? 82  PRO A N    1 
ATOM   6286  C  CA   . PRO B  1 82  ? -18.750 -67.959 -136.992 1.00 20.60  ? 82  PRO A CA   1 
ATOM   6287  C  C    . PRO B  1 82  ? -17.828 -69.180 -137.026 1.00 19.66  ? 82  PRO A C    1 
ATOM   6288  O  O    . PRO B  1 82  ? -16.628 -69.039 -136.843 1.00 18.61  ? 82  PRO A O    1 
ATOM   6289  C  CB   . PRO B  1 82  ? -19.271 -67.759 -135.561 1.00 20.28  ? 82  PRO A CB   1 
ATOM   6290  C  CG   . PRO B  1 82  ? -20.703 -67.615 -135.648 1.00 27.19  ? 82  PRO A CG   1 
ATOM   6291  C  CD   . PRO B  1 82  ? -21.178 -68.142 -136.954 1.00 20.96  ? 82  PRO A CD   1 
ATOM   6292  H  HA   . PRO B  1 82  ? -18.254 -67.172 -137.267 1.00 24.72  ? 82  PRO A HA   1 
ATOM   6293  H  HB2  . PRO B  1 82  ? -19.042 -68.534 -135.024 1.00 24.33  ? 82  PRO A HB2  1 
ATOM   6294  H  HB3  . PRO B  1 82  ? -18.874 -66.958 -135.184 1.00 24.33  ? 82  PRO A HB3  1 
ATOM   6295  H  HG2  . PRO B  1 82  ? -21.112 -68.113 -134.923 1.00 32.62  ? 82  PRO A HG2  1 
ATOM   6296  H  HG3  . PRO B  1 82  ? -20.929 -66.675 -135.570 1.00 32.62  ? 82  PRO A HG3  1 
ATOM   6297  H  HD2  . PRO B  1 82  ? -21.491 -69.055 -136.857 1.00 25.15  ? 82  PRO A HD2  1 
ATOM   6298  H  HD3  . PRO B  1 82  ? -21.868 -67.566 -137.320 1.00 25.15  ? 82  PRO A HD3  1 
ATOM   6299  N  N    . SER B  1 83  ? -18.370 -70.368 -137.258 1.00 17.56  ? 83  SER A N    1 
ATOM   6300  C  CA   . SER B  1 83  ? -17.535 -71.569 -137.218 1.00 15.54  ? 83  SER A CA   1 
ATOM   6301  C  C    . SER B  1 83  ? -16.616 -71.648 -138.432 1.00 16.90  ? 83  SER A C    1 
ATOM   6302  O  O    . SER B  1 83  ? -15.720 -72.491 -138.481 1.00 23.28  ? 83  SER A O    1 
ATOM   6303  C  CB   . SER B  1 83  ? -18.407 -72.829 -137.125 1.00 25.03  ? 83  SER A CB   1 
ATOM   6304  O  OG   . SER B  1 83  ? -19.274 -72.931 -138.243 1.00 28.18  ? 83  SER A OG   1 
ATOM   6305  H  H    . SER B  1 83  ? -19.199 -70.508 -137.436 1.00 21.07  ? 83  SER A H    1 
ATOM   6306  H  HA   . SER B  1 83  ? -16.976 -71.535 -136.425 1.00 18.65  ? 83  SER A HA   1 
ATOM   6307  H  HB2  . SER B  1 83  ? -17.831 -73.610 -137.100 1.00 30.04  ? 83  SER A HB2  1 
ATOM   6308  H  HB3  . SER B  1 83  ? -18.940 -72.785 -136.315 1.00 30.04  ? 83  SER A HB3  1 
ATOM   6309  H  HG   . SER B  1 83  ? -19.745 -73.624 -138.179 1.00 33.82  ? 83  SER A HG   1 
ATOM   6310  N  N    . LYS B  1 84  ? -16.830 -70.760 -139.400 1.00 16.51  ? 84  LYS A N    1 
ATOM   6311  C  CA   . LYS B  1 84  ? -16.100 -70.793 -140.668 1.00 16.71  ? 84  LYS A CA   1 
ATOM   6312  C  C    . LYS B  1 84  ? -15.006 -69.717 -140.723 1.00 20.99  ? 84  LYS A C    1 
ATOM   6313  O  O    . LYS B  1 84  ? -14.312 -69.583 -141.723 1.00 17.05  ? 84  LYS A O    1 
ATOM   6314  C  CB   . LYS B  1 84  ? -17.058 -70.588 -141.836 1.00 17.87  ? 84  LYS A CB   1 
ATOM   6315  C  CG   . LYS B  1 84  ? -18.145 -71.673 -141.987 1.00 28.97  ? 84  LYS A CG   1 
ATOM   6316  C  CD   . LYS B  1 84  ? -17.538 -73.038 -142.296 1.00 37.94  ? 84  LYS A CD   1 
ATOM   6317  C  CE   . LYS B  1 84  ? -18.601 -74.138 -142.330 1.00 58.05  ? 84  LYS A CE   1 
ATOM   6318  N  NZ   . LYS B  1 84  ? -19.534 -73.979 -143.483 1.00 64.51  ? 84  LYS A NZ   1 
ATOM   6319  H  H    . LYS B  1 84  ? -17.401 -70.119 -139.347 1.00 19.81  ? 84  LYS A H    1 
ATOM   6320  H  HA   . LYS B  1 84  ? -15.677 -71.660 -140.771 1.00 20.05  ? 84  LYS A HA   1 
ATOM   6321  H  HB2  . LYS B  1 84  ? -17.508 -69.737 -141.720 1.00 21.44  ? 84  LYS A HB2  1 
ATOM   6322  H  HB3  . LYS B  1 84  ? -16.543 -70.574 -142.658 1.00 21.44  ? 84  LYS A HB3  1 
ATOM   6323  H  HG2  . LYS B  1 84  ? -18.644 -71.744 -141.158 1.00 34.76  ? 84  LYS A HG2  1 
ATOM   6324  H  HG3  . LYS B  1 84  ? -18.738 -71.433 -142.716 1.00 34.76  ? 84  LYS A HG3  1 
ATOM   6325  H  HD2  . LYS B  1 84  ? -17.107 -73.006 -143.165 1.00 45.53  ? 84  LYS A HD2  1 
ATOM   6326  H  HD3  . LYS B  1 84  ? -16.891 -73.262 -141.609 1.00 45.53  ? 84  LYS A HD3  1 
ATOM   6327  H  HE2  . LYS B  1 84  ? -18.165 -75.000 -142.410 1.00 69.66  ? 84  LYS A HE2  1 
ATOM   6328  H  HE3  . LYS B  1 84  ? -19.122 -74.102 -141.512 1.00 69.66  ? 84  LYS A HE3  1 
ATOM   6329  H  HZ1  . LYS B  1 84  ? -19.952 -73.196 -143.430 1.00 77.41  ? 84  LYS A HZ1  1 
ATOM   6330  H  HZ2  . LYS B  1 84  ? -19.080 -74.014 -144.248 1.00 77.41  ? 84  LYS A HZ2  1 
ATOM   6331  H  HZ3  . LYS B  1 84  ? -20.140 -74.632 -143.475 1.00 77.41  ? 84  LYS A HZ3  1 
ATOM   6332  N  N    . ILE B  1 85  ? -14.882 -68.921 -139.666 1.00 14.81  ? 85  ILE A N    1 
ATOM   6333  C  CA   . ILE B  1 85  ? -13.858 -67.885 -139.641 1.00 13.51  ? 85  ILE A CA   1 
ATOM   6334  C  C    . ILE B  1 85  ? -12.502 -68.509 -139.282 1.00 18.83  ? 85  ILE A C    1 
ATOM   6335  O  O    . ILE B  1 85  ? -12.357 -69.128 -138.232 1.00 15.87  ? 85  ILE A O    1 
ATOM   6336  C  CB   . ILE B  1 85  ? -14.171 -66.785 -138.644 1.00 17.82  ? 85  ILE A CB   1 
ATOM   6337  C  CG1  . ILE B  1 85  ? -15.593 -66.260 -138.830 1.00 12.83  ? 85  ILE A CG1  1 
ATOM   6338  C  CG2  . ILE B  1 85  ? -13.165 -65.636 -138.793 1.00 14.58  ? 85  ILE A CG2  1 
ATOM   6339  C  CD1  . ILE B  1 85  ? -16.108 -65.510 -137.604 1.00 15.22  ? 85  ILE A CD1  1 
ATOM   6340  H  H    . ILE B  1 85  ? -15.371 -68.959 -138.960 1.00 17.77  ? 85  ILE A H    1 
ATOM   6341  H  HA   . ILE B  1 85  ? -13.785 -67.485 -140.522 1.00 16.21  ? 85  ILE A HA   1 
ATOM   6342  H  HB   . ILE B  1 85  ? -14.092 -67.149 -137.748 1.00 21.38  ? 85  ILE A HB   1 
ATOM   6343  H  HG12 . ILE B  1 85  ? -15.609 -65.650 -139.584 1.00 15.40  ? 85  ILE A HG12 1 
ATOM   6344  H  HG13 . ILE B  1 85  ? -16.187 -67.009 -138.995 1.00 15.40  ? 85  ILE A HG13 1 
ATOM   6345  H  HG21 . ILE B  1 85  ? -13.379 -64.943 -138.149 1.00 17.50  ? 85  ILE A HG21 1 
ATOM   6346  H  HG22 . ILE B  1 85  ? -12.271 -65.976 -138.628 1.00 17.50  ? 85  ILE A HG22 1 
ATOM   6347  H  HG23 . ILE B  1 85  ? -13.223 -65.281 -139.694 1.00 17.50  ? 85  ILE A HG23 1 
ATOM   6348  H  HD11 . ILE B  1 85  ? -17.011 -65.201 -137.780 1.00 18.27  ? 85  ILE A HD11 1 
ATOM   6349  H  HD12 . ILE B  1 85  ? -16.105 -66.111 -136.843 1.00 18.27  ? 85  ILE A HD12 1 
ATOM   6350  H  HD13 . ILE B  1 85  ? -15.527 -64.753 -137.431 1.00 18.27  ? 85  ILE A HD13 1 
ATOM   6351  N  N    . LYS B  1 86  ? -11.503 -68.303 -140.133 1.00 15.26  ? 86  LYS A N    1 
ATOM   6352  C  CA   . LYS B  1 86  ? -10.162 -68.860 -139.911 1.00 13.98  ? 86  LYS A CA   1 
ATOM   6353  C  C    . LYS B  1 86  ? -9.263  -68.057 -138.953 1.00 17.47  ? 86  LYS A C    1 
ATOM   6354  O  O    . LYS B  1 86  ? -8.189  -67.572 -139.328 1.00 13.72  ? 86  LYS A O    1 
ATOM   6355  C  CB   . LYS B  1 86  ? -9.453  -69.003 -141.258 1.00 24.68  ? 86  LYS A CB   1 
ATOM   6356  C  CG   . LYS B  1 86  ? -9.721  -70.318 -141.953 1.00 32.56  ? 86  LYS A CG   1 
ATOM   6357  C  CD   . LYS B  1 86  ? -11.042 -70.371 -142.647 1.00 49.05  ? 86  LYS A CD   1 
ATOM   6358  C  CE   . LYS B  1 86  ? -11.095 -71.588 -143.589 1.00 61.28  ? 86  LYS A CE   1 
ATOM   6359  N  NZ   . LYS B  1 86  ? -10.666 -72.866 -142.921 1.00 59.36  ? 86  LYS A NZ   1 
ATOM   6360  H  H    . LYS B  1 86  ? -11.572 -67.840 -140.855 1.00 18.32  ? 86  LYS A H    1 
ATOM   6361  H  HA   . LYS B  1 86  ? -10.259 -69.750 -139.537 1.00 16.77  ? 86  LYS A HA   1 
ATOM   6362  H  HB2  . LYS B  1 86  ? -9.752  -68.292 -141.845 1.00 29.61  ? 86  LYS A HB2  1 
ATOM   6363  H  HB3  . LYS B  1 86  ? -8.496  -68.933 -141.117 1.00 29.61  ? 86  LYS A HB3  1 
ATOM   6364  H  HG2  . LYS B  1 86  ? -9.030  -70.467 -142.618 1.00 39.07  ? 86  LYS A HG2  1 
ATOM   6365  H  HG3  . LYS B  1 86  ? -9.703  -71.030 -141.295 1.00 39.07  ? 86  LYS A HG3  1 
ATOM   6366  H  HD2  . LYS B  1 86  ? -11.750 -70.458 -141.991 1.00 58.86  ? 86  LYS A HD2  1 
ATOM   6367  H  HD3  . LYS B  1 86  ? -11.164 -69.567 -143.175 1.00 58.86  ? 86  LYS A HD3  1 
ATOM   6368  H  HE2  . LYS B  1 86  ? -12.005 -71.704 -143.903 1.00 73.53  ? 86  LYS A HE2  1 
ATOM   6369  H  HE3  . LYS B  1 86  ? -10.503 -71.430 -144.341 1.00 73.53  ? 86  LYS A HE3  1 
ATOM   6370  H  HZ1  . LYS B  1 86  ? -11.198 -73.041 -142.230 1.00 71.23  ? 86  LYS A HZ1  1 
ATOM   6371  H  HZ2  . LYS B  1 86  ? -10.711 -73.541 -143.499 1.00 71.23  ? 86  LYS A HZ2  1 
ATOM   6372  H  HZ3  . LYS B  1 86  ? -9.828  -72.791 -142.630 1.00 71.23  ? 86  LYS A HZ3  1 
ATOM   6373  N  N    . TRP B  1 87  ? -9.696  -67.935 -137.710 1.00 12.55  ? 87  TRP A N    1 
ATOM   6374  C  CA   . TRP B  1 87  ? -8.990  -67.128 -136.730 1.00 11.85  ? 87  TRP A CA   1 
ATOM   6375  C  C    . TRP B  1 87  ? -7.545  -67.586 -136.520 1.00 12.21  ? 87  TRP A C    1 
ATOM   6376  O  O    . TRP B  1 87  ? -6.634  -66.769 -136.423 1.00 13.80  ? 87  TRP A O    1 
ATOM   6377  C  CB   . TRP B  1 87  ? -9.712  -67.182 -135.393 1.00 11.48  ? 87  TRP A CB   1 
ATOM   6378  C  CG   . TRP B  1 87  ? -11.102 -66.631 -135.358 1.00 11.51  ? 87  TRP A CG   1 
ATOM   6379  C  CD1  . TRP B  1 87  ? -12.238 -67.317 -135.029 1.00 11.28  ? 87  TRP A CD1  1 
ATOM   6380  C  CD2  . TRP B  1 87  ? -11.510 -65.266 -135.591 1.00 10.53  ? 87  TRP A CD2  1 
ATOM   6381  N  NE1  . TRP B  1 87  ? -13.316 -66.470 -135.042 1.00 14.25  ? 87  TRP A NE1  1 
ATOM   6382  C  CE2  . TRP B  1 87  ? -12.896 -65.204 -135.366 1.00 10.51  ? 87  TRP A CE2  1 
ATOM   6383  C  CE3  . TRP B  1 87  ? -10.838 -64.101 -135.960 1.00 10.18  ? 87  TRP A CE3  1 
ATOM   6384  C  CZ2  . TRP B  1 87  ? -13.626 -64.032 -135.534 1.00 10.62  ? 87  TRP A CZ2  1 
ATOM   6385  C  CZ3  . TRP B  1 87  ? -11.562 -62.934 -136.107 1.00 12.53  ? 87  TRP A CZ3  1 
ATOM   6386  C  CH2  . TRP B  1 87  ? -12.937 -62.903 -135.881 1.00 9.81   ? 87  TRP A CH2  1 
ATOM   6387  H  H    . TRP B  1 87  ? -10.405 -68.315 -137.405 1.00 15.06  ? 87  TRP A H    1 
ATOM   6388  H  HA   . TRP B  1 87  ? -8.974  -66.205 -137.029 1.00 14.22  ? 87  TRP A HA   1 
ATOM   6389  H  HB2  . TRP B  1 87  ? -9.765  -68.110 -135.115 1.00 13.78  ? 87  TRP A HB2  1 
ATOM   6390  H  HB3  . TRP B  1 87  ? -9.189  -66.684 -134.746 1.00 13.78  ? 87  TRP A HB3  1 
ATOM   6391  H  HD1  . TRP B  1 87  ? -12.270 -68.218 -134.803 1.00 13.53  ? 87  TRP A HD1  1 
ATOM   6392  H  HE1  . TRP B  1 87  ? -14.127 -66.694 -134.863 1.00 17.10  ? 87  TRP A HE1  1 
ATOM   6393  H  HE3  . TRP B  1 87  ? -9.917  -64.106 -136.088 1.00 12.22  ? 87  TRP A HE3  1 
ATOM   6394  H  HZ2  . TRP B  1 87  ? -14.546 -64.013 -135.399 1.00 12.74  ? 87  TRP A HZ2  1 
ATOM   6395  H  HZ3  . TRP B  1 87  ? -11.120 -62.150 -136.342 1.00 15.04  ? 87  TRP A HZ3  1 
ATOM   6396  H  HH2  . TRP B  1 87  ? -13.400 -62.106 -136.002 1.00 11.77  ? 87  TRP A HH2  1 
ATOM   6397  N  N    . GLY B  1 88  ? -7.355  -68.898 -136.412 1.00 13.47  ? 88  GLY A N    1 
ATOM   6398  C  CA   . GLY B  1 88  ? -6.038  -69.473 -136.214 1.00 22.14  ? 88  GLY A CA   1 
ATOM   6399  C  C    . GLY B  1 88  ? -5.070  -69.108 -137.325 1.00 21.77  ? 88  GLY A C    1 
ATOM   6400  O  O    . GLY B  1 88  ? -3.935  -68.724 -137.057 1.00 21.79  ? 88  GLY A O    1 
ATOM   6401  H  H    . GLY B  1 88  ? -7.986  -69.481 -136.451 1.00 16.17  ? 88  GLY A H    1 
ATOM   6402  H  HA2  . GLY B  1 88  ? -5.672  -69.158 -135.372 1.00 26.57  ? 88  GLY A HA2  1 
ATOM   6403  H  HA3  . GLY B  1 88  ? -6.111  -70.439 -136.175 1.00 26.57  ? 88  GLY A HA3  1 
ATOM   6404  N  N    . ASP B  1 89  ? -5.504  -69.204 -138.577 1.00 16.02  ? 89  ASP A N    1 
ATOM   6405  C  CA   . ASP B  1 89  ? -4.625  -68.828 -139.685 1.00 20.91  ? 89  ASP A CA   1 
ATOM   6406  C  C    . ASP B  1 89  ? -4.188  -67.366 -139.565 1.00 18.60  ? 89  ASP A C    1 
ATOM   6407  O  O    . ASP B  1 89  ? -3.088  -67.000 -139.960 1.00 18.58  ? 89  ASP A O    1 
ATOM   6408  C  CB   . ASP B  1 89  ? -5.310  -69.032 -141.038 1.00 22.25  ? 89  ASP A CB   1 
ATOM   6409  C  CG   . ASP B  1 89  ? -5.471  -70.497 -141.408 1.00 33.02  ? 89  ASP A CG   1 
ATOM   6410  O  OD1  . ASP B  1 89  ? -4.863  -71.367 -140.751 1.00 40.81  ? 89  ASP A OD1  1 
ATOM   6411  O  OD2  . ASP B  1 89  ? -6.208  -70.775 -142.378 1.00 38.93  ? 89  ASP A OD2  1 
ATOM   6412  H  H    . ASP B  1 89  ? -6.285  -69.477 -138.811 1.00 19.23  ? 89  ASP A H    1 
ATOM   6413  H  HA   . ASP B  1 89  ? -3.830  -69.383 -139.663 1.00 25.09  ? 89  ASP A HA   1 
ATOM   6414  H  HB2  . ASP B  1 89  ? -6.193  -68.632 -141.008 1.00 26.70  ? 89  ASP A HB2  1 
ATOM   6415  H  HB3  . ASP B  1 89  ? -4.777  -68.606 -141.728 1.00 26.70  ? 89  ASP A HB3  1 
ATOM   6416  N  N    . ALA B  1 90  ? -5.069  -66.527 -139.040 1.00 13.73  ? 90  ALA A N    1 
ATOM   6417  C  CA   . ALA B  1 90  ? -4.788  -65.105 -138.942 1.00 13.61  ? 90  ALA A CA   1 
ATOM   6418  C  C    . ALA B  1 90  ? -3.980  -64.791 -137.690 1.00 18.08  ? 90  ALA A C    1 
ATOM   6419  O  O    . ALA B  1 90  ? -3.520  -63.665 -137.513 1.00 17.28  ? 90  ALA A O    1 
ATOM   6420  C  CB   . ALA B  1 90  ? -6.094  -64.312 -138.943 1.00 15.30  ? 90  ALA A CB   1 
ATOM   6421  H  H    . ALA B  1 90  ? -5.838  -66.757 -138.732 1.00 16.48  ? 90  ALA A H    1 
ATOM   6422  H  HA   . ALA B  1 90  ? -4.268  -64.831 -139.713 1.00 16.33  ? 90  ALA A HA   1 
ATOM   6423  H  HB1  . ALA B  1 90  ? -5.888  -63.366 -138.877 1.00 18.36  ? 90  ALA A HB1  1 
ATOM   6424  H  HB2  . ALA B  1 90  ? -6.571  -64.490 -139.768 1.00 18.36  ? 90  ALA A HB2  1 
ATOM   6425  H  HB3  . ALA B  1 90  ? -6.631  -64.587 -138.183 1.00 18.36  ? 90  ALA A HB3  1 
ATOM   6426  N  N    . GLY B  1 91  ? -3.822  -65.779 -136.816 1.00 14.29  ? 91  GLY A N    1 
ATOM   6427  C  CA   . GLY B  1 91  ? -3.085  -65.594 -135.574 1.00 12.59  ? 91  GLY A CA   1 
ATOM   6428  C  C    . GLY B  1 91  ? -3.895  -65.002 -134.429 1.00 18.29  ? 91  GLY A C    1 
ATOM   6429  O  O    . GLY B  1 91  ? -3.324  -64.587 -133.422 1.00 18.25  ? 91  GLY A O    1 
ATOM   6430  H  H    . GLY B  1 91  ? -4.136  -66.572 -136.920 1.00 17.15  ? 91  GLY A H    1 
ATOM   6431  H  HA2  . GLY B  1 91  ? -2.739  -66.452 -135.283 1.00 15.11  ? 91  GLY A HA2  1 
ATOM   6432  H  HA3  . GLY B  1 91  ? -2.331  -65.007 -135.741 1.00 15.11  ? 91  GLY A HA3  1 
ATOM   6433  N  N    . ALA B  1 92  ? -5.218  -64.952 -134.570 1.00 17.77  ? 92  ALA A N    1 
ATOM   6434  C  CA   . ALA B  1 92  ? -6.076  -64.444 -133.503 1.00 12.68  ? 92  ALA A CA   1 
ATOM   6435  C  C    . ALA B  1 92  ? -6.248  -65.510 -132.427 1.00 15.64  ? 92  ALA A C    1 
ATOM   6436  O  O    . ALA B  1 92  ? -6.784  -66.582 -132.694 1.00 19.73  ? 92  ALA A O    1 
ATOM   6437  C  CB   . ALA B  1 92  ? -7.437  -64.016 -134.046 1.00 11.96  ? 92  ALA A CB   1 
ATOM   6438  H  H    . ALA B  1 92  ? -5.643  -65.207 -135.273 1.00 21.32  ? 92  ALA A H    1 
ATOM   6439  H  HA   . ALA B  1 92  ? -5.655  -63.670 -133.097 1.00 15.22  ? 92  ALA A HA   1 
ATOM   6440  H  HB1  . ALA B  1 92  ? -7.979  -63.685 -133.313 1.00 14.35  ? 92  ALA A HB1  1 
ATOM   6441  H  HB2  . ALA B  1 92  ? -7.307  -63.315 -134.704 1.00 14.35  ? 92  ALA A HB2  1 
ATOM   6442  H  HB3  . ALA B  1 92  ? -7.868  -64.781 -134.457 1.00 14.35  ? 92  ALA A HB3  1 
ATOM   6443  N  N    . GLU B  1 93  ? -5.794  -65.201 -131.216 1.00 13.85  ? 93  GLU A N    1 
ATOM   6444  C  CA   . GLU B  1 93  ? -5.869  -66.119 -130.081 1.00 10.42  ? 93  GLU A CA   1 
ATOM   6445  C  C    . GLU B  1 93  ? -7.169  -65.941 -129.285 1.00 10.75  ? 93  GLU A C    1 
ATOM   6446  O  O    . GLU B  1 93  ? -7.814  -66.923 -128.930 1.00 11.21  ? 93  GLU A O    1 
ATOM   6447  C  CB   . GLU B  1 93  ? -4.661  -65.922 -129.167 1.00 13.63  ? 93  GLU A CB   1 
ATOM   6448  C  CG   . GLU B  1 93  ? -4.612  -66.861 -127.967 1.00 32.80  ? 93  GLU A CG   1 
ATOM   6449  C  CD   . GLU B  1 93  ? -3.284  -66.784 -127.192 1.00 54.71  ? 93  GLU A CD   1 
ATOM   6450  O  OE1  . GLU B  1 93  ? -2.323  -66.145 -127.689 1.00 51.30  ? 93  GLU A OE1  1 
ATOM   6451  O  OE2  . GLU B  1 93  ? -3.207  -67.372 -126.087 1.00 50.31  ? 93  GLU A OE2  1 
ATOM   6452  H  H    . GLU B  1 93  ? -5.428  -64.447 -131.022 1.00 16.62  ? 93  GLU A H    1 
ATOM   6453  H  HA   . GLU B  1 93  ? -5.846  -67.030 -130.413 1.00 12.50  ? 93  GLU A HA   1 
ATOM   6454  H  HB2  . GLU B  1 93  ? -3.854  -66.066 -129.686 1.00 16.35  ? 93  GLU A HB2  1 
ATOM   6455  H  HB3  . GLU B  1 93  ? -4.674  -65.013 -128.829 1.00 16.35  ? 93  GLU A HB3  1 
ATOM   6456  H  HG2  . GLU B  1 93  ? -5.328  -66.628 -127.356 1.00 39.35  ? 93  GLU A HG2  1 
ATOM   6457  H  HG3  . GLU B  1 93  ? -4.725  -67.773 -128.276 1.00 39.35  ? 93  GLU A HG3  1 
ATOM   6458  N  N    . TYR B  1 94  ? -7.525  -64.696 -128.980 1.00 12.73  ? 94  TYR A N    1 
ATOM   6459  C  CA   . TYR B  1 94  ? -8.810  -64.372 -128.359 1.00 10.08  ? 94  TYR A CA   1 
ATOM   6460  C  C    . TYR B  1 94  ? -9.724  -63.722 -129.370 1.00 11.11  ? 94  TYR A C    1 
ATOM   6461  O  O    . TYR B  1 94  ? -9.283  -62.922 -130.180 1.00 12.73  ? 94  TYR A O    1 
ATOM   6462  C  CB   . TYR B  1 94  ? -8.662  -63.413 -127.184 1.00 8.73   ? 94  TYR A CB   1 
ATOM   6463  C  CG   . TYR B  1 94  ? -7.857  -63.897 -126.001 1.00 10.68  ? 94  TYR A CG   1 
ATOM   6464  C  CD1  . TYR B  1 94  ? -7.378  -65.184 -125.916 1.00 9.63   ? 94  TYR A CD1  1 
ATOM   6465  C  CD2  . TYR B  1 94  ? -7.591  -63.037 -124.959 1.00 11.02  ? 94  TYR A CD2  1 
ATOM   6466  C  CE1  . TYR B  1 94  ? -6.658  -65.602 -124.808 1.00 10.15  ? 94  TYR A CE1  1 
ATOM   6467  C  CE2  . TYR B  1 94  ? -6.892  -63.434 -123.871 1.00 9.40   ? 94  TYR A CE2  1 
ATOM   6468  C  CZ   . TYR B  1 94  ? -6.425  -64.697 -123.784 1.00 14.54  ? 94  TYR A CZ   1 
ATOM   6469  O  OH   . TYR B  1 94  ? -5.698  -65.037 -122.667 1.00 18.72  ? 94  TYR A OH   1 
ATOM   6470  H  H    . TYR B  1 94  ? -7.030  -64.007 -129.126 1.00 15.27  ? 94  TYR A H    1 
ATOM   6471  H  HA   . TYR B  1 94  ? -9.230  -65.187 -128.042 1.00 12.10  ? 94  TYR A HA   1 
ATOM   6472  H  HB2  . TYR B  1 94  ? -8.237  -62.603 -127.507 1.00 10.47  ? 94  TYR A HB2  1 
ATOM   6473  H  HB3  . TYR B  1 94  ? -9.550  -63.198 -126.857 1.00 10.47  ? 94  TYR A HB3  1 
ATOM   6474  H  HD1  . TYR B  1 94  ? -7.548  -65.784 -126.606 1.00 11.55  ? 94  TYR A HD1  1 
ATOM   6475  H  HD2  . TYR B  1 94  ? -7.913  -62.165 -124.997 1.00 13.22  ? 94  TYR A HD2  1 
ATOM   6476  H  HE1  . TYR B  1 94  ? -6.333  -66.471 -124.755 1.00 12.18  ? 94  TYR A HE1  1 
ATOM   6477  H  HE2  . TYR B  1 94  ? -6.725  -62.831 -123.183 1.00 11.28  ? 94  TYR A HE2  1 
ATOM   6478  H  HH   . TYR B  1 94  ? -5.444  -65.836 -122.722 1.00 22.46  ? 94  TYR A HH   1 
ATOM   6479  N  N    . VAL B  1 95  ? -11.013 -64.041 -129.291 1.00 9.57   ? 95  VAL A N    1 
ATOM   6480  C  CA   . VAL B  1 95  ? -12.003 -63.431 -130.153 1.00 8.74   ? 95  VAL A CA   1 
ATOM   6481  C  C    . VAL B  1 95  ? -13.028 -62.658 -129.310 1.00 9.66   ? 95  VAL A C    1 
ATOM   6482  O  O    . VAL B  1 95  ? -13.585 -63.183 -128.344 1.00 9.06   ? 95  VAL A O    1 
ATOM   6483  C  CB   . VAL B  1 95  ? -12.720 -64.464 -131.018 1.00 11.32  ? 95  VAL A CB   1 
ATOM   6484  C  CG1  . VAL B  1 95  ? -13.945 -63.836 -131.710 1.00 11.05  ? 95  VAL A CG1  1 
ATOM   6485  C  CG2  . VAL B  1 95  ? -11.755 -65.051 -132.069 1.00 10.77  ? 95  VAL A CG2  1 
ATOM   6486  H  H    . VAL B  1 95  ? -11.337 -64.616 -128.739 1.00 11.48  ? 95  VAL A H    1 
ATOM   6487  H  HA   . VAL B  1 95  ? -11.563 -62.800 -130.743 1.00 10.49  ? 95  VAL A HA   1 
ATOM   6488  H  HB   . VAL B  1 95  ? -13.031 -65.190 -130.455 1.00 13.58  ? 95  VAL A HB   1 
ATOM   6489  H  HG11 . VAL B  1 95  ? -14.381 -64.512 -132.252 1.00 13.26  ? 95  VAL A HG11 1 
ATOM   6490  H  HG12 . VAL B  1 95  ? -14.557 -63.509 -131.032 1.00 13.26  ? 95  VAL A HG12 1 
ATOM   6491  H  HG13 . VAL B  1 95  ? -13.649 -63.102 -132.270 1.00 13.26  ? 95  VAL A HG13 1 
ATOM   6492  H  HG21 . VAL B  1 95  ? -12.232 -65.704 -132.605 1.00 12.93  ? 95  VAL A HG21 1 
ATOM   6493  H  HG22 . VAL B  1 95  ? -11.429 -64.333 -132.633 1.00 12.93  ? 95  VAL A HG22 1 
ATOM   6494  H  HG23 . VAL B  1 95  ? -11.013 -65.477 -131.612 1.00 12.93  ? 95  VAL A HG23 1 
ATOM   6495  N  N    . VAL B  1 96  ? -13.255 -61.410 -129.698 1.00 8.28   ? 96  VAL A N    1 
ATOM   6496  C  CA   . VAL B  1 96  ? -14.328 -60.597 -129.149 1.00 8.20   ? 96  VAL A CA   1 
ATOM   6497  C  C    . VAL B  1 96  ? -15.585 -60.832 -129.963 1.00 10.25  ? 96  VAL A C    1 
ATOM   6498  O  O    . VAL B  1 96  ? -15.663 -60.505 -131.160 1.00 8.80   ? 96  VAL A O    1 
ATOM   6499  C  CB   . VAL B  1 96  ? -13.993 -59.114 -129.157 1.00 8.81   ? 96  VAL A CB   1 
ATOM   6500  C  CG1  . VAL B  1 96  ? -15.199 -58.285 -128.638 1.00 14.30  ? 96  VAL A CG1  1 
ATOM   6501  C  CG2  . VAL B  1 96  ? -12.714 -58.819 -128.323 1.00 10.45  ? 96  VAL A CG2  1 
ATOM   6502  H  H    . VAL B  1 96  ? -12.788 -61.002 -130.294 1.00 9.94   ? 96  VAL A H    1 
ATOM   6503  H  HA   . VAL B  1 96  ? -14.500 -60.867 -128.234 1.00 9.84   ? 96  VAL A HA   1 
ATOM   6504  H  HB   . VAL B  1 96  ? -13.818 -58.839 -130.071 1.00 10.57  ? 96  VAL A HB   1 
ATOM   6505  H  HG11 . VAL B  1 96  ? -14.964 -57.344 -128.651 1.00 17.15  ? 96  VAL A HG11 1 
ATOM   6506  H  HG12 . VAL B  1 96  ? -15.962 -58.444 -129.215 1.00 17.15  ? 96  VAL A HG12 1 
ATOM   6507  H  HG13 . VAL B  1 96  ? -15.405 -58.563 -127.731 1.00 17.15  ? 96  VAL A HG13 1 
ATOM   6508  H  HG21 . VAL B  1 96  ? -12.532 -57.867 -128.350 1.00 12.54  ? 96  VAL A HG21 1 
ATOM   6509  H  HG22 . VAL B  1 96  ? -12.863 -59.102 -127.407 1.00 12.54  ? 96  VAL A HG22 1 
ATOM   6510  H  HG23 . VAL B  1 96  ? -11.970 -59.310 -128.704 1.00 12.54  ? 96  VAL A HG23 1 
ATOM   6511  N  N    . GLU B  1 97  ? -16.578 -61.390 -129.299 1.00 8.79   ? 97  GLU A N    1 
ATOM   6512  C  CA   . GLU B  1 97  ? -17.841 -61.701 -129.936 1.00 10.82  ? 97  GLU A CA   1 
ATOM   6513  C  C    . GLU B  1 97  ? -18.795 -60.522 -129.706 1.00 12.98  ? 97  GLU A C    1 
ATOM   6514  O  O    . GLU B  1 97  ? -19.442 -60.402 -128.662 1.00 14.19  ? 97  GLU A O    1 
ATOM   6515  C  CB   . GLU B  1 97  ? -18.356 -63.031 -129.394 1.00 11.04  ? 97  GLU A CB   1 
ATOM   6516  C  CG   . GLU B  1 97  ? -19.714 -63.469 -129.906 1.00 22.05  ? 97  GLU A CG   1 
ATOM   6517  C  CD   . GLU B  1 97  ? -19.948 -63.129 -131.367 1.00 24.15  ? 97  GLU A CD   1 
ATOM   6518  O  OE1  . GLU B  1 97  ? -19.304 -63.741 -132.263 1.00 14.56  ? 97  GLU A OE1  1 
ATOM   6519  O  OE2  . GLU B  1 97  ? -20.794 -62.244 -131.605 1.00 18.56  ? 97  GLU A OE2  1 
ATOM   6520  H  H    . GLU B  1 97  ? -16.545 -61.601 -128.466 1.00 10.54  ? 97  GLU A H    1 
ATOM   6521  H  HA   . GLU B  1 97  ? -17.702 -61.796 -130.891 1.00 12.98  ? 97  GLU A HA   1 
ATOM   6522  H  HB2  . GLU B  1 97  ? -17.720 -63.724 -129.630 1.00 13.25  ? 97  GLU A HB2  1 
ATOM   6523  H  HB3  . GLU B  1 97  ? -18.418 -62.965 -128.428 1.00 13.25  ? 97  GLU A HB3  1 
ATOM   6524  H  HG2  . GLU B  1 97  ? -19.791 -64.431 -129.808 1.00 26.45  ? 97  GLU A HG2  1 
ATOM   6525  H  HG3  . GLU B  1 97  ? -20.403 -63.029 -129.384 1.00 26.45  ? 97  GLU A HG3  1 
ATOM   6526  N  N    . SER B  1 98  ? -18.823 -59.609 -130.678 1.00 10.33  ? 98  SER A N    1 
ATOM   6527  C  CA   . SER B  1 98  ? -19.564 -58.367 -130.521 1.00 9.42   ? 98  SER A CA   1 
ATOM   6528  C  C    . SER B  1 98  ? -20.628 -58.154 -131.593 1.00 14.57  ? 98  SER A C    1 
ATOM   6529  O  O    . SER B  1 98  ? -20.960 -57.007 -131.943 1.00 18.92  ? 98  SER A O    1 
ATOM   6530  C  CB   . SER B  1 98  ? -18.584 -57.183 -130.479 1.00 14.62  ? 98  SER A CB   1 
ATOM   6531  O  OG   . SER B  1 98  ? -17.780 -57.100 -131.645 1.00 19.89  ? 98  SER A OG   1 
ATOM   6532  H  H    . SER B  1 98  ? -18.422 -59.688 -131.435 1.00 12.39  ? 98  SER A H    1 
ATOM   6533  H  HA   . SER B  1 98  ? -20.021 -58.393 -129.665 1.00 11.30  ? 98  SER A HA   1 
ATOM   6534  H  HB2  . SER B  1 98  ? -19.093 -56.362 -130.393 1.00 17.55  ? 98  SER A HB2  1 
ATOM   6535  H  HB3  . SER B  1 98  ? -18.003 -57.289 -129.709 1.00 17.55  ? 98  SER A HB3  1 
ATOM   6536  H  HG   . SER B  1 98  ? -17.327 -57.802 -131.733 1.00 23.86  ? 98  SER A HG   1 
ATOM   6537  N  N    . THR B  1 99  ? -21.205 -59.243 -132.092 1.00 13.58  ? 99  THR A N    1 
ATOM   6538  C  CA   . THR B  1 99  ? -22.269 -59.111 -133.092 1.00 11.23  ? 99  THR A CA   1 
ATOM   6539  C  C    . THR B  1 99  ? -23.642 -58.924 -132.468 1.00 17.83  ? 99  THR A C    1 
ATOM   6540  O  O    . THR B  1 99  ? -24.546 -58.405 -133.114 1.00 16.34  ? 99  THR A O    1 
ATOM   6541  C  CB   . THR B  1 99  ? -22.384 -60.332 -134.011 1.00 14.30  ? 99  THR A CB   1 
ATOM   6542  O  OG1  . THR B  1 99  ? -22.918 -61.427 -133.255 1.00 14.22  ? 99  THR A OG1  1 
ATOM   6543  C  CG2  . THR B  1 99  ? -21.024 -60.696 -134.630 1.00 13.59  ? 99  THR A CG2  1 
ATOM   6544  H  H    . THR B  1 99  ? -21.007 -60.052 -131.878 1.00 16.30  ? 99  THR A H    1 
ATOM   6545  H  HA   . THR B  1 99  ? -22.085 -58.337 -133.646 1.00 13.48  ? 99  THR A HA   1 
ATOM   6546  H  HB   . THR B  1 99  ? -22.995 -60.123 -134.736 1.00 17.16  ? 99  THR A HB   1 
ATOM   6547  H  HG1  . THR B  1 99  ? -22.410 -61.606 -132.611 1.00 17.07  ? 99  THR A HG1  1 
ATOM   6548  H  HG21 . THR B  1 99  ? -21.119 -61.470 -135.208 1.00 16.30  ? 99  THR A HG21 1 
ATOM   6549  H  HG22 . THR B  1 99  ? -20.688 -59.952 -135.153 1.00 16.30  ? 99  THR A HG22 1 
ATOM   6550  H  HG23 . THR B  1 99  ? -20.386 -60.902 -133.929 1.00 16.30  ? 99  THR A HG23 1 
ATOM   6551  N  N    . GLY B  1 100 ? -23.793 -59.385 -131.235 1.00 20.76  ? 100 GLY A N    1 
ATOM   6552  C  CA   . GLY B  1 100 ? -25.062 -59.354 -130.541 1.00 23.32  ? 100 GLY A CA   1 
ATOM   6553  C  C    . GLY B  1 100 ? -25.937 -60.576 -130.785 1.00 25.46  ? 100 GLY A C    1 
ATOM   6554  O  O    . GLY B  1 100 ? -27.019 -60.664 -130.213 1.00 28.75  ? 100 GLY A O    1 
ATOM   6555  H  H    . GLY B  1 100 ? -23.155 -59.728 -130.770 1.00 24.91  ? 100 GLY A H    1 
ATOM   6556  H  HA2  . GLY B  1 100 ? -24.901 -59.285 -129.587 1.00 27.98  ? 100 GLY A HA2  1 
ATOM   6557  H  HA3  . GLY B  1 100 ? -25.557 -58.568 -130.821 1.00 27.98  ? 100 GLY A HA3  1 
ATOM   6558  N  N    . VAL B  1 101 ? -25.489 -61.516 -131.619 1.00 16.96  ? 101 VAL A N    1 
ATOM   6559  C  CA   . VAL B  1 101 ? -26.328 -62.677 -131.961 1.00 19.28  ? 101 VAL A CA   1 
ATOM   6560  C  C    . VAL B  1 101 ? -25.714 -64.034 -131.604 1.00 25.38  ? 101 VAL A C    1 
ATOM   6561  O  O    . VAL B  1 101 ? -26.327 -65.074 -131.822 1.00 24.16  ? 101 VAL A O    1 
ATOM   6562  C  CB   . VAL B  1 101 ? -26.698 -62.668 -133.469 1.00 26.01  ? 101 VAL A CB   1 
ATOM   6563  C  CG1  . VAL B  1 101 ? -27.270 -61.316 -133.848 1.00 31.23  ? 101 VAL A CG1  1 
ATOM   6564  C  CG2  . VAL B  1 101 ? -25.518 -62.978 -134.361 1.00 25.40  ? 101 VAL A CG2  1 
ATOM   6565  H  H    . VAL B  1 101 ? -24.716 -61.510 -131.997 1.00 20.35  ? 101 VAL A H    1 
ATOM   6566  H  HA   . VAL B  1 101 ? -27.158 -62.603 -131.465 1.00 23.13  ? 101 VAL A HA   1 
ATOM   6567  H  HB   . VAL B  1 101 ? -27.380 -63.338 -133.631 1.00 31.21  ? 101 VAL A HB   1 
ATOM   6568  H  HG11 . VAL B  1 101 ? -27.497 -61.322 -134.791 1.00 37.48  ? 101 VAL A HG11 1 
ATOM   6569  H  HG12 . VAL B  1 101 ? -28.065 -61.150 -133.317 1.00 37.48  ? 101 VAL A HG12 1 
ATOM   6570  H  HG13 . VAL B  1 101 ? -26.605 -60.631 -133.671 1.00 37.48  ? 101 VAL A HG13 1 
ATOM   6571  H  HG21 . VAL B  1 101 ? -25.809 -62.958 -135.287 1.00 30.48  ? 101 VAL A HG21 1 
ATOM   6572  H  HG22 . VAL B  1 101 ? -24.829 -62.311 -134.216 1.00 30.48  ? 101 VAL A HG22 1 
ATOM   6573  H  HG23 . VAL B  1 101 ? -25.178 -63.859 -134.140 1.00 30.48  ? 101 VAL A HG23 1 
ATOM   6574  N  N    . PHE B  1 102 ? -24.523 -64.035 -131.026 1.00 18.47  ? 102 PHE A N    1 
ATOM   6575  C  CA   . PHE B  1 102 ? -23.942 -65.280 -130.542 1.00 14.24  ? 102 PHE A CA   1 
ATOM   6576  C  C    . PHE B  1 102 ? -23.541 -65.196 -129.065 1.00 19.46  ? 102 PHE A C    1 
ATOM   6577  O  O    . PHE B  1 102 ? -22.358 -65.216 -128.741 1.00 22.09  ? 102 PHE A O    1 
ATOM   6578  C  CB   . PHE B  1 102 ? -22.723 -65.643 -131.395 1.00 15.56  ? 102 PHE A CB   1 
ATOM   6579  C  CG   . PHE B  1 102 ? -23.003 -65.663 -132.870 1.00 13.83  ? 102 PHE A CG   1 
ATOM   6580  C  CD1  . PHE B  1 102 ? -23.892 -66.579 -133.405 1.00 19.51  ? 102 PHE A CD1  1 
ATOM   6581  C  CD2  . PHE B  1 102 ? -22.376 -64.754 -133.720 1.00 20.08  ? 102 PHE A CD2  1 
ATOM   6582  C  CE1  . PHE B  1 102 ? -24.154 -66.602 -134.756 1.00 19.43  ? 102 PHE A CE1  1 
ATOM   6583  C  CE2  . PHE B  1 102 ? -22.645 -64.766 -135.077 1.00 26.75  ? 102 PHE A CE2  1 
ATOM   6584  C  CZ   . PHE B  1 102 ? -23.532 -65.693 -135.595 1.00 19.53  ? 102 PHE A CZ   1 
ATOM   6585  H  H    . PHE B  1 102 ? -24.034 -63.338 -130.902 1.00 22.16  ? 102 PHE A H    1 
ATOM   6586  H  HA   . PHE B  1 102 ? -24.595 -65.990 -130.635 1.00 17.09  ? 102 PHE A HA   1 
ATOM   6587  H  HB2  . PHE B  1 102 ? -22.023 -64.991 -131.234 1.00 18.67  ? 102 PHE A HB2  1 
ATOM   6588  H  HB3  . PHE B  1 102 ? -22.414 -66.527 -131.139 1.00 18.67  ? 102 PHE A HB3  1 
ATOM   6589  H  HD1  . PHE B  1 102 ? -24.313 -67.191 -132.846 1.00 23.42  ? 102 PHE A HD1  1 
ATOM   6590  H  HD2  . PHE B  1 102 ? -21.781 -64.130 -133.373 1.00 24.09  ? 102 PHE A HD2  1 
ATOM   6591  H  HE1  . PHE B  1 102 ? -24.753 -67.223 -135.103 1.00 23.31  ? 102 PHE A HE1  1 
ATOM   6592  H  HE2  . PHE B  1 102 ? -22.223 -64.159 -135.641 1.00 32.11  ? 102 PHE A HE2  1 
ATOM   6593  H  HZ   . PHE B  1 102 ? -23.710 -65.707 -136.508 1.00 23.43  ? 102 PHE A HZ   1 
ATOM   6594  N  N    . THR B  1 103 ? -24.522 -65.133 -128.171 1.00 16.84  ? 103 THR A N    1 
ATOM   6595  C  CA   . THR B  1 103 ? -24.233 -64.780 -126.791 1.00 20.30  ? 103 THR A CA   1 
ATOM   6596  C  C    . THR B  1 103 ? -24.296 -65.952 -125.814 1.00 25.53  ? 103 THR A C    1 
ATOM   6597  O  O    . THR B  1 103 ? -24.044 -65.762 -124.625 1.00 22.17  ? 103 THR A O    1 
ATOM   6598  C  CB   . THR B  1 103 ? -25.203 -63.702 -126.280 1.00 15.08  ? 103 THR A CB   1 
ATOM   6599  O  OG1  . THR B  1 103 ? -26.510 -64.242 -126.245 1.00 20.40  ? 103 THR A OG1  1 
ATOM   6600  C  CG2  . THR B  1 103 ? -25.185 -62.468 -127.176 1.00 16.66  ? 103 THR A CG2  1 
ATOM   6601  H  H    . THR B  1 103 ? -25.352 -65.287 -128.337 1.00 20.21  ? 103 THR A H    1 
ATOM   6602  H  HA   . THR B  1 103 ? -23.336 -64.412 -126.749 1.00 24.36  ? 103 THR A HA   1 
ATOM   6603  H  HB   . THR B  1 103 ? -24.942 -63.433 -125.385 1.00 18.09  ? 103 THR A HB   1 
ATOM   6604  H  HG1  . THR B  1 103 ? -27.053 -63.664 -125.967 1.00 24.48  ? 103 THR A HG1  1 
ATOM   6605  H  HG21 . THR B  1 103 ? -25.803 -61.803 -126.836 1.00 19.99  ? 103 THR A HG21 1 
ATOM   6606  H  HG22 . THR B  1 103 ? -24.293 -62.088 -127.199 1.00 19.99  ? 103 THR A HG22 1 
ATOM   6607  H  HG23 . THR B  1 103 ? -25.448 -62.710 -128.078 1.00 19.99  ? 103 THR A HG23 1 
ATOM   6608  N  N    . THR B  1 104 ? -24.682 -67.138 -126.280 1.00 17.05  ? 104 THR A N    1 
ATOM   6609  C  CA   . THR B  1 104 ? -24.645 -68.333 -125.421 1.00 17.39  ? 104 THR A CA   1 
ATOM   6610  C  C    . THR B  1 104 ? -23.286 -69.016 -125.559 1.00 19.36  ? 104 THR A C    1 
ATOM   6611  O  O    . THR B  1 104 ? -22.573 -68.768 -126.523 1.00 16.53  ? 104 THR A O    1 
ATOM   6612  C  CB   . THR B  1 104 ? -25.715 -69.358 -125.785 1.00 24.71  ? 104 THR A CB   1 
ATOM   6613  O  OG1  . THR B  1 104 ? -25.479 -69.814 -127.120 1.00 22.21  ? 104 THR A OG1  1 
ATOM   6614  C  CG2  . THR B  1 104 ? -27.092 -68.757 -125.687 1.00 29.08  ? 104 THR A CG2  1 
ATOM   6615  H  H    . THR B  1 104 ? -24.967 -67.282 -127.078 1.00 20.46  ? 104 THR A H    1 
ATOM   6616  H  HA   . THR B  1 104 ? -24.768 -68.072 -124.495 1.00 20.86  ? 104 THR A HA   1 
ATOM   6617  H  HB   . THR B  1 104 ? -25.664 -70.109 -125.173 1.00 29.65  ? 104 THR A HB   1 
ATOM   6618  H  HG1  . THR B  1 104 ? -26.060 -70.380 -127.338 1.00 26.65  ? 104 THR A HG1  1 
ATOM   6619  H  HG21 . THR B  1 104 ? -27.760 -69.420 -125.921 1.00 34.90  ? 104 THR A HG21 1 
ATOM   6620  H  HG22 . THR B  1 104 ? -27.256 -68.450 -124.782 1.00 34.90  ? 104 THR A HG22 1 
ATOM   6621  H  HG23 . THR B  1 104 ? -27.169 -68.005 -126.294 1.00 34.90  ? 104 THR A HG23 1 
ATOM   6622  N  N    . MET B  1 105 ? -22.943 -69.905 -124.637 1.00 17.06  ? 105 MET A N    1 
ATOM   6623  C  CA   . MET B  1 105 ? -21.647 -70.571 -124.718 1.00 16.68  ? 105 MET A CA   1 
ATOM   6624  C  C    . MET B  1 105 ? -21.585 -71.440 -125.964 1.00 17.68  ? 105 MET A C    1 
ATOM   6625  O  O    . MET B  1 105 ? -20.545 -71.535 -126.608 1.00 18.15  ? 105 MET A O    1 
ATOM   6626  C  CB   . MET B  1 105 ? -21.375 -71.413 -123.470 1.00 18.24  ? 105 MET A CB   1 
ATOM   6627  C  CG   . MET B  1 105 ? -21.086 -70.562 -122.223 1.00 28.47  ? 105 MET A CG   1 
ATOM   6628  S  SD   . MET B  1 105 ? -19.910 -71.315 -121.079 1.00 35.77  ? 105 MET A SD   1 
ATOM   6629  C  CE   . MET B  1 105 ? -20.677 -72.901 -120.791 1.00 52.48  ? 105 MET A CE   1 
ATOM   6630  H  H    . MET B  1 105 ? -23.429 -70.138 -123.967 1.00 20.47  ? 105 MET A H    1 
ATOM   6631  H  HA   . MET B  1 105 ? -20.953 -69.895 -124.776 1.00 20.02  ? 105 MET A HA   1 
ATOM   6632  H  HB2  . MET B  1 105 ? -22.153 -71.962 -123.285 1.00 21.89  ? 105 MET A HB2  1 
ATOM   6633  H  HB3  . MET B  1 105 ? -20.603 -71.978 -123.633 1.00 21.89  ? 105 MET A HB3  1 
ATOM   6634  H  HG2  . MET B  1 105 ? -20.720 -69.709 -122.505 1.00 34.16  ? 105 MET A HG2  1 
ATOM   6635  H  HG3  . MET B  1 105 ? -21.917 -70.421 -121.742 1.00 34.16  ? 105 MET A HG3  1 
ATOM   6636  H  HE1  . MET B  1 105 ? -20.126 -73.411 -120.177 1.00 62.98  ? 105 MET A HE1  1 
ATOM   6637  H  HE2  . MET B  1 105 ? -21.558 -72.761 -120.409 1.00 62.98  ? 105 MET A HE2  1 
ATOM   6638  H  HE3  . MET B  1 105 ? -20.755 -73.372 -121.636 1.00 62.98  ? 105 MET A HE3  1 
ATOM   6639  N  N    . GLU B  1 106 ? -22.710 -72.050 -126.316 1.00 17.05  ? 106 GLU A N    1 
ATOM   6640  C  CA   . GLU B  1 106 ? -22.753 -72.927 -127.478 1.00 17.20  ? 106 GLU A CA   1 
ATOM   6641  C  C    . GLU B  1 106 ? -22.499 -72.172 -128.775 1.00 18.17  ? 106 GLU A C    1 
ATOM   6642  O  O    . GLU B  1 106 ? -21.760 -72.637 -129.626 1.00 21.90  ? 106 GLU A O    1 
ATOM   6643  C  CB   . GLU B  1 106 ? -24.097 -73.648 -127.565 1.00 23.00  ? 106 GLU A CB   1 
ATOM   6644  C  CG   . GLU B  1 106 ? -24.211 -74.533 -128.789 1.00 35.41  ? 106 GLU A CG   1 
ATOM   6645  C  CD   . GLU B  1 106 ? -25.495 -75.331 -128.813 1.00 47.21  ? 106 GLU A CD   1 
ATOM   6646  O  OE1  . GLU B  1 106 ? -26.576 -74.707 -128.771 1.00 53.03  ? 106 GLU A OE1  1 
ATOM   6647  O  OE2  . GLU B  1 106 ? -25.414 -76.582 -128.861 1.00 36.32  ? 106 GLU A OE2  1 
ATOM   6648  H  H    . GLU B  1 106 ? -23.459 -71.974 -125.901 1.00 20.46  ? 106 GLU A H    1 
ATOM   6649  H  HA   . GLU B  1 106 ? -22.060 -73.601 -127.387 1.00 20.64  ? 106 GLU A HA   1 
ATOM   6650  H  HB2  . GLU B  1 106 ? -24.207 -74.207 -126.780 1.00 27.60  ? 106 GLU A HB2  1 
ATOM   6651  H  HB3  . GLU B  1 106 ? -24.807 -72.989 -127.604 1.00 27.60  ? 106 GLU A HB3  1 
ATOM   6652  H  HG2  . GLU B  1 106 ? -24.188 -73.978 -129.584 1.00 42.49  ? 106 GLU A HG2  1 
ATOM   6653  H  HG3  . GLU B  1 106 ? -23.469 -75.158 -128.799 1.00 42.49  ? 106 GLU A HG3  1 
ATOM   6654  N  N    . LYS B  1 107 ? -23.128 -71.017 -128.930 1.00 18.10  ? 107 LYS A N    1 
ATOM   6655  C  CA   . LYS B  1 107 ? -23.013 -70.269 -130.171 1.00 18.55  ? 107 LYS A CA   1 
ATOM   6656  C  C    . LYS B  1 107 ? -21.662 -69.563 -130.240 1.00 13.69  ? 107 LYS A C    1 
ATOM   6657  O  O    . LYS B  1 107 ? -21.035 -69.541 -131.293 1.00 18.22  ? 107 LYS A O    1 
ATOM   6658  C  CB   . LYS B  1 107 ? -24.160 -69.260 -130.301 1.00 21.86  ? 107 LYS A CB   1 
ATOM   6659  C  CG   . LYS B  1 107 ? -25.529 -69.886 -130.581 1.00 29.40  ? 107 LYS A CG   1 
ATOM   6660  C  CD   . LYS B  1 107 ? -26.598 -68.808 -130.605 1.00 47.32  ? 107 LYS A CD   1 
ATOM   6661  C  CE   . LYS B  1 107 ? -27.982 -69.390 -130.805 1.00 66.26  ? 107 LYS A CE   1 
ATOM   6662  N  NZ   . LYS B  1 107 ? -29.028 -68.342 -130.639 1.00 76.11  ? 107 LYS A NZ   1 
ATOM   6663  H  H    . LYS B  1 107 ? -23.626 -70.645 -128.335 1.00 21.71  ? 107 LYS A H    1 
ATOM   6664  H  HA   . LYS B  1 107 ? -23.068 -70.886 -130.917 1.00 22.26  ? 107 LYS A HA   1 
ATOM   6665  H  HB2  . LYS B  1 107 ? -24.230 -68.761 -129.472 1.00 26.23  ? 107 LYS A HB2  1 
ATOM   6666  H  HB3  . LYS B  1 107 ? -23.959 -68.654 -131.031 1.00 26.23  ? 107 LYS A HB3  1 
ATOM   6667  H  HG2  . LYS B  1 107 ? -25.514 -70.326 -131.446 1.00 35.28  ? 107 LYS A HG2  1 
ATOM   6668  H  HG3  . LYS B  1 107 ? -25.746 -70.521 -129.880 1.00 35.28  ? 107 LYS A HG3  1 
ATOM   6669  H  HD2  . LYS B  1 107 ? -26.590 -68.331 -129.760 1.00 56.78  ? 107 LYS A HD2  1 
ATOM   6670  H  HD3  . LYS B  1 107 ? -26.418 -68.196 -131.336 1.00 56.78  ? 107 LYS A HD3  1 
ATOM   6671  H  HE2  . LYS B  1 107 ? -28.052 -69.752 -131.702 1.00 79.51  ? 107 LYS A HE2  1 
ATOM   6672  H  HE3  . LYS B  1 107 ? -28.138 -70.085 -130.147 1.00 79.51  ? 107 LYS A HE3  1 
ATOM   6673  H  HZ1  . LYS B  1 107 ? -29.835 -68.697 -130.759 1.00 91.33  ? 107 LYS A HZ1  1 
ATOM   6674  H  HZ2  . LYS B  1 107 ? -28.983 -67.995 -129.821 1.00 91.33  ? 107 LYS A HZ2  1 
ATOM   6675  H  HZ3  . LYS B  1 107 ? -28.905 -67.693 -131.235 1.00 91.33  ? 107 LYS A HZ3  1 
ATOM   6676  N  N    . ALA B  1 108 ? -21.218 -68.993 -129.122 1.00 13.45  ? 108 ALA A N    1 
ATOM   6677  C  CA   . ALA B  1 108 ? -19.930 -68.290 -129.069 1.00 16.98  ? 108 ALA A CA   1 
ATOM   6678  C  C    . ALA B  1 108 ? -18.775 -69.286 -129.221 1.00 12.16  ? 108 ALA A C    1 
ATOM   6679  O  O    . ALA B  1 108 ? -17.703 -68.941 -129.738 1.00 16.17  ? 108 ALA A O    1 
ATOM   6680  C  CB   . ALA B  1 108 ? -19.788 -67.514 -127.763 1.00 18.28  ? 108 ALA A CB   1 
ATOM   6681  H  H    . ALA B  1 108 ? -21.643 -68.998 -128.375 1.00 16.14  ? 108 ALA A H    1 
ATOM   6682  H  HA   . ALA B  1 108 ? -19.882 -67.657 -129.803 1.00 20.37  ? 108 ALA A HA   1 
ATOM   6683  H  HB1  . ALA B  1 108 ? -18.931 -67.061 -127.757 1.00 21.94  ? 108 ALA A HB1  1 
ATOM   6684  H  HB2  . ALA B  1 108 ? -20.506 -66.864 -127.703 1.00 21.94  ? 108 ALA A HB2  1 
ATOM   6685  H  HB3  . ALA B  1 108 ? -19.840 -68.135 -127.020 1.00 21.94  ? 108 ALA A HB3  1 
ATOM   6686  N  N    . GLY B  1 109 ? -19.021 -70.520 -128.797 1.00 14.27  ? 109 GLY A N    1 
ATOM   6687  C  CA   . GLY B  1 109 ? -18.038 -71.589 -128.892 1.00 16.57  ? 109 GLY A CA   1 
ATOM   6688  C  C    . GLY B  1 109 ? -17.627 -71.961 -130.308 1.00 19.96  ? 109 GLY A C    1 
ATOM   6689  O  O    . GLY B  1 109 ? -16.609 -72.621 -130.513 1.00 17.33  ? 109 GLY A O    1 
ATOM   6690  H  H    . GLY B  1 109 ? -19.765 -70.766 -128.444 1.00 17.12  ? 109 GLY A H    1 
ATOM   6691  H  HA2  . GLY B  1 109 ? -17.239 -71.326 -128.409 1.00 19.88  ? 109 GLY A HA2  1 
ATOM   6692  H  HA3  . GLY B  1 109 ? -18.396 -72.384 -128.467 1.00 19.88  ? 109 GLY A HA3  1 
ATOM   6693  N  N    . ALA B  1 110 ? -18.416 -71.545 -131.291 1.00 15.05  ? 110 ALA A N    1 
ATOM   6694  C  CA   . ALA B  1 110 ? -18.102 -71.824 -132.690 1.00 16.58  ? 110 ALA A CA   1 
ATOM   6695  C  C    . ALA B  1 110 ? -16.739 -71.222 -133.109 1.00 13.43  ? 110 ALA A C    1 
ATOM   6696  O  O    . ALA B  1 110 ? -16.081 -71.738 -134.010 1.00 14.46  ? 110 ALA A O    1 
ATOM   6697  C  CB   . ALA B  1 110 ? -19.204 -71.293 -133.583 1.00 18.51  ? 110 ALA A CB   1 
ATOM   6698  H  H    . ALA B  1 110 ? -19.141 -71.098 -131.176 1.00 18.06  ? 110 ALA A H    1 
ATOM   6699  H  HA   . ALA B  1 110 ? -18.054 -72.785 -132.815 1.00 19.89  ? 110 ALA A HA   1 
ATOM   6700  H  HB1  . ALA B  1 110 ? -18.982 -71.485 -134.507 1.00 22.21  ? 110 ALA A HB1  1 
ATOM   6701  H  HB2  . ALA B  1 110 ? -20.039 -71.727 -133.345 1.00 22.21  ? 110 ALA A HB2  1 
ATOM   6702  H  HB3  . ALA B  1 110 ? -19.281 -70.335 -133.453 1.00 22.21  ? 110 ALA A HB3  1 
ATOM   6703  N  N    . HIS B  1 111 ? -16.324 -70.142 -132.459 1.00 12.52  ? 111 HIS A N    1 
ATOM   6704  C  CA   . HIS B  1 111 ? -15.043 -69.521 -132.787 1.00 13.48  ? 111 HIS A CA   1 
ATOM   6705  C  C    . HIS B  1 111 ? -13.865 -70.463 -132.506 1.00 13.72  ? 111 HIS A C    1 
ATOM   6706  O  O    . HIS B  1 111 ? -12.783 -70.309 -133.070 1.00 12.33  ? 111 HIS A O    1 
ATOM   6707  C  CB   . HIS B  1 111 ? -14.874 -68.222 -132.005 1.00 11.13  ? 111 HIS A CB   1 
ATOM   6708  C  CG   . HIS B  1 111 ? -15.847 -67.159 -132.402 1.00 12.64  ? 111 HIS A CG   1 
ATOM   6709  N  ND1  . HIS B  1 111 ? -15.872 -66.607 -133.664 1.00 11.73  ? 111 HIS A ND1  1 
ATOM   6710  C  CD2  . HIS B  1 111 ? -16.842 -66.555 -131.708 1.00 10.79  ? 111 HIS A CD2  1 
ATOM   6711  C  CE1  . HIS B  1 111 ? -16.829 -65.697 -133.727 1.00 17.34  ? 111 HIS A CE1  1 
ATOM   6712  N  NE2  . HIS B  1 111 ? -17.437 -65.650 -132.555 1.00 10.81  ? 111 HIS A NE2  1 
ATOM   6713  H  H    . HIS B  1 111 ? -16.759 -69.750 -131.830 1.00 15.02  ? 111 HIS A H    1 
ATOM   6714  H  HA   . HIS B  1 111 ? -15.032 -69.304 -133.733 1.00 16.18  ? 111 HIS A HA   1 
ATOM   6715  H  HB2  . HIS B  1 111 ? -15.002 -68.405 -131.061 1.00 13.35  ? 111 HIS A HB2  1 
ATOM   6716  H  HB3  . HIS B  1 111 ? -13.979 -67.878 -132.156 1.00 13.35  ? 111 HIS A HB3  1 
ATOM   6717  H  HD2  . HIS B  1 111 ? -17.076 -66.719 -130.823 1.00 12.94  ? 111 HIS A HD2  1 
ATOM   6718  H  HE1  . HIS B  1 111 ? -17.045 -65.186 -134.473 1.00 20.81  ? 111 HIS A HE1  1 
ATOM   6719  N  N    . LEU B  1 112 ? -14.058 -71.410 -131.603 1.00 12.51  ? 112 LEU A N    1 
ATOM   6720  C  CA   . LEU B  1 112 ? -13.016 -72.374 -131.318 1.00 12.86  ? 112 LEU A CA   1 
ATOM   6721  C  C    . LEU B  1 112 ? -12.781 -73.323 -132.500 1.00 14.95  ? 112 LEU A C    1 
ATOM   6722  O  O    . LEU B  1 112 ? -11.697 -73.859 -132.655 1.00 14.14  ? 112 LEU A O    1 
ATOM   6723  C  CB   . LEU B  1 112 ? -13.361 -73.178 -130.063 1.00 13.01  ? 112 LEU A CB   1 
ATOM   6724  C  CG   . LEU B  1 112 ? -13.587 -72.418 -128.752 1.00 16.00  ? 112 LEU A CG   1 
ATOM   6725  C  CD1  . LEU B  1 112 ? -13.660 -73.435 -127.601 1.00 20.41  ? 112 LEU A CD1  1 
ATOM   6726  C  CD2  . LEU B  1 112 ? -12.519 -71.406 -128.479 1.00 19.88  ? 112 LEU A CD2  1 
ATOM   6727  H  H    . LEU B  1 112 ? -14.778 -71.515 -131.145 1.00 15.01  ? 112 LEU A H    1 
ATOM   6728  H  HA   . LEU B  1 112 ? -12.188 -71.899 -131.149 1.00 15.43  ? 112 LEU A HA   1 
ATOM   6729  H  HB2  . LEU B  1 112 ? -14.174 -73.675 -130.243 1.00 15.61  ? 112 LEU A HB2  1 
ATOM   6730  H  HB3  . LEU B  1 112 ? -12.637 -73.804 -129.904 1.00 15.61  ? 112 LEU A HB3  1 
ATOM   6731  H  HG   . LEU B  1 112 ? -14.437 -71.954 -128.798 1.00 19.20  ? 112 LEU A HG   1 
ATOM   6732  H  HD11 . LEU B  1 112 ? -13.803 -72.959 -126.768 1.00 24.49  ? 112 LEU A HD11 1 
ATOM   6733  H  HD12 . LEU B  1 112 ? -14.397 -74.044 -127.765 1.00 24.49  ? 112 LEU A HD12 1 
ATOM   6734  H  HD13 . LEU B  1 112 ? -12.826 -73.928 -127.562 1.00 24.49  ? 112 LEU A HD13 1 
ATOM   6735  H  HD21 . LEU B  1 112 ? -12.715 -70.959 -127.640 1.00 23.86  ? 112 LEU A HD21 1 
ATOM   6736  H  HD22 . LEU B  1 112 ? -11.663 -71.858 -128.420 1.00 23.86  ? 112 LEU A HD22 1 
ATOM   6737  H  HD23 . LEU B  1 112 ? -12.504 -70.760 -129.202 1.00 23.86  ? 112 LEU A HD23 1 
ATOM   6738  N  N    . GLN B  1 113 ? -13.792 -73.531 -133.340 1.00 14.57  ? 113 GLN A N    1 
ATOM   6739  C  CA   . GLN B  1 113 ? -13.642 -74.457 -134.452 1.00 17.84  ? 113 GLN A CA   1 
ATOM   6740  C  C    . GLN B  1 113 ? -12.655 -73.925 -135.492 1.00 15.73  ? 113 GLN A C    1 
ATOM   6741  O  O    . GLN B  1 113 ? -11.999 -74.701 -136.176 1.00 19.91  ? 113 GLN A O    1 
ATOM   6742  C  CB   . GLN B  1 113 ? -14.998 -74.739 -135.106 1.00 18.40  ? 113 GLN A CB   1 
ATOM   6743  C  CG   . GLN B  1 113 ? -15.992 -75.379 -134.148 1.00 26.09  ? 113 GLN A CG   1 
ATOM   6744  C  CD   . GLN B  1 113 ? -17.359 -75.583 -134.767 1.00 31.93  ? 113 GLN A CD   1 
ATOM   6745  O  OE1  . GLN B  1 113 ? -18.388 -75.269 -134.161 1.00 36.83  ? 113 GLN A OE1  1 
ATOM   6746  N  NE2  . GLN B  1 113 ? -17.378 -76.113 -135.975 1.00 24.37  ? 113 GLN A NE2  1 
ATOM   6747  H  H    . GLN B  1 113 ? -14.563 -73.153 -133.289 1.00 17.49  ? 113 GLN A H    1 
ATOM   6748  H  HA   . GLN B  1 113 ? -13.294 -75.297 -134.114 1.00 21.41  ? 113 GLN A HA   1 
ATOM   6749  H  HB2  . GLN B  1 113 ? -15.378 -73.904 -135.418 1.00 22.08  ? 113 GLN A HB2  1 
ATOM   6750  H  HB3  . GLN B  1 113 ? -14.868 -75.345 -135.852 1.00 22.08  ? 113 GLN A HB3  1 
ATOM   6751  H  HG2  . GLN B  1 113 ? -15.654 -76.246 -133.875 1.00 31.31  ? 113 GLN A HG2  1 
ATOM   6752  H  HG3  . GLN B  1 113 ? -16.097 -74.805 -133.373 1.00 31.31  ? 113 GLN A HG3  1 
ATOM   6753  H  HE21 . GLN B  1 113 ? -16.640 -76.321 -136.365 1.00 29.24  ? 113 GLN A HE21 1 
ATOM   6754  H  HE22 . GLN B  1 113 ? -18.128 -76.251 -136.372 1.00 29.24  ? 113 GLN A HE22 1 
ATOM   6755  N  N    . GLY B  1 114 ? -12.556 -72.607 -135.602 1.00 14.47  ? 114 GLY A N    1 
ATOM   6756  C  CA   . GLY B  1 114 ? -11.637 -71.985 -136.536 1.00 14.41  ? 114 GLY A CA   1 
ATOM   6757  C  C    . GLY B  1 114 ? -10.313 -71.587 -135.919 1.00 15.09  ? 114 GLY A C    1 
ATOM   6758  O  O    . GLY B  1 114 ? -9.504  -70.909 -136.551 1.00 20.65  ? 114 GLY A O    1 
ATOM   6759  H  H    . GLY B  1 114 ? -13.016 -72.046 -135.140 1.00 17.37  ? 114 GLY A H    1 
ATOM   6760  H  HA2  . GLY B  1 114 ? -11.458 -72.601 -137.264 1.00 17.29  ? 114 GLY A HA2  1 
ATOM   6761  H  HA3  . GLY B  1 114 ? -12.049 -71.189 -136.906 1.00 17.29  ? 114 GLY A HA3  1 
ATOM   6762  N  N    . GLY B  1 115 ? -10.095 -71.983 -134.673 1.00 17.37  ? 115 GLY A N    1 
ATOM   6763  C  CA   . GLY B  1 115 ? -8.775  -71.890 -134.075 1.00 15.45  ? 115 GLY A CA   1 
ATOM   6764  C  C    . GLY B  1 115 ? -8.584  -70.849 -132.989 1.00 13.53  ? 115 GLY A C    1 
ATOM   6765  O  O    . GLY B  1 115 ? -7.499  -70.764 -132.440 1.00 14.49  ? 115 GLY A O    1 
ATOM   6766  H  H    . GLY B  1 115 ? -10.697 -72.309 -134.152 1.00 20.84  ? 115 GLY A H    1 
ATOM   6767  H  HA2  . GLY B  1 115 ? -8.549  -72.753 -133.694 1.00 18.54  ? 115 GLY A HA2  1 
ATOM   6768  H  HA3  . GLY B  1 115 ? -8.132  -71.701 -134.777 1.00 18.54  ? 115 GLY A HA3  1 
ATOM   6769  N  N    . ALA B  1 116 ? -9.609  -70.068 -132.654 1.00 13.35  ? 116 ALA A N    1 
ATOM   6770  C  CA   . ALA B  1 116 ? -9.492  -69.196 -131.492 1.00 12.30  ? 116 ALA A CA   1 
ATOM   6771  C  C    . ALA B  1 116 ? -9.277  -70.057 -130.241 1.00 11.40  ? 116 ALA A C    1 
ATOM   6772  O  O    . ALA B  1 116 ? -9.720  -71.196 -130.200 1.00 15.52  ? 116 ALA A O    1 
ATOM   6773  C  CB   . ALA B  1 116 ? -10.713 -68.333 -131.347 1.00 19.81  ? 116 ALA A CB   1 
ATOM   6774  H  H    . ALA B  1 116 ? -10.361 -70.026 -133.070 1.00 16.02  ? 116 ALA A H    1 
ATOM   6775  H  HA   . ALA B  1 116 ? -8.721  -68.618 -131.601 1.00 14.76  ? 116 ALA A HA   1 
ATOM   6776  H  HB1  . ALA B  1 116 ? -10.607 -67.765 -130.568 1.00 23.78  ? 116 ALA A HB1  1 
ATOM   6777  H  HB2  . ALA B  1 116 ? -10.811 -67.788 -132.144 1.00 23.78  ? 116 ALA A HB2  1 
ATOM   6778  H  HB3  . ALA B  1 116 ? -11.491 -68.902 -131.238 1.00 23.78  ? 116 ALA A HB3  1 
ATOM   6779  N  N    . LYS B  1 117 ? -8.587  -69.520 -129.239 1.00 11.04  ? 117 LYS A N    1 
ATOM   6780  C  CA   . LYS B  1 117 ? -8.363  -70.219 -127.966 1.00 12.74  ? 117 LYS A CA   1 
ATOM   6781  C  C    . LYS B  1 117 ? -9.388  -69.843 -126.892 1.00 13.24  ? 117 LYS A C    1 
ATOM   6782  O  O    . LYS B  1 117 ? -9.769  -70.674 -126.069 1.00 10.94  ? 117 LYS A O    1 
ATOM   6783  C  CB   . LYS B  1 117 ? -6.958  -69.926 -127.440 1.00 15.76  ? 117 LYS A CB   1 
ATOM   6784  C  CG   . LYS B  1 117 ? -5.813  -70.295 -128.401 1.00 19.96  ? 117 LYS A CG   1 
ATOM   6785  C  CD   . LYS B  1 117 ? -5.786  -71.753 -128.746 1.00 32.76  ? 117 LYS A CD   1 
ATOM   6786  C  CE   . LYS B  1 117 ? -4.594  -72.081 -129.651 1.00 46.92  ? 117 LYS A CE   1 
ATOM   6787  N  NZ   . LYS B  1 117 ? -4.527  -73.534 -129.966 1.00 65.08  ? 117 LYS A NZ   1 
ATOM   6788  H  H    . LYS B  1 117 ? -8.230  -68.738 -129.269 1.00 13.25  ? 117 LYS A H    1 
ATOM   6789  H  HA   . LYS B  1 117 ? -8.430  -71.175 -128.118 1.00 15.29  ? 117 LYS A HA   1 
ATOM   6790  H  HB2  . LYS B  1 117 ? -6.890  -68.976 -127.255 1.00 18.92  ? 117 LYS A HB2  1 
ATOM   6791  H  HB3  . LYS B  1 117 ? -6.825  -70.426 -126.620 1.00 18.92  ? 117 LYS A HB3  1 
ATOM   6792  H  HG2  . LYS B  1 117 ? -5.919  -69.794 -129.224 1.00 23.95  ? 117 LYS A HG2  1 
ATOM   6793  H  HG3  . LYS B  1 117 ? -4.967  -70.071 -127.983 1.00 23.95  ? 117 LYS A HG3  1 
ATOM   6794  H  HD2  . LYS B  1 117 ? -5.705  -72.275 -127.933 1.00 39.31  ? 117 LYS A HD2  1 
ATOM   6795  H  HD3  . LYS B  1 117 ? -6.601  -71.987 -129.218 1.00 39.31  ? 117 LYS A HD3  1 
ATOM   6796  H  HE2  . LYS B  1 117 ? -4.682  -71.594 -130.485 1.00 56.30  ? 117 LYS A HE2  1 
ATOM   6797  H  HE3  . LYS B  1 117 ? -3.772  -71.830 -129.201 1.00 56.30  ? 117 LYS A HE3  1 
ATOM   6798  H  HZ1  . LYS B  1 117 ? -4.442  -74.004 -129.216 1.00 78.09  ? 117 LYS A HZ1  1 
ATOM   6799  H  HZ2  . LYS B  1 117 ? -5.270  -73.788 -130.385 1.00 78.09  ? 117 LYS A HZ2  1 
ATOM   6800  H  HZ3  . LYS B  1 117 ? -3.828  -73.699 -130.492 1.00 78.09  ? 117 LYS A HZ3  1 
ATOM   6801  N  N    . ARG B  1 118 ? -9.810  -68.585 -126.884 1.00 10.14  ? 118 ARG A N    1 
ATOM   6802  C  CA   . ARG B  1 118 ? -10.804 -68.093 -125.930 1.00 9.79   ? 118 ARG A CA   1 
ATOM   6803  C  C    . ARG B  1 118 ? -11.703 -67.065 -126.607 1.00 14.31  ? 118 ARG A C    1 
ATOM   6804  O  O    . ARG B  1 118 ? -11.312 -66.432 -127.585 1.00 9.78   ? 118 ARG A O    1 
ATOM   6805  C  CB   . ARG B  1 118 ? -10.154 -67.443 -124.690 1.00 9.91   ? 118 ARG A CB   1 
ATOM   6806  C  CG   . ARG B  1 118 ? -9.179  -68.312 -123.953 1.00 9.92   ? 118 ARG A CG   1 
ATOM   6807  C  CD   . ARG B  1 118 ? -8.705  -67.729 -122.627 1.00 15.64  ? 118 ARG A CD   1 
ATOM   6808  N  NE   . ARG B  1 118 ? -7.641  -68.584 -122.086 1.00 10.30  ? 118 ARG A NE   1 
ATOM   6809  C  CZ   . ARG B  1 118 ? -7.828  -69.650 -121.322 1.00 11.43  ? 118 ARG A CZ   1 
ATOM   6810  N  NH1  . ARG B  1 118 ? -9.045  -70.025 -120.952 1.00 14.31  ? 118 ARG A NH1  1 
ATOM   6811  N  NH2  . ARG B  1 118 ? -6.779  -70.354 -120.926 1.00 15.97  ? 118 ARG A NH2  1 
ATOM   6812  H  H    . ARG B  1 118 ? -9.532  -67.983 -127.431 1.00 12.17  ? 118 ARG A H    1 
ATOM   6813  H  HA   . ARG B  1 118 ? -11.357 -68.833 -125.632 1.00 11.75  ? 118 ARG A HA   1 
ATOM   6814  H  HB2  . ARG B  1 118 ? -9.678  -66.646 -124.974 1.00 11.89  ? 118 ARG A HB2  1 
ATOM   6815  H  HB3  . ARG B  1 118 ? -10.856 -67.198 -124.067 1.00 11.89  ? 118 ARG A HB3  1 
ATOM   6816  H  HG2  . ARG B  1 118 ? -9.602  -69.165 -123.767 1.00 11.91  ? 118 ARG A HG2  1 
ATOM   6817  H  HG3  . ARG B  1 118 ? -8.398  -68.448 -124.512 1.00 11.91  ? 118 ARG A HG3  1 
ATOM   6818  H  HD2  . ARG B  1 118 ? -8.347  -66.839 -122.769 1.00 18.77  ? 118 ARG A HD2  1 
ATOM   6819  H  HD3  . ARG B  1 118 ? -9.440  -67.709 -121.995 1.00 18.77  ? 118 ARG A HD3  1 
ATOM   6820  H  HE   . ARG B  1 118 ? -6.830  -68.376 -122.282 1.00 12.36  ? 118 ARG A HE   1 
ATOM   6821  H  HH11 . ARG B  1 118 ? -9.731  -69.577 -121.213 1.00 17.17  ? 118 ARG A HH11 1 
ATOM   6822  H  HH12 . ARG B  1 118 ? -9.148  -70.718 -120.452 1.00 17.17  ? 118 ARG A HH12 1 
ATOM   6823  H  HH21 . ARG B  1 118 ? -5.987  -70.113 -121.157 1.00 19.17  ? 118 ARG A HH21 1 
ATOM   6824  H  HH22 . ARG B  1 118 ? -6.888  -71.040 -120.419 1.00 19.17  ? 118 ARG A HH22 1 
ATOM   6825  N  N    . VAL B  1 119 ? -12.897 -66.899 -126.055 1.00 9.39   ? 119 VAL A N    1 
ATOM   6826  C  CA   . VAL B  1 119 ? -13.895 -65.988 -126.576 1.00 9.26   ? 119 VAL A CA   1 
ATOM   6827  C  C    . VAL B  1 119 ? -14.421 -65.113 -125.465 1.00 8.97   ? 119 VAL A C    1 
ATOM   6828  O  O    . VAL B  1 119 ? -14.772 -65.622 -124.391 1.00 9.66   ? 119 VAL A O    1 
ATOM   6829  C  CB   . VAL B  1 119 ? -15.078 -66.767 -127.214 1.00 13.36  ? 119 VAL A CB   1 
ATOM   6830  C  CG1  . VAL B  1 119 ? -16.067 -65.818 -127.861 1.00 14.42  ? 119 VAL A CG1  1 
ATOM   6831  C  CG2  . VAL B  1 119 ? -14.572 -67.762 -128.221 1.00 15.56  ? 119 VAL A CG2  1 
ATOM   6832  H  H    . VAL B  1 119 ? -13.158 -67.321 -125.352 1.00 11.26  ? 119 VAL A H    1 
ATOM   6833  H  HA   . VAL B  1 119 ? -13.496 -65.421 -127.255 1.00 11.12  ? 119 VAL A HA   1 
ATOM   6834  H  HB   . VAL B  1 119 ? -15.545 -67.256 -126.519 1.00 16.03  ? 119 VAL A HB   1 
ATOM   6835  H  HG11 . VAL B  1 119 ? -16.791 -66.334 -128.249 1.00 17.30  ? 119 VAL A HG11 1 
ATOM   6836  H  HG12 . VAL B  1 119 ? -16.414 -65.216 -127.185 1.00 17.30  ? 119 VAL A HG12 1 
ATOM   6837  H  HG13 . VAL B  1 119 ? -15.613 -65.313 -128.553 1.00 17.30  ? 119 VAL A HG13 1 
ATOM   6838  H  HG21 . VAL B  1 119 ? -15.327 -68.235 -128.605 1.00 18.67  ? 119 VAL A HG21 1 
ATOM   6839  H  HG22 . VAL B  1 119 ? -14.089 -67.289 -128.917 1.00 18.67  ? 119 VAL A HG22 1 
ATOM   6840  H  HG23 . VAL B  1 119 ? -13.981 -68.389 -127.775 1.00 18.67  ? 119 VAL A HG23 1 
ATOM   6841  N  N    . ILE B  1 120 ? -14.505 -63.807 -125.736 1.00 8.67   ? 120 ILE A N    1 
ATOM   6842  C  CA   . ILE B  1 120 ? -15.097 -62.829 -124.837 1.00 8.55   ? 120 ILE A CA   1 
ATOM   6843  C  C    . ILE B  1 120 ? -16.359 -62.250 -125.490 1.00 9.60   ? 120 ILE A C    1 
ATOM   6844  O  O    . ILE B  1 120 ? -16.295 -61.528 -126.500 1.00 13.10  ? 120 ILE A O    1 
ATOM   6845  C  CB   . ILE B  1 120 ? -14.121 -61.684 -124.493 1.00 8.26   ? 120 ILE A CB   1 
ATOM   6846  C  CG1  . ILE B  1 120 ? -12.853 -62.232 -123.827 1.00 14.34  ? 120 ILE A CG1  1 
ATOM   6847  C  CG2  . ILE B  1 120 ? -14.759 -60.707 -123.527 1.00 11.84  ? 120 ILE A CG2  1 
ATOM   6848  C  CD1  . ILE B  1 120 ? -11.801 -62.739 -124.789 1.00 19.85  ? 120 ILE A CD1  1 
ATOM   6849  H  H    . ILE B  1 120 ? -14.213 -63.458 -126.466 1.00 10.41  ? 120 ILE A H    1 
ATOM   6850  H  HA   . ILE B  1 120 ? -15.354 -63.267 -124.011 1.00 10.26  ? 120 ILE A HA   1 
ATOM   6851  H  HB   . ILE B  1 120 ? -13.877 -61.216 -125.307 1.00 9.91   ? 120 ILE A HB   1 
ATOM   6852  H  HG12 . ILE B  1 120 ? -12.450 -61.526 -123.299 1.00 17.21  ? 120 ILE A HG12 1 
ATOM   6853  H  HG13 . ILE B  1 120 ? -13.101 -62.970 -123.249 1.00 17.21  ? 120 ILE A HG13 1 
ATOM   6854  H  HG21 . ILE B  1 120 ? -14.125 -60.000 -123.329 1.00 14.21  ? 120 ILE A HG21 1 
ATOM   6855  H  HG22 . ILE B  1 120 ? -15.554 -60.333 -123.937 1.00 14.21  ? 120 ILE A HG22 1 
ATOM   6856  H  HG23 . ILE B  1 120 ? -14.995 -61.178 -122.713 1.00 14.21  ? 120 ILE A HG23 1 
ATOM   6857  H  HD11 . ILE B  1 120 ? -11.041 -63.065 -124.283 1.00 23.82  ? 120 ILE A HD11 1 
ATOM   6858  H  HD12 . ILE B  1 120 ? -12.179 -63.459 -125.319 1.00 23.82  ? 120 ILE A HD12 1 
ATOM   6859  H  HD13 . ILE B  1 120 ? -11.527 -62.011 -125.368 1.00 23.82  ? 120 ILE A HD13 1 
ATOM   6860  N  N    . ILE B  1 121 ? -17.500 -62.598 -124.918 1.00 9.05   ? 121 ILE A N    1 
ATOM   6861  C  CA   . ILE B  1 121 ? -18.796 -62.114 -125.373 1.00 9.38   ? 121 ILE A CA   1 
ATOM   6862  C  C    . ILE B  1 121 ? -19.011 -60.700 -124.833 1.00 10.05  ? 121 ILE A C    1 
ATOM   6863  O  O    . ILE B  1 121 ? -18.980 -60.475 -123.619 1.00 9.82   ? 121 ILE A O    1 
ATOM   6864  C  CB   . ILE B  1 121 ? -19.932 -63.024 -124.910 1.00 15.76  ? 121 ILE A CB   1 
ATOM   6865  C  CG1  . ILE B  1 121 ? -19.692 -64.471 -125.367 1.00 13.35  ? 121 ILE A CG1  1 
ATOM   6866  C  CG2  . ILE B  1 121 ? -21.278 -62.521 -125.429 1.00 14.77  ? 121 ILE A CG2  1 
ATOM   6867  C  CD1  . ILE B  1 121 ? -20.553 -65.506 -124.633 1.00 12.01  ? 121 ILE A CD1  1 
ATOM   6868  H  H    . ILE B  1 121 ? -17.552 -63.130 -124.244 1.00 10.86  ? 121 ILE A H    1 
ATOM   6869  H  HA   . ILE B  1 121 ? -18.806 -62.078 -126.342 1.00 11.26  ? 121 ILE A HA   1 
ATOM   6870  H  HB   . ILE B  1 121 ? -19.956 -63.012 -123.940 1.00 18.92  ? 121 ILE A HB   1 
ATOM   6871  H  HG12 . ILE B  1 121 ? -19.892 -64.536 -126.314 1.00 16.02  ? 121 ILE A HG12 1 
ATOM   6872  H  HG13 . ILE B  1 121 ? -18.761 -64.697 -125.212 1.00 16.02  ? 121 ILE A HG13 1 
ATOM   6873  H  HG21 . ILE B  1 121 ? -21.978 -63.117 -125.121 1.00 17.73  ? 121 ILE A HG21 1 
ATOM   6874  H  HG22 . ILE B  1 121 ? -21.432 -61.625 -125.090 1.00 17.73  ? 121 ILE A HG22 1 
ATOM   6875  H  HG23 . ILE B  1 121 ? -21.257 -62.509 -126.399 1.00 17.73  ? 121 ILE A HG23 1 
ATOM   6876  H  HD11 . ILE B  1 121 ? -20.345 -66.389 -124.976 1.00 14.41  ? 121 ILE A HD11 1 
ATOM   6877  H  HD12 . ILE B  1 121 ? -20.357 -65.464 -123.684 1.00 14.41  ? 121 ILE A HD12 1 
ATOM   6878  H  HD13 . ILE B  1 121 ? -21.489 -65.303 -124.787 1.00 14.41  ? 121 ILE A HD13 1 
ATOM   6879  N  N    . SER B  1 122 ? -19.221 -59.756 -125.744 1.00 9.42   ? 122 SER A N    1 
ATOM   6880  C  CA   . SER B  1 122 ? -19.367 -58.352 -125.386 1.00 9.39   ? 122 SER A CA   1 
ATOM   6881  C  C    . SER B  1 122 ? -20.800 -58.012 -125.013 1.00 17.00  ? 122 SER A C    1 
ATOM   6882  O  O    . SER B  1 122 ? -21.318 -56.971 -125.406 1.00 22.41  ? 122 SER A O    1 
ATOM   6883  C  CB   . SER B  1 122 ? -18.903 -57.470 -126.553 1.00 15.74  ? 122 SER A CB   1 
ATOM   6884  O  OG   . SER B  1 122 ? -19.949 -57.348 -127.494 1.00 24.28  ? 122 SER A OG   1 
ATOM   6885  H  H    . SER B  1 122 ? -19.283 -59.907 -126.588 1.00 11.30  ? 122 SER A H    1 
ATOM   6886  H  HA   . SER B  1 122 ? -18.804 -58.160 -124.621 1.00 11.27  ? 122 SER A HA   1 
ATOM   6887  H  HB2  . SER B  1 122 ? -18.670 -56.590 -126.217 1.00 18.89  ? 122 SER A HB2  1 
ATOM   6888  H  HB3  . SER B  1 122 ? -18.135 -57.881 -126.980 1.00 18.89  ? 122 SER A HB3  1 
ATOM   6889  H  HG   . SER B  1 122 ? -19.703 -56.866 -128.136 1.00 29.14  ? 122 SER A HG   1 
ATOM   6890  N  N    . ALA B  1 123 ? -21.421 -58.881 -124.221 1.00 14.38  ? 123 ALA A N    1 
ATOM   6891  C  CA   . ALA B  1 123 ? -22.816 -58.754 -123.851 1.00 16.57  ? 123 ALA A CA   1 
ATOM   6892  C  C    . ALA B  1 123 ? -23.103 -59.734 -122.726 1.00 11.25  ? 123 ALA A C    1 
ATOM   6893  O  O    . ALA B  1 123 ? -22.312 -60.647 -122.498 1.00 16.29  ? 123 ALA A O    1 
ATOM   6894  C  CB   . ALA B  1 123 ? -23.720 -59.031 -125.046 1.00 17.27  ? 123 ALA A CB   1 
ATOM   6895  H  H    . ALA B  1 123 ? -21.039 -59.572 -123.878 1.00 17.25  ? 123 ALA A H    1 
ATOM   6896  H  HA   . ALA B  1 123 ? -22.989 -57.854 -123.532 1.00 19.89  ? 123 ALA A HA   1 
ATOM   6897  H  HB1  . ALA B  1 123 ? -24.645 -58.938 -124.770 1.00 20.73  ? 123 ALA A HB1  1 
ATOM   6898  H  HB2  . ALA B  1 123 ? -23.519 -58.392 -125.749 1.00 20.73  ? 123 ALA A HB2  1 
ATOM   6899  H  HB3  . ALA B  1 123 ? -23.558 -59.933 -125.362 1.00 20.73  ? 123 ALA A HB3  1 
ATOM   6900  N  N    . PRO B  1 124 ? -24.231 -59.554 -122.029 1.00 13.53  ? 124 PRO A N    1 
ATOM   6901  C  CA   . PRO B  1 124 ? -24.671 -60.550 -121.060 1.00 17.06  ? 124 PRO A CA   1 
ATOM   6902  C  C    . PRO B  1 124 ? -24.911 -61.890 -121.740 1.00 20.50  ? 124 PRO A C    1 
ATOM   6903  O  O    . PRO B  1 124 ? -25.260 -61.917 -122.911 1.00 19.28  ? 124 PRO A O    1 
ATOM   6904  C  CB   . PRO B  1 124 ? -25.984 -59.978 -120.517 1.00 20.37  ? 124 PRO A CB   1 
ATOM   6905  C  CG   . PRO B  1 124 ? -26.015 -58.568 -120.924 1.00 21.03  ? 124 PRO A CG   1 
ATOM   6906  C  CD   . PRO B  1 124 ? -25.225 -58.467 -122.179 1.00 15.32  ? 124 PRO A CD   1 
ATOM   6907  H  HA   . PRO B  1 124 ? -24.027 -60.648 -120.341 1.00 20.47  ? 124 PRO A HA   1 
ATOM   6908  H  HB2  . PRO B  1 124 ? -26.731 -60.460 -120.903 1.00 24.44  ? 124 PRO A HB2  1 
ATOM   6909  H  HB3  . PRO B  1 124 ? -25.994 -60.052 -119.550 1.00 24.44  ? 124 PRO A HB3  1 
ATOM   6910  H  HG2  . PRO B  1 124 ? -26.933 -58.299 -121.081 1.00 25.24  ? 124 PRO A HG2  1 
ATOM   6911  H  HG3  . PRO B  1 124 ? -25.615 -58.023 -120.229 1.00 25.24  ? 124 PRO A HG3  1 
ATOM   6912  H  HD2  . PRO B  1 124 ? -25.790 -58.628 -122.951 1.00 18.38  ? 124 PRO A HD2  1 
ATOM   6913  H  HD3  . PRO B  1 124 ? -24.781 -57.606 -122.233 1.00 18.38  ? 124 PRO A HD3  1 
ATOM   6914  N  N    . SER B  1 125 ? -24.723 -62.976 -121.007 1.00 15.33  ? 125 SER A N    1 
ATOM   6915  C  CA   . SER B  1 125 ? -24.879 -64.319 -121.560 1.00 15.65  ? 125 SER A CA   1 
ATOM   6916  C  C    . SER B  1 125 ? -25.741 -65.091 -120.624 1.00 14.84  ? 125 SER A C    1 
ATOM   6917  O  O    . SER B  1 125 ? -25.625 -64.926 -119.417 1.00 17.22  ? 125 SER A O    1 
ATOM   6918  C  CB   . SER B  1 125 ? -23.520 -65.014 -121.722 1.00 15.40  ? 125 SER A CB   1 
ATOM   6919  O  OG   . SER B  1 125 ? -23.687 -66.375 -122.108 1.00 17.09  ? 125 SER A OG   1 
ATOM   6920  H  H    . SER B  1 125 ? -24.501 -62.966 -120.176 1.00 18.40  ? 125 SER A H    1 
ATOM   6921  H  HA   . SER B  1 125 ? -25.315 -64.272 -122.426 1.00 18.78  ? 125 SER A HA   1 
ATOM   6922  H  HB2  . SER B  1 125 ? -23.009 -64.553 -122.405 1.00 18.49  ? 125 SER A HB2  1 
ATOM   6923  H  HB3  . SER B  1 125 ? -23.047 -64.982 -120.876 1.00 18.49  ? 125 SER A HB3  1 
ATOM   6924  H  HG   . SER B  1 125 ? -24.096 -66.418 -122.840 1.00 20.51  ? 125 SER A HG   1 
ATOM   6925  N  N    . ALA B  1 126 ? -26.591 -65.962 -121.156 1.00 23.27  ? 126 ALA A N    1 
ATOM   6926  C  CA   . ALA B  1 126 ? -27.457 -66.749 -120.297 1.00 20.09  ? 126 ALA A CA   1 
ATOM   6927  C  C    . ALA B  1 126 ? -26.640 -67.758 -119.485 1.00 14.94  ? 126 ALA A C    1 
ATOM   6928  O  O    . ALA B  1 126 ? -27.062 -68.182 -118.417 1.00 22.18  ? 126 ALA A O    1 
ATOM   6929  C  CB   . ALA B  1 126 ? -28.530 -67.471 -121.130 1.00 25.50  ? 126 ALA A CB   1 
ATOM   6930  H  H    . ALA B  1 126 ? -26.683 -66.113 -121.998 1.00 27.92  ? 126 ALA A H    1 
ATOM   6931  H  HA   . ALA B  1 126 ? -27.907 -66.157 -119.674 1.00 24.11  ? 126 ALA A HA   1 
ATOM   6932  H  HB1  . ALA B  1 126 ? -29.095 -67.988 -120.535 1.00 30.60  ? 126 ALA A HB1  1 
ATOM   6933  H  HB2  . ALA B  1 126 ? -29.062 -66.809 -121.600 1.00 30.60  ? 126 ALA A HB2  1 
ATOM   6934  H  HB3  . ALA B  1 126 ? -28.093 -68.058 -121.766 1.00 30.60  ? 126 ALA A HB3  1 
ATOM   6935  N  N    . ASP B  1 127 ? -25.478 -68.161 -119.991 1.00 17.49  ? 127 ASP A N    1 
ATOM   6936  C  CA   . ASP B  1 127 ? -24.735 -69.215 -119.304 1.00 19.22  ? 127 ASP A CA   1 
ATOM   6937  C  C    . ASP B  1 127 ? -23.220 -69.010 -119.207 1.00 18.12  ? 127 ASP A C    1 
ATOM   6938  O  O    . ASP B  1 127 ? -22.600 -69.587 -118.338 1.00 17.46  ? 127 ASP A O    1 
ATOM   6939  C  CB   . ASP B  1 127 ? -25.054 -70.564 -119.964 1.00 22.52  ? 127 ASP A CB   1 
ATOM   6940  C  CG   . ASP B  1 127 ? -24.657 -70.640 -121.431 1.00 30.91  ? 127 ASP A CG   1 
ATOM   6941  O  OD1  . ASP B  1 127 ? -24.377 -69.603 -122.080 1.00 25.51  ? 127 ASP A OD1  1 
ATOM   6942  O  OD2  . ASP B  1 127 ? -24.636 -71.779 -121.945 1.00 33.06  ? 127 ASP A OD2  1 
ATOM   6943  H  H    . ASP B  1 127 ? -25.109 -67.854 -120.704 1.00 20.99  ? 127 ASP A H    1 
ATOM   6944  H  HA   . ASP B  1 127 ? -25.067 -69.263 -118.394 1.00 23.06  ? 127 ASP A HA   1 
ATOM   6945  H  HB2  . ASP B  1 127 ? -24.576 -71.264 -119.491 1.00 27.03  ? 127 ASP A HB2  1 
ATOM   6946  H  HB3  . ASP B  1 127 ? -26.009 -70.722 -119.907 1.00 27.03  ? 127 ASP A HB3  1 
ATOM   6947  N  N    . ALA B  1 128 ? -22.615 -68.170 -120.041 1.00 15.91  ? 128 ALA A N    1 
ATOM   6948  C  CA   . ALA B  1 128 ? -21.180 -67.924 -119.900 1.00 12.86  ? 128 ALA A CA   1 
ATOM   6949  C  C    . ALA B  1 128 ? -20.890 -67.180 -118.598 1.00 17.38  ? 128 ALA A C    1 
ATOM   6950  O  O    . ALA B  1 128 ? -21.622 -66.288 -118.251 1.00 15.91  ? 128 ALA A O    1 
ATOM   6951  C  CB   . ALA B  1 128 ? -20.650 -67.121 -121.068 1.00 13.72  ? 128 ALA A CB   1 
ATOM   6952  H  H    . ALA B  1 128 ? -22.997 -67.741 -120.681 1.00 19.09  ? 128 ALA A H    1 
ATOM   6953  H  HA   . ALA B  1 128 ? -20.710 -68.773 -119.876 1.00 15.44  ? 128 ALA A HA   1 
ATOM   6954  H  HB1  . ALA B  1 128 ? -19.699 -66.975 -120.945 1.00 16.46  ? 128 ALA A HB1  1 
ATOM   6955  H  HB2  . ALA B  1 128 ? -20.805 -67.616 -121.888 1.00 16.46  ? 128 ALA A HB2  1 
ATOM   6956  H  HB3  . ALA B  1 128 ? -21.114 -66.270 -121.102 1.00 16.46  ? 128 ALA A HB3  1 
ATOM   6957  N  N    . PRO B  1 129 ? -19.808 -67.529 -117.889 1.00 15.13  ? 129 PRO A N    1 
ATOM   6958  C  CA   . PRO B  1 129 ? -19.468 -66.725 -116.696 1.00 16.38  ? 129 PRO A CA   1 
ATOM   6959  C  C    . PRO B  1 129 ? -19.278 -65.231 -117.025 1.00 13.17  ? 129 PRO A C    1 
ATOM   6960  O  O    . PRO B  1 129 ? -18.648 -64.916 -118.032 1.00 11.13  ? 129 PRO A O    1 
ATOM   6961  C  CB   . PRO B  1 129 ? -18.152 -67.341 -116.207 1.00 21.07  ? 129 PRO A CB   1 
ATOM   6962  C  CG   . PRO B  1 129 ? -18.005 -68.632 -116.929 1.00 29.09  ? 129 PRO A CG   1 
ATOM   6963  C  CD   . PRO B  1 129 ? -18.774 -68.528 -118.201 1.00 15.84  ? 129 PRO A CD   1 
ATOM   6964  H  HA   . PRO B  1 129 ? -20.148 -66.825 -116.012 1.00 19.66  ? 129 PRO A HA   1 
ATOM   6965  H  HB2  . PRO B  1 129 ? -17.416 -66.746 -116.422 1.00 25.28  ? 129 PRO A HB2  1 
ATOM   6966  H  HB3  . PRO B  1 129 ? -18.201 -67.490 -115.250 1.00 25.28  ? 129 PRO A HB3  1 
ATOM   6967  H  HG2  . PRO B  1 129 ? -17.066 -68.789 -117.116 1.00 34.91  ? 129 PRO A HG2  1 
ATOM   6968  H  HG3  . PRO B  1 129 ? -18.362 -69.348 -116.379 1.00 34.91  ? 129 PRO A HG3  1 
ATOM   6969  H  HD2  . PRO B  1 129 ? -18.202 -68.211 -118.918 1.00 19.00  ? 129 PRO A HD2  1 
ATOM   6970  H  HD3  . PRO B  1 129 ? -19.182 -69.380 -118.421 1.00 19.00  ? 129 PRO A HD3  1 
ATOM   6971  N  N    . MET B  1 130 ? -19.813 -64.336 -116.196 1.00 12.27  ? 130 MET A N    1 
ATOM   6972  C  CA   . MET B  1 130 ? -19.708 -62.894 -116.445 1.00 11.81  ? 130 MET A CA   1 
ATOM   6973  C  C    . MET B  1 130 ? -18.708 -62.265 -115.497 1.00 15.11  ? 130 MET A C    1 
ATOM   6974  O  O    . MET B  1 130 ? -18.606 -62.658 -114.336 1.00 11.61  ? 130 MET A O    1 
ATOM   6975  C  CB   . MET B  1 130 ? -21.068 -62.188 -116.297 1.00 13.92  ? 130 MET A CB   1 
ATOM   6976  C  CG   . MET B  1 130 ? -22.137 -62.657 -117.282 1.00 34.54  ? 130 MET A CG   1 
ATOM   6977  S  SD   . MET B  1 130 ? -23.590 -61.573 -117.349 1.00 32.53  ? 130 MET A SD   1 
ATOM   6978  C  CE   . MET B  1 130 ? -23.886 -61.323 -115.608 1.00 40.82  ? 130 MET A CE   1 
ATOM   6979  H  H    . MET B  1 130 ? -20.244 -64.536 -115.479 1.00 14.72  ? 130 MET A H    1 
ATOM   6980  H  HA   . MET B  1 130 ? -19.402 -62.758 -117.356 1.00 14.17  ? 130 MET A HA   1 
ATOM   6981  H  HB2  . MET B  1 130 ? -21.404 -62.347 -115.401 1.00 16.70  ? 130 MET A HB2  1 
ATOM   6982  H  HB3  . MET B  1 130 ? -20.940 -61.236 -116.433 1.00 16.70  ? 130 MET A HB3  1 
ATOM   6983  H  HG2  . MET B  1 130 ? -21.750 -62.691 -118.171 1.00 41.45  ? 130 MET A HG2  1 
ATOM   6984  H  HG3  . MET B  1 130 ? -22.438 -63.542 -117.020 1.00 41.45  ? 130 MET A HG3  1 
ATOM   6985  H  HE1  . MET B  1 130 ? -24.658 -60.745 -115.499 1.00 48.98  ? 130 MET A HE1  1 
ATOM   6986  H  HE2  . MET B  1 130 ? -24.055 -62.182 -115.190 1.00 48.98  ? 130 MET A HE2  1 
ATOM   6987  H  HE3  . MET B  1 130 ? -23.104 -60.909 -115.211 1.00 48.98  ? 130 MET A HE3  1 
ATOM   6988  N  N    . PHE B  1 131 ? -17.949 -61.303 -116.016 1.00 10.18  ? 131 PHE A N    1 
ATOM   6989  C  CA   . PHE B  1 131 ? -16.892 -60.636 -115.264 1.00 14.37  ? 131 PHE A CA   1 
ATOM   6990  C  C    . PHE B  1 131 ? -17.014 -59.148 -115.471 1.00 12.69  ? 131 PHE A C    1 
ATOM   6991  O  O    . PHE B  1 131 ? -17.407 -58.688 -116.554 1.00 15.60  ? 131 PHE A O    1 
ATOM   6992  C  CB   . PHE B  1 131 ? -15.511 -61.138 -115.688 1.00 14.30  ? 131 PHE A CB   1 
ATOM   6993  C  CG   . PHE B  1 131 ? -15.294 -62.571 -115.376 1.00 18.10  ? 131 PHE A CG   1 
ATOM   6994  C  CD1  . PHE B  1 131 ? -14.937 -62.969 -114.100 1.00 11.96  ? 131 PHE A CD1  1 
ATOM   6995  C  CD2  . PHE B  1 131 ? -15.499 -63.536 -116.339 1.00 10.01  ? 131 PHE A CD2  1 
ATOM   6996  C  CE1  . PHE B  1 131 ? -14.782 -64.303 -113.795 1.00 14.73  ? 131 PHE A CE1  1 
ATOM   6997  C  CE2  . PHE B  1 131 ? -15.342 -64.869 -116.033 1.00 10.19  ? 131 PHE A CE2  1 
ATOM   6998  C  CZ   . PHE B  1 131 ? -14.988 -65.254 -114.768 1.00 12.77  ? 131 PHE A CZ   1 
ATOM   6999  H  H    . PHE B  1 131 ? -18.031 -61.013 -116.822 1.00 12.21  ? 131 PHE A H    1 
ATOM   7000  H  HA   . PHE B  1 131 ? -17.006 -60.823 -114.319 1.00 17.25  ? 131 PHE A HA   1 
ATOM   7001  H  HB2  . PHE B  1 131 ? -15.415 -61.023 -116.647 1.00 17.16  ? 131 PHE A HB2  1 
ATOM   7002  H  HB3  . PHE B  1 131 ? -14.832 -60.624 -115.223 1.00 17.16  ? 131 PHE A HB3  1 
ATOM   7003  H  HD1  . PHE B  1 131 ? -14.810 -62.329 -113.437 1.00 14.35  ? 131 PHE A HD1  1 
ATOM   7004  H  HD2  . PHE B  1 131 ? -15.752 -63.286 -117.198 1.00 12.01  ? 131 PHE A HD2  1 
ATOM   7005  H  HE1  . PHE B  1 131 ? -14.534 -64.559 -112.936 1.00 17.67  ? 131 PHE A HE1  1 
ATOM   7006  H  HE2  . PHE B  1 131 ? -15.475 -65.513 -116.692 1.00 12.23  ? 131 PHE A HE2  1 
ATOM   7007  H  HZ   . PHE B  1 131 ? -14.868 -66.155 -114.571 1.00 15.32  ? 131 PHE A HZ   1 
ATOM   7008  N  N    . VAL B  1 132 ? -16.765 -58.409 -114.393 1.00 10.55  ? 132 VAL A N    1 
ATOM   7009  C  CA   . VAL B  1 132 ? -16.702 -56.956 -114.408 1.00 10.78  ? 132 VAL A CA   1 
ATOM   7010  C  C    . VAL B  1 132 ? -15.351 -56.557 -113.840 1.00 10.80  ? 132 VAL A C    1 
ATOM   7011  O  O    . VAL B  1 132 ? -15.019 -56.887 -112.697 1.00 12.11  ? 132 VAL A O    1 
ATOM   7012  C  CB   . VAL B  1 132 ? -17.831 -56.301 -113.582 1.00 11.42  ? 132 VAL A CB   1 
ATOM   7013  C  CG1  . VAL B  1 132 ? -17.580 -54.799 -113.376 1.00 11.78  ? 132 VAL A CG1  1 
ATOM   7014  C  CG2  . VAL B  1 132 ? -19.194 -56.523 -114.268 1.00 18.23  ? 132 VAL A CG2  1 
ATOM   7015  H  H    . VAL B  1 132 ? -16.625 -58.743 -113.613 1.00 12.66  ? 132 VAL A H    1 
ATOM   7016  H  HA   . VAL B  1 132 ? -16.761 -56.637 -115.322 1.00 12.94  ? 132 VAL A HA   1 
ATOM   7017  H  HB   . VAL B  1 132 ? -17.865 -56.720 -112.708 1.00 13.71  ? 132 VAL A HB   1 
ATOM   7018  H  HG11 . VAL B  1 132 ? -18.308 -54.426 -112.855 1.00 14.14  ? 132 VAL A HG11 1 
ATOM   7019  H  HG12 . VAL B  1 132 ? -16.741 -54.682 -112.904 1.00 14.14  ? 132 VAL A HG12 1 
ATOM   7020  H  HG13 . VAL B  1 132 ? -17.536 -54.365 -114.243 1.00 14.14  ? 132 VAL A HG13 1 
ATOM   7021  H  HG21 . VAL B  1 132 ? -19.887 -56.105 -113.734 1.00 21.88  ? 132 VAL A HG21 1 
ATOM   7022  H  HG22 . VAL B  1 132 ? -19.171 -56.125 -115.152 1.00 21.88  ? 132 VAL A HG22 1 
ATOM   7023  H  HG23 . VAL B  1 132 ? -19.359 -57.476 -114.338 1.00 21.88  ? 132 VAL A HG23 1 
ATOM   7024  N  N    . MET B  1 133 ? -14.568 -55.847 -114.634 1.00 10.88  ? 133 MET A N    1 
ATOM   7025  C  CA   . MET B  1 133 ? -13.274 -55.369 -114.177 1.00 10.76  ? 133 MET A CA   1 
ATOM   7026  C  C    . MET B  1 133 ? -13.435 -54.518 -112.918 1.00 13.15  ? 133 MET A C    1 
ATOM   7027  O  O    . MET B  1 133 ? -14.280 -53.623 -112.864 1.00 14.93  ? 133 MET A O    1 
ATOM   7028  C  CB   . MET B  1 133 ? -12.590 -54.553 -115.266 1.00 11.70  ? 133 MET A CB   1 
ATOM   7029  C  CG   . MET B  1 133 ? -12.134 -55.360 -116.457 1.00 16.22  ? 133 MET A CG   1 
ATOM   7030  S  SD   . MET B  1 133 ? -10.906 -56.642 -116.043 1.00 20.11  ? 133 MET A SD   1 
ATOM   7031  C  CE   . MET B  1 133 ? -9.553  -55.650 -115.437 1.00 24.89  ? 133 MET A CE   1 
ATOM   7032  H  H    . MET B  1 133 ? -14.761 -55.628 -115.443 1.00 13.05  ? 133 MET A H    1 
ATOM   7033  H  HA   . MET B  1 133 ? -12.709 -56.131 -113.973 1.00 12.92  ? 133 MET A HA   1 
ATOM   7034  H  HB2  . MET B  1 133 ? -13.211 -53.880 -115.587 1.00 14.04  ? 133 MET A HB2  1 
ATOM   7035  H  HB3  . MET B  1 133 ? -11.808 -54.122 -114.887 1.00 14.04  ? 133 MET A HB3  1 
ATOM   7036  H  HG2  . MET B  1 133 ? -12.904 -55.802 -116.848 1.00 19.47  ? 133 MET A HG2  1 
ATOM   7037  H  HG3  . MET B  1 133 ? -11.732 -54.762 -117.106 1.00 19.47  ? 133 MET A HG3  1 
ATOM   7038  H  HE1  . MET B  1 133 ? -8.823  -56.236 -115.180 1.00 29.86  ? 133 MET A HE1  1 
ATOM   7039  H  HE2  . MET B  1 133 ? -9.263  -55.049 -116.140 1.00 29.86  ? 133 MET A HE2  1 
ATOM   7040  H  HE3  . MET B  1 133 ? -9.855  -55.140 -114.669 1.00 29.86  ? 133 MET A HE3  1 
ATOM   7041  N  N    . GLY B  1 134 ? -12.621 -54.821 -111.916 1.00 13.30  ? 134 GLY A N    1 
ATOM   7042  C  CA   . GLY B  1 134 ? -12.596 -54.097 -110.663 1.00 13.87  ? 134 GLY A CA   1 
ATOM   7043  C  C    . GLY B  1 134 ? -13.485 -54.728 -109.611 1.00 14.03  ? 134 GLY A C    1 
ATOM   7044  O  O    . GLY B  1 134 ? -13.413 -54.361 -108.445 1.00 18.05  ? 134 GLY A O    1 
ATOM   7045  H  H    . GLY B  1 134 ? -12.053 -55.466 -111.945 1.00 15.96  ? 134 GLY A H    1 
ATOM   7046  H  HA2  . GLY B  1 134 ? -11.688 -54.073 -110.322 1.00 16.64  ? 134 GLY A HA2  1 
ATOM   7047  H  HA3  . GLY B  1 134 ? -12.893 -53.186 -110.810 1.00 16.64  ? 134 GLY A HA3  1 
ATOM   7048  N  N    . VAL B  1 135 ? -14.315 -55.682 -110.019 1.00 12.62  ? 135 VAL A N    1 
ATOM   7049  C  CA   . VAL B  1 135 ? -15.292 -56.276 -109.117 1.00 16.07  ? 135 VAL A CA   1 
ATOM   7050  C  C    . VAL B  1 135 ? -15.037 -57.772 -108.929 1.00 13.19  ? 135 VAL A C    1 
ATOM   7051  O  O    . VAL B  1 135 ? -14.847 -58.204 -107.811 1.00 13.50  ? 135 VAL A O    1 
ATOM   7052  C  CB   . VAL B  1 135 ? -16.727 -56.015 -109.626 1.00 13.01  ? 135 VAL A CB   1 
ATOM   7053  C  CG1  . VAL B  1 135 ? -17.779 -56.682 -108.754 1.00 15.19  ? 135 VAL A CG1  1 
ATOM   7054  C  CG2  . VAL B  1 135 ? -16.975 -54.508 -109.640 1.00 13.49  ? 135 VAL A CG2  1 
ATOM   7055  H  H    . VAL B  1 135 ? -14.332 -56.003 -110.816 1.00 15.14  ? 135 VAL A H    1 
ATOM   7056  H  HA   . VAL B  1 135 ? -15.208 -55.853 -108.248 1.00 19.28  ? 135 VAL A HA   1 
ATOM   7057  H  HB   . VAL B  1 135 ? -16.817 -56.352 -110.531 1.00 15.61  ? 135 VAL A HB   1 
ATOM   7058  H  HG11 . VAL B  1 135 ? -18.658 -56.488 -109.116 1.00 18.23  ? 135 VAL A HG11 1 
ATOM   7059  H  HG12 . VAL B  1 135 ? -17.626 -57.640 -108.753 1.00 18.23  ? 135 VAL A HG12 1 
ATOM   7060  H  HG13 . VAL B  1 135 ? -17.708 -56.334 -107.852 1.00 18.23  ? 135 VAL A HG13 1 
ATOM   7061  H  HG21 . VAL B  1 135 ? -17.876 -54.340 -109.960 1.00 16.19  ? 135 VAL A HG21 1 
ATOM   7062  H  HG22 . VAL B  1 135 ? -16.874 -54.163 -108.740 1.00 16.19  ? 135 VAL A HG22 1 
ATOM   7063  H  HG23 . VAL B  1 135 ? -16.331 -54.088 -110.231 1.00 16.19  ? 135 VAL A HG23 1 
ATOM   7064  N  N    . ASN B  1 136 ? -15.046 -58.562 -109.994 1.00 12.03  ? 136 ASN A N    1 
ATOM   7065  C  CA   . ASN B  1 136 ? -14.784 -59.987 -109.840 1.00 14.87  ? 136 ASN A CA   1 
ATOM   7066  C  C    . ASN B  1 136 ? -13.861 -60.560 -110.898 1.00 11.28  ? 136 ASN A C    1 
ATOM   7067  O  O    . ASN B  1 136 ? -13.799 -61.763 -111.064 1.00 11.11  ? 136 ASN A O    1 
ATOM   7068  C  CB   . ASN B  1 136 ? -16.096 -60.773 -109.865 1.00 13.03  ? 136 ASN A CB   1 
ATOM   7069  C  CG   . ASN B  1 136 ? -16.685 -60.862 -111.252 1.00 12.53  ? 136 ASN A CG   1 
ATOM   7070  O  OD1  . ASN B  1 136 ? -16.450 -59.992 -112.094 1.00 11.14  ? 136 ASN A OD1  1 
ATOM   7071  N  ND2  . ASN B  1 136 ? -17.448 -61.936 -111.511 1.00 14.05  ? 136 ASN A ND2  1 
ATOM   7072  H  H    . ASN B  1 136 ? -15.198 -58.306 -110.800 1.00 14.44  ? 136 ASN A H    1 
ATOM   7073  H  HA   . ASN B  1 136 ? -14.368 -60.134 -108.977 1.00 17.84  ? 136 ASN A HA   1 
ATOM   7074  H  HB2  . ASN B  1 136 ? -15.931 -61.675 -109.549 1.00 15.64  ? 136 ASN A HB2  1 
ATOM   7075  H  HB3  . ASN B  1 136 ? -16.741 -60.331 -109.291 1.00 15.64  ? 136 ASN A HB3  1 
ATOM   7076  H  HD21 . ASN B  1 136 ? -17.806 -62.033 -112.287 1.00 16.86  ? 136 ASN A HD21 1 
ATOM   7077  H  HD22 . ASN B  1 136 ? -17.578 -62.528 -110.901 1.00 16.86  ? 136 ASN A HD22 1 
ATOM   7078  N  N    . HIS B  1 137 ? -13.134 -59.719 -111.613 1.00 11.45  ? 137 HIS A N    1 
ATOM   7079  C  CA   . HIS B  1 137 ? -12.263 -60.231 -112.670 1.00 12.18  ? 137 HIS A CA   1 
ATOM   7080  C  C    . HIS B  1 137 ? -11.183 -61.158 -112.111 1.00 10.81  ? 137 HIS A C    1 
ATOM   7081  O  O    . HIS B  1 137 ? -10.684 -62.033 -112.822 1.00 10.56  ? 137 HIS A O    1 
ATOM   7082  C  CB   . HIS B  1 137 ? -11.640 -59.059 -113.468 1.00 14.28  ? 137 HIS A CB   1 
ATOM   7083  C  CG   . HIS B  1 137 ? -10.597 -58.284 -112.723 1.00 11.35  ? 137 HIS A CG   1 
ATOM   7084  N  ND1  . HIS B  1 137 ? -10.904 -57.268 -111.843 1.00 11.56  ? 137 HIS A ND1  1 
ATOM   7085  C  CD2  . HIS B  1 137 ? -9.246  -58.356 -112.754 1.00 17.53  ? 137 HIS A CD2  1 
ATOM   7086  C  CE1  . HIS B  1 137 ? -9.788  -56.758 -111.352 1.00 23.17  ? 137 HIS A CE1  1 
ATOM   7087  N  NE2  . HIS B  1 137 ? -8.767  -57.402 -111.886 1.00 18.08  ? 137 HIS A NE2  1 
ATOM   7088  H  H    . HIS B  1 137 ? -13.121 -58.865 -111.514 1.00 13.74  ? 137 HIS A H    1 
ATOM   7089  H  HA   . HIS B  1 137 ? -12.802 -60.750 -113.288 1.00 14.61  ? 137 HIS A HA   1 
ATOM   7090  H  HB2  . HIS B  1 137 ? -11.225 -59.415 -114.269 1.00 17.13  ? 137 HIS A HB2  1 
ATOM   7091  H  HB3  . HIS B  1 137 ? -12.346 -58.440 -113.713 1.00 17.13  ? 137 HIS A HB3  1 
ATOM   7092  H  HD2  . HIS B  1 137 ? -8.736  -58.948 -113.259 1.00 21.03  ? 137 HIS A HD2  1 
ATOM   7093  H  HE1  . HIS B  1 137 ? -9.732  -56.066 -110.733 1.00 27.81  ? 137 HIS A HE1  1 
ATOM   7094  N  N    . GLU B  1 138 ? -10.822 -61.008 -110.834 1.00 11.37  ? 138 GLU A N    1 
ATOM   7095  C  CA   . GLU B  1 138 ? -9.798  -61.899 -110.282 1.00 11.68  ? 138 GLU A CA   1 
ATOM   7096  C  C    . GLU B  1 138 ? -10.367 -63.308 -110.105 1.00 20.29  ? 138 GLU A C    1 
ATOM   7097  O  O    . GLU B  1 138 ? -9.624  -64.243 -109.851 1.00 15.08  ? 138 GLU A O    1 
ATOM   7098  C  CB   . GLU B  1 138 ? -9.240  -61.357 -108.964 1.00 12.50  ? 138 GLU A CB   1 
ATOM   7099  C  CG   . GLU B  1 138 ? -8.523  -60.009 -109.101 1.00 17.95  ? 138 GLU A CG   1 
ATOM   7100  C  CD   . GLU B  1 138 ? -7.215  -60.085 -109.889 1.00 31.00  ? 138 GLU A CD   1 
ATOM   7101  O  OE1  . GLU B  1 138 ? -6.638  -59.012 -110.195 1.00 32.81  ? 138 GLU A OE1  1 
ATOM   7102  O  OE2  . GLU B  1 138 ? -6.751  -61.202 -110.198 1.00 32.05  ? 138 GLU A OE2  1 
ATOM   7103  H  H    . GLU B  1 138 ? -11.139 -60.425 -110.287 1.00 13.64  ? 138 GLU A H    1 
ATOM   7104  H  HA   . GLU B  1 138 ? -9.063  -61.954 -110.913 1.00 14.01  ? 138 GLU A HA   1 
ATOM   7105  H  HB2  . GLU B  1 138 ? -9.973  -61.241 -108.339 1.00 15.00  ? 138 GLU A HB2  1 
ATOM   7106  H  HB3  . GLU B  1 138 ? -8.603  -61.996 -108.609 1.00 15.00  ? 138 GLU A HB3  1 
ATOM   7107  H  HG2  . GLU B  1 138 ? -9.110  -59.388 -109.560 1.00 21.54  ? 138 GLU A HG2  1 
ATOM   7108  H  HG3  . GLU B  1 138 ? -8.317  -59.673 -108.215 1.00 21.54  ? 138 GLU A HG3  1 
ATOM   7109  N  N    . LYS B  1 139 ? -11.678 -63.479 -110.279 1.00 11.89  ? 139 LYS A N    1 
ATOM   7110  C  CA   . LYS B  1 139 ? -12.261 -64.817 -110.247 1.00 12.22  ? 139 LYS A CA   1 
ATOM   7111  C  C    . LYS B  1 139 ? -12.082 -65.558 -111.572 1.00 14.09  ? 139 LYS A C    1 
ATOM   7112  O  O    . LYS B  1 139 ? -12.401 -66.737 -111.666 1.00 17.43  ? 139 LYS A O    1 
ATOM   7113  C  CB   . LYS B  1 139 ? -13.754 -64.760 -109.904 1.00 16.82  ? 139 LYS A CB   1 
ATOM   7114  C  CG   . LYS B  1 139 ? -14.054 -64.273 -108.502 1.00 22.75  ? 139 LYS A CG   1 
ATOM   7115  C  CD   . LYS B  1 139 ? -13.534 -65.244 -107.454 1.00 36.48  ? 139 LYS A CD   1 
ATOM   7116  C  CE   . LYS B  1 139 ? -13.904 -64.815 -106.044 1.00 50.30  ? 139 LYS A CE   1 
ATOM   7117  N  NZ   . LYS B  1 139 ? -13.225 -65.656 -105.008 1.00 57.85  ? 139 LYS A NZ   1 
ATOM   7118  H  H    . LYS B  1 139 ? -12.243 -62.846 -110.415 1.00 14.26  ? 139 LYS A H    1 
ATOM   7119  H  HA   . LYS B  1 139 ? -11.817 -65.334 -109.556 1.00 14.66  ? 139 LYS A HA   1 
ATOM   7120  H  HB2  . LYS B  1 139 ? -14.192 -64.157 -110.525 1.00 20.19  ? 139 LYS A HB2  1 
ATOM   7121  H  HB3  . LYS B  1 139 ? -14.127 -65.650 -109.994 1.00 20.19  ? 139 LYS A HB3  1 
ATOM   7122  H  HG2  . LYS B  1 139 ? -13.625 -63.415 -108.361 1.00 27.30  ? 139 LYS A HG2  1 
ATOM   7123  H  HG3  . LYS B  1 139 ? -15.014 -64.191 -108.390 1.00 27.30  ? 139 LYS A HG3  1 
ATOM   7124  H  HD2  . LYS B  1 139 ? -13.918 -66.121 -107.614 1.00 43.77  ? 139 LYS A HD2  1 
ATOM   7125  H  HD3  . LYS B  1 139 ? -12.567 -65.288 -107.513 1.00 43.77  ? 139 LYS A HD3  1 
ATOM   7126  H  HE2  . LYS B  1 139 ? -13.634 -63.893 -105.911 1.00 60.37  ? 139 LYS A HE2  1 
ATOM   7127  H  HE3  . LYS B  1 139 ? -14.863 -64.904 -105.926 1.00 60.37  ? 139 LYS A HE3  1 
ATOM   7128  H  HZ1  . LYS B  1 139 ? -13.459 -65.383 -104.194 1.00 69.42  ? 139 LYS A HZ1  1 
ATOM   7129  H  HZ2  . LYS B  1 139 ? -13.461 -66.509 -105.106 1.00 69.42  ? 139 LYS A HZ2  1 
ATOM   7130  H  HZ3  . LYS B  1 139 ? -12.342 -65.588 -105.093 1.00 69.42  ? 139 LYS A HZ3  1 
ATOM   7131  N  N    . TYR B  1 140 ? -11.572 -64.884 -112.595 1.00 10.61  ? 140 TYR A N    1 
ATOM   7132  C  CA   . TYR B  1 140 ? -11.321 -65.555 -113.868 1.00 10.31  ? 140 TYR A CA   1 
ATOM   7133  C  C    . TYR B  1 140 ? -10.183 -66.569 -113.695 1.00 13.67  ? 140 TYR A C    1 
ATOM   7134  O  O    . TYR B  1 140 ? -9.215  -66.307 -112.989 1.00 12.74  ? 140 TYR A O    1 
ATOM   7135  C  CB   . TYR B  1 140 ? -10.981 -64.536 -114.986 1.00 9.94   ? 140 TYR A CB   1 
ATOM   7136  C  CG   . TYR B  1 140 ? -10.434 -65.204 -116.218 1.00 9.78   ? 140 TYR A CG   1 
ATOM   7137  C  CD1  . TYR B  1 140 ? -11.282 -65.725 -117.181 1.00 11.60  ? 140 TYR A CD1  1 
ATOM   7138  C  CD2  . TYR B  1 140 ? -9.065  -65.384 -116.383 1.00 13.00  ? 140 TYR A CD2  1 
ATOM   7139  C  CE1  . TYR B  1 140 ? -10.775 -66.383 -118.296 1.00 9.56   ? 140 TYR A CE1  1 
ATOM   7140  C  CE2  . TYR B  1 140 ? -8.557  -66.042 -117.476 1.00 9.95   ? 140 TYR A CE2  1 
ATOM   7141  C  CZ   . TYR B  1 140 ? -9.428  -66.542 -118.423 1.00 11.64  ? 140 TYR A CZ   1 
ATOM   7142  O  OH   . TYR B  1 140 ? -8.940  -67.185 -119.512 1.00 12.33  ? 140 TYR A OH   1 
ATOM   7143  H  H    . TYR B  1 140 ? -11.365 -64.049 -112.582 1.00 12.73  ? 140 TYR A H    1 
ATOM   7144  H  HA   . TYR B  1 140 ? -12.118 -66.039 -114.134 1.00 12.38  ? 140 TYR A HA   1 
ATOM   7145  H  HB2  . TYR B  1 140 ? -11.787 -64.057 -115.235 1.00 11.93  ? 140 TYR A HB2  1 
ATOM   7146  H  HB3  . TYR B  1 140 ? -10.312 -63.915 -114.658 1.00 11.93  ? 140 TYR A HB3  1 
ATOM   7147  H  HD1  . TYR B  1 140 ? -12.201 -65.627 -117.084 1.00 13.92  ? 140 TYR A HD1  1 
ATOM   7148  H  HD2  . TYR B  1 140 ? -8.482  -65.058 -115.736 1.00 15.60  ? 140 TYR A HD2  1 
ATOM   7149  H  HE1  . TYR B  1 140 ? -11.351 -66.725 -118.941 1.00 11.47  ? 140 TYR A HE1  1 
ATOM   7150  H  HE2  . TYR B  1 140 ? -7.639  -66.148 -117.578 1.00 11.93  ? 140 TYR A HE2  1 
ATOM   7151  H  HH   . TYR B  1 140 ? -8.102  -67.218 -119.474 1.00 14.80  ? 140 TYR A HH   1 
ATOM   7152  N  N    . ASP B  1 141 ? -10.304 -67.739 -114.311 1.00 15.03  ? 141 ASP A N    1 
ATOM   7153  C  CA   . ASP B  1 141 ? -9.168  -68.651 -114.355 1.00 18.27  ? 141 ASP A CA   1 
ATOM   7154  C  C    . ASP B  1 141 ? -9.086  -69.333 -115.725 1.00 16.19  ? 141 ASP A C    1 
ATOM   7155  O  O    . ASP B  1 141 ? -10.033 -69.296 -116.507 1.00 10.58  ? 141 ASP A O    1 
ATOM   7156  C  CB   . ASP B  1 141 ? -9.246  -69.680 -113.218 1.00 24.55  ? 141 ASP A CB   1 
ATOM   7157  C  CG   . ASP B  1 141 ? -10.347 -70.699 -113.416 1.00 25.04  ? 141 ASP A CG   1 
ATOM   7158  O  OD1  . ASP B  1 141 ? -10.211 -71.571 -114.301 1.00 24.72  ? 141 ASP A OD1  1 
ATOM   7159  O  OD2  . ASP B  1 141 ? -11.338 -70.646 -112.669 1.00 36.13  ? 141 ASP A OD2  1 
ATOM   7160  H  H    . ASP B  1 141 ? -11.014 -68.023 -114.703 1.00 18.04  ? 141 ASP A H    1 
ATOM   7161  H  HA   . ASP B  1 141 ? -8.354  -68.139 -114.232 1.00 21.92  ? 141 ASP A HA   1 
ATOM   7162  H  HB2  . ASP B  1 141 ? -8.403  -70.157 -113.166 1.00 29.45  ? 141 ASP A HB2  1 
ATOM   7163  H  HB3  . ASP B  1 141 ? -9.415  -69.215 -112.384 1.00 29.45  ? 141 ASP A HB3  1 
ATOM   7164  N  N    . ASN B  1 142 ? -7.926  -69.924 -115.988 1.00 12.22  ? 142 ASN A N    1 
ATOM   7165  C  CA   . ASN B  1 142 ? -7.576  -70.537 -117.273 1.00 13.20  ? 142 ASN A CA   1 
ATOM   7166  C  C    . ASN B  1 142 ? -8.494  -71.636 -117.769 1.00 17.61  ? 142 ASN A C    1 
ATOM   7167  O  O    . ASN B  1 142 ? -8.410  -71.985 -118.931 1.00 15.90  ? 142 ASN A O    1 
ATOM   7168  C  CB   . ASN B  1 142 ? -6.156  -71.142 -117.208 1.00 19.56  ? 142 ASN A CB   1 
ATOM   7169  C  CG   . ASN B  1 142 ? -5.077  -70.093 -117.211 1.00 25.70  ? 142 ASN A CG   1 
ATOM   7170  O  OD1  . ASN B  1 142 ? -5.338  -68.916 -117.480 1.00 29.27  ? 142 ASN A OD1  1 
ATOM   7171  N  ND2  . ASN B  1 142 ? -3.851  -70.507 -116.903 1.00 22.49  ? 142 ASN A ND2  1 
ATOM   7172  H  H    . ASN B  1 142 ? -7.293  -69.987 -115.410 1.00 14.66  ? 142 ASN A H    1 
ATOM   7173  H  HA   . ASN B  1 142 ? -7.566  -69.841 -117.949 1.00 15.84  ? 142 ASN A HA   1 
ATOM   7174  H  HB2  . ASN B  1 142 ? -6.069  -71.659 -116.393 1.00 23.47  ? 142 ASN A HB2  1 
ATOM   7175  H  HB3  . ASN B  1 142 ? -6.020  -71.713 -117.980 1.00 23.47  ? 142 ASN A HB3  1 
ATOM   7176  H  HD21 . ASN B  1 142 ? -3.198  -69.946 -116.890 1.00 26.99  ? 142 ASN A HD21 1 
ATOM   7177  H  HD22 . ASN B  1 142 ? -3.710  -71.335 -116.717 1.00 26.99  ? 142 ASN A HD22 1 
ATOM   7178  N  N    . SER B  1 143 ? -9.320  -72.220 -116.905 1.00 16.87  ? 143 SER A N    1 
ATOM   7179  C  CA   . SER B  1 143 ? -10.239 -73.289 -117.344 1.00 17.91  ? 143 SER A CA   1 
ATOM   7180  C  C    . SER B  1 143 ? -11.444 -72.730 -118.120 1.00 16.67  ? 143 SER A C    1 
ATOM   7181  O  O    . SER B  1 143 ? -12.221 -73.483 -118.697 1.00 13.69  ? 143 SER A O    1 
ATOM   7182  C  CB   . SER B  1 143 ? -10.743 -74.087 -116.150 1.00 13.55  ? 143 SER A CB   1 
ATOM   7183  O  OG   . SER B  1 143 ? -11.655 -73.297 -115.388 1.00 18.97  ? 143 SER A OG   1 
ATOM   7184  H  H    . SER B  1 143 ? -9.373  -72.026 -116.069 1.00 20.24  ? 143 SER A H    1 
ATOM   7185  H  HA   . SER B  1 143 ? -9.760  -73.895 -117.931 1.00 21.49  ? 143 SER A HA   1 
ATOM   7186  H  HB2  . SER B  1 143 ? -11.199 -74.883 -116.468 1.00 16.26  ? 143 SER A HB2  1 
ATOM   7187  H  HB3  . SER B  1 143 ? -9.990  -74.334 -115.591 1.00 16.26  ? 143 SER A HB3  1 
ATOM   7188  H  HG   . SER B  1 143 ? -11.271 -72.604 -115.111 1.00 22.76  ? 143 SER A HG   1 
ATOM   7189  N  N    . LEU B  1 144 ? -11.603 -71.414 -118.122 1.00 11.68  ? 144 LEU A N    1 
ATOM   7190  C  CA   . LEU B  1 144 ? -12.776 -70.782 -118.751 1.00 14.19  ? 144 LEU A CA   1 
ATOM   7191  C  C    . LEU B  1 144 ? -12.428 -70.272 -120.132 1.00 14.19  ? 144 LEU A C    1 
ATOM   7192  O  O    . LEU B  1 144 ? -11.702 -69.287 -120.272 1.00 11.94  ? 144 LEU A O    1 
ATOM   7193  C  CB   . LEU B  1 144 ? -13.303 -69.636 -117.883 1.00 13.76  ? 144 LEU A CB   1 
ATOM   7194  C  CG   . LEU B  1 144 ? -13.559 -69.957 -116.403 1.00 13.35  ? 144 LEU A CG   1 
ATOM   7195  C  CD1  . LEU B  1 144 ? -14.034 -68.721 -115.680 1.00 15.98  ? 144 LEU A CD1  1 
ATOM   7196  C  CD2  . LEU B  1 144 ? -14.559 -71.087 -116.230 1.00 16.76  ? 144 LEU A CD2  1 
ATOM   7197  H  H    . LEU B  1 144 ? -11.052 -70.857 -117.768 1.00 14.02  ? 144 LEU A H    1 
ATOM   7198  H  HA   . LEU B  1 144 ? -13.482 -71.442 -118.841 1.00 17.03  ? 144 LEU A HA   1 
ATOM   7199  H  HB2  . LEU B  1 144 ? -12.657 -68.913 -117.913 1.00 16.51  ? 144 LEU A HB2  1 
ATOM   7200  H  HB3  . LEU B  1 144 ? -14.142 -69.331 -118.261 1.00 16.51  ? 144 LEU A HB3  1 
ATOM   7201  H  HG   . LEU B  1 144 ? -12.725 -70.235 -115.995 1.00 16.02  ? 144 LEU A HG   1 
ATOM   7202  H  HD11 . LEU B  1 144 ? -14.191 -68.942 -114.749 1.00 19.17  ? 144 LEU A HD11 1 
ATOM   7203  H  HD12 . LEU B  1 144 ? -13.352 -68.035 -115.748 1.00 19.17  ? 144 LEU A HD12 1 
ATOM   7204  H  HD13 . LEU B  1 144 ? -14.857 -68.412 -116.091 1.00 19.17  ? 144 LEU A HD13 1 
ATOM   7205  H  HD21 . LEU B  1 144 ? -14.687 -71.252 -115.283 1.00 20.12  ? 144 LEU A HD21 1 
ATOM   7206  H  HD22 . LEU B  1 144 ? -15.400 -70.829 -116.639 1.00 20.12  ? 144 LEU A HD22 1 
ATOM   7207  H  HD23 . LEU B  1 144 ? -14.211 -71.884 -116.661 1.00 20.12  ? 144 LEU A HD23 1 
ATOM   7208  N  N    . LYS B  1 145 ? -12.930 -70.944 -121.158 1.00 10.65  ? 145 LYS A N    1 
ATOM   7209  C  CA   . LYS B  1 145 ? -12.567 -70.594 -122.513 1.00 10.52  ? 145 LYS A CA   1 
ATOM   7210  C  C    . LYS B  1 145 ? -13.563 -69.632 -123.153 1.00 10.22  ? 145 LYS A C    1 
ATOM   7211  O  O    . LYS B  1 145 ? -13.233 -68.955 -124.123 1.00 9.99   ? 145 LYS A O    1 
ATOM   7212  C  CB   . LYS B  1 145 ? -12.406 -71.870 -123.330 1.00 13.30  ? 145 LYS A CB   1 
ATOM   7213  C  CG   . LYS B  1 145 ? -11.444 -72.856 -122.604 1.00 23.01  ? 145 LYS A CG   1 
ATOM   7214  C  CD   . LYS B  1 145 ? -10.273 -73.301 -123.421 1.00 46.10  ? 145 LYS A CD   1 
ATOM   7215  C  CE   . LYS B  1 145 ? -10.625 -74.469 -124.329 1.00 52.15  ? 145 LYS A CE   1 
ATOM   7216  N  NZ   . LYS B  1 145 ? -9.443  -75.196 -124.840 1.00 38.99  ? 145 LYS A NZ   1 
ATOM   7217  H  H    . LYS B  1 145 ? -13.478 -71.603 -121.093 1.00 12.78  ? 145 LYS A H    1 
ATOM   7218  H  HA   . LYS B  1 145 ? -11.705 -70.150 -122.495 1.00 12.63  ? 145 LYS A HA   1 
ATOM   7219  H  HB2  . LYS B  1 145 ? -13.269 -72.301 -123.432 1.00 15.96  ? 145 LYS A HB2  1 
ATOM   7220  H  HB3  . LYS B  1 145 ? -12.029 -71.655 -124.198 1.00 15.96  ? 145 LYS A HB3  1 
ATOM   7221  H  HG2  . LYS B  1 145 ? -11.099 -72.422 -121.808 1.00 27.61  ? 145 LYS A HG2  1 
ATOM   7222  H  HG3  . LYS B  1 145 ? -11.944 -73.648 -122.352 1.00 27.61  ? 145 LYS A HG3  1 
ATOM   7223  H  HD2  . LYS B  1 145 ? -9.974  -72.564 -123.977 1.00 55.32  ? 145 LYS A HD2  1 
ATOM   7224  H  HD3  . LYS B  1 145 ? -9.559  -73.583 -122.828 1.00 55.32  ? 145 LYS A HD3  1 
ATOM   7225  H  HE2  . LYS B  1 145 ? -11.170 -75.099 -123.833 1.00 62.58  ? 145 LYS A HE2  1 
ATOM   7226  H  HE3  . LYS B  1 145 ? -11.121 -74.134 -125.093 1.00 62.58  ? 145 LYS A HE3  1 
ATOM   7227  H  HZ1  . LYS B  1 145 ? -8.971  -75.525 -124.161 1.00 46.79  ? 145 LYS A HZ1  1 
ATOM   7228  H  HZ2  . LYS B  1 145 ? -9.701  -75.867 -125.364 1.00 46.79  ? 145 LYS A HZ2  1 
ATOM   7229  H  HZ3  . LYS B  1 145 ? -8.926  -74.644 -125.311 1.00 46.79  ? 145 LYS A HZ3  1 
ATOM   7230  N  N    . ILE B  1 146 ? -14.773 -69.554 -122.603 1.00 11.79  ? 146 ILE A N    1 
ATOM   7231  C  CA   . ILE B  1 146 ? -15.797 -68.630 -123.131 1.00 10.17  ? 146 ILE A CA   1 
ATOM   7232  C  C    . ILE B  1 146 ? -16.367 -67.834 -121.964 1.00 11.41  ? 146 ILE A C    1 
ATOM   7233  O  O    . ILE B  1 146 ? -16.921 -68.411 -121.033 1.00 10.33  ? 146 ILE A O    1 
ATOM   7234  C  CB   . ILE B  1 146 ? -16.908 -69.390 -123.863 1.00 10.73  ? 146 ILE A CB   1 
ATOM   7235  C  CG1  . ILE B  1 146 ? -16.311 -70.226 -124.993 1.00 24.30  ? 146 ILE A CG1  1 
ATOM   7236  C  CG2  . ILE B  1 146 ? -17.996 -68.415 -124.406 1.00 11.23  ? 146 ILE A CG2  1 
ATOM   7237  C  CD1  . ILE B  1 146 ? -17.255 -71.203 -125.561 1.00 24.73  ? 146 ILE A CD1  1 
ATOM   7238  H  H    . ILE B  1 146 ? -15.031 -70.018 -121.927 1.00 14.15  ? 146 ILE A H    1 
ATOM   7239  H  HA   . ILE B  1 146 ? -15.385 -68.011 -123.755 1.00 12.20  ? 146 ILE A HA   1 
ATOM   7240  H  HB   . ILE B  1 146 ? -17.330 -69.992 -123.230 1.00 12.87  ? 146 ILE A HB   1 
ATOM   7241  H  HG12 . ILE B  1 146 ? -16.030 -69.633 -125.707 1.00 29.17  ? 146 ILE A HG12 1 
ATOM   7242  H  HG13 . ILE B  1 146 ? -15.547 -70.715 -124.651 1.00 29.17  ? 146 ILE A HG13 1 
ATOM   7243  H  HG21 . ILE B  1 146 ? -18.681 -68.929 -124.862 1.00 13.47  ? 146 ILE A HG21 1 
ATOM   7244  H  HG22 . ILE B  1 146 ? -18.386 -67.930 -123.662 1.00 13.47  ? 146 ILE A HG22 1 
ATOM   7245  H  HG23 . ILE B  1 146 ? -17.582 -67.793 -125.026 1.00 13.47  ? 146 ILE A HG23 1 
ATOM   7246  H  HD11 . ILE B  1 146 ? -16.811 -71.695 -126.269 1.00 29.68  ? 146 ILE A HD11 1 
ATOM   7247  H  HD12 . ILE B  1 146 ? -17.539 -71.812 -124.861 1.00 29.68  ? 146 ILE A HD12 1 
ATOM   7248  H  HD13 . ILE B  1 146 ? -18.023 -70.729 -125.918 1.00 29.68  ? 146 ILE A HD13 1 
ATOM   7249  N  N    . ILE B  1 147 ? -16.217 -66.521 -121.991 1.00 9.61   ? 147 ILE A N    1 
ATOM   7250  C  CA   . ILE B  1 147 ? -16.714 -65.703 -120.894 1.00 9.57   ? 147 ILE A CA   1 
ATOM   7251  C  C    . ILE B  1 147 ? -17.465 -64.482 -121.426 1.00 10.01  ? 147 ILE A C    1 
ATOM   7252  O  O    . ILE B  1 147 ? -17.465 -64.215 -122.624 1.00 9.37   ? 147 ILE A O    1 
ATOM   7253  C  CB   . ILE B  1 147 ? -15.566 -65.249 -119.966 1.00 9.69   ? 147 ILE A CB   1 
ATOM   7254  C  CG1  . ILE B  1 147 ? -14.623 -64.274 -120.688 1.00 14.45  ? 147 ILE A CG1  1 
ATOM   7255  C  CG2  . ILE B  1 147 ? -14.782 -66.460 -119.414 1.00 10.69  ? 147 ILE A CG2  1 
ATOM   7256  C  CD1  . ILE B  1 147 ? -13.581 -63.689 -119.789 1.00 19.33  ? 147 ILE A CD1  1 
ATOM   7257  H  H    . ILE B  1 147 ? -15.837 -66.081 -122.625 1.00 11.53  ? 147 ILE A H    1 
ATOM   7258  H  HA   . ILE B  1 147 ? -17.334 -66.228 -120.366 1.00 11.49  ? 147 ILE A HA   1 
ATOM   7259  H  HB   . ILE B  1 147 ? -15.960 -64.780 -119.214 1.00 11.62  ? 147 ILE A HB   1 
ATOM   7260  H  HG12 . ILE B  1 147 ? -14.169 -64.746 -121.404 1.00 17.34  ? 147 ILE A HG12 1 
ATOM   7261  H  HG13 . ILE B  1 147 ? -15.146 -63.543 -121.054 1.00 17.34  ? 147 ILE A HG13 1 
ATOM   7262  H  HG21 . ILE B  1 147 ? -14.071 -66.139 -118.837 1.00 12.83  ? 147 ILE A HG21 1 
ATOM   7263  H  HG22 . ILE B  1 147 ? -15.388 -67.025 -118.909 1.00 12.83  ? 147 ILE A HG22 1 
ATOM   7264  H  HG23 . ILE B  1 147 ? -14.406 -66.958 -120.157 1.00 12.83  ? 147 ILE A HG23 1 
ATOM   7265  H  HD11 . ILE B  1 147 ? -13.022 -63.086 -120.304 1.00 23.20  ? 147 ILE A HD11 1 
ATOM   7266  H  HD12 . ILE B  1 147 ? -14.019 -63.204 -119.072 1.00 23.20  ? 147 ILE A HD12 1 
ATOM   7267  H  HD13 . ILE B  1 147 ? -13.042 -64.407 -119.422 1.00 23.20  ? 147 ILE A HD13 1 
ATOM   7268  N  N    . SER B  1 148 ? -18.101 -63.756 -120.509 1.00 12.10  ? 148 SER A N    1 
ATOM   7269  C  CA   . SER B  1 148 ? -18.853 -62.551 -120.832 1.00 9.66   ? 148 SER A CA   1 
ATOM   7270  C  C    . SER B  1 148 ? -18.326 -61.389 -120.022 1.00 9.49   ? 148 SER A C    1 
ATOM   7271  O  O    . SER B  1 148 ? -17.940 -61.553 -118.853 1.00 9.88   ? 148 SER A O    1 
ATOM   7272  C  CB   . SER B  1 148 ? -20.349 -62.766 -120.557 1.00 12.17  ? 148 SER A CB   1 
ATOM   7273  O  OG   . SER B  1 148 ? -21.045 -61.529 -120.367 1.00 14.08  ? 148 SER A OG   1 
ATOM   7274  H  H    . SER B  1 148 ? -18.109 -63.948 -119.671 1.00 14.52  ? 148 SER A H    1 
ATOM   7275  H  HA   . SER B  1 148 ? -18.742 -62.344 -121.773 1.00 11.60  ? 148 SER A HA   1 
ATOM   7276  H  HB2  . SER B  1 148 ? -20.742 -63.232 -121.312 1.00 14.61  ? 148 SER A HB2  1 
ATOM   7277  H  HB3  . SER B  1 148 ? -20.445 -63.304 -119.755 1.00 14.61  ? 148 SER A HB3  1 
ATOM   7278  H  HG   . SER B  1 148 ? -20.975 -61.052 -121.054 1.00 16.90  ? 148 SER A HG   1 
ATOM   7279  N  N    . ASN B  1 149 ? -18.308 -60.214 -120.650 1.00 9.55   ? 149 ASN A N    1 
ATOM   7280  C  CA   . ASN B  1 149 ? -17.972 -58.966 -119.980 1.00 9.34   ? 149 ASN A CA   1 
ATOM   7281  C  C    . ASN B  1 149 ? -19.193 -58.196 -119.451 1.00 9.86   ? 149 ASN A C    1 
ATOM   7282  O  O    . ASN B  1 149 ? -19.090 -57.010 -119.141 1.00 10.86  ? 149 ASN A O    1 
ATOM   7283  C  CB   . ASN B  1 149 ? -17.209 -58.060 -120.932 1.00 11.27  ? 149 ASN A CB   1 
ATOM   7284  C  CG   . ASN B  1 149 ? -16.486 -56.945 -120.198 1.00 23.71  ? 149 ASN A CG   1 
ATOM   7285  O  OD1  . ASN B  1 149 ? -15.807 -57.190 -119.204 1.00 19.04  ? 149 ASN A OD1  1 
ATOM   7286  N  ND2  . ASN B  1 149 ? -16.667 -55.712 -120.656 1.00 21.20  ? 149 ASN A ND2  1 
ATOM   7287  H  H    . ASN B  1 149 ? -18.492 -60.116 -121.485 1.00 11.46  ? 149 ASN A H    1 
ATOM   7288  H  HA   . ASN B  1 149 ? -17.394 -59.161 -119.226 1.00 11.21  ? 149 ASN A HA   1 
ATOM   7289  H  HB2  . ASN B  1 149 ? -16.549 -58.584 -121.410 1.00 13.53  ? 149 ASN A HB2  1 
ATOM   7290  H  HB3  . ASN B  1 149 ? -17.832 -57.656 -121.556 1.00 13.53  ? 149 ASN A HB3  1 
ATOM   7291  H  HD21 . ASN B  1 149 ? -16.277 -55.049 -120.271 1.00 25.44  ? 149 ASN A HD21 1 
ATOM   7292  H  HD22 . ASN B  1 149 ? -17.174 -55.577 -121.337 1.00 25.44  ? 149 ASN A HD22 1 
ATOM   7293  N  N    . ALA B  1 150 ? -20.329 -58.881 -119.371 1.00 11.37  ? 150 ALA A N    1 
ATOM   7294  C  CA   . ALA B  1 150 ? -21.615 -58.326 -118.933 1.00 15.00  ? 150 ALA A CA   1 
ATOM   7295  C  C    . ALA B  1 150 ? -22.088 -57.185 -119.838 1.00 11.19  ? 150 ALA A C    1 
ATOM   7296  O  O    . ALA B  1 150 ? -21.740 -57.130 -121.007 1.00 16.15  ? 150 ALA A O    1 
ATOM   7297  C  CB   . ALA B  1 150 ? -21.527 -57.868 -117.480 1.00 17.47  ? 150 ALA A CB   1 
ATOM   7298  H  H    . ALA B  1 150 ? -20.385 -59.715 -119.576 1.00 13.64  ? 150 ALA A H    1 
ATOM   7299  H  HA   . ALA B  1 150 ? -22.283 -59.028 -118.977 1.00 18.00  ? 150 ALA A HA   1 
ATOM   7300  H  HB1  . ALA B  1 150 ? -22.386 -57.506 -117.211 1.00 20.96  ? 150 ALA A HB1  1 
ATOM   7301  H  HB2  . ALA B  1 150 ? -21.300 -58.629 -116.923 1.00 20.96  ? 150 ALA A HB2  1 
ATOM   7302  H  HB3  . ALA B  1 150 ? -20.842 -57.187 -117.405 1.00 20.96  ? 150 ALA A HB3  1 
ATOM   7303  N  N    . SER B  1 151 ? -22.931 -56.307 -119.320 1.00 14.62  ? 151 SER A N    1 
ATOM   7304  C  CA   . SER B  1 151 ? -23.421 -55.178 -120.099 1.00 17.12  ? 151 SER A CA   1 
ATOM   7305  C  C    . SER B  1 151 ? -22.804 -53.877 -119.647 1.00 13.84  ? 151 SER A C    1 
ATOM   7306  O  O    . SER B  1 151 ? -22.267 -53.798 -118.548 1.00 11.94  ? 151 SER A O    1 
ATOM   7307  C  CB   . SER B  1 151 ? -24.925 -55.052 -119.963 1.00 16.31  ? 151 SER A CB   1 
ATOM   7308  O  OG   . SER B  1 151 ? -25.250 -54.679 -118.626 1.00 18.47  ? 151 SER A OG   1 
ATOM   7309  H  H    . SER B  1 151 ? -23.237 -56.341 -118.517 1.00 17.54  ? 151 SER A H    1 
ATOM   7310  H  HA   . SER B  1 151 ? -23.206 -55.312 -121.035 1.00 20.54  ? 151 SER A HA   1 
ATOM   7311  H  HB2  . SER B  1 151 ? -25.246 -54.370 -120.573 1.00 19.57  ? 151 SER A HB2  1 
ATOM   7312  H  HB3  . SER B  1 151 ? -25.338 -55.906 -120.166 1.00 19.57  ? 151 SER A HB3  1 
ATOM   7313  H  HG   . SER B  1 151 ? -26.082 -54.608 -118.542 1.00 22.17  ? 151 SER A HG   1 
ATOM   7314  N  N    . CYS B  1 152 ? -22.925 -52.848 -120.484 1.00 12.92  ? 152 CYS A N    1 
ATOM   7315  C  CA   A CYS B  1 152 ? -22.487 -51.507 -120.103 0.62 12.27  ? 152 CYS A CA   1 
ATOM   7316  C  CA   B CYS B  1 152 ? -22.509 -51.496 -120.114 0.38 13.61  ? 152 CYS A CA   1 
ATOM   7317  C  C    . CYS B  1 152 ? -23.132 -51.070 -118.787 1.00 12.80  ? 152 CYS A C    1 
ATOM   7318  O  O    . CYS B  1 152 ? -22.453 -50.525 -117.906 1.00 11.54  ? 152 CYS A O    1 
ATOM   7319  C  CB   A CYS B  1 152 ? -22.786 -50.498 -121.216 0.62 15.08  ? 152 CYS A CB   1 
ATOM   7320  C  CB   B CYS B  1 152 ? -22.893 -50.486 -121.221 0.38 18.02  ? 152 CYS A CB   1 
ATOM   7321  S  SG   A CYS B  1 152 ? -24.287 -50.839 -122.160 0.62 14.72  ? 152 CYS A SG   1 
ATOM   7322  S  SG   B CYS B  1 152 ? -24.718 -50.170 -121.513 0.38 14.65  ? 152 CYS A SG   1 
ATOM   7323  H  H    . CYS B  1 152 ? -23.252 -52.903 -121.277 1.00 15.51  ? 152 CYS A H    1 
ATOM   7324  H  HA   . CYS B  1 152 ? -21.535 -51.499 -119.991 0.62 16.34  ? 152 CYS A HA   1 
ATOM   7325  H  HB2  A CYS B  1 152 ? -22.882 -49.619 -120.819 0.62 18.10  ? 152 CYS A HB2  1 
ATOM   7326  H  HB2  B CYS B  1 152 ? -22.488 -49.632 -121.001 0.38 21.62  ? 152 CYS A HB2  1 
ATOM   7327  H  HB3  A CYS B  1 152 ? -22.042 -50.495 -121.839 0.62 18.10  ? 152 CYS A HB3  1 
ATOM   7328  H  HB3  B CYS B  1 152 ? -22.523 -50.806 -122.059 0.38 21.62  ? 152 CYS A HB3  1 
ATOM   7329  H  HG   A CYS B  1 152 ? -24.422 -49.991 -122.999 0.62 17.66  ? 152 CYS A HG   1 
ATOM   7330  H  HG   B CYS B  1 152 ? -24.839 -49.369 -122.398 0.38 17.58  ? 152 CYS A HG   1 
ATOM   7331  N  N    . THR B  1 153 ? -24.429 -51.338 -118.625 1.00 13.12  ? 153 THR A N    1 
ATOM   7332  C  CA   . THR B  1 153 ? -25.131 -50.901 -117.426 1.00 12.61  ? 153 THR A CA   1 
ATOM   7333  C  C    . THR B  1 153 ? -24.620 -51.652 -116.198 1.00 11.05  ? 153 THR A C    1 
ATOM   7334  O  O    . THR B  1 153 ? -24.390 -51.051 -115.152 1.00 10.85  ? 153 THR A O    1 
ATOM   7335  C  CB   . THR B  1 153 ? -26.659 -51.075 -117.577 1.00 14.31  ? 153 THR A CB   1 
ATOM   7336  O  OG1  . THR B  1 153 ? -27.108 -50.271 -118.678 1.00 12.74  ? 153 THR A OG1  1 
ATOM   7337  C  CG2  . THR B  1 153 ? -27.381 -50.641 -116.305 1.00 14.40  ? 153 THR A CG2  1 
ATOM   7338  H  H    . THR B  1 153 ? -24.916 -51.765 -119.190 1.00 15.74  ? 153 THR A H    1 
ATOM   7339  H  HA   . THR B  1 153 ? -24.954 -49.957 -117.289 1.00 15.13  ? 153 THR A HA   1 
ATOM   7340  H  HB   . THR B  1 153 ? -26.866 -52.007 -117.748 1.00 17.18  ? 153 THR A HB   1 
ATOM   7341  H  HG1  . THR B  1 153 ? -26.930 -49.462 -118.535 1.00 15.29  ? 153 THR A HG1  1 
ATOM   7342  H  HG21 . THR B  1 153 ? -28.339 -50.755 -116.413 1.00 17.28  ? 153 THR A HG21 1 
ATOM   7343  H  HG22 . THR B  1 153 ? -27.082 -51.177 -115.555 1.00 17.28  ? 153 THR A HG22 1 
ATOM   7344  H  HG23 . THR B  1 153 ? -27.194 -49.707 -116.120 1.00 17.28  ? 153 THR A HG23 1 
ATOM   7345  N  N    . THR B  1 154 ? -24.379 -52.953 -116.331 1.00 11.89  ? 154 THR A N    1 
ATOM   7346  C  CA   . THR B  1 154 ? -23.835 -53.730 -115.212 1.00 12.14  ? 154 THR A CA   1 
ATOM   7347  C  C    . THR B  1 154 ? -22.414 -53.261 -114.837 1.00 12.33  ? 154 THR A C    1 
ATOM   7348  O  O    . THR B  1 154 ? -22.068 -53.222 -113.670 1.00 12.37  ? 154 THR A O    1 
ATOM   7349  C  CB   . THR B  1 154 ? -23.810 -55.240 -115.538 1.00 13.00  ? 154 THR A CB   1 
ATOM   7350  O  OG1  . THR B  1 154 ? -25.140 -55.690 -115.790 1.00 15.84  ? 154 THR A OG1  1 
ATOM   7351  C  CG2  . THR B  1 154 ? -23.219 -56.067 -114.378 1.00 13.57  ? 154 THR A CG2  1 
ATOM   7352  H  H    . THR B  1 154 ? -24.519 -53.408 -117.047 1.00 14.27  ? 154 THR A H    1 
ATOM   7353  H  HA   . THR B  1 154 ? -24.404 -53.602 -114.437 1.00 14.57  ? 154 THR A HA   1 
ATOM   7354  H  HB   . THR B  1 154 ? -23.266 -55.390 -116.328 1.00 15.60  ? 154 THR A HB   1 
ATOM   7355  H  HG1  . THR B  1 154 ? -25.620 -55.561 -115.113 1.00 19.01  ? 154 THR A HG1  1 
ATOM   7356  H  HG21 . THR B  1 154 ? -23.216 -57.008 -114.610 1.00 16.29  ? 154 THR A HG21 1 
ATOM   7357  H  HG22 . THR B  1 154 ? -22.309 -55.783 -114.200 1.00 16.29  ? 154 THR A HG22 1 
ATOM   7358  H  HG23 . THR B  1 154 ? -23.751 -55.941 -113.577 1.00 16.29  ? 154 THR A HG23 1 
ATOM   7359  N  N    . ASN B  1 155 ? -21.602 -52.890 -115.823 1.00 12.54  ? 155 ASN A N    1 
ATOM   7360  C  CA   . ASN B  1 155 ? -20.277 -52.343 -115.524 1.00 12.84  ? 155 ASN A CA   1 
ATOM   7361  C  C    . ASN B  1 155 ? -20.332 -50.974 -114.841 1.00 12.26  ? 155 ASN A C    1 
ATOM   7362  O  O    . ASN B  1 155 ? -19.374 -50.570 -114.177 1.00 12.67  ? 155 ASN A O    1 
ATOM   7363  C  CB   . ASN B  1 155 ? -19.450 -52.229 -116.796 1.00 13.37  ? 155 ASN A CB   1 
ATOM   7364  C  CG   . ASN B  1 155 ? -18.739 -53.500 -117.120 1.00 18.16  ? 155 ASN A CG   1 
ATOM   7365  O  OD1  . ASN B  1 155 ? -17.581 -53.690 -116.739 1.00 15.68  ? 155 ASN A OD1  1 
ATOM   7366  N  ND2  . ASN B  1 155 ? -19.439 -54.411 -117.786 1.00 16.37  ? 155 ASN A ND2  1 
ATOM   7367  H  H    . ASN B  1 155 ? -21.788 -52.942 -116.661 1.00 15.05  ? 155 ASN A H    1 
ATOM   7368  H  HA   . ASN B  1 155 ? -19.817 -52.953 -114.926 1.00 15.40  ? 155 ASN A HA   1 
ATOM   7369  H  HB2  . ASN B  1 155 ? -20.037 -52.013 -117.538 1.00 16.05  ? 155 ASN A HB2  1 
ATOM   7370  H  HB3  . ASN B  1 155 ? -18.786 -51.532 -116.682 1.00 16.05  ? 155 ASN A HB3  1 
ATOM   7371  H  HD21 . ASN B  1 155 ? -19.076 -55.161 -117.998 1.00 19.64  ? 155 ASN A HD21 1 
ATOM   7372  H  HD22 . ASN B  1 155 ? -20.255 -54.250 -118.006 1.00 19.64  ? 155 ASN A HD22 1 
ATOM   7373  N  N    . CYS B  1 156 ? -21.432 -50.252 -115.012 1.00 11.59  ? 156 CYS A N    1 
ATOM   7374  C  CA   . CYS B  1 156 ? -21.593 -48.981 -114.300 1.00 11.63  ? 156 CYS A CA   1 
ATOM   7375  C  C    . CYS B  1 156 ? -22.051 -49.208 -112.861 1.00 13.84  ? 156 CYS A C    1 
ATOM   7376  O  O    . CYS B  1 156 ? -21.528 -48.617 -111.910 1.00 14.68  ? 156 CYS A O    1 
ATOM   7377  C  CB   . CYS B  1 156 ? -22.596 -48.080 -114.999 1.00 12.25  ? 156 CYS A CB   1 
ATOM   7378  S  SG   . CYS B  1 156 ? -22.895 -46.534 -114.074 1.00 17.29  ? 156 CYS A SG   1 
ATOM   7379  H  H    . CYS B  1 156 ? -22.090 -50.466 -115.523 1.00 13.91  ? 156 CYS A H    1 
ATOM   7380  H  HA   . CYS B  1 156 ? -20.740 -48.521 -114.276 1.00 13.95  ? 156 CYS A HA   1 
ATOM   7381  H  HB2  . CYS B  1 156 ? -22.254 -47.846 -115.877 1.00 14.70  ? 156 CYS A HB2  1 
ATOM   7382  H  HB3  . CYS B  1 156 ? -23.440 -48.550 -115.084 1.00 14.70  ? 156 CYS A HB3  1 
ATOM   7383  H  HG   . CYS B  1 156 ? -23.692 -45.868 -114.674 1.00 20.75  ? 156 CYS A HG   1 
ATOM   7384  N  N    . LEU B  1 157 ? -23.040 -50.071 -112.703 1.00 10.95  ? 157 LEU A N    1 
ATOM   7385  C  CA   . LEU B  1 157 ? -23.639 -50.286 -111.405 1.00 10.93  ? 157 LEU A CA   1 
ATOM   7386  C  C    . LEU B  1 157 ? -22.759 -51.101 -110.445 1.00 11.47  ? 157 LEU A C    1 
ATOM   7387  O  O    . LEU B  1 157 ? -22.712 -50.817 -109.250 1.00 14.27  ? 157 LEU A O    1 
ATOM   7388  C  CB   . LEU B  1 157 ? -24.989 -50.981 -111.580 1.00 12.68  ? 157 LEU A CB   1 
ATOM   7389  C  CG   . LEU B  1 157 ? -25.764 -51.226 -110.294 1.00 24.59  ? 157 LEU A CG   1 
ATOM   7390  C  CD1  . LEU B  1 157 ? -25.942 -49.928 -109.513 1.00 21.85  ? 157 LEU A CD1  1 
ATOM   7391  C  CD2  . LEU B  1 157 ? -27.103 -51.867 -110.598 1.00 28.88  ? 157 LEU A CD2  1 
ATOM   7392  H  H    . LEU B  1 157 ? -23.381 -50.545 -113.335 1.00 13.15  ? 157 LEU A H    1 
ATOM   7393  H  HA   . LEU B  1 157 ? -23.803 -49.423 -110.992 1.00 13.12  ? 157 LEU A HA   1 
ATOM   7394  H  HB2  . LEU B  1 157 ? -25.545 -50.432 -112.156 1.00 15.22  ? 157 LEU A HB2  1 
ATOM   7395  H  HB3  . LEU B  1 157 ? -24.840 -51.843 -111.999 1.00 15.22  ? 157 LEU A HB3  1 
ATOM   7396  H  HG   . LEU B  1 157 ? -25.260 -51.841 -109.738 1.00 29.51  ? 157 LEU A HG   1 
ATOM   7397  H  HD11 . LEU B  1 157 ? -26.438 -50.115 -108.700 1.00 26.22  ? 157 LEU A HD11 1 
ATOM   7398  H  HD12 . LEU B  1 157 ? -25.068 -49.570 -109.292 1.00 26.22  ? 157 LEU A HD12 1 
ATOM   7399  H  HD13 . LEU B  1 157 ? -26.431 -49.295 -110.061 1.00 26.22  ? 157 LEU A HD13 1 
ATOM   7400  H  HD21 . LEU B  1 157 ? -27.579 -52.014 -109.766 1.00 34.66  ? 157 LEU A HD21 1 
ATOM   7401  H  HD22 . LEU B  1 157 ? -27.614 -51.274 -111.172 1.00 34.66  ? 157 LEU A HD22 1 
ATOM   7402  H  HD23 . LEU B  1 157 ? -26.952 -52.713 -111.048 1.00 34.66  ? 157 LEU A HD23 1 
ATOM   7403  N  N    . ALA B  1 158 ? -22.067 -52.107 -110.958 1.00 11.94  ? 158 ALA A N    1 
ATOM   7404  C  CA   . ALA B  1 158 ? -21.413 -53.067 -110.083 1.00 12.54  ? 158 ALA A CA   1 
ATOM   7405  C  C    . ALA B  1 158 ? -20.263 -52.440 -109.280 1.00 14.33  ? 158 ALA A C    1 
ATOM   7406  O  O    . ALA B  1 158 ? -20.143 -52.702 -108.085 1.00 15.16  ? 158 ALA A O    1 
ATOM   7407  C  CB   . ALA B  1 158 ? -20.930 -54.276 -110.890 1.00 13.28  ? 158 ALA A CB   1 
ATOM   7408  H  H    . ALA B  1 158 ? -21.962 -52.255 -111.798 1.00 14.33  ? 158 ALA A H    1 
ATOM   7409  H  HA   . ALA B  1 158 ? -22.067 -53.389 -109.444 1.00 15.05  ? 158 ALA A HA   1 
ATOM   7410  H  HB1  . ALA B  1 158 ? -20.497 -54.903 -110.289 1.00 15.94  ? 158 ALA A HB1  1 
ATOM   7411  H  HB2  . ALA B  1 158 ? -21.694 -54.697 -111.314 1.00 15.94  ? 158 ALA A HB2  1 
ATOM   7412  H  HB3  . ALA B  1 158 ? -20.301 -53.975 -111.564 1.00 15.94  ? 158 ALA A HB3  1 
ATOM   7413  N  N    . PRO B  1 159 ? -19.422 -51.596 -109.913 1.00 12.71  ? 159 PRO A N    1 
ATOM   7414  C  CA   . PRO B  1 159 ? -18.339 -50.990 -109.118 1.00 17.66  ? 159 PRO A CA   1 
ATOM   7415  C  C    . PRO B  1 159 ? -18.860 -50.100 -107.998 1.00 18.15  ? 159 PRO A C    1 
ATOM   7416  O  O    . PRO B  1 159 ? -18.339 -50.116 -106.889 1.00 19.09  ? 159 PRO A O    1 
ATOM   7417  C  CB   . PRO B  1 159 ? -17.569 -50.170 -110.145 1.00 16.79  ? 159 PRO A CB   1 
ATOM   7418  C  CG   . PRO B  1 159 ? -17.835 -50.877 -111.437 1.00 17.22  ? 159 PRO A CG   1 
ATOM   7419  C  CD   . PRO B  1 159 ? -19.254 -51.327 -111.347 1.00 17.83  ? 159 PRO A CD   1 
ATOM   7420  H  HA   . PRO B  1 159 ? -17.760 -51.676 -108.749 1.00 21.20  ? 159 PRO A HA   1 
ATOM   7421  H  HB2  . PRO B  1 159 ? -17.912 -49.263 -110.169 1.00 20.15  ? 159 PRO A HB2  1 
ATOM   7422  H  HB3  . PRO B  1 159 ? -16.622 -50.178 -109.934 1.00 20.15  ? 159 PRO A HB3  1 
ATOM   7423  H  HG2  . PRO B  1 159 ? -17.717 -50.262 -112.178 1.00 20.67  ? 159 PRO A HG2  1 
ATOM   7424  H  HG3  . PRO B  1 159 ? -17.239 -51.638 -111.523 1.00 20.67  ? 159 PRO A HG3  1 
ATOM   7425  H  HD2  . PRO B  1 159 ? -19.854 -50.620 -111.632 1.00 21.40  ? 159 PRO A HD2  1 
ATOM   7426  H  HD3  . PRO B  1 159 ? -19.387 -52.138 -111.862 1.00 21.40  ? 159 PRO A HD3  1 
ATOM   7427  N  N    . LEU B  1 160 ? -19.903 -49.339 -108.291 1.00 14.91  ? 160 LEU A N    1 
ATOM   7428  C  CA   . LEU B  1 160 ? -20.517 -48.491 -107.291 1.00 14.39  ? 160 LEU A CA   1 
ATOM   7429  C  C    . LEU B  1 160 ? -21.163 -49.342 -106.193 1.00 18.19  ? 160 LEU A C    1 
ATOM   7430  O  O    . LEU B  1 160 ? -20.926 -49.099 -105.013 1.00 15.16  ? 160 LEU A O    1 
ATOM   7431  C  CB   . LEU B  1 160 ? -21.532 -47.549 -107.954 1.00 19.83  ? 160 LEU A CB   1 
ATOM   7432  C  CG   . LEU B  1 160 ? -22.341 -46.689 -106.976 1.00 21.34  ? 160 LEU A CG   1 
ATOM   7433  C  CD1  . LEU B  1 160 ? -21.431 -45.827 -106.152 1.00 23.36  ? 160 LEU A CD1  1 
ATOM   7434  C  CD2  . LEU B  1 160 ? -23.364 -45.857 -107.731 1.00 30.44  ? 160 LEU A CD2  1 
ATOM   7435  H  H    . LEU B  1 160 ? -20.275 -49.298 -109.066 1.00 17.89  ? 160 LEU A H    1 
ATOM   7436  H  HA   . LEU B  1 160 ? -19.830 -47.945 -106.878 1.00 17.27  ? 160 LEU A HA   1 
ATOM   7437  H  HB2  . LEU B  1 160 ? -21.055 -46.948 -108.547 1.00 23.80  ? 160 LEU A HB2  1 
ATOM   7438  H  HB3  . LEU B  1 160 ? -22.161 -48.082 -108.465 1.00 23.80  ? 160 LEU A HB3  1 
ATOM   7439  H  HG   . LEU B  1 160 ? -22.824 -47.274 -106.371 1.00 25.61  ? 160 LEU A HG   1 
ATOM   7440  H  HD11 . LEU B  1 160 ? -21.966 -45.295 -105.543 1.00 28.03  ? 160 LEU A HD11 1 
ATOM   7441  H  HD12 . LEU B  1 160 ? -20.826 -46.396 -105.650 1.00 28.03  ? 160 LEU A HD12 1 
ATOM   7442  H  HD13 . LEU B  1 160 ? -20.926 -45.247 -106.743 1.00 28.03  ? 160 LEU A HD13 1 
ATOM   7443  H  HD21 . LEU B  1 160 ? -23.865 -45.321 -107.097 1.00 36.53  ? 160 LEU A HD21 1 
ATOM   7444  H  HD22 . LEU B  1 160 ? -22.900 -45.280 -108.358 1.00 36.53  ? 160 LEU A HD22 1 
ATOM   7445  H  HD23 . LEU B  1 160 ? -23.963 -46.451 -108.209 1.00 36.53  ? 160 LEU A HD23 1 
ATOM   7446  N  N    . ALA B  1 161 ? -21.927 -50.370 -106.564 1.00 12.09  ? 161 ALA A N    1 
ATOM   7447  C  CA   . ALA B  1 161 ? -22.558 -51.244 -105.569 1.00 15.20  ? 161 ALA A CA   1 
ATOM   7448  C  C    . ALA B  1 161 ? -21.528 -51.931 -104.690 1.00 15.92  ? 161 ALA A C    1 
ATOM   7449  O  O    . ALA B  1 161 ? -21.767 -52.152 -103.508 1.00 15.11  ? 161 ALA A O    1 
ATOM   7450  C  CB   . ALA B  1 161 ? -23.437 -52.306 -106.239 1.00 14.15  ? 161 ALA A CB   1 
ATOM   7451  H  H    . ALA B  1 161 ? -22.096 -50.583 -107.380 1.00 14.51  ? 161 ALA A H    1 
ATOM   7452  H  HA   . ALA B  1 161 ? -23.126 -50.706 -104.996 1.00 18.24  ? 161 ALA A HA   1 
ATOM   7453  H  HB1  . ALA B  1 161 ? -23.836 -52.863 -105.552 1.00 16.98  ? 161 ALA A HB1  1 
ATOM   7454  H  HB2  . ALA B  1 161 ? -24.131 -51.863 -106.751 1.00 16.98  ? 161 ALA A HB2  1 
ATOM   7455  H  HB3  . ALA B  1 161 ? -22.885 -52.847 -106.826 1.00 16.98  ? 161 ALA A HB3  1 
ATOM   7456  N  N    . LYS B  1 162 ? -20.385 -52.273 -105.268 1.00 13.99  ? 162 LYS A N    1 
ATOM   7457  C  CA   . LYS B  1 162 ? -19.345 -52.935 -104.510 1.00 13.78  ? 162 LYS A CA   1 
ATOM   7458  C  C    . LYS B  1 162 ? -18.898 -52.028 -103.372 1.00 16.18  ? 162 LYS A C    1 
ATOM   7459  O  O    . LYS B  1 162 ? -18.767 -52.475 -102.252 1.00 16.01  ? 162 LYS A O    1 
ATOM   7460  C  CB   . LYS B  1 162 ? -18.155 -53.303 -105.406 1.00 17.62  ? 162 LYS A CB   1 
ATOM   7461  C  CG   . LYS B  1 162 ? -16.851 -53.617 -104.649 1.00 28.96  ? 162 LYS A CG   1 
ATOM   7462  C  CD   . LYS B  1 162 ? -15.700 -53.907 -105.607 1.00 31.25  ? 162 LYS A CD   1 
ATOM   7463  C  CE   . LYS B  1 162 ? -14.360 -53.953 -104.882 1.00 32.26  ? 162 LYS A CE   1 
ATOM   7464  N  NZ   . LYS B  1 162 ? -14.372 -54.987 -103.817 1.00 38.89  ? 162 LYS A NZ   1 
ATOM   7465  H  H    . LYS B  1 162 ? -20.190 -52.132 -106.093 1.00 16.79  ? 162 LYS A H    1 
ATOM   7466  H  HA   . LYS B  1 162 ? -19.699 -53.752 -104.126 1.00 16.53  ? 162 LYS A HA   1 
ATOM   7467  H  HB2  . LYS B  1 162 ? -18.390 -54.088 -105.925 1.00 21.15  ? 162 LYS A HB2  1 
ATOM   7468  H  HB3  . LYS B  1 162 ? -17.976 -52.559 -106.003 1.00 21.15  ? 162 LYS A HB3  1 
ATOM   7469  H  HG2  . LYS B  1 162 ? -16.606 -52.854 -104.103 1.00 34.75  ? 162 LYS A HG2  1 
ATOM   7470  H  HG3  . LYS B  1 162 ? -16.986 -54.400 -104.092 1.00 34.75  ? 162 LYS A HG3  1 
ATOM   7471  H  HD2  . LYS B  1 162 ? -15.845 -54.768 -106.030 1.00 37.50  ? 162 LYS A HD2  1 
ATOM   7472  H  HD3  . LYS B  1 162 ? -15.658 -53.207 -106.277 1.00 37.50  ? 162 LYS A HD3  1 
ATOM   7473  H  HE2  . LYS B  1 162 ? -13.658 -54.173 -105.515 1.00 38.71  ? 162 LYS A HE2  1 
ATOM   7474  H  HE3  . LYS B  1 162 ? -14.186 -53.091 -104.471 1.00 38.71  ? 162 LYS A HE3  1 
ATOM   7475  H  HZ1  . LYS B  1 162 ? -15.009 -54.804 -103.223 1.00 46.67  ? 162 LYS A HZ1  1 
ATOM   7476  H  HZ2  . LYS B  1 162 ? -14.529 -55.787 -104.172 1.00 46.67  ? 162 LYS A HZ2  1 
ATOM   7477  H  HZ3  . LYS B  1 162 ? -13.585 -55.004 -103.401 1.00 46.67  ? 162 LYS A HZ3  1 
ATOM   7478  N  N    . VAL B  1 163 ? -18.657 -50.758 -103.675 1.00 15.53  ? 163 VAL A N    1 
ATOM   7479  C  CA   . VAL B  1 163 ? -18.149 -49.829 -102.680 1.00 17.15  ? 163 VAL A CA   1 
ATOM   7480  C  C    . VAL B  1 163 ? -19.216 -49.608 -101.614 1.00 15.49  ? 163 VAL A C    1 
ATOM   7481  O  O    . VAL B  1 163 ? -18.930 -49.649 -100.422 1.00 14.29  ? 163 VAL A O    1 
ATOM   7482  C  CB   . VAL B  1 163 ? -17.734 -48.486 -103.338 1.00 13.74  ? 163 VAL A CB   1 
ATOM   7483  C  CG1  . VAL B  1 163 ? -17.360 -47.429 -102.274 1.00 18.68  ? 163 VAL A CG1  1 
ATOM   7484  C  CG2  . VAL B  1 163 ? -16.604 -48.725 -104.299 1.00 13.98  ? 163 VAL A CG2  1 
ATOM   7485  H  H    . VAL B  1 163 ? -18.779 -50.411 -104.452 1.00 18.63  ? 163 VAL A H    1 
ATOM   7486  H  HA   . VAL B  1 163 ? -17.367 -50.213 -102.253 1.00 20.58  ? 163 VAL A HA   1 
ATOM   7487  H  HB   . VAL B  1 163 ? -18.486 -48.142 -103.845 1.00 16.48  ? 163 VAL A HB   1 
ATOM   7488  H  HG11 . VAL B  1 163 ? -17.107 -46.607 -102.722 1.00 22.42  ? 163 VAL A HG11 1 
ATOM   7489  H  HG12 . VAL B  1 163 ? -18.127 -47.272 -101.702 1.00 22.42  ? 163 VAL A HG12 1 
ATOM   7490  H  HG13 . VAL B  1 163 ? -16.616 -47.761 -101.747 1.00 22.42  ? 163 VAL A HG13 1 
ATOM   7491  H  HG21 . VAL B  1 163 ? -16.352 -47.881 -104.705 1.00 16.78  ? 163 VAL A HG21 1 
ATOM   7492  H  HG22 . VAL B  1 163 ? -15.851 -49.098 -103.814 1.00 16.78  ? 163 VAL A HG22 1 
ATOM   7493  H  HG23 . VAL B  1 163 ? -16.898 -49.347 -104.983 1.00 16.78  ? 163 VAL A HG23 1 
ATOM   7494  N  N    . ILE B  1 164 ? -20.456 -49.401 -102.038 1.00 13.40  ? 164 ILE A N    1 
ATOM   7495  C  CA   . ILE B  1 164 ? -21.520 -49.098 -101.073 1.00 13.51  ? 164 ILE A CA   1 
ATOM   7496  C  C    . ILE B  1 164 ? -21.786 -50.311 -100.182 1.00 14.38  ? 164 ILE A C    1 
ATOM   7497  O  O    . ILE B  1 164 ? -21.884 -50.213 -98.949  1.00 17.44  ? 164 ILE A O    1 
ATOM   7498  C  CB   . ILE B  1 164 ? -22.807 -48.669 -101.786 1.00 15.10  ? 164 ILE A CB   1 
ATOM   7499  C  CG1  . ILE B  1 164 ? -22.538 -47.425 -102.637 1.00 14.87  ? 164 ILE A CG1  1 
ATOM   7500  C  CG2  . ILE B  1 164 ? -23.936 -48.414 -100.781 1.00 15.51  ? 164 ILE A CG2  1 
ATOM   7501  C  CD1  . ILE B  1 164 ? -22.123 -46.178 -101.839 1.00 25.23  ? 164 ILE A CD1  1 
ATOM   7502  H  H    . ILE B  1 164 ? -20.709 -49.427 -102.859 1.00 16.08  ? 164 ILE A H    1 
ATOM   7503  H  HA   . ILE B  1 164 ? -21.233 -48.366 -100.505 1.00 16.21  ? 164 ILE A HA   1 
ATOM   7504  H  HB   . ILE B  1 164 ? -23.081 -49.388 -102.377 1.00 18.13  ? 164 ILE A HB   1 
ATOM   7505  H  HG12 . ILE B  1 164 ? -21.824 -47.625 -103.262 1.00 17.85  ? 164 ILE A HG12 1 
ATOM   7506  H  HG13 . ILE B  1 164 ? -23.346 -47.204 -103.127 1.00 17.85  ? 164 ILE A HG13 1 
ATOM   7507  H  HG21 . ILE B  1 164 ? -24.733 -48.146 -101.264 1.00 18.61  ? 164 ILE A HG21 1 
ATOM   7508  H  HG22 . ILE B  1 164 ? -24.108 -49.231 -100.286 1.00 18.61  ? 164 ILE A HG22 1 
ATOM   7509  H  HG23 . ILE B  1 164 ? -23.664 -47.710 -100.173 1.00 18.61  ? 164 ILE A HG23 1 
ATOM   7510  H  HD11 . ILE B  1 164 ? -21.974 -45.444 -102.455 1.00 30.27  ? 164 ILE A HD11 1 
ATOM   7511  H  HD12 . ILE B  1 164 ? -22.832 -45.950 -101.218 1.00 30.27  ? 164 ILE A HD12 1 
ATOM   7512  H  HD13 . ILE B  1 164 ? -21.306 -46.372 -101.353 1.00 30.27  ? 164 ILE A HD13 1 
ATOM   7513  N  N    . HIS B  1 165 ? -21.858 -51.474 -100.798 1.00 13.94  ? 165 HIS A N    1 
ATOM   7514  C  CA   . HIS B  1 165 ? -22.080 -52.688 -100.042 1.00 17.44  ? 165 HIS A CA   1 
ATOM   7515  C  C    . HIS B  1 165 ? -20.914 -52.975 -99.086  1.00 22.33  ? 165 HIS A C    1 
ATOM   7516  O  O    . HIS B  1 165 ? -21.124 -53.368 -97.942  1.00 16.90  ? 165 HIS A O    1 
ATOM   7517  C  CB   . HIS B  1 165 ? -22.292 -53.871 -100.979 1.00 16.90  ? 165 HIS A CB   1 
ATOM   7518  C  CG   . HIS B  1 165 ? -22.632 -55.135 -100.259 1.00 17.16  ? 165 HIS A CG   1 
ATOM   7519  N  ND1  . HIS B  1 165 ? -23.779 -55.269 -99.509  1.00 22.74  ? 165 HIS A ND1  1 
ATOM   7520  C  CD2  . HIS B  1 165 ? -21.957 -56.301 -100.129 1.00 25.22  ? 165 HIS A CD2  1 
ATOM   7521  C  CE1  . HIS B  1 165 ? -23.809 -56.471 -98.964  1.00 22.97  ? 165 HIS A CE1  1 
ATOM   7522  N  NE2  . HIS B  1 165 ? -22.710 -57.114 -99.314  1.00 23.74  ? 165 HIS A NE2  1 
ATOM   7523  H  H    . HIS B  1 165 ? -21.782 -51.589 -101.647 1.00 16.73  ? 165 HIS A H    1 
ATOM   7524  H  HA   . HIS B  1 165 ? -22.884 -52.583 -99.509  1.00 20.93  ? 165 HIS A HA   1 
ATOM   7525  H  HB2  . HIS B  1 165 ? -23.022 -53.666 -101.584 1.00 20.28  ? 165 HIS A HB2  1 
ATOM   7526  H  HB3  . HIS B  1 165 ? -21.477 -54.023 -101.482 1.00 20.28  ? 165 HIS A HB3  1 
ATOM   7527  H  HD2  . HIS B  1 165 ? -21.137 -56.512 -100.514 1.00 30.27  ? 165 HIS A HD2  1 
ATOM   7528  H  HE1  . HIS B  1 165 ? -24.485 -56.805 -98.419  1.00 27.56  ? 165 HIS A HE1  1 
ATOM   7529  N  N    . ASP B  1 166 ? -19.689 -52.760 -99.546  1.00 18.23  ? 166 ASP A N    1 
ATOM   7530  C  CA   . ASP B  1 166 ? -18.516 -53.059 -98.725  1.00 16.54  ? 166 ASP A CA   1 
ATOM   7531  C  C    . ASP B  1 166 ? -18.530 -52.221 -97.453  1.00 17.55  ? 166 ASP A C    1 
ATOM   7532  O  O    . ASP B  1 166 ? -18.151 -52.673 -96.381  1.00 22.62  ? 166 ASP A O    1 
ATOM   7533  C  CB   . ASP B  1 166 ? -17.239 -52.778 -99.506  1.00 15.75  ? 166 ASP A CB   1 
ATOM   7534  C  CG   . ASP B  1 166 ? -16.875 -53.897 -100.495 1.00 29.60  ? 166 ASP A CG   1 
ATOM   7535  O  OD1  . ASP B  1 166 ? -17.520 -54.965 -100.474 1.00 29.15  ? 166 ASP A OD1  1 
ATOM   7536  O  OD2  . ASP B  1 166 ? -15.926 -53.696 -101.293 1.00 29.65  ? 166 ASP A OD2  1 
ATOM   7537  H  H    . ASP B  1 166 ? -19.507 -52.444 -100.324 1.00 21.87  ? 166 ASP A H    1 
ATOM   7538  H  HA   . ASP B  1 166 ? -18.526 -53.996 -98.476  1.00 19.85  ? 166 ASP A HA   1 
ATOM   7539  H  HB2  . ASP B  1 166 ? -17.353 -51.959 -100.011 1.00 18.90  ? 166 ASP A HB2  1 
ATOM   7540  H  HB3  . ASP B  1 166 ? -16.503 -52.681 -98.881  1.00 18.90  ? 166 ASP A HB3  1 
ATOM   7541  N  N    . ASN B  1 167 ? -18.970 -50.981 -97.575  1.00 16.44  ? 167 ASN A N    1 
ATOM   7542  C  CA   . ASN B  1 167 ? -18.869 -50.066 -96.455  1.00 21.31  ? 167 ASN A CA   1 
ATOM   7543  C  C    . ASN B  1 167 ? -20.132 -50.011 -95.598  1.00 26.18  ? 167 ASN A C    1 
ATOM   7544  O  O    . ASN B  1 167 ? -20.042 -49.934 -94.377  1.00 23.85  ? 167 ASN A O    1 
ATOM   7545  C  CB   . ASN B  1 167 ? -18.504 -48.681 -96.973  1.00 19.31  ? 167 ASN A CB   1 
ATOM   7546  C  CG   . ASN B  1 167 ? -17.049 -48.593 -97.413  1.00 24.30  ? 167 ASN A CG   1 
ATOM   7547  O  OD1  . ASN B  1 167 ? -16.173 -48.356 -96.595  1.00 24.25  ? 167 ASN A OD1  1 
ATOM   7548  N  ND2  . ASN B  1 167 ? -16.787 -48.796 -98.711  1.00 17.83  ? 167 ASN A ND2  1 
ATOM   7549  H  H    . ASN B  1 167 ? -19.325 -50.648 -98.284  1.00 19.73  ? 167 ASN A H    1 
ATOM   7550  H  HA   . ASN B  1 167 ? -18.144 -50.362 -95.882  1.00 25.57  ? 167 ASN A HA   1 
ATOM   7551  H  HB2  . ASN B  1 167 ? -19.064 -48.471 -97.737  1.00 23.17  ? 167 ASN A HB2  1 
ATOM   7552  H  HB3  . ASN B  1 167 ? -18.646 -48.031 -96.268  1.00 23.17  ? 167 ASN A HB3  1 
ATOM   7553  H  HD21 . ASN B  1 167 ? -15.978 -48.755 -98.998  1.00 21.40  ? 167 ASN A HD21 1 
ATOM   7554  H  HD22 . ASN B  1 167 ? -17.429 -48.968 -99.257  1.00 21.40  ? 167 ASN A HD22 1 
ATOM   7555  N  N    . PHE B  1 168 ? -21.305 -50.090 -96.218  1.00 20.62  ? 168 PHE A N    1 
ATOM   7556  C  CA   . PHE B  1 168 ? -22.547 -49.841 -95.489  1.00 22.80  ? 168 PHE A CA   1 
ATOM   7557  C  C    . PHE B  1 168 ? -23.541 -51.001 -95.531  1.00 25.01  ? 168 PHE A C    1 
ATOM   7558  O  O    . PHE B  1 168 ? -24.463 -51.065 -94.720  1.00 22.48  ? 168 PHE A O    1 
ATOM   7559  C  CB   . PHE B  1 168 ? -23.210 -48.583 -96.038  1.00 21.15  ? 168 PHE A CB   1 
ATOM   7560  C  CG   . PHE B  1 168 ? -22.298 -47.400 -96.071  1.00 18.86  ? 168 PHE A CG   1 
ATOM   7561  C  CD1  . PHE B  1 168 ? -21.883 -46.798 -94.888  1.00 23.65  ? 168 PHE A CD1  1 
ATOM   7562  C  CD2  . PHE B  1 168 ? -21.831 -46.905 -97.274  1.00 20.03  ? 168 PHE A CD2  1 
ATOM   7563  C  CE1  . PHE B  1 168 ? -21.031 -45.708 -94.903  1.00 21.79  ? 168 PHE A CE1  1 
ATOM   7564  C  CE2  . PHE B  1 168 ? -20.978 -45.809 -97.302  1.00 17.17  ? 168 PHE A CE2  1 
ATOM   7565  C  CZ   . PHE B  1 168 ? -20.584 -45.205 -96.119  1.00 17.17  ? 168 PHE A CZ   1 
ATOM   7566  H  H    . PHE B  1 168 ? -21.411 -50.284 -97.049  1.00 24.74  ? 168 PHE A H    1 
ATOM   7567  H  HA   . PHE B  1 168 ? -22.330 -49.676 -94.558  1.00 27.36  ? 168 PHE A HA   1 
ATOM   7568  H  HB2  . PHE B  1 168 ? -23.507 -48.756 -96.945  1.00 25.38  ? 168 PHE A HB2  1 
ATOM   7569  H  HB3  . PHE B  1 168 ? -23.969 -48.358 -95.478  1.00 25.38  ? 168 PHE A HB3  1 
ATOM   7570  H  HD1  . PHE B  1 168 ? -22.188 -47.129 -94.074  1.00 28.38  ? 168 PHE A HD1  1 
ATOM   7571  H  HD2  . PHE B  1 168 ? -22.100 -47.301 -98.071  1.00 24.03  ? 168 PHE A HD2  1 
ATOM   7572  H  HE1  . PHE B  1 168 ? -20.767 -45.308 -94.106  1.00 26.15  ? 168 PHE A HE1  1 
ATOM   7573  H  HE2  . PHE B  1 168 ? -20.676 -45.477 -98.117  1.00 20.60  ? 168 PHE A HE2  1 
ATOM   7574  H  HZ   . PHE B  1 168 ? -20.007 -44.475 -96.137  1.00 20.61  ? 168 PHE A HZ   1 
ATOM   7575  N  N    . GLY B  1 169 ? -23.361 -51.902 -96.484  1.00 19.17  ? 169 GLY A N    1 
ATOM   7576  C  CA   . GLY B  1 169 ? -24.257 -53.029 -96.634  1.00 20.55  ? 169 GLY A CA   1 
ATOM   7577  C  C    . GLY B  1 169 ? -25.532 -52.606 -97.337  1.00 23.34  ? 169 GLY A C    1 
ATOM   7578  O  O    . GLY B  1 169 ? -26.290 -51.787 -96.822  1.00 22.14  ? 169 GLY A O    1 
ATOM   7579  H  H    . GLY B  1 169 ? -22.722 -51.882 -97.059  1.00 23.01  ? 169 GLY A H    1 
ATOM   7580  H  HA2  . GLY B  1 169 ? -23.827 -53.725 -97.156  1.00 24.66  ? 169 GLY A HA2  1 
ATOM   7581  H  HA3  . GLY B  1 169 ? -24.485 -53.388 -95.762  1.00 24.66  ? 169 GLY A HA3  1 
ATOM   7582  N  N    . ILE B  1 170 ? -25.746 -53.141 -98.531  1.00 15.34  ? 170 ILE A N    1 
ATOM   7583  C  CA   . ILE B  1 170 ? -26.992 -52.920 -99.260  1.00 17.90  ? 170 ILE A CA   1 
ATOM   7584  C  C    . ILE B  1 170 ? -28.016 -53.965 -98.847  1.00 24.79  ? 170 ILE A C    1 
ATOM   7585  O  O    . ILE B  1 170 ? -27.804 -55.155 -99.056  1.00 25.01  ? 170 ILE A O    1 
ATOM   7586  C  CB   . ILE B  1 170 ? -26.790 -52.983 -100.777 1.00 18.40  ? 170 ILE A CB   1 
ATOM   7587  C  CG1  . ILE B  1 170 ? -25.877 -51.845 -101.238 1.00 17.47  ? 170 ILE A CG1  1 
ATOM   7588  C  CG2  . ILE B  1 170 ? -28.141 -52.883 -101.498 1.00 16.34  ? 170 ILE A CG2  1 
ATOM   7589  C  CD1  . ILE B  1 170 ? -25.503 -51.877 -102.718 1.00 17.23  ? 170 ILE A CD1  1 
ATOM   7590  H  H    . ILE B  1 170 ? -25.182 -53.640 -98.946  1.00 18.41  ? 170 ILE A H    1 
ATOM   7591  H  HA   . ILE B  1 170 ? -27.343 -52.044 -99.036  1.00 21.48  ? 170 ILE A HA   1 
ATOM   7592  H  HB   . ILE B  1 170 ? -26.375 -53.830 -101.003 1.00 22.08  ? 170 ILE A HB   1 
ATOM   7593  H  HG12 . ILE B  1 170 ? -26.326 -51.002 -101.068 1.00 20.96  ? 170 ILE A HG12 1 
ATOM   7594  H  HG13 . ILE B  1 170 ? -25.053 -51.884 -100.727 1.00 20.96  ? 170 ILE A HG13 1 
ATOM   7595  H  HG21 . ILE B  1 170 ? -27.991 -52.925 -102.456 1.00 19.61  ? 170 ILE A HG21 1 
ATOM   7596  H  HG22 . ILE B  1 170 ? -28.704 -53.622 -101.218 1.00 19.61  ? 170 ILE A HG22 1 
ATOM   7597  H  HG23 . ILE B  1 170 ? -28.561 -52.040 -101.265 1.00 19.61  ? 170 ILE A HG23 1 
ATOM   7598  H  HD11 . ILE B  1 170 ? -24.927 -51.122 -102.914 1.00 20.67  ? 170 ILE A HD11 1 
ATOM   7599  H  HD12 . ILE B  1 170 ? -25.037 -52.707 -102.907 1.00 20.67  ? 170 ILE A HD12 1 
ATOM   7600  H  HD13 . ILE B  1 170 ? -26.313 -51.823 -103.249 1.00 20.67  ? 170 ILE A HD13 1 
ATOM   7601  N  N    . VAL B  1 171 ? -29.127 -53.521 -98.268  1.00 16.24  ? 171 VAL A N    1 
ATOM   7602  C  CA   . VAL B  1 171 ? -30.200 -54.436 -97.882  1.00 17.14  ? 171 VAL A CA   1 
ATOM   7603  C  C    . VAL B  1 171 ? -31.013 -54.788 -99.122  1.00 16.86  ? 171 VAL A C    1 
ATOM   7604  O  O    . VAL B  1 171 ? -31.326 -55.947 -99.366  1.00 17.41  ? 171 VAL A O    1 
ATOM   7605  C  CB   . VAL B  1 171 ? -31.124 -53.827 -96.805  1.00 17.87  ? 171 VAL A CB   1 
ATOM   7606  C  CG1  . VAL B  1 171 ? -32.291 -54.766 -96.494  1.00 19.85  ? 171 VAL A CG1  1 
ATOM   7607  C  CG2  . VAL B  1 171 ? -30.341 -53.518 -95.533  1.00 29.09  ? 171 VAL A CG2  1 
ATOM   7608  H  H    . VAL B  1 171 ? -29.286 -52.695 -98.088  1.00 19.49  ? 171 VAL A H    1 
ATOM   7609  H  HA   . VAL B  1 171 ? -29.814 -55.252 -97.527  1.00 20.56  ? 171 VAL A HA   1 
ATOM   7610  H  HB   . VAL B  1 171 ? -31.491 -52.994 -97.139  1.00 21.44  ? 171 VAL A HB   1 
ATOM   7611  H  HG11 . VAL B  1 171 ? -32.852 -54.358 -95.816  1.00 23.82  ? 171 VAL A HG11 1 
ATOM   7612  H  HG12 . VAL B  1 171 ? -32.803 -54.911 -97.304  1.00 23.82  ? 171 VAL A HG12 1 
ATOM   7613  H  HG13 . VAL B  1 171 ? -31.939 -55.609 -96.168  1.00 23.82  ? 171 VAL A HG13 1 
ATOM   7614  H  HG21 . VAL B  1 171 ? -30.944 -53.138 -94.876  1.00 34.90  ? 171 VAL A HG21 1 
ATOM   7615  H  HG22 . VAL B  1 171 ? -29.956 -54.341 -95.193  1.00 34.90  ? 171 VAL A HG22 1 
ATOM   7616  H  HG23 . VAL B  1 171 ? -29.637 -52.885 -95.743  1.00 34.90  ? 171 VAL A HG23 1 
ATOM   7617  N  N    . GLU B  1 172 ? -31.347 -53.763 -99.902  1.00 22.05  ? 172 GLU A N    1 
ATOM   7618  C  CA   . GLU B  1 172 ? -32.072 -53.937 -101.149 1.00 20.57  ? 172 GLU A CA   1 
ATOM   7619  C  C    . GLU B  1 172 ? -31.954 -52.664 -101.966 1.00 17.62  ? 172 GLU A C    1 
ATOM   7620  O  O    . GLU B  1 172 ? -31.830 -51.580 -101.412 1.00 19.01  ? 172 GLU A O    1 
ATOM   7621  C  CB   . GLU B  1 172 ? -33.543 -54.268 -100.899 1.00 22.75  ? 172 GLU A CB   1 
ATOM   7622  C  CG   . GLU B  1 172 ? -34.257 -53.284 -99.996  1.00 25.19  ? 172 GLU A CG   1 
ATOM   7623  C  CD   . GLU B  1 172 ? -35.637 -53.761 -99.555  1.00 36.19  ? 172 GLU A CD   1 
ATOM   7624  O  OE1  . GLU B  1 172 ? -36.063 -54.856 -99.982  1.00 33.78  ? 172 GLU A OE1  1 
ATOM   7625  O  OE2  . GLU B  1 172 ? -36.287 -53.040 -98.763  1.00 25.56  ? 172 GLU A OE2  1 
ATOM   7626  H  H    . GLU B  1 172 ? -31.158 -52.943 -99.724  1.00 26.45  ? 172 GLU A H    1 
ATOM   7627  H  HA   . GLU B  1 172 ? -31.675 -54.664 -101.655 1.00 24.69  ? 172 GLU A HA   1 
ATOM   7628  H  HB2  . GLU B  1 172 ? -34.008 -54.278 -101.751 1.00 27.29  ? 172 GLU A HB2  1 
ATOM   7629  H  HB3  . GLU B  1 172 ? -33.599 -55.143 -100.485 1.00 27.29  ? 172 GLU A HB3  1 
ATOM   7630  H  HG2  . GLU B  1 172 ? -33.722 -53.143 -99.199  1.00 30.22  ? 172 GLU A HG2  1 
ATOM   7631  H  HG3  . GLU B  1 172 ? -34.369 -52.446 -100.471 1.00 30.22  ? 172 GLU A HG3  1 
ATOM   7632  N  N    . GLY B  1 173 ? -31.996 -52.803 -103.281 1.00 15.94  ? 173 GLY A N    1 
ATOM   7633  C  CA   . GLY B  1 173 ? -31.821 -51.672 -104.170 1.00 14.80  ? 173 GLY A CA   1 
ATOM   7634  C  C    . GLY B  1 173 ? -32.642 -51.836 -105.420 1.00 13.35  ? 173 GLY A C    1 
ATOM   7635  O  O    . GLY B  1 173 ? -32.904 -52.956 -105.882 1.00 16.02  ? 173 GLY A O    1 
ATOM   7636  H  H    . GLY B  1 173 ? -32.126 -53.550 -103.686 1.00 19.13  ? 173 GLY A H    1 
ATOM   7637  H  HA2  . GLY B  1 173 ? -32.096 -50.857 -103.722 1.00 17.76  ? 173 GLY A HA2  1 
ATOM   7638  H  HA3  . GLY B  1 173 ? -30.887 -51.592 -104.419 1.00 17.76  ? 173 GLY A HA3  1 
ATOM   7639  N  N    . LEU B  1 174 ? -33.071 -50.709 -105.959 1.00 12.58  ? 174 LEU A N    1 
ATOM   7640  C  CA   . LEU B  1 174 ? -33.790 -50.674 -107.227 1.00 12.25  ? 174 LEU A CA   1 
ATOM   7641  C  C    . LEU B  1 174 ? -33.095 -49.628 -108.095 1.00 14.27  ? 174 LEU A C    1 
ATOM   7642  O  O    . LEU B  1 174 ? -32.713 -48.557 -107.611 1.00 17.24  ? 174 LEU A O    1 
ATOM   7643  C  CB   . LEU B  1 174 ? -35.280 -50.339 -107.020 1.00 14.68  ? 174 LEU A CB   1 
ATOM   7644  C  CG   . LEU B  1 174 ? -36.173 -51.501 -106.570 1.00 22.07  ? 174 LEU A CG   1 
ATOM   7645  C  CD1  . LEU B  1 174 ? -37.508 -51.027 -106.033 1.00 24.84  ? 174 LEU A CD1  1 
ATOM   7646  C  CD2  . LEU B  1 174 ? -36.399 -52.438 -107.742 1.00 16.75  ? 174 LEU A CD2  1 
ATOM   7647  H  H    . LEU B  1 174 ? -32.958 -49.933 -105.604 1.00 15.10  ? 174 LEU A H    1 
ATOM   7648  H  HA   . LEU B  1 174 ? -33.723 -51.537 -107.665 1.00 14.70  ? 174 LEU A HA   1 
ATOM   7649  H  HB2  . LEU B  1 174 ? -35.346 -49.645 -106.345 1.00 17.62  ? 174 LEU A HB2  1 
ATOM   7650  H  HB3  . LEU B  1 174 ? -35.637 -50.007 -107.859 1.00 17.62  ? 174 LEU A HB3  1 
ATOM   7651  H  HG   . LEU B  1 174 ? -35.723 -51.997 -105.868 1.00 26.48  ? 174 LEU A HG   1 
ATOM   7652  H  HD11 . LEU B  1 174 ? -38.032 -51.797 -105.764 1.00 29.81  ? 174 LEU A HD11 1 
ATOM   7653  H  HD12 . LEU B  1 174 ? -37.353 -50.448 -105.270 1.00 29.81  ? 174 LEU A HD12 1 
ATOM   7654  H  HD13 . LEU B  1 174 ? -37.973 -50.538 -106.731 1.00 29.81  ? 174 LEU A HD13 1 
ATOM   7655  H  HD21 . LEU B  1 174 ? -36.964 -53.172 -107.454 1.00 20.11  ? 174 LEU A HD21 1 
ATOM   7656  H  HD22 . LEU B  1 174 ? -36.832 -51.948 -108.458 1.00 20.11  ? 174 LEU A HD22 1 
ATOM   7657  H  HD23 . LEU B  1 174 ? -35.542 -52.778 -108.043 1.00 20.11  ? 174 LEU A HD23 1 
ATOM   7658  N  N    . MET B  1 175 ? -32.883 -49.969 -109.356 1.00 13.35  ? 175 MET A N    1 
ATOM   7659  C  CA   . MET B  1 175 ? -32.101 -49.139 -110.261 1.00 13.69  ? 175 MET A CA   1 
ATOM   7660  C  C    . MET B  1 175 ? -32.959 -48.665 -111.428 1.00 14.76  ? 175 MET A C    1 
ATOM   7661  O  O    . MET B  1 175 ? -33.773 -49.419 -111.970 1.00 14.17  ? 175 MET A O    1 
ATOM   7662  C  CB   . MET B  1 175 ? -30.900 -49.936 -110.797 1.00 12.63  ? 175 MET A CB   1 
ATOM   7663  C  CG   . MET B  1 175 ? -30.032 -49.174 -111.793 1.00 29.30  ? 175 MET A CG   1 
ATOM   7664  S  SD   . MET B  1 175 ? -29.460 -50.219 -113.143 1.00 41.03  ? 175 MET A SD   1 
ATOM   7665  C  CE   . MET B  1 175 ? -31.003 -50.496 -114.032 1.00 29.07  ? 175 MET A CE   1 
ATOM   7666  H  H    . MET B  1 175 ? -33.186 -50.688 -109.718 1.00 16.02  ? 175 MET A H    1 
ATOM   7667  H  HA   . MET B  1 175 ? -31.764 -48.369 -109.777 1.00 16.42  ? 175 MET A HA   1 
ATOM   7668  H  HB2  . MET B  1 175 ? -30.336 -50.189 -110.048 1.00 15.16  ? 175 MET A HB2  1 
ATOM   7669  H  HB3  . MET B  1 175 ? -31.229 -50.732 -111.242 1.00 15.16  ? 175 MET A HB3  1 
ATOM   7670  H  HG2  . MET B  1 175 ? -30.549 -48.447 -112.173 1.00 35.16  ? 175 MET A HG2  1 
ATOM   7671  H  HG3  . MET B  1 175 ? -29.253 -48.824 -111.333 1.00 35.16  ? 175 MET A HG3  1 
ATOM   7672  H  HE1  . MET B  1 175 ? -30.827 -51.060 -114.801 1.00 34.89  ? 175 MET A HE1  1 
ATOM   7673  H  HE2  . MET B  1 175 ? -31.634 -50.933 -113.439 1.00 34.89  ? 175 MET A HE2  1 
ATOM   7674  H  HE3  . MET B  1 175 ? -31.357 -49.641 -114.322 1.00 34.89  ? 175 MET A HE3  1 
ATOM   7675  N  N    . THR B  1 176 ? -32.761 -47.419 -111.824 1.00 12.59  ? 176 THR A N    1 
ATOM   7676  C  CA   . THR B  1 176 ? -33.223 -46.948 -113.124 1.00 17.55  ? 176 THR A CA   1 
ATOM   7677  C  C    . THR B  1 176 ? -32.015 -46.480 -113.902 1.00 15.71  ? 176 THR A C    1 
ATOM   7678  O  O    . THR B  1 176 ? -31.162 -45.783 -113.358 1.00 16.19  ? 176 THR A O    1 
ATOM   7679  C  CB   . THR B  1 176 ? -34.229 -45.790 -113.002 1.00 20.43  ? 176 THR A CB   1 
ATOM   7680  O  OG1  . THR B  1 176 ? -35.417 -46.261 -112.362 1.00 29.72  ? 176 THR A OG1  1 
ATOM   7681  C  CG2  . THR B  1 176 ? -34.593 -45.210 -114.388 1.00 18.95  ? 176 THR A CG2  1 
ATOM   7682  H  H    . THR B  1 176 ? -32.359 -46.820 -111.357 1.00 15.11  ? 176 THR A H    1 
ATOM   7683  H  HA   . THR B  1 176 ? -33.643 -47.677 -113.607 1.00 21.06  ? 176 THR A HA   1 
ATOM   7684  H  HB   . THR B  1 176 ? -33.838 -45.080 -112.469 1.00 24.52  ? 176 THR A HB   1 
ATOM   7685  H  HG1  . THR B  1 176 ? -35.973 -45.635 -112.291 1.00 35.67  ? 176 THR A HG1  1 
ATOM   7686  H  HG21 . THR B  1 176 ? -35.227 -44.483 -114.286 1.00 22.73  ? 176 THR A HG21 1 
ATOM   7687  H  HG22 . THR B  1 176 ? -33.796 -44.874 -114.826 1.00 22.73  ? 176 THR A HG22 1 
ATOM   7688  H  HG23 . THR B  1 176 ? -34.991 -45.900 -114.941 1.00 22.73  ? 176 THR A HG23 1 
ATOM   7689  N  N    . THR B  1 177 ? -31.924 -46.859 -115.168 1.00 14.13  ? 177 THR A N    1 
ATOM   7690  C  CA   . THR B  1 177 ? -30.925 -46.240 -116.023 1.00 12.56  ? 177 THR A CA   1 
ATOM   7691  C  C    . THR B  1 177 ? -31.627 -45.397 -117.102 1.00 13.67  ? 177 THR A C    1 
ATOM   7692  O  O    . THR B  1 177 ? -32.609 -45.819 -117.727 1.00 10.56  ? 177 THR A O    1 
ATOM   7693  C  CB   . THR B  1 177 ? -29.979 -47.275 -116.650 1.00 9.85   ? 177 THR A CB   1 
ATOM   7694  O  OG1  . THR B  1 177 ? -29.062 -46.606 -117.517 1.00 15.51  ? 177 THR A OG1  1 
ATOM   7695  C  CG2  . THR B  1 177 ? -30.724 -48.327 -117.439 1.00 15.21  ? 177 THR A CG2  1 
ATOM   7696  H  H    . THR B  1 177 ? -32.414 -47.455 -115.548 1.00 16.95  ? 177 THR A H    1 
ATOM   7697  H  HA   . THR B  1 177 ? -30.386 -45.639 -115.485 1.00 15.07  ? 177 THR A HA   1 
ATOM   7698  H  HB   . THR B  1 177 ? -29.484 -47.720 -115.945 1.00 11.82  ? 177 THR A HB   1 
ATOM   7699  H  HG1  . THR B  1 177 ? -28.612 -46.045 -117.083 1.00 18.61  ? 177 THR A HG1  1 
ATOM   7700  H  HG21 . THR B  1 177 ? -30.096 -48.961 -117.819 1.00 18.25  ? 177 THR A HG21 1 
ATOM   7701  H  HG22 . THR B  1 177 ? -31.340 -48.801 -116.860 1.00 18.25  ? 177 THR A HG22 1 
ATOM   7702  H  HG23 . THR B  1 177 ? -31.224 -47.909 -118.158 1.00 18.25  ? 177 THR A HG23 1 
ATOM   7703  N  N    . VAL B  1 178 ? -31.139 -44.178 -117.253 1.00 8.32   ? 178 VAL A N    1 
ATOM   7704  C  CA   . VAL B  1 178 ? -31.540 -43.299 -118.341 1.00 8.22   ? 178 VAL A CA   1 
ATOM   7705  C  C    . VAL B  1 178 ? -30.492 -43.479 -119.439 1.00 11.47  ? 178 VAL A C    1 
ATOM   7706  O  O    . VAL B  1 178 ? -29.345 -43.089 -119.271 1.00 9.72   ? 178 VAL A O    1 
ATOM   7707  C  CB   . VAL B  1 178 ? -31.639 -41.859 -117.874 1.00 10.97  ? 178 VAL A CB   1 
ATOM   7708  C  CG1  . VAL B  1 178 ? -32.036 -40.937 -119.034 1.00 11.30  ? 178 VAL A CG1  1 
ATOM   7709  C  CG2  . VAL B  1 178 ? -32.666 -41.763 -116.716 1.00 14.27  ? 178 VAL A CG2  1 
ATOM   7710  H  H    . VAL B  1 178 ? -30.558 -43.827 -116.725 1.00 9.98   ? 178 VAL A H    1 
ATOM   7711  H  HA   . VAL B  1 178 ? -32.404 -43.576 -118.685 1.00 9.86   ? 178 VAL A HA   1 
ATOM   7712  H  HB   . VAL B  1 178 ? -30.776 -41.571 -117.539 1.00 13.16  ? 178 VAL A HB   1 
ATOM   7713  H  HG11 . VAL B  1 178 ? -32.092 -40.025 -118.708 1.00 13.56  ? 178 VAL A HG11 1 
ATOM   7714  H  HG12 . VAL B  1 178 ? -31.364 -40.999 -119.731 1.00 13.56  ? 178 VAL A HG12 1 
ATOM   7715  H  HG13 . VAL B  1 178 ? -32.898 -41.218 -119.380 1.00 13.56  ? 178 VAL A HG13 1 
ATOM   7716  H  HG21 . VAL B  1 178 ? -32.725 -40.840 -116.423 1.00 17.12  ? 178 VAL A HG21 1 
ATOM   7717  H  HG22 . VAL B  1 178 ? -33.531 -42.064 -117.036 1.00 17.12  ? 178 VAL A HG22 1 
ATOM   7718  H  HG23 . VAL B  1 178 ? -32.369 -42.325 -115.984 1.00 17.12  ? 178 VAL A HG23 1 
ATOM   7719  N  N    . HIS B  1 179 ? -30.887 -44.114 -120.537 1.00 8.16   ? 179 HIS A N    1 
ATOM   7720  C  CA   . HIS B  1 179 ? -29.920 -44.690 -121.449 1.00 8.38   ? 179 HIS A CA   1 
ATOM   7721  C  C    . HIS B  1 179 ? -30.009 -44.105 -122.856 1.00 11.74  ? 179 HIS A C    1 
ATOM   7722  O  O    . HIS B  1 179 ? -31.093 -43.928 -123.411 1.00 12.38  ? 179 HIS A O    1 
ATOM   7723  C  CB   . HIS B  1 179 ? -30.112 -46.211 -121.471 1.00 10.65  ? 179 HIS A CB   1 
ATOM   7724  C  CG   . HIS B  1 179 ? -28.941 -46.963 -122.013 1.00 12.89  ? 179 HIS A CG   1 
ATOM   7725  N  ND1  . HIS B  1 179 ? -28.605 -46.952 -123.349 1.00 16.93  ? 179 HIS A ND1  1 
ATOM   7726  C  CD2  . HIS B  1 179 ? -28.003 -47.724 -121.392 1.00 20.05  ? 179 HIS A CD2  1 
ATOM   7727  C  CE1  . HIS B  1 179 ? -27.514 -47.685 -123.529 1.00 17.99  ? 179 HIS A CE1  1 
ATOM   7728  N  NE2  . HIS B  1 179 ? -27.128 -48.159 -122.356 1.00 17.73  ? 179 HIS A NE2  1 
ATOM   7729  H  H    . HIS B  1 179 ? -31.707 -44.223 -120.773 1.00 9.79   ? 179 HIS A H    1 
ATOM   7730  H  HA   . HIS B  1 179 ? -29.029 -44.510 -121.111 1.00 10.05  ? 179 HIS A HA   1 
ATOM   7731  H  HB2  . HIS B  1 179 ? -30.266 -46.519 -120.564 1.00 12.78  ? 179 HIS A HB2  1 
ATOM   7732  H  HB3  . HIS B  1 179 ? -30.880 -46.421 -122.024 1.00 12.78  ? 179 HIS A HB3  1 
ATOM   7733  H  HD2  . HIS B  1 179 ? -27.960 -47.913 -120.482 1.00 24.06  ? 179 HIS A HD2  1 
ATOM   7734  H  HE1  . HIS B  1 179 ? -27.091 -47.839 -124.343 1.00 21.59  ? 179 HIS A HE1  1 
ATOM   7735  N  N    . ALA B  1 180 ? -28.845 -43.801 -123.418 1.00 8.82   ? 180 ALA A N    1 
ATOM   7736  C  CA   . ALA B  1 180 ? -28.744 -43.346 -124.795 1.00 8.95   ? 180 ALA A CA   1 
ATOM   7737  C  C    . ALA B  1 180 ? -29.347 -44.358 -125.755 1.00 8.98   ? 180 ALA A C    1 
ATOM   7738  O  O    . ALA B  1 180 ? -29.459 -45.535 -125.421 1.00 11.65  ? 180 ALA A O    1 
ATOM   7739  C  CB   . ALA B  1 180 ? -27.308 -43.105 -125.158 1.00 11.35  ? 180 ALA A CB   1 
ATOM   7740  H  H    . ALA B  1 180 ? -28.087 -43.851 -123.014 1.00 10.59  ? 180 ALA A H    1 
ATOM   7741  H  HA   . ALA B  1 180 ? -29.226 -42.510 -124.892 1.00 10.73  ? 180 ALA A HA   1 
ATOM   7742  H  HB1  . ALA B  1 180 ? -27.261 -42.803 -126.079 1.00 13.62  ? 180 ALA A HB1  1 
ATOM   7743  H  HB2  . ALA B  1 180 ? -26.942 -42.428 -124.568 1.00 13.62  ? 180 ALA A HB2  1 
ATOM   7744  H  HB3  . ALA B  1 180 ? -26.814 -43.934 -125.057 1.00 13.62  ? 180 ALA A HB3  1 
ATOM   7745  N  N    . ILE B  1 181 ? -29.701 -43.909 -126.954 1.00 11.57  ? 181 ILE A N    1 
ATOM   7746  C  CA   . ILE B  1 181 ? -30.243 -44.816 -127.949 1.00 9.78   ? 181 ILE A CA   1 
ATOM   7747  C  C    . ILE B  1 181 ? -29.136 -45.697 -128.508 1.00 13.75  ? 181 ILE A C    1 
ATOM   7748  O  O    . ILE B  1 181 ? -27.958 -45.361 -128.438 1.00 11.73  ? 181 ILE A O    1 
ATOM   7749  C  CB   . ILE B  1 181 ? -30.962 -44.076 -129.111 1.00 14.61  ? 181 ILE A CB   1 
ATOM   7750  C  CG1  . ILE B  1 181 ? -29.973 -43.304 -129.980 1.00 20.98  ? 181 ILE A CG1  1 
ATOM   7751  C  CG2  . ILE B  1 181 ? -32.043 -43.192 -128.553 1.00 20.47  ? 181 ILE A CG2  1 
ATOM   7752  C  CD1  . ILE B  1 181 ? -30.622 -42.473 -131.065 1.00 34.27  ? 181 ILE A CD1  1 
ATOM   7753  H  H    . ILE B  1 181 ? -29.637 -43.091 -127.211 1.00 13.89  ? 181 ILE A H    1 
ATOM   7754  H  HA   . ILE B  1 181 ? -30.893 -45.395 -127.521 1.00 11.74  ? 181 ILE A HA   1 
ATOM   7755  H  HB   . ILE B  1 181 ? -31.387 -44.745 -129.671 1.00 17.53  ? 181 ILE A HB   1 
ATOM   7756  H  HG12 . ILE B  1 181 ? -29.463 -42.704 -129.413 1.00 25.18  ? 181 ILE A HG12 1 
ATOM   7757  H  HG13 . ILE B  1 181 ? -29.375 -43.936 -130.409 1.00 25.18  ? 181 ILE A HG13 1 
ATOM   7758  H  HG21 . ILE B  1 181 ? -32.486 -42.735 -129.285 1.00 24.56  ? 181 ILE A HG21 1 
ATOM   7759  H  HG22 . ILE B  1 181 ? -32.682 -43.740 -128.071 1.00 24.56  ? 181 ILE A HG22 1 
ATOM   7760  H  HG23 . ILE B  1 181 ? -31.643 -42.544 -127.953 1.00 24.56  ? 181 ILE A HG23 1 
ATOM   7761  H  HD11 . ILE B  1 181 ? -29.930 -42.017 -131.569 1.00 41.12  ? 181 ILE A HD11 1 
ATOM   7762  H  HD12 . ILE B  1 181 ? -31.127 -43.058 -131.651 1.00 41.12  ? 181 ILE A HD12 1 
ATOM   7763  H  HD13 . ILE B  1 181 ? -31.215 -41.824 -130.654 1.00 41.12  ? 181 ILE A HD13 1 
ATOM   7764  N  N    . THR B  1 182 ? -29.521 -46.842 -129.042 1.00 10.20  ? 182 THR A N    1 
ATOM   7765  C  CA   . THR B  1 182 ? -28.560 -47.761 -129.635 1.00 13.10  ? 182 THR A CA   1 
ATOM   7766  C  C    . THR B  1 182 ? -29.034 -48.252 -131.001 1.00 11.51  ? 182 THR A C    1 
ATOM   7767  O  O    . THR B  1 182 ? -30.146 -47.973 -131.423 1.00 12.95  ? 182 THR A O    1 
ATOM   7768  C  CB   . THR B  1 182 ? -28.320 -48.993 -128.743 1.00 19.99  ? 182 THR A CB   1 
ATOM   7769  O  OG1  . THR B  1 182 ? -29.537 -49.731 -128.626 1.00 18.94  ? 182 THR A OG1  1 
ATOM   7770  C  CG2  . THR B  1 182 ? -27.827 -48.597 -127.335 1.00 26.58  ? 182 THR A CG2  1 
ATOM   7771  H  H    . THR B  1 182 ? -30.336 -47.114 -129.076 1.00 12.24  ? 182 THR A H    1 
ATOM   7772  H  HA   . THR B  1 182 ? -27.713 -47.303 -129.754 1.00 15.72  ? 182 THR A HA   1 
ATOM   7773  H  HB   . THR B  1 182 ? -27.645 -49.555 -129.153 1.00 23.98  ? 182 THR A HB   1 
ATOM   7774  H  HG1  . THR B  1 182 ? -29.418 -50.407 -128.141 1.00 22.73  ? 182 THR A HG1  1 
ATOM   7775  H  HG21 . THR B  1 182 ? -27.685 -49.392 -126.798 1.00 31.89  ? 182 THR A HG21 1 
ATOM   7776  H  HG22 . THR B  1 182 ? -26.991 -48.108 -127.401 1.00 31.89  ? 182 THR A HG22 1 
ATOM   7777  H  HG23 . THR B  1 182 ? -28.486 -48.036 -126.898 1.00 31.89  ? 182 THR A HG23 1 
ATOM   7778  N  N    . ALA B  1 183 ? -28.187 -49.044 -131.641 1.00 12.43  ? 183 ALA A N    1 
ATOM   7779  C  CA   . ALA B  1 183 ? -28.431 -49.549 -132.976 1.00 13.43  ? 183 ALA A CA   1 
ATOM   7780  C  C    . ALA B  1 183 ? -29.668 -50.457 -133.070 1.00 14.68  ? 183 ALA A C    1 
ATOM   7781  O  O    . ALA B  1 183 ? -30.186 -50.667 -134.144 1.00 13.54  ? 183 ALA A O    1 
ATOM   7782  C  CB   . ALA B  1 183 ? -27.178 -50.308 -133.471 1.00 15.92  ? 183 ALA A CB   1 
ATOM   7783  H  H    . ALA B  1 183 ? -27.440 -49.310 -131.309 1.00 14.91  ? 183 ALA A H    1 
ATOM   7784  H  HA   . ALA B  1 183 ? -28.574 -48.797 -133.571 1.00 16.11  ? 183 ALA A HA   1 
ATOM   7785  H  HB1  . ALA B  1 183 ? -27.346 -50.645 -134.365 1.00 19.10  ? 183 ALA A HB1  1 
ATOM   7786  H  HB2  . ALA B  1 183 ? -26.424 -49.698 -133.483 1.00 19.10  ? 183 ALA A HB2  1 
ATOM   7787  H  HB3  . ALA B  1 183 ? -26.998 -51.046 -132.868 1.00 19.10  ? 183 ALA A HB3  1 
ATOM   7788  N  N    . THR B  1 184 ? -30.142 -51.009 -131.964 1.00 12.82  ? 184 THR A N    1 
ATOM   7789  C  CA   . THR B  1 184 ? -31.303 -51.885 -132.054 1.00 15.56  ? 184 THR A CA   1 
ATOM   7790  C  C    . THR B  1 184 ? -32.595 -51.064 -132.160 1.00 16.42  ? 184 THR A C    1 
ATOM   7791  O  O    . THR B  1 184 ? -33.637 -51.584 -132.544 1.00 18.95  ? 184 THR A O    1 
ATOM   7792  C  CB   . THR B  1 184 ? -31.385 -52.836 -130.846 1.00 15.02  ? 184 THR A CB   1 
ATOM   7793  O  OG1  . THR B  1 184 ? -31.454 -52.071 -129.650 1.00 21.95  ? 184 THR A OG1  1 
ATOM   7794  C  CG2  . THR B  1 184 ? -30.176 -53.750 -130.798 1.00 27.03  ? 184 THR A CG2  1 
ATOM   7795  H  H    . THR B  1 184 ? -29.824 -50.900 -131.173 1.00 15.38  ? 184 THR A H    1 
ATOM   7796  H  HA   . THR B  1 184 ? -31.227 -52.426 -132.856 1.00 18.67  ? 184 THR A HA   1 
ATOM   7797  H  HB   . THR B  1 184 ? -32.181 -53.386 -130.923 1.00 18.02  ? 184 THR A HB   1 
ATOM   7798  H  HG1  . THR B  1 184 ? -30.770 -51.588 -129.577 1.00 26.34  ? 184 THR A HG1  1 
ATOM   7799  H  HG21 . THR B  1 184 ? -30.239 -54.343 -130.034 1.00 32.44  ? 184 THR A HG21 1 
ATOM   7800  H  HG22 . THR B  1 184 ? -30.131 -54.282 -131.608 1.00 32.44  ? 184 THR A HG22 1 
ATOM   7801  H  HG23 . THR B  1 184 ? -29.365 -53.223 -130.722 1.00 32.44  ? 184 THR A HG23 1 
ATOM   7802  N  N    . GLN B  1 185 ? -32.520 -49.774 -131.853 1.00 11.38  ? 185 GLN A N    1 
ATOM   7803  C  CA   . GLN B  1 185 ? -33.703 -48.913 -131.950 1.00 10.74  ? 185 GLN A CA   1 
ATOM   7804  C  C    . GLN B  1 185 ? -33.968 -48.441 -133.378 1.00 12.39  ? 185 GLN A C    1 
ATOM   7805  O  O    . GLN B  1 185 ? -33.160 -48.667 -134.285 1.00 12.89  ? 185 GLN A O    1 
ATOM   7806  C  CB   . GLN B  1 185 ? -33.553 -47.729 -131.014 1.00 11.01  ? 185 GLN A CB   1 
ATOM   7807  C  CG   . GLN B  1 185 ? -33.770 -48.119 -129.542 1.00 14.58  ? 185 GLN A CG   1 
ATOM   7808  C  CD   . GLN B  1 185 ? -33.773 -46.926 -128.628 1.00 21.57  ? 185 GLN A CD   1 
ATOM   7809  O  OE1  . GLN B  1 185 ? -32.788 -46.646 -127.953 1.00 20.30  ? 185 GLN A OE1  1 
ATOM   7810  N  NE2  . GLN B  1 185 ? -34.878 -46.205 -128.608 1.00 13.32  ? 185 GLN A NE2  1 
ATOM   7811  H  H    . GLN B  1 185 ? -31.807 -49.372 -131.588 1.00 13.66  ? 185 GLN A H    1 
ATOM   7812  H  HA   . GLN B  1 185 ? -34.478 -49.419 -131.660 1.00 12.89  ? 185 GLN A HA   1 
ATOM   7813  H  HB2  . GLN B  1 185 ? -32.658 -47.366 -131.101 1.00 13.21  ? 185 GLN A HB2  1 
ATOM   7814  H  HB3  . GLN B  1 185 ? -34.210 -47.055 -131.247 1.00 13.21  ? 185 GLN A HB3  1 
ATOM   7815  H  HG2  . GLN B  1 185 ? -34.625 -48.567 -129.455 1.00 17.50  ? 185 GLN A HG2  1 
ATOM   7816  H  HG3  . GLN B  1 185 ? -33.054 -48.710 -129.262 1.00 17.50  ? 185 GLN A HG3  1 
ATOM   7817  H  HE21 . GLN B  1 185 ? -35.546 -46.428 -129.102 1.00 15.98  ? 185 GLN A HE21 1 
ATOM   7818  H  HE22 . GLN B  1 185 ? -34.930 -45.513 -128.101 1.00 15.98  ? 185 GLN A HE22 1 
ATOM   7819  N  N    . LYS B  1 186 ? -35.110 -47.787 -133.558 1.00 12.53  ? 186 LYS A N    1 
ATOM   7820  C  CA   . LYS B  1 186 ? -35.601 -47.383 -134.866 1.00 11.08  ? 186 LYS A CA   1 
ATOM   7821  C  C    . LYS B  1 186 ? -35.666 -45.878 -134.952 1.00 10.97  ? 186 LYS A C    1 
ATOM   7822  O  O    . LYS B  1 186 ? -35.974 -45.237 -133.960 1.00 13.44  ? 186 LYS A O    1 
ATOM   7823  C  CB   . LYS B  1 186 ? -37.002 -47.959 -135.124 1.00 12.17  ? 186 LYS A CB   1 
ATOM   7824  C  CG   . LYS B  1 186 ? -37.085 -49.485 -135.074 1.00 16.63  ? 186 LYS A CG   1 
ATOM   7825  C  CD   . LYS B  1 186 ? -36.441 -50.098 -136.284 1.00 21.14  ? 186 LYS A CD   1 
ATOM   7826  C  CE   . LYS B  1 186 ? -36.745 -51.586 -136.391 1.00 36.47  ? 186 LYS A CE   1 
ATOM   7827  N  NZ   . LYS B  1 186 ? -36.122 -52.329 -135.275 1.00 47.34  ? 186 LYS A NZ   1 
ATOM   7828  H  H    . LYS B  1 186 ? -35.634 -47.559 -132.914 1.00 15.03  ? 186 LYS A H    1 
ATOM   7829  H  HA   . LYS B  1 186 ? -35.000 -47.708 -135.554 1.00 13.30  ? 186 LYS A HA   1 
ATOM   7830  H  HB2  . LYS B  1 186 ? -37.609 -47.610 -134.453 1.00 14.60  ? 186 LYS A HB2  1 
ATOM   7831  H  HB3  . LYS B  1 186 ? -37.294 -47.678 -136.005 1.00 14.60  ? 186 LYS A HB3  1 
ATOM   7832  H  HG2  . LYS B  1 186 ? -36.621 -49.806 -134.285 1.00 19.96  ? 186 LYS A HG2  1 
ATOM   7833  H  HG3  . LYS B  1 186 ? -38.016 -49.756 -135.052 1.00 19.96  ? 186 LYS A HG3  1 
ATOM   7834  H  HD2  . LYS B  1 186 ? -36.779 -49.661 -137.082 1.00 25.37  ? 186 LYS A HD2  1 
ATOM   7835  H  HD3  . LYS B  1 186 ? -35.479 -49.988 -136.224 1.00 25.37  ? 186 LYS A HD3  1 
ATOM   7836  H  HE2  . LYS B  1 186 ? -37.704 -51.722 -136.353 1.00 43.77  ? 186 LYS A HE2  1 
ATOM   7837  H  HE3  . LYS B  1 186 ? -36.387 -51.929 -137.225 1.00 43.77  ? 186 LYS A HE3  1 
ATOM   7838  H  HZ1  . LYS B  1 186 ? -36.438 -52.030 -134.498 1.00 56.81  ? 186 LYS A HZ1  1 
ATOM   7839  H  HZ2  . LYS B  1 186 ? -36.306 -53.196 -135.347 1.00 56.81  ? 186 LYS A HZ2  1 
ATOM   7840  H  HZ3  . LYS B  1 186 ? -35.240 -52.218 -135.290 1.00 56.81  ? 186 LYS A HZ3  1 
ATOM   7841  N  N    . THR B  1 187 ? -35.406 -45.322 -136.136 1.00 10.55  ? 187 THR A N    1 
ATOM   7842  C  CA   . THR B  1 187 ? -35.538 -43.878 -136.347 1.00 11.88  ? 187 THR A CA   1 
ATOM   7843  C  C    . THR B  1 187 ? -36.993 -43.382 -136.346 1.00 14.22  ? 187 THR A C    1 
ATOM   7844  O  O    . THR B  1 187 ? -37.254 -42.277 -135.905 1.00 15.59  ? 187 THR A O    1 
ATOM   7845  C  CB   . THR B  1 187 ? -34.927 -43.447 -137.674 1.00 13.03  ? 187 THR A CB   1 
ATOM   7846  O  OG1  . THR B  1 187 ? -35.464 -44.276 -138.705 1.00 14.94  ? 187 THR A OG1  1 
ATOM   7847  C  CG2  . THR B  1 187 ? -33.418 -43.566 -137.650 1.00 14.01  ? 187 THR A CG2  1 
ATOM   7848  H  H    . THR B  1 187 ? -35.153 -45.757 -136.833 1.00 12.66  ? 187 THR A H    1 
ATOM   7849  H  HA   . THR B  1 187 ? -35.066 -43.414 -135.638 1.00 14.25  ? 187 THR A HA   1 
ATOM   7850  H  HB   . THR B  1 187 ? -35.159 -42.522 -137.851 1.00 15.64  ? 187 THR A HB   1 
ATOM   7851  H  HG1  . THR B  1 187 ? -35.141 -44.057 -139.448 1.00 17.92  ? 187 THR A HG1  1 
ATOM   7852  H  HG21 . THR B  1 187 ? -33.051 -43.287 -138.503 1.00 16.82  ? 187 THR A HG21 1 
ATOM   7853  H  HG22 . THR B  1 187 ? -33.053 -43.002 -136.950 1.00 16.82  ? 187 THR A HG22 1 
ATOM   7854  H  HG23 . THR B  1 187 ? -33.161 -44.485 -137.480 1.00 16.82  ? 187 THR A HG23 1 
ATOM   7855  N  N    . VAL B  1 188 ? -37.911 -44.175 -136.895 1.00 10.36  ? 188 VAL A N    1 
ATOM   7856  C  CA   . VAL B  1 188 ? -39.346 -43.872 -136.881 1.00 13.29  ? 188 VAL A CA   1 
ATOM   7857  C  C    . VAL B  1 188 ? -40.080 -45.166 -136.521 1.00 12.17  ? 188 VAL A C    1 
ATOM   7858  O  O    . VAL B  1 188 ? -39.493 -46.233 -136.629 1.00 15.16  ? 188 VAL A O    1 
ATOM   7859  C  CB   . VAL B  1 188 ? -39.847 -43.338 -138.242 1.00 25.21  ? 188 VAL A CB   1 
ATOM   7860  C  CG1  . VAL B  1 188 ? -39.065 -42.096 -138.661 1.00 21.98  ? 188 VAL A CG1  1 
ATOM   7861  C  CG2  . VAL B  1 188 ? -39.727 -44.400 -139.317 1.00 18.63  ? 188 VAL A CG2  1 
ATOM   7862  H  H    . VAL B  1 188 ? -37.724 -44.915 -137.293 1.00 12.43  ? 188 VAL A H    1 
ATOM   7863  H  HA   . VAL B  1 188 ? -39.533 -43.208 -136.199 1.00 15.94  ? 188 VAL A HA   1 
ATOM   7864  H  HB   . VAL B  1 188 ? -40.783 -43.094 -138.163 1.00 30.26  ? 188 VAL A HB   1 
ATOM   7865  H  HG11 . VAL B  1 188 ? -39.402 -41.785 -139.516 1.00 26.37  ? 188 VAL A HG11 1 
ATOM   7866  H  HG12 . VAL B  1 188 ? -39.184 -41.407 -137.988 1.00 26.37  ? 188 VAL A HG12 1 
ATOM   7867  H  HG13 . VAL B  1 188 ? -38.126 -42.325 -138.738 1.00 26.37  ? 188 VAL A HG13 1 
ATOM   7868  H  HG21 . VAL B  1 188 ? -40.048 -44.036 -140.157 1.00 22.36  ? 188 VAL A HG21 1 
ATOM   7869  H  HG22 . VAL B  1 188 ? -38.795 -44.657 -139.403 1.00 22.36  ? 188 VAL A HG22 1 
ATOM   7870  H  HG23 . VAL B  1 188 ? -40.261 -45.168 -139.063 1.00 22.36  ? 188 VAL A HG23 1 
ATOM   7871  N  N    . ASP B  1 189 ? -41.339 -45.068 -136.099 1.00 9.84   ? 189 ASP A N    1 
ATOM   7872  C  CA   . ASP B  1 189 ? -42.121 -46.237 -135.679 1.00 10.98  ? 189 ASP A CA   1 
ATOM   7873  C  C    . ASP B  1 189 ? -41.969 -47.363 -136.685 1.00 15.16  ? 189 ASP A C    1 
ATOM   7874  O  O    . ASP B  1 189 ? -42.361 -47.224 -137.839 1.00 13.21  ? 189 ASP A O    1 
ATOM   7875  C  CB   . ASP B  1 189 ? -43.623 -45.918 -135.533 1.00 10.18  ? 189 ASP A CB   1 
ATOM   7876  C  CG   . ASP B  1 189 ? -43.962 -45.034 -134.331 1.00 11.60  ? 189 ASP A CG   1 
ATOM   7877  O  OD1  . ASP B  1 189 ? -43.099 -44.695 -133.496 1.00 13.34  ? 189 ASP A OD1  1 
ATOM   7878  O  OD2  . ASP B  1 189 ? -45.157 -44.680 -134.215 1.00 13.83  ? 189 ASP A OD2  1 
ATOM   7879  H  H    . ASP B  1 189 ? -41.771 -44.327 -136.046 1.00 11.80  ? 189 ASP A H    1 
ATOM   7880  H  HA   . ASP B  1 189 ? -41.792 -46.549 -134.821 1.00 13.18  ? 189 ASP A HA   1 
ATOM   7881  H  HB2  . ASP B  1 189 ? -43.922 -45.457 -136.332 1.00 12.21  ? 189 ASP A HB2  1 
ATOM   7882  H  HB3  . ASP B  1 189 ? -44.110 -46.751 -135.433 1.00 12.21  ? 189 ASP A HB3  1 
ATOM   7883  N  N    . GLY B  1 190 ? -41.408 -48.479 -136.235 1.00 15.28  ? 190 GLY A N    1 
ATOM   7884  C  CA   . GLY B  1 190 ? -41.255 -49.648 -137.082 1.00 15.17  ? 190 GLY A CA   1 
ATOM   7885  C  C    . GLY B  1 190 ? -41.375 -50.934 -136.283 1.00 14.32  ? 190 GLY A C    1 
ATOM   7886  O  O    . GLY B  1 190 ? -41.634 -50.884 -135.076 1.00 16.95  ? 190 GLY A O    1 
ATOM   7887  H  H    . GLY B  1 190 ? -41.107 -48.584 -135.436 1.00 18.33  ? 190 GLY A H    1 
ATOM   7888  H  HA2  . GLY B  1 190 ? -41.940 -49.644 -137.769 1.00 18.20  ? 190 GLY A HA2  1 
ATOM   7889  H  HA3  . GLY B  1 190 ? -40.385 -49.629 -137.510 1.00 18.20  ? 190 GLY A HA3  1 
ATOM   7890  N  N    . PRO B  1 191 ? -41.177 -52.086 -136.946 1.00 18.65  ? 191 PRO A N    1 
ATOM   7891  C  CA   . PRO B  1 191 ? -41.446 -53.400 -136.354 1.00 19.46  ? 191 PRO A CA   1 
ATOM   7892  C  C    . PRO B  1 191 ? -40.399 -53.884 -135.360 1.00 23.70  ? 191 PRO A C    1 
ATOM   7893  O  O    . PRO B  1 191 ? -39.195 -53.868 -135.613 1.00 19.25  ? 191 PRO A O    1 
ATOM   7894  C  CB   . PRO B  1 191 ? -41.475 -54.338 -137.572 1.00 33.02  ? 191 PRO A CB   1 
ATOM   7895  C  CG   . PRO B  1 191 ? -41.605 -53.467 -138.747 1.00 33.90  ? 191 PRO A CG   1 
ATOM   7896  C  CD   . PRO B  1 191 ? -40.892 -52.208 -138.385 1.00 26.00  ? 191 PRO A CD   1 
ATOM   7897  H  HA   . PRO B  1 191 ? -42.317 -53.404 -135.927 1.00 23.35  ? 191 PRO A HA   1 
ATOM   7898  H  HB2  . PRO B  1 191 ? -40.648 -54.844 -137.613 1.00 39.63  ? 191 PRO A HB2  1 
ATOM   7899  H  HB3  . PRO B  1 191 ? -42.237 -54.935 -137.504 1.00 39.63  ? 191 PRO A HB3  1 
ATOM   7900  H  HG2  . PRO B  1 191 ? -41.187 -53.888 -139.514 1.00 40.69  ? 191 PRO A HG2  1 
ATOM   7901  H  HG3  . PRO B  1 191 ? -42.543 -53.291 -138.921 1.00 40.69  ? 191 PRO A HG3  1 
ATOM   7902  H  HD2  . PRO B  1 191 ? -39.938 -52.301 -138.537 1.00 31.19  ? 191 PRO A HD2  1 
ATOM   7903  H  HD3  . PRO B  1 191 ? -41.262 -51.455 -138.871 1.00 31.19  ? 191 PRO A HD3  1 
ATOM   7904  N  N    . SER B  1 192 ? -40.903 -54.348 -134.228 1.00 20.12  ? 192 SER A N    1 
ATOM   7905  C  CA   . SER B  1 192 ? -40.095 -54.906 -133.161 1.00 20.32  ? 192 SER A CA   1 
ATOM   7906  C  C    . SER B  1 192 ? -40.992 -55.923 -132.472 1.00 29.34  ? 192 SER A C    1 
ATOM   7907  O  O    . SER B  1 192 ? -41.485 -55.697 -131.364 1.00 22.64  ? 192 SER A O    1 
ATOM   7908  C  CB   . SER B  1 192 ? -39.623 -53.805 -132.207 1.00 27.39  ? 192 SER A CB   1 
ATOM   7909  O  OG   . SER B  1 192 ? -38.883 -54.331 -131.126 1.00 24.68  ? 192 SER A OG   1 
ATOM   7910  H  H    . SER B  1 192 ? -41.745 -54.350 -134.050 1.00 24.15  ? 192 SER A H    1 
ATOM   7911  H  HA   . SER B  1 192 ? -39.322 -55.361 -133.530 1.00 24.39  ? 192 SER A HA   1 
ATOM   7912  H  HB2  . SER B  1 192 ? -39.061 -53.185 -132.698 1.00 32.86  ? 192 SER A HB2  1 
ATOM   7913  H  HB3  . SER B  1 192 ? -40.399 -53.340 -131.858 1.00 32.86  ? 192 SER A HB3  1 
ATOM   7914  H  HG   . SER B  1 192 ? -39.357 -54.869 -130.688 1.00 29.61  ? 192 SER A HG   1 
ATOM   7915  N  N    . GLY B  1 193 ? -41.234 -57.033 -133.164 1.00 28.05  ? 193 GLY A N    1 
ATOM   7916  C  CA   . GLY B  1 193 ? -42.278 -57.968 -132.787 1.00 27.92  ? 193 GLY A CA   1 
ATOM   7917  C  C    . GLY B  1 193 ? -42.203 -58.568 -131.394 1.00 22.78  ? 193 GLY A C    1 
ATOM   7918  O  O    . GLY B  1 193 ? -43.220 -58.973 -130.831 1.00 29.98  ? 193 GLY A O    1 
ATOM   7919  H  H    . GLY B  1 193 ? -40.798 -57.266 -133.868 1.00 33.65  ? 193 GLY A H    1 
ATOM   7920  H  HA2  . GLY B  1 193 ? -43.134 -57.518 -132.864 1.00 33.50  ? 193 GLY A HA2  1 
ATOM   7921  H  HA3  . GLY B  1 193 ? -42.274 -58.703 -133.421 1.00 33.50  ? 193 GLY A HA3  1 
ATOM   7922  N  N    . LYS B  1 194 ? -41.002 -58.665 -130.848 1.00 23.04  ? 194 LYS A N    1 
ATOM   7923  C  CA   . LYS B  1 194 ? -40.813 -59.251 -129.531 1.00 29.76  ? 194 LYS A CA   1 
ATOM   7924  C  C    . LYS B  1 194 ? -40.900 -58.205 -128.410 1.00 32.15  ? 194 LYS A C    1 
ATOM   7925  O  O    . LYS B  1 194 ? -41.199 -58.528 -127.261 1.00 39.10  ? 194 LYS A O    1 
ATOM   7926  C  CB   . LYS B  1 194 ? -39.461 -59.971 -129.482 1.00 39.92  ? 194 LYS A CB   1 
ATOM   7927  C  CG   . LYS B  1 194 ? -39.369 -61.141 -130.446 1.00 50.45  ? 194 LYS A CG   1 
ATOM   7928  C  CD   . LYS B  1 194 ? -37.988 -61.783 -130.432 1.00 62.99  ? 194 LYS A CD   1 
ATOM   7929  C  CE   . LYS B  1 194 ? -37.917 -62.966 -131.393 1.00 69.72  ? 194 LYS A CE   1 
ATOM   7930  N  NZ   . LYS B  1 194 ? -36.554 -63.559 -131.458 1.00 73.35  ? 194 LYS A NZ   1 
ATOM   7931  H  H    . LYS B  1 194 ? -40.275 -58.398 -131.221 1.00 27.65  ? 194 LYS A H    1 
ATOM   7932  H  HA   . LYS B  1 194 ? -41.508 -59.910 -129.378 1.00 35.72  ? 194 LYS A HA   1 
ATOM   7933  H  HB2  . LYS B  1 194 ? -38.761 -59.340 -129.710 1.00 47.90  ? 194 LYS A HB2  1 
ATOM   7934  H  HB3  . LYS B  1 194 ? -39.319 -60.311 -128.585 1.00 47.90  ? 194 LYS A HB3  1 
ATOM   7935  H  HG2  . LYS B  1 194 ? -40.019 -61.815 -130.193 1.00 60.54  ? 194 LYS A HG2  1 
ATOM   7936  H  HG3  . LYS B  1 194 ? -39.547 -60.826 -131.346 1.00 60.54  ? 194 LYS A HG3  1 
ATOM   7937  H  HD2  . LYS B  1 194 ? -37.327 -61.128 -130.706 1.00 75.59  ? 194 LYS A HD2  1 
ATOM   7938  H  HD3  . LYS B  1 194 ? -37.793 -62.104 -129.537 1.00 75.59  ? 194 LYS A HD3  1 
ATOM   7939  H  HE2  . LYS B  1 194 ? -38.532 -63.655 -131.094 1.00 83.67  ? 194 LYS A HE2  1 
ATOM   7940  H  HE3  . LYS B  1 194 ? -38.158 -62.667 -132.283 1.00 83.67  ? 194 LYS A HE3  1 
ATOM   7941  H  HZ1  . LYS B  1 194 ? -36.547 -64.245 -132.025 1.00 88.02  ? 194 LYS A HZ1  1 
ATOM   7942  H  HZ2  . LYS B  1 194 ? -35.969 -62.948 -131.735 1.00 88.02  ? 194 LYS A HZ2  1 
ATOM   7943  H  HZ3  . LYS B  1 194 ? -36.309 -63.848 -130.652 1.00 88.02  ? 194 LYS A HZ3  1 
ATOM   7944  N  N    . LEU B  1 195 ? -40.646 -56.954 -128.760 1.00 21.26  ? 195 LEU A N    1 
ATOM   7945  C  CA   . LEU B  1 195 ? -40.586 -55.856 -127.787 1.00 14.58  ? 195 LEU A CA   1 
ATOM   7946  C  C    . LEU B  1 195 ? -41.209 -54.614 -128.420 1.00 13.60  ? 195 LEU A C    1 
ATOM   7947  O  O    . LEU B  1 195 ? -40.516 -53.798 -129.009 1.00 15.32  ? 195 LEU A O    1 
ATOM   7948  C  CB   . LEU B  1 195 ? -39.154 -55.592 -127.374 1.00 20.53  ? 195 LEU A CB   1 
ATOM   7949  C  CG   . LEU B  1 195 ? -38.411 -56.752 -126.700 1.00 34.07  ? 195 LEU A CG   1 
ATOM   7950  C  CD1  . LEU B  1 195 ? -36.908 -56.520 -126.723 1.00 40.42  ? 195 LEU A CD1  1 
ATOM   7951  C  CD2  . LEU B  1 195 ? -38.909 -56.931 -125.280 1.00 41.32  ? 195 LEU A CD2  1 
ATOM   7952  H  H    . LEU B  1 195 ? -40.502 -56.703 -129.570 1.00 25.52  ? 195 LEU A H    1 
ATOM   7953  H  HA   . LEU B  1 195 ? -41.098 -56.092 -126.998 1.00 17.49  ? 195 LEU A HA   1 
ATOM   7954  H  HB2  . LEU B  1 195 ? -38.649 -55.350 -128.166 1.00 24.63  ? 195 LEU A HB2  1 
ATOM   7955  H  HB3  . LEU B  1 195 ? -39.150 -54.848 -126.751 1.00 24.63  ? 195 LEU A HB3  1 
ATOM   7956  H  HG   . LEU B  1 195 ? -38.595 -57.570 -127.187 1.00 40.89  ? 195 LEU A HG   1 
ATOM   7957  H  HD11 . LEU B  1 195 ? -36.467 -57.268 -126.291 1.00 48.51  ? 195 LEU A HD11 1 
ATOM   7958  H  HD12 . LEU B  1 195 ? -36.614 -56.449 -127.645 1.00 48.51  ? 195 LEU A HD12 1 
ATOM   7959  H  HD13 . LEU B  1 195 ? -36.709 -55.698 -126.248 1.00 48.51  ? 195 LEU A HD13 1 
ATOM   7960  H  HD21 . LEU B  1 195 ? -38.431 -57.667 -124.868 1.00 49.59  ? 195 LEU A HD21 1 
ATOM   7961  H  HD22 . LEU B  1 195 ? -38.749 -56.112 -124.784 1.00 49.59  ? 195 LEU A HD22 1 
ATOM   7962  H  HD23 . LEU B  1 195 ? -39.860 -57.124 -125.302 1.00 49.59  ? 195 LEU A HD23 1 
ATOM   7963  N  N    . TRP B  1 196 ? -42.527 -54.507 -128.332 1.00 13.84  ? 196 TRP A N    1 
ATOM   7964  C  CA   . TRP B  1 196 ? -43.270 -53.506 -129.095 1.00 13.36  ? 196 TRP A CA   1 
ATOM   7965  C  C    . TRP B  1 196 ? -42.815 -52.074 -128.832 1.00 12.18  ? 196 TRP A C    1 
ATOM   7966  O  O    . TRP B  1 196 ? -42.712 -51.277 -129.759 1.00 13.51  ? 196 TRP A O    1 
ATOM   7967  C  CB   . TRP B  1 196 ? -44.757 -53.631 -128.799 1.00 13.92  ? 196 TRP A CB   1 
ATOM   7968  C  CG   . TRP B  1 196 ? -45.393 -54.872 -129.357 1.00 16.06  ? 196 TRP A CG   1 
ATOM   7969  C  CD1  . TRP B  1 196 ? -44.771 -55.885 -130.038 1.00 16.71  ? 196 TRP A CD1  1 
ATOM   7970  C  CD2  . TRP B  1 196 ? -46.780 -55.223 -129.292 1.00 16.12  ? 196 TRP A CD2  1 
ATOM   7971  N  NE1  . TRP B  1 196 ? -45.694 -56.850 -130.394 1.00 20.59  ? 196 TRP A NE1  1 
ATOM   7972  C  CE2  . TRP B  1 196 ? -46.932 -56.462 -129.955 1.00 19.95  ? 196 TRP A CE2  1 
ATOM   7973  C  CE3  . TRP B  1 196 ? -47.913 -54.610 -128.739 1.00 20.85  ? 196 TRP A CE3  1 
ATOM   7974  C  CZ2  . TRP B  1 196 ? -48.168 -57.102 -130.071 1.00 21.15  ? 196 TRP A CZ2  1 
ATOM   7975  C  CZ3  . TRP B  1 196 ? -49.148 -55.253 -128.862 1.00 19.35  ? 196 TRP A CZ3  1 
ATOM   7976  C  CH2  . TRP B  1 196 ? -49.260 -56.485 -129.515 1.00 26.63  ? 196 TRP A CH2  1 
ATOM   7977  H  H    . TRP B  1 196 ? -43.022 -55.004 -127.834 1.00 16.61  ? 196 TRP A H    1 
ATOM   7978  H  HA   . TRP B  1 196 ? -43.144 -53.683 -130.040 1.00 16.03  ? 196 TRP A HA   1 
ATOM   7979  H  HB2  . TRP B  1 196 ? -44.883 -53.641 -127.837 1.00 16.71  ? 196 TRP A HB2  1 
ATOM   7980  H  HB3  . TRP B  1 196 ? -45.216 -52.866 -129.181 1.00 16.71  ? 196 TRP A HB3  1 
ATOM   7981  H  HD1  . TRP B  1 196 ? -43.862 -55.919 -130.230 1.00 20.05  ? 196 TRP A HD1  1 
ATOM   7982  H  HE1  . TRP B  1 196 ? -45.520 -57.572 -130.829 1.00 24.71  ? 196 TRP A HE1  1 
ATOM   7983  H  HE3  . TRP B  1 196 ? -47.844 -53.793 -128.300 1.00 25.02  ? 196 TRP A HE3  1 
ATOM   7984  H  HZ2  . TRP B  1 196 ? -48.247 -57.920 -130.505 1.00 25.38  ? 196 TRP A HZ2  1 
ATOM   7985  H  HZ3  . TRP B  1 196 ? -49.908 -54.857 -128.498 1.00 23.21  ? 196 TRP A HZ3  1 
ATOM   7986  H  HH2  . TRP B  1 196 ? -50.095 -56.888 -129.585 1.00 31.96  ? 196 TRP A HH2  1 
ATOM   7987  N  N    . ARG B  1 197 ? -42.541 -51.745 -127.583 1.00 11.78  ? 197 ARG A N    1 
ATOM   7988  C  CA   . ARG B  1 197 ? -42.131 -50.378 -127.253 1.00 10.84  ? 197 ARG A CA   1 
ATOM   7989  C  C    . ARG B  1 197 ? -40.828 -50.018 -127.974 1.00 10.40  ? 197 ARG A C    1 
ATOM   7990  O  O    . ARG B  1 197 ? -40.631 -48.878 -128.402 1.00 12.63  ? 197 ARG A O    1 
ATOM   7991  C  CB   . ARG B  1 197 ? -41.963 -50.220 -125.751 1.00 10.67  ? 197 ARG A CB   1 
ATOM   7992  C  CG   . ARG B  1 197 ? -43.198 -50.596 -124.938 1.00 11.28  ? 197 ARG A CG   1 
ATOM   7993  C  CD   . ARG B  1 197 ? -43.004 -50.120 -123.542 1.00 11.04  ? 197 ARG A CD   1 
ATOM   7994  N  NE   . ARG B  1 197 ? -43.785 -50.817 -122.517 1.00 12.01  ? 197 ARG A NE   1 
ATOM   7995  C  CZ   . ARG B  1 197 ? -44.479 -50.212 -121.547 1.00 16.42  ? 197 ARG A CZ   1 
ATOM   7996  N  NH1  . ARG B  1 197 ? -44.581 -48.889 -121.495 1.00 11.39  ? 197 ARG A NH1  1 
ATOM   7997  N  NH2  . ARG B  1 197 ? -45.101 -50.931 -120.633 1.00 16.75  ? 197 ARG A NH2  1 
ATOM   7998  H  H    . ARG B  1 197 ? -42.583 -52.281 -126.911 1.00 14.14  ? 197 ARG A H    1 
ATOM   7999  H  HA   . ARG B  1 197 ? -42.819 -49.761 -127.547 1.00 13.01  ? 197 ARG A HA   1 
ATOM   8000  H  HB2  . ARG B  1 197 ? -41.233 -50.788 -125.458 1.00 12.80  ? 197 ARG A HB2  1 
ATOM   8001  H  HB3  . ARG B  1 197 ? -41.753 -49.293 -125.557 1.00 12.80  ? 197 ARG A HB3  1 
ATOM   8002  H  HG2  . ARG B  1 197 ? -43.983 -50.165 -125.311 1.00 13.53  ? 197 ARG A HG2  1 
ATOM   8003  H  HG3  . ARG B  1 197 ? -43.306 -51.560 -124.928 1.00 13.53  ? 197 ARG A HG3  1 
ATOM   8004  H  HD2  . ARG B  1 197 ? -42.068 -50.220 -123.312 1.00 13.25  ? 197 ARG A HD2  1 
ATOM   8005  H  HD3  . ARG B  1 197 ? -43.247 -49.181 -123.503 1.00 13.25  ? 197 ARG A HD3  1 
ATOM   8006  H  HE   . ARG B  1 197 ? -43.798 -51.677 -122.541 1.00 14.41  ? 197 ARG A HE   1 
ATOM   8007  H  HH11 . ARG B  1 197 ? -44.170 -48.403 -122.074 1.00 13.67  ? 197 ARG A HH11 1 
ATOM   8008  H  HH12 . ARG B  1 197 ? -45.042 -48.517 -120.872 1.00 13.67  ? 197 ARG A HH12 1 
ATOM   8009  H  HH21 . ARG B  1 197 ? -45.062 -51.790 -120.662 1.00 20.10  ? 197 ARG A HH21 1 
ATOM   8010  H  HH22 . ARG B  1 197 ? -45.574 -50.542 -120.029 1.00 20.10  ? 197 ARG A HH22 1 
ATOM   8011  N  N    . ASP B  1 198 ? -39.956 -51.011 -128.122 1.00 15.80  ? 198 ASP A N    1 
ATOM   8012  C  CA   . ASP B  1 198 ? -38.646 -50.793 -128.738 1.00 18.67  ? 198 ASP A CA   1 
ATOM   8013  C  C    . ASP B  1 198 ? -38.723 -50.460 -130.228 1.00 18.39  ? 198 ASP A C    1 
ATOM   8014  O  O    . ASP B  1 198 ? -37.753 -49.979 -130.805 1.00 17.71  ? 198 ASP A O    1 
ATOM   8015  C  CB   . ASP B  1 198 ? -37.772 -52.029 -128.544 1.00 30.99  ? 198 ASP A CB   1 
ATOM   8016  C  CG   . ASP B  1 198 ? -37.150 -52.101 -127.151 1.00 39.40  ? 198 ASP A CG   1 
ATOM   8017  O  OD1  . ASP B  1 198 ? -37.549 -51.319 -126.257 1.00 31.52  ? 198 ASP A OD1  1 
ATOM   8018  O  OD2  . ASP B  1 198 ? -36.260 -52.952 -126.956 1.00 50.15  ? 198 ASP A OD2  1 
ATOM   8019  H  H    . ASP B  1 198 ? -40.097 -51.822 -127.875 1.00 18.96  ? 198 ASP A H    1 
ATOM   8020  H  HA   . ASP B  1 198 ? -38.212 -50.050 -128.292 1.00 22.41  ? 198 ASP A HA   1 
ATOM   8021  H  HB2  . ASP B  1 198 ? -38.315 -52.822 -128.672 1.00 37.18  ? 198 ASP A HB2  1 
ATOM   8022  H  HB3  . ASP B  1 198 ? -37.052 -52.011 -129.193 1.00 37.18  ? 198 ASP A HB3  1 
ATOM   8023  N  N    . GLY B  1 199 ? -39.864 -50.721 -130.860 1.00 16.80  ? 199 GLY A N    1 
ATOM   8024  C  CA   . GLY B  1 199 ? -40.021 -50.372 -132.263 1.00 15.23  ? 199 GLY A CA   1 
ATOM   8025  C  C    . GLY B  1 199 ? -40.451 -48.931 -132.504 1.00 10.50  ? 199 GLY A C    1 
ATOM   8026  O  O    . GLY B  1 199 ? -40.415 -48.452 -133.642 1.00 13.32  ? 199 GLY A O    1 
ATOM   8027  H  H    . GLY B  1 199 ? -40.551 -51.095 -130.502 1.00 20.16  ? 199 GLY A H    1 
ATOM   8028  H  HA2  . GLY B  1 199 ? -39.179 -50.516 -132.722 1.00 18.27  ? 199 GLY A HA2  1 
ATOM   8029  H  HA3  . GLY B  1 199 ? -40.686 -50.955 -132.662 1.00 18.27  ? 199 GLY A HA3  1 
ATOM   8030  N  N    . ARG B  1 200 ? -40.859 -48.242 -131.445 1.00 12.82  ? 200 ARG A N    1 
ATOM   8031  C  CA   . ARG B  1 200 ? -41.374 -46.901 -131.564 1.00 11.47  ? 200 ARG A CA   1 
ATOM   8032  C  C    . ARG B  1 200 ? -40.219 -45.908 -131.813 1.00 10.68  ? 200 ARG A C    1 
ATOM   8033  O  O    . ARG B  1 200 ? -39.089 -46.145 -131.369 1.00 11.76  ? 200 ARG A O    1 
ATOM   8034  C  CB   . ARG B  1 200 ? -42.153 -46.532 -130.306 1.00 12.41  ? 200 ARG A CB   1 
ATOM   8035  C  CG   . ARG B  1 200 ? -43.304 -47.516 -129.982 1.00 12.14  ? 200 ARG A CG   1 
ATOM   8036  C  CD   . ARG B  1 200 ? -44.416 -47.480 -131.056 1.00 13.35  ? 200 ARG A CD   1 
ATOM   8037  N  NE   . ARG B  1 200 ? -44.965 -46.139 -131.135 1.00 12.42  ? 200 ARG A NE   1 
ATOM   8038  C  CZ   . ARG B  1 200 ? -45.891 -45.657 -130.313 1.00 17.82  ? 200 ARG A CZ   1 
ATOM   8039  N  NH1  . ARG B  1 200 ? -46.422 -46.418 -129.360 1.00 14.27  ? 200 ARG A NH1  1 
ATOM   8040  N  NH2  . ARG B  1 200 ? -46.279 -44.405 -130.441 1.00 13.51  ? 200 ARG A NH2  1 
ATOM   8041  H  H    . ARG B  1 200 ? -40.844 -48.540 -130.638 1.00 15.38  ? 200 ARG A H    1 
ATOM   8042  H  HA   . ARG B  1 200 ? -41.979 -46.857 -132.320 1.00 13.76  ? 200 ARG A HA   1 
ATOM   8043  H  HB2  . ARG B  1 200 ? -41.545 -46.527 -129.551 1.00 14.89  ? 200 ARG A HB2  1 
ATOM   8044  H  HB3  . ARG B  1 200 ? -42.540 -45.650 -130.425 1.00 14.89  ? 200 ARG A HB3  1 
ATOM   8045  H  HG2  . ARG B  1 200 ? -42.951 -48.418 -129.943 1.00 14.57  ? 200 ARG A HG2  1 
ATOM   8046  H  HG3  . ARG B  1 200 ? -43.700 -47.274 -129.130 1.00 14.57  ? 200 ARG A HG3  1 
ATOM   8047  H  HD2  . ARG B  1 200 ? -44.043 -47.714 -131.921 1.00 16.02  ? 200 ARG A HD2  1 
ATOM   8048  H  HD3  . ARG B  1 200 ? -45.126 -48.093 -130.812 1.00 16.02  ? 200 ARG A HD3  1 
ATOM   8049  H  HE   . ARG B  1 200 ? -44.671 -45.622 -131.756 1.00 14.91  ? 200 ARG A HE   1 
ATOM   8050  H  HH11 . ARG B  1 200 ? -46.160 -47.232 -129.263 1.00 17.12  ? 200 ARG A HH11 1 
ATOM   8051  H  HH12 . ARG B  1 200 ? -47.025 -46.096 -128.839 1.00 17.12  ? 200 ARG A HH12 1 
ATOM   8052  H  HH21 . ARG B  1 200 ? -45.946 -43.913 -131.063 1.00 16.21  ? 200 ARG A HH21 1 
ATOM   8053  H  HH22 . ARG B  1 200 ? -46.894 -44.091 -129.928 1.00 16.21  ? 200 ARG A HH22 1 
ATOM   8054  N  N    . GLY B  1 201 ? -40.498 -44.830 -132.536 1.00 10.38  ? 201 GLY A N    1 
ATOM   8055  C  CA   . GLY B  1 201 ? -39.460 -43.893 -132.979 1.00 10.51  ? 201 GLY A CA   1 
ATOM   8056  C  C    . GLY B  1 201 ? -38.568 -43.417 -131.842 1.00 9.90   ? 201 GLY A C    1 
ATOM   8057  O  O    . GLY B  1 201 ? -39.057 -42.904 -130.845 1.00 9.55   ? 201 GLY A O    1 
ATOM   8058  H  H    . GLY B  1 201 ? -41.290 -44.613 -132.789 1.00 12.46  ? 201 GLY A H    1 
ATOM   8059  H  HA2  . GLY B  1 201 ? -38.901 -44.324 -133.646 1.00 12.61  ? 201 GLY A HA2  1 
ATOM   8060  H  HA3  . GLY B  1 201 ? -39.878 -43.118 -133.385 1.00 12.61  ? 201 GLY A HA3  1 
ATOM   8061  N  N    . ALA B  1 202 ? -37.258 -43.605 -131.999 1.00 10.92  ? 202 ALA A N    1 
ATOM   8062  C  CA   . ALA B  1 202 ? -36.293 -43.334 -130.940 1.00 15.07  ? 202 ALA A CA   1 
ATOM   8063  C  C    . ALA B  1 202 ? -36.021 -41.858 -130.738 1.00 17.91  ? 202 ALA A C    1 
ATOM   8064  O  O    . ALA B  1 202 ? -35.579 -41.455 -129.673 1.00 19.54  ? 202 ALA A O    1 
ATOM   8065  C  CB   . ALA B  1 202 ? -34.967 -44.045 -131.243 1.00 17.98  ? 202 ALA A CB   1 
ATOM   8066  H  H    . ALA B  1 202 ? -36.899 -43.894 -132.725 1.00 13.10  ? 202 ALA A H    1 
ATOM   8067  H  HA   . ALA B  1 202 ? -36.637 -43.689 -130.105 1.00 18.09  ? 202 ALA A HA   1 
ATOM   8068  H  HB1  . ALA B  1 202 ? -34.337 -43.855 -130.531 1.00 21.57  ? 202 ALA A HB1  1 
ATOM   8069  H  HB2  . ALA B  1 202 ? -35.127 -45.000 -131.298 1.00 21.57  ? 202 ALA A HB2  1 
ATOM   8070  H  HB3  . ALA B  1 202 ? -34.620 -43.718 -132.088 1.00 21.57  ? 202 ALA A HB3  1 
ATOM   8071  N  N    . LEU B  1 203 ? -36.256 -41.056 -131.768 1.00 12.17  ? 203 LEU A N    1 
ATOM   8072  C  CA   . LEU B  1 203 ? -35.999 -39.623 -131.685 1.00 16.64  ? 203 LEU A CA   1 
ATOM   8073  C  C    . LEU B  1 203 ? -37.127 -38.879 -130.989 1.00 16.32  ? 203 LEU A C    1 
ATOM   8074  O  O    . LEU B  1 203 ? -36.907 -37.826 -130.412 1.00 20.48  ? 203 LEU A O    1 
ATOM   8075  C  CB   . LEU B  1 203 ? -35.779 -39.032 -133.077 1.00 18.03  ? 203 LEU A CB   1 
ATOM   8076  C  CG   . LEU B  1 203 ? -34.358 -39.273 -133.601 1.00 45.73  ? 203 LEU A CG   1 
ATOM   8077  C  CD1  . LEU B  1 203 ? -34.226 -40.649 -134.251 1.00 44.65  ? 203 LEU A CD1  1 
ATOM   8078  C  CD2  . LEU B  1 203 ? -33.936 -38.168 -134.558 1.00 64.84  ? 203 LEU A CD2  1 
ATOM   8079  H  H    . LEU B  1 203 ? -36.565 -41.315 -132.527 1.00 14.61  ? 203 LEU A H    1 
ATOM   8080  H  HA   . LEU B  1 203 ? -35.189 -39.481 -131.170 1.00 19.97  ? 203 LEU A HA   1 
ATOM   8081  H  HB2  . LEU B  1 203 ? -36.402 -39.442 -133.698 1.00 21.63  ? 203 LEU A HB2  1 
ATOM   8082  H  HB3  . LEU B  1 203 ? -35.927 -38.074 -133.042 1.00 21.63  ? 203 LEU A HB3  1 
ATOM   8083  H  HG   . LEU B  1 203 ? -33.748 -39.251 -132.848 1.00 54.87  ? 203 LEU A HG   1 
ATOM   8084  H  HD11 . LEU B  1 203 ? -33.317 -40.762 -134.568 1.00 53.57  ? 203 LEU A HD11 1 
ATOM   8085  H  HD12 . LEU B  1 203 ? -34.434 -41.330 -133.593 1.00 53.57  ? 203 LEU A HD12 1 
ATOM   8086  H  HD13 . LEU B  1 203 ? -34.846 -40.707 -134.995 1.00 53.57  ? 203 LEU A HD13 1 
ATOM   8087  H  HD21 . LEU B  1 203 ? -33.036 -38.349 -134.871 1.00 77.81  ? 203 LEU A HD21 1 
ATOM   8088  H  HD22 . LEU B  1 203 ? -34.550 -38.149 -135.309 1.00 77.81  ? 203 LEU A HD22 1 
ATOM   8089  H  HD23 . LEU B  1 203 ? -33.959 -37.320 -134.090 1.00 77.81  ? 203 LEU A HD23 1 
ATOM   8090  N  N    . GLN B  1 204 ? -38.331 -39.436 -131.067 1.00 12.93  ? 204 GLN A N    1 
ATOM   8091  C  CA   . GLN B  1 204 ? -39.538 -38.798 -130.583 1.00 12.35  ? 204 GLN A CA   1 
ATOM   8092  C  C    . GLN B  1 204 ? -39.896 -39.172 -129.132 1.00 18.45  ? 204 GLN A C    1 
ATOM   8093  O  O    . GLN B  1 204 ? -40.648 -38.450 -128.482 1.00 18.12  ? 204 GLN A O    1 
ATOM   8094  C  CB   . GLN B  1 204 ? -40.727 -39.178 -131.496 1.00 14.31  ? 204 GLN A CB   1 
ATOM   8095  C  CG   . GLN B  1 204 ? -40.665 -38.585 -132.887 1.00 16.11  ? 204 GLN A CG   1 
ATOM   8096  C  CD   . GLN B  1 204 ? -41.547 -39.337 -133.867 1.00 17.82  ? 204 GLN A CD   1 
ATOM   8097  O  OE1  . GLN B  1 204 ? -42.582 -38.833 -134.304 1.00 23.95  ? 204 GLN A OE1  1 
ATOM   8098  N  NE2  . GLN B  1 204 ? -41.138 -40.542 -134.217 1.00 10.74  ? 204 GLN A NE2  1 
ATOM   8099  H  H    . GLN B  1 204 ? -38.472 -40.212 -131.409 1.00 15.51  ? 204 GLN A H    1 
ATOM   8100  H  HA   . GLN B  1 204 ? -39.423 -37.836 -130.625 1.00 14.82  ? 204 GLN A HA   1 
ATOM   8101  H  HB2  . GLN B  1 204 ? -40.751 -40.143 -131.588 1.00 17.18  ? 204 GLN A HB2  1 
ATOM   8102  H  HB3  . GLN B  1 204 ? -41.547 -38.868 -131.080 1.00 17.18  ? 204 GLN A HB3  1 
ATOM   8103  H  HG2  . GLN B  1 204 ? -40.967 -37.664 -132.855 1.00 19.33  ? 204 GLN A HG2  1 
ATOM   8104  H  HG3  . GLN B  1 204 ? -39.751 -38.626 -133.211 1.00 19.33  ? 204 GLN A HG3  1 
ATOM   8105  H  HE21 . GLN B  1 204 ? -40.408 -40.860 -133.892 1.00 12.89  ? 204 GLN A HE21 1 
ATOM   8106  H  HE22 . GLN B  1 204 ? -41.602 -41.010 -134.770 1.00 12.89  ? 204 GLN A HE22 1 
ATOM   8107  N  N    . ASN B  1 205 ? -39.345 -40.278 -128.630 1.00 11.20  ? 205 ASN A N    1 
ATOM   8108  C  CA   . ASN B  1 205 ? -39.908 -40.929 -127.449 1.00 9.39   ? 205 ASN A CA   1 
ATOM   8109  C  C    . ASN B  1 205 ? -38.951 -41.215 -126.315 1.00 18.86  ? 205 ASN A C    1 
ATOM   8110  O  O    . ASN B  1 205 ? -37.791 -41.547 -126.516 1.00 10.52  ? 205 ASN A O    1 
ATOM   8111  C  CB   . ASN B  1 205 ? -40.553 -42.259 -127.847 1.00 8.02   ? 205 ASN A CB   1 
ATOM   8112  C  CG   . ASN B  1 205 ? -41.786 -42.089 -128.706 1.00 8.45   ? 205 ASN A CG   1 
ATOM   8113  O  OD1  . ASN B  1 205 ? -42.806 -41.643 -128.225 1.00 9.60   ? 205 ASN A OD1  1 
ATOM   8114  N  ND2  . ASN B  1 205 ? -41.723 -42.541 -129.967 1.00 10.14  ? 205 ASN A ND2  1 
ATOM   8115  H  H    . ASN B  1 205 ? -38.650 -40.668 -128.953 1.00 13.44  ? 205 ASN A H    1 
ATOM   8116  H  HA   . ASN B  1 205 ? -40.610 -40.361 -127.097 1.00 11.27  ? 205 ASN A HA   1 
ATOM   8117  H  HB2  . ASN B  1 205 ? -39.909 -42.783 -128.349 1.00 9.63   ? 205 ASN A HB2  1 
ATOM   8118  H  HB3  . ASN B  1 205 ? -40.812 -42.735 -127.043 1.00 9.63   ? 205 ASN A HB3  1 
ATOM   8119  H  HD21 . ASN B  1 205 ? -42.404 -42.463 -130.487 1.00 12.17  ? 205 ASN A HD21 1 
ATOM   8120  H  HD22 . ASN B  1 205 ? -41.002 -42.910 -130.256 1.00 12.17  ? 205 ASN A HD22 1 
ATOM   8121  N  N    . ILE B  1 206 ? -39.474 -41.088 -125.105 1.00 8.96   ? 206 ILE A N    1 
ATOM   8122  C  CA   . ILE B  1 206 ? -38.918 -41.786 -123.967 1.00 8.97   ? 206 ILE A CA   1 
ATOM   8123  C  C    . ILE B  1 206 ? -39.542 -43.178 -124.003 1.00 9.47   ? 206 ILE A C    1 
ATOM   8124  O  O    . ILE B  1 206 ? -40.760 -43.282 -124.073 1.00 8.85   ? 206 ILE A O    1 
ATOM   8125  C  CB   . ILE B  1 206 ? -39.243 -41.078 -122.656 1.00 10.22  ? 206 ILE A CB   1 
ATOM   8126  C  CG1  . ILE B  1 206 ? -38.721 -39.635 -122.701 1.00 11.79  ? 206 ILE A CG1  1 
ATOM   8127  C  CG2  . ILE B  1 206 ? -38.679 -41.876 -121.469 1.00 10.31  ? 206 ILE A CG2  1 
ATOM   8128  C  CD1  . ILE B  1 206 ? -39.224 -38.773 -121.585 1.00 13.50  ? 206 ILE A CD1  1 
ATOM   8129  H  H    . ILE B  1 206 ? -40.156 -40.598 -124.919 1.00 10.75  ? 206 ILE A H    1 
ATOM   8130  H  HA   . ILE B  1 206 ? -37.956 -41.865 -124.059 1.00 10.77  ? 206 ILE A HA   1 
ATOM   8131  H  HB   . ILE B  1 206 ? -40.208 -41.045 -122.563 1.00 12.27  ? 206 ILE A HB   1 
ATOM   8132  H  HG12 . ILE B  1 206 ? -37.753 -39.652 -122.649 1.00 14.14  ? 206 ILE A HG12 1 
ATOM   8133  H  HG13 . ILE B  1 206 ? -38.998 -39.229 -123.537 1.00 14.14  ? 206 ILE A HG13 1 
ATOM   8134  H  HG21 . ILE B  1 206 ? -38.895 -41.411 -120.646 1.00 12.37  ? 206 ILE A HG21 1 
ATOM   8135  H  HG22 . ILE B  1 206 ? -39.079 -42.760 -121.465 1.00 12.37  ? 206 ILE A HG22 1 
ATOM   8136  H  HG23 . ILE B  1 206 ? -37.717 -41.948 -121.567 1.00 12.37  ? 206 ILE A HG23 1 
ATOM   8137  H  HD11 . ILE B  1 206 ? -38.852 -37.882 -121.682 1.00 16.20  ? 206 ILE A HD11 1 
ATOM   8138  H  HD12 . ILE B  1 206 ? -40.193 -38.734 -121.628 1.00 16.20  ? 206 ILE A HD12 1 
ATOM   8139  H  HD13 . ILE B  1 206 ? -38.946 -39.157 -120.739 1.00 16.20  ? 206 ILE A HD13 1 
ATOM   8140  N  N    . ILE B  1 207 ? -38.707 -44.227 -123.972 1.00 9.44   ? 207 ILE A N    1 
ATOM   8141  C  CA   . ILE B  1 207 ? -39.171 -45.602 -124.128 1.00 12.00  ? 207 ILE A CA   1 
ATOM   8142  C  C    . ILE B  1 207 ? -38.744 -46.437 -122.923 1.00 9.12   ? 207 ILE A C    1 
ATOM   8143  O  O    . ILE B  1 207 ? -37.566 -46.639 -122.701 1.00 11.02  ? 207 ILE A O    1 
ATOM   8144  C  CB   . ILE B  1 207 ? -38.598 -46.254 -125.414 1.00 9.39   ? 207 ILE A CB   1 
ATOM   8145  C  CG1  . ILE B  1 207 ? -38.982 -45.438 -126.640 1.00 9.94   ? 207 ILE A CG1  1 
ATOM   8146  C  CG2  . ILE B  1 207 ? -39.058 -47.712 -125.558 1.00 11.83  ? 207 ILE A CG2  1 
ATOM   8147  C  CD1  . ILE B  1 207 ? -38.441 -45.992 -127.945 1.00 11.11  ? 207 ILE A CD1  1 
ATOM   8148  H  H    . ILE B  1 207 ? -37.857 -44.161 -123.860 1.00 11.33  ? 207 ILE A H    1 
ATOM   8149  H  HA   . ILE B  1 207 ? -40.139 -45.613 -124.183 1.00 14.40  ? 207 ILE A HA   1 
ATOM   8150  H  HB   . ILE B  1 207 ? -37.630 -46.252 -125.344 1.00 11.26  ? 207 ILE A HB   1 
ATOM   8151  H  HG12 . ILE B  1 207 ? -39.950 -45.414 -126.708 1.00 11.93  ? 207 ILE A HG12 1 
ATOM   8152  H  HG13 . ILE B  1 207 ? -38.638 -44.537 -126.536 1.00 11.93  ? 207 ILE A HG13 1 
ATOM   8153  H  HG21 . ILE B  1 207 ? -38.680 -48.083 -126.371 1.00 14.20  ? 207 ILE A HG21 1 
ATOM   8154  H  HG22 . ILE B  1 207 ? -38.751 -48.218 -124.789 1.00 14.20  ? 207 ILE A HG22 1 
ATOM   8155  H  HG23 . ILE B  1 207 ? -40.027 -47.734 -125.603 1.00 14.20  ? 207 ILE A HG23 1 
ATOM   8156  H  HD11 . ILE B  1 207 ? -38.728 -45.420 -128.674 1.00 13.34  ? 207 ILE A HD11 1 
ATOM   8157  H  HD12 . ILE B  1 207 ? -37.472 -46.012 -127.902 1.00 13.34  ? 207 ILE A HD12 1 
ATOM   8158  H  HD13 . ILE B  1 207 ? -38.785 -46.890 -128.074 1.00 13.34  ? 207 ILE A HD13 1 
ATOM   8159  N  N    . PRO B  1 208 ? -39.700 -46.899 -122.116 1.00 9.62   ? 208 PRO A N    1 
ATOM   8160  C  CA   . PRO B  1 208 ? -39.277 -47.844 -121.081 1.00 9.62   ? 208 PRO A CA   1 
ATOM   8161  C  C    . PRO B  1 208 ? -38.876 -49.214 -121.660 1.00 16.28  ? 208 PRO A C    1 
ATOM   8162  O  O    . PRO B  1 208 ? -39.458 -49.695 -122.645 1.00 10.46  ? 208 PRO A O    1 
ATOM   8163  C  CB   . PRO B  1 208 ? -40.516 -47.986 -120.202 1.00 12.60  ? 208 PRO A CB   1 
ATOM   8164  C  CG   . PRO B  1 208 ? -41.625 -47.558 -121.009 1.00 26.80  ? 208 PRO A CG   1 
ATOM   8165  C  CD   . PRO B  1 208 ? -41.140 -46.651 -122.083 1.00 19.76  ? 208 PRO A CD   1 
ATOM   8166  H  HA   . PRO B  1 208 ? -38.545 -47.479 -120.560 1.00 11.54  ? 208 PRO A HA   1 
ATOM   8167  H  HB2  . PRO B  1 208 ? -40.623 -48.914 -119.941 1.00 15.12  ? 208 PRO A HB2  1 
ATOM   8168  H  HB3  . PRO B  1 208 ? -40.426 -47.420 -119.420 1.00 15.12  ? 208 PRO A HB3  1 
ATOM   8169  H  HG2  . PRO B  1 208 ? -42.046 -48.338 -121.402 1.00 32.16  ? 208 PRO A HG2  1 
ATOM   8170  H  HG3  . PRO B  1 208 ? -42.260 -47.090 -120.445 1.00 32.16  ? 208 PRO A HG3  1 
ATOM   8171  H  HD2  . PRO B  1 208 ? -41.544 -46.888 -122.932 1.00 23.71  ? 208 PRO A HD2  1 
ATOM   8172  H  HD3  . PRO B  1 208 ? -41.319 -45.727 -121.850 1.00 23.71  ? 208 PRO A HD3  1 
ATOM   8173  N  N    . ALA B  1 209 ? -37.917 -49.847 -121.003 1.00 9.73   ? 209 ALA A N    1 
ATOM   8174  C  CA   . ALA B  1 209 ? -37.384 -51.134 -121.428 1.00 16.87  ? 209 ALA A CA   1 
ATOM   8175  C  C    . ALA B  1 209 ? -36.994 -51.932 -120.198 1.00 21.09  ? 209 ALA A C    1 
ATOM   8176  O  O    . ALA B  1 209 ? -36.591 -51.366 -119.170 1.00 15.56  ? 209 ALA A O    1 
ATOM   8177  C  CB   . ALA B  1 209 ? -36.168 -50.958 -122.352 1.00 15.64  ? 209 ALA A CB   1 
ATOM   8178  H  H    . ALA B  1 209 ? -37.548 -49.544 -120.288 1.00 11.68  ? 209 ALA A H    1 
ATOM   8179  H  HA   . ALA B  1 209 ? -38.068 -51.624 -121.910 1.00 20.24  ? 209 ALA A HA   1 
ATOM   8180  H  HB1  . ALA B  1 209 ? -35.842 -51.833 -122.614 1.00 18.77  ? 209 ALA A HB1  1 
ATOM   8181  H  HB2  . ALA B  1 209 ? -36.439 -50.457 -123.138 1.00 18.77  ? 209 ALA A HB2  1 
ATOM   8182  H  HB3  . ALA B  1 209 ? -35.476 -50.475 -121.874 1.00 18.77  ? 209 ALA A HB3  1 
ATOM   8183  N  N    . SER B  1 210 ? -37.144 -53.244 -120.296 1.00 18.87  ? 210 SER A N    1 
ATOM   8184  C  CA   . SER B  1 210 ? -36.635 -54.143 -119.276 1.00 16.45  ? 210 SER A CA   1 
ATOM   8185  C  C    . SER B  1 210 ? -35.142 -54.260 -119.388 1.00 19.76  ? 210 SER A C    1 
ATOM   8186  O  O    . SER B  1 210 ? -34.577 -54.058 -120.461 1.00 22.20  ? 210 SER A O    1 
ATOM   8187  C  CB   . SER B  1 210 ? -37.273 -55.518 -119.420 1.00 20.62  ? 210 SER A CB   1 
ATOM   8188  O  OG   . SER B  1 210 ? -38.667 -55.370 -119.309 1.00 25.12  ? 210 SER A OG   1 
ATOM   8189  H  H    . SER B  1 210 ? -37.539 -53.641 -120.948 1.00 22.64  ? 210 SER A H    1 
ATOM   8190  H  HA   . SER B  1 210 ? -36.852 -53.793 -118.398 1.00 19.74  ? 210 SER A HA   1 
ATOM   8191  H  HB2  . SER B  1 210 ? -37.055 -55.888 -120.290 1.00 24.74  ? 210 SER A HB2  1 
ATOM   8192  H  HB3  . SER B  1 210 ? -36.952 -56.100 -118.713 1.00 24.74  ? 210 SER A HB3  1 
ATOM   8193  H  HG   . SER B  1 210 ? -39.042 -56.118 -119.386 1.00 30.14  ? 210 SER A HG   1 
ATOM   8194  N  N    . THR B  1 211 ? -34.491 -54.563 -118.273 1.00 19.79  ? 211 THR A N    1 
ATOM   8195  C  CA   . THR B  1 211 ? -33.075 -54.903 -118.316 1.00 20.66  ? 211 THR A CA   1 
ATOM   8196  C  C    . THR B  1 211 ? -32.726 -55.829 -117.163 1.00 19.54  ? 211 THR A C    1 
ATOM   8197  O  O    . THR B  1 211 ? -33.288 -55.716 -116.072 1.00 24.83  ? 211 THR A O    1 
ATOM   8198  C  CB   . THR B  1 211 ? -32.187 -53.655 -118.263 1.00 22.42  ? 211 THR A CB   1 
ATOM   8199  O  OG1  . THR B  1 211 ? -30.833 -54.048 -117.999 1.00 30.32  ? 211 THR A OG1  1 
ATOM   8200  C  CG2  . THR B  1 211 ? -32.670 -52.697 -117.186 1.00 27.22  ? 211 THR A CG2  1 
ATOM   8201  H  H    . THR B  1 211 ? -34.840 -54.580 -117.488 1.00 23.75  ? 211 THR A H    1 
ATOM   8202  H  HA   . THR B  1 211 ? -32.887 -55.371 -119.145 1.00 24.79  ? 211 THR A HA   1 
ATOM   8203  H  HB   . THR B  1 211 ? -32.227 -53.197 -119.117 1.00 26.90  ? 211 THR A HB   1 
ATOM   8204  H  HG1  . THR B  1 211 ? -30.338 -53.370 -117.968 1.00 36.39  ? 211 THR A HG1  1 
ATOM   8205  H  HG21 . THR B  1 211 ? -32.102 -51.912 -117.161 1.00 32.67  ? 211 THR A HG21 1 
ATOM   8206  H  HG22 . THR B  1 211 ? -33.581 -52.421 -117.372 1.00 32.67  ? 211 THR A HG22 1 
ATOM   8207  H  HG23 . THR B  1 211 ? -32.644 -53.133 -116.319 1.00 32.67  ? 211 THR A HG23 1 
ATOM   8208  N  N    . GLY B  1 212 ? -31.799 -56.749 -117.420 1.00 21.61  ? 212 GLY A N    1 
ATOM   8209  C  CA   . GLY B  1 212 ? -31.352 -57.689 -116.406 1.00 22.35  ? 212 GLY A CA   1 
ATOM   8210  C  C    . GLY B  1 212 ? -30.086 -57.201 -115.720 1.00 23.49  ? 212 GLY A C    1 
ATOM   8211  O  O    . GLY B  1 212 ? -29.472 -57.935 -114.950 1.00 14.41  ? 212 GLY A O    1 
ATOM   8212  H  H    . GLY B  1 212 ? -31.414 -56.848 -118.183 1.00 25.93  ? 212 GLY A H    1 
ATOM   8213  H  HA2  . GLY B  1 212 ? -32.045 -57.801 -115.736 1.00 26.82  ? 212 GLY A HA2  1 
ATOM   8214  H  HA3  . GLY B  1 212 ? -31.173 -58.550 -116.814 1.00 26.82  ? 212 GLY A HA3  1 
ATOM   8215  N  N    . ALA B  1 213 ? -29.706 -55.956 -115.983 1.00 15.26  ? 213 ALA A N    1 
ATOM   8216  C  CA   . ALA B  1 213 ? -28.403 -55.443 -115.535 1.00 16.63  ? 213 ALA A CA   1 
ATOM   8217  C  C    . ALA B  1 213 ? -28.257 -55.402 -114.011 1.00 15.40  ? 213 ALA A C    1 
ATOM   8218  O  O    . ALA B  1 213 ? -27.205 -55.715 -113.488 1.00 17.93  ? 213 ALA A O    1 
ATOM   8219  C  CB   . ALA B  1 213 ? -28.167 -54.060 -116.108 1.00 26.54  ? 213 ALA A CB   1 
ATOM   8220  H  H    . ALA B  1 213 ? -30.179 -55.385 -116.419 1.00 18.31  ? 213 ALA A H    1 
ATOM   8221  H  HA   . ALA B  1 213 ? -27.708 -56.025 -115.880 1.00 19.96  ? 213 ALA A HA   1 
ATOM   8222  H  HB1  . ALA B  1 213 ? -27.305 -53.735 -115.804 1.00 31.84  ? 213 ALA A HB1  1 
ATOM   8223  H  HB2  . ALA B  1 213 ? -28.178 -54.113 -117.076 1.00 31.84  ? 213 ALA A HB2  1 
ATOM   8224  H  HB3  . ALA B  1 213 ? -28.871 -53.467 -115.801 1.00 31.84  ? 213 ALA A HB3  1 
ATOM   8225  N  N    . ALA B  1 214 ? -29.308 -54.997 -113.301 1.00 15.21  ? 214 ALA A N    1 
ATOM   8226  C  CA   . ALA B  1 214 ? -29.250 -54.904 -111.851 1.00 24.42  ? 214 ALA A CA   1 
ATOM   8227  C  C    . ALA B  1 214 ? -29.203 -56.282 -111.223 1.00 22.29  ? 214 ALA A C    1 
ATOM   8228  O  O    . ALA B  1 214 ? -28.398 -56.548 -110.330 1.00 20.85  ? 214 ALA A O    1 
ATOM   8229  C  CB   . ALA B  1 214 ? -30.437 -54.119 -111.323 1.00 26.60  ? 214 ALA A CB   1 
ATOM   8230  H  H    . ALA B  1 214 ? -30.066 -54.770 -113.639 1.00 18.25  ? 214 ALA A H    1 
ATOM   8231  H  HA   . ALA B  1 214 ? -28.441 -54.432 -111.597 1.00 29.30  ? 214 ALA A HA   1 
ATOM   8232  H  HB1  . ALA B  1 214 ? -30.377 -54.070 -110.356 1.00 31.92  ? 214 ALA A HB1  1 
ATOM   8233  H  HB2  . ALA B  1 214 ? -30.418 -53.226 -111.701 1.00 31.92  ? 214 ALA A HB2  1 
ATOM   8234  H  HB3  . ALA B  1 214 ? -31.255 -54.571 -111.582 1.00 31.92  ? 214 ALA A HB3  1 
ATOM   8235  N  N    . LYS B  1 215 ? -30.075 -57.166 -111.684 1.00 15.97  ? 215 LYS A N    1 
ATOM   8236  C  CA   . LYS B  1 215 ? -30.056 -58.537 -111.231 1.00 16.62  ? 215 LYS A CA   1 
ATOM   8237  C  C    . LYS B  1 215 ? -28.677 -59.167 -111.470 1.00 24.65  ? 215 LYS A C    1 
ATOM   8238  O  O    . LYS B  1 215 ? -28.213 -59.962 -110.661 1.00 22.40  ? 215 LYS A O    1 
ATOM   8239  C  CB   . LYS B  1 215 ? -31.144 -59.340 -111.947 1.00 28.56  ? 215 LYS A CB   1 
ATOM   8240  C  CG   . LYS B  1 215 ? -31.307 -60.756 -111.450 1.00 51.21  ? 215 LYS A CG   1 
ATOM   8241  C  CD   . LYS B  1 215 ? -32.311 -61.537 -112.298 1.00 61.96  ? 215 LYS A CD   1 
ATOM   8242  C  CE   . LYS B  1 215 ? -33.669 -60.858 -112.335 1.00 74.30  ? 215 LYS A CE   1 
ATOM   8243  N  NZ   . LYS B  1 215 ? -34.176 -60.551 -110.966 1.00 81.46  ? 215 LYS A NZ   1 
ATOM   8244  H  H    . LYS B  1 215 ? -30.689 -56.993 -112.262 1.00 19.16  ? 215 LYS A H    1 
ATOM   8245  H  HA   . LYS B  1 215 ? -30.238 -58.560 -110.279 1.00 19.94  ? 215 LYS A HA   1 
ATOM   8246  H  HB2  . LYS B  1 215 ? -31.994 -58.887 -111.827 1.00 34.27  ? 215 LYS A HB2  1 
ATOM   8247  H  HB3  . LYS B  1 215 ? -30.928 -59.383 -112.892 1.00 34.27  ? 215 LYS A HB3  1 
ATOM   8248  H  HG2  . LYS B  1 215 ? -30.452 -61.211 -111.496 1.00 61.45  ? 215 LYS A HG2  1 
ATOM   8249  H  HG3  . LYS B  1 215 ? -31.630 -60.739 -110.536 1.00 61.45  ? 215 LYS A HG3  1 
ATOM   8250  H  HD2  . LYS B  1 215 ? -31.979 -61.600 -113.208 1.00 74.36  ? 215 LYS A HD2  1 
ATOM   8251  H  HD3  . LYS B  1 215 ? -32.425 -62.423 -111.922 1.00 74.36  ? 215 LYS A HD3  1 
ATOM   8252  H  HE2  . LYS B  1 215 ? -33.596 -60.024 -112.825 1.00 89.16  ? 215 LYS A HE2  1 
ATOM   8253  H  HE3  . LYS B  1 215 ? -34.307 -61.446 -112.770 1.00 89.16  ? 215 LYS A HE3  1 
ATOM   8254  H  HZ1  . LYS B  1 215 ? -33.610 -60.008 -110.547 1.00 97.75  ? 215 LYS A HZ1  1 
ATOM   8255  H  HZ2  . LYS B  1 215 ? -34.972 -60.155 -111.018 1.00 97.75  ? 215 LYS A HZ2  1 
ATOM   8256  H  HZ3  . LYS B  1 215 ? -34.258 -61.303 -110.497 1.00 97.75  ? 215 LYS A HZ3  1 
ATOM   8257  N  N    . ALA B  1 216 ? -28.020 -58.786 -112.568 1.00 18.16  ? 216 ALA A N    1 
ATOM   8258  C  CA   . ALA B  1 216 ? -26.712 -59.334 -112.918 1.00 18.42  ? 216 ALA A CA   1 
ATOM   8259  C  C    . ALA B  1 216 ? -25.609 -58.950 -111.934 1.00 14.21  ? 216 ALA A C    1 
ATOM   8260  O  O    . ALA B  1 216 ? -24.620 -59.662 -111.803 1.00 18.02  ? 216 ALA A O    1 
ATOM   8261  C  CB   . ALA B  1 216 ? -26.315 -58.890 -114.321 1.00 18.87  ? 216 ALA A CB   1 
ATOM   8262  H  H    . ALA B  1 216 ? -28.315 -58.206 -113.130 1.00 21.80  ? 216 ALA A H    1 
ATOM   8263  H  HA   . ALA B  1 216 ? -26.775 -60.302 -112.924 1.00 22.11  ? 216 ALA A HA   1 
ATOM   8264  H  HB1  . ALA B  1 216 ? -25.445 -59.263 -114.535 1.00 22.64  ? 216 ALA A HB1  1 
ATOM   8265  H  HB2  . ALA B  1 216 ? -26.977 -59.210 -114.953 1.00 22.64  ? 216 ALA A HB2  1 
ATOM   8266  H  HB3  . ALA B  1 216 ? -26.274 -57.921 -114.345 1.00 22.64  ? 216 ALA A HB3  1 
ATOM   8267  N  N    . VAL B  1 217 ? -25.769 -57.819 -111.273 1.00 13.28  ? 217 VAL A N    1 
ATOM   8268  C  CA   . VAL B  1 217 ? -24.832 -57.397 -110.249 1.00 19.81  ? 217 VAL A CA   1 
ATOM   8269  C  C    . VAL B  1 217 ? -24.755 -58.469 -109.173 1.00 19.93  ? 217 VAL A C    1 
ATOM   8270  O  O    . VAL B  1 217 ? -23.698 -58.690 -108.592 1.00 24.35  ? 217 VAL A O    1 
ATOM   8271  C  CB   . VAL B  1 217 ? -25.244 -56.063 -109.633 1.00 18.12  ? 217 VAL A CB   1 
ATOM   8272  C  CG1  . VAL B  1 217 ? -24.340 -55.709 -108.443 1.00 21.50  ? 217 VAL A CG1  1 
ATOM   8273  C  CG2  . VAL B  1 217 ? -25.191 -54.971 -110.687 1.00 24.93  ? 217 VAL A CG2  1 
ATOM   8274  H  H    . VAL B  1 217 ? -26.420 -57.271 -111.400 1.00 15.94  ? 217 VAL A H    1 
ATOM   8275  H  HA   . VAL B  1 217 ? -23.951 -57.294 -110.642 1.00 23.77  ? 217 VAL A HA   1 
ATOM   8276  H  HB   . VAL B  1 217 ? -26.157 -56.128 -109.311 1.00 21.74  ? 217 VAL A HB   1 
ATOM   8277  H  HG11 . VAL B  1 217 ? -24.625 -54.859 -108.073 1.00 25.81  ? 217 VAL A HG11 1 
ATOM   8278  H  HG12 . VAL B  1 217 ? -24.416 -56.405 -107.772 1.00 25.81  ? 217 VAL A HG12 1 
ATOM   8279  H  HG13 . VAL B  1 217 ? -23.423 -55.645 -108.752 1.00 25.81  ? 217 VAL A HG13 1 
ATOM   8280  H  HG21 . VAL B  1 217 ? -25.455 -54.130 -110.283 1.00 29.92  ? 217 VAL A HG21 1 
ATOM   8281  H  HG22 . VAL B  1 217 ? -24.285 -54.906 -111.027 1.00 29.92  ? 217 VAL A HG22 1 
ATOM   8282  H  HG23 . VAL B  1 217 ? -25.800 -55.199 -111.407 1.00 29.92  ? 217 VAL A HG23 1 
ATOM   8283  N  N    . GLY B  1 218 ? -25.886 -59.131 -108.933 1.00 19.89  ? 218 GLY A N    1 
ATOM   8284  C  CA   . GLY B  1 218 ? -25.968 -60.244 -108.003 1.00 21.85  ? 218 GLY A CA   1 
ATOM   8285  C  C    . GLY B  1 218 ? -25.166 -61.475 -108.388 1.00 20.65  ? 218 GLY A C    1 
ATOM   8286  O  O    . GLY B  1 218 ? -24.909 -62.325 -107.545 1.00 30.50  ? 218 GLY A O    1 
ATOM   8287  H  H    . GLY B  1 218 ? -26.636 -58.946 -109.310 1.00 23.87  ? 218 GLY A H    1 
ATOM   8288  H  HA2  . GLY B  1 218 ? -25.658 -59.948 -107.133 1.00 26.22  ? 218 GLY A HA2  1 
ATOM   8289  H  HA3  . GLY B  1 218 ? -26.897 -60.510 -107.915 1.00 26.22  ? 218 GLY A HA3  1 
ATOM   8290  N  N    . LYS B  1 219 ? -24.771 -61.570 -109.658 1.00 19.19  ? 219 LYS A N    1 
ATOM   8291  C  CA   . LYS B  1 219 ? -23.894 -62.639 -110.126 1.00 20.11  ? 219 LYS A CA   1 
ATOM   8292  C  C    . LYS B  1 219 ? -22.425 -62.278 -109.949 1.00 20.26  ? 219 LYS A C    1 
ATOM   8293  O  O    . LYS B  1 219 ? -21.599 -63.131 -109.636 1.00 19.54  ? 219 LYS A O    1 
ATOM   8294  C  CB   . LYS B  1 219 ? -24.125 -62.952 -111.606 1.00 24.62  ? 219 LYS A CB   1 
ATOM   8295  C  CG   . LYS B  1 219 ? -25.412 -63.686 -111.945 1.00 37.70  ? 219 LYS A CG   1 
ATOM   8296  C  CD   . LYS B  1 219 ? -25.214 -64.530 -113.215 1.00 69.40  ? 219 LYS A CD   1 
ATOM   8297  C  CE   . LYS B  1 219 ? -26.385 -64.427 -114.190 1.00 82.91  ? 219 LYS A CE   1 
ATOM   8298  N  NZ   . LYS B  1 219 ? -27.674 -64.848 -113.573 1.00 91.98  ? 219 LYS A NZ   1 
ATOM   8299  H  H    . LYS B  1 219 ? -25.002 -61.018 -110.275 1.00 23.03  ? 219 LYS A H    1 
ATOM   8300  H  HA   . LYS B  1 219 ? -24.072 -63.444 -109.615 1.00 24.13  ? 219 LYS A HA   1 
ATOM   8301  H  HB2  . LYS B  1 219 ? -24.133 -62.115 -112.096 1.00 29.55  ? 219 LYS A HB2  1 
ATOM   8302  H  HB3  . LYS B  1 219 ? -23.389 -63.500 -111.919 1.00 29.55  ? 219 LYS A HB3  1 
ATOM   8303  H  HG2  . LYS B  1 219 ? -25.651 -64.278 -111.215 1.00 45.24  ? 219 LYS A HG2  1 
ATOM   8304  H  HG3  . LYS B  1 219 ? -26.120 -63.043 -112.109 1.00 45.24  ? 219 LYS A HG3  1 
ATOM   8305  H  HD2  . LYS B  1 219 ? -24.415 -64.226 -113.674 1.00 83.28  ? 219 LYS A HD2  1 
ATOM   8306  H  HD3  . LYS B  1 219 ? -25.117 -65.461 -112.962 1.00 83.28  ? 219 LYS A HD3  1 
ATOM   8307  H  HE2  . LYS B  1 219 ? -26.476 -63.506 -114.480 1.00 99.49  ? 219 LYS A HE2  1 
ATOM   8308  H  HE3  . LYS B  1 219 ? -26.214 -65.001 -114.953 1.00 99.49  ? 219 LYS A HE3  1 
ATOM   8309  H  HZ1  . LYS B  1 219 ? -27.858 -64.331 -112.872 1.00 110.37 ? 219 LYS A HZ1  1 
ATOM   8310  H  HZ2  . LYS B  1 219 ? -28.333 -64.775 -114.167 1.00 110.37 ? 219 LYS A HZ2  1 
ATOM   8311  H  HZ3  . LYS B  1 219 ? -27.620 -65.694 -113.303 1.00 110.37 ? 219 LYS A HZ3  1 
ATOM   8312  N  N    . VAL B  1 220 ? -22.087 -61.017 -110.189 1.00 17.08  ? 220 VAL A N    1 
ATOM   8313  C  CA   . VAL B  1 220 ? -20.696 -60.610 -110.073 1.00 17.67  ? 220 VAL A CA   1 
ATOM   8314  C  C    . VAL B  1 220 ? -20.379 -60.239 -108.619 1.00 16.91  ? 220 VAL A C    1 
ATOM   8315  O  O    . VAL B  1 220 ? -19.214 -60.262 -108.216 1.00 17.82  ? 220 VAL A O    1 
ATOM   8316  C  CB   . VAL B  1 220 ? -20.365 -59.428 -111.046 1.00 17.71  ? 220 VAL A CB   1 
ATOM   8317  C  CG1  . VAL B  1 220 ? -20.706 -59.830 -112.492 1.00 24.17  ? 220 VAL A CG1  1 
ATOM   8318  C  CG2  . VAL B  1 220 ? -21.096 -58.207 -110.676 1.00 21.19  ? 220 VAL A CG2  1 
ATOM   8319  H  H    . VAL B  1 220 ? -22.631 -60.391 -110.416 1.00 20.49  ? 220 VAL A H    1 
ATOM   8320  H  HA   . VAL B  1 220 ? -20.130 -61.360 -110.316 1.00 21.21  ? 220 VAL A HA   1 
ATOM   8321  H  HB   . VAL B  1 220 ? -19.415 -59.237 -111.002 1.00 21.25  ? 220 VAL A HB   1 
ATOM   8322  H  HG11 . VAL B  1 220 ? -20.496 -59.090 -113.083 1.00 29.01  ? 220 VAL A HG11 1 
ATOM   8323  H  HG12 . VAL B  1 220 ? -20.180 -60.608 -112.736 1.00 29.01  ? 220 VAL A HG12 1 
ATOM   8324  H  HG13 . VAL B  1 220 ? -21.651 -60.040 -112.546 1.00 29.01  ? 220 VAL A HG13 1 
ATOM   8325  H  HG21 . VAL B  1 220 ? -20.866 -57.500 -111.300 1.00 25.43  ? 220 VAL A HG21 1 
ATOM   8326  H  HG22 . VAL B  1 220 ? -22.049 -58.385 -110.715 1.00 25.43  ? 220 VAL A HG22 1 
ATOM   8327  H  HG23 . VAL B  1 220 ? -20.844 -57.949 -109.776 1.00 25.43  ? 220 VAL A HG23 1 
ATOM   8328  N  N    . ILE B  1 221 ? -21.415 -59.897 -107.845 1.00 16.07  ? 221 ILE A N    1 
ATOM   8329  C  CA   . ILE B  1 221 ? -21.285 -59.728 -106.395 1.00 15.49  ? 221 ILE A CA   1 
ATOM   8330  C  C    . ILE B  1 221 ? -22.289 -60.666 -105.699 1.00 15.64  ? 221 ILE A C    1 
ATOM   8331  O  O    . ILE B  1 221 ? -23.434 -60.287 -105.441 1.00 18.14  ? 221 ILE A O    1 
ATOM   8332  C  CB   . ILE B  1 221 ? -21.524 -58.271 -105.960 1.00 15.05  ? 221 ILE A CB   1 
ATOM   8333  C  CG1  . ILE B  1 221 ? -20.597 -57.323 -106.715 1.00 16.77  ? 221 ILE A CG1  1 
ATOM   8334  C  CG2  . ILE B  1 221 ? -21.258 -58.094 -104.484 1.00 15.36  ? 221 ILE A CG2  1 
ATOM   8335  C  CD1  . ILE B  1 221 ? -20.939 -55.864 -106.512 1.00 17.94  ? 221 ILE A CD1  1 
ATOM   8336  H  H    . ILE B  1 221 ? -22.210 -59.755 -108.140 1.00 19.28  ? 221 ILE A H    1 
ATOM   8337  H  HA   . ILE B  1 221 ? -20.390 -59.984 -106.122 1.00 18.58  ? 221 ILE A HA   1 
ATOM   8338  H  HB   . ILE B  1 221 ? -22.445 -58.030 -106.148 1.00 18.06  ? 221 ILE A HB   1 
ATOM   8339  H  HG12 . ILE B  1 221 ? -19.688 -57.462 -106.407 1.00 20.12  ? 221 ILE A HG12 1 
ATOM   8340  H  HG13 . ILE B  1 221 ? -20.658 -57.514 -107.664 1.00 20.12  ? 221 ILE A HG13 1 
ATOM   8341  H  HG21 . ILE B  1 221 ? -21.417 -57.168 -104.243 1.00 18.43  ? 221 ILE A HG21 1 
ATOM   8342  H  HG22 . ILE B  1 221 ? -21.854 -58.674 -103.985 1.00 18.43  ? 221 ILE A HG22 1 
ATOM   8343  H  HG23 . ILE B  1 221 ? -20.335 -58.331 -104.300 1.00 18.43  ? 221 ILE A HG23 1 
ATOM   8344  H  HD11 . ILE B  1 221 ? -20.314 -55.320 -107.017 1.00 21.53  ? 221 ILE A HD11 1 
ATOM   8345  H  HD12 . ILE B  1 221 ? -21.843 -55.705 -106.825 1.00 21.53  ? 221 ILE A HD12 1 
ATOM   8346  H  HD13 . ILE B  1 221 ? -20.873 -55.653 -105.567 1.00 21.53  ? 221 ILE A HD13 1 
ATOM   8347  N  N    . PRO B  1 222 ? -21.876 -61.910 -105.431 1.00 18.03  ? 222 PRO A N    1 
ATOM   8348  C  CA   . PRO B  1 222 ? -22.793 -62.961 -104.950 1.00 22.57  ? 222 PRO A CA   1 
ATOM   8349  C  C    . PRO B  1 222 ? -23.625 -62.590 -103.715 1.00 21.11  ? 222 PRO A C    1 
ATOM   8350  O  O    . PRO B  1 222 ? -24.780 -63.004 -103.611 1.00 18.86  ? 222 PRO A O    1 
ATOM   8351  C  CB   . PRO B  1 222 ? -21.841 -64.114 -104.630 1.00 24.79  ? 222 PRO A CB   1 
ATOM   8352  C  CG   . PRO B  1 222 ? -20.741 -63.947 -105.612 1.00 26.24  ? 222 PRO A CG   1 
ATOM   8353  C  CD   . PRO B  1 222 ? -20.539 -62.461 -105.734 1.00 22.55  ? 222 PRO A CD   1 
ATOM   8354  H  HA   . PRO B  1 222 ? -23.391 -63.232 -105.664 1.00 27.08  ? 222 PRO A HA   1 
ATOM   8355  H  HB2  . PRO B  1 222 ? -21.510 -64.029 -103.722 1.00 29.75  ? 222 PRO A HB2  1 
ATOM   8356  H  HB3  . PRO B  1 222 ? -22.294 -64.963 -104.758 1.00 29.75  ? 222 PRO A HB3  1 
ATOM   8357  H  HG2  . PRO B  1 222 ? -19.938 -64.376 -105.278 1.00 31.49  ? 222 PRO A HG2  1 
ATOM   8358  H  HG3  . PRO B  1 222 ? -21.004 -64.328 -106.464 1.00 31.49  ? 222 PRO A HG3  1 
ATOM   8359  H  HD2  . PRO B  1 222 ? -19.890 -62.152 -105.082 1.00 27.06  ? 222 PRO A HD2  1 
ATOM   8360  H  HD3  . PRO B  1 222 ? -20.274 -62.228 -106.638 1.00 27.06  ? 222 PRO A HD3  1 
ATOM   8361  N  N    . GLU B  1 223 ? -23.052 -61.815 -102.800 1.00 23.29  ? 223 GLU A N    1 
ATOM   8362  C  CA   . GLU B  1 223 ? -23.776 -61.377 -101.605 1.00 24.20  ? 223 GLU A CA   1 
ATOM   8363  C  C    . GLU B  1 223 ? -25.013 -60.530 -101.946 1.00 25.57  ? 223 GLU A C    1 
ATOM   8364  O  O    . GLU B  1 223 ? -25.926 -60.418 -101.137 1.00 24.34  ? 223 GLU A O    1 
ATOM   8365  C  CB   . GLU B  1 223 ? -22.854 -60.576 -100.684 1.00 26.99  ? 223 GLU A CB   1 
ATOM   8366  C  CG   . GLU B  1 223 ? -21.856 -61.408 -99.883  1.00 39.41  ? 223 GLU A CG   1 
ATOM   8367  C  CD   . GLU B  1 223 ? -21.035 -60.563 -98.903  1.00 66.02  ? 223 GLU A CD   1 
ATOM   8368  O  OE1  . GLU B  1 223 ? -20.036 -61.085 -98.353  1.00 71.74  ? 223 GLU A OE1  1 
ATOM   8369  O  OE2  . GLU B  1 223 ? -21.384 -59.380 -98.677  1.00 58.14  ? 223 GLU A OE2  1 
ATOM   8370  H  H    . GLU B  1 223 ? -22.243 -61.527 -102.845 1.00 27.95  ? 223 GLU A H    1 
ATOM   8371  H  HA   . GLU B  1 223 ? -24.077 -62.160 -101.117 1.00 29.03  ? 223 GLU A HA   1 
ATOM   8372  H  HB2  . GLU B  1 223 ? -22.346 -59.951 -101.224 1.00 32.39  ? 223 GLU A HB2  1 
ATOM   8373  H  HB3  . GLU B  1 223 ? -23.402 -60.086 -100.050 1.00 32.39  ? 223 GLU A HB3  1 
ATOM   8374  H  HG2  . GLU B  1 223 ? -22.339 -62.076 -99.372  1.00 47.29  ? 223 GLU A HG2  1 
ATOM   8375  H  HG3  . GLU B  1 223 ? -21.241 -61.840 -100.496 1.00 47.29  ? 223 GLU A HG3  1 
ATOM   8376  N  N    . LEU B  1 224 ? -25.037 -59.931 -103.133 1.00 17.30  ? 224 LEU A N    1 
ATOM   8377  C  CA   . LEU B  1 224 ? -26.174 -59.112 -103.549 1.00 16.70  ? 224 LEU A CA   1 
ATOM   8378  C  C    . LEU B  1 224 ? -27.156 -59.887 -104.419 1.00 16.62  ? 224 LEU A C    1 
ATOM   8379  O  O    . LEU B  1 224 ? -28.083 -59.307 -104.984 1.00 16.47  ? 224 LEU A O    1 
ATOM   8380  C  CB   . LEU B  1 224 ? -25.686 -57.881 -104.305 1.00 18.20  ? 224 LEU A CB   1 
ATOM   8381  C  CG   . LEU B  1 224 ? -24.831 -56.918 -103.487 1.00 25.81  ? 224 LEU A CG   1 
ATOM   8382  C  CD1  . LEU B  1 224 ? -24.462 -55.729 -104.348 1.00 23.26  ? 224 LEU A CD1  1 
ATOM   8383  C  CD2  . LEU B  1 224 ? -25.549 -56.448 -102.217 1.00 22.83  ? 224 LEU A CD2  1 
ATOM   8384  H  H    . LEU B  1 224 ? -24.408 -59.983 -103.716 1.00 20.76  ? 224 LEU A H    1 
ATOM   8385  H  HA   . LEU B  1 224 ? -26.649 -58.809 -102.760 1.00 20.04  ? 224 LEU A HA   1 
ATOM   8386  H  HB2  . LEU B  1 224 ? -25.155 -58.174 -105.061 1.00 21.84  ? 224 LEU A HB2  1 
ATOM   8387  H  HB3  . LEU B  1 224 ? -26.459 -57.388 -104.622 1.00 21.84  ? 224 LEU A HB3  1 
ATOM   8388  H  HG   . LEU B  1 224 ? -24.012 -57.366 -103.224 1.00 30.98  ? 224 LEU A HG   1 
ATOM   8389  H  HD11 . LEU B  1 224 ? -23.918 -55.119 -103.826 1.00 27.91  ? 224 LEU A HD11 1 
ATOM   8390  H  HD12 . LEU B  1 224 ? -23.963 -56.041 -105.119 1.00 27.91  ? 224 LEU A HD12 1 
ATOM   8391  H  HD13 . LEU B  1 224 ? -25.274 -55.285 -104.637 1.00 27.91  ? 224 LEU A HD13 1 
ATOM   8392  H  HD21 . LEU B  1 224 ? -24.968 -55.840 -101.732 1.00 27.40  ? 224 LEU A HD21 1 
ATOM   8393  H  HD22 . LEU B  1 224 ? -26.368 -55.993 -102.467 1.00 27.40  ? 224 LEU A HD22 1 
ATOM   8394  H  HD23 . LEU B  1 224 ? -25.753 -57.220 -101.666 1.00 27.40  ? 224 LEU A HD23 1 
ATOM   8395  N  N    . ASN B  1 225 ? -26.965 -61.196 -104.520 1.00 17.52  ? 225 ASN A N    1 
ATOM   8396  C  CA   . ASN B  1 225 ? -27.919 -62.022 -105.254 1.00 19.18  ? 225 ASN A CA   1 
ATOM   8397  C  C    . ASN B  1 225 ? -29.330 -61.861 -104.697 1.00 20.31  ? 225 ASN A C    1 
ATOM   8398  O  O    . ASN B  1 225 ? -29.556 -62.034 -103.509 1.00 21.70  ? 225 ASN A O    1 
ATOM   8399  C  CB   . ASN B  1 225 ? -27.504 -63.489 -105.209 1.00 26.39  ? 225 ASN A CB   1 
ATOM   8400  C  CG   . ASN B  1 225 ? -28.399 -64.366 -106.055 1.00 33.04  ? 225 ASN A CG   1 
ATOM   8401  O  OD1  . ASN B  1 225 ? -29.053 -65.264 -105.541 1.00 43.12  ? 225 ASN A OD1  1 
ATOM   8402  N  ND2  . ASN B  1 225 ? -28.463 -64.083 -107.354 1.00 30.72  ? 225 ASN A ND2  1 
ATOM   8403  H  H    . ASN B  1 225 ? -26.303 -61.627 -104.179 1.00 21.02  ? 225 ASN A H    1 
ATOM   8404  H  HA   . ASN B  1 225 ? -27.929 -61.742 -106.182 1.00 23.01  ? 225 ASN A HA   1 
ATOM   8405  H  HB2  . ASN B  1 225 ? -26.597 -63.573 -105.544 1.00 31.67  ? 225 ASN A HB2  1 
ATOM   8406  H  HB3  . ASN B  1 225 ? -27.551 -63.805 -104.293 1.00 31.67  ? 225 ASN A HB3  1 
ATOM   8407  H  HD21 . ASN B  1 225 ? -28.960 -64.556 -107.873 1.00 36.86  ? 225 ASN A HD21 1 
ATOM   8408  H  HD22 . ASN B  1 225 ? -28.007 -63.427 -107.674 1.00 36.86  ? 225 ASN A HD22 1 
ATOM   8409  N  N    . GLY B  1 226 ? -30.271 -61.503 -105.553 1.00 20.39  ? 226 GLY A N    1 
ATOM   8410  C  CA   . GLY B  1 226 ? -31.646 -61.312 -105.125 1.00 23.94  ? 226 GLY A CA   1 
ATOM   8411  C  C    . GLY B  1 226 ? -31.964 -59.972 -104.471 1.00 23.62  ? 226 GLY A C    1 
ATOM   8412  O  O    . GLY B  1 226 ? -33.114 -59.731 -104.118 1.00 24.25  ? 226 GLY A O    1 
ATOM   8413  H  H    . GLY B  1 226 ? -30.140 -61.364 -106.392 1.00 24.47  ? 226 GLY A H    1 
ATOM   8414  H  HA2  . GLY B  1 226 ? -32.228 -61.409 -105.896 1.00 28.73  ? 226 GLY A HA2  1 
ATOM   8415  H  HA3  . GLY B  1 226 ? -31.874 -62.011 -104.492 1.00 28.73  ? 226 GLY A HA3  1 
ATOM   8416  N  N    . LYS B  1 227 ? -30.978 -59.091 -104.317 1.00 19.87  ? 227 LYS A N    1 
ATOM   8417  C  CA   . LYS B  1 227 ? -31.190 -57.848 -103.565 1.00 20.22  ? 227 LYS A CA   1 
ATOM   8418  C  C    . LYS B  1 227 ? -31.340 -56.622 -104.454 1.00 18.77  ? 227 LYS A C    1 
ATOM   8419  O  O    . LYS B  1 227 ? -31.549 -55.513 -103.960 1.00 19.41  ? 227 LYS A O    1 
ATOM   8420  C  CB   . LYS B  1 227 ? -30.035 -57.629 -102.583 1.00 19.94  ? 227 LYS A CB   1 
ATOM   8421  C  CG   . LYS B  1 227 ? -29.927 -58.726 -101.537 1.00 23.49  ? 227 LYS A CG   1 
ATOM   8422  C  CD   . LYS B  1 227 ? -28.983 -58.347 -100.407 1.00 24.01  ? 227 LYS A CD   1 
ATOM   8423  C  CE   . LYS B  1 227 ? -28.813 -59.500 -99.425  1.00 39.87  ? 227 LYS A CE   1 
ATOM   8424  N  NZ   . LYS B  1 227 ? -30.132 -59.978 -98.917  1.00 46.94  ? 227 LYS A NZ   1 
ATOM   8425  H  H    . LYS B  1 227 ? -30.184 -59.185 -104.633 1.00 23.85  ? 227 LYS A H    1 
ATOM   8426  H  HA   . LYS B  1 227 ? -32.005 -57.935 -103.046 1.00 24.27  ? 227 LYS A HA   1 
ATOM   8427  H  HB2  . LYS B  1 227 ? -29.201 -57.606 -103.079 1.00 23.93  ? 227 LYS A HB2  1 
ATOM   8428  H  HB3  . LYS B  1 227 ? -30.169 -56.787 -102.121 1.00 23.93  ? 227 LYS A HB3  1 
ATOM   8429  H  HG2  . LYS B  1 227 ? -30.804 -58.889 -101.155 1.00 28.18  ? 227 LYS A HG2  1 
ATOM   8430  H  HG3  . LYS B  1 227 ? -29.589 -59.533 -101.955 1.00 28.18  ? 227 LYS A HG3  1 
ATOM   8431  H  HD2  . LYS B  1 227 ? -28.112 -58.129 -100.775 1.00 28.81  ? 227 LYS A HD2  1 
ATOM   8432  H  HD3  . LYS B  1 227 ? -29.345 -57.587 -99.926  1.00 28.81  ? 227 LYS A HD3  1 
ATOM   8433  H  HE2  . LYS B  1 227 ? -28.373 -60.239 -99.872  1.00 47.85  ? 227 LYS A HE2  1 
ATOM   8434  H  HE3  . LYS B  1 227 ? -28.286 -59.202 -98.668  1.00 47.85  ? 227 LYS A HE3  1 
ATOM   8435  H  HZ1  . LYS B  1 227 ? -30.635 -60.261 -99.596  1.00 56.33  ? 227 LYS A HZ1  1 
ATOM   8436  H  HZ2  . LYS B  1 227 ? -30.013 -60.651 -98.347  1.00 56.33  ? 227 LYS A HZ2  1 
ATOM   8437  H  HZ3  . LYS B  1 227 ? -30.556 -59.316 -98.500  1.00 56.33  ? 227 LYS A HZ3  1 
ATOM   8438  N  N    . LEU B  1 228 ? -31.248 -56.818 -105.766 1.00 13.20  ? 228 LEU A N    1 
ATOM   8439  C  CA   . LEU B  1 228 ? -31.276 -55.708 -106.721 1.00 13.09  ? 228 LEU A CA   1 
ATOM   8440  C  C    . LEU B  1 228 ? -32.090 -56.048 -107.943 1.00 16.70  ? 228 LEU A C    1 
ATOM   8441  O  O    . LEU B  1 228 ? -31.999 -57.147 -108.466 1.00 16.70  ? 228 LEU A O    1 
ATOM   8442  C  CB   . LEU B  1 228 ? -29.858 -55.340 -107.195 1.00 17.26  ? 228 LEU A CB   1 
ATOM   8443  C  CG   . LEU B  1 228 ? -28.855 -54.859 -106.160 1.00 24.91  ? 228 LEU A CG   1 
ATOM   8444  C  CD1  . LEU B  1 228 ? -27.483 -54.703 -106.788 1.00 38.02  ? 228 LEU A CD1  1 
ATOM   8445  C  CD2  . LEU B  1 228 ? -29.309 -53.543 -105.569 1.00 25.65  ? 228 LEU A CD2  1 
ATOM   8446  H  H    . LEU B  1 228 ? -31.168 -57.591 -106.134 1.00 15.84  ? 228 LEU A H    1 
ATOM   8447  H  HA   . LEU B  1 228 ? -31.669 -54.929 -106.297 1.00 15.71  ? 228 LEU A HA   1 
ATOM   8448  H  HB2  . LEU B  1 228 ? -29.473 -56.124 -107.617 1.00 20.71  ? 228 LEU A HB2  1 
ATOM   8449  H  HB3  . LEU B  1 228 ? -29.940 -54.635 -107.856 1.00 20.71  ? 228 LEU A HB3  1 
ATOM   8450  H  HG   . LEU B  1 228 ? -28.792 -55.511 -105.444 1.00 29.89  ? 228 LEU A HG   1 
ATOM   8451  H  HD11 . LEU B  1 228 ? -26.860 -54.396 -106.111 1.00 45.62  ? 228 LEU A HD11 1 
ATOM   8452  H  HD12 . LEU B  1 228 ? -27.196 -55.561 -107.137 1.00 45.62  ? 228 LEU A HD12 1 
ATOM   8453  H  HD13 . LEU B  1 228 ? -27.537 -54.054 -107.507 1.00 45.62  ? 228 LEU A HD13 1 
ATOM   8454  H  HD21 . LEU B  1 228 ? -28.658 -53.251 -104.911 1.00 30.78  ? 228 LEU A HD21 1 
ATOM   8455  H  HD22 . LEU B  1 228 ? -29.380 -52.886 -106.279 1.00 30.78  ? 228 LEU A HD22 1 
ATOM   8456  H  HD23 . LEU B  1 228 ? -30.173 -53.669 -105.146 1.00 30.78  ? 228 LEU A HD23 1 
ATOM   8457  N  N    . THR B  1 229 ? -32.877 -55.101 -108.425 1.00 17.25  ? 229 THR A N    1 
ATOM   8458  C  CA   . THR B  1 229 ? -33.343 -55.205 -109.794 1.00 14.50  ? 229 THR A CA   1 
ATOM   8459  C  C    . THR B  1 229 ? -33.564 -53.786 -110.320 1.00 16.73  ? 229 THR A C    1 
ATOM   8460  O  O    . THR B  1 229 ? -33.146 -52.805 -109.677 1.00 13.88  ? 229 THR A O    1 
ATOM   8461  C  CB   . THR B  1 229 ? -34.599 -56.121 -109.920 1.00 19.13  ? 229 THR A CB   1 
ATOM   8462  O  OG1  . THR B  1 229 ? -34.866 -56.357 -111.312 1.00 24.59  ? 229 THR A OG1  1 
ATOM   8463  C  CG2  . THR B  1 229 ? -35.817 -55.538 -109.227 1.00 17.40  ? 229 THR A CG2  1 
ATOM   8464  H  H    . THR B  1 229 ? -33.148 -54.407 -107.996 1.00 20.70  ? 229 THR A H    1 
ATOM   8465  H  HA   . THR B  1 229 ? -32.639 -55.605 -110.328 1.00 17.40  ? 229 THR A HA   1 
ATOM   8466  H  HB   . THR B  1 229 ? -34.402 -56.972 -109.497 1.00 22.95  ? 229 THR A HB   1 
ATOM   8467  H  HG1  . THR B  1 229 ? -35.541 -56.850 -111.396 1.00 29.50  ? 229 THR A HG1  1 
ATOM   8468  H  HG21 . THR B  1 229 ? -36.574 -56.137 -109.328 1.00 20.88  ? 229 THR A HG21 1 
ATOM   8469  H  HG22 . THR B  1 229 ? -35.634 -55.418 -108.282 1.00 20.88  ? 229 THR A HG22 1 
ATOM   8470  H  HG23 . THR B  1 229 ? -36.040 -54.679 -109.616 1.00 20.88  ? 229 THR A HG23 1 
ATOM   8471  N  N    . GLY B  1 230 ? -34.106 -53.664 -111.522 1.00 13.49  ? 230 GLY A N    1 
ATOM   8472  C  CA   . GLY B  1 230 ? -34.228 -52.351 -112.127 1.00 19.14  ? 230 GLY A CA   1 
ATOM   8473  C  C    . GLY B  1 230 ? -34.869 -52.366 -113.496 1.00 19.29  ? 230 GLY A C    1 
ATOM   8474  O  O    . GLY B  1 230 ? -35.347 -53.394 -113.955 1.00 12.97  ? 230 GLY A O    1 
ATOM   8475  H  H    . GLY B  1 230 ? -34.406 -54.313 -112.000 1.00 16.19  ? 230 GLY A H    1 
ATOM   8476  H  HA2  . GLY B  1 230 ? -34.762 -51.783 -111.549 1.00 22.97  ? 230 GLY A HA2  1 
ATOM   8477  H  HA3  . GLY B  1 230 ? -33.346 -51.956 -112.210 1.00 22.97  ? 230 GLY A HA3  1 
ATOM   8478  N  N    . MET B  1 231 ? -34.904 -51.197 -114.123 1.00 14.91  ? 231 MET A N    1 
ATOM   8479  C  CA   . MET B  1 231 ? -35.432 -51.044 -115.466 1.00 13.08  ? 231 MET A CA   1 
ATOM   8480  C  C    . MET B  1 231 ? -34.761 -49.843 -116.112 1.00 15.96  ? 231 MET A C    1 
ATOM   8481  O  O    . MET B  1 231 ? -33.914 -49.190 -115.491 1.00 9.31   ? 231 MET A O    1 
ATOM   8482  C  CB   . MET B  1 231 ? -36.952 -50.901 -115.455 1.00 13.19  ? 231 MET A CB   1 
ATOM   8483  C  CG   . MET B  1 231 ? -37.517 -49.857 -114.509 1.00 20.85  ? 231 MET A CG   1 
ATOM   8484  S  SD   . MET B  1 231 ? -37.402 -48.196 -115.179 1.00 25.14  ? 231 MET A SD   1 
ATOM   8485  C  CE   . MET B  1 231 ? -38.664 -48.280 -116.471 1.00 32.36  ? 231 MET A CE   1 
ATOM   8486  H  H    . MET B  1 231 ? -34.621 -50.461 -113.780 1.00 17.89  ? 231 MET A H    1 
ATOM   8487  H  HA   . MET B  1 231 ? -35.213 -51.837 -115.979 1.00 15.69  ? 231 MET A HA   1 
ATOM   8488  H  HB2  . MET B  1 231 ? -37.242 -50.666 -116.351 1.00 15.82  ? 231 MET A HB2  1 
ATOM   8489  H  HB3  . MET B  1 231 ? -37.337 -51.755 -115.206 1.00 15.82  ? 231 MET A HB3  1 
ATOM   8490  H  HG2  . MET B  1 231 ? -38.453 -50.052 -114.345 1.00 25.02  ? 231 MET A HG2  1 
ATOM   8491  H  HG3  . MET B  1 231 ? -37.020 -49.881 -113.676 1.00 25.02  ? 231 MET A HG3  1 
ATOM   8492  H  HE1  . MET B  1 231 ? -38.708 -47.423 -116.924 1.00 38.83  ? 231 MET A HE1  1 
ATOM   8493  H  HE2  . MET B  1 231 ? -38.424 -48.977 -117.101 1.00 38.83  ? 231 MET A HE2  1 
ATOM   8494  H  HE3  . MET B  1 231 ? -39.520 -48.482 -116.063 1.00 38.83  ? 231 MET A HE3  1 
ATOM   8495  N  N    . ALA B  1 232 ? -35.102 -49.592 -117.372 1.00 13.48  ? 232 ALA A N    1 
ATOM   8496  C  CA   . ALA B  1 232 ? -34.445 -48.560 -118.168 1.00 12.48  ? 232 ALA A CA   1 
ATOM   8497  C  C    . ALA B  1 232 ? -35.437 -47.677 -118.871 1.00 8.66   ? 232 ALA A C    1 
ATOM   8498  O  O    . ALA B  1 232 ? -36.575 -48.098 -119.173 1.00 11.97  ? 232 ALA A O    1 
ATOM   8499  C  CB   . ALA B  1 232 ? -33.522 -49.183 -119.197 1.00 13.82  ? 232 ALA A CB   1 
ATOM   8500  H  H    . ALA B  1 232 ? -35.721 -50.012 -117.795 1.00 16.17  ? 232 ALA A H    1 
ATOM   8501  H  HA   . ALA B  1 232 ? -33.909 -48.002 -117.583 1.00 14.97  ? 232 ALA A HA   1 
ATOM   8502  H  HB1  . ALA B  1 232 ? -33.100 -48.477 -119.710 1.00 16.59  ? 232 ALA A HB1  1 
ATOM   8503  H  HB2  . ALA B  1 232 ? -32.848 -49.708 -118.738 1.00 16.59  ? 232 ALA A HB2  1 
ATOM   8504  H  HB3  . ALA B  1 232 ? -34.043 -49.753 -119.783 1.00 16.59  ? 232 ALA A HB3  1 
ATOM   8505  N  N    . PHE B  1 233 ? -34.987 -46.453 -119.152 1.00 8.29   ? 233 PHE A N    1 
ATOM   8506  C  CA   . PHE B  1 233 ? -35.664 -45.540 -120.053 1.00 9.74   ? 233 PHE A CA   1 
ATOM   8507  C  C    . PHE B  1 233 ? -34.691 -45.167 -121.152 1.00 13.54  ? 233 PHE A C    1 
ATOM   8508  O  O    . PHE B  1 233 ? -33.638 -44.621 -120.863 1.00 15.78  ? 233 PHE A O    1 
ATOM   8509  C  CB   . PHE B  1 233 ? -36.111 -44.261 -119.348 1.00 8.31   ? 233 PHE A CB   1 
ATOM   8510  C  CG   . PHE B  1 233 ? -37.255 -44.453 -118.399 1.00 10.30  ? 233 PHE A CG   1 
ATOM   8511  C  CD1  . PHE B  1 233 ? -38.540 -44.637 -118.879 1.00 9.21   ? 233 PHE A CD1  1 
ATOM   8512  C  CD2  . PHE B  1 233 ? -37.047 -44.424 -117.033 1.00 20.46  ? 233 PHE A CD2  1 
ATOM   8513  C  CE1  . PHE B  1 233 ? -39.604 -44.801 -118.013 1.00 13.58  ? 233 PHE A CE1  1 
ATOM   8514  C  CE2  . PHE B  1 233 ? -38.106 -44.582 -116.164 1.00 16.37  ? 233 PHE A CE2  1 
ATOM   8515  C  CZ   . PHE B  1 233 ? -39.382 -44.777 -116.652 1.00 18.84  ? 233 PHE A CZ   1 
ATOM   8516  H  H    . PHE B  1 233 ? -34.265 -46.125 -118.817 1.00 9.94   ? 233 PHE A H    1 
ATOM   8517  H  HA   . PHE B  1 233 ? -36.437 -45.972 -120.447 1.00 11.69  ? 233 PHE A HA   1 
ATOM   8518  H  HB2  . PHE B  1 233 ? -35.364 -43.907 -118.842 1.00 9.97   ? 233 PHE A HB2  1 
ATOM   8519  H  HB3  . PHE B  1 233 ? -36.388 -43.617 -120.018 1.00 9.97   ? 233 PHE A HB3  1 
ATOM   8520  H  HD1  . PHE B  1 233 ? -38.689 -44.654 -119.797 1.00 11.05  ? 233 PHE A HD1  1 
ATOM   8521  H  HD2  . PHE B  1 233 ? -36.189 -44.295 -116.699 1.00 24.56  ? 233 PHE A HD2  1 
ATOM   8522  H  HE1  . PHE B  1 233 ? -40.463 -44.929 -118.345 1.00 16.30  ? 233 PHE A HE1  1 
ATOM   8523  H  HE2  . PHE B  1 233 ? -37.958 -44.569 -115.246 1.00 19.64  ? 233 PHE A HE2  1 
ATOM   8524  H  HZ   . PHE B  1 233 ? -40.093 -44.887 -116.063 1.00 22.60  ? 233 PHE A HZ   1 
ATOM   8525  N  N    . ARG B  1 234 ? -35.045 -45.441 -122.396 1.00 8.27   ? 234 ARG A N    1 
ATOM   8526  C  CA   . ARG B  1 234 ? -34.257 -44.999 -123.545 1.00 8.01   ? 234 ARG A CA   1 
ATOM   8527  C  C    . ARG B  1 234 ? -34.676 -43.586 -123.903 1.00 8.01   ? 234 ARG A C    1 
ATOM   8528  O  O    . ARG B  1 234 ? -35.876 -43.309 -124.010 1.00 8.61   ? 234 ARG A O    1 
ATOM   8529  C  CB   . ARG B  1 234 ? -34.467 -45.934 -124.743 1.00 8.33   ? 234 ARG A CB   1 
ATOM   8530  C  CG   . ARG B  1 234 ? -33.887 -47.341 -124.569 1.00 14.31  ? 234 ARG A CG   1 
ATOM   8531  C  CD   . ARG B  1 234 ? -32.353 -47.270 -124.571 1.00 36.23  ? 234 ARG A CD   1 
ATOM   8532  N  NE   . ARG B  1 234 ? -31.676 -48.557 -124.364 1.00 35.84  ? 234 ARG A NE   1 
ATOM   8533  C  CZ   . ARG B  1 234 ? -31.174 -49.322 -125.331 1.00 39.99  ? 234 ARG A CZ   1 
ATOM   8534  N  NH1  . ARG B  1 234 ? -31.270 -48.961 -126.605 1.00 43.64  ? 234 ARG A NH1  1 
ATOM   8535  N  NH2  . ARG B  1 234 ? -30.567 -50.459 -125.024 1.00 44.26  ? 234 ARG A NH2  1 
ATOM   8536  H  H    . ARG B  1 234 ? -35.748 -45.888 -122.609 1.00 9.92   ? 234 ARG A H    1 
ATOM   8537  H  HA   . ARG B  1 234 ? -33.315 -44.996 -123.314 1.00 9.61   ? 234 ARG A HA   1 
ATOM   8538  H  HB2  . ARG B  1 234 ? -35.419 -46.027 -124.900 1.00 10.00  ? 234 ARG A HB2  1 
ATOM   8539  H  HB3  . ARG B  1 234 ? -34.045 -45.538 -125.522 1.00 10.00  ? 234 ARG A HB3  1 
ATOM   8540  H  HG2  . ARG B  1 234 ? -34.179 -47.711 -123.721 1.00 17.18  ? 234 ARG A HG2  1 
ATOM   8541  H  HG3  . ARG B  1 234 ? -34.173 -47.904 -125.305 1.00 17.18  ? 234 ARG A HG3  1 
ATOM   8542  H  HD2  . ARG B  1 234 ? -32.061 -46.919 -125.427 1.00 43.48  ? 234 ARG A HD2  1 
ATOM   8543  H  HD3  . ARG B  1 234 ? -32.070 -46.672 -123.861 1.00 43.48  ? 234 ARG A HD3  1 
ATOM   8544  H  HE   . ARG B  1 234 ? -31.598 -48.838 -123.555 1.00 43.00  ? 234 ARG A HE   1 
ATOM   8545  H  HH11 . ARG B  1 234 ? -31.658 -48.223 -126.814 1.00 52.37  ? 234 ARG A HH11 1 
ATOM   8546  H  HH12 . ARG B  1 234 ? -30.944 -49.466 -127.220 1.00 52.37  ? 234 ARG A HH12 1 
ATOM   8547  H  HH21 . ARG B  1 234 ? -30.502 -50.704 -124.202 1.00 53.12  ? 234 ARG A HH21 1 
ATOM   8548  H  HH22 . ARG B  1 234 ? -30.248 -50.959 -125.647 1.00 53.12  ? 234 ARG A HH22 1 
ATOM   8549  N  N    . VAL B  1 235 ? -33.707 -42.681 -124.090 1.00 7.81   ? 235 VAL A N    1 
ATOM   8550  C  CA   . VAL B  1 235 ? -34.027 -41.305 -124.444 1.00 7.79   ? 235 VAL A CA   1 
ATOM   8551  C  C    . VAL B  1 235 ? -33.190 -40.860 -125.632 1.00 7.78   ? 235 VAL A C    1 
ATOM   8552  O  O    . VAL B  1 235 ? -32.121 -41.432 -125.902 1.00 11.43  ? 235 VAL A O    1 
ATOM   8553  C  CB   . VAL B  1 235 ? -33.806 -40.337 -123.251 1.00 15.00  ? 235 VAL A CB   1 
ATOM   8554  C  CG1  . VAL B  1 235 ? -34.660 -40.771 -122.069 1.00 11.02  ? 235 VAL A CG1  1 
ATOM   8555  C  CG2  . VAL B  1 235 ? -32.346 -40.284 -122.846 1.00 11.30  ? 235 VAL A CG2  1 
ATOM   8556  H  H    . VAL B  1 235 ? -32.866 -42.842 -124.017 1.00 9.38   ? 235 VAL A H    1 
ATOM   8557  H  HA   . VAL B  1 235 ? -34.961 -41.256 -124.700 1.00 9.35   ? 235 VAL A HA   1 
ATOM   8558  H  HB   . VAL B  1 235 ? -34.081 -39.443 -123.511 1.00 18.00  ? 235 VAL A HB   1 
ATOM   8559  H  HG11 . VAL B  1 235 ? -34.513 -40.158 -121.332 1.00 13.22  ? 235 VAL A HG11 1 
ATOM   8560  H  HG12 . VAL B  1 235 ? -35.594 -40.755 -122.332 1.00 13.22  ? 235 VAL A HG12 1 
ATOM   8561  H  HG13 . VAL B  1 235 ? -34.405 -41.669 -121.809 1.00 13.22  ? 235 VAL A HG13 1 
ATOM   8562  H  HG21 . VAL B  1 235 ? -32.248 -39.671 -122.101 1.00 13.56  ? 235 VAL A HG21 1 
ATOM   8563  H  HG22 . VAL B  1 235 ? -32.059 -41.173 -122.583 1.00 13.56  ? 235 VAL A HG22 1 
ATOM   8564  H  HG23 . VAL B  1 235 ? -31.820 -39.976 -123.600 1.00 13.56  ? 235 VAL A HG23 1 
ATOM   8565  N  N    . PRO B  1 236 ? -33.649 -39.822 -126.328 1.00 8.00   ? 236 PRO A N    1 
ATOM   8566  C  CA   . PRO B  1 236 ? -33.025 -39.400 -127.588 1.00 14.97  ? 236 PRO A CA   1 
ATOM   8567  C  C    . PRO B  1 236 ? -31.711 -38.642 -127.430 1.00 15.00  ? 236 PRO A C    1 
ATOM   8568  O  O    . PRO B  1 236 ? -31.656 -37.428 -127.678 1.00 17.15  ? 236 PRO A O    1 
ATOM   8569  C  CB   . PRO B  1 236 ? -34.094 -38.485 -128.224 1.00 11.60  ? 236 PRO A CB   1 
ATOM   8570  C  CG   . PRO B  1 236 ? -35.266 -38.573 -127.381 1.00 17.56  ? 236 PRO A CG   1 
ATOM   8571  C  CD   . PRO B  1 236 ? -34.852 -39.025 -126.045 1.00 11.45  ? 236 PRO A CD   1 
ATOM   8572  H  HA   . PRO B  1 236 ? -32.881 -40.168 -128.163 1.00 17.96  ? 236 PRO A HA   1 
ATOM   8573  H  HB2  . PRO B  1 236 ? -33.763 -37.573 -128.250 1.00 13.92  ? 236 PRO A HB2  1 
ATOM   8574  H  HB3  . PRO B  1 236 ? -34.296 -38.798 -129.119 1.00 13.92  ? 236 PRO A HB3  1 
ATOM   8575  H  HG2  . PRO B  1 236 ? -35.680 -37.698 -127.323 1.00 21.07  ? 236 PRO A HG2  1 
ATOM   8576  H  HG3  . PRO B  1 236 ? -35.887 -39.210 -127.770 1.00 21.07  ? 236 PRO A HG3  1 
ATOM   8577  H  HD2  . PRO B  1 236 ? -34.632 -38.266 -125.482 1.00 13.74  ? 236 PRO A HD2  1 
ATOM   8578  H  HD3  . PRO B  1 236 ? -35.541 -39.579 -125.645 1.00 13.74  ? 236 PRO A HD3  1 
ATOM   8579  N  N    . THR B  1 237 ? -30.663 -39.348 -127.022 1.00 11.78  ? 237 THR A N    1 
ATOM   8580  C  CA   . THR B  1 237 ? -29.308 -38.846 -127.131 1.00 16.80  ? 237 THR A CA   1 
ATOM   8581  C  C    . THR B  1 237 ? -28.503 -39.977 -127.733 1.00 11.58  ? 237 THR A C    1 
ATOM   8582  O  O    . THR B  1 237 ? -28.817 -41.137 -127.514 1.00 10.17  ? 237 THR A O    1 
ATOM   8583  C  CB   . THR B  1 237 ? -28.698 -38.427 -125.767 1.00 17.60  ? 237 THR A CB   1 
ATOM   8584  O  OG1  . THR B  1 237 ? -28.675 -39.564 -124.891 1.00 23.78  ? 237 THR A OG1  1 
ATOM   8585  C  CG2  . THR B  1 237 ? -29.535 -37.350 -125.131 1.00 27.97  ? 237 THR A CG2  1 
ATOM   8586  H  H    . THR B  1 237 ? -30.715 -40.132 -126.673 1.00 14.14  ? 237 THR A H    1 
ATOM   8587  H  HA   . THR B  1 237 ? -29.284 -38.086 -127.734 1.00 20.16  ? 237 THR A HA   1 
ATOM   8588  H  HB   . THR B  1 237 ? -27.797 -38.090 -125.896 1.00 21.12  ? 237 THR A HB   1 
ATOM   8589  H  HG1  . THR B  1 237 ? -28.346 -39.349 -124.149 1.00 28.53  ? 237 THR A HG1  1 
ATOM   8590  H  HG21 . THR B  1 237 ? -29.150 -37.091 -124.279 1.00 33.57  ? 237 THR A HG21 1 
ATOM   8591  H  HG22 . THR B  1 237 ? -29.570 -36.573 -125.710 1.00 33.57  ? 237 THR A HG22 1 
ATOM   8592  H  HG23 . THR B  1 237 ? -30.437 -37.675 -124.984 1.00 33.57  ? 237 THR A HG23 1 
ATOM   8593  N  N    . ALA B  1 238 ? -27.457 -39.646 -128.475 1.00 14.11  ? 238 ALA A N    1 
ATOM   8594  C  CA   . ALA B  1 238 ? -26.735 -40.637 -129.265 1.00 15.46  ? 238 ALA A CA   1 
ATOM   8595  C  C    . ALA B  1 238 ? -25.743 -41.447 -128.448 1.00 12.81  ? 238 ALA A C    1 
ATOM   8596  O  O    . ALA B  1 238 ? -25.322 -42.538 -128.873 1.00 10.62  ? 238 ALA A O    1 
ATOM   8597  C  CB   . ALA B  1 238 ? -26.019 -39.949 -130.421 1.00 16.96  ? 238 ALA A CB   1 
ATOM   8598  H  H    . ALA B  1 238 ? -27.142 -38.848 -128.540 1.00 16.93  ? 238 ALA A H    1 
ATOM   8599  H  HA   . ALA B  1 238 ? -27.378 -41.257 -129.645 1.00 18.56  ? 238 ALA A HA   1 
ATOM   8600  H  HB1  . ALA B  1 238 ? -25.543 -40.617 -130.939 1.00 20.35  ? 238 ALA A HB1  1 
ATOM   8601  H  HB2  . ALA B  1 238 ? -26.675 -39.503 -130.978 1.00 20.35  ? 238 ALA A HB2  1 
ATOM   8602  H  HB3  . ALA B  1 238 ? -25.393 -39.300 -130.062 1.00 20.35  ? 238 ALA A HB3  1 
ATOM   8603  N  N    . ASN B  1 239 ? -25.362 -40.915 -127.287 1.00 11.83  ? 239 ASN A N    1 
ATOM   8604  C  CA   . ASN B  1 239 ? -24.403 -41.582 -126.411 1.00 10.50  ? 239 ASN A CA   1 
ATOM   8605  C  C    . ASN B  1 239 ? -24.359 -40.935 -125.032 1.00 10.85  ? 239 ASN A C    1 
ATOM   8606  O  O    . ASN B  1 239 ? -24.722 -39.762 -124.880 1.00 9.47   ? 239 ASN A O    1 
ATOM   8607  C  CB   . ASN B  1 239 ? -23.006 -41.546 -127.027 1.00 9.09   ? 239 ASN A CB   1 
ATOM   8608  C  CG   . ASN B  1 239 ? -22.038 -42.525 -126.365 1.00 15.31  ? 239 ASN A CG   1 
ATOM   8609  O  OD1  . ASN B  1 239 ? -22.382 -43.671 -126.076 1.00 14.86  ? 239 ASN A OD1  1 
ATOM   8610  N  ND2  . ASN B  1 239 ? -20.808 -42.076 -126.154 1.00 11.90  ? 239 ASN A ND2  1 
ATOM   8611  H  H    . ASN B  1 239 ? -25.648 -40.164 -126.983 1.00 14.19  ? 239 ASN A H    1 
ATOM   8612  H  HA   . ASN B  1 239 ? -24.662 -42.510 -126.302 1.00 12.60  ? 239 ASN A HA   1 
ATOM   8613  H  HB2  . ASN B  1 239 ? -23.069 -41.777 -127.967 1.00 10.91  ? 239 ASN A HB2  1 
ATOM   8614  H  HB3  . ASN B  1 239 ? -22.641 -40.652 -126.930 1.00 10.91  ? 239 ASN A HB3  1 
ATOM   8615  H  HD21 . ASN B  1 239 ? -20.222 -42.586 -125.784 1.00 14.28  ? 239 ASN A HD21 1 
ATOM   8616  H  HD22 . ASN B  1 239 ? -20.597 -41.276 -126.386 1.00 14.28  ? 239 ASN A HD22 1 
ATOM   8617  N  N    . VAL B  1 240 ? -23.871 -41.732 -124.084 1.00 8.18   ? 240 VAL A N    1 
ATOM   8618  C  CA   . VAL B  1 240 ? -23.746 -41.471 -122.631 1.00 6.51   ? 240 VAL A CA   1 
ATOM   8619  C  C    . VAL B  1 240 ? -25.064 -41.707 -121.887 1.00 7.62   ? 240 VAL A C    1 
ATOM   8620  O  O    . VAL B  1 240 ? -26.131 -41.206 -122.257 1.00 8.49   ? 240 VAL A O    1 
ATOM   8621  C  CB   . VAL B  1 240 ? -23.237 -40.059 -122.307 1.00 7.70   ? 240 VAL A CB   1 
ATOM   8622  C  CG1  . VAL B  1 240 ? -23.010 -39.929 -120.793 1.00 8.62   ? 240 VAL A CG1  1 
ATOM   8623  C  CG2  . VAL B  1 240 ? -21.917 -39.763 -123.071 1.00 6.82   ? 240 VAL A CG2  1 
ATOM   8624  H  H    . VAL B  1 240 ? -23.573 -42.515 -124.277 1.00 9.81   ? 240 VAL A H    1 
ATOM   8625  H  HA   . VAL B  1 240 ? -23.099 -42.097 -122.270 1.00 7.81   ? 240 VAL A HA   1 
ATOM   8626  H  HB   . VAL B  1 240 ? -23.901 -39.406 -122.576 1.00 9.24   ? 240 VAL A HB   1 
ATOM   8627  H  HG11 . VAL B  1 240 ? -22.689 -39.035 -120.598 1.00 10.35  ? 240 VAL A HG11 1 
ATOM   8628  H  HG12 . VAL B  1 240 ? -23.850 -40.087 -120.334 1.00 10.35  ? 240 VAL A HG12 1 
ATOM   8629  H  HG13 . VAL B  1 240 ? -22.352 -40.586 -120.516 1.00 10.35  ? 240 VAL A HG13 1 
ATOM   8630  H  HG21 . VAL B  1 240 ? -21.618 -38.867 -122.849 1.00 8.18   ? 240 VAL A HG21 1 
ATOM   8631  H  HG22 . VAL B  1 240 ? -21.246 -40.411 -122.805 1.00 8.18   ? 240 VAL A HG22 1 
ATOM   8632  H  HG23 . VAL B  1 240 ? -22.083 -39.830 -124.025 1.00 8.18   ? 240 VAL A HG23 1 
ATOM   8633  N  N    . SER B  1 241 ? -24.939 -42.453 -120.804 1.00 7.33   ? 241 SER A N    1 
ATOM   8634  C  CA   . SER B  1 241 ? -26.067 -42.928 -120.031 1.00 8.29   ? 241 SER A CA   1 
ATOM   8635  C  C    . SER B  1 241 ? -25.808 -42.660 -118.575 1.00 9.97   ? 241 SER A C    1 
ATOM   8636  O  O    . SER B  1 241 ? -24.704 -42.262 -118.183 1.00 6.52   ? 241 SER A O    1 
ATOM   8637  C  CB   . SER B  1 241 ? -26.296 -44.416 -120.300 1.00 9.79   ? 241 SER A CB   1 
ATOM   8638  O  OG   . SER B  1 241 ? -26.569 -44.621 -121.690 1.00 8.81   ? 241 SER A OG   1 
ATOM   8639  H  H    . SER B  1 241 ? -24.181 -42.705 -120.487 1.00 8.80   ? 241 SER A H    1 
ATOM   8640  H  HA   . SER B  1 241 ? -26.865 -42.443 -120.294 1.00 9.95   ? 241 SER A HA   1 
ATOM   8641  H  HB2  . SER B  1 241 ? -25.499 -44.911 -120.055 1.00 11.74  ? 241 SER A HB2  1 
ATOM   8642  H  HB3  . SER B  1 241 ? -27.054 -44.721 -119.777 1.00 11.74  ? 241 SER A HB3  1 
ATOM   8643  H  HG   . SER B  1 241 ? -25.920 -44.357 -122.152 1.00 10.57  ? 241 SER A HG   1 
ATOM   8644  N  N    . VAL B  1 242 ? -26.836 -42.851 -117.760 1.00 8.49   ? 242 VAL A N    1 
ATOM   8645  C  CA   . VAL B  1 242 ? -26.700 -42.592 -116.344 1.00 7.98   ? 242 VAL A CA   1 
ATOM   8646  C  C    . VAL B  1 242 ? -27.547 -43.572 -115.543 1.00 11.36  ? 242 VAL A C    1 
ATOM   8647  O  O    . VAL B  1 242 ? -28.635 -43.963 -115.958 1.00 10.06  ? 242 VAL A O    1 
ATOM   8648  C  CB   . VAL B  1 242 ? -27.064 -41.124 -116.004 1.00 10.45  ? 242 VAL A CB   1 
ATOM   8649  C  CG1  . VAL B  1 242 ? -28.487 -40.781 -116.380 1.00 10.49  ? 242 VAL A CG1  1 
ATOM   8650  C  CG2  . VAL B  1 242 ? -26.825 -40.828 -114.532 1.00 14.08  ? 242 VAL A CG2  1 
ATOM   8651  H  H    . VAL B  1 242 ? -27.614 -43.127 -118.002 1.00 10.19  ? 242 VAL A H    1 
ATOM   8652  H  HA   . VAL B  1 242 ? -25.774 -42.730 -116.092 1.00 9.57   ? 242 VAL A HA   1 
ATOM   8653  H  HB   . VAL B  1 242 ? -26.482 -40.540 -116.514 1.00 12.54  ? 242 VAL A HB   1 
ATOM   8654  H  HG11 . VAL B  1 242 ? -28.660 -39.855 -116.146 1.00 12.59  ? 242 VAL A HG11 1 
ATOM   8655  H  HG12 . VAL B  1 242 ? -28.600 -40.908 -117.334 1.00 12.59  ? 242 VAL A HG12 1 
ATOM   8656  H  HG13 . VAL B  1 242 ? -29.091 -41.364 -115.894 1.00 12.59  ? 242 VAL A HG13 1 
ATOM   8657  H  HG21 . VAL B  1 242 ? -27.063 -39.904 -114.354 1.00 16.89  ? 242 VAL A HG21 1 
ATOM   8658  H  HG22 . VAL B  1 242 ? -27.377 -41.420 -113.998 1.00 16.89  ? 242 VAL A HG22 1 
ATOM   8659  H  HG23 . VAL B  1 242 ? -25.888 -40.974 -114.329 1.00 16.89  ? 242 VAL A HG23 1 
ATOM   8660  N  N    . VAL B  1 243 ? -26.990 -43.982 -114.412 1.00 9.33   ? 243 VAL A N    1 
ATOM   8661  C  CA   . VAL B  1 243 ? -27.630 -44.905 -113.487 1.00 11.65  ? 243 VAL A CA   1 
ATOM   8662  C  C    . VAL B  1 243 ? -28.113 -44.147 -112.279 1.00 13.20  ? 243 VAL A C    1 
ATOM   8663  O  O    . VAL B  1 243 ? -27.439 -43.272 -111.768 1.00 13.19  ? 243 VAL A O    1 
ATOM   8664  C  CB   . VAL B  1 243 ? -26.657 -46.038 -113.045 1.00 16.68  ? 243 VAL A CB   1 
ATOM   8665  C  CG1  . VAL B  1 243 ? -27.023 -46.596 -111.670 1.00 38.38  ? 243 VAL A CG1  1 
ATOM   8666  C  CG2  . VAL B  1 243 ? -26.672 -47.148 -114.060 1.00 21.65  ? 243 VAL A CG2  1 
ATOM   8667  H  H    . VAL B  1 243 ? -26.211 -43.729 -114.150 1.00 11.20  ? 243 VAL A H    1 
ATOM   8668  H  HA   . VAL B  1 243 ? -28.397 -45.313 -113.919 1.00 13.98  ? 243 VAL A HA   1 
ATOM   8669  H  HB   . VAL B  1 243 ? -25.756 -45.683 -112.998 1.00 20.01  ? 243 VAL A HB   1 
ATOM   8670  H  HG11 . VAL B  1 243 ? -26.393 -47.295 -111.436 1.00 46.06  ? 243 VAL A HG11 1 
ATOM   8671  H  HG12 . VAL B  1 243 ? -26.980 -45.879 -111.017 1.00 46.06  ? 243 VAL A HG12 1 
ATOM   8672  H  HG13 . VAL B  1 243 ? -27.922 -46.958 -111.705 1.00 46.06  ? 243 VAL A HG13 1 
ATOM   8673  H  HG21 . VAL B  1 243 ? -26.062 -47.846 -113.773 1.00 25.97  ? 243 VAL A HG21 1 
ATOM   8674  H  HG22 . VAL B  1 243 ? -27.572 -47.502 -114.128 1.00 25.97  ? 243 VAL A HG22 1 
ATOM   8675  H  HG23 . VAL B  1 243 ? -26.390 -46.794 -114.919 1.00 25.97  ? 243 VAL A HG23 1 
ATOM   8676  N  N    . ASP B  1 244 ? -29.297 -44.517 -111.829 1.00 9.86   ? 244 ASP A N    1 
ATOM   8677  C  CA   . ASP B  1 244 ? -29.923 -43.983 -110.629 1.00 17.60  ? 244 ASP A CA   1 
ATOM   8678  C  C    . ASP B  1 244 ? -30.191 -45.169 -109.695 1.00 19.84  ? 244 ASP A C    1 
ATOM   8679  O  O    . ASP B  1 244 ? -31.128 -45.925 -109.941 1.00 19.70  ? 244 ASP A O    1 
ATOM   8680  C  CB   . ASP B  1 244 ? -31.201 -43.257 -111.056 1.00 27.62  ? 244 ASP A CB   1 
ATOM   8681  C  CG   . ASP B  1 244 ? -32.016 -42.734 -109.916 1.00 67.41  ? 244 ASP A CG   1 
ATOM   8682  O  OD1  . ASP B  1 244 ? -32.199 -43.438 -108.904 1.00 81.66  ? 244 ASP A OD1  1 
ATOM   8683  O  OD2  . ASP B  1 244 ? -32.532 -41.609 -110.078 1.00 88.51  ? 244 ASP A OD2  1 
ATOM   8684  H  H    . ASP B  1 244 ? -29.784 -45.107 -112.222 1.00 11.84  ? 244 ASP A H    1 
ATOM   8685  H  HA   . ASP B  1 244 ? -29.328 -43.356 -110.189 1.00 21.12  ? 244 ASP A HA   1 
ATOM   8686  H  HB2  . ASP B  1 244 ? -30.959 -42.504 -111.616 1.00 33.15  ? 244 ASP A HB2  1 
ATOM   8687  H  HB3  . ASP B  1 244 ? -31.756 -43.874 -111.557 1.00 33.15  ? 244 ASP A HB3  1 
ATOM   8688  N  N    . LEU B  1 245 ? -29.377 -45.341 -108.648 1.00 10.58  ? 245 LEU A N    1 
ATOM   8689  C  CA   . LEU B  1 245 ? -29.513 -46.465 -107.719 1.00 11.19  ? 245 LEU A CA   1 
ATOM   8690  C  C    . LEU B  1 245 ? -30.193 -46.020 -106.425 1.00 15.82  ? 245 LEU A C    1 
ATOM   8691  O  O    . LEU B  1 245 ? -29.647 -45.210 -105.684 1.00 14.84  ? 245 LEU A O    1 
ATOM   8692  C  CB   . LEU B  1 245 ? -28.144 -47.076 -107.407 1.00 21.90  ? 245 LEU A CB   1 
ATOM   8693  C  CG   . LEU B  1 245 ? -28.110 -48.169 -106.321 1.00 24.07  ? 245 LEU A CG   1 
ATOM   8694  C  CD1  . LEU B  1 245 ? -28.899 -49.401 -106.729 1.00 18.99  ? 245 LEU A CD1  1 
ATOM   8695  C  CD2  . LEU B  1 245 ? -26.673 -48.549 -105.972 1.00 24.58  ? 245 LEU A CD2  1 
ATOM   8696  H  H    . LEU B  1 245 ? -28.729 -44.811 -108.453 1.00 12.69  ? 245 LEU A H    1 
ATOM   8697  H  HA   . LEU B  1 245 ? -30.063 -47.150 -108.128 1.00 13.43  ? 245 LEU A HA   1 
ATOM   8698  H  HB2  . LEU B  1 245 ? -27.794 -47.470 -108.222 1.00 26.28  ? 245 LEU A HB2  1 
ATOM   8699  H  HB3  . LEU B  1 245 ? -27.553 -46.364 -107.116 1.00 26.28  ? 245 LEU A HB3  1 
ATOM   8700  H  HG   . LEU B  1 245 ? -28.520 -47.815 -105.517 1.00 28.89  ? 245 LEU A HG   1 
ATOM   8701  H  HD11 . LEU B  1 245 ? -28.849 -50.057 -106.017 1.00 22.79  ? 245 LEU A HD11 1 
ATOM   8702  H  HD12 . LEU B  1 245 ? -29.823 -49.147 -106.881 1.00 22.79  ? 245 LEU A HD12 1 
ATOM   8703  H  HD13 . LEU B  1 245 ? -28.518 -49.765 -107.543 1.00 22.79  ? 245 LEU A HD13 1 
ATOM   8704  H  HD21 . LEU B  1 245 ? -26.686 -49.237 -105.289 1.00 29.49  ? 245 LEU A HD21 1 
ATOM   8705  H  HD22 . LEU B  1 245 ? -26.232 -48.883 -106.770 1.00 29.49  ? 245 LEU A HD22 1 
ATOM   8706  H  HD23 . LEU B  1 245 ? -26.210 -47.763 -105.643 1.00 29.49  ? 245 LEU A HD23 1 
ATOM   8707  N  N    . THR B  1 246 ? -31.392 -46.535 -106.162 1.00 11.75  ? 246 THR A N    1 
ATOM   8708  C  CA   . THR B  1 246 ? -32.083 -46.248 -104.920 1.00 13.12  ? 246 THR A CA   1 
ATOM   8709  C  C    . THR B  1 246 ? -31.877 -47.432 -103.997 1.00 19.17  ? 246 THR A C    1 
ATOM   8710  O  O    . THR B  1 246 ? -32.368 -48.519 -104.288 1.00 17.14  ? 246 THR A O    1 
ATOM   8711  C  CB   . THR B  1 246 ? -33.571 -45.990 -105.152 1.00 20.52  ? 246 THR A CB   1 
ATOM   8712  O  OG1  . THR B  1 246 ? -33.718 -44.837 -105.990 1.00 28.14  ? 246 THR A OG1  1 
ATOM   8713  C  CG2  . THR B  1 246 ? -34.291 -45.746 -103.843 1.00 28.57  ? 246 THR A CG2  1 
ATOM   8714  H  H    . THR B  1 246 ? -31.825 -47.055 -106.693 1.00 14.10  ? 246 THR A H    1 
ATOM   8715  H  HA   . THR B  1 246 ? -31.694 -45.462 -104.506 1.00 15.75  ? 246 THR A HA   1 
ATOM   8716  H  HB   . THR B  1 246 ? -33.971 -46.759 -105.586 1.00 24.63  ? 246 THR A HB   1 
ATOM   8717  H  HG1  . THR B  1 246 ? -34.532 -44.683 -106.126 1.00 33.77  ? 246 THR A HG1  1 
ATOM   8718  H  HG21 . THR B  1 246 ? -35.233 -45.583 -104.008 1.00 34.28  ? 246 THR A HG21 1 
ATOM   8719  H  HG22 . THR B  1 246 ? -34.201 -46.520 -103.266 1.00 34.28  ? 246 THR A HG22 1 
ATOM   8720  H  HG23 . THR B  1 246 ? -33.912 -44.973 -103.395 1.00 34.28  ? 246 THR A HG23 1 
ATOM   8721  N  N    . CYS B  1 247 ? -31.147 -47.256 -102.894 1.00 15.54  ? 247 CYS A N    1 
ATOM   8722  C  CA   . CYS B  1 247 ? -30.962 -48.404 -101.993 1.00 15.28  ? 247 CYS A CA   1 
ATOM   8723  C  C    . CYS B  1 247 ? -31.194 -48.115 -100.528 1.00 16.73  ? 247 CYS A C    1 
ATOM   8724  O  O    . CYS B  1 247 ? -31.093 -46.981 -100.056 1.00 17.98  ? 247 CYS A O    1 
ATOM   8725  C  CB   . CYS B  1 247 ? -29.576 -48.990 -102.166 1.00 28.35  ? 247 CYS A CB   1 
ATOM   8726  S  SG   . CYS B  1 247 ? -28.293 -47.801 -102.183 1.00 39.93  ? 247 CYS A SG   1 
ATOM   8727  H  H    . CYS B  1 247 ? -30.765 -46.525 -102.651 1.00 18.65  ? 247 CYS A H    1 
ATOM   8728  H  HA   . CYS B  1 247 ? -31.596 -49.091 -102.250 1.00 18.34  ? 247 CYS A HA   1 
ATOM   8729  H  HB2  . CYS B  1 247 ? -29.403 -49.601 -101.433 1.00 34.02  ? 247 CYS A HB2  1 
ATOM   8730  H  HB3  . CYS B  1 247 ? -29.544 -49.471 -103.008 1.00 34.02  ? 247 CYS A HB3  1 
ATOM   8731  H  HG   . CYS B  1 247 ? -27.242 -48.362 -102.324 1.00 47.92  ? 247 CYS A HG   1 
ATOM   8732  N  N    . ARG B  1 248 ? -31.533 -49.190 -99.831  1.00 14.80  ? 248 ARG A N    1 
ATOM   8733  C  CA   . ARG B  1 248 ? -31.612 -49.214 -98.389  1.00 15.58  ? 248 ARG A CA   1 
ATOM   8734  C  C    . ARG B  1 248 ? -30.328 -49.808 -97.848  1.00 18.74  ? 248 ARG A C    1 
ATOM   8735  O  O    . ARG B  1 248 ? -29.920 -50.876 -98.289  1.00 17.86  ? 248 ARG A O    1 
ATOM   8736  C  CB   . ARG B  1 248 ? -32.757 -50.066 -97.897  1.00 24.15  ? 248 ARG A CB   1 
ATOM   8737  C  CG   . ARG B  1 248 ? -34.143 -49.645 -98.226  1.00 46.46  ? 248 ARG A CG   1 
ATOM   8738  C  CD   . ARG B  1 248 ? -35.034 -50.705 -97.605  1.00 57.49  ? 248 ARG A CD   1 
ATOM   8739  N  NE   . ARG B  1 248 ? -34.939 -50.700 -96.147  1.00 47.54  ? 248 ARG A NE   1 
ATOM   8740  C  CZ   . ARG B  1 248 ? -35.059 -51.780 -95.375  1.00 49.58  ? 248 ARG A CZ   1 
ATOM   8741  N  NH1  . ARG B  1 248 ? -35.286 -52.975 -95.904  1.00 39.02  ? 248 ARG A NH1  1 
ATOM   8742  N  NH2  . ARG B  1 248 ? -34.948 -51.664 -94.061  1.00 62.24  ? 248 ARG A NH2  1 
ATOM   8743  H  H    . ARG B  1 248 ? -31.728 -49.946 -100.192 1.00 17.76  ? 248 ARG A H    1 
ATOM   8744  H  HA   . ARG B  1 248 ? -31.715 -48.313 -98.045  1.00 18.69  ? 248 ARG A HA   1 
ATOM   8745  H  HB2  . ARG B  1 248 ? -32.640 -50.958 -98.261  1.00 28.98  ? 248 ARG A HB2  1 
ATOM   8746  H  HB3  . ARG B  1 248 ? -32.699 -50.110 -96.930  1.00 28.98  ? 248 ARG A HB3  1 
ATOM   8747  H  HG2  . ARG B  1 248 ? -34.340 -48.783 -97.827  1.00 55.75  ? 248 ARG A HG2  1 
ATOM   8748  H  HG3  . ARG B  1 248 ? -34.276 -49.633 -99.186  1.00 55.75  ? 248 ARG A HG3  1 
ATOM   8749  H  HD2  . ARG B  1 248 ? -35.956 -50.531 -97.850  1.00 68.99  ? 248 ARG A HD2  1 
ATOM   8750  H  HD3  . ARG B  1 248 ? -34.761 -51.579 -97.925  1.00 68.99  ? 248 ARG A HD3  1 
ATOM   8751  H  HE   . ARG B  1 248 ? -34.795 -49.947 -95.758  1.00 57.05  ? 248 ARG A HE   1 
ATOM   8752  H  HH11 . ARG B  1 248 ? -35.358 -53.062 -96.756  1.00 46.83  ? 248 ARG A HH11 1 
ATOM   8753  H  HH12 . ARG B  1 248 ? -35.362 -53.664 -95.393  1.00 46.83  ? 248 ARG A HH12 1 
ATOM   8754  H  HH21 . ARG B  1 248 ? -34.802 -50.893 -93.709  1.00 74.68  ? 248 ARG A HH21 1 
ATOM   8755  H  HH22 . ARG B  1 248 ? -35.027 -52.358 -93.560  1.00 74.68  ? 248 ARG A HH22 1 
ATOM   8756  N  N    . LEU B  1 249 ? -29.728 -49.134 -96.877  1.00 17.61  ? 249 LEU A N    1 
ATOM   8757  C  CA   . LEU B  1 249 ? -28.439 -49.530 -96.324  1.00 23.32  ? 249 LEU A CA   1 
ATOM   8758  C  C    . LEU B  1 249 ? -28.604 -50.110 -94.940  1.00 23.67  ? 249 LEU A C    1 
ATOM   8759  O  O    . LEU B  1 249 ? -29.494 -49.706 -94.193  1.00 18.33  ? 249 LEU A O    1 
ATOM   8760  C  CB   . LEU B  1 249 ? -27.487 -48.338 -96.270  1.00 18.17  ? 249 LEU A CB   1 
ATOM   8761  C  CG   . LEU B  1 249 ? -27.364 -47.576 -97.595  1.00 24.68  ? 249 LEU A CG   1 
ATOM   8762  C  CD1  . LEU B  1 249 ? -26.507 -46.342 -97.424  1.00 40.81  ? 249 LEU A CD1  1 
ATOM   8763  C  CD2  . LEU B  1 249 ? -26.788 -48.476 -98.651  1.00 19.10  ? 249 LEU A CD2  1 
ATOM   8764  H  H    . LEU B  1 249 ? -30.055 -48.426 -96.513  1.00 21.14  ? 249 LEU A H    1 
ATOM   8765  H  HA   . LEU B  1 249 ? -28.044 -50.209 -96.893  1.00 27.98  ? 249 LEU A HA   1 
ATOM   8766  H  HB2  . LEU B  1 249 ? -27.806 -47.714 -95.599  1.00 21.80  ? 249 LEU A HB2  1 
ATOM   8767  H  HB3  . LEU B  1 249 ? -26.603 -48.656 -96.029  1.00 21.80  ? 249 LEU A HB3  1 
ATOM   8768  H  HG   . LEU B  1 249 ? -28.246 -47.294 -97.885  1.00 29.62  ? 249 LEU A HG   1 
ATOM   8769  H  HD11 . LEU B  1 249 ? -26.445 -45.880 -98.275  1.00 48.97  ? 249 LEU A HD11 1 
ATOM   8770  H  HD12 . LEU B  1 249 ? -26.916 -45.763 -96.762  1.00 48.97  ? 249 LEU A HD12 1 
ATOM   8771  H  HD13 . LEU B  1 249 ? -25.623 -46.610 -97.128  1.00 48.97  ? 249 LEU A HD13 1 
ATOM   8772  H  HD21 . LEU B  1 249 ? -26.716 -47.981 -99.482  1.00 22.92  ? 249 LEU A HD21 1 
ATOM   8773  H  HD22 . LEU B  1 249 ? -25.910 -48.775 -98.366  1.00 22.92  ? 249 LEU A HD22 1 
ATOM   8774  H  HD23 . LEU B  1 249 ? -27.375 -49.239 -98.770  1.00 22.92  ? 249 LEU A HD23 1 
ATOM   8775  N  N    . GLU B  1 250 ? -27.732 -51.048 -94.596  1.00 17.51  ? 250 GLU A N    1 
ATOM   8776  C  CA   . GLU B  1 250 ? -27.801 -51.706 -93.298  1.00 18.72  ? 250 GLU A CA   1 
ATOM   8777  C  C    . GLU B  1 250 ? -27.236 -50.804 -92.205  1.00 20.58  ? 250 GLU A C    1 
ATOM   8778  O  O    . GLU B  1 250 ? -27.845 -50.626 -91.162  1.00 24.34  ? 250 GLU A O    1 
ATOM   8779  C  CB   . GLU B  1 250 ? -27.044 -53.027 -93.346  1.00 34.83  ? 250 GLU A CB   1 
ATOM   8780  C  CG   . GLU B  1 250 ? -27.313 -53.953 -92.182  1.00 52.44  ? 250 GLU A CG   1 
ATOM   8781  C  CD   . GLU B  1 250 ? -26.649 -55.300 -92.390  1.00 85.02  ? 250 GLU A CD   1 
ATOM   8782  O  OE1  . GLU B  1 250 ? -27.105 -56.059 -93.275  1.00 89.61  ? 250 GLU A OE1  1 
ATOM   8783  O  OE2  . GLU B  1 250 ? -25.658 -55.590 -91.687  1.00 98.37  ? 250 GLU A OE2  1 
ATOM   8784  H  H    . GLU B  1 250 ? -27.089 -51.323 -95.097  1.00 21.01  ? 250 GLU A H    1 
ATOM   8785  H  HA   . GLU B  1 250 ? -28.728 -51.895 -93.085  1.00 22.47  ? 250 GLU A HA   1 
ATOM   8786  H  HB2  . GLU B  1 250 ? -27.292 -53.496 -94.158  1.00 41.80  ? 250 GLU A HB2  1 
ATOM   8787  H  HB3  . GLU B  1 250 ? -26.093 -52.838 -93.357  1.00 41.80  ? 250 GLU A HB3  1 
ATOM   8788  H  HG2  . GLU B  1 250 ? -26.957 -53.560 -91.370  1.00 62.93  ? 250 GLU A HG2  1 
ATOM   8789  H  HG3  . GLU B  1 250 ? -28.269 -54.094 -92.098  1.00 62.93  ? 250 GLU A HG3  1 
ATOM   8790  N  N    . LYS B  1 251 ? -26.061 -50.245 -92.456  1.00 21.71  ? 251 LYS A N    1 
ATOM   8791  C  CA   . LYS B  1 251 ? -25.436 -49.344 -91.505  1.00 24.87  ? 251 LYS A CA   1 
ATOM   8792  C  C    . LYS B  1 251 ? -25.733 -47.902 -91.889  1.00 26.74  ? 251 LYS A C    1 
ATOM   8793  O  O    . LYS B  1 251 ? -25.921 -47.606 -93.064  1.00 23.11  ? 251 LYS A O    1 
ATOM   8794  C  CB   . LYS B  1 251 ? -23.928 -49.587 -91.463  1.00 26.14  ? 251 LYS A CB   1 
ATOM   8795  C  CG   . LYS B  1 251 ? -23.560 -50.995 -91.018  1.00 34.85  ? 251 LYS A CG   1 
ATOM   8796  C  CD   . LYS B  1 251 ? -22.114 -51.330 -91.324  1.00 55.13  ? 251 LYS A CD   1 
ATOM   8797  C  CE   . LYS B  1 251 ? -21.155 -50.570 -90.439  1.00 69.99  ? 251 LYS A CE   1 
ATOM   8798  N  NZ   . LYS B  1 251 ? -19.763 -51.087 -90.591  1.00 79.40  ? 251 LYS A NZ   1 
ATOM   8799  H  H    . LYS B  1 251 ? -25.603 -50.372 -93.173  1.00 26.05  ? 251 LYS A H    1 
ATOM   8800  H  HA   . LYS B  1 251 ? -25.797 -49.507 -90.620  1.00 29.85  ? 251 LYS A HA   1 
ATOM   8801  H  HB2  . LYS B  1 251 ? -23.562 -49.449 -92.351  1.00 31.36  ? 251 LYS A HB2  1 
ATOM   8802  H  HB3  . LYS B  1 251 ? -23.525 -48.962 -90.839  1.00 31.36  ? 251 LYS A HB3  1 
ATOM   8803  H  HG2  . LYS B  1 251 ? -23.692 -51.071 -90.060  1.00 41.82  ? 251 LYS A HG2  1 
ATOM   8804  H  HG3  . LYS B  1 251 ? -24.123 -51.633 -91.484  1.00 41.82  ? 251 LYS A HG3  1 
ATOM   8805  H  HD2  . LYS B  1 251 ? -21.970 -52.279 -91.181  1.00 66.15  ? 251 LYS A HD2  1 
ATOM   8806  H  HD3  . LYS B  1 251 ? -21.922 -51.099 -92.247  1.00 66.15  ? 251 LYS A HD3  1 
ATOM   8807  H  HE2  . LYS B  1 251 ? -21.162 -49.633 -90.688  1.00 83.99  ? 251 LYS A HE2  1 
ATOM   8808  H  HE3  . LYS B  1 251 ? -21.421 -50.675 -89.512  1.00 83.99  ? 251 LYS A HE3  1 
ATOM   8809  H  HZ1  . LYS B  1 251 ? -19.210 -50.630 -90.064  1.00 95.28  ? 251 LYS A HZ1  1 
ATOM   8810  H  HZ2  . LYS B  1 251 ? -19.732 -51.948 -90.366  1.00 95.28  ? 251 LYS A HZ2  1 
ATOM   8811  H  HZ3  . LYS B  1 251 ? -19.496 -50.999 -91.435  1.00 95.28  ? 251 LYS A HZ3  1 
ATOM   8812  N  N    . PRO B  1 252 ? -25.776 -46.997 -90.902  1.00 23.81  ? 252 PRO A N    1 
ATOM   8813  C  CA   . PRO B  1 252 ? -26.067 -45.595 -91.214  1.00 33.29  ? 252 PRO A CA   1 
ATOM   8814  C  C    . PRO B  1 252 ? -24.986 -44.986 -92.093  1.00 26.31  ? 252 PRO A C    1 
ATOM   8815  O  O    . PRO B  1 252 ? -23.808 -45.210 -91.838  1.00 23.69  ? 252 PRO A O    1 
ATOM   8816  C  CB   . PRO B  1 252 ? -26.090 -44.916 -89.837  1.00 41.13  ? 252 PRO A CB   1 
ATOM   8817  C  CG   . PRO B  1 252 ? -26.057 -46.024 -88.834  1.00 30.76  ? 252 PRO A CG   1 
ATOM   8818  C  CD   . PRO B  1 252 ? -25.417 -47.177 -89.485  1.00 21.79  ? 252 PRO A CD   1 
ATOM   8819  H  HA   . PRO B  1 252 ? -26.933 -45.506 -91.642  1.00 39.94  ? 252 PRO A HA   1 
ATOM   8820  H  HB2  . PRO B  1 252 ? -25.310 -44.347 -89.742  1.00 49.36  ? 252 PRO A HB2  1 
ATOM   8821  H  HB3  . PRO B  1 252 ? -26.904 -44.396 -89.745  1.00 49.36  ? 252 PRO A HB3  1 
ATOM   8822  H  HG2  . PRO B  1 252 ? -25.542 -45.743 -88.062  1.00 36.91  ? 252 PRO A HG2  1 
ATOM   8823  H  HG3  . PRO B  1 252 ? -26.964 -46.246 -88.572  1.00 36.91  ? 252 PRO A HG3  1 
ATOM   8824  H  HD2  . PRO B  1 252 ? -24.454 -47.140 -89.371  1.00 26.15  ? 252 PRO A HD2  1 
ATOM   8825  H  HD3  . PRO B  1 252 ? -25.786 -48.007 -89.145  1.00 26.15  ? 252 PRO A HD3  1 
ATOM   8826  N  N    . ALA B  1 253 ? -25.389 -44.228 -93.109  1.00 21.22  ? 253 ALA A N    1 
ATOM   8827  C  CA   . ALA B  1 253 ? -24.455 -43.626 -94.039  1.00 26.44  ? 253 ALA A CA   1 
ATOM   8828  C  C    . ALA B  1 253 ? -24.861 -42.193 -94.352  1.00 32.07  ? 253 ALA A C    1 
ATOM   8829  O  O    . ALA B  1 253 ? -25.736 -41.965 -95.182  1.00 36.57  ? 253 ALA A O    1 
ATOM   8830  C  CB   . ALA B  1 253 ? -24.386 -44.450 -95.325  1.00 30.53  ? 253 ALA A CB   1 
ATOM   8831  H  H    . ALA B  1 253 ? -26.212 -44.049 -93.279  1.00 25.46  ? 253 ALA A H    1 
ATOM   8832  H  HA   . ALA B  1 253 ? -23.571 -43.611 -93.639  1.00 31.73  ? 253 ALA A HA   1 
ATOM   8833  H  HB1  . ALA B  1 253 ? -23.757 -44.032 -95.934  1.00 36.63  ? 253 ALA A HB1  1 
ATOM   8834  H  HB2  . ALA B  1 253 ? -24.091 -45.349 -95.109  1.00 36.63  ? 253 ALA A HB2  1 
ATOM   8835  H  HB3  . ALA B  1 253 ? -25.268 -44.480 -95.728  1.00 36.63  ? 253 ALA A HB3  1 
ATOM   8836  N  N    . LYS B  1 254 ? -24.231 -41.243 -93.664  1.00 19.61  ? 254 LYS A N    1 
ATOM   8837  C  CA   . LYS B  1 254 ? -24.320 -39.835 -94.011  1.00 26.36  ? 254 LYS A CA   1 
ATOM   8838  C  C    . LYS B  1 254 ? -23.852 -39.675 -95.443  1.00 20.36  ? 254 LYS A C    1 
ATOM   8839  O  O    . LYS B  1 254 ? -22.929 -40.363 -95.886  1.00 17.44  ? 254 LYS A O    1 
ATOM   8840  C  CB   . LYS B  1 254 ? -23.452 -38.976 -93.088  1.00 32.76  ? 254 LYS A CB   1 
ATOM   8841  C  CG   . LYS B  1 254 ? -23.660 -39.182 -91.587  1.00 46.93  ? 254 LYS A CG   1 
ATOM   8842  C  CD   . LYS B  1 254 ? -24.938 -38.560 -91.099  1.00 53.35  ? 254 LYS A CD   1 
ATOM   8843  C  CE   . LYS B  1 254 ? -25.035 -38.600 -89.582  1.00 54.23  ? 254 LYS A CE   1 
ATOM   8844  N  NZ   . LYS B  1 254 ? -26.351 -38.075 -89.130  1.00 60.57  ? 254 LYS A NZ   1 
ATOM   8845  H  H    . LYS B  1 254 ? -23.736 -41.397 -92.977  1.00 23.54  ? 254 LYS A H    1 
ATOM   8846  H  HA   . LYS B  1 254 ? -25.240 -39.536 -93.946  1.00 31.63  ? 254 LYS A HA   1 
ATOM   8847  H  HB2  . LYS B  1 254 ? -22.520 -39.168 -93.279  1.00 39.31  ? 254 LYS A HB2  1 
ATOM   8848  H  HB3  . LYS B  1 254 ? -23.634 -38.043 -93.279  1.00 39.31  ? 254 LYS A HB3  1 
ATOM   8849  H  HG2  . LYS B  1 254 ? -23.696 -40.133 -91.399  1.00 56.32  ? 254 LYS A HG2  1 
ATOM   8850  H  HG3  . LYS B  1 254 ? -22.923 -38.774 -91.106  1.00 56.32  ? 254 LYS A HG3  1 
ATOM   8851  H  HD2  . LYS B  1 254 ? -24.971 -37.632 -91.381  1.00 64.02  ? 254 LYS A HD2  1 
ATOM   8852  H  HD3  . LYS B  1 254 ? -25.692 -39.049 -91.465  1.00 64.02  ? 254 LYS A HD3  1 
ATOM   8853  H  HE2  . LYS B  1 254 ? -24.948 -39.517 -89.276  1.00 65.08  ? 254 LYS A HE2  1 
ATOM   8854  H  HE3  . LYS B  1 254 ? -24.336 -38.047 -89.198  1.00 65.08  ? 254 LYS A HE3  1 
ATOM   8855  H  HZ1  . LYS B  1 254 ? -26.400 -38.102 -88.242  1.00 72.68  ? 254 LYS A HZ1  1 
ATOM   8856  H  HZ2  . LYS B  1 254 ? -26.451 -37.233 -89.400  1.00 72.68  ? 254 LYS A HZ2  1 
ATOM   8857  H  HZ3  . LYS B  1 254 ? -27.008 -38.569 -89.471  1.00 72.68  ? 254 LYS A HZ3  1 
ATOM   8858  N  N    . TYR B  1 255 ? -24.463 -38.765 -96.181  1.00 20.48  ? 255 TYR A N    1 
ATOM   8859  C  CA   . TYR B  1 255 ? -24.082 -38.610 -97.585  1.00 19.06  ? 255 TYR A CA   1 
ATOM   8860  C  C    . TYR B  1 255 ? -22.620 -38.203 -97.697  1.00 21.01  ? 255 TYR A C    1 
ATOM   8861  O  O    . TYR B  1 255 ? -21.937 -38.626 -98.622  1.00 18.94  ? 255 TYR A O    1 
ATOM   8862  C  CB   . TYR B  1 255 ? -24.972 -37.603 -98.281  1.00 22.18  ? 255 TYR A CB   1 
ATOM   8863  C  CG   . TYR B  1 255 ? -24.900 -37.673 -99.792  1.00 16.49  ? 255 TYR A CG   1 
ATOM   8864  C  CD1  . TYR B  1 255 ? -25.623 -38.634 -100.507 1.00 16.04  ? 255 TYR A CD1  1 
ATOM   8865  C  CD2  . TYR B  1 255 ? -24.125 -36.771 -100.506 1.00 20.54  ? 255 TYR A CD2  1 
ATOM   8866  C  CE1  . TYR B  1 255 ? -25.577 -38.681 -101.898 1.00 21.70  ? 255 TYR A CE1  1 
ATOM   8867  C  CE2  . TYR B  1 255 ? -24.067 -36.814 -101.897 1.00 23.62  ? 255 TYR A CE2  1 
ATOM   8868  C  CZ   . TYR B  1 255 ? -24.792 -37.770 -102.586 1.00 14.79  ? 255 TYR A CZ   1 
ATOM   8869  O  OH   . TYR B  1 255 ? -24.729 -37.800 -103.969 1.00 17.25  ? 255 TYR A OH   1 
ATOM   8870  H  H    . TYR B  1 255 ? -25.084 -38.236 -95.909  1.00 24.58  ? 255 TYR A H    1 
ATOM   8871  H  HA   . TYR B  1 255 ? -24.189 -39.463 -98.035  1.00 22.87  ? 255 TYR A HA   1 
ATOM   8872  H  HB2  . TYR B  1 255 ? -25.892 -37.764 -98.020  1.00 26.62  ? 255 TYR A HB2  1 
ATOM   8873  H  HB3  . TYR B  1 255 ? -24.705 -36.710 -98.012  1.00 26.62  ? 255 TYR A HB3  1 
ATOM   8874  H  HD1  . TYR B  1 255 ? -26.154 -39.242 -100.046 1.00 19.25  ? 255 TYR A HD1  1 
ATOM   8875  H  HD2  . TYR B  1 255 ? -23.640 -36.123 -100.049 1.00 24.65  ? 255 TYR A HD2  1 
ATOM   8876  H  HE1  . TYR B  1 255 ? -26.062 -39.326 -102.361 1.00 26.04  ? 255 TYR A HE1  1 
ATOM   8877  H  HE2  . TYR B  1 255 ? -23.543 -36.201 -102.361 1.00 28.35  ? 255 TYR A HE2  1 
ATOM   8878  H  HH   . TYR B  1 255 ? -24.218 -37.194 -104.247 1.00 20.70  ? 255 TYR A HH   1 
ATOM   8879  N  N    . ASP B  1 256 ? -22.115 -37.415 -96.747  1.00 22.33  ? 256 ASP A N    1 
ATOM   8880  C  CA   . ASP B  1 256 ? -20.699 -37.037 -96.802  1.00 26.82  ? 256 ASP A CA   1 
ATOM   8881  C  C    . ASP B  1 256 ? -19.783 -38.253 -96.601  1.00 26.46  ? 256 ASP A C    1 
ATOM   8882  O  O    . ASP B  1 256 ? -18.675 -38.303 -97.141  1.00 22.02  ? 256 ASP A O    1 
ATOM   8883  C  CB   . ASP B  1 256 ? -20.375 -35.953 -95.769  1.00 36.17  ? 256 ASP A CB   1 
ATOM   8884  C  CG   . ASP B  1 256 ? -20.906 -34.581 -96.176  1.00 55.37  ? 256 ASP A CG   1 
ATOM   8885  O  OD1  . ASP B  1 256 ? -20.857 -34.244 -97.378  1.00 52.34  ? 256 ASP A OD1  1 
ATOM   8886  O  OD2  . ASP B  1 256 ? -21.385 -33.840 -95.291  1.00 76.37  ? 256 ASP A OD2  1 
ATOM   8887  H  H    . ASP B  1 256 ? -22.554 -37.093 -96.081  1.00 26.80  ? 256 ASP A H    1 
ATOM   8888  H  HA   . ASP B  1 256 ? -20.510 -36.671 -97.680  1.00 32.18  ? 256 ASP A HA   1 
ATOM   8889  H  HB2  . ASP B  1 256 ? -20.780 -36.193 -94.921  1.00 43.41  ? 256 ASP A HB2  1 
ATOM   8890  H  HB3  . ASP B  1 256 ? -19.413 -35.886 -95.671  1.00 43.41  ? 256 ASP A HB3  1 
ATOM   8891  N  N    . ASP B  1 257 ? -20.240 -39.243 -95.844  1.00 20.47  ? 257 ASP A N    1 
ATOM   8892  C  CA   . ASP B  1 257 ? -19.460 -40.477 -95.687  1.00 19.70  ? 257 ASP A CA   1 
ATOM   8893  C  C    . ASP B  1 257 ? -19.508 -41.359 -96.940  1.00 14.92  ? 257 ASP A C    1 
ATOM   8894  O  O    . ASP B  1 257 ? -18.525 -41.999 -97.295  1.00 17.42  ? 257 ASP A O    1 
ATOM   8895  C  CB   . ASP B  1 257 ? -19.950 -41.255 -94.474  1.00 25.80  ? 257 ASP A CB   1 
ATOM   8896  C  CG   . ASP B  1 257 ? -19.647 -40.540 -93.166  1.00 33.54  ? 257 ASP A CG   1 
ATOM   8897  O  OD1  . ASP B  1 257 ? -18.564 -39.920 -93.051  1.00 42.67  ? 257 ASP A OD1  1 
ATOM   8898  O  OD2  . ASP B  1 257 ? -20.497 -40.606 -92.260  1.00 46.10  ? 257 ASP A OD2  1 
ATOM   8899  H  H    . ASP B  1 257 ? -20.985 -39.232 -95.416  1.00 24.57  ? 257 ASP A H    1 
ATOM   8900  H  HA   . ASP B  1 257 ? -18.532 -40.239 -95.530  1.00 23.63  ? 257 ASP A HA   1 
ATOM   8901  H  HB2  . ASP B  1 257 ? -20.911 -41.371 -94.538  1.00 30.95  ? 257 ASP A HB2  1 
ATOM   8902  H  HB3  . ASP B  1 257 ? -19.511 -42.120 -94.453  1.00 30.95  ? 257 ASP A HB3  1 
ATOM   8903  N  N    . ILE B  1 258 ? -20.642 -41.380 -97.623  1.00 14.80  ? 258 ILE A N    1 
ATOM   8904  C  CA   . ILE B  1 258 ? -20.727 -42.043 -98.924  1.00 14.46  ? 258 ILE A CA   1 
ATOM   8905  C  C    . ILE B  1 258 ? -19.759 -41.384 -99.914  1.00 15.09  ? 258 ILE A C    1 
ATOM   8906  O  O    . ILE B  1 258 ? -19.038 -42.057 -100.635 1.00 16.06  ? 258 ILE A O    1 
ATOM   8907  C  CB   . ILE B  1 258 ? -22.159 -41.996 -99.487  1.00 14.97  ? 258 ILE A CB   1 
ATOM   8908  C  CG1  . ILE B  1 258 ? -23.088 -42.878 -98.650  1.00 21.04  ? 258 ILE A CG1  1 
ATOM   8909  C  CG2  . ILE B  1 258 ? -22.197 -42.415 -100.968 1.00 16.84  ? 258 ILE A CG2  1 
ATOM   8910  C  CD1  . ILE B  1 258 ? -24.550 -42.666 -98.958  1.00 22.72  ? 258 ILE A CD1  1 
ATOM   8911  H  H    . ILE B  1 258 ? -21.378 -41.020 -97.360  1.00 17.76  ? 258 ILE A H    1 
ATOM   8912  H  HA   . ILE B  1 258 ? -20.471 -42.974 -98.824  1.00 17.35  ? 258 ILE A HA   1 
ATOM   8913  H  HB   . ILE B  1 258 ? -22.476 -41.081 -99.425  1.00 17.96  ? 258 ILE A HB   1 
ATOM   8914  H  HG12 . ILE B  1 258 ? -22.879 -43.809 -98.825  1.00 25.24  ? 258 ILE A HG12 1 
ATOM   8915  H  HG13 . ILE B  1 258 ? -22.949 -42.678 -97.711  1.00 25.24  ? 258 ILE A HG13 1 
ATOM   8916  H  HG21 . ILE B  1 258 ? -23.113 -42.372 -101.284 1.00 20.20  ? 258 ILE A HG21 1 
ATOM   8917  H  HG22 . ILE B  1 258 ? -21.640 -41.809 -101.481 1.00 20.20  ? 258 ILE A HG22 1 
ATOM   8918  H  HG23 . ILE B  1 258 ? -21.861 -43.321 -101.048 1.00 20.20  ? 258 ILE A HG23 1 
ATOM   8919  H  HD11 . ILE B  1 258 ? -25.079 -43.253 -98.396  1.00 27.27  ? 258 ILE A HD11 1 
ATOM   8920  H  HD12 . ILE B  1 258 ? -24.779 -41.740 -98.779  1.00 27.27  ? 258 ILE A HD12 1 
ATOM   8921  H  HD13 . ILE B  1 258 ? -24.709 -42.871 -99.893  1.00 27.27  ? 258 ILE A HD13 1 
ATOM   8922  N  N    . LYS B  1 259 ? -19.740 -40.062 -99.942  1.00 14.66  ? 259 LYS A N    1 
ATOM   8923  C  CA   . LYS B  1 259 ? -18.844 -39.355 -100.854 1.00 16.53  ? 259 LYS A CA   1 
ATOM   8924  C  C    . LYS B  1 259 ? -17.392 -39.737 -100.557 1.00 18.25  ? 259 LYS A C    1 
ATOM   8925  O  O    . LYS B  1 259 ? -16.623 -40.034 -101.457 1.00 14.60  ? 259 LYS A O    1 
ATOM   8926  C  CB   . LYS B  1 259 ? -19.052 -37.849 -100.740 1.00 13.09  ? 259 LYS A CB   1 
ATOM   8927  C  CG   . LYS B  1 259 ? -20.324 -37.344 -101.406 1.00 15.67  ? 259 LYS A CG   1 
ATOM   8928  C  CD   . LYS B  1 259 ? -20.705 -35.917 -100.957 1.00 23.35  ? 259 LYS A CD   1 
ATOM   8929  C  CE   . LYS B  1 259 ? -19.616 -34.891 -101.238 1.00 25.61  ? 259 LYS A CE   1 
ATOM   8930  N  NZ   . LYS B  1 259 ? -20.011 -33.530 -100.732 1.00 33.65  ? 259 LYS A NZ   1 
ATOM   8931  H  H    . LYS B  1 259 ? -20.229 -39.552 -99.451  1.00 17.59  ? 259 LYS A H    1 
ATOM   8932  H  HA   . LYS B  1 259 ? -19.045 -39.619 -101.765 1.00 19.84  ? 259 LYS A HA   1 
ATOM   8933  H  HB2  . LYS B  1 259 ? -19.095 -37.611 -99.800  1.00 15.71  ? 259 LYS A HB2  1 
ATOM   8934  H  HB3  . LYS B  1 259 ? -18.301 -37.399 -101.157 1.00 15.71  ? 259 LYS A HB3  1 
ATOM   8935  H  HG2  . LYS B  1 259 ? -20.194 -37.331 -102.367 1.00 18.80  ? 259 LYS A HG2  1 
ATOM   8936  H  HG3  . LYS B  1 259 ? -21.057 -37.936 -101.177 1.00 18.80  ? 259 LYS A HG3  1 
ATOM   8937  H  HD2  . LYS B  1 259 ? -21.505 -35.641 -101.431 1.00 28.02  ? 259 LYS A HD2  1 
ATOM   8938  H  HD3  . LYS B  1 259 ? -20.872 -35.922 -100.001 1.00 28.02  ? 259 LYS A HD3  1 
ATOM   8939  H  HE2  . LYS B  1 259 ? -18.799 -35.158 -100.788 1.00 30.73  ? 259 LYS A HE2  1 
ATOM   8940  H  HE3  . LYS B  1 259 ? -19.469 -34.831 -102.195 1.00 30.73  ? 259 LYS A HE3  1 
ATOM   8941  H  HZ1  . LYS B  1 259 ? -19.365 -32.942 -100.904 1.00 40.37  ? 259 LYS A HZ1  1 
ATOM   8942  H  HZ2  . LYS B  1 259 ? -20.759 -33.262 -101.133 1.00 40.37  ? 259 LYS A HZ2  1 
ATOM   8943  H  HZ3  . LYS B  1 259 ? -20.149 -33.560 -99.853  1.00 40.37  ? 259 LYS A HZ3  1 
ATOM   8944  N  N    . LYS B  1 260 ? -17.050 -39.754 -99.277  1.00 16.92  ? 260 LYS A N    1 
ATOM   8945  C  CA   . LYS B  1 260 ? -15.716 -40.065 -98.830  1.00 14.39  ? 260 LYS A CA   1 
ATOM   8946  C  C    . LYS B  1 260 ? -15.223 -41.430 -99.298  1.00 20.30  ? 260 LYS A C    1 
ATOM   8947  O  O    . LYS B  1 260 ? -14.114 -41.531 -99.817  1.00 18.33  ? 260 LYS A O    1 
ATOM   8948  C  CB   . LYS B  1 260 ? -15.663 -39.979 -97.292  1.00 20.50  ? 260 LYS A CB   1 
ATOM   8949  C  CG   . LYS B  1 260 ? -14.328 -40.384 -96.685  1.00 37.61  ? 260 LYS A CG   1 
ATOM   8950  C  CD   . LYS B  1 260 ? -14.328 -40.273 -95.158  1.00 49.16  ? 260 LYS A CD   1 
ATOM   8951  C  CE   . LYS B  1 260 ? -13.000 -40.761 -94.584  1.00 68.82  ? 260 LYS A CE   1 
ATOM   8952  N  NZ   . LYS B  1 260 ? -12.892 -40.570 -93.112  1.00 78.17  ? 260 LYS A NZ   1 
ATOM   8953  H  H    . LYS B  1 260 ? -17.595 -39.582 -98.634  1.00 20.30  ? 260 LYS A H    1 
ATOM   8954  H  HA   . LYS B  1 260 ? -15.108 -39.397 -99.183  1.00 17.27  ? 260 LYS A HA   1 
ATOM   8955  H  HB2  . LYS B  1 260 ? -15.842 -39.064 -97.026  1.00 24.60  ? 260 LYS A HB2  1 
ATOM   8956  H  HB3  . LYS B  1 260 ? -16.343 -40.565 -96.925  1.00 24.60  ? 260 LYS A HB3  1 
ATOM   8957  H  HG2  . LYS B  1 260 ? -14.139 -41.306 -96.921  1.00 45.13  ? 260 LYS A HG2  1 
ATOM   8958  H  HG3  . LYS B  1 260 ? -13.633 -39.803 -97.030  1.00 45.13  ? 260 LYS A HG3  1 
ATOM   8959  H  HD2  . LYS B  1 260 ? -14.451 -39.346 -94.901  1.00 59.00  ? 260 LYS A HD2  1 
ATOM   8960  H  HD3  . LYS B  1 260 ? -15.040 -40.822 -94.794  1.00 59.00  ? 260 LYS A HD3  1 
ATOM   8961  H  HE2  . LYS B  1 260 ? -12.906 -41.708 -94.770  1.00 82.58  ? 260 LYS A HE2  1 
ATOM   8962  H  HE3  . LYS B  1 260 ? -12.277 -40.269 -95.003  1.00 82.58  ? 260 LYS A HE3  1 
ATOM   8963  H  HZ1  . LYS B  1 260 ? -12.104 -40.868 -92.824  1.00 93.80  ? 260 LYS A HZ1  1 
ATOM   8964  H  HZ2  . LYS B  1 260 ? -12.965 -39.706 -92.911  1.00 93.80  ? 260 LYS A HZ2  1 
ATOM   8965  H  HZ3  . LYS B  1 260 ? -13.539 -41.019 -92.698  1.00 93.80  ? 260 LYS A HZ3  1 
ATOM   8966  N  N    . VAL B  1 261 ? -16.024 -42.478 -99.122  1.00 14.53  ? 261 VAL A N    1 
ATOM   8967  C  CA   . VAL B  1 261 ? -15.547 -43.815 -99.467  1.00 19.89  ? 261 VAL A CA   1 
ATOM   8968  C  C    . VAL B  1 261 ? -15.567 -44.034 -100.978 1.00 20.33  ? 261 VAL A C    1 
ATOM   8969  O  O    . VAL B  1 261 ? -14.748 -44.789 -101.499 1.00 15.33  ? 261 VAL A O    1 
ATOM   8970  C  CB   . VAL B  1 261 ? -16.363 -44.928 -98.758  1.00 17.30  ? 261 VAL A CB   1 
ATOM   8971  C  CG1  . VAL B  1 261 ? -16.306 -44.742 -97.247  1.00 26.31  ? 261 VAL A CG1  1 
ATOM   8972  C  CG2  . VAL B  1 261 ? -17.794 -44.967 -99.244  1.00 20.38  ? 261 VAL A CG2  1 
ATOM   8973  H  H    . VAL B  1 261 ? -16.826 -42.446 -98.814  1.00 17.43  ? 261 VAL A H    1 
ATOM   8974  H  HA   . VAL B  1 261 ? -14.626 -43.897 -99.173  1.00 23.87  ? 261 VAL A HA   1 
ATOM   8975  H  HB   . VAL B  1 261 ? -15.959 -45.786 -98.964  1.00 20.76  ? 261 VAL A HB   1 
ATOM   8976  H  HG11 . VAL B  1 261 ? -16.821 -45.447 -96.823  1.00 31.57  ? 261 VAL A HG11 1 
ATOM   8977  H  HG12 . VAL B  1 261 ? -15.381 -44.788 -96.958  1.00 31.57  ? 261 VAL A HG12 1 
ATOM   8978  H  HG13 . VAL B  1 261 ? -16.681 -43.876 -97.021  1.00 31.57  ? 261 VAL A HG13 1 
ATOM   8979  H  HG21 . VAL B  1 261 ? -18.266 -45.674 -98.778  1.00 24.46  ? 261 VAL A HG21 1 
ATOM   8980  H  HG22 . VAL B  1 261 ? -18.213 -44.112 -99.061  1.00 24.46  ? 261 VAL A HG22 1 
ATOM   8981  H  HG23 . VAL B  1 261 ? -17.798 -45.140 -100.199 1.00 24.46  ? 261 VAL A HG23 1 
ATOM   8982  N  N    . VAL B  1 262 ? -16.471 -43.373 -101.698 1.00 14.05  ? 262 VAL A N    1 
ATOM   8983  C  CA   . VAL B  1 262 ? -16.466 -43.492 -103.159 1.00 11.87  ? 262 VAL A CA   1 
ATOM   8984  C  C    . VAL B  1 262 ? -15.237 -42.772 -103.738 1.00 15.92  ? 262 VAL A C    1 
ATOM   8985  O  O    . VAL B  1 262 ? -14.560 -43.301 -104.625 1.00 12.91  ? 262 VAL A O    1 
ATOM   8986  C  CB   . VAL B  1 262 ? -17.748 -42.943 -103.803 1.00 12.14  ? 262 VAL A CB   1 
ATOM   8987  C  CG1  . VAL B  1 262 ? -17.619 -42.932 -105.327 1.00 11.16  ? 262 VAL A CG1  1 
ATOM   8988  C  CG2  . VAL B  1 262 ? -18.957 -43.796 -103.393 1.00 18.81  ? 262 VAL A CG2  1 
ATOM   8989  H  H    . VAL B  1 262 ? -17.083 -42.861 -101.378 1.00 16.85  ? 262 VAL A H    1 
ATOM   8990  H  HA   . VAL B  1 262 ? -16.396 -44.430 -103.394 1.00 14.24  ? 262 VAL A HA   1 
ATOM   8991  H  HB   . VAL B  1 262 ? -17.898 -42.033 -103.501 1.00 14.57  ? 262 VAL A HB   1 
ATOM   8992  H  HG11 . VAL B  1 262 ? -18.439 -42.582 -105.710 1.00 13.40  ? 262 VAL A HG11 1 
ATOM   8993  H  HG12 . VAL B  1 262 ? -16.870 -42.368 -105.576 1.00 13.40  ? 262 VAL A HG12 1 
ATOM   8994  H  HG13 . VAL B  1 262 ? -17.469 -43.839 -105.637 1.00 13.40  ? 262 VAL A HG13 1 
ATOM   8995  H  HG21 . VAL B  1 262 ? -19.755 -43.434 -103.809 1.00 22.58  ? 262 VAL A HG21 1 
ATOM   8996  H  HG22 . VAL B  1 262 ? -18.814 -44.709 -103.689 1.00 22.58  ? 262 VAL A HG22 1 
ATOM   8997  H  HG23 . VAL B  1 262 ? -19.047 -43.772 -102.427 1.00 22.58  ? 262 VAL A HG23 1 
ATOM   8998  N  N    . LYS B  1 263 ? -14.929 -41.589 -103.224 1.00 13.36  ? 263 LYS A N    1 
ATOM   8999  C  CA   . LYS B  1 263 ? -13.757 -40.871 -103.686 1.00 12.50  ? 263 LYS A CA   1 
ATOM   9000  C  C    . LYS B  1 263 ? -12.499 -41.671 -103.372 1.00 19.00  ? 263 LYS A C    1 
ATOM   9001  O  O    . LYS B  1 263 ? -11.594 -41.781 -104.202 1.00 13.72  ? 263 LYS A O    1 
ATOM   9002  C  CB   . LYS B  1 263 ? -13.686 -39.487 -103.044 1.00 14.12  ? 263 LYS A CB   1 
ATOM   9003  C  CG   . LYS B  1 263 ? -12.476 -38.669 -103.472 1.00 22.63  ? 263 LYS A CG   1 
ATOM   9004  C  CD   . LYS B  1 263 ? -12.532 -37.281 -102.872 1.00 27.41  ? 263 LYS A CD   1 
ATOM   9005  C  CE   . LYS B  1 263 ? -11.335 -36.440 -103.282 1.00 39.93  ? 263 LYS A CE   1 
ATOM   9006  N  NZ   . LYS B  1 263 ? -11.461 -35.041 -102.781 1.00 41.20  ? 263 LYS A NZ   1 
ATOM   9007  H  H    . LYS B  1 263 ? -15.379 -41.185 -102.613 1.00 16.03  ? 263 LYS A H    1 
ATOM   9008  H  HA   . LYS B  1 263 ? -13.811 -40.756 -104.648 1.00 14.99  ? 263 LYS A HA   1 
ATOM   9009  H  HB2  . LYS B  1 263 ? -14.482 -38.989 -103.288 1.00 16.95  ? 263 LYS A HB2  1 
ATOM   9010  H  HB3  . LYS B  1 263 ? -13.647 -39.592 -102.081 1.00 16.95  ? 263 LYS A HB3  1 
ATOM   9011  H  HG2  . LYS B  1 263 ? -11.666 -39.104 -103.164 1.00 27.15  ? 263 LYS A HG2  1 
ATOM   9012  H  HG3  . LYS B  1 263 ? -12.469 -38.585 -104.439 1.00 27.15  ? 263 LYS A HG3  1 
ATOM   9013  H  HD2  . LYS B  1 263 ? -13.336 -36.833 -103.178 1.00 32.89  ? 263 LYS A HD2  1 
ATOM   9014  H  HD3  . LYS B  1 263 ? -12.536 -37.352 -101.905 1.00 32.89  ? 263 LYS A HD3  1 
ATOM   9015  H  HE2  . LYS B  1 263 ? -10.528 -36.826 -102.907 1.00 47.92  ? 263 LYS A HE2  1 
ATOM   9016  H  HE3  . LYS B  1 263 ? -11.278 -36.413 -104.250 1.00 47.92  ? 263 LYS A HE3  1 
ATOM   9017  H  HZ1  . LYS B  1 263 ? -11.513 -35.041 -101.892 1.00 49.44  ? 263 LYS A HZ1  1 
ATOM   9018  H  HZ2  . LYS B  1 263 ? -10.752 -34.564 -103.030 1.00 49.44  ? 263 LYS A HZ2  1 
ATOM   9019  H  HZ3  . LYS B  1 263 ? -12.195 -34.664 -103.114 1.00 49.44  ? 263 LYS A HZ3  1 
ATOM   9020  N  N    . GLN B  1 264 ? -12.438 -42.241 -102.175 1.00 15.52  ? 264 GLN A N    1 
ATOM   9021  C  CA   . GLN B  1 264 ? -11.284 -43.052 -101.799 1.00 16.78  ? 264 GLN A CA   1 
ATOM   9022  C  C    . GLN B  1 264 ? -11.087 -44.228 -102.757 1.00 15.94  ? 264 GLN A C    1 
ATOM   9023  O  O    . GLN B  1 264 ? -9.968  -44.506 -103.200 1.00 17.17  ? 264 GLN A O    1 
ATOM   9024  C  CB   . GLN B  1 264 ? -11.443 -43.561 -100.365 1.00 19.03  ? 264 GLN A CB   1 
ATOM   9025  C  CG   . GLN B  1 264 ? -10.313 -44.457 -99.887  1.00 35.53  ? 264 GLN A CG   1 
ATOM   9026  C  CD   . GLN B  1 264 ? -10.529 -44.949 -98.459  1.00 57.67  ? 264 GLN A CD   1 
ATOM   9027  O  OE1  . GLN B  1 264 ? -11.572 -44.695 -97.850  1.00 62.82  ? 264 GLN A OE1  1 
ATOM   9028  N  NE2  . GLN B  1 264 ? -9.541  -45.652 -97.921  1.00 62.79  ? 264 GLN A NE2  1 
ATOM   9029  H  H    . GLN B  1 264 ? -13.044 -42.176 -101.568 1.00 18.63  ? 264 GLN A H    1 
ATOM   9030  H  HA   . GLN B  1 264 ? -10.487 -42.501 -101.834 1.00 20.14  ? 264 GLN A HA   1 
ATOM   9031  H  HB2  . GLN B  1 264 ? -11.486 -42.797 -99.768  1.00 22.83  ? 264 GLN A HB2  1 
ATOM   9032  H  HB3  . GLN B  1 264 ? -12.267 -44.069 -100.305 1.00 22.83  ? 264 GLN A HB3  1 
ATOM   9033  H  HG2  . GLN B  1 264 ? -10.255 -45.232 -100.467 1.00 42.64  ? 264 GLN A HG2  1 
ATOM   9034  H  HG3  . GLN B  1 264 ? -9.480  -43.960 -99.911  1.00 42.64  ? 264 GLN A HG3  1 
ATOM   9035  H  HE21 . GLN B  1 264 ? -8.827  -45.807 -98.374  1.00 75.35  ? 264 GLN A HE21 1 
ATOM   9036  H  HE22 . GLN B  1 264 ? -9.614  -45.952 -97.118  1.00 75.35  ? 264 GLN A HE22 1 
ATOM   9037  N  N    . ALA B  1 265 ? -12.171 -44.915 -103.095 1.00 13.12  ? 265 ALA A N    1 
ATOM   9038  C  CA   . ALA B  1 265 ? -12.090 -46.025 -104.031 1.00 16.97  ? 265 ALA A CA   1 
ATOM   9039  C  C    . ALA B  1 265 ? -11.639 -45.579 -105.415 1.00 17.13  ? 265 ALA A C    1 
ATOM   9040  O  O    . ALA B  1 265 ? -10.886 -46.300 -106.071 1.00 16.42  ? 265 ALA A O    1 
ATOM   9041  C  CB   . ALA B  1 265 ? -13.431 -46.740 -104.131 1.00 15.75  ? 265 ALA A CB   1 
ATOM   9042  H  H    . ALA B  1 265 ? -12.962 -44.759 -102.796 1.00 15.75  ? 265 ALA A H    1 
ATOM   9043  H  HA   . ALA B  1 265 ? -11.439 -46.663 -103.700 1.00 20.36  ? 265 ALA A HA   1 
ATOM   9044  H  HB1  . ALA B  1 265 ? -13.351 -47.474 -104.760 1.00 18.90  ? 265 ALA A HB1  1 
ATOM   9045  H  HB2  . ALA B  1 265 ? -13.673 -47.079 -103.255 1.00 18.90  ? 265 ALA A HB2  1 
ATOM   9046  H  HB3  . ALA B  1 265 ? -14.102 -46.111 -104.440 1.00 18.90  ? 265 ALA A HB3  1 
ATOM   9047  N  N    . SER B  1 266 ? -12.116 -44.418 -105.873 1.00 15.70  ? 266 SER A N    1 
ATOM   9048  C  CA   . SER B  1 266 ? -11.757 -43.911 -107.204 1.00 13.43  ? 266 SER A CA   1 
ATOM   9049  C  C    . SER B  1 266 ? -10.272 -43.557 -107.321 1.00 18.44  ? 266 SER A C    1 
ATOM   9050  O  O    . SER B  1 266 ? -9.728  -43.510 -108.425 1.00 19.14  ? 266 SER A O    1 
ATOM   9051  C  CB   . SER B  1 266 ? -12.584 -42.667 -107.568 1.00 12.61  ? 266 SER A CB   1 
ATOM   9052  O  OG   . SER B  1 266 ? -12.076 -41.514 -106.926 1.00 20.74  ? 266 SER A OG   1 
ATOM   9053  H  H    . SER B  1 266 ? -12.649 -43.905 -105.434 1.00 18.84  ? 266 SER A H    1 
ATOM   9054  H  HA   . SER B  1 266 ? -11.950 -44.598 -107.861 1.00 16.11  ? 266 SER A HA   1 
ATOM   9055  H  HB2  . SER B  1 266 ? -12.548 -42.535 -108.528 1.00 15.13  ? 266 SER A HB2  1 
ATOM   9056  H  HB3  . SER B  1 266 ? -13.502 -42.806 -107.287 1.00 15.13  ? 266 SER A HB3  1 
ATOM   9057  H  HG   . SER B  1 266 ? -12.101 -41.614 -106.092 1.00 24.89  ? 266 SER A HG   1 
ATOM   9058  N  N    . GLU B  1 267 ? -9.639  -43.271 -106.187 1.00 18.17  ? 267 GLU A N    1 
ATOM   9059  C  CA   . GLU B  1 267 ? -8.243  -42.860 -106.163 1.00 18.23  ? 267 GLU A CA   1 
ATOM   9060  C  C    . GLU B  1 267 ? -7.328  -44.045 -105.916 1.00 22.83  ? 267 GLU A C    1 
ATOM   9061  O  O    . GLU B  1 267 ? -6.135  -43.953 -106.133 1.00 25.98  ? 267 GLU A O    1 
ATOM   9062  C  CB   . GLU B  1 267 ? -8.009  -41.793 -105.092 1.00 21.65  ? 267 GLU A CB   1 
ATOM   9063  C  CG   . GLU B  1 267 ? -8.612  -40.428 -105.439 1.00 35.01  ? 267 GLU A CG   1 
ATOM   9064  C  CD   . GLU B  1 267 ? -8.516  -39.418 -104.301 1.00 52.27  ? 267 GLU A CD   1 
ATOM   9065  O  OE1  . GLU B  1 267 ? -7.971  -39.766 -103.230 1.00 57.90  ? 267 GLU A OE1  1 
ATOM   9066  O  OE2  . GLU B  1 267 ? -8.992  -38.276 -104.483 1.00 57.02  ? 267 GLU A OE2  1 
ATOM   9067  H  H    . GLU B  1 267 ? -10.003 -43.308 -105.409 1.00 21.80  ? 267 GLU A H    1 
ATOM   9068  H  HA   . GLU B  1 267 ? -8.012  -42.477 -107.023 1.00 21.87  ? 267 GLU A HA   1 
ATOM   9069  H  HB2  . GLU B  1 267 ? -8.410  -42.091 -104.260 1.00 25.98  ? 267 GLU A HB2  1 
ATOM   9070  H  HB3  . GLU B  1 267 ? -7.054  -41.673 -104.972 1.00 25.98  ? 267 GLU A HB3  1 
ATOM   9071  H  HG2  . GLU B  1 267 ? -8.140  -40.061 -106.203 1.00 42.01  ? 267 GLU A HG2  1 
ATOM   9072  H  HG3  . GLU B  1 267 ? -9.550  -40.545 -105.656 1.00 42.01  ? 267 GLU A HG3  1 
ATOM   9073  N  N    . GLY B  1 268 ? -7.898  -45.160 -105.482 1.00 22.61  ? 268 GLY A N    1 
ATOM   9074  C  CA   . GLY B  1 268 ? -7.120  -46.320 -105.110 1.00 23.43  ? 268 GLY A CA   1 
ATOM   9075  C  C    . GLY B  1 268 ? -7.503  -47.561 -105.889 1.00 15.86  ? 268 GLY A C    1 
ATOM   9076  O  O    . GLY B  1 268 ? -7.204  -47.659 -107.074 1.00 19.01  ? 268 GLY A O    1 
ATOM   9077  H  H    . GLY B  1 268 ? -8.747  -45.267 -105.395 1.00 27.13  ? 268 GLY A H    1 
ATOM   9078  H  HA2  . GLY B  1 268 ? -6.179  -46.140 -105.266 1.00 28.12  ? 268 GLY A HA2  1 
ATOM   9079  H  HA3  . GLY B  1 268 ? -7.244  -46.502 -104.166 1.00 28.12  ? 268 GLY A HA3  1 
ATOM   9080  N  N    . PRO B  1 269 ? -8.150  -48.529 -105.225 1.00 19.03  ? 269 PRO A N    1 
ATOM   9081  C  CA   . PRO B  1 269 ? -8.336  -49.830 -105.869 1.00 18.94  ? 269 PRO A CA   1 
ATOM   9082  C  C    . PRO B  1 269 ? -9.179  -49.801 -107.135 1.00 21.22  ? 269 PRO A C    1 
ATOM   9083  O  O    . PRO B  1 269 ? -9.021  -50.689 -107.960 1.00 23.06  ? 269 PRO A O    1 
ATOM   9084  C  CB   . PRO B  1 269 ? -9.034  -50.661 -104.787 1.00 25.69  ? 269 PRO A CB   1 
ATOM   9085  C  CG   . PRO B  1 269 ? -9.577  -49.671 -103.817 1.00 27.50  ? 269 PRO A CG   1 
ATOM   9086  C  CD   . PRO B  1 269 ? -8.615  -48.540 -103.829 1.00 25.81  ? 269 PRO A CD   1 
ATOM   9087  H  HA   . PRO B  1 269 ? -7.475  -50.229 -106.069 1.00 22.73  ? 269 PRO A HA   1 
ATOM   9088  H  HB2  . PRO B  1 269 ? -9.751  -51.179 -105.186 1.00 30.83  ? 269 PRO A HB2  1 
ATOM   9089  H  HB3  . PRO B  1 269 ? -8.389  -51.244 -104.357 1.00 30.83  ? 269 PRO A HB3  1 
ATOM   9090  H  HG2  . PRO B  1 269 ? -10.455 -49.378 -104.107 1.00 33.00  ? 269 PRO A HG2  1 
ATOM   9091  H  HG3  . PRO B  1 269 ? -9.623  -50.072 -102.934 1.00 33.00  ? 269 PRO A HG3  1 
ATOM   9092  H  HD2  . PRO B  1 269 ? -9.065  -47.708 -103.614 1.00 30.97  ? 269 PRO A HD2  1 
ATOM   9093  H  HD3  . PRO B  1 269 ? -7.876  -48.714 -103.225 1.00 30.97  ? 269 PRO A HD3  1 
ATOM   9094  N  N    . LEU B  1 270 ? -10.063 -48.819 -107.291 1.00 17.51  ? 270 LEU A N    1 
ATOM   9095  C  CA   . LEU B  1 270 ? -10.925 -48.785 -108.472 1.00 14.44  ? 270 LEU A CA   1 
ATOM   9096  C  C    . LEU B  1 270 ? -10.556 -47.654 -109.442 1.00 17.89  ? 270 LEU A C    1 
ATOM   9097  O  O    . LEU B  1 270 ? -11.352 -47.253 -110.306 1.00 12.97  ? 270 LEU A O    1 
ATOM   9098  C  CB   . LEU B  1 270 ? -12.384 -48.680 -108.036 1.00 17.20  ? 270 LEU A CB   1 
ATOM   9099  C  CG   . LEU B  1 270 ? -12.931 -49.977 -107.446 1.00 16.75  ? 270 LEU A CG   1 
ATOM   9100  C  CD1  . LEU B  1 270 ? -14.323 -49.767 -106.888 1.00 17.59  ? 270 LEU A CD1  1 
ATOM   9101  C  CD2  . LEU B  1 270 ? -12.966 -51.063 -108.501 1.00 20.05  ? 270 LEU A CD2  1 
ATOM   9102  H  H    . LEU B  1 270 ? -10.183 -48.170 -106.739 1.00 21.01  ? 270 LEU A H    1 
ATOM   9103  H  HA   . LEU B  1 270 ? -10.823 -49.623 -108.950 1.00 17.32  ? 270 LEU A HA   1 
ATOM   9104  H  HB2  . LEU B  1 270 ? -12.461 -47.989 -107.359 1.00 20.64  ? 270 LEU A HB2  1 
ATOM   9105  H  HB3  . LEU B  1 270 ? -12.926 -48.451 -108.806 1.00 20.64  ? 270 LEU A HB3  1 
ATOM   9106  H  HG   . LEU B  1 270 ? -12.353 -50.271 -106.724 1.00 20.10  ? 270 LEU A HG   1 
ATOM   9107  H  HD11 . LEU B  1 270 ? -14.645 -50.604 -106.521 1.00 21.11  ? 270 LEU A HD11 1 
ATOM   9108  H  HD12 . LEU B  1 270 ? -14.285 -49.092 -106.192 1.00 21.11  ? 270 LEU A HD12 1 
ATOM   9109  H  HD13 . LEU B  1 270 ? -14.908 -49.471 -107.603 1.00 21.11  ? 270 LEU A HD13 1 
ATOM   9110  H  HD21 . LEU B  1 270 ? -13.316 -51.877 -108.106 1.00 24.06  ? 270 LEU A HD21 1 
ATOM   9111  H  HD22 . LEU B  1 270 ? -13.538 -50.776 -109.230 1.00 24.06  ? 270 LEU A HD22 1 
ATOM   9112  H  HD23 . LEU B  1 270 ? -12.065 -51.215 -108.828 1.00 24.06  ? 270 LEU A HD23 1 
ATOM   9113  N  N    . LYS B  1 271 ? -9.334  -47.156 -109.308 1.00 13.84  ? 271 LYS A N    1 
ATOM   9114  C  CA   . LYS B  1 271 ? -8.844  -46.111 -110.187 1.00 20.84  ? 271 LYS A CA   1 
ATOM   9115  C  C    . LYS B  1 271 ? -8.933  -46.509 -111.660 1.00 17.20  ? 271 LYS A C    1 
ATOM   9116  O  O    . LYS B  1 271 ? -8.532  -47.600 -112.051 1.00 13.28  ? 271 LYS A O    1 
ATOM   9117  C  CB   . LYS B  1 271 ? -7.395  -45.756 -109.835 1.00 20.79  ? 271 LYS A CB   1 
ATOM   9118  C  CG   . LYS B  1 271 ? -6.899  -44.508 -110.532 1.00 29.56  ? 271 LYS A CG   1 
ATOM   9119  C  CD   . LYS B  1 271 ? -5.492  -44.131 -110.072 1.00 35.80  ? 271 LYS A CD   1 
ATOM   9120  C  CE   . LYS B  1 271 ? -5.030  -42.816 -110.674 1.00 56.79  ? 271 LYS A CE   1 
ATOM   9121  N  NZ   . LYS B  1 271 ? -5.843  -41.667 -110.192 1.00 73.86  ? 271 LYS A NZ   1 
ATOM   9122  H  H    . LYS B  1 271 ? -8.768  -47.410 -108.712 1.00 16.61  ? 271 LYS A H    1 
ATOM   9123  H  HA   . LYS B  1 271 ? -9.384  -45.316 -110.061 1.00 25.01  ? 271 LYS A HA   1 
ATOM   9124  H  HB2  . LYS B  1 271 ? -7.331  -45.609 -108.879 1.00 24.95  ? 271 LYS A HB2  1 
ATOM   9125  H  HB3  . LYS B  1 271 ? -6.818  -46.492 -110.095 1.00 24.95  ? 271 LYS A HB3  1 
ATOM   9126  H  HG2  . LYS B  1 271 ? -6.874  -44.665 -111.489 1.00 35.47  ? 271 LYS A HG2  1 
ATOM   9127  H  HG3  . LYS B  1 271 ? -7.494  -43.770 -110.328 1.00 35.47  ? 271 LYS A HG3  1 
ATOM   9128  H  HD2  . LYS B  1 271 ? -5.487  -44.039 -109.106 1.00 42.97  ? 271 LYS A HD2  1 
ATOM   9129  H  HD3  . LYS B  1 271 ? -4.871  -44.824 -110.345 1.00 42.97  ? 271 LYS A HD3  1 
ATOM   9130  H  HE2  . LYS B  1 271 ? -4.106  -42.659 -110.424 1.00 68.14  ? 271 LYS A HE2  1 
ATOM   9131  H  HE3  . LYS B  1 271 ? -5.113  -42.862 -111.639 1.00 68.14  ? 271 LYS A HE3  1 
ATOM   9132  H  HZ1  . LYS B  1 271 ? -5.780  -41.600 -109.306 1.00 88.64  ? 271 LYS A HZ1  1 
ATOM   9133  H  HZ2  . LYS B  1 271 ? -5.551  -40.911 -110.560 1.00 88.64  ? 271 LYS A HZ2  1 
ATOM   9134  H  HZ3  . LYS B  1 271 ? -6.697  -41.785 -110.413 1.00 88.64  ? 271 LYS A HZ3  1 
ATOM   9135  N  N    . GLY B  1 272 ? -9.467  -45.609 -112.474 1.00 11.02  ? 272 GLY A N    1 
ATOM   9136  C  CA   . GLY B  1 272 ? -9.651  -45.871 -113.885 1.00 14.41  ? 272 GLY A CA   1 
ATOM   9137  C  C    . GLY B  1 272 ? -10.968 -46.583 -114.179 1.00 12.83  ? 272 GLY A C    1 
ATOM   9138  O  O    . GLY B  1 272 ? -11.415 -46.599 -115.329 1.00 16.64  ? 272 GLY A O    1 
ATOM   9139  H  H    . GLY B  1 272 ? -9.732  -44.829 -112.226 1.00 13.22  ? 272 GLY A H    1 
ATOM   9140  H  HA2  . GLY B  1 272 ? -9.640  -45.033 -114.373 1.00 17.30  ? 272 GLY A HA2  1 
ATOM   9141  H  HA3  . GLY B  1 272 ? -8.924  -46.425 -114.208 1.00 17.30  ? 272 GLY A HA3  1 
ATOM   9142  N  N    . ILE B  1 273 ? -11.574 -47.191 -113.160 1.00 11.49  ? 273 ILE A N    1 
ATOM   9143  C  CA   . ILE B  1 273 ? -12.845 -47.897 -113.335 1.00 10.27  ? 273 ILE A CA   1 
ATOM   9144  C  C    . ILE B  1 273 ? -13.993 -47.076 -112.758 1.00 12.71  ? 273 ILE A C    1 
ATOM   9145  O  O    . ILE B  1 273 ? -14.954 -46.758 -113.460 1.00 9.49   ? 273 ILE A O    1 
ATOM   9146  C  CB   . ILE B  1 273 ? -12.792 -49.286 -112.689 1.00 14.11  ? 273 ILE A CB   1 
ATOM   9147  C  CG1  . ILE B  1 273 ? -11.777 -50.144 -113.454 1.00 15.14  ? 273 ILE A CG1  1 
ATOM   9148  C  CG2  . ILE B  1 273 ? -14.178 -49.977 -112.698 1.00 13.45  ? 273 ILE A CG2  1 
ATOM   9149  C  CD1  . ILE B  1 273 ? -11.364 -51.361 -112.704 1.00 25.39  ? 273 ILE A CD1  1 
ATOM   9150  H  H    . ILE B  1 273 ? -11.270 -47.209 -112.356 1.00 13.79  ? 273 ILE A H    1 
ATOM   9151  H  HA   . ILE B  1 273 ? -13.011 -48.016 -114.283 1.00 12.32  ? 273 ILE A HA   1 
ATOM   9152  H  HB   . ILE B  1 273 ? -12.494 -49.193 -111.770 1.00 16.93  ? 273 ILE A HB   1 
ATOM   9153  H  HG12 . ILE B  1 273 ? -12.173 -50.429 -114.293 1.00 18.17  ? 273 ILE A HG12 1 
ATOM   9154  H  HG13 . ILE B  1 273 ? -10.982 -49.614 -113.626 1.00 18.17  ? 273 ILE A HG13 1 
ATOM   9155  H  HG21 . ILE B  1 273 ? -14.098 -50.850 -112.281 1.00 16.14  ? 273 ILE A HG21 1 
ATOM   9156  H  HG22 . ILE B  1 273 ? -14.807 -49.430 -112.202 1.00 16.14  ? 273 ILE A HG22 1 
ATOM   9157  H  HG23 . ILE B  1 273 ? -14.476 -50.075 -113.616 1.00 16.14  ? 273 ILE A HG23 1 
ATOM   9158  H  HD11 . ILE B  1 273 ? -10.725 -51.858 -113.238 1.00 30.47  ? 273 ILE A HD11 1 
ATOM   9159  H  HD12 . ILE B  1 273 ? -10.958 -51.091 -111.866 1.00 30.47  ? 273 ILE A HD12 1 
ATOM   9160  H  HD13 . ILE B  1 273 ? -12.148 -51.906 -112.533 1.00 30.47  ? 273 ILE A HD13 1 
ATOM   9161  N  N    . LEU B  1 274 ? -13.884 -46.732 -111.484 1.00 10.52  ? 274 LEU A N    1 
ATOM   9162  C  CA   . LEU B  1 274 ? -14.876 -45.894 -110.817 1.00 11.93  ? 274 LEU A CA   1 
ATOM   9163  C  C    . LEU B  1 274 ? -14.327 -44.482 -110.659 1.00 14.73  ? 274 LEU A C    1 
ATOM   9164  O  O    . LEU B  1 274 ? -13.312 -44.293 -110.008 1.00 17.16  ? 274 LEU A O    1 
ATOM   9165  C  CB   . LEU B  1 274 ? -15.232 -46.468 -109.447 1.00 11.96  ? 274 LEU A CB   1 
ATOM   9166  C  CG   . LEU B  1 274 ? -16.174 -45.640 -108.572 1.00 17.57  ? 274 LEU A CG   1 
ATOM   9167  C  CD1  . LEU B  1 274 ? -17.504 -45.398 -109.254 1.00 14.13  ? 274 LEU A CD1  1 
ATOM   9168  C  CD2  . LEU B  1 274 ? -16.399 -46.346 -107.240 1.00 26.24  ? 274 LEU A CD2  1 
ATOM   9169  H  H    . LEU B  1 274 ? -13.235 -46.974 -110.974 1.00 12.62  ? 274 LEU A H    1 
ATOM   9170  H  HA   . LEU B  1 274 ? -15.682 -45.854 -111.354 1.00 14.32  ? 274 LEU A HA   1 
ATOM   9171  H  HB2  . LEU B  1 274 ? -15.652 -47.331 -109.581 1.00 14.35  ? 274 LEU A HB2  1 
ATOM   9172  H  HB3  . LEU B  1 274 ? -14.409 -46.587 -108.947 1.00 14.35  ? 274 LEU A HB3  1 
ATOM   9173  H  HG   . LEU B  1 274 ? -15.766 -44.779 -108.392 1.00 21.08  ? 274 LEU A HG   1 
ATOM   9174  H  HD11 . LEU B  1 274 ? -18.068 -44.872 -108.666 1.00 16.95  ? 274 LEU A HD11 1 
ATOM   9175  H  HD12 . LEU B  1 274 ? -17.350 -44.919 -110.083 1.00 16.95  ? 274 LEU A HD12 1 
ATOM   9176  H  HD13 . LEU B  1 274 ? -17.924 -46.253 -109.438 1.00 16.95  ? 274 LEU A HD13 1 
ATOM   9177  H  HD21 . LEU B  1 274 ? -16.997 -45.811 -106.696 1.00 31.49  ? 274 LEU A HD21 1 
ATOM   9178  H  HD22 . LEU B  1 274 ? -16.793 -47.217 -107.407 1.00 31.49  ? 274 LEU A HD22 1 
ATOM   9179  H  HD23 . LEU B  1 274 ? -15.546 -46.449 -106.790 1.00 31.49  ? 274 LEU A HD23 1 
ATOM   9180  N  N    . GLY B  1 275 ? -14.991 -43.507 -111.267 1.00 13.20  ? 275 GLY A N    1 
ATOM   9181  C  CA   . GLY B  1 275 ? -14.632 -42.107 -111.089 1.00 11.97  ? 275 GLY A CA   1 
ATOM   9182  C  C    . GLY B  1 275 ? -15.475 -41.425 -110.018 1.00 9.69   ? 275 GLY A C    1 
ATOM   9183  O  O    . GLY B  1 275 ? -16.458 -41.982 -109.530 1.00 10.88  ? 275 GLY A O    1 
ATOM   9184  H  H    . GLY B  1 275 ? -15.660 -43.631 -111.793 1.00 15.84  ? 275 GLY A H    1 
ATOM   9185  H  HA2  . GLY B  1 275 ? -13.699 -42.043 -110.832 1.00 14.36  ? 275 GLY A HA2  1 
ATOM   9186  H  HA3  . GLY B  1 275 ? -14.755 -41.633 -111.926 1.00 14.36  ? 275 GLY A HA3  1 
ATOM   9187  N  N    . TYR B  1 276 ? -15.098 -40.197 -109.690 1.00 13.34  ? 276 TYR A N    1 
ATOM   9188  C  CA   . TYR B  1 276 ? -15.778 -39.397 -108.690 1.00 11.75  ? 276 TYR A CA   1 
ATOM   9189  C  C    . TYR B  1 276 ? -15.707 -37.945 -109.100 1.00 13.93  ? 276 TYR A C    1 
ATOM   9190  O  O    . TYR B  1 276 ? -14.619 -37.448 -109.412 1.00 12.28  ? 276 TYR A O    1 
ATOM   9191  C  CB   . TYR B  1 276 ? -15.141 -39.589 -107.311 1.00 10.39  ? 276 TYR A CB   1 
ATOM   9192  C  CG   . TYR B  1 276 ? -15.715 -38.692 -106.243 1.00 13.04  ? 276 TYR A CG   1 
ATOM   9193  C  CD1  . TYR B  1 276 ? -16.792 -39.111 -105.480 1.00 12.55  ? 276 TYR A CD1  1 
ATOM   9194  C  CD2  . TYR B  1 276 ? -15.166 -37.437 -105.972 1.00 18.51  ? 276 TYR A CD2  1 
ATOM   9195  C  CE1  . TYR B  1 276 ? -17.327 -38.300 -104.486 1.00 14.49  ? 276 TYR A CE1  1 
ATOM   9196  C  CE2  . TYR B  1 276 ? -15.701 -36.617 -104.981 1.00 17.17  ? 276 TYR A CE2  1 
ATOM   9197  C  CZ   . TYR B  1 276 ? -16.788 -37.069 -104.243 1.00 16.63  ? 276 TYR A CZ   1 
ATOM   9198  O  OH   . TYR B  1 276 ? -17.364 -36.290 -103.268 1.00 15.76  ? 276 TYR A OH   1 
ATOM   9199  H  H    . TYR B  1 276 ? -14.428 -39.794 -110.048 1.00 16.01  ? 276 TYR A H    1 
ATOM   9200  H  HA   . TYR B  1 276 ? -16.711 -39.660 -108.641 1.00 14.10  ? 276 TYR A HA   1 
ATOM   9201  H  HB2  . TYR B  1 276 ? -15.275 -40.508 -107.031 1.00 12.46  ? 276 TYR A HB2  1 
ATOM   9202  H  HB3  . TYR B  1 276 ? -14.192 -39.401 -107.377 1.00 12.46  ? 276 TYR A HB3  1 
ATOM   9203  H  HD1  . TYR B  1 276 ? -17.169 -39.946 -105.640 1.00 15.06  ? 276 TYR A HD1  1 
ATOM   9204  H  HD2  . TYR B  1 276 ? -14.441 -37.138 -106.472 1.00 22.21  ? 276 TYR A HD2  1 
ATOM   9205  H  HE1  . TYR B  1 276 ? -18.059 -38.593 -103.993 1.00 17.39  ? 276 TYR A HE1  1 
ATOM   9206  H  HE2  . TYR B  1 276 ? -15.336 -35.777 -104.817 1.00 20.60  ? 276 TYR A HE2  1 
ATOM   9207  H  HH   . TYR B  1 276 ? -16.955 -35.559 -103.204 1.00 18.91  ? 276 TYR A HH   1 
ATOM   9208  N  N    . THR B  1 277 ? -16.857 -37.272 -109.127 1.00 15.04  ? 277 THR A N    1 
ATOM   9209  C  CA   . THR B  1 277 ? -16.877 -35.829 -109.359 1.00 14.28  ? 277 THR A CA   1 
ATOM   9210  C  C    . THR B  1 277 ? -17.855 -35.075 -108.469 1.00 11.29  ? 277 THR A C    1 
ATOM   9211  O  O    . THR B  1 277 ? -18.891 -35.611 -108.067 1.00 14.26  ? 277 THR A O    1 
ATOM   9212  C  CB   . THR B  1 277 ? -17.206 -35.486 -110.838 1.00 13.80  ? 277 THR A CB   1 
ATOM   9213  O  OG1  . THR B  1 277 ? -16.976 -34.092 -111.027 1.00 17.20  ? 277 THR A OG1  1 
ATOM   9214  C  CG2  . THR B  1 277 ? -18.658 -35.818 -111.206 1.00 14.40  ? 277 THR A CG2  1 
ATOM   9215  H  H    . THR B  1 277 ? -17.634 -37.624 -109.016 1.00 18.05  ? 277 THR A H    1 
ATOM   9216  H  HA   . THR B  1 277 ? -15.991 -35.481 -109.172 1.00 17.13  ? 277 THR A HA   1 
ATOM   9217  H  HB   . THR B  1 277 ? -16.619 -35.990 -111.423 1.00 16.56  ? 277 THR A HB   1 
ATOM   9218  H  HG1  . THR B  1 277 ? -17.147 -33.878 -111.821 1.00 20.64  ? 277 THR A HG1  1 
ATOM   9219  H  HG21 . THR B  1 277 ? -18.825 -35.590 -112.134 1.00 17.28  ? 277 THR A HG21 1 
ATOM   9220  H  HG22 . THR B  1 277 ? -18.824 -36.765 -111.078 1.00 17.28  ? 277 THR A HG22 1 
ATOM   9221  H  HG23 . THR B  1 277 ? -19.266 -35.313 -110.643 1.00 17.28  ? 277 THR A HG23 1 
ATOM   9222  N  N    . GLU B  1 278 ? -17.477 -33.833 -108.143 1.00 10.94  ? 278 GLU A N    1 
ATOM   9223  C  CA   . GLU B  1 278 ? -18.348 -32.873 -107.489 1.00 11.33  ? 278 GLU A CA   1 
ATOM   9224  C  C    . GLU B  1 278 ? -18.670 -31.707 -108.425 1.00 16.08  ? 278 GLU A C    1 
ATOM   9225  O  O    . GLU B  1 278 ? -19.386 -30.800 -108.045 1.00 16.76  ? 278 GLU A O    1 
ATOM   9226  C  CB   . GLU B  1 278 ? -17.696 -32.340 -106.194 1.00 15.14  ? 278 GLU A CB   1 
ATOM   9227  C  CG   . GLU B  1 278 ? -17.377 -33.464 -105.218 1.00 22.48  ? 278 GLU A CG   1 
ATOM   9228  C  CD   . GLU B  1 278 ? -16.647 -33.021 -103.962 1.00 29.10  ? 278 GLU A CD   1 
ATOM   9229  O  OE1  . GLU B  1 278 ? -16.264 -31.840 -103.866 1.00 25.89  ? 278 GLU A OE1  1 
ATOM   9230  O  OE2  . GLU B  1 278 ? -16.473 -33.873 -103.063 1.00 19.92  ? 278 GLU A OE2  1 
ATOM   9231  H  H    . GLU B  1 278 ? -16.691 -33.522 -108.301 1.00 13.13  ? 278 GLU A H    1 
ATOM   9232  H  HA   . GLU B  1 278 ? -19.181 -33.309 -107.251 1.00 13.59  ? 278 GLU A HA   1 
ATOM   9233  H  HB2  . GLU B  1 278 ? -16.867 -31.888 -106.416 1.00 18.17  ? 278 GLU A HB2  1 
ATOM   9234  H  HB3  . GLU B  1 278 ? -18.306 -31.725 -105.759 1.00 18.17  ? 278 GLU A HB3  1 
ATOM   9235  H  HG2  . GLU B  1 278 ? -18.209 -33.880 -104.943 1.00 26.98  ? 278 GLU A HG2  1 
ATOM   9236  H  HG3  . GLU B  1 278 ? -16.818 -34.116 -105.668 1.00 26.98  ? 278 GLU A HG3  1 
ATOM   9237  N  N    . HIS B  1 279 ? -18.139 -31.745 -109.644 1.00 12.36  ? 279 HIS A N    1 
ATOM   9238  C  CA   . HIS B  1 279 ? -18.452 -30.745 -110.659 1.00 11.04  ? 279 HIS A CA   1 
ATOM   9239  C  C    . HIS B  1 279 ? -19.918 -30.816 -111.136 1.00 10.55  ? 279 HIS A C    1 
ATOM   9240  O  O    . HIS B  1 279 ? -20.601 -31.842 -111.007 1.00 14.37  ? 279 HIS A O    1 
ATOM   9241  C  CB   . HIS B  1 279 ? -17.518 -30.916 -111.867 1.00 17.25  ? 279 HIS A CB   1 
ATOM   9242  C  CG   . HIS B  1 279 ? -16.071 -30.695 -111.553 1.00 29.18  ? 279 HIS A CG   1 
ATOM   9243  N  ND1  . HIS B  1 279 ? -15.642 -29.771 -110.625 1.00 39.90  ? 279 HIS A ND1  1 
ATOM   9244  C  CD2  . HIS B  1 279 ? -14.953 -31.273 -112.053 1.00 35.64  ? 279 HIS A CD2  1 
ATOM   9245  C  CE1  . HIS B  1 279 ? -14.322 -29.794 -110.560 1.00 37.46  ? 279 HIS A CE1  1 
ATOM   9246  N  NE2  . HIS B  1 279 ? -13.879 -30.698 -111.414 1.00 38.11  ? 279 HIS A NE2  1 
ATOM   9247  H  H    . HIS B  1 279 ? -17.586 -32.348 -109.910 1.00 14.83  ? 279 HIS A H    1 
ATOM   9248  H  HA   . HIS B  1 279 ? -18.302 -29.862 -110.287 1.00 13.25  ? 279 HIS A HA   1 
ATOM   9249  H  HB2  . HIS B  1 279 ? -17.612 -31.818 -112.210 1.00 20.70  ? 279 HIS A HB2  1 
ATOM   9250  H  HB3  . HIS B  1 279 ? -17.773 -30.277 -112.551 1.00 20.70  ? 279 HIS A HB3  1 
ATOM   9251  H  HD2  . HIS B  1 279 ? -14.917 -31.939 -112.700 1.00 42.77  ? 279 HIS A HD2  1 
ATOM   9252  H  HE1  . HIS B  1 279 ? -13.796 -29.264 -110.006 1.00 44.95  ? 279 HIS A HE1  1 
ATOM   9253  N  N    . GLN B  1 280 ? -20.390 -29.712 -111.691 1.00 10.75  ? 280 GLN A N    1 
ATOM   9254  C  CA   . GLN B  1 280 ? -21.767 -29.590 -112.172 1.00 10.41  ? 280 GLN A CA   1 
ATOM   9255  C  C    . GLN B  1 280 ? -21.919 -30.149 -113.590 1.00 12.42  ? 280 GLN A C    1 
ATOM   9256  O  O    . GLN B  1 280 ? -22.152 -29.406 -114.550 1.00 13.37  ? 280 GLN A O    1 
ATOM   9257  C  CB   . GLN B  1 280 ? -22.179 -28.126 -112.128 1.00 11.44  ? 280 GLN A CB   1 
ATOM   9258  C  CG   . GLN B  1 280 ? -22.147 -27.526 -110.704 1.00 19.74  ? 280 GLN A CG   1 
ATOM   9259  C  CD   . GLN B  1 280 ? -23.160 -28.191 -109.805 1.00 31.31  ? 280 GLN A CD   1 
ATOM   9260  O  OE1  . GLN B  1 280 ? -24.358 -28.241 -110.129 1.00 34.54  ? 280 GLN A OE1  1 
ATOM   9261  N  NE2  . GLN B  1 280 ? -22.695 -28.725 -108.675 1.00 45.49  ? 280 GLN A NE2  1 
ATOM   9262  H  H    . GLN B  1 280 ? -19.923 -28.999 -111.805 1.00 12.90  ? 280 GLN A H    1 
ATOM   9263  H  HA   . GLN B  1 280 ? -22.356 -30.089 -111.585 1.00 12.50  ? 280 GLN A HA   1 
ATOM   9264  H  HB2  . GLN B  1 280 ? -21.572 -27.611 -112.682 1.00 13.73  ? 280 GLN A HB2  1 
ATOM   9265  H  HB3  . GLN B  1 280 ? -23.085 -28.044 -112.466 1.00 13.73  ? 280 GLN A HB3  1 
ATOM   9266  H  HG2  . GLN B  1 280 ? -21.266 -27.659 -110.320 1.00 23.68  ? 280 GLN A HG2  1 
ATOM   9267  H  HG3  . GLN B  1 280 ? -22.355 -26.580 -110.750 1.00 23.68  ? 280 GLN A HG3  1 
ATOM   9268  H  HE21 . GLN B  1 280 ? -21.856 -28.680 -108.492 1.00 54.59  ? 280 GLN A HE21 1 
ATOM   9269  H  HE22 . GLN B  1 280 ? -23.234 -29.115 -108.130 1.00 54.59  ? 280 GLN A HE22 1 
ATOM   9270  N  N    . VAL B  1 281 ? -21.779 -31.465 -113.697 1.00 9.37   ? 281 VAL A N    1 
ATOM   9271  C  CA   . VAL B  1 281 ? -21.663 -32.150 -114.966 1.00 11.85  ? 281 VAL A CA   1 
ATOM   9272  C  C    . VAL B  1 281 ? -23.000 -32.469 -115.626 1.00 12.75  ? 281 VAL A C    1 
ATOM   9273  O  O    . VAL B  1 281 ? -24.024 -32.586 -114.970 1.00 10.57  ? 281 VAL A O    1 
ATOM   9274  C  CB   . VAL B  1 281 ? -20.877 -33.476 -114.803 1.00 14.06  ? 281 VAL A CB   1 
ATOM   9275  C  CG1  . VAL B  1 281 ? -19.443 -33.195 -114.420 1.00 17.92  ? 281 VAL A CG1  1 
ATOM   9276  C  CG2  . VAL B  1 281 ? -21.546 -34.384 -113.775 1.00 16.40  ? 281 VAL A CG2  1 
ATOM   9277  H  H    . VAL B  1 281 ? -21.748 -31.996 -113.021 1.00 11.24  ? 281 VAL A H    1 
ATOM   9278  H  HA   . VAL B  1 281 ? -21.163 -31.585 -115.576 1.00 14.22  ? 281 VAL A HA   1 
ATOM   9279  H  HB   . VAL B  1 281 ? -20.872 -33.943 -115.653 1.00 16.87  ? 281 VAL A HB   1 
ATOM   9280  H  HG11 . VAL B  1 281 ? -18.971 -34.037 -114.324 1.00 21.51  ? 281 VAL A HG11 1 
ATOM   9281  H  HG12 . VAL B  1 281 ? -19.029 -32.661 -115.117 1.00 21.51  ? 281 VAL A HG12 1 
ATOM   9282  H  HG13 . VAL B  1 281 ? -19.430 -32.710 -113.580 1.00 21.51  ? 281 VAL A HG13 1 
ATOM   9283  H  HG21 . VAL B  1 281 ? -21.032 -35.203 -113.696 1.00 19.68  ? 281 VAL A HG21 1 
ATOM   9284  H  HG22 . VAL B  1 281 ? -21.574 -33.926 -112.920 1.00 19.68  ? 281 VAL A HG22 1 
ATOM   9285  H  HG23 . VAL B  1 281 ? -22.448 -34.586 -114.072 1.00 19.68  ? 281 VAL A HG23 1 
ATOM   9286  N  N    . VAL B  1 282 ? -22.963 -32.604 -116.949 1.00 8.35   ? 282 VAL A N    1 
ATOM   9287  C  CA   . VAL B  1 282 ? -24.098 -33.089 -117.714 1.00 8.02   ? 282 VAL A CA   1 
ATOM   9288  C  C    . VAL B  1 282 ? -23.551 -34.197 -118.624 1.00 10.78  ? 282 VAL A C    1 
ATOM   9289  O  O    . VAL B  1 282 ? -22.336 -34.396 -118.686 1.00 10.55  ? 282 VAL A O    1 
ATOM   9290  C  CB   . VAL B  1 282 ? -24.779 -31.960 -118.508 1.00 8.24   ? 282 VAL A CB   1 
ATOM   9291  C  CG1  . VAL B  1 282 ? -25.396 -30.926 -117.547 1.00 8.58   ? 282 VAL A CG1  1 
ATOM   9292  C  CG2  . VAL B  1 282 ? -23.787 -31.261 -119.478 1.00 8.54   ? 282 VAL A CG2  1 
ATOM   9293  H  H    . VAL B  1 282 ? -22.277 -32.416 -117.432 1.00 10.02  ? 282 VAL A H    1 
ATOM   9294  H  HA   . VAL B  1 282 ? -24.751 -33.479 -117.112 1.00 9.62   ? 282 VAL A HA   1 
ATOM   9295  H  HB   . VAL B  1 282 ? -25.497 -32.339 -119.039 1.00 9.89   ? 282 VAL A HB   1 
ATOM   9296  H  HG11 . VAL B  1 282 ? -25.819 -30.225 -118.067 1.00 10.30  ? 282 VAL A HG11 1 
ATOM   9297  H  HG12 . VAL B  1 282 ? -26.055 -31.369 -116.989 1.00 10.30  ? 282 VAL A HG12 1 
ATOM   9298  H  HG13 . VAL B  1 282 ? -24.693 -30.551 -116.994 1.00 10.30  ? 282 VAL A HG13 1 
ATOM   9299  H  HG21 . VAL B  1 282 ? -24.256 -30.559 -119.956 1.00 10.25  ? 282 VAL A HG21 1 
ATOM   9300  H  HG22 . VAL B  1 282 ? -23.058 -30.881 -118.963 1.00 10.25  ? 282 VAL A HG22 1 
ATOM   9301  H  HG23 . VAL B  1 282 ? -23.444 -31.917 -120.105 1.00 10.25  ? 282 VAL A HG23 1 
ATOM   9302  N  N    . SER B  1 283 ? -24.425 -34.921 -119.322 1.00 8.88   ? 283 SER A N    1 
ATOM   9303  C  CA   . SER B  1 283 ? -23.997 -36.133 -120.018 1.00 8.62   ? 283 SER A CA   1 
ATOM   9304  C  C    . SER B  1 283 ? -22.835 -35.887 -120.998 1.00 7.95   ? 283 SER A C    1 
ATOM   9305  O  O    . SER B  1 283 ? -21.911 -36.705 -121.039 1.00 7.24   ? 283 SER A O    1 
ATOM   9306  C  CB   . SER B  1 283 ? -25.174 -36.798 -120.744 1.00 12.32  ? 283 SER A CB   1 
ATOM   9307  O  OG   . SER B  1 283 ? -25.713 -35.968 -121.746 1.00 9.42   ? 283 SER A OG   1 
ATOM   9308  H  H    . SER B  1 283 ? -25.261 -34.735 -119.407 1.00 10.65  ? 283 SER A H    1 
ATOM   9309  H  HA   . SER B  1 283 ? -23.679 -36.764 -119.354 1.00 10.34  ? 283 SER A HA   1 
ATOM   9310  H  HB2  . SER B  1 283 ? -24.863 -37.620 -121.154 1.00 14.78  ? 283 SER A HB2  1 
ATOM   9311  H  HB3  . SER B  1 283 ? -25.868 -36.996 -120.096 1.00 14.78  ? 283 SER A HB3  1 
ATOM   9312  H  HG   . SER B  1 283 ? -26.354 -36.356 -122.126 1.00 11.31  ? 283 SER A HG   1 
ATOM   9313  N  N    . SER B  1 284 ? -22.836 -34.777 -121.742 1.00 7.64   ? 284 SER A N    1 
ATOM   9314  C  CA   . SER B  1 284 ? -21.812 -34.589 -122.769 1.00 11.74  ? 284 SER A CA   1 
ATOM   9315  C  C    . SER B  1 284 ? -20.403 -34.472 -122.159 1.00 12.46  ? 284 SER A C    1 
ATOM   9316  O  O    . SER B  1 284 ? -19.408 -34.698 -122.847 1.00 8.50   ? 284 SER A O    1 
ATOM   9317  C  CB   . SER B  1 284 ? -22.105 -33.362 -123.646 1.00 13.46  ? 284 SER A CB   1 
ATOM   9318  O  OG   . SER B  1 284 ? -22.047 -32.174 -122.892 1.00 19.80  ? 284 SER A OG   1 
ATOM   9319  H  H    . SER B  1 284 ? -23.403 -34.135 -121.674 1.00 9.17   ? 284 SER A H    1 
ATOM   9320  H  HA   . SER B  1 284 ? -21.814 -35.367 -123.348 1.00 14.09  ? 284 SER A HA   1 
ATOM   9321  H  HB2  . SER B  1 284 ? -21.444 -33.317 -124.355 1.00 16.15  ? 284 SER A HB2  1 
ATOM   9322  H  HB3  . SER B  1 284 ? -22.993 -33.451 -124.026 1.00 16.15  ? 284 SER A HB3  1 
ATOM   9323  H  HG   . SER B  1 284 ? -21.282 -32.083 -122.557 1.00 23.76  ? 284 SER A HG   1 
ATOM   9324  N  N    . ASP B  1 285 ? -20.314 -34.179 -120.867 1.00 8.12   ? 285 ASP A N    1 
ATOM   9325  C  CA   . ASP B  1 285 ? -19.016 -34.076 -120.220 1.00 15.11  ? 285 ASP A CA   1 
ATOM   9326  C  C    . ASP B  1 285 ? -18.354 -35.440 -120.100 1.00 15.02  ? 285 ASP A C    1 
ATOM   9327  O  O    . ASP B  1 285 ? -17.157 -35.525 -119.822 1.00 10.52  ? 285 ASP A O    1 
ATOM   9328  C  CB   . ASP B  1 285 ? -19.152 -33.419 -118.856 1.00 11.55  ? 285 ASP A CB   1 
ATOM   9329  C  CG   . ASP B  1 285 ? -19.620 -31.953 -118.952 1.00 13.83  ? 285 ASP A CG   1 
ATOM   9330  O  OD1  . ASP B  1 285 ? -19.240 -31.259 -119.915 1.00 12.23  ? 285 ASP A OD1  1 
ATOM   9331  O  OD2  . ASP B  1 285 ? -20.385 -31.496 -118.073 1.00 13.01  ? 285 ASP A OD2  1 
ATOM   9332  H  H    . ASP B  1 285 ? -20.985 -34.037 -120.347 1.00 9.74   ? 285 ASP A H    1 
ATOM   9333  H  HA   . ASP B  1 285 ? -18.441 -33.514 -120.763 1.00 18.13  ? 285 ASP A HA   1 
ATOM   9334  H  HB2  . ASP B  1 285 ? -19.804 -33.910 -118.332 1.00 13.85  ? 285 ASP A HB2  1 
ATOM   9335  H  HB3  . ASP B  1 285 ? -18.290 -33.432 -118.411 1.00 13.85  ? 285 ASP A HB3  1 
ATOM   9336  N  N    . PHE B  1 286 ? -19.120 -36.504 -120.332 1.00 8.23   ? 286 PHE A N    1 
ATOM   9337  C  CA   . PHE B  1 286 ? -18.584 -37.870 -120.238 1.00 9.77   ? 286 PHE A CA   1 
ATOM   9338  C  C    . PHE B  1 286 ? -18.399 -38.541 -121.584 1.00 7.43   ? 286 PHE A C    1 
ATOM   9339  O  O    . PHE B  1 286 ? -18.048 -39.711 -121.645 1.00 7.65   ? 286 PHE A O    1 
ATOM   9340  C  CB   . PHE B  1 286 ? -19.493 -38.728 -119.359 1.00 7.25   ? 286 PHE A CB   1 
ATOM   9341  C  CG   . PHE B  1 286 ? -19.528 -38.254 -117.956 1.00 7.26   ? 286 PHE A CG   1 
ATOM   9342  C  CD1  . PHE B  1 286 ? -18.497 -38.558 -117.094 1.00 10.78  ? 286 PHE A CD1  1 
ATOM   9343  C  CD2  . PHE B  1 286 ? -20.554 -37.442 -117.513 1.00 7.32   ? 286 PHE A CD2  1 
ATOM   9344  C  CE1  . PHE B  1 286 ? -18.501 -38.089 -115.800 1.00 14.64  ? 286 PHE A CE1  1 
ATOM   9345  C  CE2  . PHE B  1 286 ? -20.568 -36.970 -116.223 1.00 10.54  ? 286 PHE A CE2  1 
ATOM   9346  C  CZ   . PHE B  1 286 ? -19.548 -37.279 -115.363 1.00 14.13  ? 286 PHE A CZ   1 
ATOM   9347  H  H    . PHE B  1 286 ? -19.952 -36.467 -120.546 1.00 9.87   ? 286 PHE A H    1 
ATOM   9348  H  HA   . PHE B  1 286 ? -17.715 -37.830 -119.810 1.00 11.72  ? 286 PHE A HA   1 
ATOM   9349  H  HB2  . PHE B  1 286 ? -20.397 -38.697 -119.710 1.00 8.70   ? 286 PHE A HB2  1 
ATOM   9350  H  HB3  . PHE B  1 286 ? -19.166 -39.641 -119.360 1.00 8.70   ? 286 PHE A HB3  1 
ATOM   9351  H  HD1  . PHE B  1 286 ? -17.794 -39.092 -117.387 1.00 12.94  ? 286 PHE A HD1  1 
ATOM   9352  H  HD2  . PHE B  1 286 ? -21.247 -37.220 -118.092 1.00 8.78   ? 286 PHE A HD2  1 
ATOM   9353  H  HE1  . PHE B  1 286 ? -17.807 -38.308 -115.221 1.00 17.56  ? 286 PHE A HE1  1 
ATOM   9354  H  HE2  . PHE B  1 286 ? -21.271 -36.433 -115.934 1.00 12.64  ? 286 PHE A HE2  1 
ATOM   9355  H  HZ   . PHE B  1 286 ? -19.563 -36.966 -114.487 1.00 16.96  ? 286 PHE A HZ   1 
ATOM   9356  N  N    . ASN B  1 287 ? -18.612 -37.810 -122.669 1.00 7.55   ? 287 ASN A N    1 
ATOM   9357  C  CA   . ASN B  1 287 ? -18.396 -38.404 -123.972 1.00 10.00  ? 287 ASN A CA   1 
ATOM   9358  C  C    . ASN B  1 287 ? -16.924 -38.765 -124.195 1.00 16.51  ? 287 ASN A C    1 
ATOM   9359  O  O    . ASN B  1 287 ? -16.044 -37.936 -124.017 1.00 10.94  ? 287 ASN A O    1 
ATOM   9360  C  CB   . ASN B  1 287 ? -18.870 -37.497 -125.092 1.00 14.68  ? 287 ASN A CB   1 
ATOM   9361  C  CG   . ASN B  1 287 ? -19.042 -38.280 -126.407 1.00 27.05  ? 287 ASN A CG   1 
ATOM   9362  O  OD1  . ASN B  1 287 ? -19.718 -39.321 -126.450 1.00 17.60  ? 287 ASN A OD1  1 
ATOM   9363  N  ND2  . ASN B  1 287 ? -18.384 -37.823 -127.450 1.00 20.07  ? 287 ASN A ND2  1 
ATOM   9364  H  H    . ASN B  1 287 ? -18.874 -36.990 -122.678 1.00 9.07   ? 287 ASN A H    1 
ATOM   9365  H  HA   . ASN B  1 287 ? -18.909 -39.226 -124.024 1.00 12.00  ? 287 ASN A HA   1 
ATOM   9366  H  HB2  . ASN B  1 287 ? -19.727 -37.111 -124.852 1.00 17.61  ? 287 ASN A HB2  1 
ATOM   9367  H  HB3  . ASN B  1 287 ? -18.214 -36.797 -125.238 1.00 17.61  ? 287 ASN A HB3  1 
ATOM   9368  H  HD21 . ASN B  1 287 ? -18.446 -38.224 -128.208 1.00 24.08  ? 287 ASN A HD21 1 
ATOM   9369  H  HD22 . ASN B  1 287 ? -17.891 -37.122 -127.375 1.00 24.08  ? 287 ASN A HD22 1 
ATOM   9370  N  N    . SER B  1 288 ? -16.686 -40.021 -124.573 1.00 10.52  ? 288 SER A N    1 
ATOM   9371  C  CA   . SER B  1 288 ? -15.347 -40.611 -124.688 1.00 19.57  ? 288 SER A CA   1 
ATOM   9372  C  C    . SER B  1 288 ? -14.601 -40.736 -123.342 1.00 19.26  ? 288 SER A C    1 
ATOM   9373  O  O    . SER B  1 288 ? -13.377 -40.878 -123.311 1.00 15.46  ? 288 SER A O    1 
ATOM   9374  C  CB   . SER B  1 288 ? -14.509 -39.810 -125.682 1.00 16.81  ? 288 SER A CB   1 
ATOM   9375  O  OG   . SER B  1 288 ? -15.159 -39.748 -126.952 1.00 16.54  ? 288 SER A OG   1 
ATOM   9376  H  H    . SER B  1 288 ? -17.312 -40.575 -124.775 1.00 12.63  ? 288 SER A H    1 
ATOM   9377  H  HA   . SER B  1 288 ? -15.441 -41.507 -125.048 1.00 23.48  ? 288 SER A HA   1 
ATOM   9378  H  HB2  . SER B  1 288 ? -14.391 -38.909 -125.342 1.00 20.17  ? 288 SER A HB2  1 
ATOM   9379  H  HB3  . SER B  1 288 ? -13.646 -40.241 -125.789 1.00 20.17  ? 288 SER A HB3  1 
ATOM   9380  H  HG   . SER B  1 288 ? -15.269 -40.523 -127.257 1.00 19.85  ? 288 SER A HG   1 
ATOM   9381  N  N    . ASP B  1 289 ? -15.333 -40.700 -122.234 1.00 13.79  ? 289 ASP A N    1 
ATOM   9382  C  CA   . ASP B  1 289 ? -14.736 -40.932 -120.914 1.00 14.12  ? 289 ASP A CA   1 
ATOM   9383  C  C    . ASP B  1 289 ? -14.558 -42.438 -120.726 1.00 10.08  ? 289 ASP A C    1 
ATOM   9384  O  O    . ASP B  1 289 ? -15.482 -43.188 -120.987 1.00 13.44  ? 289 ASP A O    1 
ATOM   9385  C  CB   . ASP B  1 289 ? -15.623 -40.352 -119.812 1.00 12.87  ? 289 ASP A CB   1 
ATOM   9386  C  CG   . ASP B  1 289 ? -14.961 -40.396 -118.450 1.00 16.10  ? 289 ASP A CG   1 
ATOM   9387  O  OD1  . ASP B  1 289 ? -14.772 -41.517 -117.920 1.00 20.74  ? 289 ASP A OD1  1 
ATOM   9388  O  OD2  . ASP B  1 289 ? -14.637 -39.320 -117.908 1.00 21.81  ? 289 ASP A OD2  1 
ATOM   9389  H  H    . ASP B  1 289 ? -16.179 -40.544 -122.215 1.00 16.54  ? 289 ASP A H    1 
ATOM   9390  H  HA   . ASP B  1 289 ? -13.865 -40.507 -120.869 1.00 16.95  ? 289 ASP A HA   1 
ATOM   9391  H  HB2  . ASP B  1 289 ? -15.822 -39.426 -120.019 1.00 15.44  ? 289 ASP A HB2  1 
ATOM   9392  H  HB3  . ASP B  1 289 ? -16.445 -40.866 -119.763 1.00 15.44  ? 289 ASP A HB3  1 
ATOM   9393  N  N    . THR B  1 290 ? -13.382 -42.897 -120.291 1.00 9.08   ? 290 THR A N    1 
ATOM   9394  C  CA   . THR B  1 290 ? -13.108 -44.345 -120.276 1.00 11.06  ? 290 THR A CA   1 
ATOM   9395  C  C    . THR B  1 290 ? -13.453 -45.036 -118.961 1.00 12.13  ? 290 THR A C    1 
ATOM   9396  O  O    . THR B  1 290 ? -13.211 -46.240 -118.805 1.00 11.41  ? 290 THR A O    1 
ATOM   9397  C  CB   . THR B  1 290 ? -11.624 -44.638 -120.580 1.00 14.45  ? 290 THR A CB   1 
ATOM   9398  O  OG1  . THR B  1 290 ? -10.815 -43.975 -119.601 1.00 15.52  ? 290 THR A OG1  1 
ATOM   9399  C  CG2  . THR B  1 290 ? -11.266 -44.152 -121.971 1.00 21.18  ? 290 THR A CG2  1 
ATOM   9400  H  H    . THR B  1 290 ? -12.736 -42.407 -120.004 1.00 10.89  ? 290 THR A H    1 
ATOM   9401  H  HA   . THR B  1 290 ? -13.638 -44.764 -120.973 1.00 13.27  ? 290 THR A HA   1 
ATOM   9402  H  HB   . THR B  1 290 ? -11.466 -45.594 -120.537 1.00 17.34  ? 290 THR A HB   1 
ATOM   9403  H  HG1  . THR B  1 290 ? -10.002 -44.124 -119.752 1.00 18.63  ? 290 THR A HG1  1 
ATOM   9404  H  HG21 . THR B  1 290 ? -10.332 -44.338 -122.157 1.00 25.42  ? 290 THR A HG21 1 
ATOM   9405  H  HG22 . THR B  1 290 ? -11.815 -44.603 -122.631 1.00 25.42  ? 290 THR A HG22 1 
ATOM   9406  H  HG23 . THR B  1 290 ? -11.416 -43.196 -122.036 1.00 25.42  ? 290 THR A HG23 1 
ATOM   9407  N  N    . HIS B  1 291 ? -14.002 -44.302 -118.001 1.00 11.18  ? 291 HIS A N    1 
ATOM   9408  C  CA   . HIS B  1 291 ? -14.411 -44.948 -116.767 1.00 7.21   ? 291 HIS A CA   1 
ATOM   9409  C  C    . HIS B  1 291 ? -15.613 -45.841 -117.022 1.00 10.49  ? 291 HIS A C    1 
ATOM   9410  O  O    . HIS B  1 291 ? -16.391 -45.621 -117.960 1.00 12.54  ? 291 HIS A O    1 
ATOM   9411  C  CB   . HIS B  1 291 ? -14.743 -43.920 -115.679 1.00 14.30  ? 291 HIS A CB   1 
ATOM   9412  C  CG   . HIS B  1 291 ? -13.540 -43.213 -115.133 1.00 13.85  ? 291 HIS A CG   1 
ATOM   9413  N  ND1  . HIS B  1 291 ? -12.988 -42.104 -115.744 1.00 24.92  ? 291 HIS A ND1  1 
ATOM   9414  C  CD2  . HIS B  1 291 ? -12.774 -43.462 -114.040 1.00 20.05  ? 291 HIS A CD2  1 
ATOM   9415  C  CE1  . HIS B  1 291 ? -11.936 -41.699 -115.047 1.00 22.99  ? 291 HIS A CE1  1 
ATOM   9416  N  NE2  . HIS B  1 291 ? -11.790 -42.499 -114.005 1.00 11.79  ? 291 HIS A NE2  1 
ATOM   9417  H  H    . HIS B  1 291 ? -14.145 -43.455 -118.037 1.00 13.42  ? 291 HIS A H    1 
ATOM   9418  H  HA   . HIS B  1 291 ? -13.685 -45.504 -116.444 1.00 8.66   ? 291 HIS A HA   1 
ATOM   9419  H  HB2  . HIS B  1 291 ? -15.337 -43.250 -116.052 1.00 17.16  ? 291 HIS A HB2  1 
ATOM   9420  H  HB3  . HIS B  1 291 ? -15.180 -44.374 -114.942 1.00 17.16  ? 291 HIS A HB3  1 
ATOM   9421  H  HD2  . HIS B  1 291 ? -12.898 -44.147 -113.423 1.00 24.06  ? 291 HIS A HD2  1 
ATOM   9422  H  HE1  . HIS B  1 291 ? -11.397 -40.969 -115.252 1.00 27.59  ? 291 HIS A HE1  1 
ATOM   9423  N  N    . SER B  1 292 ? -15.779 -46.837 -116.168 1.00 7.97   ? 292 SER A N    1 
ATOM   9424  C  CA   . SER B  1 292 ? -16.969 -47.686 -116.225 1.00 6.78   ? 292 SER A CA   1 
ATOM   9425  C  C    . SER B  1 292 ? -18.135 -46.967 -115.556 1.00 8.52   ? 292 SER A C    1 
ATOM   9426  O  O    . SER B  1 292 ? -19.285 -47.210 -115.877 1.00 13.64  ? 292 SER A O    1 
ATOM   9427  C  CB   . SER B  1 292 ? -16.715 -49.017 -115.530 1.00 6.92   ? 292 SER A CB   1 
ATOM   9428  O  OG   . SER B  1 292 ? -15.750 -49.780 -116.211 1.00 10.59  ? 292 SER A OG   1 
ATOM   9429  H  H    . SER B  1 292 ? -15.224 -47.047 -115.546 1.00 9.56   ? 292 SER A H    1 
ATOM   9430  H  HA   . SER B  1 292 ? -17.201 -47.859 -117.151 1.00 8.13   ? 292 SER A HA   1 
ATOM   9431  H  HB2  . SER B  1 292 ? -16.400 -48.845 -114.629 1.00 8.30   ? 292 SER A HB2  1 
ATOM   9432  H  HB3  . SER B  1 292 ? -17.545 -49.518 -115.499 1.00 8.30   ? 292 SER A HB3  1 
ATOM   9433  H  HG   . SER B  1 292 ? -15.626 -50.508 -115.812 1.00 12.70  ? 292 SER A HG   1 
ATOM   9434  N  N    . SER B  1 293 ? -17.819 -46.090 -114.615 1.00 10.78  ? 293 SER A N    1 
ATOM   9435  C  CA   . SER B  1 293 ? -18.813 -45.506 -113.712 1.00 15.08  ? 293 SER A CA   1 
ATOM   9436  C  C    . SER B  1 293 ? -18.211 -44.239 -113.120 1.00 14.00  ? 293 SER A C    1 
ATOM   9437  O  O    . SER B  1 293 ? -17.098 -44.304 -112.635 1.00 14.25  ? 293 SER A O    1 
ATOM   9438  C  CB   . SER B  1 293 ? -19.159 -46.531 -112.620 1.00 16.92  ? 293 SER A CB   1 
ATOM   9439  O  OG   . SER B  1 293 ? -20.231 -46.147 -111.783 1.00 17.71  ? 293 SER A OG   1 
ATOM   9440  H  H    . SER B  1 293 ? -17.019 -45.808 -114.472 1.00 12.94  ? 293 SER A H    1 
ATOM   9441  H  HA   . SER B  1 293 ? -19.618 -45.278 -114.203 1.00 18.10  ? 293 SER A HA   1 
ATOM   9442  H  HB2  . SER B  1 293 ? -19.394 -47.368 -113.051 1.00 20.31  ? 293 SER A HB2  1 
ATOM   9443  H  HB3  . SER B  1 293 ? -18.373 -46.664 -112.067 1.00 20.31  ? 293 SER A HB3  1 
ATOM   9444  H  HG   . SER B  1 293 ? -20.375 -46.742 -111.208 1.00 21.25  ? 293 SER A HG   1 
ATOM   9445  N  N    . THR B  1 294 ? -18.907 -43.094 -113.169 1.00 8.44   ? 294 THR A N    1 
ATOM   9446  C  CA   . THR B  1 294 ? -18.431 -41.889 -112.473 1.00 8.90   ? 294 THR A CA   1 
ATOM   9447  C  C    . THR B  1 294 ? -19.542 -41.370 -111.586 1.00 9.09   ? 294 THR A C    1 
ATOM   9448  O  O    . THR B  1 294 ? -20.575 -40.914 -112.080 1.00 9.97   ? 294 THR A O    1 
ATOM   9449  C  CB   . THR B  1 294 ? -17.984 -40.759 -113.429 1.00 7.86   ? 294 THR A CB   1 
ATOM   9450  O  OG1  . THR B  1 294 ? -16.896 -41.209 -114.245 1.00 14.10  ? 294 THR A OG1  1 
ATOM   9451  C  CG2  . THR B  1 294 ? -17.531 -39.525 -112.615 1.00 10.66  ? 294 THR A CG2  1 
ATOM   9452  H  H    . THR B  1 294 ? -19.648 -42.989 -113.592 1.00 10.13  ? 294 THR A H    1 
ATOM   9453  H  HA   . THR B  1 294 ? -17.677 -42.124 -111.909 1.00 10.68  ? 294 THR A HA   1 
ATOM   9454  H  HB   . THR B  1 294 ? -18.728 -40.499 -113.995 1.00 9.43   ? 294 THR A HB   1 
ATOM   9455  H  HG1  . THR B  1 294 ? -16.653 -40.595 -114.764 1.00 16.92  ? 294 THR A HG1  1 
ATOM   9456  H  HG21 . THR B  1 294 ? -17.251 -38.817 -113.216 1.00 12.79  ? 294 THR A HG21 1 
ATOM   9457  H  HG22 . THR B  1 294 ? -18.264 -39.203 -112.067 1.00 12.79  ? 294 THR A HG22 1 
ATOM   9458  H  HG23 . THR B  1 294 ? -16.788 -39.763 -112.039 1.00 12.79  ? 294 THR A HG23 1 
ATOM   9459  N  N    . PHE B  1 295 ? -19.311 -41.478 -110.281 1.00 10.97  ? 295 PHE A N    1 
ATOM   9460  C  CA   . PHE B  1 295 ? -20.204 -41.013 -109.237 1.00 11.59  ? 295 PHE A CA   1 
ATOM   9461  C  C    . PHE B  1 295 ? -20.389 -39.511 -109.291 1.00 8.63   ? 295 PHE A C    1 
ATOM   9462  O  O    . PHE B  1 295 ? -19.435 -38.770 -109.270 1.00 9.42   ? 295 PHE A O    1 
ATOM   9463  C  CB   . PHE B  1 295 ? -19.646 -41.436 -107.879 1.00 8.92   ? 295 PHE A CB   1 
ATOM   9464  C  CG   . PHE B  1 295 ? -20.557 -41.137 -106.714 1.00 11.90  ? 295 PHE A CG   1 
ATOM   9465  C  CD1  . PHE B  1 295 ? -21.615 -41.968 -106.414 1.00 18.39  ? 295 PHE A CD1  1 
ATOM   9466  C  CD2  . PHE B  1 295 ? -20.320 -40.048 -105.900 1.00 13.93  ? 295 PHE A CD2  1 
ATOM   9467  C  CE1  . PHE B  1 295 ? -22.436 -41.710 -105.341 1.00 22.73  ? 295 PHE A CE1  1 
ATOM   9468  C  CE2  . PHE B  1 295 ? -21.144 -39.776 -104.812 1.00 15.24  ? 295 PHE A CE2  1 
ATOM   9469  C  CZ   . PHE B  1 295 ? -22.196 -40.609 -104.533 1.00 17.80  ? 295 PHE A CZ   1 
ATOM   9470  H  H    . PHE B  1 295 ? -18.598 -41.841 -109.965 1.00 13.17  ? 295 PHE A H    1 
ATOM   9471  H  HA   . PHE B  1 295 ? -21.072 -41.430 -109.351 1.00 13.91  ? 295 PHE A HA   1 
ATOM   9472  H  HB2  . PHE B  1 295 ? -19.488 -42.392 -107.892 1.00 10.71  ? 295 PHE A HB2  1 
ATOM   9473  H  HB3  . PHE B  1 295 ? -18.810 -40.968 -107.728 1.00 10.71  ? 295 PHE A HB3  1 
ATOM   9474  H  HD1  . PHE B  1 295 ? -21.781 -42.710 -106.950 1.00 22.06  ? 295 PHE A HD1  1 
ATOM   9475  H  HD2  . PHE B  1 295 ? -19.605 -39.483 -106.086 1.00 16.72  ? 295 PHE A HD2  1 
ATOM   9476  H  HE1  . PHE B  1 295 ? -23.150 -42.276 -105.156 1.00 27.27  ? 295 PHE A HE1  1 
ATOM   9477  H  HE2  . PHE B  1 295 ? -20.979 -39.035 -104.275 1.00 18.29  ? 295 PHE A HE2  1 
ATOM   9478  H  HZ   . PHE B  1 295 ? -22.753 -40.431 -103.809 1.00 21.36  ? 295 PHE A HZ   1 
ATOM   9479  N  N    . ASP B  1 296 ? -21.640 -39.079 -109.366 1.00 8.93   ? 296 ASP A N    1 
ATOM   9480  C  CA   . ASP B  1 296 ? -21.994 -37.664 -109.426 1.00 8.83   ? 296 ASP A CA   1 
ATOM   9481  C  C    . ASP B  1 296 ? -22.420 -37.220 -108.051 1.00 9.37   ? 296 ASP A C    1 
ATOM   9482  O  O    . ASP B  1 296 ? -23.580 -37.403 -107.678 1.00 13.04  ? 296 ASP A O    1 
ATOM   9483  C  CB   . ASP B  1 296 ? -23.125 -37.438 -110.442 1.00 9.68   ? 296 ASP A CB   1 
ATOM   9484  C  CG   . ASP B  1 296 ? -23.470 -35.952 -110.657 1.00 10.36  ? 296 ASP A CG   1 
ATOM   9485  O  OD1  . ASP B  1 296 ? -23.243 -35.111 -109.756 1.00 11.36  ? 296 ASP A OD1  1 
ATOM   9486  O  OD2  . ASP B  1 296 ? -23.979 -35.629 -111.759 1.00 12.23  ? 296 ASP A OD2  1 
ATOM   9487  H  H    . ASP B  1 296 ? -22.324 -39.601 -109.384 1.00 10.71  ? 296 ASP A H    1 
ATOM   9488  H  HA   . ASP B  1 296 ? -21.221 -37.143 -109.698 1.00 10.60  ? 296 ASP A HA   1 
ATOM   9489  H  HB2  . ASP B  1 296 ? -22.856 -37.808 -111.297 1.00 11.61  ? 296 ASP A HB2  1 
ATOM   9490  H  HB3  . ASP B  1 296 ? -23.924 -37.886 -110.125 1.00 11.61  ? 296 ASP A HB3  1 
ATOM   9491  N  N    . ALA B  1 297 ? -21.502 -36.635 -107.290 1.00 11.99  ? 297 ALA A N    1 
ATOM   9492  C  CA   . ALA B  1 297 ? -21.791 -36.323 -105.884 1.00 17.29  ? 297 ALA A CA   1 
ATOM   9493  C  C    . ALA B  1 297 ? -22.955 -35.339 -105.725 1.00 17.97  ? 297 ALA A C    1 
ATOM   9494  O  O    . ALA B  1 297 ? -23.849 -35.534 -104.899 1.00 17.01  ? 297 ALA A O    1 
ATOM   9495  C  CB   . ALA B  1 297 ? -20.546 -35.763 -105.197 1.00 15.79  ? 297 ALA A CB   1 
ATOM   9496  H  H    . ALA B  1 297 ? -20.715 -36.410 -107.553 1.00 14.39  ? 297 ALA A H    1 
ATOM   9497  H  HA   . ALA B  1 297 ? -22.035 -37.143 -105.428 1.00 20.75  ? 297 ALA A HA   1 
ATOM   9498  H  HB1  . ALA B  1 297 ? -20.759 -35.564 -104.272 1.00 18.95  ? 297 ALA A HB1  1 
ATOM   9499  H  HB2  . ALA B  1 297 ? -19.838 -36.425 -105.239 1.00 18.95  ? 297 ALA A HB2  1 
ATOM   9500  H  HB3  . ALA B  1 297 ? -20.270 -34.954 -105.655 1.00 18.95  ? 297 ALA A HB3  1 
ATOM   9501  N  N    . GLY B  1 298 ? -22.958 -34.286 -106.523 1.00 17.71  ? 298 GLY A N    1 
ATOM   9502  C  CA   . GLY B  1 298 ? -23.985 -33.273 -106.401 1.00 14.63  ? 298 GLY A CA   1 
ATOM   9503  C  C    . GLY B  1 298 ? -25.377 -33.695 -106.860 1.00 19.95  ? 298 GLY A C    1 
ATOM   9504  O  O    . GLY B  1 298 ? -26.355 -33.062 -106.481 1.00 23.96  ? 298 GLY A O    1 
ATOM   9505  H  H    . GLY B  1 298 ? -22.378 -34.136 -107.140 1.00 21.25  ? 298 GLY A H    1 
ATOM   9506  H  HA2  . GLY B  1 298 ? -24.049 -33.002 -105.472 1.00 17.56  ? 298 GLY A HA2  1 
ATOM   9507  H  HA3  . GLY B  1 298 ? -23.723 -32.498 -106.921 1.00 17.56  ? 298 GLY A HA3  1 
ATOM   9508  N  N    . ALA B  1 299 ? -25.489 -34.755 -107.662 1.00 12.50  ? 299 ALA A N    1 
ATOM   9509  C  CA   . ALA B  1 299 ? -26.776 -35.104 -108.265 1.00 15.05  ? 299 ALA A CA   1 
ATOM   9510  C  C    . ALA B  1 299 ? -27.618 -36.016 -107.362 1.00 19.82  ? 299 ALA A C    1 
ATOM   9511  O  O    . ALA B  1 299 ? -28.838 -36.045 -107.461 1.00 21.05  ? 299 ALA A O    1 
ATOM   9512  C  CB   . ALA B  1 299 ? -26.559 -35.773 -109.606 1.00 14.33  ? 299 ALA A CB   1 
ATOM   9513  H  H    . ALA B  1 299 ? -24.842 -35.283 -107.871 1.00 15.00  ? 299 ALA A H    1 
ATOM   9514  H  HA   . ALA B  1 299 ? -27.280 -34.289 -108.418 1.00 18.07  ? 299 ALA A HA   1 
ATOM   9515  H  HB1  . ALA B  1 299 ? -27.421 -35.997 -109.990 1.00 17.19  ? 299 ALA A HB1  1 
ATOM   9516  H  HB2  . ALA B  1 299 ? -26.085 -35.162 -110.191 1.00 17.19  ? 299 ALA A HB2  1 
ATOM   9517  H  HB3  . ALA B  1 299 ? -26.036 -36.579 -109.475 1.00 17.19  ? 299 ALA A HB3  1 
ATOM   9518  N  N    . GLY B  1 300 ? -26.955 -36.774 -106.501 1.00 16.68  ? 300 GLY A N    1 
ATOM   9519  C  CA   . GLY B  1 300 ? -27.639 -37.743 -105.669 1.00 18.99  ? 300 GLY A CA   1 
ATOM   9520  C  C    . GLY B  1 300 ? -28.334 -37.070 -104.515 1.00 19.50  ? 300 GLY A C    1 
ATOM   9521  O  O    . GLY B  1 300 ? -28.130 -35.889 -104.271 1.00 19.36  ? 300 GLY A O    1 
ATOM   9522  H  H    . GLY B  1 300 ? -26.104 -36.745 -106.381 1.00 20.02  ? 300 GLY A H    1 
ATOM   9523  H  HA2  . GLY B  1 300 ? -28.300 -38.219 -106.195 1.00 22.78  ? 300 GLY A HA2  1 
ATOM   9524  H  HA3  . GLY B  1 300 ? -27.000 -38.383 -105.318 1.00 22.78  ? 300 GLY A HA3  1 
ATOM   9525  N  N    . ILE B  1 301 ? -29.148 -37.826 -103.792 1.00 13.24  ? 301 ILE A N    1 
ATOM   9526  C  CA   . ILE B  1 301 ? -29.886 -37.249 -102.680 1.00 17.34  ? 301 ILE A CA   1 
ATOM   9527  C  C    . ILE B  1 301 ? -30.229 -38.337 -101.673 1.00 20.26  ? 301 ILE A C    1 
ATOM   9528  O  O    . ILE B  1 301 ? -30.561 -39.465 -102.046 1.00 16.02  ? 301 ILE A O    1 
ATOM   9529  C  CB   . ILE B  1 301 ? -31.166 -36.532 -103.184 1.00 19.50  ? 301 ILE A CB   1 
ATOM   9530  C  CG1  . ILE B  1 301 ? -31.850 -35.771 -102.040 1.00 30.34  ? 301 ILE A CG1  1 
ATOM   9531  C  CG2  . ILE B  1 301 ? -32.124 -37.519 -103.824 1.00 21.25  ? 301 ILE A CG2  1 
ATOM   9532  C  CD1  . ILE B  1 301 ? -32.767 -34.675 -102.512 1.00 31.32  ? 301 ILE A CD1  1 
ATOM   9533  H  H    . ILE B  1 301 ? -29.289 -38.664 -103.922 1.00 15.88  ? 301 ILE A H    1 
ATOM   9534  H  HA   . ILE B  1 301 ? -29.328 -36.592 -102.235 1.00 20.81  ? 301 ILE A HA   1 
ATOM   9535  H  HB   . ILE B  1 301 ? -30.904 -35.887 -103.859 1.00 23.39  ? 301 ILE A HB   1 
ATOM   9536  H  HG12 . ILE B  1 301 ? -32.377 -36.396 -101.518 1.00 36.41  ? 301 ILE A HG12 1 
ATOM   9537  H  HG13 . ILE B  1 301 ? -31.168 -35.368 -101.480 1.00 36.41  ? 301 ILE A HG13 1 
ATOM   9538  H  HG21 . ILE B  1 301 ? -32.912 -37.042 -104.128 1.00 25.50  ? 301 ILE A HG21 1 
ATOM   9539  H  HG22 . ILE B  1 301 ? -31.683 -37.944 -104.576 1.00 25.50  ? 301 ILE A HG22 1 
ATOM   9540  H  HG23 . ILE B  1 301 ? -32.374 -38.187 -103.166 1.00 25.50  ? 301 ILE A HG23 1 
ATOM   9541  H  HD11 . ILE B  1 301 ? -33.161 -34.240 -101.740 1.00 37.59  ? 301 ILE A HD11 1 
ATOM   9542  H  HD12 . ILE B  1 301 ? -32.253 -34.034 -103.027 1.00 37.59  ? 301 ILE A HD12 1 
ATOM   9543  H  HD13 . ILE B  1 301 ? -33.463 -35.062 -103.065 1.00 37.59  ? 301 ILE A HD13 1 
ATOM   9544  N  N    . ALA B  1 302 ? -30.100 -38.006 -100.397 1.00 13.36  ? 302 ALA A N    1 
ATOM   9545  C  CA   . ALA B  1 302 ? -30.485 -38.919 -99.324  1.00 22.07  ? 302 ALA A CA   1 
ATOM   9546  C  C    . ALA B  1 302 ? -31.817 -38.494 -98.728  1.00 22.01  ? 302 ALA A C    1 
ATOM   9547  O  O    . ALA B  1 302 ? -32.045 -37.310 -98.542  1.00 21.10  ? 302 ALA A O    1 
ATOM   9548  C  CB   . ALA B  1 302 ? -29.428 -38.943 -98.249  1.00 24.37  ? 302 ALA A CB   1 
ATOM   9549  H  H    . ALA B  1 302 ? -29.790 -37.253 -100.120 1.00 16.03  ? 302 ALA A H    1 
ATOM   9550  H  HA   . ALA B  1 302 ? -30.580 -39.816 -99.681  1.00 26.48  ? 302 ALA A HA   1 
ATOM   9551  H  HB1  . ALA B  1 302 ? -29.704 -39.555 -97.549  1.00 29.24  ? 302 ALA A HB1  1 
ATOM   9552  H  HB2  . ALA B  1 302 ? -28.590 -39.241 -98.637  1.00 29.24  ? 302 ALA A HB2  1 
ATOM   9553  H  HB3  . ALA B  1 302 ? -29.326 -38.049 -97.887  1.00 29.24  ? 302 ALA A HB3  1 
ATOM   9554  N  N    . LEU B  1 303 ? -32.691 -39.454 -98.427  1.00 15.35  ? 303 LEU A N    1 
ATOM   9555  C  CA   . LEU B  1 303 ? -33.877 -39.172 -97.632  1.00 15.60  ? 303 LEU A CA   1 
ATOM   9556  C  C    . LEU B  1 303 ? -33.486 -39.198 -96.164  1.00 17.09  ? 303 LEU A C    1 
ATOM   9557  O  O    . LEU B  1 303 ? -33.868 -38.334 -95.386  1.00 21.28  ? 303 LEU A O    1 
ATOM   9558  C  CB   . LEU B  1 303 ? -34.993 -40.178 -97.921  1.00 16.98  ? 303 LEU A CB   1 
ATOM   9559  C  CG   . LEU B  1 303 ? -36.297 -39.943 -97.154  1.00 16.55  ? 303 LEU A CG   1 
ATOM   9560  C  CD1  . LEU B  1 303 ? -36.939 -38.630 -97.537  1.00 24.00  ? 303 LEU A CD1  1 
ATOM   9561  C  CD2  . LEU B  1 303 ? -37.238 -41.086 -97.424  1.00 29.46  ? 303 LEU A CD2  1 
ATOM   9562  H  H    . LEU B  1 303 ? -32.617 -40.275 -98.672  1.00 18.42  ? 303 LEU A H    1 
ATOM   9563  H  HA   . LEU B  1 303 ? -34.203 -38.284 -97.846  1.00 18.73  ? 303 LEU A HA   1 
ATOM   9564  H  HB2  . LEU B  1 303 ? -35.201 -40.143 -98.868  1.00 20.38  ? 303 LEU A HB2  1 
ATOM   9565  H  HB3  . LEU B  1 303 ? -34.675 -41.065 -97.691  1.00 20.38  ? 303 LEU A HB3  1 
ATOM   9566  H  HG   . LEU B  1 303 ? -36.109 -39.922 -96.203  1.00 19.86  ? 303 LEU A HG   1 
ATOM   9567  H  HD11 . LEU B  1 303 ? -37.759 -38.520 -97.031  1.00 28.80  ? 303 LEU A HD11 1 
ATOM   9568  H  HD12 . LEU B  1 303 ? -36.325 -37.907 -97.334  1.00 28.80  ? 303 LEU A HD12 1 
ATOM   9569  H  HD13 . LEU B  1 303 ? -37.135 -38.640 -98.487  1.00 28.80  ? 303 LEU A HD13 1 
ATOM   9570  H  HD21 . LEU B  1 303 ? -38.064 -40.936 -96.938  1.00 35.35  ? 303 LEU A HD21 1 
ATOM   9571  H  HD22 . LEU B  1 303 ? -37.418 -41.128 -98.376  1.00 35.35  ? 303 LEU A HD22 1 
ATOM   9572  H  HD23 . LEU B  1 303 ? -36.825 -41.912 -97.128  1.00 35.35  ? 303 LEU A HD23 1 
ATOM   9573  N  N    . ASN B  1 304 ? -32.707 -40.206 -95.796  1.00 17.88  ? 304 ASN A N    1 
ATOM   9574  C  CA   . ASN B  1 304 ? -32.184 -40.320 -94.450  1.00 19.71  ? 304 ASN A CA   1 
ATOM   9575  C  C    . ASN B  1 304 ? -30.924 -41.184 -94.475  1.00 20.50  ? 304 ASN A C    1 
ATOM   9576  O  O    . ASN B  1 304 ? -30.436 -41.539 -95.547  1.00 20.90  ? 304 ASN A O    1 
ATOM   9577  C  CB   . ASN B  1 304 ? -33.241 -40.904 -93.515  1.00 28.17  ? 304 ASN A CB   1 
ATOM   9578  C  CG   . ASN B  1 304 ? -33.774 -42.223 -94.006  1.00 27.55  ? 304 ASN A CG   1 
ATOM   9579  O  OD1  . ASN B  1 304 ? -33.012 -43.162 -94.229  1.00 24.56  ? 304 ASN A OD1  1 
ATOM   9580  N  ND2  . ASN B  1 304 ? -35.090 -42.308 -94.182  1.00 27.04  ? 304 ASN A ND2  1 
ATOM   9581  H  H    . ASN B  1 304 ? -32.465 -40.845 -96.318  1.00 21.46  ? 304 ASN A H    1 
ATOM   9582  H  HA   . ASN B  1 304 ? -31.943 -39.439 -94.124  1.00 23.65  ? 304 ASN A HA   1 
ATOM   9583  H  HB2  . ASN B  1 304 ? -32.848 -41.045 -92.640  1.00 33.81  ? 304 ASN A HB2  1 
ATOM   9584  H  HB3  . ASN B  1 304 ? -33.985 -40.285 -93.450  1.00 33.81  ? 304 ASN A HB3  1 
ATOM   9585  H  HD21 . ASN B  1 304 ? -35.441 -43.042 -94.461  1.00 32.45  ? 304 ASN A HD21 1 
ATOM   9586  H  HD22 . ASN B  1 304 ? -35.591 -41.628 -94.016  1.00 32.45  ? 304 ASN A HD22 1 
ATOM   9587  N  N    . ASP B  1 305 ? -30.412 -41.546 -93.307  1.00 20.59  ? 305 ASP A N    1 
ATOM   9588  C  CA   . ASP B  1 305 ? -29.117 -42.230 -93.226  1.00 26.14  ? 305 ASP A CA   1 
ATOM   9589  C  C    . ASP B  1 305 ? -29.137 -43.657 -93.768  1.00 25.39  ? 305 ASP A C    1 
ATOM   9590  O  O    . ASP B  1 305 ? -28.078 -44.271 -93.955  1.00 26.03  ? 305 ASP A O    1 
ATOM   9591  C  CB   . ASP B  1 305 ? -28.625 -42.259 -91.773  1.00 30.87  ? 305 ASP A CB   1 
ATOM   9592  C  CG   . ASP B  1 305 ? -28.217 -40.888 -91.267  1.00 46.89  ? 305 ASP A CG   1 
ATOM   9593  O  OD1  . ASP B  1 305 ? -27.973 -39.985 -92.097  1.00 47.25  ? 305 ASP A OD1  1 
ATOM   9594  O  OD2  . ASP B  1 305 ? -28.134 -40.713 -90.036  1.00 49.86  ? 305 ASP A OD2  1 
ATOM   9595  H  H    . ASP B  1 305 ? -30.789 -41.411 -92.546  1.00 24.70  ? 305 ASP A H    1 
ATOM   9596  H  HA   . ASP B  1 305 ? -28.470 -41.728 -93.745  1.00 31.37  ? 305 ASP A HA   1 
ATOM   9597  H  HB2  . ASP B  1 305 ? -29.338 -42.589 -91.204  1.00 37.05  ? 305 ASP A HB2  1 
ATOM   9598  H  HB3  . ASP B  1 305 ? -27.853 -42.843 -91.712  1.00 37.05  ? 305 ASP A HB3  1 
ATOM   9599  N  N    . HIS B  1 306 ? -30.329 -44.190 -94.002  1.00 17.61  ? 306 HIS A N    1 
ATOM   9600  C  CA   . HIS B  1 306 ? -30.465 -45.557 -94.492  1.00 17.35  ? 306 HIS A CA   1 
ATOM   9601  C  C    . HIS B  1 306 ? -31.122 -45.679 -95.871  1.00 19.44  ? 306 HIS A C    1 
ATOM   9602  O  O    . HIS B  1 306 ? -31.343 -46.791 -96.342  1.00 22.82  ? 306 HIS A O    1 
ATOM   9603  C  CB   . HIS B  1 306 ? -31.282 -46.375 -93.502  1.00 18.43  ? 306 HIS A CB   1 
ATOM   9604  C  CG   . HIS B  1 306 ? -30.601 -46.616 -92.195  1.00 23.82  ? 306 HIS A CG   1 
ATOM   9605  N  ND1  . HIS B  1 306 ? -30.947 -45.941 -91.044  1.00 32.42  ? 306 HIS A ND1  1 
ATOM   9606  C  CD2  . HIS B  1 306 ? -29.631 -47.491 -91.841  1.00 31.00  ? 306 HIS A CD2  1 
ATOM   9607  C  CE1  . HIS B  1 306 ? -30.207 -46.378 -90.041  1.00 35.83  ? 306 HIS A CE1  1 
ATOM   9608  N  NE2  . HIS B  1 306 ? -29.399 -47.318 -90.498  1.00 27.86  ? 306 HIS A NE2  1 
ATOM   9609  H  H    . HIS B  1 306 ? -31.077 -43.782 -93.886  1.00 21.14  ? 306 HIS A H    1 
ATOM   9610  H  HA   . HIS B  1 306 ? -29.583 -45.955 -94.549  1.00 20.82  ? 306 HIS A HA   1 
ATOM   9611  H  HB2  . HIS B  1 306 ? -32.111 -45.907 -93.320  1.00 22.11  ? 306 HIS A HB2  1 
ATOM   9612  H  HB3  . HIS B  1 306 ? -31.474 -47.240 -93.898  1.00 22.11  ? 306 HIS A HB3  1 
ATOM   9613  H  HD2  . HIS B  1 306 ? -29.197 -48.092 -92.404  1.00 37.20  ? 306 HIS A HD2  1 
ATOM   9614  H  HE1  . HIS B  1 306 ? -30.244 -46.071 -89.164  1.00 42.99  ? 306 HIS A HE1  1 
ATOM   9615  N  N    . PHE B  1 307 ? -31.430 -44.560 -96.511  1.00 15.91  ? 307 PHE A N    1 
ATOM   9616  C  CA   . PHE B  1 307 ? -32.186 -44.581 -97.760  1.00 15.19  ? 307 PHE A CA   1 
ATOM   9617  C  C    . PHE B  1 307 ? -31.749 -43.446 -98.672  1.00 15.90  ? 307 PHE A C    1 
ATOM   9618  O  O    . PHE B  1 307 ? -32.011 -42.271 -98.394  1.00 14.58  ? 307 PHE A O    1 
ATOM   9619  C  CB   . PHE B  1 307 ? -33.681 -44.499 -97.456  1.00 15.78  ? 307 PHE A CB   1 
ATOM   9620  C  CG   . PHE B  1 307 ? -34.570 -44.924 -98.589  1.00 16.34  ? 307 PHE A CG   1 
ATOM   9621  C  CD1  . PHE B  1 307 ? -34.392 -46.146 -99.220  1.00 30.69  ? 307 PHE A CD1  1 
ATOM   9622  C  CD2  . PHE B  1 307 ? -35.612 -44.111 -99.003  1.00 23.79  ? 307 PHE A CD2  1 
ATOM   9623  C  CE1  . PHE B  1 307 ? -35.224 -46.536 -100.260 1.00 27.29  ? 307 PHE A CE1  1 
ATOM   9624  C  CE2  . PHE B  1 307 ? -36.451 -44.496 -100.043 1.00 23.98  ? 307 PHE A CE2  1 
ATOM   9625  C  CZ   . PHE B  1 307 ? -36.255 -45.706 -100.672 1.00 28.17  ? 307 PHE A CZ   1 
ATOM   9626  H  H    . PHE B  1 307 ? -31.214 -43.771 -96.244  1.00 19.10  ? 307 PHE A H    1 
ATOM   9627  H  HA   . PHE B  1 307 ? -32.017 -45.418 -98.219  1.00 18.22  ? 307 PHE A HA   1 
ATOM   9628  H  HB2  . PHE B  1 307 ? -33.875 -45.072 -96.699  1.00 18.93  ? 307 PHE A HB2  1 
ATOM   9629  H  HB3  . PHE B  1 307 ? -33.903 -43.581 -97.237  1.00 18.93  ? 307 PHE A HB3  1 
ATOM   9630  H  HD1  . PHE B  1 307 ? -33.699 -46.705 -98.951  1.00 36.83  ? 307 PHE A HD1  1 
ATOM   9631  H  HD2  . PHE B  1 307 ? -35.746 -43.291 -98.586  1.00 28.55  ? 307 PHE A HD2  1 
ATOM   9632  H  HE1  . PHE B  1 307 ? -35.090 -47.355 -100.680 1.00 32.75  ? 307 PHE A HE1  1 
ATOM   9633  H  HE2  . PHE B  1 307 ? -37.141 -43.936 -100.315 1.00 28.78  ? 307 PHE A HE2  1 
ATOM   9634  H  HZ   . PHE B  1 307 ? -36.816 -45.966 -101.367 1.00 33.80  ? 307 PHE A HZ   1 
ATOM   9635  N  N    . VAL B  1 308 ? -31.080 -43.817 -99.762  1.00 14.97  ? 308 VAL A N    1 
ATOM   9636  C  CA   . VAL B  1 308 ? -30.361 -42.867 -100.615 1.00 14.72  ? 308 VAL A CA   1 
ATOM   9637  C  C    . VAL B  1 308 ? -30.529 -43.180 -102.091 1.00 12.95  ? 308 VAL A C    1 
ATOM   9638  O  O    . VAL B  1 308 ? -30.818 -44.306 -102.447 1.00 16.57  ? 308 VAL A O    1 
ATOM   9639  C  CB   . VAL B  1 308 ? -28.844 -42.870 -100.289 1.00 19.79  ? 308 VAL A CB   1 
ATOM   9640  C  CG1  . VAL B  1 308 ? -28.623 -42.514 -98.854  1.00 29.28  ? 308 VAL A CG1  1 
ATOM   9641  C  CG2  . VAL B  1 308 ? -28.215 -44.234 -100.574 1.00 15.16  ? 308 VAL A CG2  1 
ATOM   9642  H  H    . VAL B  1 308 ? -31.027 -44.631 -100.036 1.00 17.97  ? 308 VAL A H    1 
ATOM   9643  H  HA   . VAL B  1 308 ? -30.703 -41.973 -100.454 1.00 17.67  ? 308 VAL A HA   1 
ATOM   9644  H  HB   . VAL B  1 308 ? -28.397 -42.208 -100.839 1.00 23.75  ? 308 VAL A HB   1 
ATOM   9645  H  HG11 . VAL B  1 308 ? -27.670 -42.521 -98.671  1.00 35.14  ? 308 VAL A HG11 1 
ATOM   9646  H  HG12 . VAL B  1 308 ? -28.985 -41.629 -98.690  1.00 35.14  ? 308 VAL A HG12 1 
ATOM   9647  H  HG13 . VAL B  1 308 ? -29.073 -43.166 -98.295  1.00 35.14  ? 308 VAL A HG13 1 
ATOM   9648  H  HG21 . VAL B  1 308 ? -27.270 -44.197 -100.359 1.00 18.19  ? 308 VAL A HG21 1 
ATOM   9649  H  HG22 . VAL B  1 308 ? -28.653 -44.904 -100.026 1.00 18.19  ? 308 VAL A HG22 1 
ATOM   9650  H  HG23 . VAL B  1 308 ? -28.333 -44.446 -101.513 1.00 18.19  ? 308 VAL A HG23 1 
ATOM   9651  N  N    . LYS B  1 309 ? -30.369 -42.156 -102.931 1.00 11.50  ? 309 LYS A N    1 
ATOM   9652  C  CA   . LYS B  1 309 ? -30.375 -42.286 -104.368 1.00 10.76  ? 309 LYS A CA   1 
ATOM   9653  C  C    . LYS B  1 309 ? -29.026 -41.806 -104.890 1.00 11.71  ? 309 LYS A C    1 
ATOM   9654  O  O    . LYS B  1 309 ? -28.629 -40.658 -104.662 1.00 12.70  ? 309 LYS A O    1 
ATOM   9655  C  CB   . LYS B  1 309 ? -31.514 -41.472 -104.989 1.00 14.09  ? 309 LYS A CB   1 
ATOM   9656  C  CG   . LYS B  1 309 ? -31.623 -41.593 -106.513 1.00 12.88  ? 309 LYS A CG   1 
ATOM   9657  C  CD   . LYS B  1 309 ? -32.705 -40.641 -107.082 1.00 19.77  ? 309 LYS A CD   1 
ATOM   9658  C  CE   . LYS B  1 309 ? -34.111 -41.099 -106.772 1.00 20.84  ? 309 LYS A CE   1 
ATOM   9659  N  NZ   . LYS B  1 309 ? -34.410 -42.447 -107.285 1.00 27.13  ? 309 LYS A NZ   1 
ATOM   9660  H  H    . LYS B  1 309 ? -30.250 -41.346 -102.668 1.00 13.80  ? 309 LYS A H    1 
ATOM   9661  H  HA   . LYS B  1 309 ? -30.490 -43.218 -104.612 1.00 12.91  ? 309 LYS A HA   1 
ATOM   9662  H  HB2  . LYS B  1 309 ? -32.354 -41.773 -104.609 1.00 16.91  ? 309 LYS A HB2  1 
ATOM   9663  H  HB3  . LYS B  1 309 ? -31.376 -40.535 -104.778 1.00 16.91  ? 309 LYS A HB3  1 
ATOM   9664  H  HG2  . LYS B  1 309 ? -30.772 -41.360 -106.915 1.00 15.46  ? 309 LYS A HG2  1 
ATOM   9665  H  HG3  . LYS B  1 309 ? -31.866 -42.503 -106.746 1.00 15.46  ? 309 LYS A HG3  1 
ATOM   9666  H  HD2  . LYS B  1 309 ? -32.585 -39.760 -106.695 1.00 23.73  ? 309 LYS A HD2  1 
ATOM   9667  H  HD3  . LYS B  1 309 ? -32.611 -40.596 -108.046 1.00 23.73  ? 309 LYS A HD3  1 
ATOM   9668  H  HE2  . LYS B  1 309 ? -34.232 -41.113 -105.810 1.00 25.01  ? 309 LYS A HE2  1 
ATOM   9669  H  HE3  . LYS B  1 309 ? -34.739 -40.481 -107.176 1.00 25.01  ? 309 LYS A HE3  1 
ATOM   9670  H  HZ1  . LYS B  1 309 ? -33.853 -43.040 -106.924 1.00 32.56  ? 309 LYS A HZ1  1 
ATOM   9671  H  HZ2  . LYS B  1 309 ? -35.246 -42.672 -107.079 1.00 32.56  ? 309 LYS A HZ2  1 
ATOM   9672  H  HZ3  . LYS B  1 309 ? -34.315 -42.463 -108.170 1.00 32.56  ? 309 LYS A HZ3  1 
ATOM   9673  N  N    . LEU B  1 310 ? -28.312 -42.700 -105.557 1.00 12.64  ? 310 LEU A N    1 
ATOM   9674  C  CA   . LEU B  1 310 ? -26.948 -42.421 -106.015 1.00 11.91  ? 310 LEU A CA   1 
ATOM   9675  C  C    . LEU B  1 310 ? -26.948 -42.458 -107.524 1.00 10.07  ? 310 LEU A C    1 
ATOM   9676  O  O    . LEU B  1 310 ? -27.632 -43.279 -108.140 1.00 12.61  ? 310 LEU A O    1 
ATOM   9677  C  CB   . LEU B  1 310 ? -25.956 -43.438 -105.442 1.00 12.84  ? 310 LEU A CB   1 
ATOM   9678  C  CG   . LEU B  1 310 ? -26.051 -43.633 -103.933 1.00 17.55  ? 310 LEU A CG   1 
ATOM   9679  C  CD1  . LEU B  1 310 ? -25.179 -44.793 -103.505 1.00 22.56  ? 310 LEU A CD1  1 
ATOM   9680  C  CD2  . LEU B  1 310 ? -25.648 -42.365 -103.218 1.00 18.20  ? 310 LEU A CD2  1 
ATOM   9681  H  H    . LEU B  1 310 ? -28.593 -43.486 -105.762 1.00 15.17  ? 310 LEU A H    1 
ATOM   9682  H  HA   . LEU B  1 310 ? -26.683 -41.534 -105.727 1.00 14.29  ? 310 LEU A HA   1 
ATOM   9683  H  HB2  . LEU B  1 310 ? -26.118 -44.298 -105.860 1.00 15.41  ? 310 LEU A HB2  1 
ATOM   9684  H  HB3  . LEU B  1 310 ? -25.055 -43.141 -105.645 1.00 15.41  ? 310 LEU A HB3  1 
ATOM   9685  H  HG   . LEU B  1 310 ? -26.968 -43.838 -103.694 1.00 21.06  ? 310 LEU A HG   1 
ATOM   9686  H  HD11 . LEU B  1 310 ? -25.250 -44.903 -102.544 1.00 27.07  ? 310 LEU A HD11 1 
ATOM   9687  H  HD12 . LEU B  1 310 ? -25.482 -45.598 -103.954 1.00 27.07  ? 310 LEU A HD12 1 
ATOM   9688  H  HD13 . LEU B  1 310 ? -24.259 -44.603 -103.749 1.00 27.07  ? 310 LEU A HD13 1 
ATOM   9689  H  HD21 . LEU B  1 310 ? -25.715 -42.508 -102.261 1.00 21.84  ? 310 LEU A HD21 1 
ATOM   9690  H  HD22 . LEU B  1 310 ? -24.735 -42.144 -103.457 1.00 21.84  ? 310 LEU A HD22 1 
ATOM   9691  H  HD23 . LEU B  1 310 ? -26.244 -41.648 -103.488 1.00 21.84  ? 310 LEU A HD23 1 
ATOM   9692  N  N    . ILE B  1 311 ? -26.194 -41.532 -108.091 1.00 8.74   ? 311 ILE A N    1 
ATOM   9693  C  CA   . ILE B  1 311 ? -26.178 -41.253 -109.508 1.00 11.32  ? 311 ILE A CA   1 
ATOM   9694  C  C    . ILE B  1 311 ? -24.785 -41.522 -110.060 1.00 14.15  ? 311 ILE A C    1 
ATOM   9695  O  O    . ILE B  1 311 ? -23.799 -41.029 -109.520 1.00 12.51  ? 311 ILE A O    1 
ATOM   9696  C  CB   . ILE B  1 311 ? -26.561 -39.781 -109.763 1.00 9.67   ? 311 ILE A CB   1 
ATOM   9697  C  CG1  . ILE B  1 311 ? -27.919 -39.453 -109.121 1.00 13.20  ? 311 ILE A CG1  1 
ATOM   9698  C  CG2  . ILE B  1 311 ? -26.581 -39.456 -111.250 1.00 10.04  ? 311 ILE A CG2  1 
ATOM   9699  C  CD1  . ILE B  1 311 ? -29.039 -40.398 -109.523 1.00 13.28  ? 311 ILE A CD1  1 
ATOM   9700  H  H    . ILE B  1 311 ? -25.656 -41.029 -107.648 1.00 10.48  ? 311 ILE A H    1 
ATOM   9701  H  HA   . ILE B  1 311 ? -26.813 -41.826 -109.964 1.00 13.58  ? 311 ILE A HA   1 
ATOM   9702  H  HB   . ILE B  1 311 ? -25.889 -39.221 -109.344 1.00 11.60  ? 311 ILE A HB   1 
ATOM   9703  H  HG12 . ILE B  1 311 ? -27.827 -39.498 -108.157 1.00 15.84  ? 311 ILE A HG12 1 
ATOM   9704  H  HG13 . ILE B  1 311 ? -28.180 -38.557 -109.385 1.00 15.84  ? 311 ILE A HG13 1 
ATOM   9705  H  HG21 . ILE B  1 311 ? -26.826 -38.524 -111.366 1.00 12.05  ? 311 ILE A HG21 1 
ATOM   9706  H  HG22 . ILE B  1 311 ? -25.699 -39.615 -111.620 1.00 12.05  ? 311 ILE A HG22 1 
ATOM   9707  H  HG23 . ILE B  1 311 ? -27.232 -40.026 -111.689 1.00 12.05  ? 311 ILE A HG23 1 
ATOM   9708  H  HD11 . ILE B  1 311 ? -29.857 -40.125 -109.079 1.00 15.93  ? 311 ILE A HD11 1 
ATOM   9709  H  HD12 . ILE B  1 311 ? -29.155 -40.358 -110.485 1.00 15.93  ? 311 ILE A HD12 1 
ATOM   9710  H  HD13 . ILE B  1 311 ? -28.802 -41.300 -109.256 1.00 15.93  ? 311 ILE A HD13 1 
ATOM   9711  N  N    . SER B  1 312 ? -24.693 -42.303 -111.124 1.00 12.04  ? 312 SER A N    1 
ATOM   9712  C  CA   . SER B  1 312 ? -23.407 -42.509 -111.752 1.00 8.72   ? 312 SER A CA   1 
ATOM   9713  C  C    . SER B  1 312 ? -23.516 -42.493 -113.276 1.00 10.14  ? 312 SER A C    1 
ATOM   9714  O  O    . SER B  1 312 ? -24.439 -43.067 -113.869 1.00 12.21  ? 312 SER A O    1 
ATOM   9715  C  CB   . SER B  1 312 ? -22.790 -43.815 -111.248 1.00 10.98  ? 312 SER A CB   1 
ATOM   9716  O  OG   . SER B  1 312 ? -21.490 -43.977 -111.764 1.00 16.13  ? 312 SER A OG   1 
ATOM   9717  H  H    . SER B  1 312 ? -25.348 -42.718 -111.495 1.00 14.44  ? 312 SER A H    1 
ATOM   9718  H  HA   . SER B  1 312 ? -22.816 -41.785 -111.492 1.00 10.47  ? 312 SER A HA   1 
ATOM   9719  H  HB2  . SER B  1 312 ? -22.746 -43.792 -110.279 1.00 13.18  ? 312 SER A HB2  1 
ATOM   9720  H  HB3  . SER B  1 312 ? -23.341 -44.559 -111.538 1.00 13.18  ? 312 SER A HB3  1 
ATOM   9721  H  HG   . SER B  1 312 ? -21.157 -44.695 -111.484 1.00 19.36  ? 312 SER A HG   1 
ATOM   9722  N  N    . TRP B  1 313 ? -22.566 -41.804 -113.901 1.00 6.99   ? 313 TRP A N    1 
ATOM   9723  C  CA   . TRP B  1 313 ? -22.554 -41.619 -115.341 1.00 6.76   ? 313 TRP A CA   1 
ATOM   9724  C  C    . TRP B  1 313 ? -21.679 -42.645 -116.028 1.00 9.58   ? 313 TRP A C    1 
ATOM   9725  O  O    . TRP B  1 313 ? -20.668 -43.065 -115.451 1.00 9.67   ? 313 TRP A O    1 
ATOM   9726  C  CB   . TRP B  1 313 ? -22.019 -40.226 -115.695 1.00 9.65   ? 313 TRP A CB   1 
ATOM   9727  C  CG   . TRP B  1 313 ? -22.840 -39.136 -115.207 1.00 10.06  ? 313 TRP A CG   1 
ATOM   9728  C  CD1  . TRP B  1 313 ? -22.709 -38.485 -114.024 1.00 14.96  ? 313 TRP A CD1  1 
ATOM   9729  C  CD2  . TRP B  1 313 ? -23.944 -38.537 -115.883 1.00 7.91   ? 313 TRP A CD2  1 
ATOM   9730  N  NE1  . TRP B  1 313 ? -23.676 -37.513 -113.915 1.00 11.09  ? 313 TRP A NE1  1 
ATOM   9731  C  CE2  . TRP B  1 313 ? -24.449 -37.534 -115.046 1.00 12.06  ? 313 TRP A CE2  1 
ATOM   9732  C  CE3  . TRP B  1 313 ? -24.562 -38.760 -117.118 1.00 12.71  ? 313 TRP A CE3  1 
ATOM   9733  C  CZ2  . TRP B  1 313 ? -25.530 -36.740 -115.407 1.00 14.34  ? 313 TRP A CZ2  1 
ATOM   9734  C  CZ3  . TRP B  1 313 ? -25.639 -37.987 -117.462 1.00 10.02  ? 313 TRP A CZ3  1 
ATOM   9735  C  CH2  . TRP B  1 313 ? -26.112 -36.985 -116.617 1.00 12.93  ? 313 TRP A CH2  1 
ATOM   9736  H  H    . TRP B  1 313 ? -21.905 -41.427 -113.500 1.00 8.39   ? 313 TRP A H    1 
ATOM   9737  H  HA   . TRP B  1 313 ? -23.456 -41.701 -115.688 1.00 8.12   ? 313 TRP A HA   1 
ATOM   9738  H  HB2  . TRP B  1 313 ? -21.134 -40.126 -115.310 1.00 11.57  ? 313 TRP A HB2  1 
ATOM   9739  H  HB3  . TRP B  1 313 ? -21.967 -40.149 -116.661 1.00 11.57  ? 313 TRP A HB3  1 
ATOM   9740  H  HD1  . TRP B  1 313 ? -22.065 -38.672 -113.379 1.00 17.95  ? 313 TRP A HD1  1 
ATOM   9741  H  HE1  . TRP B  1 313 ? -23.779 -36.980 -113.248 1.00 13.30  ? 313 TRP A HE1  1 
ATOM   9742  H  HE3  . TRP B  1 313 ? -24.254 -39.426 -117.689 1.00 15.25  ? 313 TRP A HE3  1 
ATOM   9743  H  HZ2  . TRP B  1 313 ? -25.852 -36.076 -114.841 1.00 17.21  ? 313 TRP A HZ2  1 
ATOM   9744  H  HZ3  . TRP B  1 313 ? -26.055 -38.125 -118.282 1.00 12.03  ? 313 TRP A HZ3  1 
ATOM   9745  H  HH2  . TRP B  1 313 ? -26.843 -36.475 -116.881 1.00 15.52  ? 313 TRP A HH2  1 
ATOM   9746  N  N    . TYR B  1 314 ? -22.027 -42.999 -117.262 1.00 8.32   ? 314 TYR A N    1 
ATOM   9747  C  CA   . TYR B  1 314 ? -21.184 -43.864 -118.070 1.00 10.63  ? 314 TYR A CA   1 
ATOM   9748  C  C    . TYR B  1 314 ? -21.330 -43.634 -119.564 1.00 8.83   ? 314 TYR A C    1 
ATOM   9749  O  O    . TYR B  1 314 ? -22.442 -43.525 -120.128 1.00 8.28   ? 314 TYR A O    1 
ATOM   9750  C  CB   . TYR B  1 314 ? -21.434 -45.357 -117.747 1.00 8.35   ? 314 TYR A CB   1 
ATOM   9751  C  CG   . TYR B  1 314 ? -22.822 -45.933 -117.949 1.00 10.46  ? 314 TYR A CG   1 
ATOM   9752  C  CD1  . TYR B  1 314 ? -23.895 -45.532 -117.160 1.00 13.59  ? 314 TYR A CD1  1 
ATOM   9753  C  CD2  . TYR B  1 314 ? -23.041 -46.930 -118.884 1.00 14.84  ? 314 TYR A CD2  1 
ATOM   9754  C  CE1  . TYR B  1 314 ? -25.159 -46.075 -117.327 1.00 10.96  ? 314 TYR A CE1  1 
ATOM   9755  C  CE2  . TYR B  1 314 ? -24.305 -47.496 -119.056 1.00 13.43  ? 314 TYR A CE2  1 
ATOM   9756  C  CZ   . TYR B  1 314 ? -25.348 -47.075 -118.268 1.00 13.63  ? 314 TYR A CZ   1 
ATOM   9757  O  OH   . TYR B  1 314 ? -26.588 -47.645 -118.439 1.00 15.09  ? 314 TYR A OH   1 
ATOM   9758  H  H    . TYR B  1 314 ? -22.750 -42.749 -117.654 1.00 9.98   ? 314 TYR A H    1 
ATOM   9759  H  HA   . TYR B  1 314 ? -20.260 -43.676 -117.844 1.00 12.76  ? 314 TYR A HA   1 
ATOM   9760  H  HB2  . TYR B  1 314 ? -20.832 -45.882 -118.298 1.00 10.02  ? 314 TYR A HB2  1 
ATOM   9761  H  HB3  . TYR B  1 314 ? -21.207 -45.498 -116.815 1.00 10.02  ? 314 TYR A HB3  1 
ATOM   9762  H  HD1  . TYR B  1 314 ? -23.766 -44.869 -116.521 1.00 16.30  ? 314 TYR A HD1  1 
ATOM   9763  H  HD2  . TYR B  1 314 ? -22.333 -47.224 -119.411 1.00 17.81  ? 314 TYR A HD2  1 
ATOM   9764  H  HE1  . TYR B  1 314 ? -25.865 -45.795 -116.791 1.00 13.15  ? 314 TYR A HE1  1 
ATOM   9765  H  HE2  . TYR B  1 314 ? -24.438 -48.163 -119.691 1.00 16.12  ? 314 TYR A HE2  1 
ATOM   9766  H  HH   . TYR B  1 314 ? -27.140 -47.295 -117.910 1.00 18.11  ? 314 TYR A HH   1 
ATOM   9767  N  N    . ASP B  1 315 ? -20.178 -43.531 -120.215 1.00 7.31   ? 315 ASP A N    1 
ATOM   9768  C  CA   . ASP B  1 315 ? -20.156 -43.570 -121.661 1.00 8.97   ? 315 ASP A CA   1 
ATOM   9769  C  C    . ASP B  1 315 ? -20.344 -45.045 -122.033 1.00 9.19   ? 315 ASP A C    1 
ATOM   9770  O  O    . ASP B  1 315 ? -19.420 -45.859 -121.908 1.00 9.82   ? 315 ASP A O    1 
ATOM   9771  C  CB   . ASP B  1 315 ? -18.857 -42.986 -122.215 1.00 8.39   ? 315 ASP A CB   1 
ATOM   9772  C  CG   . ASP B  1 315 ? -18.812 -43.027 -123.736 1.00 7.56   ? 315 ASP A CG   1 
ATOM   9773  O  OD1  . ASP B  1 315 ? -19.345 -43.982 -124.321 1.00 12.17  ? 315 ASP A OD1  1 
ATOM   9774  O  OD2  . ASP B  1 315 ? -18.257 -42.099 -124.348 1.00 14.94  ? 315 ASP A OD2  1 
ATOM   9775  H  H    . ASP B  1 315 ? -19.407 -43.439 -119.844 1.00 8.77   ? 315 ASP A H    1 
ATOM   9776  H  HA   . ASP B  1 315 ? -20.902 -43.061 -122.015 1.00 10.76  ? 315 ASP A HA   1 
ATOM   9777  H  HB2  . ASP B  1 315 ? -18.780 -42.060 -121.936 1.00 10.06  ? 315 ASP A HB2  1 
ATOM   9778  H  HB3  . ASP B  1 315 ? -18.107 -43.500 -121.876 1.00 10.06  ? 315 ASP A HB3  1 
ATOM   9779  N  N    . ASN B  1 316 ? -21.542 -45.380 -122.498 1.00 8.18   ? 316 ASN A N    1 
ATOM   9780  C  CA   . ASN B  1 316 ? -21.920 -46.777 -122.665 1.00 10.13  ? 316 ASN A CA   1 
ATOM   9781  C  C    . ASN B  1 316 ? -21.138 -47.467 -123.789 1.00 11.18  ? 316 ASN A C    1 
ATOM   9782  O  O    . ASN B  1 316 ? -21.013 -48.690 -123.799 1.00 15.31  ? 316 ASN A O    1 
ATOM   9783  C  CB   . ASN B  1 316 ? -23.441 -46.903 -122.913 1.00 12.75  ? 316 ASN A CB   1 
ATOM   9784  C  CG   . ASN B  1 316 ? -23.986 -45.823 -123.828 1.00 13.26  ? 316 ASN A CG   1 
ATOM   9785  O  OD1  . ASN B  1 316 ? -24.250 -44.699 -123.396 1.00 9.19   ? 316 ASN A OD1  1 
ATOM   9786  N  ND2  . ASN B  1 316 ? -24.187 -46.165 -125.093 1.00 11.83  ? 316 ASN A ND2  1 
ATOM   9787  H  H    . ASN B  1 316 ? -22.153 -44.819 -122.723 1.00 9.82   ? 316 ASN A H    1 
ATOM   9788  H  HA   . ASN B  1 316 ? -21.720 -47.248 -121.841 1.00 12.16  ? 316 ASN A HA   1 
ATOM   9789  H  HB2  . ASN B  1 316 ? -23.622 -47.763 -123.324 1.00 15.31  ? 316 ASN A HB2  1 
ATOM   9790  H  HB3  . ASN B  1 316 ? -23.905 -46.838 -122.063 1.00 15.31  ? 316 ASN A HB3  1 
ATOM   9791  H  HD21 . ASN B  1 316 ? -24.010 -46.965 -125.355 1.00 14.20  ? 316 ASN A HD21 1 
ATOM   9792  H  HD22 . ASN B  1 316 ? -24.495 -45.588 -125.651 1.00 14.20  ? 316 ASN A HD22 1 
ATOM   9793  N  N    . GLU B  1 317 ? -20.627 -46.686 -124.731 1.00 10.08  ? 317 GLU A N    1 
ATOM   9794  C  CA   . GLU B  1 317 ? -19.807 -47.219 -125.816 1.00 12.80  ? 317 GLU A CA   1 
ATOM   9795  C  C    . GLU B  1 317 ? -18.331 -47.348 -125.394 1.00 13.98  ? 317 GLU A C    1 
ATOM   9796  O  O    . GLU B  1 317 ? -17.707 -48.409 -125.490 1.00 12.85  ? 317 GLU A O    1 
ATOM   9797  C  CB   . GLU B  1 317 ? -19.904 -46.312 -127.045 1.00 17.34  ? 317 GLU A CB   1 
ATOM   9798  C  CG   . GLU B  1 317 ? -21.265 -46.336 -127.723 1.00 15.46  ? 317 GLU A CG   1 
ATOM   9799  C  CD   . GLU B  1 317 ? -21.336 -45.470 -128.980 1.00 16.28  ? 317 GLU A CD   1 
ATOM   9800  O  OE1  . GLU B  1 317 ? -20.447 -44.597 -129.178 1.00 13.84  ? 317 GLU A OE1  1 
ATOM   9801  O  OE2  . GLU B  1 317 ? -22.300 -45.652 -129.759 1.00 14.56  ? 317 GLU A OE2  1 
ATOM   9802  H  H    . GLU B  1 317 ? -20.742 -45.835 -124.767 1.00 12.09  ? 317 GLU A H    1 
ATOM   9803  H  HA   . GLU B  1 317 ? -20.132 -48.100 -126.061 1.00 15.36  ? 317 GLU A HA   1 
ATOM   9804  H  HB2  . GLU B  1 317 ? -19.725 -45.398 -126.774 1.00 20.81  ? 317 GLU A HB2  1 
ATOM   9805  H  HB3  . GLU B  1 317 ? -19.244 -46.596 -127.696 1.00 20.81  ? 317 GLU A HB3  1 
ATOM   9806  H  HG2  . GLU B  1 317 ? -21.472 -47.248 -127.979 1.00 18.56  ? 317 GLU A HG2  1 
ATOM   9807  H  HG3  . GLU B  1 317 ? -21.932 -46.009 -127.099 1.00 18.56  ? 317 GLU A HG3  1 
ATOM   9808  N  N    . PHE B  1 318 ? -17.792 -46.246 -124.910 1.00 8.61   ? 318 PHE A N    1 
ATOM   9809  C  CA   . PHE B  1 318 ? -16.354 -46.087 -124.727 1.00 10.37  ? 318 PHE A CA   1 
ATOM   9810  C  C    . PHE B  1 318 ? -15.809 -46.716 -123.446 1.00 15.21  ? 318 PHE A C    1 
ATOM   9811  O  O    . PHE B  1 318 ? -14.721 -47.293 -123.444 1.00 14.13  ? 318 PHE A O    1 
ATOM   9812  C  CB   . PHE B  1 318 ? -16.045 -44.603 -124.733 1.00 10.17  ? 318 PHE A CB   1 
ATOM   9813  C  CG   . PHE B  1 318 ? -14.837 -44.229 -125.508 1.00 17.11  ? 318 PHE A CG   1 
ATOM   9814  C  CD1  . PHE B  1 318 ? -14.802 -44.365 -126.880 1.00 30.93  ? 318 PHE A CD1  1 
ATOM   9815  C  CD2  . PHE B  1 318 ? -13.748 -43.668 -124.860 1.00 27.11  ? 318 PHE A CD2  1 
ATOM   9816  C  CE1  . PHE B  1 318 ? -13.680 -43.990 -127.588 1.00 59.76  ? 318 PHE A CE1  1 
ATOM   9817  C  CE2  . PHE B  1 318 ? -12.637 -43.295 -125.558 1.00 32.15  ? 318 PHE A CE2  1 
ATOM   9818  C  CZ   . PHE B  1 318 ? -12.601 -43.453 -126.924 1.00 36.30  ? 318 PHE A CZ   1 
ATOM   9819  H  H    . PHE B  1 318 ? -18.247 -45.555 -124.673 1.00 10.33  ? 318 PHE A H    1 
ATOM   9820  H  HA   . PHE B  1 318 ? -15.894 -46.492 -125.478 1.00 12.44  ? 318 PHE A HA   1 
ATOM   9821  H  HB2  . PHE B  1 318 ? -16.800 -44.131 -125.118 1.00 12.20  ? 318 PHE A HB2  1 
ATOM   9822  H  HB3  . PHE B  1 318 ? -15.909 -44.311 -123.818 1.00 12.20  ? 318 PHE A HB3  1 
ATOM   9823  H  HD1  . PHE B  1 318 ? -15.530 -44.730 -127.328 1.00 37.12  ? 318 PHE A HD1  1 
ATOM   9824  H  HD2  . PHE B  1 318 ? -13.767 -43.562 -123.936 1.00 32.53  ? 318 PHE A HD2  1 
ATOM   9825  H  HE1  . PHE B  1 318 ? -13.654 -44.095 -128.512 1.00 71.71  ? 318 PHE A HE1  1 
ATOM   9826  H  HE2  . PHE B  1 318 ? -11.906 -42.933 -125.111 1.00 38.58  ? 318 PHE A HE2  1 
ATOM   9827  H  HZ   . PHE B  1 318 ? -11.843 -43.199 -127.400 1.00 43.56  ? 318 PHE A HZ   1 
ATOM   9828  N  N    . GLY B  1 319 ? -16.544 -46.579 -122.348 1.00 10.10  ? 319 GLY A N    1 
ATOM   9829  C  CA   . GLY B  1 319 ? -16.162 -47.222 -121.101 1.00 7.44   ? 319 GLY A CA   1 
ATOM   9830  C  C    . GLY B  1 319 ? -16.077 -48.731 -121.282 1.00 10.03  ? 319 GLY A C    1 
ATOM   9831  O  O    . GLY B  1 319 ? -15.035 -49.370 -121.013 1.00 10.02  ? 319 GLY A O    1 
ATOM   9832  H  H    . GLY B  1 319 ? -17.269 -46.119 -122.301 1.00 12.12  ? 319 GLY A H    1 
ATOM   9833  H  HA2  . GLY B  1 319 ? -15.297 -46.892 -120.812 1.00 8.93   ? 319 GLY A HA2  1 
ATOM   9834  H  HA3  . GLY B  1 319 ? -16.818 -47.025 -120.414 1.00 8.93   ? 319 GLY A HA3  1 
ATOM   9835  N  N    . TYR B  1 320 ? -17.174 -49.294 -121.762 1.00 9.33   ? 320 TYR A N    1 
ATOM   9836  C  CA   . TYR B  1 320 ? -17.308 -50.725 -121.947 1.00 9.28   ? 320 TYR A CA   1 
ATOM   9837  C  C    . TYR B  1 320 ? -16.270 -51.293 -122.920 1.00 8.24   ? 320 TYR A C    1 
ATOM   9838  O  O    . TYR B  1 320 ? -15.672 -52.342 -122.642 1.00 7.17   ? 320 TYR A O    1 
ATOM   9839  C  CB   . TYR B  1 320 ? -18.729 -51.047 -122.433 1.00 10.78  ? 320 TYR A CB   1 
ATOM   9840  C  CG   . TYR B  1 320 ? -19.007 -52.525 -122.499 1.00 8.84   ? 320 TYR A CG   1 
ATOM   9841  C  CD1  . TYR B  1 320 ? -19.388 -53.231 -121.362 1.00 10.11  ? 320 TYR A CD1  1 
ATOM   9842  C  CD2  . TYR B  1 320 ? -18.893 -53.227 -123.699 1.00 7.17   ? 320 TYR A CD2  1 
ATOM   9843  C  CE1  . TYR B  1 320 ? -19.651 -54.584 -121.411 1.00 12.37  ? 320 TYR A CE1  1 
ATOM   9844  C  CE2  . TYR B  1 320 ? -19.136 -54.599 -123.748 1.00 17.56  ? 320 TYR A CE2  1 
ATOM   9845  C  CZ   . TYR B  1 320 ? -19.514 -55.268 -122.608 1.00 15.79  ? 320 TYR A CZ   1 
ATOM   9846  O  OH   . TYR B  1 320 ? -19.764 -56.624 -122.649 1.00 12.86  ? 320 TYR A OH   1 
ATOM   9847  H  H    . TYR B  1 320 ? -17.875 -48.852 -121.995 1.00 11.19  ? 320 TYR A H    1 
ATOM   9848  H  HA   . TYR B  1 320 ? -17.181 -51.163 -121.091 1.00 11.13  ? 320 TYR A HA   1 
ATOM   9849  H  HB2  . TYR B  1 320 ? -19.369 -50.650 -121.821 1.00 12.94  ? 320 TYR A HB2  1 
ATOM   9850  H  HB3  . TYR B  1 320 ? -18.849 -50.680 -123.322 1.00 12.94  ? 320 TYR A HB3  1 
ATOM   9851  H  HD1  . TYR B  1 320 ? -19.477 -52.779 -120.554 1.00 12.13  ? 320 TYR A HD1  1 
ATOM   9852  H  HD2  . TYR B  1 320 ? -18.631 -52.779 -124.470 1.00 8.60   ? 320 TYR A HD2  1 
ATOM   9853  H  HE1  . TYR B  1 320 ? -19.898 -55.039 -120.639 1.00 14.84  ? 320 TYR A HE1  1 
ATOM   9854  H  HE2  . TYR B  1 320 ? -19.055 -55.058 -124.552 1.00 21.07  ? 320 TYR A HE2  1 
ATOM   9855  H  HH   . TYR B  1 320 ? -19.986 -56.899 -121.887 1.00 15.44  ? 320 TYR A HH   1 
ATOM   9856  N  N    . SER B  1 321 ? -16.030 -50.601 -124.036 1.00 8.70   ? 321 SER A N    1 
ATOM   9857  C  CA   . SER B  1 321 ? -15.021 -51.053 -125.029 1.00 8.20   ? 321 SER A CA   1 
ATOM   9858  C  C    . SER B  1 321 ? -13.639 -51.151 -124.429 1.00 9.74   ? 321 SER A C    1 
ATOM   9859  O  O    . SER B  1 321 ? -12.877 -52.085 -124.717 1.00 8.37   ? 321 SER A O    1 
ATOM   9860  C  CB   . SER B  1 321 ? -14.986 -50.103 -126.226 1.00 14.21  ? 321 SER A CB   1 
ATOM   9861  O  OG   . SER B  1 321 ? -16.183 -50.230 -126.969 1.00 19.48  ? 321 SER A OG   1 
ATOM   9862  H  H    . SER B  1 321 ? -16.430 -49.871 -124.250 1.00 10.45  ? 321 SER A H    1 
ATOM   9863  H  HA   . SER B  1 321 ? -15.270 -51.933 -125.352 1.00 9.84   ? 321 SER A HA   1 
ATOM   9864  H  HB2  . SER B  1 321 ? -14.903 -49.191 -125.908 1.00 17.05  ? 321 SER A HB2  1 
ATOM   9865  H  HB3  . SER B  1 321 ? -14.233 -50.332 -126.793 1.00 17.05  ? 321 SER A HB3  1 
ATOM   9866  H  HG   . SER B  1 321 ? -16.843 -50.039 -126.485 1.00 23.38  ? 321 SER A HG   1 
ATOM   9867  N  N    . ASN B  1 322 ? -13.299 -50.172 -123.593 1.00 7.34   ? 322 ASN A N    1 
ATOM   9868  C  CA   . ASN B  1 322 ? -12.047 -50.224 -122.869 1.00 12.88  ? 322 ASN A CA   1 
ATOM   9869  C  C    . ASN B  1 322 ? -11.993 -51.348 -121.850 1.00 8.16   ? 322 ASN A C    1 
ATOM   9870  O  O    . ASN B  1 322 ? -10.933 -51.949 -121.656 1.00 7.68   ? 322 ASN A O    1 
ATOM   9871  C  CB   . ASN B  1 322 ? -11.771 -48.888 -122.186 1.00 12.48  ? 322 ASN A CB   1 
ATOM   9872  C  CG   . ASN B  1 322 ? -11.048 -47.926 -123.100 1.00 15.28  ? 322 ASN A CG   1 
ATOM   9873  O  OD1  . ASN B  1 322 ? -9.822  -47.966 -123.217 1.00 15.05  ? 322 ASN A OD1  1 
ATOM   9874  N  ND2  . ASN B  1 322 ? -11.809 -47.083 -123.784 1.00 12.27  ? 322 ASN A ND2  1 
ATOM   9875  H  H    . ASN B  1 322 ? -13.776 -49.475 -123.432 1.00 8.81   ? 322 ASN A H    1 
ATOM   9876  H  HA   . ASN B  1 322 ? -11.332 -50.377 -123.507 1.00 15.46  ? 322 ASN A HA   1 
ATOM   9877  H  HB2  . ASN B  1 322 ? -12.614 -48.484 -121.926 1.00 14.97  ? 322 ASN A HB2  1 
ATOM   9878  H  HB3  . ASN B  1 322 ? -11.217 -49.039 -121.404 1.00 14.97  ? 322 ASN A HB3  1 
ATOM   9879  H  HD21 . ASN B  1 322 ? -11.448 -46.515 -124.318 1.00 14.73  ? 322 ASN A HD21 1 
ATOM   9880  H  HD22 . ASN B  1 322 ? -12.664 -47.105 -123.693 1.00 14.73  ? 322 ASN A HD22 1 
ATOM   9881  N  N    . ARG B  1 323 ? -13.112 -51.653 -121.207 1.00 7.69   ? 323 ARG A N    1 
ATOM   9882  C  CA   . ARG B  1 323 ? -13.132 -52.794 -120.282 1.00 11.05  ? 323 ARG A CA   1 
ATOM   9883  C  C    . ARG B  1 323 ? -12.962 -54.151 -120.988 1.00 10.71  ? 323 ARG A C    1 
ATOM   9884  O  O    . ARG B  1 323 ? -12.360 -55.048 -120.426 1.00 9.82   ? 323 ARG A O    1 
ATOM   9885  C  CB   . ARG B  1 323 ? -14.426 -52.825 -119.456 1.00 13.16  ? 323 ARG A CB   1 
ATOM   9886  C  CG   . ARG B  1 323 ? -14.590 -51.708 -118.418 1.00 9.11   ? 323 ARG A CG   1 
ATOM   9887  C  CD   . ARG B  1 323 ? -13.410 -51.589 -117.455 1.00 8.62   ? 323 ARG A CD   1 
ATOM   9888  N  NE   . ARG B  1 323 ? -12.366 -50.721 -117.966 1.00 11.09  ? 323 ARG A NE   1 
ATOM   9889  C  CZ   . ARG B  1 323 ? -12.448 -49.400 -118.030 1.00 11.74  ? 323 ARG A CZ   1 
ATOM   9890  N  NH1  . ARG B  1 323 ? -13.543 -48.763 -117.611 1.00 10.69  ? 323 ARG A NH1  1 
ATOM   9891  N  NH2  . ARG B  1 323 ? -11.439 -48.716 -118.536 1.00 12.36  ? 323 ARG A NH2  1 
ATOM   9892  H  H    . ARG B  1 323 ? -13.858 -51.233 -121.282 1.00 9.22   ? 323 ARG A H    1 
ATOM   9893  H  HA   . ARG B  1 323 ? -12.393 -52.696 -119.661 1.00 13.26  ? 323 ARG A HA   1 
ATOM   9894  H  HB2  . ARG B  1 323 ? -15.178 -52.765 -120.065 1.00 15.79  ? 323 ARG A HB2  1 
ATOM   9895  H  HB3  . ARG B  1 323 ? -14.464 -53.670 -118.980 1.00 15.79  ? 323 ARG A HB3  1 
ATOM   9896  H  HG2  . ARG B  1 323 ? -14.681 -50.861 -118.881 1.00 10.94  ? 323 ARG A HG2  1 
ATOM   9897  H  HG3  . ARG B  1 323 ? -15.386 -51.884 -117.892 1.00 10.94  ? 323 ARG A HG3  1 
ATOM   9898  H  HD2  . ARG B  1 323 ? -13.723 -51.221 -116.614 1.00 10.34  ? 323 ARG A HD2  1 
ATOM   9899  H  HD3  . ARG B  1 323 ? -13.027 -52.469 -117.311 1.00 10.34  ? 323 ARG A HD3  1 
ATOM   9900  H  HE   . ARG B  1 323 ? -11.642 -51.090 -118.248 1.00 13.30  ? 323 ARG A HE   1 
ATOM   9901  H  HH11 . ARG B  1 323 ? -14.203 -49.210 -117.288 1.00 12.82  ? 323 ARG A HH11 1 
ATOM   9902  H  HH12 . ARG B  1 323 ? -13.586 -47.906 -117.658 1.00 12.82  ? 323 ARG A HH12 1 
ATOM   9903  H  HH21 . ARG B  1 323 ? -10.733 -49.128 -118.805 1.00 14.83  ? 323 ARG A HH21 1 
ATOM   9904  H  HH22 . ARG B  1 323 ? -11.480 -47.858 -118.578 1.00 14.83  ? 323 ARG A HH22 1 
ATOM   9905  N  N    . VAL B  1 324 ? -13.505 -54.314 -122.197 1.00 8.92   ? 324 VAL A N    1 
ATOM   9906  C  CA   . VAL B  1 324 ? -13.271 -55.526 -122.970 1.00 7.80   ? 324 VAL A CA   1 
ATOM   9907  C  C    . VAL B  1 324 ? -11.767 -55.733 -123.195 1.00 9.40   ? 324 VAL A C    1 
ATOM   9908  O  O    . VAL B  1 324 ? -11.238 -56.811 -122.964 1.00 8.68   ? 324 VAL A O    1 
ATOM   9909  C  CB   . VAL B  1 324 ? -13.986 -55.470 -124.334 1.00 8.83   ? 324 VAL A CB   1 
ATOM   9910  C  CG1  . VAL B  1 324 ? -13.603 -56.675 -125.199 1.00 13.44  ? 324 VAL A CG1  1 
ATOM   9911  C  CG2  . VAL B  1 324 ? -15.507 -55.411 -124.159 1.00 12.91  ? 324 VAL A CG2  1 
ATOM   9912  H  H    . VAL B  1 324 ? -14.010 -53.738 -122.587 1.00 10.71  ? 324 VAL A H    1 
ATOM   9913  H  HA   . VAL B  1 324 ? -13.613 -56.290 -122.479 1.00 9.36   ? 324 VAL A HA   1 
ATOM   9914  H  HB   . VAL B  1 324 ? -13.708 -54.667 -124.802 1.00 10.60  ? 324 VAL A HB   1 
ATOM   9915  H  HG11 . VAL B  1 324 ? -14.067 -56.613 -126.048 1.00 16.13  ? 324 VAL A HG11 1 
ATOM   9916  H  HG12 . VAL B  1 324 ? -12.644 -56.667 -125.343 1.00 16.13  ? 324 VAL A HG12 1 
ATOM   9917  H  HG13 . VAL B  1 324 ? -13.862 -57.488 -124.738 1.00 16.13  ? 324 VAL A HG13 1 
ATOM   9918  H  HG21 . VAL B  1 324 ? -15.924 -55.376 -125.034 1.00 15.49  ? 324 VAL A HG21 1 
ATOM   9919  H  HG22 . VAL B  1 324 ? -15.801 -56.203 -123.683 1.00 15.49  ? 324 VAL A HG22 1 
ATOM   9920  H  HG23 . VAL B  1 324 ? -15.735 -54.616 -123.652 1.00 15.49  ? 324 VAL A HG23 1 
ATOM   9921  N  N    . VAL B  1 325 ? -11.085 -54.694 -123.663 1.00 8.07   ? 325 VAL A N    1 
ATOM   9922  C  CA   . VAL B  1 325 ? -9.642  -54.756 -123.835 1.00 8.37   ? 325 VAL A CA   1 
ATOM   9923  C  C    . VAL B  1 325 ? -8.914  -55.056 -122.508 1.00 8.41   ? 325 VAL A C    1 
ATOM   9924  O  O    . VAL B  1 325 ? -8.020  -55.895 -122.471 1.00 8.70   ? 325 VAL A O    1 
ATOM   9925  C  CB   . VAL B  1 325 ? -9.113  -53.435 -124.464 1.00 8.46   ? 325 VAL A CB   1 
ATOM   9926  C  CG1  . VAL B  1 325 ? -7.611  -53.369 -124.390 1.00 9.81   ? 325 VAL A CG1  1 
ATOM   9927  C  CG2  . VAL B  1 325 ? -9.594  -53.301 -125.925 1.00 9.20   ? 325 VAL A CG2  1 
ATOM   9928  H  H    . VAL B  1 325 ? -11.436 -53.941 -123.887 1.00 9.68   ? 325 VAL A H    1 
ATOM   9929  H  HA   . VAL B  1 325 ? -9.436  -55.477 -124.451 1.00 10.04  ? 325 VAL A HA   1 
ATOM   9930  H  HB   . VAL B  1 325 ? -9.469  -52.684 -123.963 1.00 10.15  ? 325 VAL A HB   1 
ATOM   9931  H  HG11 . VAL B  1 325 ? -7.312  -52.537 -124.789 1.00 11.78  ? 325 VAL A HG11 1 
ATOM   9932  H  HG12 . VAL B  1 325 ? -7.339  -53.407 -123.460 1.00 11.78  ? 325 VAL A HG12 1 
ATOM   9933  H  HG13 . VAL B  1 325 ? -7.238  -54.121 -124.876 1.00 11.78  ? 325 VAL A HG13 1 
ATOM   9934  H  HG21 . VAL B  1 325 ? -9.253  -52.472 -126.295 1.00 11.03  ? 325 VAL A HG21 1 
ATOM   9935  H  HG22 . VAL B  1 325 ? -9.260  -54.055 -126.437 1.00 11.03  ? 325 VAL A HG22 1 
ATOM   9936  H  HG23 . VAL B  1 325 ? -10.564 -53.296 -125.939 1.00 11.03  ? 325 VAL A HG23 1 
ATOM   9937  N  N    . ASP B  1 326 ? -9.284  -54.370 -121.430 1.00 10.74  ? 326 ASP A N    1 
ATOM   9938  C  CA   . ASP B  1 326 ? -8.692  -54.618 -120.107 1.00 13.93  ? 326 ASP A CA   1 
ATOM   9939  C  C    . ASP B  1 326 ? -8.851  -56.074 -119.668 1.00 12.84  ? 326 ASP A C    1 
ATOM   9940  O  O    . ASP B  1 326 ? -7.910  -56.694 -119.157 1.00 9.16   ? 326 ASP A O    1 
ATOM   9941  C  CB   . ASP B  1 326 ? -9.329  -53.723 -119.037 1.00 12.42  ? 326 ASP A CB   1 
ATOM   9942  C  CG   . ASP B  1 326 ? -9.049  -52.233 -119.245 1.00 21.21  ? 326 ASP A CG   1 
ATOM   9943  O  OD1  . ASP B  1 326 ? -8.115  -51.869 -119.996 1.00 16.00  ? 326 ASP A OD1  1 
ATOM   9944  O  OD2  . ASP B  1 326 ? -9.796  -51.421 -118.645 1.00 16.57  ? 326 ASP A OD2  1 
ATOM   9945  H  H    . ASP B  1 326 ? -9.880  -53.750 -121.433 1.00 12.89  ? 326 ASP A H    1 
ATOM   9946  H  HA   . ASP B  1 326 ? -7.744  -54.417 -120.142 1.00 16.71  ? 326 ASP A HA   1 
ATOM   9947  H  HB2  . ASP B  1 326 ? -10.291 -53.850 -119.053 1.00 14.91  ? 326 ASP A HB2  1 
ATOM   9948  H  HB3  . ASP B  1 326 ? -8.978  -53.973 -118.168 1.00 14.91  ? 326 ASP A HB3  1 
ATOM   9949  N  N    . LEU B  1 327 ? -10.055 -56.611 -119.837 1.00 10.85  ? 327 LEU A N    1 
ATOM   9950  C  CA   . LEU B  1 327 ? -10.318 -57.982 -119.437 1.00 12.00  ? 327 LEU A CA   1 
ATOM   9951  C  C    . LEU B  1 327 ? -9.431  -58.938 -120.218 1.00 11.37  ? 327 LEU A C    1 
ATOM   9952  O  O    . LEU B  1 327 ? -8.846  -59.830 -119.626 1.00 9.09   ? 327 LEU A O    1 
ATOM   9953  C  CB   . LEU B  1 327 ? -11.789 -58.343 -119.639 1.00 10.14  ? 327 LEU A CB   1 
ATOM   9954  C  CG   . LEU B  1 327 ? -12.177 -59.782 -119.297 1.00 10.53  ? 327 LEU A CG   1 
ATOM   9955  C  CD1  . LEU B  1 327 ? -11.821 -60.131 -117.875 1.00 11.59  ? 327 LEU A CD1  1 
ATOM   9956  C  CD2  . LEU B  1 327 ? -13.672 -59.985 -119.540 1.00 13.79  ? 327 LEU A CD2  1 
ATOM   9957  H  H    . LEU B  1 327 ? -10.730 -56.204 -120.179 1.00 13.02  ? 327 LEU A H    1 
ATOM   9958  H  HA   . LEU B  1 327 ? -10.111 -58.082 -118.495 1.00 14.40  ? 327 LEU A HA   1 
ATOM   9959  H  HB2  . LEU B  1 327 ? -12.326 -57.758 -119.081 1.00 12.17  ? 327 LEU A HB2  1 
ATOM   9960  H  HB3  . LEU B  1 327 ? -12.014 -58.195 -120.571 1.00 12.17  ? 327 LEU A HB3  1 
ATOM   9961  H  HG   . LEU B  1 327 ? -11.694 -60.386 -119.883 1.00 12.63  ? 327 LEU A HG   1 
ATOM   9962  H  HD11 . LEU B  1 327 ? -12.083 -61.049 -117.701 1.00 13.91  ? 327 LEU A HD11 1 
ATOM   9963  H  HD12 . LEU B  1 327 ? -10.864 -60.032 -117.756 1.00 13.91  ? 327 LEU A HD12 1 
ATOM   9964  H  HD13 . LEU B  1 327 ? -12.294 -59.533 -117.276 1.00 13.91  ? 327 LEU A HD13 1 
ATOM   9965  H  HD21 . LEU B  1 327 ? -13.906 -60.901 -119.320 1.00 16.55  ? 327 LEU A HD21 1 
ATOM   9966  H  HD22 . LEU B  1 327 ? -14.169 -59.372 -118.976 1.00 16.55  ? 327 LEU A HD22 1 
ATOM   9967  H  HD23 . LEU B  1 327 ? -13.867 -59.809 -120.473 1.00 16.55  ? 327 LEU A HD23 1 
ATOM   9968  N  N    . MET B  1 328 ? -9.328  -58.751 -121.538 1.00 8.83   ? 328 MET A N    1 
ATOM   9969  C  CA   . MET B  1 328 ? -8.491  -59.644 -122.351 1.00 9.23   ? 328 MET A CA   1 
ATOM   9970  C  C    . MET B  1 328 ? -7.025  -59.599 -121.914 1.00 9.47   ? 328 MET A C    1 
ATOM   9971  O  O    . MET B  1 328 ? -6.361  -60.616 -121.860 1.00 9.83   ? 328 MET A O    1 
ATOM   9972  C  CB   . MET B  1 328 ? -8.602  -59.293 -123.834 1.00 11.90  ? 328 MET A CB   1 
ATOM   9973  C  CG   . MET B  1 328 ? -9.949  -59.662 -124.419 1.00 15.01  ? 328 MET A CG   1 
ATOM   9974  S  SD   . MET B  1 328 ? -10.023 -59.496 -126.196 1.00 13.29  ? 328 MET A SD   1 
ATOM   9975  C  CE   . MET B  1 328 ? -9.943  -57.727 -126.386 1.00 9.75   ? 328 MET A CE   1 
ATOM   9976  H  H    . MET B  1 328 ? -9.723  -58.128 -121.979 1.00 10.60  ? 328 MET A H    1 
ATOM   9977  H  HA   . MET B  1 328 ? -8.816  -60.551 -122.242 1.00 11.07  ? 328 MET A HA   1 
ATOM   9978  H  HB2  . MET B  1 328 ? -8.479  -58.337 -123.944 1.00 14.28  ? 328 MET A HB2  1 
ATOM   9979  H  HB3  . MET B  1 328 ? -7.919  -59.775 -124.326 1.00 14.28  ? 328 MET A HB3  1 
ATOM   9980  H  HG2  . MET B  1 328 ? -10.145 -60.586 -124.198 1.00 18.01  ? 328 MET A HG2  1 
ATOM   9981  H  HG3  . MET B  1 328 ? -10.626 -59.081 -124.037 1.00 18.01  ? 328 MET A HG3  1 
ATOM   9982  H  HE1  . MET B  1 328 ? -9.975  -57.509 -127.330 1.00 11.70  ? 328 MET A HE1  1 
ATOM   9983  H  HE2  . MET B  1 328 ? -10.698 -57.326 -125.927 1.00 11.70  ? 328 MET A HE2  1 
ATOM   9984  H  HE3  . MET B  1 328 ? -9.113  -57.405 -126.000 1.00 11.70  ? 328 MET A HE3  1 
ATOM   9985  N  N    . ALA B  1 329 ? -6.517  -58.420 -121.593 1.00 9.35   ? 329 ALA A N    1 
ATOM   9986  C  CA   . ALA B  1 329 ? -5.109  -58.319 -121.158 1.00 9.67   ? 329 ALA A CA   1 
ATOM   9987  C  C    . ALA B  1 329 ? -4.914  -59.012 -119.813 1.00 9.79   ? 329 ALA A C    1 
ATOM   9988  O  O    . ALA B  1 329 ? -3.910  -59.666 -119.587 1.00 10.18  ? 329 ALA A O    1 
ATOM   9989  C  CB   . ALA B  1 329 ? -4.675  -56.854 -121.088 1.00 9.60   ? 329 ALA A CB   1 
ATOM   9990  H  H    . ALA B  1 329 ? -6.944  -57.673 -121.613 1.00 11.22  ? 329 ALA A H    1 
ATOM   9991  H  HA   . ALA B  1 329 ? -4.546  -58.766 -121.809 1.00 11.60  ? 329 ALA A HA   1 
ATOM   9992  H  HB1  . ALA B  1 329 ? -3.749  -56.813 -120.801 1.00 11.52  ? 329 ALA A HB1  1 
ATOM   9993  H  HB2  . ALA B  1 329 ? -4.767  -56.455 -121.967 1.00 11.52  ? 329 ALA A HB2  1 
ATOM   9994  H  HB3  . ALA B  1 329 ? -5.240  -56.388 -120.452 1.00 11.52  ? 329 ALA A HB3  1 
ATOM   9995  N  N    . HIS B  1 330 ? -5.906  -58.913 -118.936 1.00 9.52   ? 330 HIS A N    1 
ATOM   9996  C  CA   . HIS B  1 330 ? -5.877  -59.654 -117.679 1.00 15.55  ? 330 HIS A CA   1 
ATOM   9997  C  C    . HIS B  1 330 ? -5.911  -61.173 -117.914 1.00 10.01  ? 330 HIS A C    1 
ATOM   9998  O  O    . HIS B  1 330 ? -5.148  -61.929 -117.298 1.00 10.40  ? 330 HIS A O    1 
ATOM   9999  C  CB   . HIS B  1 330 ? -7.043  -59.253 -116.765 1.00 10.35  ? 330 HIS A CB   1 
ATOM   10000 C  CG   . HIS B  1 330 ? -7.104  -60.069 -115.515 1.00 9.86   ? 330 HIS A CG   1 
ATOM   10001 N  ND1  . HIS B  1 330 ? -6.210  -59.910 -114.478 1.00 10.03  ? 330 HIS A ND1  1 
ATOM   10002 C  CD2  . HIS B  1 330 ? -7.901  -61.109 -115.173 1.00 10.91  ? 330 HIS A CD2  1 
ATOM   10003 C  CE1  . HIS B  1 330 ? -6.474  -60.802 -113.539 1.00 16.72  ? 330 HIS A CE1  1 
ATOM   10004 N  NE2  . HIS B  1 330 ? -7.491  -61.546 -113.942 1.00 10.24  ? 330 HIS A NE2  1 
ATOM   10005 H  H    . HIS B  1 330 ? -6.605  -58.425 -119.044 1.00 11.43  ? 330 HIS A H    1 
ATOM   10006 H  HA   . HIS B  1 330 ? -5.052  -59.446 -117.214 1.00 18.66  ? 330 HIS A HA   1 
ATOM   10007 H  HB2  . HIS B  1 330 ? -6.940  -58.323 -116.512 1.00 12.42  ? 330 HIS A HB2  1 
ATOM   10008 H  HB3  . HIS B  1 330 ? -7.877  -59.376 -117.245 1.00 12.42  ? 330 HIS A HB3  1 
ATOM   10009 H  HD2  . HIS B  1 330 ? -8.597  -61.461 -115.681 1.00 13.10  ? 330 HIS A HD2  1 
ATOM   10010 H  HE1  . HIS B  1 330 ? -6.022  -60.891 -112.731 1.00 20.06  ? 330 HIS A HE1  1 
ATOM   10011 N  N    . MET B  1 331 ? -6.773  -61.621 -118.808 1.00 9.91   ? 331 MET A N    1 
ATOM   10012 C  CA   . MET B  1 331 ? -6.861  -63.046 -119.123 1.00 12.17  ? 331 MET A CA   1 
ATOM   10013 C  C    . MET B  1 331 ? -5.515  -63.543 -119.612 1.00 14.20  ? 331 MET A C    1 
ATOM   10014 O  O    . MET B  1 331 ? -5.035  -64.618 -119.232 1.00 11.08  ? 331 MET A O    1 
ATOM   10015 C  CB   . MET B  1 331 ? -7.936  -63.315 -120.197 1.00 12.48  ? 331 MET A CB   1 
ATOM   10016 C  CG   . MET B  1 331 ? -9.359  -63.097 -119.748 1.00 11.15  ? 331 MET A CG   1 
ATOM   10017 S  SD   . MET B  1 331 ? -10.467 -62.941 -121.176 1.00 14.10  ? 331 MET A SD   1 
ATOM   10018 C  CE   . MET B  1 331 ? -10.286 -64.553 -121.910 1.00 11.19  ? 331 MET A CE   1 
ATOM   10019 H  H    . MET B  1 331 ? -7.321  -61.127 -119.250 1.00 11.89  ? 331 MET A H    1 
ATOM   10020 H  HA   . MET B  1 331 ? -7.107  -63.533 -118.321 1.00 14.60  ? 331 MET A HA   1 
ATOM   10021 H  HB2  . MET B  1 331 ? -7.774  -62.725 -120.950 1.00 14.98  ? 331 MET A HB2  1 
ATOM   10022 H  HB3  . MET B  1 331 ? -7.859  -64.238 -120.485 1.00 14.98  ? 331 MET A HB3  1 
ATOM   10023 H  HG2  . MET B  1 331 ? -9.649  -63.854 -119.216 1.00 13.38  ? 331 MET A HG2  1 
ATOM   10024 H  HG3  . MET B  1 331 ? -9.411  -62.279 -119.229 1.00 13.38  ? 331 MET A HG3  1 
ATOM   10025 H  HE1  . MET B  1 331 ? -10.841 -64.603 -122.704 1.00 13.43  ? 331 MET A HE1  1 
ATOM   10026 H  HE2  . MET B  1 331 ? -9.355  -64.689 -122.148 1.00 13.43  ? 331 MET A HE2  1 
ATOM   10027 H  HE3  . MET B  1 331 ? -10.565 -65.225 -121.268 1.00 13.43  ? 331 MET A HE3  1 
ATOM   10028 N  N    . ALA B  1 332 ? -4.907  -62.753 -120.481 1.00 10.60  ? 332 ALA A N    1 
ATOM   10029 C  CA   . ALA B  1 332 ? -3.606  -63.115 -121.034 1.00 11.03  ? 332 ALA A CA   1 
ATOM   10030 C  C    . ALA B  1 332 ? -2.559  -63.238 -119.932 1.00 11.31  ? 332 ALA A C    1 
ATOM   10031 O  O    . ALA B  1 332 ? -1.673  -64.084 -120.020 1.00 11.78  ? 332 ALA A O    1 
ATOM   10032 C  CB   . ALA B  1 332 ? -3.180  -62.103 -122.072 1.00 12.28  ? 332 ALA A CB   1 
ATOM   10033 H  H    . ALA B  1 332 ? -5.221  -62.005 -120.768 1.00 12.72  ? 332 ALA A H    1 
ATOM   10034 H  HA   . ALA B  1 332 ? -3.680  -63.978 -121.472 1.00 13.24  ? 332 ALA A HA   1 
ATOM   10035 H  HB1  . ALA B  1 332 ? -2.315  -62.361 -122.427 1.00 14.73  ? 332 ALA A HB1  1 
ATOM   10036 H  HB2  . ALA B  1 332 ? -3.839  -62.086 -122.784 1.00 14.73  ? 332 ALA A HB2  1 
ATOM   10037 H  HB3  . ALA B  1 332 ? -3.121  -61.230 -121.655 1.00 14.73  ? 332 ALA A HB3  1 
ATOM   10038 N  N    . SER B  1 333 ? -2.662  -62.415 -118.889 1.00 11.09  ? 333 SER A N    1 
ATOM   10039 C  CA   . SER B  1 333 ? -1.682  -62.456 -117.803 1.00 11.54  ? 333 SER A CA   1 
ATOM   10040 C  C    . SER B  1 333 ? -1.794  -63.740 -116.993 1.00 15.27  ? 333 SER A C    1 
ATOM   10041 O  O    . SER B  1 333 ? -0.842  -64.134 -116.322 1.00 14.59  ? 333 SER A O    1 
ATOM   10042 C  CB   . SER B  1 333 ? -1.836  -61.244 -116.868 1.00 19.39  ? 333 SER A CB   1 
ATOM   10043 O  OG   . SER B  1 333 ? -2.969  -61.365 -116.008 1.00 13.39  ? 333 SER A OG   1 
ATOM   10044 H  H    . SER B  1 333 ? -3.283  -61.829 -118.787 1.00 13.30  ? 333 SER A H    1 
ATOM   10045 H  HA   . SER B  1 333 ? -0.791  -62.424 -118.185 1.00 13.85  ? 333 SER A HA   1 
ATOM   10046 H  HB2  . SER B  1 333 ? -1.038  -61.169 -116.323 1.00 23.27  ? 333 SER A HB2  1 
ATOM   10047 H  HB3  . SER B  1 333 ? -1.940  -60.446 -117.409 1.00 23.27  ? 333 SER A HB3  1 
ATOM   10048 H  HG   . SER B  1 333 ? -3.671  -61.427 -116.465 1.00 16.07  ? 333 SER A HG   1 
ATOM   10049 N  N    . LYS B  1 334 ? -2.943  -64.411 -117.070 1.00 13.28  ? 334 LYS A N    1 
ATOM   10050 C  CA   . LYS B  1 334 ? -3.151  -65.652 -116.313 1.00 16.79  ? 334 LYS A CA   1 
ATOM   10051 C  C    . LYS B  1 334 ? -2.668  -66.914 -117.043 1.00 22.13  ? 334 LYS A C    1 
ATOM   10052 O  O    . LYS B  1 334 ? -2.458  -67.948 -116.410 1.00 28.24  ? 334 LYS A O    1 
ATOM   10053 C  CB   . LYS B  1 334 ? -4.636  -65.807 -115.961 1.00 11.80  ? 334 LYS A CB   1 
ATOM   10054 C  CG   . LYS B  1 334 ? -5.220  -64.635 -115.179 1.00 22.96  ? 334 LYS A CG   1 
ATOM   10055 C  CD   . LYS B  1 334 ? -4.533  -64.428 -113.831 1.00 26.28  ? 334 LYS A CD   1 
ATOM   10056 C  CE   . LYS B  1 334 ? -4.878  -65.544 -112.855 1.00 40.96  ? 334 LYS A CE   1 
ATOM   10057 N  NZ   . LYS B  1 334 ? -4.326  -65.286 -111.488 1.00 53.51  ? 334 LYS A NZ   1 
ATOM   10058 H  H    . LYS B  1 334 ? -3.616  -64.172 -117.549 1.00 15.93  ? 334 LYS A H    1 
ATOM   10059 H  HA   . LYS B  1 334 ? -2.658  -65.590 -115.480 1.00 20.15  ? 334 LYS A HA   1 
ATOM   10060 H  HB2  . LYS B  1 334 ? -5.143  -65.896 -116.783 1.00 14.16  ? 334 LYS A HB2  1 
ATOM   10061 H  HB3  . LYS B  1 334 ? -4.745  -66.606 -115.421 1.00 14.16  ? 334 LYS A HB3  1 
ATOM   10062 H  HG2  . LYS B  1 334 ? -5.113  -63.823 -115.699 1.00 27.55  ? 334 LYS A HG2  1 
ATOM   10063 H  HG3  . LYS B  1 334 ? -6.162  -64.803 -115.014 1.00 27.55  ? 334 LYS A HG3  1 
ATOM   10064 H  HD2  . LYS B  1 334 ? -3.572  -64.422 -113.959 1.00 31.54  ? 334 LYS A HD2  1 
ATOM   10065 H  HD3  . LYS B  1 334 ? -4.827  -63.587 -113.447 1.00 31.54  ? 334 LYS A HD3  1 
ATOM   10066 H  HE2  . LYS B  1 334 ? -5.842  -65.616 -112.782 1.00 49.16  ? 334 LYS A HE2  1 
ATOM   10067 H  HE3  . LYS B  1 334 ? -4.503  -66.378 -113.180 1.00 49.16  ? 334 LYS A HE3  1 
ATOM   10068 H  HZ1  . LYS B  1 334 ? -4.543  -65.954 -110.942 1.00 64.21  ? 334 LYS A HZ1  1 
ATOM   10069 H  HZ2  . LYS B  1 334 ? -3.439  -65.221 -111.526 1.00 64.21  ? 334 LYS A HZ2  1 
ATOM   10070 H  HZ3  . LYS B  1 334 ? -4.658  -64.527 -111.164 1.00 64.21  ? 334 LYS A HZ3  1 
ATOM   10071 N  N    . GLU B  1 335 ? -2.474  -66.839 -118.358 1.00 17.67  ? 335 GLU A N    1 
ATOM   10072 C  CA   . GLU B  1 335 ? -2.129  -68.037 -119.142 1.00 20.18  ? 335 GLU A CA   1 
ATOM   10073 C  C    . GLU B  1 335 ? -0.891  -68.716 -118.565 1.00 54.01  ? 335 GLU A C    1 
ATOM   10074 O  O    . GLU B  1 335 ? -0.887  -69.923 -118.308 1.00 68.82  ? 335 GLU A O    1 
ATOM   10075 C  CB   . GLU B  1 335 ? -1.863  -67.694 -120.606 1.00 18.28  ? 335 GLU A CB   1 
ATOM   10076 C  CG   . GLU B  1 335 ? -3.045  -67.061 -121.333 1.00 22.88  ? 335 GLU A CG   1 
ATOM   10077 C  CD   . GLU B  1 335 ? -4.068  -68.084 -121.829 1.00 29.02  ? 335 GLU A CD   1 
ATOM   10078 O  OE1  . GLU B  1 335 ? -5.023  -67.666 -122.535 1.00 20.24  ? 335 GLU A OE1  1 
ATOM   10079 O  OE2  . GLU B  1 335 ? -3.909  -69.293 -121.530 1.00 20.51  ? 335 GLU A OE2  1 
ATOM   10080 O  OXT  . GLU B  1 335 ? 0.129   -68.054 -118.343 1.00 59.06  ? 335 GLU A OXT  1 
ATOM   10081 H  H    . GLU B  1 335 ? -2.533  -66.117 -118.821 1.00 21.21  ? 335 GLU A H    1 
ATOM   10082 H  HA   . GLU B  1 335 ? -2.866  -68.666 -119.105 1.00 24.22  ? 335 GLU A HA   1 
ATOM   10083 H  HB2  . GLU B  1 335 ? -1.122  -67.070 -120.649 1.00 21.93  ? 335 GLU A HB2  1 
ATOM   10084 H  HB3  . GLU B  1 335 ? -1.631  -68.510 -121.078 1.00 21.93  ? 335 GLU A HB3  1 
ATOM   10085 H  HG2  . GLU B  1 335 ? -3.499  -66.455 -120.727 1.00 27.46  ? 335 GLU A HG2  1 
ATOM   10086 H  HG3  . GLU B  1 335 ? -2.714  -66.572 -122.103 1.00 27.46  ? 335 GLU A HG3  1 
ATOM   10087 N  N    . LYS C  1 3   ? -66.588 22.407  -52.490  1.00 24.90  ? 3   LYS B N    1 
ATOM   10088 C  CA   . LYS C  1 3   ? -66.908 23.827  -52.330  1.00 29.63  ? 3   LYS B CA   1 
ATOM   10089 C  C    . LYS C  1 3   ? -65.855 24.757  -52.956  1.00 20.82  ? 3   LYS B C    1 
ATOM   10090 O  O    . LYS C  1 3   ? -66.132 25.261  -54.016  1.00 15.61  ? 3   LYS B O    1 
ATOM   10091 C  CB   . LYS C  1 3   ? -67.106 24.216  -50.872  1.00 30.90  ? 3   LYS B CB   1 
ATOM   10092 C  CG   . LYS C  1 3   ? -67.555 25.629  -50.733  1.00 22.81  ? 3   LYS B CG   1 
ATOM   10093 C  CD   . LYS C  1 3   ? -67.970 26.045  -49.355  1.00 44.82  ? 3   LYS B CD   1 
ATOM   10094 C  CE   . LYS C  1 3   ? -68.859 27.282  -49.414  1.00 56.54  ? 3   LYS B CE   1 
ATOM   10095 N  NZ   . LYS C  1 3   ? -69.513 27.589  -48.108  1.00 71.28  ? 3   LYS B NZ   1 
ATOM   10096 H  HA   . LYS C  1 3   ? -67.747 23.999  -52.787  1.00 35.56  ? 3   LYS B HA   1 
ATOM   10097 H  HB2  . LYS C  1 3   ? -67.783 23.643  -50.479  1.00 37.08  ? 3   LYS B HB2  1 
ATOM   10098 H  HB3  . LYS C  1 3   ? -66.266 24.116  -50.399  1.00 37.08  ? 3   LYS B HB3  1 
ATOM   10099 H  HG2  . LYS C  1 3   ? -66.827 26.209  -51.004  1.00 27.37  ? 3   LYS B HG2  1 
ATOM   10100 H  HG3  . LYS C  1 3   ? -68.315 25.768  -51.319  1.00 27.37  ? 3   LYS B HG3  1 
ATOM   10101 H  HD2  . LYS C  1 3   ? -68.470 25.327  -48.937  1.00 53.78  ? 3   LYS B HD2  1 
ATOM   10102 H  HD3  . LYS C  1 3   ? -67.182 26.258  -48.831  1.00 53.78  ? 3   LYS B HD3  1 
ATOM   10103 H  HE2  . LYS C  1 3   ? -68.319 28.047  -49.666  1.00 67.85  ? 3   LYS B HE2  1 
ATOM   10104 H  HE3  . LYS C  1 3   ? -69.557 27.138  -50.072  1.00 67.85  ? 3   LYS B HE3  1 
ATOM   10105 H  HZ1  . LYS C  1 3   ? -70.023 26.905  -47.855  1.00 85.53  ? 3   LYS B HZ1  1 
ATOM   10106 H  HZ2  . LYS C  1 3   ? -68.894 27.735  -47.485  1.00 85.53  ? 3   LYS B HZ2  1 
ATOM   10107 H  HZ3  . LYS C  1 3   ? -70.021 28.316  -48.186  1.00 85.53  ? 3   LYS B HZ3  1 
ATOM   10108 N  N    . VAL C  1 4   ? -64.691 25.022  -52.339  1.00 17.80  ? 4   VAL B N    1 
ATOM   10109 C  CA   . VAL C  1 4   ? -63.781 26.020  -52.940  1.00 14.81  ? 4   VAL B CA   1 
ATOM   10110 C  C    . VAL C  1 4   ? -63.247 25.481  -54.272  1.00 12.15  ? 4   VAL B C    1 
ATOM   10111 O  O    . VAL C  1 4   ? -62.994 24.281  -54.419  1.00 10.63  ? 4   VAL B O    1 
ATOM   10112 C  CB   . VAL C  1 4   ? -62.608 26.427  -51.994  1.00 13.06  ? 4   VAL B CB   1 
ATOM   10113 C  CG1  . VAL C  1 4   ? -61.671 25.256  -51.716  1.00 9.96   ? 4   VAL B CG1  1 
ATOM   10114 C  CG2  . VAL C  1 4   ? -61.839 27.636  -52.557  1.00 13.72  ? 4   VAL B CG2  1 
ATOM   10115 H  H    . VAL C  1 4   ? -64.414 24.659  -51.609  1.00 21.36  ? 4   VAL B H    1 
ATOM   10116 H  HA   . VAL C  1 4   ? -64.290 26.822  -53.133  1.00 17.77  ? 4   VAL B HA   1 
ATOM   10117 H  HB   . VAL C  1 4   ? -62.986 26.700  -51.144  1.00 15.67  ? 4   VAL B HB   1 
ATOM   10118 H  HG11 . VAL C  1 4   ? -60.961 25.553  -51.127  1.00 11.95  ? 4   VAL B HG11 1 
ATOM   10119 H  HG12 . VAL C  1 4   ? -62.175 24.543  -51.294  1.00 11.95  ? 4   VAL B HG12 1 
ATOM   10120 H  HG13 . VAL C  1 4   ? -61.298 24.945  -52.555  1.00 11.95  ? 4   VAL B HG13 1 
ATOM   10121 H  HG21 . VAL C  1 4   ? -61.119 27.863  -51.948  1.00 16.47  ? 4   VAL B HG21 1 
ATOM   10122 H  HG22 . VAL C  1 4   ? -61.476 27.402  -53.426  1.00 16.47  ? 4   VAL B HG22 1 
ATOM   10123 H  HG23 . VAL C  1 4   ? -62.448 28.385  -52.644  1.00 16.47  ? 4   VAL B HG23 1 
ATOM   10124 N  N    . LYS C  1 5   ? -63.123 26.361  -55.264  1.00 9.87   ? 5   LYS B N    1 
ATOM   10125 C  CA   . LYS C  1 5   ? -62.590 25.965  -56.565  1.00 9.64   ? 5   LYS B CA   1 
ATOM   10126 C  C    . LYS C  1 5   ? -61.088 26.281  -56.610  1.00 13.14  ? 5   LYS B C    1 
ATOM   10127 O  O    . LYS C  1 5   ? -60.646 27.366  -56.192  1.00 10.97  ? 5   LYS B O    1 
ATOM   10128 C  CB   . LYS C  1 5   ? -63.330 26.664  -57.704  1.00 10.09  ? 5   LYS B CB   1 
ATOM   10129 C  CG   . LYS C  1 5   ? -64.810 26.329  -57.808  1.00 12.63  ? 5   LYS B CG   1 
ATOM   10130 C  CD   . LYS C  1 5   ? -65.462 27.068  -58.953  1.00 15.61  ? 5   LYS B CD   1 
ATOM   10131 C  CE   . LYS C  1 5   ? -66.955 27.253  -58.749  1.00 30.67  ? 5   LYS B CE   1 
ATOM   10132 N  NZ   . LYS C  1 5   ? -67.640 26.012  -58.392  1.00 30.49  ? 5   LYS B NZ   1 
ATOM   10133 H  H    . LYS C  1 5   ? -63.341 27.191  -55.209  1.00 11.84  ? 5   LYS B H    1 
ATOM   10134 H  HA   . LYS C  1 5   ? -62.701 25.008  -56.675  1.00 11.57  ? 5   LYS B HA   1 
ATOM   10135 H  HB2  . LYS C  1 5   ? -63.255 27.623  -57.579  1.00 12.11  ? 5   LYS B HB2  1 
ATOM   10136 H  HB3  . LYS C  1 5   ? -62.914 26.412  -58.543  1.00 12.11  ? 5   LYS B HB3  1 
ATOM   10137 H  HG2  . LYS C  1 5   ? -64.913 25.377  -57.961  1.00 15.15  ? 5   LYS B HG2  1 
ATOM   10138 H  HG3  . LYS C  1 5   ? -65.255 26.588  -56.986  1.00 15.15  ? 5   LYS B HG3  1 
ATOM   10139 H  HD2  . LYS C  1 5   ? -65.059 27.946  -59.035  1.00 18.73  ? 5   LYS B HD2  1 
ATOM   10140 H  HD3  . LYS C  1 5   ? -65.331 26.564  -59.771  1.00 18.73  ? 5   LYS B HD3  1 
ATOM   10141 H  HE2  . LYS C  1 5   ? -67.099 27.891  -58.032  1.00 36.80  ? 5   LYS B HE2  1 
ATOM   10142 H  HE3  . LYS C  1 5   ? -67.348 27.585  -59.572  1.00 36.80  ? 5   LYS B HE3  1 
ATOM   10143 H  HZ1  . LYS C  1 5   ? -68.509 26.166  -58.282  1.00 36.59  ? 5   LYS B HZ1  1 
ATOM   10144 H  HZ2  . LYS C  1 5   ? -67.532 25.409  -59.037  1.00 36.59  ? 5   LYS B HZ2  1 
ATOM   10145 H  HZ3  . LYS C  1 5   ? -67.305 25.688  -57.634  1.00 36.59  ? 5   LYS B HZ3  1 
ATOM   10146 N  N    . VAL C  1 6   ? -60.329 25.325  -57.135  1.00 8.93   ? 6   VAL B N    1 
ATOM   10147 C  CA   . VAL C  1 6   ? -58.868 25.296  -57.022  1.00 8.63   ? 6   VAL B CA   1 
ATOM   10148 C  C    . VAL C  1 6   ? -58.179 25.214  -58.384  1.00 9.83   ? 6   VAL B C    1 
ATOM   10149 O  O    . VAL C  1 6   ? -58.623 24.490  -59.290  1.00 10.22  ? 6   VAL B O    1 
ATOM   10150 C  CB   . VAL C  1 6   ? -58.434 24.101  -56.155  1.00 10.67  ? 6   VAL B CB   1 
ATOM   10151 C  CG1  . VAL C  1 6   ? -56.914 23.940  -56.073  1.00 14.63  ? 6   VAL B CG1  1 
ATOM   10152 C  CG2  . VAL C  1 6   ? -59.015 24.262  -54.753  1.00 14.63  ? 6   VAL B CG2  1 
ATOM   10153 H  H    . VAL C  1 6   ? -60.646 24.659  -57.576  1.00 10.71  ? 6   VAL B H    1 
ATOM   10154 H  HA   . VAL C  1 6   ? -58.570 26.108  -56.584  1.00 10.35  ? 6   VAL B HA   1 
ATOM   10155 H  HB   . VAL C  1 6   ? -58.799 23.287  -56.537  1.00 12.81  ? 6   VAL B HB   1 
ATOM   10156 H  HG11 . VAL C  1 6   ? -56.707 23.174  -55.516  1.00 17.56  ? 6   VAL B HG11 1 
ATOM   10157 H  HG12 . VAL C  1 6   ? -56.562 23.803  -56.967  1.00 17.56  ? 6   VAL B HG12 1 
ATOM   10158 H  HG13 . VAL C  1 6   ? -56.532 24.743  -55.687  1.00 17.56  ? 6   VAL B HG13 1 
ATOM   10159 H  HG21 . VAL C  1 6   ? -58.740 23.507  -54.209  1.00 17.56  ? 6   VAL B HG21 1 
ATOM   10160 H  HG22 . VAL C  1 6   ? -58.683 25.087  -54.367  1.00 17.56  ? 6   VAL B HG22 1 
ATOM   10161 H  HG23 . VAL C  1 6   ? -59.983 24.290  -54.814  1.00 17.56  ? 6   VAL B HG23 1 
ATOM   10162 N  N    . GLY C  1 7   ? -57.110 25.993  -58.522  1.00 9.03   ? 7   GLY B N    1 
ATOM   10163 C  CA   . GLY C  1 7   ? -56.169 25.846  -59.618  1.00 12.24  ? 7   GLY B CA   1 
ATOM   10164 C  C    . GLY C  1 7   ? -54.872 25.218  -59.127  1.00 10.91  ? 7   GLY B C    1 
ATOM   10165 O  O    . GLY C  1 7   ? -54.479 25.423  -57.978  1.00 10.91  ? 7   GLY B O    1 
ATOM   10166 H  H    . GLY C  1 7   ? -56.907 26.628  -57.979  1.00 10.84  ? 7   GLY B H    1 
ATOM   10167 H  HA2  . GLY C  1 7   ? -56.550 25.279  -60.307  1.00 14.68  ? 7   GLY B HA2  1 
ATOM   10168 H  HA3  . GLY C  1 7   ? -55.971 26.715  -60.002  1.00 14.68  ? 7   GLY B HA3  1 
ATOM   10169 N  N    . VAL C  1 8   ? -54.220 24.433  -59.982  1.00 10.69  ? 8   VAL B N    1 
ATOM   10170 C  CA   . VAL C  1 8   ? -52.944 23.802  -59.647  1.00 9.92   ? 8   VAL B CA   1 
ATOM   10171 C  C    . VAL C  1 8   ? -51.856 24.303  -60.597  1.00 15.45  ? 8   VAL B C    1 
ATOM   10172 O  O    . VAL C  1 8   ? -51.979 24.175  -61.817  1.00 9.52   ? 8   VAL B O    1 
ATOM   10173 C  CB   . VAL C  1 8   ? -53.038 22.268  -59.734  1.00 10.18  ? 8   VAL B CB   1 
ATOM   10174 C  CG1  . VAL C