data_4WNF
# 
_entry.id   4WNF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4WNF         
WWPDB D_1000204105 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '3SF4 contains the same protein complexed with mInsc.' 3SF4 unspecified 
PDB .                                                      4WND unspecified 
PDB .                                                      4WNE unspecified 
PDB .                                                      4WNG unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4WNF 
_pdbx_database_status.recvd_initial_deposition_date   2014-10-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Takayanagi, H.' 1 
'Yuzawa, S.'     2 
'Sumimoto, H.'   3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_id_ASTM           ACSFEN 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2053-230X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            71 
_citation.language                  ? 
_citation.page_first                175 
_citation.page_last                 183 
_citation.title                     
'Structural basis for the recognition of the scaffold protein Frmpd4/Preso1 by the TPR domain of the adaptor protein LGN' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S2053230X14028143 
_citation.pdbx_database_id_PubMed   25664792 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Takayanagi, H.' 1 ? 
primary 'Yuzawa, S.'     2 ? 
primary 'Sumimoto, H.'   3 ? 
# 
_cell.length_a           92.599 
_cell.length_b           92.599 
_cell.length_c           175.238 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4WNF 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4WNF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'G-protein-signaling modulator 2'          44948.281 1 ? ? 'N-terminal TPR domain, UNP residues 20-421' ? 
2 polymer man 'FERM and PDZ domain-containing protein 4' 5831.625  1 ? ? 'FRMPD4-L, UNP residues 978-1025'            ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Mosaic protein LGN'                                                                         
2 'PDZ domain-containing protein 10,PSD-95-interacting regulator of spine morphogenesis,Preso' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPGSMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTI
GDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVR
DALQAAVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFL
GEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTAL
GNHDQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELM
KLTPEK
;
;GPGSMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTI
GDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVR
DALQAAVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFL
GEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTAL
GNHDQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELM
KLTPEK
;
A ? 
2 'polypeptide(L)' no no GPLGSDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTS 
GPLGSDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTS B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   SER n 
1 5   MET n 
1 6   GLU n 
1 7   ALA n 
1 8   SER n 
1 9   CYS n 
1 10  LEU n 
1 11  GLU n 
1 12  LEU n 
1 13  ALA n 
1 14  LEU n 
1 15  GLU n 
1 16  GLY n 
1 17  GLU n 
1 18  ARG n 
1 19  LEU n 
1 20  CYS n 
1 21  LYS n 
1 22  SER n 
1 23  GLY n 
1 24  ASP n 
1 25  CYS n 
1 26  ARG n 
1 27  ALA n 
1 28  GLY n 
1 29  VAL n 
1 30  SER n 
1 31  PHE n 
1 32  PHE n 
1 33  GLU n 
1 34  ALA n 
1 35  ALA n 
1 36  VAL n 
1 37  GLN n 
1 38  VAL n 
1 39  GLY n 
1 40  THR n 
1 41  GLU n 
1 42  ASP n 
1 43  LEU n 
1 44  LYS n 
1 45  THR n 
1 46  LEU n 
1 47  SER n 
1 48  ALA n 
1 49  ILE n 
1 50  TYR n 
1 51  SER n 
1 52  GLN n 
1 53  LEU n 
1 54  GLY n 
1 55  ASN n 
1 56  ALA n 
1 57  TYR n 
1 58  PHE n 
1 59  TYR n 
1 60  LEU n 
1 61  HIS n 
1 62  ASP n 
1 63  TYR n 
1 64  ALA n 
1 65  LYS n 
1 66  ALA n 
1 67  LEU n 
1 68  GLU n 
1 69  TYR n 
1 70  HIS n 
1 71  HIS n 
1 72  HIS n 
1 73  ASP n 
1 74  LEU n 
1 75  THR n 
1 76  LEU n 
1 77  ALA n 
1 78  ARG n 
1 79  THR n 
1 80  ILE n 
1 81  GLY n 
1 82  ASP n 
1 83  GLN n 
1 84  LEU n 
1 85  GLY n 
1 86  GLU n 
1 87  ALA n 
1 88  LYS n 
1 89  ALA n 
1 90  SER n 
1 91  GLY n 
1 92  ASN n 
1 93  LEU n 
1 94  GLY n 
1 95  ASN n 
1 96  THR n 
1 97  LEU n 
1 98  LYS n 
1 99  VAL n 
1 100 LEU n 
1 101 GLY n 
1 102 ASN n 
1 103 PHE n 
1 104 ASP n 
1 105 GLU n 
1 106 ALA n 
1 107 ILE n 
1 108 VAL n 
1 109 CYS n 
1 110 CYS n 
1 111 GLN n 
1 112 ARG n 
1 113 HIS n 
1 114 LEU n 
1 115 ASP n 
1 116 ILE n 
1 117 SER n 
1 118 ARG n 
1 119 GLU n 
1 120 LEU n 
1 121 ASN n 
1 122 ASP n 
1 123 LYS n 
1 124 VAL n 
1 125 GLY n 
1 126 GLU n 
1 127 ALA n 
1 128 ARG n 
1 129 ALA n 
1 130 LEU n 
1 131 TYR n 
1 132 ASN n 
1 133 LEU n 
1 134 GLY n 
1 135 ASN n 
1 136 VAL n 
1 137 TYR n 
1 138 HIS n 
1 139 ALA n 
1 140 LYS n 
1 141 GLY n 
1 142 LYS n 
1 143 SER n 
1 144 PHE n 
1 145 GLY n 
1 146 CYS n 
1 147 PRO n 
1 148 GLY n 
1 149 PRO n 
1 150 GLN n 
1 151 ASP n 
1 152 VAL n 
1 153 GLY n 
1 154 GLU n 
1 155 PHE n 
1 156 PRO n 
1 157 GLU n 
1 158 GLU n 
1 159 VAL n 
1 160 ARG n 
1 161 ASP n 
1 162 ALA n 
1 163 LEU n 
1 164 GLN n 
1 165 ALA n 
1 166 ALA n 
1 167 VAL n 
1 168 ASP n 
1 169 PHE n 
1 170 TYR n 
1 171 GLU n 
1 172 GLU n 
1 173 ASN n 
1 174 LEU n 
1 175 SER n 
1 176 LEU n 
1 177 VAL n 
1 178 THR n 
1 179 ALA n 
1 180 LEU n 
1 181 GLY n 
1 182 ASP n 
1 183 ARG n 
1 184 ALA n 
1 185 ALA n 
1 186 GLN n 
1 187 GLY n 
1 188 ARG n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 ASN n 
1 193 LEU n 
1 194 GLY n 
1 195 ASN n 
1 196 THR n 
1 197 HIS n 
1 198 TYR n 
1 199 LEU n 
1 200 LEU n 
1 201 GLY n 
1 202 ASN n 
1 203 PHE n 
1 204 ARG n 
1 205 ASP n 
1 206 ALA n 
1 207 VAL n 
1 208 ILE n 
1 209 ALA n 
1 210 HIS n 
1 211 GLU n 
1 212 GLN n 
1 213 ARG n 
1 214 LEU n 
1 215 LEU n 
1 216 ILE n 
1 217 ALA n 
1 218 LYS n 
1 219 GLU n 
1 220 PHE n 
1 221 GLY n 
1 222 ASP n 
1 223 LYS n 
1 224 ALA n 
1 225 ALA n 
1 226 GLU n 
1 227 ARG n 
1 228 ARG n 
1 229 ALA n 
1 230 TYR n 
1 231 SER n 
1 232 ASN n 
1 233 LEU n 
1 234 GLY n 
1 235 ASN n 
1 236 ALA n 
1 237 TYR n 
1 238 ILE n 
1 239 PHE n 
1 240 LEU n 
1 241 GLY n 
1 242 GLU n 
1 243 PHE n 
1 244 GLU n 
1 245 THR n 
1 246 ALA n 
1 247 SER n 
1 248 GLU n 
1 249 TYR n 
1 250 TYR n 
1 251 LYS n 
1 252 LYS n 
1 253 THR n 
1 254 LEU n 
1 255 LEU n 
1 256 LEU n 
1 257 ALA n 
1 258 ARG n 
1 259 GLN n 
1 260 LEU n 
1 261 LYS n 
1 262 ASP n 
1 263 ARG n 
1 264 ALA n 
1 265 VAL n 
1 266 GLU n 
1 267 ALA n 
1 268 GLN n 
1 269 SER n 
1 270 CYS n 
1 271 TYR n 
1 272 SER n 
1 273 LEU n 
1 274 GLY n 
1 275 ASN n 
1 276 THR n 
1 277 TYR n 
1 278 THR n 
1 279 LEU n 
1 280 LEU n 
1 281 GLN n 
1 282 ASP n 
1 283 TYR n 
1 284 GLU n 
1 285 LYS n 
1 286 ALA n 
1 287 ILE n 
1 288 ASP n 
1 289 TYR n 
1 290 HIS n 
1 291 LEU n 
1 292 LYS n 
1 293 HIS n 
1 294 LEU n 
1 295 ALA n 
1 296 ILE n 
1 297 ALA n 
1 298 GLN n 
1 299 GLU n 
1 300 LEU n 
1 301 ASN n 
1 302 ASP n 
1 303 ARG n 
1 304 ILE n 
1 305 GLY n 
1 306 GLU n 
1 307 GLY n 
1 308 ARG n 
1 309 ALA n 
1 310 CYS n 
1 311 TRP n 
1 312 SER n 
1 313 LEU n 
1 314 GLY n 
1 315 ASN n 
1 316 ALA n 
1 317 TYR n 
1 318 THR n 
1 319 ALA n 
1 320 LEU n 
1 321 GLY n 
1 322 ASN n 
1 323 HIS n 
1 324 ASP n 
1 325 GLN n 
1 326 ALA n 
1 327 MET n 
1 328 HIS n 
1 329 PHE n 
1 330 ALA n 
1 331 GLU n 
1 332 LYS n 
1 333 HIS n 
1 334 LEU n 
1 335 GLU n 
1 336 ILE n 
1 337 SER n 
1 338 ARG n 
1 339 GLU n 
1 340 VAL n 
1 341 GLY n 
1 342 ASP n 
1 343 LYS n 
1 344 SER n 
1 345 GLY n 
1 346 GLU n 
1 347 LEU n 
1 348 THR n 
1 349 ALA n 
1 350 ARG n 
1 351 LEU n 
1 352 ASN n 
1 353 LEU n 
1 354 SER n 
1 355 ASP n 
1 356 LEU n 
1 357 GLN n 
1 358 MET n 
1 359 VAL n 
1 360 LEU n 
1 361 GLY n 
1 362 LEU n 
1 363 SER n 
1 364 TYR n 
1 365 SER n 
1 366 THR n 
1 367 ASN n 
1 368 ASN n 
1 369 SER n 
1 370 ILE n 
1 371 MET n 
1 372 SER n 
1 373 GLU n 
1 374 ASN n 
1 375 THR n 
1 376 GLU n 
1 377 ILE n 
1 378 ASP n 
1 379 SER n 
1 380 SER n 
1 381 LEU n 
1 382 ASN n 
1 383 GLY n 
1 384 VAL n 
1 385 ARG n 
1 386 PRO n 
1 387 LYS n 
1 388 LEU n 
1 389 GLY n 
1 390 ARG n 
1 391 ARG n 
1 392 HIS n 
1 393 SER n 
1 394 MET n 
1 395 GLU n 
1 396 ASN n 
1 397 MET n 
1 398 GLU n 
1 399 LEU n 
1 400 MET n 
1 401 LYS n 
1 402 LEU n 
1 403 THR n 
1 404 PRO n 
1 405 GLU n 
1 406 LYS n 
2 1   GLY n 
2 2   PRO n 
2 3   LEU n 
2 4   GLY n 
2 5   SER n 
2 6   ASP n 
2 7   LEU n 
2 8   PRO n 
2 9   PRO n 
2 10  LYS n 
2 11  VAL n 
2 12  VAL n 
2 13  PRO n 
2 14  SER n 
2 15  LYS n 
2 16  GLN n 
2 17  LEU n 
2 18  LEU n 
2 19  HIS n 
2 20  SER n 
2 21  ASP n 
2 22  HIS n 
2 23  MET n 
2 24  GLU n 
2 25  MET n 
2 26  GLU n 
2 27  PRO n 
2 28  GLU n 
2 29  THR n 
2 30  MET n 
2 31  GLU n 
2 32  THR n 
2 33  LYS n 
2 34  SER n 
2 35  VAL n 
2 36  THR n 
2 37  ASP n 
2 38  TYR n 
2 39  PHE n 
2 40  SER n 
2 41  LYS n 
2 42  LEU n 
2 43  HIS n 
2 44  MET n 
2 45  GLY n 
2 46  SER n 
2 47  VAL n 
2 48  ALA n 
2 49  TYR n 
2 50  SER n 
2 51  CYS n 
2 52  THR n 
2 53  SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 406 Human ? 'GPSM2, LGN'                       ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pRSFDUET-1 ? ? 
2 1 sample 'Biological sequence' 1 53  Human ? 'FRMPD4, KIAA0316, PDZD10, PDZK10' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pGEX-6P-2  ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GPSM2_HUMAN P81274 ? 1 
;MEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIGDQL
GEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQ
AAVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFE
TASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHD
QAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTP
EK
;
20  
2 UNP FRPD4_HUMAN Q14CM0 ? 2 DLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTS 978 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4WNF A 5 ? 406 ? P81274 20  ? 421  ? 13  414  
2 2 4WNF B 6 ? 53  ? Q14CM0 978 ? 1025 ? 978 1025 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4WNF GLY A 1 ? UNP P81274 ? ? 'expression tag' 9   1 
1 4WNF PRO A 2 ? UNP P81274 ? ? 'expression tag' 10  2 
1 4WNF GLY A 3 ? UNP P81274 ? ? 'expression tag' 11  3 
1 4WNF SER A 4 ? UNP P81274 ? ? 'expression tag' 12  4 
2 4WNF GLY B 1 ? UNP Q14CM0 ? ? 'expression tag' 973 5 
2 4WNF PRO B 2 ? UNP Q14CM0 ? ? 'expression tag' 974 6 
2 4WNF LEU B 3 ? UNP Q14CM0 ? ? 'expression tag' 975 7 
2 4WNF GLY B 4 ? UNP Q14CM0 ? ? 'expression tag' 976 8 
2 4WNF SER B 5 ? UNP Q14CM0 ? ? 'expression tag' 977 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4WNF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.14 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.40 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M BisTrispropane (pH 7.5), 0.2 M potassium thiocyanate, 20% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-12-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4WNF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.900 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       10385 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.300 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.200 
_reflns.pdbx_Rmerge_I_obs                0.075 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         18.174 
_reflns.pdbx_netI_over_sigmaI            15.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.998 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         74336 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.900 2.950  ? 2.728 ? ? ? 496 ? 100.000 ? ? ? ? 0.502 ? ? ? ? ? ? ? ? 7.600 ? 1.081 ? ? ? ? 0 1  1 ? ? 
2.950 3.000  ? ?     ? ? ? 505 ? 100.000 ? ? ? ? 0.445 ? ? ? ? ? ? ? ? 7.400 ? 0.969 ? ? ? ? 0 2  1 ? ? 
3.000 3.060  ? ?     ? ? ? 499 ? 100.000 ? ? ? ? 0.475 ? ? ? ? ? ? ? ? 7.400 ? 0.976 ? ? ? ? 0 3  1 ? ? 
3.060 3.120  ? ?     ? ? ? 511 ? 100.000 ? ? ? ? 0.350 ? ? ? ? ? ? ? ? 7.500 ? 0.994 ? ? ? ? 0 4  1 ? ? 
3.120 3.190  ? ?     ? ? ? 510 ? 100.000 ? ? ? ? 0.296 ? ? ? ? ? ? ? ? 7.400 ? 1.050 ? ? ? ? 0 5  1 ? ? 
3.190 3.270  ? ?     ? ? ? 500 ? 99.800  ? ? ? ? 0.254 ? ? ? ? ? ? ? ? 7.500 ? 0.919 ? ? ? ? 0 6  1 ? ? 
3.270 3.350  ? ?     ? ? ? 517 ? 100.000 ? ? ? ? 0.193 ? ? ? ? ? ? ? ? 7.500 ? 0.994 ? ? ? ? 0 7  1 ? ? 
3.350 3.440  ? ?     ? ? ? 511 ? 100.000 ? ? ? ? 0.218 ? ? ? ? ? ? ? ? 7.200 ? 0.996 ? ? ? ? 0 8  1 ? ? 
3.440 3.540  ? ?     ? ? ? 509 ? 100.000 ? ? ? ? 0.164 ? ? ? ? ? ? ? ? 7.100 ? 1.106 ? ? ? ? 0 9  1 ? ? 
3.540 3.650  ? ?     ? ? ? 512 ? 99.600  ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 6.900 ? 0.972 ? ? ? ? 0 10 1 ? ? 
3.650 3.780  ? ?     ? ? ? 497 ? 99.000  ? ? ? ? 0.165 ? ? ? ? ? ? ? ? 6.800 ? 0.955 ? ? ? ? 0 11 1 ? ? 
3.780 3.940  ? ?     ? ? ? 510 ? 98.800  ? ? ? ? 0.134 ? ? ? ? ? ? ? ? 6.500 ? 0.966 ? ? ? ? 0 12 1 ? ? 
3.940 4.110  ? ?     ? ? ? 523 ? 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 7.400 ? 0.963 ? ? ? ? 0 13 1 ? ? 
4.110 4.330  ? ?     ? ? ? 524 ? 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 7.200 ? 1.030 ? ? ? ? 0 14 1 ? ? 
4.330 4.600  ? ?     ? ? ? 529 ? 99.600  ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 7.300 ? 0.925 ? ? ? ? 0 15 1 ? ? 
4.600 4.960  ? ?     ? ? ? 520 ? 100.000 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 7.200 ? 0.949 ? ? ? ? 0 16 1 ? ? 
4.960 5.460  ? ?     ? ? ? 542 ? 99.800  ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 7.100 ? 1.095 ? ? ? ? 0 17 1 ? ? 
5.460 6.240  ? ?     ? ? ? 539 ? 100.000 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 7.100 ? 0.957 ? ? ? ? 0 18 1 ? ? 
6.240 7.860  ? ?     ? ? ? 555 ? 99.300  ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 6.900 ? 1.100 ? ? ? ? 0 19 1 ? ? 
7.860 50.000 ? ?     ? ? ? 576 ? 91.600  ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 6.100 ? 0.953 ? ? ? ? 0 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            3.1300 
_refine.aniso_B[1][2]                            3.1300 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            3.1300 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -10.1600 
_refine.B_iso_max                                202.880 
_refine.B_iso_mean                               88.3250 
_refine.B_iso_min                                50.240 
_refine.correlation_coeff_Fo_to_Fc               0.9310 
_refine.correlation_coeff_Fo_to_Fc_free          0.9080 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4WNF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.9000 
_refine.ls_d_res_low                             39.1200 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     9777 
_refine.ls_number_reflns_R_free                  513 
_refine.ls_number_reflns_R_work                  9777 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.7100 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2391 
_refine.ls_R_factor_R_free                       0.2802 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2370 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      0.2832 
_refine.ls_wR_factor_R_work                      0.2379 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4WNE 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.8200 
_refine.pdbx_overall_ESU_R_Free                  0.3820 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             17.0970 
_refine.overall_SU_ML                            0.3150 
_refine.overall_SU_R_Cruickshank_DPI             0.8202 
_refine.overall_SU_R_free                        0.3820 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.7607 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.9000 
_refine_hist.d_res_low                        39.1200 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2065 
_refine_hist.pdbx_number_residues_total       273 
_refine_hist.pdbx_number_atoms_protein        2065 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  0.019  2100 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  1923 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.138  1.950  2834 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.685  3.001  4406 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 5.522  5.000  270  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 35.501 24.706 102  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 19.496 15.000 337  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 16.779 15.000 10   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.058  0.200  312  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  2453 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  493  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.9030 
_refine_ls_shell.d_res_low                        2.9780 
_refine_ls_shell.number_reflns_all                739 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             47 
_refine_ls_shell.number_reflns_R_work             692 
_refine_ls_shell.percent_reflns_obs               99.7300 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3500 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.3160 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
# 
_struct.entry_id                     4WNF 
_struct.title                        
'Crystal structure of the oxidized TPR domain of LGN in complex with Frmpd4/Preso1 at 2.9 Angstrom resolution' 
_struct.pdbx_descriptor              'G-protein-signaling modulator 2, FERM and PDZ domain-containing protein 4' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4WNF 
_struct_keywords.text            
'TETRATRICOPEPTIDE REPEAT, TPR, CELL POLARITY, CYTOPLASM AND CELL CORTEX, SIGNALING PROTEIN-PROTEIN BINDING COMPLEX' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 4   ? SER A 22  ? SER A 12   SER A 30   1 ? 19 
HELX_P HELX_P2  AA2 ASP A 24  ? GLY A 39  ? ASP A 32   GLY A 47   1 ? 16 
HELX_P HELX_P3  AA3 ASP A 42  ? LEU A 60  ? ASP A 50   LEU A 68   1 ? 19 
HELX_P HELX_P4  AA4 ASP A 62  ? ILE A 80  ? ASP A 70   ILE A 88   1 ? 19 
HELX_P HELX_P5  AA5 ASP A 82  ? GLY A 101 ? ASP A 90   GLY A 109  1 ? 20 
HELX_P HELX_P6  AA6 ASN A 102 ? LEU A 120 ? ASN A 110  LEU A 128  1 ? 19 
HELX_P HELX_P7  AA7 ASP A 122 ? SER A 143 ? ASP A 130  SER A 151  1 ? 22 
HELX_P HELX_P8  AA8 GLN A 150 ? GLU A 154 ? GLN A 158  GLU A 162  1 ? 5  
HELX_P HELX_P9  AA9 PRO A 156 ? GLY A 181 ? PRO A 164  GLY A 189  1 ? 26 
HELX_P HELX_P10 AB1 ASP A 182 ? GLY A 201 ? ASP A 190  GLY A 209  1 ? 20 
HELX_P HELX_P11 AB2 ASN A 202 ? GLY A 221 ? ASN A 210  GLY A 229  1 ? 20 
HELX_P HELX_P12 AB3 ASP A 222 ? GLY A 241 ? ASP A 230  GLY A 249  1 ? 20 
HELX_P HELX_P13 AB4 GLU A 242 ? GLN A 259 ? GLU A 250  GLN A 267  1 ? 18 
HELX_P HELX_P14 AB5 SER B 34  ? TYR B 38  ? SER B 1006 TYR B 1010 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            20 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            25 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             28 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             33 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.057 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    4WNF 
_atom_sites.fract_transf_matrix[1][1]   0.010799 
_atom_sites.fract_transf_matrix[1][2]   0.006235 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012470 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005707 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . SER A 1 4   ? 33.962  31.808 -9.784  1.00 147.05 ? 12   SER A N   1 
ATOM 2    C CA  . SER A 1 4   ? 33.667  31.204 -11.123 1.00 144.33 ? 12   SER A CA  1 
ATOM 3    C C   . SER A 1 4   ? 32.405  31.822 -11.720 1.00 137.09 ? 12   SER A C   1 
ATOM 4    O O   . SER A 1 4   ? 31.748  32.632 -11.063 1.00 125.80 ? 12   SER A O   1 
ATOM 5    C CB  . SER A 1 4   ? 33.501  29.683 -11.000 1.00 141.85 ? 12   SER A CB  1 
ATOM 6    O OG  . SER A 1 4   ? 32.418  29.352 -10.145 1.00 135.75 ? 12   SER A OG  1 
ATOM 7    N N   . MET A 1 5   ? 32.071  31.442 -12.957 1.00 137.95 ? 13   MET A N   1 
ATOM 8    C CA  . MET A 1 5   ? 30.807  31.873 -13.584 1.00 140.31 ? 13   MET A CA  1 
ATOM 9    C C   . MET A 1 5   ? 29.589  31.209 -12.917 1.00 137.23 ? 13   MET A C   1 
ATOM 10   O O   . MET A 1 5   ? 28.479  31.730 -12.997 1.00 124.77 ? 13   MET A O   1 
ATOM 11   C CB  . MET A 1 5   ? 30.794  31.649 -15.118 1.00 143.28 ? 13   MET A CB  1 
ATOM 12   C CG  . MET A 1 5   ? 30.989  30.211 -15.617 1.00 149.57 ? 13   MET A CG  1 
ATOM 13   S SD  . MET A 1 5   ? 30.586  29.990 -17.378 1.00 141.88 ? 13   MET A SD  1 
ATOM 14   C CE  . MET A 1 5   ? 32.056  29.166 -18.000 1.00 128.09 ? 13   MET A CE  1 
ATOM 15   N N   . GLU A 1 6   ? 29.805  30.074 -12.249 1.00 135.17 ? 14   GLU A N   1 
ATOM 16   C CA  . GLU A 1 6   ? 28.745  29.427 -11.474 1.00 123.03 ? 14   GLU A CA  1 
ATOM 17   C C   . GLU A 1 6   ? 28.327  30.383 -10.363 1.00 113.75 ? 14   GLU A C   1 
ATOM 18   O O   . GLU A 1 6   ? 27.219  30.910 -10.370 1.00 104.92 ? 14   GLU A O   1 
ATOM 19   C CB  . GLU A 1 6   ? 29.196  28.077 -10.886 1.00 126.73 ? 14   GLU A CB  1 
ATOM 20   C CG  . GLU A 1 6   ? 30.139  27.239 -11.758 1.00 136.23 ? 14   GLU A CG  1 
ATOM 21   C CD  . GLU A 1 6   ? 29.615  26.979 -13.165 1.00 141.16 ? 14   GLU A CD  1 
ATOM 22   O OE1 . GLU A 1 6   ? 30.414  27.029 -14.132 1.00 133.17 ? 14   GLU A OE1 1 
ATOM 23   O OE2 . GLU A 1 6   ? 28.404  26.712 -13.308 1.00 149.46 ? 14   GLU A OE2 1 
ATOM 24   N N   . ALA A 1 7   ? 29.241  30.648 -9.437  1.00 116.83 ? 15   ALA A N   1 
ATOM 25   C CA  . ALA A 1 7   ? 28.963  31.545 -8.313  1.00 115.58 ? 15   ALA A CA  1 
ATOM 26   C C   . ALA A 1 7   ? 28.165  32.807 -8.716  1.00 106.19 ? 15   ALA A C   1 
ATOM 27   O O   . ALA A 1 7   ? 27.135  33.104 -8.107  1.00 97.20  ? 15   ALA A O   1 
ATOM 28   C CB  . ALA A 1 7   ? 30.263  31.925 -7.613  1.00 113.37 ? 15   ALA A CB  1 
ATOM 29   N N   . SER A 1 8   ? 28.617  33.520 -9.754  1.00 102.36 ? 16   SER A N   1 
ATOM 30   C CA  . SER A 1 8   ? 27.963  34.787 -10.174 1.00 107.92 ? 16   SER A CA  1 
ATOM 31   C C   . SER A 1 8   ? 26.555  34.590 -10.756 1.00 113.90 ? 16   SER A C   1 
ATOM 32   O O   . SER A 1 8   ? 25.662  35.442 -10.577 1.00 100.84 ? 16   SER A O   1 
ATOM 33   C CB  . SER A 1 8   ? 28.814  35.555 -11.188 1.00 102.15 ? 16   SER A CB  1 
ATOM 34   O OG  . SER A 1 8   ? 29.750  36.404 -10.533 1.00 120.69 ? 16   SER A OG  1 
ATOM 35   N N   . CYS A 1 9   ? 26.381  33.482 -11.474 1.00 112.87 ? 17   CYS A N   1 
ATOM 36   C CA  . CYS A 1 9   ? 25.069  33.053 -11.959 1.00 106.96 ? 17   CYS A CA  1 
ATOM 37   C C   . CYS A 1 9   ? 24.179  32.674 -10.782 1.00 107.97 ? 17   CYS A C   1 
ATOM 38   O O   . CYS A 1 9   ? 22.978  32.950 -10.780 1.00 104.73 ? 17   CYS A O   1 
ATOM 39   C CB  . CYS A 1 9   ? 25.221  31.863 -12.919 1.00 110.57 ? 17   CYS A CB  1 
ATOM 40   S SG  . CYS A 1 9   ? 23.741  30.864 -13.206 1.00 105.88 ? 17   CYS A SG  1 
ATOM 41   N N   . LEU A 1 10  ? 24.770  32.051 -9.772  1.00 105.69 ? 18   LEU A N   1 
ATOM 42   C CA  . LEU A 1 10  ? 24.003  31.668 -8.606  1.00 107.59 ? 18   LEU A CA  1 
ATOM 43   C C   . LEU A 1 10  ? 23.520  32.930 -7.902  1.00 99.70  ? 18   LEU A C   1 
ATOM 44   O O   . LEU A 1 10  ? 22.361  33.014 -7.502  1.00 90.52  ? 18   LEU A O   1 
ATOM 45   C CB  . LEU A 1 10  ? 24.832  30.775 -7.670  1.00 115.52 ? 18   LEU A CB  1 
ATOM 46   C CG  . LEU A 1 10  ? 24.076  29.781 -6.764  1.00 122.10 ? 18   LEU A CG  1 
ATOM 47   C CD1 . LEU A 1 10  ? 23.071  28.921 -7.529  1.00 120.10 ? 18   LEU A CD1 1 
ATOM 48   C CD2 . LEU A 1 10  ? 25.061  28.888 -6.007  1.00 116.93 ? 18   LEU A CD2 1 
ATOM 49   N N   . GLU A 1 11  ? 24.402  33.920 -7.785  1.00 96.19  ? 19   GLU A N   1 
ATOM 50   C CA  . GLU A 1 11  ? 24.051  35.186 -7.133  1.00 101.23 ? 19   GLU A CA  1 
ATOM 51   C C   . GLU A 1 11  ? 22.871  35.859 -7.814  1.00 91.67  ? 19   GLU A C   1 
ATOM 52   O O   . GLU A 1 11  ? 21.917  36.266 -7.170  1.00 84.70  ? 19   GLU A O   1 
ATOM 53   C CB  . GLU A 1 11  ? 25.228  36.167 -7.151  1.00 108.45 ? 19   GLU A CB  1 
ATOM 54   C CG  . GLU A 1 11  ? 26.343  35.870 -6.164  1.00 111.12 ? 19   GLU A CG  1 
ATOM 55   C CD  . GLU A 1 11  ? 27.661  36.514 -6.571  1.00 119.90 ? 19   GLU A CD  1 
ATOM 56   O OE1 . GLU A 1 11  ? 27.653  37.455 -7.411  1.00 107.79 ? 19   GLU A OE1 1 
ATOM 57   O OE2 . GLU A 1 11  ? 28.710  36.059 -6.058  1.00 126.08 ? 19   GLU A OE2 1 
ATOM 58   N N   . LEU A 1 12  ? 22.950  35.987 -9.125  1.00 87.64  ? 20   LEU A N   1 
ATOM 59   C CA  . LEU A 1 12  ? 21.969  36.771 -9.844  1.00 96.03  ? 20   LEU A CA  1 
ATOM 60   C C   . LEU A 1 12  ? 20.568  36.179 -9.751  1.00 95.28  ? 20   LEU A C   1 
ATOM 61   O O   . LEU A 1 12  ? 19.571  36.913 -9.698  1.00 91.06  ? 20   LEU A O   1 
ATOM 62   C CB  . LEU A 1 12  ? 22.404  36.920 -11.290 1.00 103.12 ? 20   LEU A CB  1 
ATOM 63   C CG  . LEU A 1 12  ? 23.612  37.854 -11.397 1.00 110.38 ? 20   LEU A CG  1 
ATOM 64   C CD1 . LEU A 1 12  ? 24.495  37.538 -12.596 1.00 114.94 ? 20   LEU A CD1 1 
ATOM 65   C CD2 . LEU A 1 12  ? 23.132  39.298 -11.447 1.00 113.97 ? 20   LEU A CD2 1 
ATOM 66   N N   . ALA A 1 13  ? 20.504  34.852 -9.712  1.00 92.26  ? 21   ALA A N   1 
ATOM 67   C CA  . ALA A 1 13  ? 19.236  34.140 -9.596  1.00 90.56  ? 21   ALA A CA  1 
ATOM 68   C C   . ALA A 1 13  ? 18.635  34.320 -8.224  1.00 90.61  ? 21   ALA A C   1 
ATOM 69   O O   . ALA A 1 13  ? 17.472  34.713 -8.098  1.00 91.55  ? 21   ALA A O   1 
ATOM 70   C CB  . ALA A 1 13  ? 19.445  32.668 -9.866  1.00 97.14  ? 21   ALA A CB  1 
ATOM 71   N N   . LEU A 1 14  ? 19.433  34.016 -7.202  1.00 92.96  ? 22   LEU A N   1 
ATOM 72   C CA  . LEU A 1 14  ? 19.068  34.280 -5.809  1.00 99.03  ? 22   LEU A CA  1 
ATOM 73   C C   . LEU A 1 14  ? 18.472  35.665 -5.632  1.00 99.20  ? 22   LEU A C   1 
ATOM 74   O O   . LEU A 1 14  ? 17.397  35.820 -5.047  1.00 106.07 ? 22   LEU A O   1 
ATOM 75   C CB  . LEU A 1 14  ? 20.287  34.146 -4.904  1.00 104.46 ? 22   LEU A CB  1 
ATOM 76   C CG  . LEU A 1 14  ? 20.719  32.707 -4.598  1.00 114.79 ? 22   LEU A CG  1 
ATOM 77   C CD1 . LEU A 1 14  ? 22.099  32.689 -3.951  1.00 120.17 ? 22   LEU A CD1 1 
ATOM 78   C CD2 . LEU A 1 14  ? 19.705  31.996 -3.706  1.00 110.80 ? 22   LEU A CD2 1 
ATOM 79   N N   . GLU A 1 15  ? 19.168  36.671 -6.145  1.00 93.07  ? 23   GLU A N   1 
ATOM 80   C CA  . GLU A 1 15  ? 18.621  38.007 -6.146  1.00 93.40  ? 23   GLU A CA  1 
ATOM 81   C C   . GLU A 1 15  ? 17.236  37.950 -6.758  1.00 89.04  ? 23   GLU A C   1 
ATOM 82   O O   . GLU A 1 15  ? 16.245  38.183 -6.074  1.00 92.54  ? 23   GLU A O   1 
ATOM 83   C CB  . GLU A 1 15  ? 19.520  38.973 -6.919  1.00 97.45  ? 23   GLU A CB  1 
ATOM 84   C CG  . GLU A 1 15  ? 19.082  40.431 -6.829  1.00 101.61 ? 23   GLU A CG  1 
ATOM 85   C CD  . GLU A 1 15  ? 19.220  41.034 -5.433  1.00 102.94 ? 23   GLU A CD  1 
ATOM 86   O OE1 . GLU A 1 15  ? 19.692  40.336 -4.494  1.00 95.30  ? 23   GLU A OE1 1 
ATOM 87   O OE2 . GLU A 1 15  ? 18.852  42.223 -5.283  1.00 98.93  ? 23   GLU A OE2 1 
ATOM 88   N N   . GLY A 1 16  ? 17.168  37.571 -8.029  1.00 86.06  ? 24   GLY A N   1 
ATOM 89   C CA  . GLY A 1 16  ? 15.904  37.526 -8.758  1.00 86.88  ? 24   GLY A CA  1 
ATOM 90   C C   . GLY A 1 16  ? 14.750  36.926 -7.976  1.00 91.52  ? 24   GLY A C   1 
ATOM 91   O O   . GLY A 1 16  ? 13.597  37.376 -8.098  1.00 83.11  ? 24   GLY A O   1 
ATOM 92   N N   . GLU A 1 17  ? 15.056  35.902 -7.178  1.00 97.56  ? 25   GLU A N   1 
ATOM 93   C CA  . GLU A 1 17  ? 14.038  35.229 -6.381  1.00 101.07 ? 25   GLU A CA  1 
ATOM 94   C C   . GLU A 1 17  ? 13.480  36.165 -5.327  1.00 102.22 ? 25   GLU A C   1 
ATOM 95   O O   . GLU A 1 17  ? 12.264  36.320 -5.229  1.00 99.66  ? 25   GLU A O   1 
ATOM 96   C CB  . GLU A 1 17  ? 14.588  33.962 -5.731  1.00 101.06 ? 25   GLU A CB  1 
ATOM 97   C CG  . GLU A 1 17  ? 14.883  32.844 -6.718  1.00 98.78  ? 25   GLU A CG  1 
ATOM 98   C CD  . GLU A 1 17  ? 14.803  31.461 -6.089  1.00 104.19 ? 25   GLU A CD  1 
ATOM 99   O OE1 . GLU A 1 17  ? 15.445  30.532 -6.614  1.00 106.31 ? 25   GLU A OE1 1 
ATOM 100  O OE2 . GLU A 1 17  ? 14.074  31.284 -5.090  1.00 100.46 ? 25   GLU A OE2 1 
ATOM 101  N N   . ARG A 1 18  ? 14.364  36.809 -4.564  1.00 103.31 ? 26   ARG A N   1 
ATOM 102  C CA  . ARG A 1 18  ? 13.919  37.751 -3.537  1.00 108.36 ? 26   ARG A CA  1 
ATOM 103  C C   . ARG A 1 18  ? 13.130  38.907 -4.171  1.00 105.59 ? 26   ARG A C   1 
ATOM 104  O O   . ARG A 1 18  ? 12.162  39.405 -3.592  1.00 108.56 ? 26   ARG A O   1 
ATOM 105  C CB  . ARG A 1 18  ? 15.091  38.241 -2.657  1.00 113.75 ? 26   ARG A CB  1 
ATOM 106  C CG  . ARG A 1 18  ? 15.882  39.450 -3.147  1.00 123.25 ? 26   ARG A CG  1 
ATOM 107  C CD  . ARG A 1 18  ? 16.855  39.966 -2.080  1.00 122.65 ? 26   ARG A CD  1 
ATOM 108  N NE  . ARG A 1 18  ? 17.426  41.268 -2.438  1.00 121.39 ? 26   ARG A NE  1 
ATOM 109  C CZ  . ARG A 1 18  ? 16.769  42.431 -2.394  1.00 122.23 ? 26   ARG A CZ  1 
ATOM 110  N NH1 . ARG A 1 18  ? 15.498  42.486 -1.999  1.00 121.28 ? 26   ARG A NH1 1 
ATOM 111  N NH2 . ARG A 1 18  ? 17.384  43.557 -2.746  1.00 119.70 ? 26   ARG A NH2 1 
ATOM 112  N N   . LEU A 1 19  ? 13.518  39.285 -5.384  1.00 96.41  ? 27   LEU A N   1 
ATOM 113  C CA  . LEU A 1 19  ? 12.883  40.384 -6.093  1.00 95.23  ? 27   LEU A CA  1 
ATOM 114  C C   . LEU A 1 19  ? 11.461  40.030 -6.520  1.00 98.54  ? 27   LEU A C   1 
ATOM 115  O O   . LEU A 1 19  ? 10.532  40.831 -6.376  1.00 93.66  ? 27   LEU A O   1 
ATOM 116  C CB  . LEU A 1 19  ? 13.709  40.745 -7.324  1.00 97.70  ? 27   LEU A CB  1 
ATOM 117  C CG  . LEU A 1 19  ? 15.196  41.048 -7.129  1.00 96.34  ? 27   LEU A CG  1 
ATOM 118  C CD1 . LEU A 1 19  ? 15.844  41.280 -8.480  1.00 103.35 ? 27   LEU A CD1 1 
ATOM 119  C CD2 . LEU A 1 19  ? 15.400  42.256 -6.235  1.00 97.56  ? 27   LEU A CD2 1 
ATOM 120  N N   . CYS A 1 20  ? 11.300  38.833 -7.069  1.00 107.15 ? 28   CYS A N   1 
ATOM 121  C CA  . CYS A 1 20  ? 9.969   38.337 -7.408  1.00 115.93 ? 28   CYS A CA  1 
ATOM 122  C C   . CYS A 1 20  ? 9.192   38.032 -6.132  1.00 111.19 ? 28   CYS A C   1 
ATOM 123  O O   . CYS A 1 20  ? 8.023   38.414 -6.000  1.00 101.38 ? 28   CYS A O   1 
ATOM 124  C CB  . CYS A 1 20  ? 10.036  37.099 -8.321  1.00 119.27 ? 28   CYS A CB  1 
ATOM 125  S SG  . CYS A 1 20  ? 9.769   37.459 -10.079 1.00 125.89 ? 28   CYS A SG  1 
ATOM 126  N N   . LYS A 1 21  ? 9.855   37.356 -5.194  1.00 109.25 ? 29   LYS A N   1 
ATOM 127  C CA  . LYS A 1 21  ? 9.271   37.062 -3.886  1.00 107.04 ? 29   LYS A CA  1 
ATOM 128  C C   . LYS A 1 21  ? 8.713   38.335 -3.259  1.00 112.27 ? 29   LYS A C   1 
ATOM 129  O O   . LYS A 1 21  ? 7.677   38.286 -2.602  1.00 119.16 ? 29   LYS A O   1 
ATOM 130  C CB  . LYS A 1 21  ? 10.309  36.417 -2.957  1.00 100.09 ? 29   LYS A CB  1 
ATOM 131  C CG  . LYS A 1 21  ? 9.844   36.198 -1.529  1.00 99.80  ? 29   LYS A CG  1 
ATOM 132  N N   . SER A 1 22  ? 9.385   39.469 -3.493  1.00 111.46 ? 30   SER A N   1 
ATOM 133  C CA  . SER A 1 22  ? 9.014   40.749 -2.876  1.00 106.70 ? 30   SER A CA  1 
ATOM 134  C C   . SER A 1 22  ? 8.322   41.742 -3.816  1.00 107.63 ? 30   SER A C   1 
ATOM 135  O O   . SER A 1 22  ? 8.501   42.953 -3.675  1.00 102.09 ? 30   SER A O   1 
ATOM 136  C CB  . SER A 1 22  ? 10.257  41.421 -2.283  1.00 104.88 ? 30   SER A CB  1 
ATOM 137  O OG  . SER A 1 22  ? 11.007  42.083 -3.290  1.00 97.41  ? 30   SER A OG  1 
ATOM 138  N N   . GLY A 1 23  ? 7.544   41.247 -4.771  1.00 109.48 ? 31   GLY A N   1 
ATOM 139  C CA  . GLY A 1 23  ? 6.703   42.124 -5.581  1.00 111.56 ? 31   GLY A CA  1 
ATOM 140  C C   . GLY A 1 23  ? 7.255   42.623 -6.913  1.00 112.43 ? 31   GLY A C   1 
ATOM 141  O O   . GLY A 1 23  ? 6.496   42.772 -7.868  1.00 111.40 ? 31   GLY A O   1 
ATOM 142  N N   . ASP A 1 24  ? 8.546   42.912 -7.013  1.00 116.86 ? 32   ASP A N   1 
ATOM 143  C CA  . ASP A 1 24  ? 9.044   43.450 -8.278  1.00 128.99 ? 32   ASP A CA  1 
ATOM 144  C C   . ASP A 1 24  ? 9.627   42.364 -9.167  1.00 133.85 ? 32   ASP A C   1 
ATOM 145  O O   . ASP A 1 24  ? 10.838  42.095 -9.149  1.00 120.17 ? 32   ASP A O   1 
ATOM 146  C CB  . ASP A 1 24  ? 10.045  44.580 -8.073  1.00 134.78 ? 32   ASP A CB  1 
ATOM 147  C CG  . ASP A 1 24  ? 10.021  45.561 -9.217  1.00 143.33 ? 32   ASP A CG  1 
ATOM 148  O OD1 . ASP A 1 24  ? 8.933   46.123 -9.476  1.00 147.78 ? 32   ASP A OD1 1 
ATOM 149  O OD2 . ASP A 1 24  ? 11.068  45.756 -9.869  1.00 143.43 ? 32   ASP A OD2 1 
ATOM 150  N N   . CYS A 1 25  ? 8.740   41.745 -9.947  1.00 134.05 ? 33   CYS A N   1 
ATOM 151  C CA  . CYS A 1 25  ? 9.126   40.669 -10.856 1.00 126.67 ? 33   CYS A CA  1 
ATOM 152  C C   . CYS A 1 25  ? 9.734   41.224 -12.142 1.00 112.98 ? 33   CYS A C   1 
ATOM 153  O O   . CYS A 1 25  ? 10.533  40.540 -12.770 1.00 109.83 ? 33   CYS A O   1 
ATOM 154  C CB  . CYS A 1 25  ? 7.941   39.722 -11.160 1.00 131.11 ? 33   CYS A CB  1 
ATOM 155  S SG  . CYS A 1 25  ? 7.850   38.195 -10.152 1.00 137.00 ? 33   CYS A SG  1 
ATOM 156  N N   . ARG A 1 26  ? 9.374   42.456 -12.517 1.00 101.06 ? 34   ARG A N   1 
ATOM 157  C CA  . ARG A 1 26  ? 9.955   43.123 -13.700 1.00 87.86  ? 34   ARG A CA  1 
ATOM 158  C C   . ARG A 1 26  ? 11.480  43.172 -13.639 1.00 87.15  ? 34   ARG A C   1 
ATOM 159  O O   . ARG A 1 26  ? 12.171  42.957 -14.647 1.00 81.17  ? 34   ARG A O   1 
ATOM 160  C CB  . ARG A 1 26  ? 9.426   44.552 -13.848 1.00 83.48  ? 34   ARG A CB  1 
ATOM 161  C CG  . ARG A 1 26  ? 8.178   44.678 -14.691 1.00 86.93  ? 34   ARG A CG  1 
ATOM 162  C CD  . ARG A 1 26  ? 7.934   46.117 -15.098 1.00 97.16  ? 34   ARG A CD  1 
ATOM 163  N NE  . ARG A 1 26  ? 6.680   46.270 -15.836 1.00 104.30 ? 34   ARG A NE  1 
ATOM 164  N N   . ALA A 1 27  ? 11.992  43.477 -12.454 1.00 87.27  ? 35   ALA A N   1 
ATOM 165  C CA  . ALA A 1 27  ? 13.420  43.544 -12.239 1.00 96.45  ? 35   ALA A CA  1 
ATOM 166  C C   . ALA A 1 27  ? 13.952  42.142 -12.069 1.00 99.08  ? 35   ALA A C   1 
ATOM 167  O O   . ALA A 1 27  ? 15.044  41.823 -12.534 1.00 107.56 ? 35   ALA A O   1 
ATOM 168  C CB  . ALA A 1 27  ? 13.728  44.365 -11.008 1.00 103.84 ? 35   ALA A CB  1 
ATOM 169  N N   . GLY A 1 28  ? 13.176  41.309 -11.387 1.00 96.98  ? 36   GLY A N   1 
ATOM 170  C CA  . GLY A 1 28  ? 13.528  39.907 -11.201 1.00 97.16  ? 36   GLY A CA  1 
ATOM 171  C C   . GLY A 1 28  ? 13.813  39.217 -12.516 1.00 89.94  ? 36   GLY A C   1 
ATOM 172  O O   . GLY A 1 28  ? 14.781  38.466 -12.636 1.00 95.08  ? 36   GLY A O   1 
ATOM 173  N N   . VAL A 1 29  ? 12.974  39.487 -13.509 1.00 86.20  ? 37   VAL A N   1 
ATOM 174  C CA  . VAL A 1 29  ? 13.166  38.934 -14.839 1.00 87.86  ? 37   VAL A CA  1 
ATOM 175  C C   . VAL A 1 29  ? 14.555  39.278 -15.296 1.00 83.29  ? 37   VAL A C   1 
ATOM 176  O O   . VAL A 1 29  ? 15.327  38.401 -15.680 1.00 89.09  ? 37   VAL A O   1 
ATOM 177  C CB  . VAL A 1 29  ? 12.189  39.539 -15.857 1.00 93.21  ? 37   VAL A CB  1 
ATOM 178  C CG1 . VAL A 1 29  ? 12.612  39.175 -17.278 1.00 96.34  ? 37   VAL A CG1 1 
ATOM 179  C CG2 . VAL A 1 29  ? 10.759  39.084 -15.571 1.00 90.27  ? 37   VAL A CG2 1 
ATOM 180  N N   . SER A 1 30  ? 14.869  40.567 -15.230 1.00 81.60  ? 38   SER A N   1 
ATOM 181  C CA  . SER A 1 30  ? 16.167  41.059 -15.670 1.00 82.70  ? 38   SER A CA  1 
ATOM 182  C C   . SER A 1 30  ? 17.299  40.309 -14.973 1.00 78.35  ? 38   SER A C   1 
ATOM 183  O O   . SER A 1 30  ? 18.248  39.891 -15.618 1.00 79.95  ? 38   SER A O   1 
ATOM 184  C CB  . SER A 1 30  ? 16.282  42.575 -15.473 1.00 83.17  ? 38   SER A CB  1 
ATOM 185  O OG  . SER A 1 30  ? 15.372  43.300 -16.315 1.00 85.81  ? 38   SER A OG  1 
ATOM 186  N N   . PHE A 1 31  ? 17.181  40.080 -13.676 1.00 81.53  ? 39   PHE A N   1 
ATOM 187  C CA  . PHE A 1 31  ? 18.243  39.361 -12.972 1.00 92.52  ? 39   PHE A CA  1 
ATOM 188  C C   . PHE A 1 31  ? 18.326  37.900 -13.417 1.00 92.87  ? 39   PHE A C   1 
ATOM 189  O O   . PHE A 1 31  ? 19.421  37.333 -13.514 1.00 95.34  ? 39   PHE A O   1 
ATOM 190  C CB  . PHE A 1 31  ? 18.133  39.529 -11.440 1.00 94.60  ? 39   PHE A CB  1 
ATOM 191  C CG  . PHE A 1 31  ? 18.696  40.842 -10.952 1.00 104.42 ? 39   PHE A CG  1 
ATOM 192  C CD1 . PHE A 1 31  ? 17.956  42.023 -11.067 1.00 107.31 ? 39   PHE A CD1 1 
ATOM 193  C CD2 . PHE A 1 31  ? 19.987  40.918 -10.445 1.00 104.14 ? 39   PHE A CD2 1 
ATOM 194  C CE1 . PHE A 1 31  ? 18.478  43.239 -10.652 1.00 102.07 ? 39   PHE A CE1 1 
ATOM 195  C CE2 . PHE A 1 31  ? 20.513  42.133 -10.027 1.00 104.37 ? 39   PHE A CE2 1 
ATOM 196  C CZ  . PHE A 1 31  ? 19.757  43.293 -10.124 1.00 101.84 ? 39   PHE A CZ  1 
ATOM 197  N N   . PHE A 1 32  ? 17.183  37.307 -13.736 1.00 86.52  ? 40   PHE A N   1 
ATOM 198  C CA  . PHE A 1 32  ? 17.177  35.938 -14.215 1.00 83.29  ? 40   PHE A CA  1 
ATOM 199  C C   . PHE A 1 32  ? 17.815  35.858 -15.589 1.00 80.83  ? 40   PHE A C   1 
ATOM 200  O O   . PHE A 1 32  ? 18.750  35.087 -15.791 1.00 88.27  ? 40   PHE A O   1 
ATOM 201  C CB  . PHE A 1 32  ? 15.762  35.370 -14.240 1.00 85.52  ? 40   PHE A CB  1 
ATOM 202  C CG  . PHE A 1 32  ? 15.204  35.065 -12.872 1.00 79.59  ? 40   PHE A CG  1 
ATOM 203  C CD1 . PHE A 1 32  ? 15.920  34.274 -11.972 1.00 76.41  ? 40   PHE A CD1 1 
ATOM 204  C CD2 . PHE A 1 32  ? 13.950  35.528 -12.502 1.00 72.37  ? 40   PHE A CD2 1 
ATOM 205  C CE1 . PHE A 1 32  ? 15.408  33.980 -10.725 1.00 73.31  ? 40   PHE A CE1 1 
ATOM 206  C CE2 . PHE A 1 32  ? 13.435  35.241 -11.255 1.00 69.19  ? 40   PHE A CE2 1 
ATOM 207  C CZ  . PHE A 1 32  ? 14.160  34.469 -10.366 1.00 71.05  ? 40   PHE A CZ  1 
ATOM 208  N N   . GLU A 1 33  ? 17.338  36.676 -16.518 1.00 75.82  ? 41   GLU A N   1 
ATOM 209  C CA  . GLU A 1 33  ? 17.956  36.762 -17.847 1.00 83.73  ? 41   GLU A CA  1 
ATOM 210  C C   . GLU A 1 33  ? 19.455  36.938 -17.745 1.00 80.13  ? 41   GLU A C   1 
ATOM 211  O O   . GLU A 1 33  ? 20.232  36.272 -18.421 1.00 83.98  ? 41   GLU A O   1 
ATOM 212  C CB  . GLU A 1 33  ? 17.390  37.941 -18.634 1.00 89.53  ? 41   GLU A CB  1 
ATOM 213  C CG  . GLU A 1 33  ? 15.881  37.891 -18.824 1.00 96.01  ? 41   GLU A CG  1 
ATOM 214  C CD  . GLU A 1 33  ? 15.437  38.441 -20.158 1.00 102.08 ? 41   GLU A CD  1 
ATOM 215  O OE1 . GLU A 1 33  ? 14.671  39.424 -20.156 1.00 111.75 ? 41   GLU A OE1 1 
ATOM 216  O OE2 . GLU A 1 33  ? 15.857  37.892 -21.204 1.00 109.67 ? 41   GLU A OE2 1 
ATOM 217  N N   . ALA A 1 34  ? 19.847  37.858 -16.884 1.00 84.65  ? 42   ALA A N   1 
ATOM 218  C CA  . ALA A 1 34  ? 21.243  38.137 -16.646 1.00 82.76  ? 42   ALA A CA  1 
ATOM 219  C C   . ALA A 1 34  ? 21.959  36.866 -16.255 1.00 77.63  ? 42   ALA A C   1 
ATOM 220  O O   . ALA A 1 34  ? 22.955  36.515 -16.857 1.00 78.97  ? 42   ALA A O   1 
ATOM 221  C CB  . ALA A 1 34  ? 21.386  39.189 -15.559 1.00 84.68  ? 42   ALA A CB  1 
ATOM 222  N N   . ALA A 1 35  ? 21.436  36.173 -15.253 1.00 79.54  ? 43   ALA A N   1 
ATOM 223  C CA  . ALA A 1 35  ? 22.010  34.897 -14.805 1.00 82.56  ? 43   ALA A CA  1 
ATOM 224  C C   . ALA A 1 35  ? 22.101  33.880 -15.937 1.00 85.82  ? 43   ALA A C   1 
ATOM 225  O O   . ALA A 1 35  ? 23.016  33.056 -15.980 1.00 97.23  ? 43   ALA A O   1 
ATOM 226  C CB  . ALA A 1 35  ? 21.188  34.320 -13.667 1.00 81.98  ? 43   ALA A CB  1 
ATOM 227  N N   . VAL A 1 36  ? 21.138  33.930 -16.842 1.00 85.47  ? 44   VAL A N   1 
ATOM 228  C CA  . VAL A 1 36  ? 21.183  33.117 -18.044 1.00 88.71  ? 44   VAL A CA  1 
ATOM 229  C C   . VAL A 1 36  ? 22.403  33.506 -18.874 1.00 83.05  ? 44   VAL A C   1 
ATOM 230  O O   . VAL A 1 36  ? 23.206  32.643 -19.256 1.00 76.68  ? 44   VAL A O   1 
ATOM 231  C CB  . VAL A 1 36  ? 19.873  33.272 -18.854 1.00 93.45  ? 44   VAL A CB  1 
ATOM 232  C CG1 . VAL A 1 36  ? 20.036  32.794 -20.282 1.00 96.41  ? 44   VAL A CG1 1 
ATOM 233  C CG2 . VAL A 1 36  ? 18.755  32.504 -18.167 1.00 95.93  ? 44   VAL A CG2 1 
ATOM 234  N N   . GLN A 1 37  ? 22.529  34.810 -19.123 1.00 85.68  ? 45   GLN A N   1 
ATOM 235  C CA  . GLN A 1 37  ? 23.662  35.401 -19.872 1.00 94.47  ? 45   GLN A CA  1 
ATOM 236  C C   . GLN A 1 37  ? 25.051  35.040 -19.285 1.00 96.33  ? 45   GLN A C   1 
ATOM 237  O O   . GLN A 1 37  ? 26.052  34.938 -20.004 1.00 93.80  ? 45   GLN A O   1 
ATOM 238  C CB  . GLN A 1 37  ? 23.497  36.925 -19.915 1.00 93.24  ? 45   GLN A CB  1 
ATOM 239  C CG  . GLN A 1 37  ? 24.314  37.618 -20.984 1.00 98.56  ? 45   GLN A CG  1 
ATOM 240  C CD  . GLN A 1 37  ? 23.715  37.469 -22.363 1.00 106.76 ? 45   GLN A CD  1 
ATOM 241  O OE1 . GLN A 1 37  ? 22.515  37.664 -22.553 1.00 119.35 ? 45   GLN A OE1 1 
ATOM 242  N NE2 . GLN A 1 37  ? 24.552  37.137 -23.342 1.00 118.15 ? 45   GLN A NE2 1 
ATOM 243  N N   . VAL A 1 38  ? 25.092  34.856 -17.974 1.00 95.26  ? 46   VAL A N   1 
ATOM 244  C CA  . VAL A 1 38  ? 26.277  34.381 -17.301 1.00 95.90  ? 46   VAL A CA  1 
ATOM 245  C C   . VAL A 1 38  ? 26.371  32.875 -17.504 1.00 95.36  ? 46   VAL A C   1 
ATOM 246  O O   . VAL A 1 38  ? 27.352  32.383 -18.050 1.00 96.82  ? 46   VAL A O   1 
ATOM 247  C CB  . VAL A 1 38  ? 26.221  34.695 -15.792 1.00 100.83 ? 46   VAL A CB  1 
ATOM 248  C CG1 . VAL A 1 38  ? 27.502  34.240 -15.107 1.00 104.99 ? 46   VAL A CG1 1 
ATOM 249  C CG2 . VAL A 1 38  ? 25.992  36.184 -15.552 1.00 97.61  ? 46   VAL A CG2 1 
ATOM 250  N N   . GLY A 1 39  ? 25.351  32.148 -17.053 1.00 96.77  ? 47   GLY A N   1 
ATOM 251  C CA  . GLY A 1 39  ? 25.265  30.706 -17.287 1.00 105.01 ? 47   GLY A CA  1 
ATOM 252  C C   . GLY A 1 39  ? 26.065  29.814 -16.341 1.00 103.88 ? 47   GLY A C   1 
ATOM 253  O O   . GLY A 1 39  ? 26.875  30.282 -15.538 1.00 103.32 ? 47   GLY A O   1 
ATOM 254  N N   . THR A 1 40  ? 25.847  28.510 -16.473 1.00 99.44  ? 48   THR A N   1 
ATOM 255  C CA  . THR A 1 40  ? 26.318  27.552 -15.495 1.00 98.35  ? 48   THR A CA  1 
ATOM 256  C C   . THR A 1 40  ? 26.302  26.131 -16.058 1.00 102.79 ? 48   THR A C   1 
ATOM 257  O O   . THR A 1 40  ? 25.464  25.793 -16.893 1.00 110.94 ? 48   THR A O   1 
ATOM 258  C CB  . THR A 1 40  ? 25.428  27.607 -14.236 1.00 102.14 ? 48   THR A CB  1 
ATOM 259  O OG1 . THR A 1 40  ? 25.687  26.474 -13.399 1.00 106.05 ? 48   THR A OG1 1 
ATOM 260  C CG2 . THR A 1 40  ? 23.954  27.607 -14.614 1.00 99.48  ? 48   THR A CG2 1 
ATOM 261  N N   . GLU A 1 41  ? 27.230  25.306 -15.583 1.00 105.88 ? 49   GLU A N   1 
ATOM 262  C CA  . GLU A 1 41  ? 27.296  23.893 -15.955 1.00 107.37 ? 49   GLU A CA  1 
ATOM 263  C C   . GLU A 1 41  ? 26.337  23.037 -15.138 1.00 107.96 ? 49   GLU A C   1 
ATOM 264  O O   . GLU A 1 41  ? 26.278  21.824 -15.329 1.00 103.59 ? 49   GLU A O   1 
ATOM 265  C CB  . GLU A 1 41  ? 28.704  23.365 -15.719 1.00 118.87 ? 49   GLU A CB  1 
ATOM 266  C CG  . GLU A 1 41  ? 29.757  23.958 -16.635 1.00 125.99 ? 49   GLU A CG  1 
ATOM 267  C CD  . GLU A 1 41  ? 31.161  23.783 -16.091 1.00 128.23 ? 49   GLU A CD  1 
ATOM 268  O OE1 . GLU A 1 41  ? 31.332  23.091 -15.061 1.00 122.60 ? 49   GLU A OE1 1 
ATOM 269  O OE2 . GLU A 1 41  ? 32.094  24.345 -16.700 1.00 126.65 ? 49   GLU A OE2 1 
ATOM 270  N N   . ASP A 1 42  ? 25.625  23.660 -14.200 1.00 109.77 ? 50   ASP A N   1 
ATOM 271  C CA  . ASP A 1 42  ? 24.665  22.964 -13.346 1.00 103.93 ? 50   ASP A CA  1 
ATOM 272  C C   . ASP A 1 42  ? 23.257  23.185 -13.866 1.00 98.04  ? 50   ASP A C   1 
ATOM 273  O O   . ASP A 1 42  ? 22.643  24.228 -13.620 1.00 106.79 ? 50   ASP A O   1 
ATOM 274  C CB  . ASP A 1 42  ? 24.763  23.466 -11.909 1.00 109.69 ? 50   ASP A CB  1 
ATOM 275  C CG  . ASP A 1 42  ? 23.744  22.818 -10.991 1.00 106.96 ? 50   ASP A CG  1 
ATOM 276  O OD1 . ASP A 1 42  ? 22.985  21.947 -11.454 1.00 95.02  ? 50   ASP A OD1 1 
ATOM 277  O OD2 . ASP A 1 42  ? 23.696  23.194 -9.802  1.00 119.65 ? 50   ASP A OD2 1 
ATOM 278  N N   . LEU A 1 43  ? 22.739  22.182 -14.558 1.00 92.67  ? 51   LEU A N   1 
ATOM 279  C CA  . LEU A 1 43  ? 21.471  22.309 -15.253 1.00 92.61  ? 51   LEU A CA  1 
ATOM 280  C C   . LEU A 1 43  ? 20.301  22.288 -14.309 1.00 94.08  ? 51   LEU A C   1 
ATOM 281  O O   . LEU A 1 43  ? 19.236  22.814 -14.629 1.00 98.24  ? 51   LEU A O   1 
ATOM 282  C CB  . LEU A 1 43  ? 21.317  21.211 -16.293 1.00 90.55  ? 51   LEU A CB  1 
ATOM 283  C CG  . LEU A 1 43  ? 22.421  21.215 -17.352 1.00 96.60  ? 51   LEU A CG  1 
ATOM 284  C CD1 . LEU A 1 43  ? 22.090  20.173 -18.406 1.00 96.81  ? 51   LEU A CD1 1 
ATOM 285  C CD2 . LEU A 1 43  ? 22.638  22.592 -17.992 1.00 96.83  ? 51   LEU A CD2 1 
ATOM 286  N N   . LYS A 1 44  ? 20.475  21.692 -13.140 1.00 95.82  ? 52   LYS A N   1 
ATOM 287  C CA  . LYS A 1 44  ? 19.419  21.776 -12.155 1.00 97.96  ? 52   LYS A CA  1 
ATOM 288  C C   . LYS A 1 44  ? 19.119  23.262 -11.967 1.00 93.21  ? 52   LYS A C   1 
ATOM 289  O O   . LYS A 1 44  ? 17.987  23.704 -12.123 1.00 92.89  ? 52   LYS A O   1 
ATOM 290  C CB  . LYS A 1 44  ? 19.817  21.117 -10.828 1.00 98.95  ? 52   LYS A CB  1 
ATOM 291  C CG  . LYS A 1 44  ? 18.707  20.281 -10.212 1.00 101.17 ? 52   LYS A CG  1 
ATOM 292  C CD  . LYS A 1 44  ? 17.382  21.034 -10.174 1.00 105.29 ? 52   LYS A CD  1 
ATOM 293  C CE  . LYS A 1 44  ? 16.240  20.133 -9.740  1.00 112.65 ? 52   LYS A CE  1 
ATOM 294  N NZ  . LYS A 1 44  ? 14.912  20.801 -9.909  1.00 120.65 ? 52   LYS A NZ  1 
ATOM 295  N N   . THR A 1 45  ? 20.169  24.026 -11.694 1.00 92.28  ? 53   THR A N   1 
ATOM 296  C CA  . THR A 1 45  ? 20.058  25.455 -11.478 1.00 94.38  ? 53   THR A CA  1 
ATOM 297  C C   . THR A 1 45  ? 19.465  26.177 -12.678 1.00 95.18  ? 53   THR A C   1 
ATOM 298  O O   . THR A 1 45  ? 18.551  26.989 -12.528 1.00 98.34  ? 53   THR A O   1 
ATOM 299  C CB  . THR A 1 45  ? 21.430  26.089 -11.196 1.00 96.27  ? 53   THR A CB  1 
ATOM 300  O OG1 . THR A 1 45  ? 22.110  25.370 -10.153 1.00 95.57  ? 53   THR A OG1 1 
ATOM 301  C CG2 . THR A 1 45  ? 21.254  27.529 -10.780 1.00 91.12  ? 53   THR A CG2 1 
ATOM 302  N N   . LEU A 1 46  ? 19.992  25.903 -13.866 1.00 88.32  ? 54   LEU A N   1 
ATOM 303  C CA  . LEU A 1 46  ? 19.465  26.546 -15.075 1.00 86.92  ? 54   LEU A CA  1 
ATOM 304  C C   . LEU A 1 46  ? 17.969  26.271 -15.233 1.00 87.14  ? 54   LEU A C   1 
ATOM 305  O O   . LEU A 1 46  ? 17.170  27.198 -15.431 1.00 80.23  ? 54   LEU A O   1 
ATOM 306  C CB  . LEU A 1 46  ? 20.224  26.075 -16.307 1.00 87.63  ? 54   LEU A CB  1 
ATOM 307  C CG  . LEU A 1 46  ? 20.270  27.026 -17.508 1.00 97.46  ? 54   LEU A CG  1 
ATOM 308  C CD1 . LEU A 1 46  ? 20.634  28.460 -17.156 1.00 100.91 ? 54   LEU A CD1 1 
ATOM 309  C CD2 . LEU A 1 46  ? 21.277  26.492 -18.506 1.00 102.63 ? 54   LEU A CD2 1 
ATOM 310  N N   . SER A 1 47  ? 17.605  24.992 -15.110 1.00 90.69  ? 55   SER A N   1 
ATOM 311  C CA  . SER A 1 47  ? 16.208  24.550 -15.138 1.00 89.28  ? 55   SER A CA  1 
ATOM 312  C C   . SER A 1 47  ? 15.368  25.421 -14.229 1.00 82.21  ? 55   SER A C   1 
ATOM 313  O O   . SER A 1 47  ? 14.364  25.997 -14.644 1.00 77.72  ? 55   SER A O   1 
ATOM 314  C CB  . SER A 1 47  ? 16.096  23.089 -14.683 1.00 94.67  ? 55   SER A CB  1 
ATOM 315  O OG  . SER A 1 47  ? 14.739  22.668 -14.593 1.00 101.02 ? 55   SER A OG  1 
ATOM 316  N N   . ALA A 1 48  ? 15.798  25.520 -12.982 1.00 73.59  ? 56   ALA A N   1 
ATOM 317  C CA  . ALA A 1 48  ? 15.105  26.344 -12.027 1.00 74.03  ? 56   ALA A CA  1 
ATOM 318  C C   . ALA A 1 48  ? 14.886  27.749 -12.597 1.00 72.46  ? 56   ALA A C   1 
ATOM 319  O O   . ALA A 1 48  ? 13.779  28.284 -12.560 1.00 72.22  ? 56   ALA A O   1 
ATOM 320  C CB  . ALA A 1 48  ? 15.888  26.399 -10.731 1.00 73.95  ? 56   ALA A CB  1 
ATOM 321  N N   . ILE A 1 49  ? 15.935  28.317 -13.173 1.00 74.05  ? 57   ILE A N   1 
ATOM 322  C CA  . ILE A 1 49  ? 15.899  29.711 -13.587 1.00 78.20  ? 57   ILE A CA  1 
ATOM 323  C C   . ILE A 1 49  ? 14.906  29.936 -14.712 1.00 73.51  ? 57   ILE A C   1 
ATOM 324  O O   . ILE A 1 49  ? 14.152  30.899 -14.693 1.00 62.65  ? 57   ILE A O   1 
ATOM 325  C CB  . ILE A 1 49  ? 17.295  30.203 -14.010 1.00 79.73  ? 57   ILE A CB  1 
ATOM 326  C CG1 . ILE A 1 49  ? 18.247  30.136 -12.810 1.00 83.92  ? 57   ILE A CG1 1 
ATOM 327  C CG2 . ILE A 1 49  ? 17.226  31.633 -14.541 1.00 77.08  ? 57   ILE A CG2 1 
ATOM 328  C CD1 . ILE A 1 49  ? 19.701  29.957 -13.180 1.00 90.26  ? 57   ILE A CD1 1 
ATOM 329  N N   . TYR A 1 50  ? 14.906  29.042 -15.694 1.00 77.82  ? 58   TYR A N   1 
ATOM 330  C CA  . TYR A 1 50  ? 13.959  29.164 -16.802 1.00 80.17  ? 58   TYR A CA  1 
ATOM 331  C C   . TYR A 1 50  ? 12.520  29.113 -16.267 1.00 79.23  ? 58   TYR A C   1 
ATOM 332  O O   . TYR A 1 50  ? 11.612  29.762 -16.793 1.00 77.01  ? 58   TYR A O   1 
ATOM 333  C CB  . TYR A 1 50  ? 14.119  28.039 -17.830 1.00 78.47  ? 58   TYR A CB  1 
ATOM 334  C CG  . TYR A 1 50  ? 15.446  27.913 -18.574 1.00 78.44  ? 58   TYR A CG  1 
ATOM 335  C CD1 . TYR A 1 50  ? 16.191  29.013 -18.970 1.00 78.26  ? 58   TYR A CD1 1 
ATOM 336  C CD2 . TYR A 1 50  ? 15.909  26.652 -18.939 1.00 81.60  ? 58   TYR A CD2 1 
ATOM 337  C CE1 . TYR A 1 50  ? 17.396  28.840 -19.660 1.00 86.55  ? 58   TYR A CE1 1 
ATOM 338  C CE2 . TYR A 1 50  ? 17.089  26.468 -19.632 1.00 82.36  ? 58   TYR A CE2 1 
ATOM 339  C CZ  . TYR A 1 50  ? 17.838  27.545 -20.002 1.00 82.79  ? 58   TYR A CZ  1 
ATOM 340  O OH  . TYR A 1 50  ? 19.011  27.274 -20.700 1.00 73.89  ? 58   TYR A OH  1 
ATOM 341  N N   . SER A 1 51  ? 12.315  28.324 -15.223 1.00 79.25  ? 59   SER A N   1 
ATOM 342  C CA  . SER A 1 51  ? 11.004  28.171 -14.682 1.00 74.96  ? 59   SER A CA  1 
ATOM 343  C C   . SER A 1 51  ? 10.569  29.510 -14.141 1.00 81.38  ? 59   SER A C   1 
ATOM 344  O O   . SER A 1 51  ? 9.480   30.020 -14.468 1.00 81.43  ? 59   SER A O   1 
ATOM 345  C CB  . SER A 1 51  ? 11.003  27.128 -13.592 1.00 77.68  ? 59   SER A CB  1 
ATOM 346  O OG  . SER A 1 51  ? 9.691   26.628 -13.461 1.00 93.18  ? 59   SER A OG  1 
ATOM 347  N N   . GLN A 1 52  ? 11.462  30.101 -13.352 1.00 81.49  ? 60   GLN A N   1 
ATOM 348  C CA  . GLN A 1 52  ? 11.208  31.390 -12.723 1.00 78.86  ? 60   GLN A CA  1 
ATOM 349  C C   . GLN A 1 52  ? 10.840  32.417 -13.781 1.00 73.05  ? 60   GLN A C   1 
ATOM 350  O O   . GLN A 1 52  ? 9.896   33.169 -13.633 1.00 75.27  ? 60   GLN A O   1 
ATOM 351  C CB  . GLN A 1 52  ? 12.443  31.843 -11.964 1.00 87.67  ? 60   GLN A CB  1 
ATOM 352  C CG  . GLN A 1 52  ? 12.904  30.873 -10.876 1.00 99.03  ? 60   GLN A CG  1 
ATOM 353  C CD  . GLN A 1 52  ? 12.440  31.239 -9.468  1.00 103.03 ? 60   GLN A CD  1 
ATOM 354  O OE1 . GLN A 1 52  ? 11.514  32.049 -9.261  1.00 98.24  ? 60   GLN A OE1 1 
ATOM 355  N NE2 . GLN A 1 52  ? 13.089  30.631 -8.484  1.00 107.02 ? 60   GLN A NE2 1 
ATOM 356  N N   . LEU A 1 53  ? 11.576  32.422 -14.874 1.00 69.17  ? 61   LEU A N   1 
ATOM 357  C CA  . LEU A 1 53  ? 11.255  33.298 -15.967 1.00 70.42  ? 61   LEU A CA  1 
ATOM 358  C C   . LEU A 1 53  ? 9.888   32.994 -16.558 1.00 72.34  ? 61   LEU A C   1 
ATOM 359  O O   . LEU A 1 53  ? 9.085   33.903 -16.804 1.00 72.99  ? 61   LEU A O   1 
ATOM 360  C CB  . LEU A 1 53  ? 12.332  33.190 -17.023 1.00 72.94  ? 61   LEU A CB  1 
ATOM 361  C CG  . LEU A 1 53  ? 13.598  33.891 -16.538 1.00 75.01  ? 61   LEU A CG  1 
ATOM 362  C CD1 . LEU A 1 53  ? 14.827  33.075 -16.881 1.00 79.81  ? 61   LEU A CD1 1 
ATOM 363  C CD2 . LEU A 1 53  ? 13.672  35.282 -17.143 1.00 76.26  ? 61   LEU A CD2 1 
ATOM 364  N N   . GLY A 1 54  ? 9.615   31.714 -16.773 1.00 69.90  ? 62   GLY A N   1 
ATOM 365  C CA  . GLY A 1 54  ? 8.339   31.316 -17.318 1.00 69.03  ? 62   GLY A CA  1 
ATOM 366  C C   . GLY A 1 54  ? 7.173   31.897 -16.537 1.00 69.97  ? 62   GLY A C   1 
ATOM 367  O O   . GLY A 1 54  ? 6.212   32.392 -17.121 1.00 66.00  ? 62   GLY A O   1 
ATOM 368  N N   . ASN A 1 55  ? 7.255   31.838 -15.213 1.00 70.31  ? 63   ASN A N   1 
ATOM 369  C CA  . ASN A 1 55  ? 6.149   32.300 -14.381 1.00 76.24  ? 63   ASN A CA  1 
ATOM 370  C C   . ASN A 1 55  ? 6.127   33.824 -14.349 1.00 69.91  ? 63   ASN A C   1 
ATOM 371  O O   . ASN A 1 55  ? 5.093   34.464 -14.585 1.00 64.44  ? 63   ASN A O   1 
ATOM 372  C CB  . ASN A 1 55  ? 6.252   31.727 -12.960 1.00 77.80  ? 63   ASN A CB  1 
ATOM 373  C CG  . ASN A 1 55  ? 6.031   30.211 -12.904 1.00 86.40  ? 63   ASN A CG  1 
ATOM 374  O OD1 . ASN A 1 55  ? 5.361   29.617 -13.764 1.00 83.73  ? 63   ASN A OD1 1 
ATOM 375  N ND2 . ASN A 1 55  ? 6.582   29.580 -11.866 1.00 89.93  ? 63   ASN A ND2 1 
ATOM 376  N N   . ALA A 1 56  ? 7.289   34.392 -14.059 1.00 68.24  ? 64   ALA A N   1 
ATOM 377  C CA  . ALA A 1 56  ? 7.480   35.828 -14.114 1.00 69.14  ? 64   ALA A CA  1 
ATOM 378  C C   . ALA A 1 56  ? 6.740   36.355 -15.323 1.00 69.34  ? 64   ALA A C   1 
ATOM 379  O O   . ALA A 1 56  ? 5.791   37.119 -15.190 1.00 71.74  ? 64   ALA A O   1 
ATOM 380  C CB  . ALA A 1 56  ? 8.962   36.163 -14.198 1.00 63.02  ? 64   ALA A CB  1 
ATOM 381  N N   . TYR A 1 57  ? 7.132   35.882 -16.496 1.00 69.31  ? 65   TYR A N   1 
ATOM 382  C CA  . TYR A 1 57  ? 6.525   36.345 -17.716 1.00 74.42  ? 65   TYR A CA  1 
ATOM 383  C C   . TYR A 1 57  ? 5.045   35.983 -17.780 1.00 80.95  ? 65   TYR A C   1 
ATOM 384  O O   . TYR A 1 57  ? 4.250   36.754 -18.334 1.00 90.01  ? 65   TYR A O   1 
ATOM 385  C CB  . TYR A 1 57  ? 7.265   35.800 -18.932 1.00 77.86  ? 65   TYR A CB  1 
ATOM 386  C CG  . TYR A 1 57  ? 8.471   36.616 -19.342 1.00 80.67  ? 65   TYR A CG  1 
ATOM 387  C CD1 . TYR A 1 57  ? 8.318   37.896 -19.878 1.00 85.51  ? 65   TYR A CD1 1 
ATOM 388  C CD2 . TYR A 1 57  ? 9.767   36.101 -19.230 1.00 80.44  ? 65   TYR A CD2 1 
ATOM 389  C CE1 . TYR A 1 57  ? 9.419   38.647 -20.272 1.00 83.66  ? 65   TYR A CE1 1 
ATOM 390  C CE2 . TYR A 1 57  ? 10.874  36.847 -19.620 1.00 77.42  ? 65   TYR A CE2 1 
ATOM 391  C CZ  . TYR A 1 57  ? 10.690  38.119 -20.138 1.00 77.92  ? 65   TYR A CZ  1 
ATOM 392  O OH  . TYR A 1 57  ? 11.765  38.878 -20.524 1.00 84.60  ? 65   TYR A OH  1 
ATOM 393  N N   . PHE A 1 58  ? 4.668   34.829 -17.225 1.00 75.91  ? 66   PHE A N   1 
ATOM 394  C CA  . PHE A 1 58  ? 3.254   34.481 -17.132 1.00 76.11  ? 66   PHE A CA  1 
ATOM 395  C C   . PHE A 1 58  ? 2.486   35.584 -16.395 1.00 81.50  ? 66   PHE A C   1 
ATOM 396  O O   . PHE A 1 58  ? 1.458   36.073 -16.879 1.00 77.88  ? 66   PHE A O   1 
ATOM 397  C CB  . PHE A 1 58  ? 3.049   33.142 -16.417 1.00 77.54  ? 66   PHE A CB  1 
ATOM 398  C CG  . PHE A 1 58  ? 1.609   32.683 -16.383 1.00 77.04  ? 66   PHE A CG  1 
ATOM 399  C CD1 . PHE A 1 58  ? 0.716   33.223 -15.473 1.00 78.10  ? 66   PHE A CD1 1 
ATOM 400  C CD2 . PHE A 1 58  ? 1.155   31.716 -17.255 1.00 75.35  ? 66   PHE A CD2 1 
ATOM 401  C CE1 . PHE A 1 58  ? -0.600  32.824 -15.444 1.00 78.48  ? 66   PHE A CE1 1 
ATOM 402  C CE2 . PHE A 1 58  ? -0.165  31.310 -17.229 1.00 81.51  ? 66   PHE A CE2 1 
ATOM 403  C CZ  . PHE A 1 58  ? -1.044  31.868 -16.323 1.00 81.32  ? 66   PHE A CZ  1 
ATOM 404  N N   . TYR A 1 59  ? 2.980   35.974 -15.223 1.00 85.72  ? 67   TYR A N   1 
ATOM 405  C CA  . TYR A 1 59  ? 2.303   37.004 -14.438 1.00 87.82  ? 67   TYR A CA  1 
ATOM 406  C C   . TYR A 1 59  ? 2.237   38.318 -15.218 1.00 86.59  ? 67   TYR A C   1 
ATOM 407  O O   . TYR A 1 59  ? 1.272   39.078 -15.093 1.00 88.78  ? 67   TYR A O   1 
ATOM 408  C CB  . TYR A 1 59  ? 2.983   37.212 -13.082 1.00 90.80  ? 67   TYR A CB  1 
ATOM 409  C CG  . TYR A 1 59  ? 2.127   37.980 -12.088 1.00 90.98  ? 67   TYR A CG  1 
ATOM 410  N N   . LEU A 1 60  ? 3.239   38.557 -16.058 1.00 83.13  ? 68   LEU A N   1 
ATOM 411  C CA  . LEU A 1 60  ? 3.306   39.788 -16.836 1.00 84.27  ? 68   LEU A CA  1 
ATOM 412  C C   . LEU A 1 60  ? 2.439   39.791 -18.093 1.00 84.26  ? 68   LEU A C   1 
ATOM 413  O O   . LEU A 1 60  ? 2.489   40.731 -18.878 1.00 87.55  ? 68   LEU A O   1 
ATOM 414  C CB  . LEU A 1 60  ? 4.760   40.092 -17.195 1.00 84.61  ? 68   LEU A CB  1 
ATOM 415  C CG  . LEU A 1 60  ? 5.599   40.409 -15.950 1.00 93.34  ? 68   LEU A CG  1 
ATOM 416  C CD1 . LEU A 1 60  ? 7.096   40.325 -16.222 1.00 94.87  ? 68   LEU A CD1 1 
ATOM 417  C CD2 . LEU A 1 60  ? 5.245   41.778 -15.384 1.00 95.34  ? 68   LEU A CD2 1 
ATOM 418  N N   . HIS A 1 61  ? 1.640   38.753 -18.287 1.00 85.20  ? 69   HIS A N   1 
ATOM 419  C CA  . HIS A 1 61  ? 0.769   38.674 -19.455 1.00 85.93  ? 69   HIS A CA  1 
ATOM 420  C C   . HIS A 1 61  ? 1.525   38.553 -20.787 1.00 81.57  ? 69   HIS A C   1 
ATOM 421  O O   . HIS A 1 61  ? 0.971   38.871 -21.838 1.00 75.63  ? 69   HIS A O   1 
ATOM 422  C CB  . HIS A 1 61  ? -0.195  39.868 -19.500 1.00 88.41  ? 69   HIS A CB  1 
ATOM 423  C CG  . HIS A 1 61  ? -1.041  40.006 -18.275 1.00 97.13  ? 69   HIS A CG  1 
ATOM 424  N ND1 . HIS A 1 61  ? -2.351  39.579 -18.225 1.00 102.00 ? 69   HIS A ND1 1 
ATOM 425  C CD2 . HIS A 1 61  ? -0.768  40.522 -17.054 1.00 97.87  ? 69   HIS A CD2 1 
ATOM 426  C CE1 . HIS A 1 61  ? -2.849  39.826 -17.028 1.00 100.63 ? 69   HIS A CE1 1 
ATOM 427  N NE2 . HIS A 1 61  ? -1.910  40.401 -16.299 1.00 102.94 ? 69   HIS A NE2 1 
ATOM 428  N N   . ASP A 1 62  ? 2.777   38.093 -20.761 1.00 86.93  ? 70   ASP A N   1 
ATOM 429  C CA  . ASP A 1 62  ? 3.470   37.746 -22.014 1.00 90.12  ? 70   ASP A CA  1 
ATOM 430  C C   . ASP A 1 62  ? 3.555   36.247 -22.123 1.00 85.24  ? 70   ASP A C   1 
ATOM 431  O O   . ASP A 1 62  ? 4.590   35.639 -21.873 1.00 82.80  ? 70   ASP A O   1 
ATOM 432  C CB  . ASP A 1 62  ? 4.867   38.347 -22.108 1.00 96.05  ? 70   ASP A CB  1 
ATOM 433  C CG  . ASP A 1 62  ? 5.510   38.086 -23.457 1.00 98.71  ? 70   ASP A CG  1 
ATOM 434  O OD1 . ASP A 1 62  ? 4.792   37.652 -24.387 1.00 99.22  ? 70   ASP A OD1 1 
ATOM 435  O OD2 . ASP A 1 62  ? 6.730   38.306 -23.586 1.00 104.84 ? 70   ASP A OD2 1 
ATOM 436  N N   . TYR A 1 63  ? 2.443   35.660 -22.519 1.00 84.31  ? 71   TYR A N   1 
ATOM 437  C CA  . TYR A 1 63  ? 2.251   34.234 -22.381 1.00 77.11  ? 71   TYR A CA  1 
ATOM 438  C C   . TYR A 1 63  ? 3.182   33.441 -23.331 1.00 77.20  ? 71   TYR A C   1 
ATOM 439  O O   . TYR A 1 63  ? 3.739   32.407 -22.951 1.00 82.75  ? 71   TYR A O   1 
ATOM 440  C CB  . TYR A 1 63  ? 0.762   33.930 -22.582 1.00 78.99  ? 71   TYR A CB  1 
ATOM 441  C CG  . TYR A 1 63  ? -0.125  34.607 -21.544 1.00 77.17  ? 71   TYR A CG  1 
ATOM 442  C CD1 . TYR A 1 63  ? -0.053  34.233 -20.212 1.00 85.45  ? 71   TYR A CD1 1 
ATOM 443  C CD2 . TYR A 1 63  ? -1.018  35.626 -21.886 1.00 76.24  ? 71   TYR A CD2 1 
ATOM 444  C CE1 . TYR A 1 63  ? -0.845  34.841 -19.244 1.00 89.14  ? 71   TYR A CE1 1 
ATOM 445  C CE2 . TYR A 1 63  ? -1.820  36.240 -20.922 1.00 73.47  ? 71   TYR A CE2 1 
ATOM 446  C CZ  . TYR A 1 63  ? -1.724  35.837 -19.602 1.00 79.14  ? 71   TYR A CZ  1 
ATOM 447  O OH  . TYR A 1 63  ? -2.475  36.393 -18.603 1.00 81.74  ? 71   TYR A OH  1 
ATOM 448  N N   . ALA A 1 64  ? 3.394   33.971 -24.535 1.00 75.38  ? 72   ALA A N   1 
ATOM 449  C CA  . ALA A 1 64  ? 4.269   33.359 -25.534 1.00 69.06  ? 72   ALA A CA  1 
ATOM 450  C C   . ALA A 1 64  ? 5.645   33.040 -24.974 1.00 75.80  ? 72   ALA A C   1 
ATOM 451  O O   . ALA A 1 64  ? 6.189   31.943 -25.206 1.00 71.32  ? 72   ALA A O   1 
ATOM 452  C CB  . ALA A 1 64  ? 4.401   34.268 -26.736 1.00 63.78  ? 72   ALA A CB  1 
ATOM 453  N N   . LYS A 1 65  ? 6.203   34.002 -24.243 1.00 80.40  ? 73   LYS A N   1 
ATOM 454  C CA  . LYS A 1 65  ? 7.533   33.848 -23.647 1.00 86.21  ? 73   LYS A CA  1 
ATOM 455  C C   . LYS A 1 65  ? 7.520   32.877 -22.462 1.00 80.61  ? 73   LYS A C   1 
ATOM 456  O O   . LYS A 1 65  ? 8.529   32.215 -22.184 1.00 78.18  ? 73   LYS A O   1 
ATOM 457  C CB  . LYS A 1 65  ? 8.092   35.207 -23.211 1.00 94.94  ? 73   LYS A CB  1 
ATOM 458  C CG  . LYS A 1 65  ? 8.614   36.084 -24.347 1.00 104.31 ? 73   LYS A CG  1 
ATOM 459  C CD  . LYS A 1 65  ? 10.139  36.240 -24.360 1.00 111.65 ? 73   LYS A CD  1 
ATOM 460  C CE  . LYS A 1 65  ? 10.539  37.591 -24.949 1.00 117.69 ? 73   LYS A CE  1 
ATOM 461  N NZ  . LYS A 1 65  ? 11.873  37.575 -25.613 1.00 122.72 ? 73   LYS A NZ  1 
ATOM 462  N N   . ALA A 1 66  ? 6.385   32.786 -21.770 1.00 71.88  ? 74   ALA A N   1 
ATOM 463  C CA  . ALA A 1 66  ? 6.256   31.847 -20.657 1.00 74.66  ? 74   ALA A CA  1 
ATOM 464  C C   . ALA A 1 66  ? 6.267   30.418 -21.190 1.00 76.91  ? 74   ALA A C   1 
ATOM 465  O O   . ALA A 1 66  ? 7.067   29.550 -20.747 1.00 69.45  ? 74   ALA A O   1 
ATOM 466  C CB  . ALA A 1 66  ? 4.981   32.110 -19.894 1.00 77.55  ? 74   ALA A CB  1 
ATOM 467  N N   . LEU A 1 67  ? 5.384   30.194 -22.164 1.00 71.50  ? 75   LEU A N   1 
ATOM 468  C CA  . LEU A 1 67  ? 5.389   28.965 -22.933 1.00 68.14  ? 75   LEU A CA  1 
ATOM 469  C C   . LEU A 1 67  ? 6.812   28.624 -23.322 1.00 67.07  ? 75   LEU A C   1 
ATOM 470  O O   . LEU A 1 67  ? 7.320   27.584 -22.966 1.00 72.22  ? 75   LEU A O   1 
ATOM 471  C CB  . LEU A 1 67  ? 4.536   29.111 -24.173 1.00 68.75  ? 75   LEU A CB  1 
ATOM 472  C CG  . LEU A 1 67  ? 4.166   27.805 -24.872 1.00 74.14  ? 75   LEU A CG  1 
ATOM 473  C CD1 . LEU A 1 67  ? 2.844   27.977 -25.594 1.00 74.87  ? 75   LEU A CD1 1 
ATOM 474  C CD2 . LEU A 1 67  ? 5.217   27.343 -25.872 1.00 78.11  ? 75   LEU A CD2 1 
ATOM 475  N N   . GLU A 1 68  ? 7.502   29.515 -24.005 1.00 73.57  ? 76   GLU A N   1 
ATOM 476  C CA  . GLU A 1 68  ? 8.823   29.131 -24.475 1.00 75.35  ? 76   GLU A CA  1 
ATOM 477  C C   . GLU A 1 68  ? 9.754   28.789 -23.310 1.00 69.90  ? 76   GLU A C   1 
ATOM 478  O O   . GLU A 1 68  ? 10.457  27.786 -23.379 1.00 62.02  ? 76   GLU A O   1 
ATOM 479  C CB  . GLU A 1 68  ? 9.417   30.161 -25.436 1.00 83.76  ? 76   GLU A CB  1 
ATOM 480  C CG  . GLU A 1 68  ? 10.098  29.527 -26.662 1.00 96.55  ? 76   GLU A CG  1 
ATOM 481  C CD  . GLU A 1 68  ? 9.158   28.801 -27.647 1.00 102.42 ? 76   GLU A CD  1 
ATOM 482  O OE1 . GLU A 1 68  ? 9.466   27.634 -28.037 1.00 94.87  ? 76   GLU A OE1 1 
ATOM 483  O OE2 . GLU A 1 68  ? 8.124   29.406 -28.049 1.00 97.33  ? 76   GLU A OE2 1 
ATOM 484  N N   . TYR A 1 69  ? 9.719   29.554 -22.218 1.00 72.13  ? 77   TYR A N   1 
ATOM 485  C CA  . TYR A 1 69  ? 10.653  29.278 -21.098 1.00 75.11  ? 77   TYR A CA  1 
ATOM 486  C C   . TYR A 1 69  ? 10.340  27.980 -20.363 1.00 72.31  ? 77   TYR A C   1 
ATOM 487  O O   . TYR A 1 69  ? 11.250  27.297 -19.870 1.00 67.35  ? 77   TYR A O   1 
ATOM 488  C CB  . TYR A 1 69  ? 10.732  30.437 -20.088 1.00 78.61  ? 77   TYR A CB  1 
ATOM 489  C CG  . TYR A 1 69  ? 11.743  31.519 -20.436 1.00 74.74  ? 77   TYR A CG  1 
ATOM 490  C CD1 . TYR A 1 69  ? 13.101  31.262 -20.404 1.00 76.66  ? 77   TYR A CD1 1 
ATOM 491  C CD2 . TYR A 1 69  ? 11.327  32.806 -20.785 1.00 78.26  ? 77   TYR A CD2 1 
ATOM 492  C CE1 . TYR A 1 69  ? 14.021  32.247 -20.731 1.00 84.74  ? 77   TYR A CE1 1 
ATOM 493  C CE2 . TYR A 1 69  ? 12.236  33.802 -21.099 1.00 76.56  ? 77   TYR A CE2 1 
ATOM 494  C CZ  . TYR A 1 69  ? 13.579  33.517 -21.076 1.00 81.12  ? 77   TYR A CZ  1 
ATOM 495  O OH  . TYR A 1 69  ? 14.489  34.492 -21.392 1.00 81.57  ? 77   TYR A OH  1 
ATOM 496  N N   . HIS A 1 70  ? 9.062   27.634 -20.280 1.00 70.31  ? 78   HIS A N   1 
ATOM 497  C CA  . HIS A 1 70  ? 8.683   26.380 -19.632 1.00 70.57  ? 78   HIS A CA  1 
ATOM 498  C C   . HIS A 1 70  ? 8.948   25.150 -20.512 1.00 73.45  ? 78   HIS A C   1 
ATOM 499  O O   . HIS A 1 70  ? 9.261   24.058 -20.038 1.00 75.50  ? 78   HIS A O   1 
ATOM 500  C CB  . HIS A 1 70  ? 7.232   26.441 -19.266 1.00 69.51  ? 78   HIS A CB  1 
ATOM 501  C CG  . HIS A 1 70  ? 6.952   27.334 -18.106 1.00 71.80  ? 78   HIS A CG  1 
ATOM 502  N ND1 . HIS A 1 70  ? 5.986   28.321 -18.143 1.00 71.56  ? 78   HIS A ND1 1 
ATOM 503  C CD2 . HIS A 1 70  ? 7.484   27.365 -16.862 1.00 67.17  ? 78   HIS A CD2 1 
ATOM 504  C CE1 . HIS A 1 70  ? 5.939   28.926 -16.971 1.00 73.23  ? 78   HIS A CE1 1 
ATOM 505  N NE2 . HIS A 1 70  ? 6.840   28.367 -16.177 1.00 75.67  ? 78   HIS A NE2 1 
ATOM 506  N N   . HIS A 1 71  ? 8.811   25.340 -21.808 1.00 71.53  ? 79   HIS A N   1 
ATOM 507  C CA  . HIS A 1 71  ? 9.167   24.327 -22.753 1.00 70.17  ? 79   HIS A CA  1 
ATOM 508  C C   . HIS A 1 71  ? 10.648  23.979 -22.623 1.00 69.15  ? 79   HIS A C   1 
ATOM 509  O O   . HIS A 1 71  ? 11.004  22.813 -22.689 1.00 69.17  ? 79   HIS A O   1 
ATOM 510  C CB  . HIS A 1 71  ? 8.832   24.828 -24.142 1.00 76.80  ? 79   HIS A CB  1 
ATOM 511  C CG  . HIS A 1 71  ? 9.222   23.894 -25.227 1.00 89.57  ? 79   HIS A CG  1 
ATOM 512  N ND1 . HIS A 1 71  ? 10.508  23.822 -25.717 1.00 99.79  ? 79   HIS A ND1 1 
ATOM 513  C CD2 . HIS A 1 71  ? 8.493   23.002 -25.935 1.00 96.61  ? 79   HIS A CD2 1 
ATOM 514  C CE1 . HIS A 1 71  ? 10.555  22.915 -26.676 1.00 103.93 ? 79   HIS A CE1 1 
ATOM 515  N NE2 . HIS A 1 71  ? 9.345   22.405 -26.830 1.00 102.47 ? 79   HIS A NE2 1 
ATOM 516  N N   . HIS A 1 72  ? 11.516  24.976 -22.418 1.00 73.19  ? 80   HIS A N   1 
ATOM 517  C CA  . HIS A 1 72  ? 12.945  24.679 -22.204 1.00 71.87  ? 80   HIS A CA  1 
ATOM 518  C C   . HIS A 1 72  ? 13.142  24.010 -20.864 1.00 67.59  ? 80   HIS A C   1 
ATOM 519  O O   . HIS A 1 72  ? 13.996  23.134 -20.719 1.00 64.37  ? 80   HIS A O   1 
ATOM 520  C CB  . HIS A 1 72  ? 13.816  25.917 -22.203 1.00 71.63  ? 80   HIS A CB  1 
ATOM 521  C CG  . HIS A 1 72  ? 13.892  26.636 -23.511 1.00 73.97  ? 80   HIS A CG  1 
ATOM 522  N ND1 . HIS A 1 72  ? 13.118  27.741 -23.782 1.00 75.07  ? 80   HIS A ND1 1 
ATOM 523  C CD2 . HIS A 1 72  ? 14.714  26.485 -24.577 1.00 71.29  ? 80   HIS A CD2 1 
ATOM 524  C CE1 . HIS A 1 72  ? 13.421  28.207 -24.979 1.00 70.10  ? 80   HIS A CE1 1 
ATOM 525  N NE2 . HIS A 1 72  ? 14.390  27.467 -25.480 1.00 69.92  ? 80   HIS A NE2 1 
ATOM 526  N N   . ASP A 1 73  ? 12.374  24.460 -19.875 1.00 67.95  ? 81   ASP A N   1 
ATOM 527  C CA  . ASP A 1 73  ? 12.424  23.859 -18.539 1.00 67.07  ? 81   ASP A CA  1 
ATOM 528  C C   . ASP A 1 73  ? 12.034  22.393 -18.644 1.00 66.80  ? 81   ASP A C   1 
ATOM 529  O O   . ASP A 1 73  ? 12.768  21.515 -18.192 1.00 69.24  ? 81   ASP A O   1 
ATOM 530  C CB  . ASP A 1 73  ? 11.488  24.591 -17.576 1.00 65.06  ? 81   ASP A CB  1 
ATOM 531  C CG  . ASP A 1 73  ? 11.547  24.037 -16.160 1.00 67.98  ? 81   ASP A CG  1 
ATOM 532  O OD1 . ASP A 1 73  ? 12.631  23.575 -15.748 1.00 68.04  ? 81   ASP A OD1 1 
ATOM 533  O OD2 . ASP A 1 73  ? 10.508  24.084 -15.452 1.00 70.95  ? 81   ASP A OD2 1 
ATOM 534  N N   . LEU A 1 74  ? 10.889  22.145 -19.278 1.00 66.33  ? 82   LEU A N   1 
ATOM 535  C CA  . LEU A 1 74  ? 10.381  20.800 -19.473 1.00 68.34  ? 82   LEU A CA  1 
ATOM 536  C C   . LEU A 1 74  ? 11.395  19.899 -20.168 1.00 73.95  ? 82   LEU A C   1 
ATOM 537  O O   . LEU A 1 74  ? 11.678  18.780 -19.712 1.00 70.62  ? 82   LEU A O   1 
ATOM 538  C CB  . LEU A 1 74  ? 9.106   20.851 -20.300 1.00 72.39  ? 82   LEU A CB  1 
ATOM 539  C CG  . LEU A 1 74  ? 8.569   19.485 -20.726 1.00 77.11  ? 82   LEU A CG  1 
ATOM 540  C CD1 . LEU A 1 74  ? 8.296   18.607 -19.516 1.00 77.63  ? 82   LEU A CD1 1 
ATOM 541  C CD2 . LEU A 1 74  ? 7.320   19.652 -21.575 1.00 78.21  ? 82   LEU A CD2 1 
ATOM 542  N N   . THR A 1 75  ? 11.931  20.396 -21.281 1.00 74.61  ? 83   THR A N   1 
ATOM 543  C CA  . THR A 1 75  ? 12.916  19.656 -22.042 1.00 69.91  ? 83   THR A CA  1 
ATOM 544  C C   . THR A 1 75  ? 14.077  19.259 -21.141 1.00 71.41  ? 83   THR A C   1 
ATOM 545  O O   . THR A 1 75  ? 14.517  18.109 -21.132 1.00 66.54  ? 83   THR A O   1 
ATOM 546  C CB  . THR A 1 75  ? 13.466  20.492 -23.206 1.00 67.54  ? 83   THR A CB  1 
ATOM 547  O OG1 . THR A 1 75  ? 12.383  21.071 -23.961 1.00 61.37  ? 83   THR A OG1 1 
ATOM 548  C CG2 . THR A 1 75  ? 14.322  19.604 -24.102 1.00 64.91  ? 83   THR A CG2 1 
ATOM 549  N N   . LEU A 1 76  ? 14.541  20.226 -20.362 1.00 75.41  ? 84   LEU A N   1 
ATOM 550  C CA  . LEU A 1 76  ? 15.773  20.087 -19.595 1.00 81.08  ? 84   LEU A CA  1 
ATOM 551  C C   . LEU A 1 76  ? 15.598  19.148 -18.399 1.00 83.70  ? 84   LEU A C   1 
ATOM 552  O O   . LEU A 1 76  ? 16.515  18.386 -18.049 1.00 68.92  ? 84   LEU A O   1 
ATOM 553  C CB  . LEU A 1 76  ? 16.230  21.474 -19.143 1.00 81.79  ? 84   LEU A CB  1 
ATOM 554  C CG  . LEU A 1 76  ? 17.704  21.686 -18.824 1.00 89.17  ? 84   LEU A CG  1 
ATOM 555  C CD1 . LEU A 1 76  ? 18.605  21.343 -20.001 1.00 95.25  ? 84   LEU A CD1 1 
ATOM 556  C CD2 . LEU A 1 76  ? 17.889  23.141 -18.440 1.00 89.14  ? 84   LEU A CD2 1 
ATOM 557  N N   . ALA A 1 77  ? 14.415  19.210 -17.781 1.00 86.78  ? 85   ALA A N   1 
ATOM 558  C CA  . ALA A 1 77  ? 14.063  18.311 -16.685 1.00 90.70  ? 85   ALA A CA  1 
ATOM 559  C C   . ALA A 1 77  ? 14.036  16.880 -17.192 1.00 85.90  ? 85   ALA A C   1 
ATOM 560  O O   . ALA A 1 77  ? 14.492  15.964 -16.515 1.00 87.91  ? 85   ALA A O   1 
ATOM 561  C CB  . ALA A 1 77  ? 12.710  18.682 -16.102 1.00 93.64  ? 85   ALA A CB  1 
ATOM 562  N N   . ARG A 1 78  ? 13.489  16.702 -18.388 1.00 77.57  ? 86   ARG A N   1 
ATOM 563  C CA  . ARG A 1 78  ? 13.560  15.421 -19.049 1.00 78.38  ? 86   ARG A CA  1 
ATOM 564  C C   . ARG A 1 78  ? 15.023  15.077 -19.255 1.00 78.27  ? 86   ARG A C   1 
ATOM 565  O O   . ARG A 1 78  ? 15.433  13.947 -19.003 1.00 77.41  ? 86   ARG A O   1 
ATOM 566  C CB  . ARG A 1 78  ? 12.800  15.424 -20.390 1.00 80.50  ? 86   ARG A CB  1 
ATOM 567  C CG  . ARG A 1 78  ? 11.391  14.842 -20.317 1.00 83.65  ? 86   ARG A CG  1 
ATOM 568  C CD  . ARG A 1 78  ? 10.493  15.366 -21.435 1.00 93.06  ? 86   ARG A CD  1 
ATOM 569  N NE  . ARG A 1 78  ? 9.064   15.196 -21.133 1.00 98.70  ? 86   ARG A NE  1 
ATOM 570  C CZ  . ARG A 1 78  ? 8.061   15.494 -21.964 1.00 97.16  ? 86   ARG A CZ  1 
ATOM 571  N NH1 . ARG A 1 78  ? 6.803   15.290 -21.579 1.00 99.15  ? 86   ARG A NH1 1 
ATOM 572  N NH2 . ARG A 1 78  ? 8.300   15.984 -23.175 1.00 92.71  ? 86   ARG A NH2 1 
ATOM 573  N N   . THR A 1 79  ? 15.817  16.055 -19.682 1.00 76.11  ? 87   THR A N   1 
ATOM 574  C CA  . THR A 1 79  ? 17.214  15.780 -20.019 1.00 82.32  ? 87   THR A CA  1 
ATOM 575  C C   . THR A 1 79  ? 17.978  15.182 -18.855 1.00 80.26  ? 87   THR A C   1 
ATOM 576  O O   . THR A 1 79  ? 18.778  14.286 -19.051 1.00 89.03  ? 87   THR A O   1 
ATOM 577  C CB  . THR A 1 79  ? 17.984  17.033 -20.495 1.00 83.54  ? 87   THR A CB  1 
ATOM 578  O OG1 . THR A 1 79  ? 17.329  17.599 -21.637 1.00 89.25  ? 87   THR A OG1 1 
ATOM 579  C CG2 . THR A 1 79  ? 19.424  16.678 -20.862 1.00 74.93  ? 87   THR A CG2 1 
ATOM 580  N N   . ILE A 1 80  ? 17.739  15.671 -17.650 1.00 77.97  ? 88   ILE A N   1 
ATOM 581  C CA  . ILE A 1 80  ? 18.579  15.284 -16.529 1.00 77.66  ? 88   ILE A CA  1 
ATOM 582  C C   . ILE A 1 80  ? 17.912  14.253 -15.640 1.00 75.38  ? 88   ILE A C   1 
ATOM 583  O O   . ILE A 1 80  ? 18.412  13.951 -14.572 1.00 82.02  ? 88   ILE A O   1 
ATOM 584  C CB  . ILE A 1 80  ? 18.978  16.509 -15.689 1.00 82.05  ? 88   ILE A CB  1 
ATOM 585  C CG1 . ILE A 1 80  ? 17.826  16.997 -14.814 1.00 89.50  ? 88   ILE A CG1 1 
ATOM 586  C CG2 . ILE A 1 80  ? 19.426  17.645 -16.592 1.00 82.84  ? 88   ILE A CG2 1 
ATOM 587  C CD1 . ILE A 1 80  ? 18.309  17.869 -13.677 1.00 94.42  ? 88   ILE A CD1 1 
ATOM 588  N N   . GLY A 1 81  ? 16.790  13.708 -16.078 1.00 73.86  ? 89   GLY A N   1 
ATOM 589  C CA  . GLY A 1 81  ? 16.037  12.788 -15.253 1.00 76.41  ? 89   GLY A CA  1 
ATOM 590  C C   . GLY A 1 81  ? 15.557  13.404 -13.952 1.00 81.45  ? 89   GLY A C   1 
ATOM 591  O O   . GLY A 1 81  ? 15.695  12.786 -12.906 1.00 99.51  ? 89   GLY A O   1 
ATOM 592  N N   . ASP A 1 82  ? 15.003  14.615 -13.999 1.00 84.65  ? 90   ASP A N   1 
ATOM 593  C CA  . ASP A 1 82  ? 14.358  15.207 -12.815 1.00 87.16  ? 90   ASP A CA  1 
ATOM 594  C C   . ASP A 1 82  ? 12.815  15.126 -12.890 1.00 89.17  ? 90   ASP A C   1 
ATOM 595  O O   . ASP A 1 82  ? 12.127  16.104 -13.205 1.00 89.46  ? 90   ASP A O   1 
ATOM 596  C CB  . ASP A 1 82  ? 14.811  16.653 -12.605 1.00 87.03  ? 90   ASP A CB  1 
ATOM 597  C CG  . ASP A 1 82  ? 14.037  17.349 -11.489 1.00 91.18  ? 90   ASP A CG  1 
ATOM 598  O OD1 . ASP A 1 82  ? 13.425  16.622 -10.658 1.00 84.96  ? 90   ASP A OD1 1 
ATOM 599  O OD2 . ASP A 1 82  ? 14.023  18.611 -11.458 1.00 85.52  ? 90   ASP A OD2 1 
ATOM 600  N N   . GLN A 1 83  ? 12.279  13.959 -12.558 1.00 85.05  ? 91   GLN A N   1 
ATOM 601  C CA  . GLN A 1 83  ? 10.841  13.710 -12.647 1.00 81.99  ? 91   GLN A CA  1 
ATOM 602  C C   . GLN A 1 83  ? 9.932   14.785 -12.045 1.00 73.99  ? 91   GLN A C   1 
ATOM 603  O O   . GLN A 1 83  ? 8.981   15.242 -12.688 1.00 72.34  ? 91   GLN A O   1 
ATOM 604  C CB  . GLN A 1 83  ? 10.515  12.362 -12.016 1.00 86.77  ? 91   GLN A CB  1 
ATOM 605  C CG  . GLN A 1 83  ? 10.900  11.186 -12.896 1.00 91.62  ? 91   GLN A CG  1 
ATOM 606  C CD  . GLN A 1 83  ? 9.887   10.063 -12.830 1.00 94.54  ? 91   GLN A CD  1 
ATOM 607  O OE1 . GLN A 1 83  ? 9.874   9.284  -11.874 1.00 98.73  ? 91   GLN A OE1 1 
ATOM 608  N NE2 . GLN A 1 83  ? 9.025   9.972  -13.847 1.00 96.39  ? 91   GLN A NE2 1 
ATOM 609  N N   . LEU A 1 84  ? 10.195  15.179 -10.815 1.00 70.72  ? 92   LEU A N   1 
ATOM 610  C CA  . LEU A 1 84  ? 9.415   16.259 -10.232 1.00 73.31  ? 92   LEU A CA  1 
ATOM 611  C C   . LEU A 1 84  ? 9.503   17.505 -11.099 1.00 74.05  ? 92   LEU A C   1 
ATOM 612  O O   . LEU A 1 84  ? 8.486   18.101 -11.434 1.00 78.94  ? 92   LEU A O   1 
ATOM 613  C CB  . LEU A 1 84  ? 9.903   16.587 -8.833  1.00 80.23  ? 92   LEU A CB  1 
ATOM 614  C CG  . LEU A 1 84  ? 9.120   17.673 -8.094  1.00 84.55  ? 92   LEU A CG  1 
ATOM 615  C CD1 . LEU A 1 84  ? 7.646   17.326 -7.935  1.00 85.89  ? 92   LEU A CD1 1 
ATOM 616  C CD2 . LEU A 1 84  ? 9.753   17.890 -6.733  1.00 85.77  ? 92   LEU A CD2 1 
ATOM 617  N N   . GLY A 1 85  ? 10.721  17.885 -11.474 1.00 71.52  ? 93   GLY A N   1 
ATOM 618  C CA  . GLY A 1 85  ? 10.938  19.013 -12.390 1.00 69.72  ? 93   GLY A CA  1 
ATOM 619  C C   . GLY A 1 85  ? 10.124  18.921 -13.673 1.00 70.67  ? 93   GLY A C   1 
ATOM 620  O O   . GLY A 1 85  ? 9.547   19.903 -14.138 1.00 70.17  ? 93   GLY A O   1 
ATOM 621  N N   . GLU A 1 86  ? 10.067  17.730 -14.246 1.00 71.37  ? 94   GLU A N   1 
ATOM 622  C CA  . GLU A 1 86  ? 9.240   17.496 -15.417 1.00 69.83  ? 94   GLU A CA  1 
ATOM 623  C C   . GLU A 1 86  ? 7.760   17.570 -15.100 1.00 68.20  ? 94   GLU A C   1 
ATOM 624  O O   . GLU A 1 86  ? 6.981   18.053 -15.924 1.00 62.00  ? 94   GLU A O   1 
ATOM 625  C CB  . GLU A 1 86  ? 9.533   16.126 -15.990 1.00 75.88  ? 94   GLU A CB  1 
ATOM 626  C CG  . GLU A 1 86  ? 8.654   15.738 -17.163 1.00 75.91  ? 94   GLU A CG  1 
ATOM 627  C CD  . GLU A 1 86  ? 8.859   14.303 -17.593 1.00 78.05  ? 94   GLU A CD  1 
ATOM 628  O OE1 . GLU A 1 86  ? 8.126   13.854 -18.507 1.00 87.89  ? 94   GLU A OE1 1 
ATOM 629  O OE2 . GLU A 1 86  ? 9.743   13.631 -17.023 1.00 72.45  ? 94   GLU A OE2 1 
ATOM 630  N N   . ALA A 1 87  ? 7.359   17.049 -13.941 1.00 66.19  ? 95   ALA A N   1 
ATOM 631  C CA  . ALA A 1 87  ? 5.971   17.194 -13.500 1.00 69.23  ? 95   ALA A CA  1 
ATOM 632  C C   . ALA A 1 87  ? 5.585   18.668 -13.447 1.00 70.35  ? 95   ALA A C   1 
ATOM 633  O O   . ALA A 1 87  ? 4.540   19.100 -13.955 1.00 64.37  ? 95   ALA A O   1 
ATOM 634  C CB  . ALA A 1 87  ? 5.791   16.575 -12.136 1.00 72.48  ? 95   ALA A CB  1 
ATOM 635  N N   . LYS A 1 88  ? 6.456   19.451 -12.839 1.00 71.00  ? 96   LYS A N   1 
ATOM 636  C CA  . LYS A 1 88  ? 6.176   20.853 -12.660 1.00 74.79  ? 96   LYS A CA  1 
ATOM 637  C C   . LYS A 1 88  ? 6.137   21.599 -13.995 1.00 77.65  ? 96   LYS A C   1 
ATOM 638  O O   . LYS A 1 88  ? 5.237   22.417 -14.259 1.00 73.94  ? 96   LYS A O   1 
ATOM 639  C CB  . LYS A 1 88  ? 7.243   21.479 -11.786 1.00 79.22  ? 96   LYS A CB  1 
ATOM 640  C CG  . LYS A 1 88  ? 7.456   20.800 -10.440 1.00 85.91  ? 96   LYS A CG  1 
ATOM 641  C CD  . LYS A 1 88  ? 7.304   21.794 -9.296  1.00 90.62  ? 96   LYS A CD  1 
ATOM 642  C CE  . LYS A 1 88  ? 8.199   21.487 -8.112  1.00 88.47  ? 96   LYS A CE  1 
ATOM 643  N NZ  . LYS A 1 88  ? 7.991   22.533 -7.077  1.00 87.55  ? 96   LYS A NZ  1 
ATOM 644  N N   . ALA A 1 89  ? 7.137   21.351 -14.831 1.00 73.06  ? 97   ALA A N   1 
ATOM 645  C CA  . ALA A 1 89  ? 7.264   22.146 -16.038 1.00 69.23  ? 97   ALA A CA  1 
ATOM 646  C C   . ALA A 1 89  ? 6.070   21.861 -16.911 1.00 62.86  ? 97   ALA A C   1 
ATOM 647  O O   . ALA A 1 89  ? 5.503   22.774 -17.516 1.00 56.56  ? 97   ALA A O   1 
ATOM 648  C CB  . ALA A 1 89  ? 8.561   21.847 -16.758 1.00 70.50  ? 97   ALA A CB  1 
ATOM 649  N N   . SER A 1 90  ? 5.676   20.588 -16.927 1.00 63.55  ? 98   SER A N   1 
ATOM 650  C CA  . SER A 1 90  ? 4.413   20.155 -17.543 1.00 65.89  ? 98   SER A CA  1 
ATOM 651  C C   . SER A 1 90  ? 3.258   21.023 -17.086 1.00 61.44  ? 98   SER A C   1 
ATOM 652  O O   . SER A 1 90  ? 2.525   21.599 -17.901 1.00 63.00  ? 98   SER A O   1 
ATOM 653  C CB  . SER A 1 90  ? 4.097   18.692 -17.187 1.00 66.75  ? 98   SER A CB  1 
ATOM 654  O OG  . SER A 1 90  ? 4.694   17.785 -18.091 1.00 68.57  ? 98   SER A OG  1 
ATOM 655  N N   . GLY A 1 91  ? 3.094   21.110 -15.772 1.00 55.53  ? 99   GLY A N   1 
ATOM 656  C CA  . GLY A 1 91  ? 1.984   21.872 -15.228 1.00 56.37  ? 99   GLY A CA  1 
ATOM 657  C C   . GLY A 1 91  ? 1.979   23.292 -15.797 1.00 58.57  ? 99   GLY A C   1 
ATOM 658  O O   . GLY A 1 91  ? 0.977   23.770 -16.394 1.00 60.00  ? 99   GLY A O   1 
ATOM 659  N N   . ASN A 1 92  ? 3.109   23.961 -15.638 1.00 50.72  ? 100  ASN A N   1 
ATOM 660  C CA  . ASN A 1 92  ? 3.203   25.340 -16.047 1.00 51.02  ? 100  ASN A CA  1 
ATOM 661  C C   . ASN A 1 92  ? 2.969   25.494 -17.538 1.00 53.29  ? 100  ASN A C   1 
ATOM 662  O O   . ASN A 1 92  ? 2.224   26.384 -18.005 1.00 54.17  ? 100  ASN A O   1 
ATOM 663  C CB  . ASN A 1 92  ? 4.557   25.874 -15.643 1.00 53.42  ? 100  ASN A CB  1 
ATOM 664  C CG  . ASN A 1 92  ? 4.713   25.930 -14.130 1.00 63.22  ? 100  ASN A CG  1 
ATOM 665  O OD1 . ASN A 1 92  ? 3.716   25.962 -13.393 1.00 72.67  ? 100  ASN A OD1 1 
ATOM 666  N ND2 . ASN A 1 92  ? 5.949   25.949 -13.657 1.00 65.64  ? 100  ASN A ND2 1 
ATOM 667  N N   . LEU A 1 93  ? 3.561   24.606 -18.312 1.00 52.51  ? 101  LEU A N   1 
ATOM 668  C CA  . LEU A 1 93  ? 3.321   24.663 -19.753 1.00 57.69  ? 101  LEU A CA  1 
ATOM 669  C C   . LEU A 1 93  ? 1.804   24.467 -20.030 1.00 59.30  ? 101  LEU A C   1 
ATOM 670  O O   . LEU A 1 93  ? 1.160   25.249 -20.769 1.00 52.43  ? 101  LEU A O   1 
ATOM 671  C CB  . LEU A 1 93  ? 4.130   23.569 -20.421 1.00 60.88  ? 101  LEU A CB  1 
ATOM 672  C CG  . LEU A 1 93  ? 4.517   23.710 -21.882 1.00 69.62  ? 101  LEU A CG  1 
ATOM 673  C CD1 . LEU A 1 93  ? 5.320   24.988 -22.118 1.00 71.54  ? 101  LEU A CD1 1 
ATOM 674  C CD2 . LEU A 1 93  ? 5.322   22.450 -22.250 1.00 65.72  ? 101  LEU A CD2 1 
ATOM 675  N N   . GLY A 1 94  ? 1.228   23.450 -19.384 1.00 55.20  ? 102  GLY A N   1 
ATOM 676  C CA  . GLY A 1 94  ? -0.182  23.170 -19.557 1.00 56.05  ? 102  GLY A CA  1 
ATOM 677  C C   . GLY A 1 94  ? -1.021  24.408 -19.294 1.00 54.54  ? 102  GLY A C   1 
ATOM 678  O O   . GLY A 1 94  ? -1.850  24.816 -20.129 1.00 53.91  ? 102  GLY A O   1 
ATOM 679  N N   . ASN A 1 95  ? -0.784  25.037 -18.152 1.00 50.24  ? 103  ASN A N   1 
ATOM 680  C CA  . ASN A 1 95  ? -1.597  26.205 -17.778 1.00 54.97  ? 103  ASN A CA  1 
ATOM 681  C C   . ASN A 1 95  ? -1.450  27.312 -18.817 1.00 57.11  ? 103  ASN A C   1 
ATOM 682  O O   . ASN A 1 95  ? -2.441  27.934 -19.224 1.00 56.17  ? 103  ASN A O   1 
ATOM 683  C CB  . ASN A 1 95  ? -1.216  26.711 -16.381 1.00 58.57  ? 103  ASN A CB  1 
ATOM 684  C CG  . ASN A 1 95  ? -1.581  25.703 -15.258 1.00 72.16  ? 103  ASN A CG  1 
ATOM 685  O OD1 . ASN A 1 95  ? -2.394  24.771 -15.462 1.00 82.96  ? 103  ASN A OD1 1 
ATOM 686  N ND2 . ASN A 1 95  ? -0.987  25.894 -14.063 1.00 68.31  ? 103  ASN A ND2 1 
ATOM 687  N N   . THR A 1 96  ? -0.217  27.509 -19.286 1.00 53.67  ? 104  THR A N   1 
ATOM 688  C CA  . THR A 1 96  ? 0.073   28.543 -20.274 1.00 55.12  ? 104  THR A CA  1 
ATOM 689  C C   . THR A 1 96  ? -0.620  28.253 -21.580 1.00 58.26  ? 104  THR A C   1 
ATOM 690  O O   . THR A 1 96  ? -1.267  29.120 -22.167 1.00 58.12  ? 104  THR A O   1 
ATOM 691  C CB  . THR A 1 96  ? 1.581   28.628 -20.561 1.00 56.47  ? 104  THR A CB  1 
ATOM 692  O OG1 . THR A 1 96  ? 2.299   28.745 -19.319 1.00 56.03  ? 104  THR A OG1 1 
ATOM 693  C CG2 . THR A 1 96  ? 1.884   29.862 -21.448 1.00 57.84  ? 104  THR A CG2 1 
ATOM 694  N N   . LEU A 1 97  ? -0.487  27.018 -22.032 1.00 66.29  ? 105  LEU A N   1 
ATOM 695  C CA  . LEU A 1 97  ? -1.252  26.574 -23.177 1.00 70.99  ? 105  LEU A CA  1 
ATOM 696  C C   . LEU A 1 97  ? -2.751  26.821 -22.977 1.00 67.19  ? 105  LEU A C   1 
ATOM 697  O O   . LEU A 1 97  ? -3.440  27.151 -23.923 1.00 67.71  ? 105  LEU A O   1 
ATOM 698  C CB  . LEU A 1 97  ? -0.959  25.110 -23.464 1.00 74.62  ? 105  LEU A CB  1 
ATOM 699  C CG  . LEU A 1 97  ? 0.474   24.913 -23.973 1.00 79.10  ? 105  LEU A CG  1 
ATOM 700  C CD1 . LEU A 1 97  ? 0.907   23.465 -23.819 1.00 87.04  ? 105  LEU A CD1 1 
ATOM 701  C CD2 . LEU A 1 97  ? 0.606   25.353 -25.421 1.00 74.89  ? 105  LEU A CD2 1 
ATOM 702  N N   . LYS A 1 98  ? -3.248  26.698 -21.751 1.00 65.91  ? 106  LYS A N   1 
ATOM 703  C CA  . LYS A 1 98  ? -4.657  26.930 -21.520 1.00 72.60  ? 106  LYS A CA  1 
ATOM 704  C C   . LYS A 1 98  ? -4.984  28.383 -21.807 1.00 78.02  ? 106  LYS A C   1 
ATOM 705  O O   . LYS A 1 98  ? -5.987  28.708 -22.468 1.00 78.49  ? 106  LYS A O   1 
ATOM 706  C CB  . LYS A 1 98  ? -5.037  26.601 -20.083 1.00 74.99  ? 106  LYS A CB  1 
ATOM 707  C CG  . LYS A 1 98  ? -6.528  26.783 -19.802 1.00 78.66  ? 106  LYS A CG  1 
ATOM 708  C CD  . LYS A 1 98  ? -6.791  27.053 -18.333 1.00 81.16  ? 106  LYS A CD  1 
ATOM 709  C CE  . LYS A 1 98  ? -6.429  28.474 -17.951 1.00 83.36  ? 106  LYS A CE  1 
ATOM 710  N NZ  . LYS A 1 98  ? -5.720  28.501 -16.646 1.00 87.77  ? 106  LYS A NZ  1 
ATOM 711  N N   . VAL A 1 99  ? -4.131  29.255 -21.292 1.00 77.71  ? 107  VAL A N   1 
ATOM 712  C CA  . VAL A 1 99  ? -4.320  30.687 -21.427 1.00 83.86  ? 107  VAL A CA  1 
ATOM 713  C C   . VAL A 1 99  ? -4.353  31.096 -22.905 1.00 82.24  ? 107  VAL A C   1 
ATOM 714  O O   . VAL A 1 99  ? -5.103  31.984 -23.301 1.00 77.00  ? 107  VAL A O   1 
ATOM 715  C CB  . VAL A 1 99  ? -3.198  31.431 -20.679 1.00 89.49  ? 107  VAL A CB  1 
ATOM 716  C CG1 . VAL A 1 99  ? -3.094  32.873 -21.129 1.00 94.43  ? 107  VAL A CG1 1 
ATOM 717  C CG2 . VAL A 1 99  ? -3.435  31.354 -19.181 1.00 92.57  ? 107  VAL A CG2 1 
ATOM 718  N N   . LEU A 1 100 ? -3.536  30.431 -23.711 1.00 78.94  ? 108  LEU A N   1 
ATOM 719  C CA  . LEU A 1 100 ? -3.491  30.677 -25.142 1.00 74.74  ? 108  LEU A CA  1 
ATOM 720  C C   . LEU A 1 100 ? -4.649  30.053 -25.907 1.00 70.94  ? 108  LEU A C   1 
ATOM 721  O O   . LEU A 1 100 ? -4.942  30.467 -27.010 1.00 76.16  ? 108  LEU A O   1 
ATOM 722  C CB  . LEU A 1 100 ? -2.149  30.190 -25.701 1.00 74.36  ? 108  LEU A CB  1 
ATOM 723  C CG  . LEU A 1 100 ? -0.968  31.018 -25.177 1.00 69.55  ? 108  LEU A CG  1 
ATOM 724  C CD1 . LEU A 1 100 ? 0.359   30.337 -25.403 1.00 70.28  ? 108  LEU A CD1 1 
ATOM 725  C CD2 . LEU A 1 100 ? -0.947  32.391 -25.825 1.00 69.80  ? 108  LEU A CD2 1 
ATOM 726  N N   . GLY A 1 101 ? -5.306  29.060 -25.322 1.00 73.98  ? 109  GLY A N   1 
ATOM 727  C CA  . GLY A 1 101 ? -6.479  28.441 -25.941 1.00 76.93  ? 109  GLY A CA  1 
ATOM 728  C C   . GLY A 1 101 ? -6.134  27.226 -26.779 1.00 73.30  ? 109  GLY A C   1 
ATOM 729  O O   . GLY A 1 101 ? -6.866  26.866 -27.696 1.00 68.89  ? 109  GLY A O   1 
ATOM 730  N N   . ASN A 1 102 ? -5.008  26.602 -26.463 1.00 71.64  ? 110  ASN A N   1 
ATOM 731  C CA  . ASN A 1 102 ? -4.614  25.355 -27.082 1.00 73.62  ? 110  ASN A CA  1 
ATOM 732  C C   . ASN A 1 102 ? -4.897  24.239 -26.086 1.00 75.48  ? 110  ASN A C   1 
ATOM 733  O O   . ASN A 1 102 ? -3.989  23.640 -25.480 1.00 76.87  ? 110  ASN A O   1 
ATOM 734  C CB  . ASN A 1 102 ? -3.149  25.424 -27.482 1.00 78.75  ? 110  ASN A CB  1 
ATOM 735  C CG  . ASN A 1 102 ? -2.843  26.649 -28.324 1.00 82.11  ? 110  ASN A CG  1 
ATOM 736  O OD1 . ASN A 1 102 ? -3.581  26.972 -29.258 1.00 83.69  ? 110  ASN A OD1 1 
ATOM 737  N ND2 . ASN A 1 102 ? -1.759  27.345 -27.993 1.00 78.30  ? 110  ASN A ND2 1 
ATOM 738  N N   . PHE A 1 103 ? -6.189  23.978 -25.929 1.00 70.89  ? 111  PHE A N   1 
ATOM 739  C CA  . PHE A 1 103 ? -6.686  23.158 -24.841 1.00 69.44  ? 111  PHE A CA  1 
ATOM 740  C C   . PHE A 1 103 ? -6.188  21.748 -24.935 1.00 66.70  ? 111  PHE A C   1 
ATOM 741  O O   . PHE A 1 103 ? -5.795  21.153 -23.922 1.00 64.65  ? 111  PHE A O   1 
ATOM 742  C CB  . PHE A 1 103 ? -8.217  23.162 -24.822 1.00 71.05  ? 111  PHE A CB  1 
ATOM 743  C CG  . PHE A 1 103 ? -8.805  24.538 -24.715 1.00 71.91  ? 111  PHE A CG  1 
ATOM 744  C CD1 . PHE A 1 103 ? -8.313  25.448 -23.771 1.00 79.78  ? 111  PHE A CD1 1 
ATOM 745  C CD2 . PHE A 1 103 ? -9.822  24.939 -25.549 1.00 66.39  ? 111  PHE A CD2 1 
ATOM 746  C CE1 . PHE A 1 103 ? -8.839  26.726 -23.666 1.00 74.99  ? 111  PHE A CE1 1 
ATOM 747  C CE2 . PHE A 1 103 ? -10.345 26.217 -25.451 1.00 69.98  ? 111  PHE A CE2 1 
ATOM 748  C CZ  . PHE A 1 103 ? -9.857  27.110 -24.510 1.00 71.58  ? 111  PHE A CZ  1 
ATOM 749  N N   . ASP A 1 104 ? -6.178  21.222 -26.149 1.00 64.80  ? 112  ASP A N   1 
ATOM 750  C CA  . ASP A 1 104 ? -5.887  19.812 -26.341 1.00 72.12  ? 112  ASP A CA  1 
ATOM 751  C C   . ASP A 1 104 ? -4.477  19.462 -25.843 1.00 74.08  ? 112  ASP A C   1 
ATOM 752  O O   . ASP A 1 104 ? -4.303  18.526 -25.047 1.00 79.76  ? 112  ASP A O   1 
ATOM 753  C CB  . ASP A 1 104 ? -6.111  19.428 -27.800 1.00 74.29  ? 112  ASP A CB  1 
ATOM 754  C CG  . ASP A 1 104 ? -7.480  19.886 -28.311 1.00 83.19  ? 112  ASP A CG  1 
ATOM 755  O OD1 . ASP A 1 104 ? -8.399  20.064 -27.474 1.00 81.13  ? 112  ASP A OD1 1 
ATOM 756  O OD2 . ASP A 1 104 ? -7.627  20.096 -29.536 1.00 91.60  ? 112  ASP A OD2 1 
ATOM 757  N N   . GLU A 1 105 ? -3.490  20.242 -26.255 1.00 69.17  ? 113  GLU A N   1 
ATOM 758  C CA  . GLU A 1 105 ? -2.137  20.007 -25.813 1.00 75.16  ? 113  GLU A CA  1 
ATOM 759  C C   . GLU A 1 105 ? -1.975  20.364 -24.314 1.00 76.62  ? 113  GLU A C   1 
ATOM 760  O O   . GLU A 1 105 ? -1.222  19.699 -23.548 1.00 71.12  ? 113  GLU A O   1 
ATOM 761  C CB  . GLU A 1 105 ? -1.170  20.802 -26.677 1.00 79.96  ? 113  GLU A CB  1 
ATOM 762  C CG  . GLU A 1 105 ? 0.257   20.295 -26.587 1.00 83.69  ? 113  GLU A CG  1 
ATOM 763  C CD  . GLU A 1 105 ? 1.247   21.254 -27.209 1.00 90.81  ? 113  GLU A CD  1 
ATOM 764  O OE1 . GLU A 1 105 ? 0.837   22.039 -28.105 1.00 91.64  ? 113  GLU A OE1 1 
ATOM 765  O OE2 . GLU A 1 105 ? 2.434   21.208 -26.803 1.00 93.30  ? 113  GLU A OE2 1 
ATOM 766  N N   . ALA A 1 106 ? -2.682  21.405 -23.892 1.00 69.58  ? 114  ALA A N   1 
ATOM 767  C CA  . ALA A 1 106 ? -2.750  21.728 -22.459 1.00 72.21  ? 114  ALA A CA  1 
ATOM 768  C C   . ALA A 1 106 ? -3.203  20.519 -21.613 1.00 66.92  ? 114  ALA A C   1 
ATOM 769  O O   . ALA A 1 106 ? -2.584  20.200 -20.587 1.00 61.19  ? 114  ALA A O   1 
ATOM 770  C CB  . ALA A 1 106 ? -3.672  22.924 -22.226 1.00 70.78  ? 114  ALA A CB  1 
ATOM 771  N N   . ILE A 1 107 ? -4.276  19.855 -22.047 1.00 60.53  ? 115  ILE A N   1 
ATOM 772  C CA  . ILE A 1 107 ? -4.762  18.669 -21.347 1.00 65.25  ? 115  ILE A CA  1 
ATOM 773  C C   . ILE A 1 107 ? -3.672  17.613 -21.210 1.00 62.86  ? 115  ILE A C   1 
ATOM 774  O O   . ILE A 1 107 ? -3.434  17.102 -20.125 1.00 65.11  ? 115  ILE A O   1 
ATOM 775  C CB  . ILE A 1 107 ? -6.005  18.064 -22.027 1.00 68.50  ? 115  ILE A CB  1 
ATOM 776  C CG1 . ILE A 1 107 ? -7.224  18.937 -21.715 1.00 73.72  ? 115  ILE A CG1 1 
ATOM 777  C CG2 . ILE A 1 107 ? -6.280  16.655 -21.518 1.00 64.82  ? 115  ILE A CG2 1 
ATOM 778  C CD1 . ILE A 1 107 ? -8.250  19.026 -22.829 1.00 78.26  ? 115  ILE A CD1 1 
ATOM 779  N N   . VAL A 1 108 ? -2.990  17.312 -22.298 1.00 57.97  ? 116  VAL A N   1 
ATOM 780  C CA  . VAL A 1 108 ? -1.900  16.366 -22.222 1.00 57.35  ? 116  VAL A CA  1 
ATOM 781  C C   . VAL A 1 108 ? -0.868  16.806 -21.225 1.00 61.64  ? 116  VAL A C   1 
ATOM 782  O O   . VAL A 1 108 ? -0.349  15.969 -20.480 1.00 70.00  ? 116  VAL A O   1 
ATOM 783  C CB  . VAL A 1 108 ? -1.152  16.205 -23.546 1.00 55.18  ? 116  VAL A CB  1 
ATOM 784  C CG1 . VAL A 1 108 ? -0.129  15.094 -23.406 1.00 53.62  ? 116  VAL A CG1 1 
ATOM 785  C CG2 . VAL A 1 108 ? -2.115  15.910 -24.680 1.00 54.24  ? 116  VAL A CG2 1 
ATOM 786  N N   . CYS A 1 109 ? -0.531  18.099 -21.237 1.00 66.84  ? 117  CYS A N   1 
ATOM 787  C CA  . CYS A 1 109 ? 0.547   18.614 -20.366 1.00 71.11  ? 117  CYS A CA  1 
ATOM 788  C C   . CYS A 1 109 ? 0.194   18.559 -18.882 1.00 72.07  ? 117  CYS A C   1 
ATOM 789  O O   . CYS A 1 109 ? 1.003   18.116 -18.051 1.00 67.99  ? 117  CYS A O   1 
ATOM 790  C CB  . CYS A 1 109 ? 0.932   20.038 -20.750 1.00 73.75  ? 117  CYS A CB  1 
ATOM 791  S SG  . CYS A 1 109 ? 2.015   20.101 -22.186 1.00 71.16  ? 117  CYS A SG  1 
ATOM 792  N N   . CYS A 1 110 ? -1.019  19.001 -18.559 1.00 72.96  ? 118  CYS A N   1 
ATOM 793  C CA  . CYS A 1 110 ? -1.537  18.903 -17.193 1.00 74.36  ? 118  CYS A CA  1 
ATOM 794  C C   . CYS A 1 110 ? -1.735  17.429 -16.799 1.00 76.16  ? 118  CYS A C   1 
ATOM 795  O O   . CYS A 1 110 ? -1.481  17.046 -15.656 1.00 77.52  ? 118  CYS A O   1 
ATOM 796  C CB  . CYS A 1 110 ? -2.843  19.692 -17.064 1.00 72.02  ? 118  CYS A CB  1 
ATOM 797  S SG  . CYS A 1 110 ? -2.696  21.467 -17.438 1.00 77.55  ? 118  CYS A SG  1 
ATOM 798  N N   . GLN A 1 111 ? -2.150  16.593 -17.751 1.00 72.81  ? 119  GLN A N   1 
ATOM 799  C CA  . GLN A 1 111 ? -2.323  15.174 -17.466 1.00 71.55  ? 119  GLN A CA  1 
ATOM 800  C C   . GLN A 1 111 ? -1.002  14.551 -17.043 1.00 69.97  ? 119  GLN A C   1 
ATOM 801  O O   . GLN A 1 111 ? -0.963  13.742 -16.127 1.00 78.60  ? 119  GLN A O   1 
ATOM 802  C CB  . GLN A 1 111 ? -2.943  14.439 -18.658 1.00 75.15  ? 119  GLN A CB  1 
ATOM 803  C CG  . GLN A 1 111 ? -3.088  12.931 -18.498 1.00 77.55  ? 119  GLN A CG  1 
ATOM 804  C CD  . GLN A 1 111 ? -4.012  12.546 -17.369 1.00 77.88  ? 119  GLN A CD  1 
ATOM 805  O OE1 . GLN A 1 111 ? -5.206  12.845 -17.396 1.00 80.88  ? 119  GLN A OE1 1 
ATOM 806  N NE2 . GLN A 1 111 ? -3.462  11.898 -16.357 1.00 74.47  ? 119  GLN A NE2 1 
ATOM 807  N N   . ARG A 1 112 ? 0.081   14.957 -17.684 1.00 71.76  ? 120  ARG A N   1 
ATOM 808  C CA  . ARG A 1 112 ? 1.400   14.435 -17.340 1.00 76.98  ? 120  ARG A CA  1 
ATOM 809  C C   . ARG A 1 112 ? 1.785   14.795 -15.922 1.00 76.49  ? 120  ARG A C   1 
ATOM 810  O O   . ARG A 1 112 ? 2.415   14.027 -15.201 1.00 79.58  ? 120  ARG A O   1 
ATOM 811  C CB  . ARG A 1 112 ? 2.456   15.018 -18.268 1.00 81.29  ? 120  ARG A CB  1 
ATOM 812  C CG  . ARG A 1 112 ? 2.942   14.083 -19.353 1.00 94.31  ? 120  ARG A CG  1 
ATOM 813  C CD  . ARG A 1 112 ? 4.462   14.104 -19.440 1.00 102.53 ? 120  ARG A CD  1 
ATOM 814  N NE  . ARG A 1 112 ? 5.072   13.036 -18.636 1.00 110.80 ? 120  ARG A NE  1 
ATOM 815  C CZ  . ARG A 1 112 ? 5.616   11.920 -19.129 1.00 116.48 ? 120  ARG A CZ  1 
ATOM 816  N NH1 . ARG A 1 112 ? 5.661   11.700 -20.443 1.00 122.44 ? 120  ARG A NH1 1 
ATOM 817  N NH2 . ARG A 1 112 ? 6.136   11.016 -18.300 1.00 114.46 ? 120  ARG A NH2 1 
ATOM 818  N N   . HIS A 1 113 ? 1.447   16.013 -15.556 1.00 80.43  ? 121  HIS A N   1 
ATOM 819  C CA  . HIS A 1 113 ? 1.772   16.546 -14.253 1.00 78.62  ? 121  HIS A CA  1 
ATOM 820  C C   . HIS A 1 113 ? 1.091   15.661 -13.217 1.00 79.62  ? 121  HIS A C   1 
ATOM 821  O O   . HIS A 1 113 ? 1.712   15.208 -12.249 1.00 82.26  ? 121  HIS A O   1 
ATOM 822  C CB  . HIS A 1 113 ? 1.256   17.976 -14.215 1.00 76.59  ? 121  HIS A CB  1 
ATOM 823  C CG  . HIS A 1 113 ? 1.402   18.660 -12.901 1.00 70.38  ? 121  HIS A CG  1 
ATOM 824  N ND1 . HIS A 1 113 ? 0.759   19.850 -12.620 1.00 67.01  ? 121  HIS A ND1 1 
ATOM 825  C CD2 . HIS A 1 113 ? 2.101   18.332 -11.791 1.00 68.07  ? 121  HIS A CD2 1 
ATOM 826  C CE1 . HIS A 1 113 ? 1.074   20.235 -11.398 1.00 66.32  ? 121  HIS A CE1 1 
ATOM 827  N NE2 . HIS A 1 113 ? 1.880   19.329 -10.870 1.00 71.76  ? 121  HIS A NE2 1 
ATOM 828  N N   . LEU A 1 114 ? -0.180  15.381 -13.461 1.00 68.99  ? 122  LEU A N   1 
ATOM 829  C CA  . LEU A 1 114 ? -0.926  14.493 -12.607 1.00 71.14  ? 122  LEU A CA  1 
ATOM 830  C C   . LEU A 1 114 ? -0.263  13.115 -12.455 1.00 72.62  ? 122  LEU A C   1 
ATOM 831  O O   . LEU A 1 114 ? 0.045   12.662 -11.345 1.00 75.36  ? 122  LEU A O   1 
ATOM 832  C CB  . LEU A 1 114 ? -2.320  14.315 -13.183 1.00 70.39  ? 122  LEU A CB  1 
ATOM 833  C CG  . LEU A 1 114 ? -3.259  13.476 -12.332 1.00 66.99  ? 122  LEU A CG  1 
ATOM 834  C CD1 . LEU A 1 114 ? -3.148  13.866 -10.872 1.00 64.63  ? 122  LEU A CD1 1 
ATOM 835  C CD2 . LEU A 1 114 ? -4.686  13.650 -12.828 1.00 64.58  ? 122  LEU A CD2 1 
ATOM 836  N N   . ASP A 1 115 ? -0.049  12.459 -13.585 1.00 68.61  ? 123  ASP A N   1 
ATOM 837  C CA  . ASP A 1 115 ? 0.507   11.122 -13.608 1.00 65.48  ? 123  ASP A CA  1 
ATOM 838  C C   . ASP A 1 115 ? 1.830   11.003 -12.891 1.00 69.68  ? 123  ASP A C   1 
ATOM 839  O O   . ASP A 1 115 ? 2.018   10.070 -12.110 1.00 76.40  ? 123  ASP A O   1 
ATOM 840  C CB  . ASP A 1 115 ? 0.632   10.652 -15.044 1.00 69.46  ? 123  ASP A CB  1 
ATOM 841  C CG  . ASP A 1 115 ? -0.725  10.462 -15.695 1.00 77.07  ? 123  ASP A CG  1 
ATOM 842  O OD1 . ASP A 1 115 ? -1.714  10.410 -14.918 1.00 77.78  ? 123  ASP A OD1 1 
ATOM 843  O OD2 . ASP A 1 115 ? -0.814  10.383 -16.954 1.00 72.98  ? 123  ASP A OD2 1 
ATOM 844  N N   . ILE A 1 116 ? 2.738   11.944 -13.130 1.00 71.56  ? 124  ILE A N   1 
ATOM 845  C CA  . ILE A 1 116 ? 4.028   11.919 -12.443 1.00 76.39  ? 124  ILE A CA  1 
ATOM 846  C C   . ILE A 1 116 ? 3.836   12.152 -10.955 1.00 77.77  ? 124  ILE A C   1 
ATOM 847  O O   . ILE A 1 116 ? 4.545   11.556 -10.133 1.00 80.80  ? 124  ILE A O   1 
ATOM 848  C CB  . ILE A 1 116 ? 5.051   12.949 -13.003 1.00 75.89  ? 124  ILE A CB  1 
ATOM 849  C CG1 . ILE A 1 116 ? 5.498   12.561 -14.405 1.00 79.30  ? 124  ILE A CG1 1 
ATOM 850  C CG2 . ILE A 1 116 ? 6.304   13.018 -12.135 1.00 70.24  ? 124  ILE A CG2 1 
ATOM 851  C CD1 . ILE A 1 116 ? 6.422   13.574 -15.056 1.00 84.60  ? 124  ILE A CD1 1 
ATOM 852  N N   . SER A 1 117 ? 2.905   13.036 -10.602 1.00 79.72  ? 125  SER A N   1 
ATOM 853  C CA  . SER A 1 117 ? 2.702   13.362 -9.189  1.00 78.32  ? 125  SER A CA  1 
ATOM 854  C C   . SER A 1 117 ? 2.135   12.155 -8.465  1.00 74.76  ? 125  SER A C   1 
ATOM 855  O O   . SER A 1 117 ? 2.541   11.845 -7.334  1.00 70.45  ? 125  SER A O   1 
ATOM 856  C CB  . SER A 1 117 ? 1.812   14.580 -9.035  1.00 72.50  ? 125  SER A CB  1 
ATOM 857  O OG  . SER A 1 117 ? 2.452   15.675 -9.648  1.00 70.07  ? 125  SER A OG  1 
ATOM 858  N N   . ARG A 1 118 ? 1.236   11.443 -9.139  1.00 71.20  ? 126  ARG A N   1 
ATOM 859  C CA  . ARG A 1 118 ? 0.759   10.168 -8.614  1.00 76.74  ? 126  ARG A CA  1 
ATOM 860  C C   . ARG A 1 118 ? 1.900   9.143  -8.463  1.00 80.23  ? 126  ARG A C   1 
ATOM 861  O O   . ARG A 1 118 ? 2.144   8.632  -7.371  1.00 75.51  ? 126  ARG A O   1 
ATOM 862  C CB  . ARG A 1 118 ? -0.368  9.626  -9.475  1.00 70.20  ? 126  ARG A CB  1 
ATOM 863  C CG  . ARG A 1 118 ? -1.730  10.091 -9.005  1.00 67.06  ? 126  ARG A CG  1 
ATOM 864  C CD  . ARG A 1 118 ? -2.746  10.031 -10.129 1.00 66.17  ? 126  ARG A CD  1 
ATOM 865  N NE  . ARG A 1 118 ? -4.012  10.628 -9.732  1.00 65.83  ? 126  ARG A NE  1 
ATOM 866  C CZ  . ARG A 1 118 ? -5.087  10.705 -10.515 1.00 66.58  ? 126  ARG A CZ  1 
ATOM 867  N NH1 . ARG A 1 118 ? -5.060  10.223 -11.750 1.00 61.48  ? 126  ARG A NH1 1 
ATOM 868  N NH2 . ARG A 1 118 ? -6.198  11.280 -10.057 1.00 68.51  ? 126  ARG A NH2 1 
ATOM 869  N N   . GLU A 1 119 ? 2.628   8.895  -9.543  1.00 89.38  ? 127  GLU A N   1 
ATOM 870  C CA  . GLU A 1 119 ? 3.794   8.021  -9.484  1.00 95.65  ? 127  GLU A CA  1 
ATOM 871  C C   . GLU A 1 119 ? 4.638   8.287  -8.234  1.00 92.80  ? 127  GLU A C   1 
ATOM 872  O O   . GLU A 1 119 ? 4.828   7.401  -7.411  1.00 106.30 ? 127  GLU A O   1 
ATOM 873  C CB  . GLU A 1 119 ? 4.684   8.221  -10.707 1.00 106.75 ? 127  GLU A CB  1 
ATOM 874  C CG  . GLU A 1 119 ? 4.142   7.694  -12.028 1.00 116.64 ? 127  GLU A CG  1 
ATOM 875  C CD  . GLU A 1 119 ? 5.212   7.679  -13.120 1.00 123.02 ? 127  GLU A CD  1 
ATOM 876  O OE1 . GLU A 1 119 ? 4.895   7.982  -14.295 1.00 118.92 ? 127  GLU A OE1 1 
ATOM 877  O OE2 . GLU A 1 119 ? 6.382   7.371  -12.799 1.00 122.26 ? 127  GLU A OE2 1 
ATOM 878  N N   . LEU A 1 120 ? 5.124   9.514  -8.094  1.00 89.70  ? 128  LEU A N   1 
ATOM 879  C CA  . LEU A 1 120 ? 5.980   9.886  -6.976  1.00 97.34  ? 128  LEU A CA  1 
ATOM 880  C C   . LEU A 1 120 ? 5.230   9.977  -5.658  1.00 101.37 ? 128  LEU A C   1 
ATOM 881  O O   . LEU A 1 120 ? 5.833   10.259 -4.610  1.00 87.88  ? 128  LEU A O   1 
ATOM 882  C CB  . LEU A 1 120 ? 6.590   11.257 -7.222  1.00 107.49 ? 128  LEU A CB  1 
ATOM 883  C CG  . LEU A 1 120 ? 7.477   11.471 -8.438  1.00 109.68 ? 128  LEU A CG  1 
ATOM 884  C CD1 . LEU A 1 120 ? 7.873   12.936 -8.492  1.00 108.30 ? 128  LEU A CD1 1 
ATOM 885  C CD2 . LEU A 1 120 ? 8.712   10.593 -8.361  1.00 116.04 ? 128  LEU A CD2 1 
ATOM 886  N N   . ASN A 1 121 ? 3.915   9.793  -5.714  1.00 104.05 ? 129  ASN A N   1 
ATOM 887  C CA  . ASN A 1 121 ? 3.091   9.896  -4.537  1.00 103.98 ? 129  ASN A CA  1 
ATOM 888  C C   . ASN A 1 121 ? 3.249   11.264 -3.874  1.00 97.65  ? 129  ASN A C   1 
ATOM 889  O O   . ASN A 1 121 ? 3.476   11.370 -2.664  1.00 87.87  ? 129  ASN A O   1 
ATOM 890  C CB  . ASN A 1 121 ? 3.427   8.770  -3.569  1.00 106.28 ? 129  ASN A CB  1 
ATOM 891  C CG  . ASN A 1 121 ? 2.192   8.088  -3.067  1.00 115.47 ? 129  ASN A CG  1 
ATOM 892  O OD1 . ASN A 1 121 ? 1.543   7.354  -3.811  1.00 119.76 ? 129  ASN A OD1 1 
ATOM 893  N ND2 . ASN A 1 121 ? 1.825   8.355  -1.823  1.00 121.32 ? 129  ASN A ND2 1 
ATOM 894  N N   . ASP A 1 122 ? 3.159   12.301 -4.703  1.00 91.69  ? 130  ASP A N   1 
ATOM 895  C CA  . ASP A 1 122 ? 3.122   13.679 -4.241  1.00 86.23  ? 130  ASP A CA  1 
ATOM 896  C C   . ASP A 1 122 ? 1.673   14.144 -4.277  1.00 85.33  ? 130  ASP A C   1 
ATOM 897  O O   . ASP A 1 122 ? 1.110   14.416 -5.337  1.00 85.90  ? 130  ASP A O   1 
ATOM 898  C CB  . ASP A 1 122 ? 3.979   14.580 -5.121  1.00 81.84  ? 130  ASP A CB  1 
ATOM 899  C CG  . ASP A 1 122 ? 3.956   16.006 -4.666  1.00 79.96  ? 130  ASP A CG  1 
ATOM 900  O OD1 . ASP A 1 122 ? 3.747   16.227 -3.461  1.00 86.40  ? 130  ASP A OD1 1 
ATOM 901  O OD2 . ASP A 1 122 ? 4.140   16.910 -5.500  1.00 84.76  ? 130  ASP A OD2 1 
ATOM 902  N N   . LYS A 1 123 ? 1.079   14.230 -3.102  1.00 80.98  ? 131  LYS A N   1 
ATOM 903  C CA  . LYS A 1 123 ? -0.330  14.478 -2.988  1.00 76.04  ? 131  LYS A CA  1 
ATOM 904  C C   . LYS A 1 123 ? -0.585  15.959 -3.220  1.00 71.38  ? 131  LYS A C   1 
ATOM 905  O O   . LYS A 1 123 ? -1.554  16.355 -3.886  1.00 68.39  ? 131  LYS A O   1 
ATOM 906  C CB  . LYS A 1 123 ? -0.795  14.037 -1.613  1.00 88.08  ? 131  LYS A CB  1 
ATOM 907  C CG  . LYS A 1 123 ? -0.544  12.552 -1.324  1.00 102.68 ? 131  LYS A CG  1 
ATOM 908  C CD  . LYS A 1 123 ? -1.740  11.676 -1.689  1.00 109.70 ? 131  LYS A CD  1 
ATOM 909  C CE  . LYS A 1 123 ? -1.728  10.345 -0.940  1.00 119.89 ? 131  LYS A CE  1 
ATOM 910  N NZ  . LYS A 1 123 ? -3.098  9.756  -0.846  1.00 121.77 ? 131  LYS A NZ  1 
ATOM 911  N N   . VAL A 1 124 ? 0.317   16.780 -2.705  1.00 67.85  ? 132  VAL A N   1 
ATOM 912  C CA  . VAL A 1 124 ? 0.293   18.226 -2.950  1.00 67.21  ? 132  VAL A CA  1 
ATOM 913  C C   . VAL A 1 124 ? 0.242   18.513 -4.439  1.00 63.85  ? 132  VAL A C   1 
ATOM 914  O O   . VAL A 1 124 ? -0.673  19.184 -4.919  1.00 58.95  ? 132  VAL A O   1 
ATOM 915  C CB  . VAL A 1 124 ? 1.554   18.918 -2.369  1.00 71.33  ? 132  VAL A CB  1 
ATOM 916  C CG1 . VAL A 1 124 ? 1.634   20.350 -2.847  1.00 77.29  ? 132  VAL A CG1 1 
ATOM 917  C CG2 . VAL A 1 124 ? 1.561   18.875 -0.839  1.00 70.63  ? 132  VAL A CG2 1 
ATOM 918  N N   . GLY A 1 125 ? 1.241   17.997 -5.157  1.00 61.25  ? 133  GLY A N   1 
ATOM 919  C CA  . GLY A 1 125 ? 1.335   18.160 -6.600  1.00 60.30  ? 133  GLY A CA  1 
ATOM 920  C C   . GLY A 1 125 ? 0.147   17.537 -7.294  1.00 67.56  ? 133  GLY A C   1 
ATOM 921  O O   . GLY A 1 125 ? -0.358  18.086 -8.279  1.00 73.63  ? 133  GLY A O   1 
ATOM 922  N N   . GLU A 1 126 ? -0.314  16.390 -6.785  1.00 68.80  ? 134  GLU A N   1 
ATOM 923  C CA  . GLU A 1 126 ? -1.430  15.689 -7.403  1.00 65.87  ? 134  GLU A CA  1 
ATOM 924  C C   . GLU A 1 126 ? -2.683  16.548 -7.380  1.00 67.68  ? 134  GLU A C   1 
ATOM 925  O O   . GLU A 1 126 ? -3.436  16.605 -8.354  1.00 61.10  ? 134  GLU A O   1 
ATOM 926  C CB  . GLU A 1 126 ? -1.717  14.372 -6.701  1.00 71.03  ? 134  GLU A CB  1 
ATOM 927  C CG  . GLU A 1 126 ? -2.978  13.697 -7.238  1.00 76.10  ? 134  GLU A CG  1 
ATOM 928  C CD  . GLU A 1 126 ? -3.332  12.405 -6.537  1.00 79.64  ? 134  GLU A CD  1 
ATOM 929  O OE1 . GLU A 1 126 ? -2.588  12.008 -5.604  1.00 78.75  ? 134  GLU A OE1 1 
ATOM 930  O OE2 . GLU A 1 126 ? -4.358  11.796 -6.937  1.00 77.44  ? 134  GLU A OE2 1 
ATOM 931  N N   . ALA A 1 127 ? -2.921  17.215 -6.261  1.00 69.77  ? 135  ALA A N   1 
ATOM 932  C CA  . ALA A 1 127 ? -4.131  18.015 -6.135  1.00 67.77  ? 135  ALA A CA  1 
ATOM 933  C C   . ALA A 1 127 ? -4.105  19.227 -7.075  1.00 69.53  ? 135  ALA A C   1 
ATOM 934  O O   . ALA A 1 127 ? -5.074  19.473 -7.798  1.00 70.27  ? 135  ALA A O   1 
ATOM 935  C CB  . ALA A 1 127 ? -4.315  18.450 -4.701  1.00 70.54  ? 135  ALA A CB  1 
ATOM 936  N N   . ARG A 1 128 ? -2.989  19.953 -7.097  1.00 67.70  ? 136  ARG A N   1 
ATOM 937  C CA  . ARG A 1 128 ? -2.843  21.115 -7.991  1.00 70.20  ? 136  ARG A CA  1 
ATOM 938  C C   . ARG A 1 128 ? -3.135  20.754 -9.441  1.00 72.76  ? 136  ARG A C   1 
ATOM 939  O O   . ARG A 1 128 ? -3.822  21.497 -10.165 1.00 70.75  ? 136  ARG A O   1 
ATOM 940  C CB  . ARG A 1 128 ? -1.429  21.647 -7.966  1.00 71.29  ? 136  ARG A CB  1 
ATOM 941  C CG  . ARG A 1 128 ? -0.828  21.812 -6.595  1.00 83.69  ? 136  ARG A CG  1 
ATOM 942  C CD  . ARG A 1 128 ? -0.609  23.260 -6.242  1.00 89.54  ? 136  ARG A CD  1 
ATOM 943  N NE  . ARG A 1 128 ? 0.770   23.496 -5.839  1.00 96.60  ? 136  ARG A NE  1 
ATOM 944  C CZ  . ARG A 1 128 ? 1.320   24.703 -5.770  1.00 115.44 ? 136  ARG A CZ  1 
ATOM 945  N NH1 . ARG A 1 128 ? 2.585   24.829 -5.399  1.00 128.94 ? 136  ARG A NH1 1 
ATOM 946  N NH2 . ARG A 1 128 ? 0.612   25.793 -6.069  1.00 115.37 ? 136  ARG A NH2 1 
ATOM 947  N N   . ALA A 1 129 ? -2.577  19.622 -9.874  1.00 71.61  ? 137  ALA A N   1 
ATOM 948  C CA  . ALA A 1 129 ? -2.763  19.164 -11.245 1.00 68.83  ? 137  ALA A CA  1 
ATOM 949  C C   . ALA A 1 129 ? -4.241  18.933 -11.494 1.00 67.13  ? 137  ALA A C   1 
ATOM 950  O O   . ALA A 1 129 ? -4.756  19.246 -12.568 1.00 61.76  ? 137  ALA A O   1 
ATOM 951  C CB  . ALA A 1 129 ? -1.973  17.900 -11.488 1.00 68.49  ? 137  ALA A CB  1 
ATOM 952  N N   . LEU A 1 130 ? -4.926  18.420 -10.470 1.00 70.67  ? 138  LEU A N   1 
ATOM 953  C CA  . LEU A 1 130 ? -6.368  18.186 -10.545 1.00 66.71  ? 138  LEU A CA  1 
ATOM 954  C C   . LEU A 1 130 ? -7.131  19.485 -10.742 1.00 61.99  ? 138  LEU A C   1 
ATOM 955  O O   . LEU A 1 130 ? -8.097  19.537 -11.495 1.00 53.67  ? 138  LEU A O   1 
ATOM 956  C CB  . LEU A 1 130 ? -6.862  17.451 -9.302  1.00 64.79  ? 138  LEU A CB  1 
ATOM 957  C CG  . LEU A 1 130 ? -6.538  15.958 -9.317  1.00 66.91  ? 138  LEU A CG  1 
ATOM 958  C CD1 . LEU A 1 130 ? -6.841  15.338 -7.970  1.00 71.00  ? 138  LEU A CD1 1 
ATOM 959  C CD2 . LEU A 1 130 ? -7.328  15.242 -10.391 1.00 67.76  ? 138  LEU A CD2 1 
ATOM 960  N N   . TYR A 1 131 ? -6.671  20.530 -10.075 1.00 63.70  ? 139  TYR A N   1 
ATOM 961  C CA  . TYR A 1 131 ? -7.258  21.858 -10.217 1.00 69.96  ? 139  TYR A CA  1 
ATOM 962  C C   . TYR A 1 131 ? -6.937  22.414 -11.604 1.00 70.75  ? 139  TYR A C   1 
ATOM 963  O O   . TYR A 1 131 ? -7.840  22.912 -12.306 1.00 74.14  ? 139  TYR A O   1 
ATOM 964  C CB  . TYR A 1 131 ? -6.729  22.783 -9.100  1.00 77.55  ? 139  TYR A CB  1 
ATOM 965  C CG  . TYR A 1 131 ? -7.151  24.218 -9.201  1.00 75.57  ? 139  TYR A CG  1 
ATOM 966  C CD1 . TYR A 1 131 ? -8.488  24.566 -9.102  1.00 77.43  ? 139  TYR A CD1 1 
ATOM 967  C CD2 . TYR A 1 131 ? -6.208  25.234 -9.393  1.00 81.78  ? 139  TYR A CD2 1 
ATOM 968  C CE1 . TYR A 1 131 ? -8.893  25.890 -9.199  1.00 84.63  ? 139  TYR A CE1 1 
ATOM 969  C CE2 . TYR A 1 131 ? -6.596  26.570 -9.486  1.00 83.74  ? 139  TYR A CE2 1 
ATOM 970  C CZ  . TYR A 1 131 ? -7.943  26.891 -9.392  1.00 88.39  ? 139  TYR A CZ  1 
ATOM 971  O OH  . TYR A 1 131 ? -8.358  28.196 -9.486  1.00 81.80  ? 139  TYR A OH  1 
ATOM 972  N N   . ASN A 1 132 ? -5.668  22.302 -12.006 1.00 61.74  ? 140  ASN A N   1 
ATOM 973  C CA  . ASN A 1 132 ? -5.245  22.786 -13.297 1.00 60.58  ? 140  ASN A CA  1 
ATOM 974  C C   . ASN A 1 132 ? -6.062  22.164 -14.413 1.00 67.38  ? 140  ASN A C   1 
ATOM 975  O O   . ASN A 1 132 ? -6.519  22.862 -15.329 1.00 66.25  ? 140  ASN A O   1 
ATOM 976  C CB  . ASN A 1 132 ? -3.789  22.472 -13.507 1.00 65.25  ? 140  ASN A CB  1 
ATOM 977  C CG  . ASN A 1 132 ? -2.905  23.310 -12.646 1.00 70.41  ? 140  ASN A CG  1 
ATOM 978  O OD1 . ASN A 1 132 ? -3.346  24.326 -12.131 1.00 82.97  ? 140  ASN A OD1 1 
ATOM 979  N ND2 . ASN A 1 132 ? -1.651  22.907 -12.486 1.00 70.69  ? 140  ASN A ND2 1 
ATOM 980  N N   . LEU A 1 133 ? -6.260  20.851 -14.328 1.00 63.79  ? 141  LEU A N   1 
ATOM 981  C CA  . LEU A 1 133 ? -7.077  20.153 -15.315 1.00 66.99  ? 141  LEU A CA  1 
ATOM 982  C C   . LEU A 1 133 ? -8.508  20.670 -15.310 1.00 70.15  ? 141  LEU A C   1 
ATOM 983  O O   . LEU A 1 133 ? -9.077  20.967 -16.364 1.00 75.04  ? 141  LEU A O   1 
ATOM 984  C CB  . LEU A 1 133 ? -7.062  18.647 -15.063 1.00 64.78  ? 141  LEU A CB  1 
ATOM 985  C CG  . LEU A 1 133 ? -5.716  18.014 -15.417 1.00 60.11  ? 141  LEU A CG  1 
ATOM 986  C CD1 . LEU A 1 133 ? -5.533  16.702 -14.702 1.00 66.64  ? 141  LEU A CD1 1 
ATOM 987  C CD2 . LEU A 1 133 ? -5.601  17.806 -16.903 1.00 57.78  ? 141  LEU A CD2 1 
ATOM 988  N N   . GLY A 1 134 ? -9.082  20.790 -14.120 1.00 65.94  ? 142  GLY A N   1 
ATOM 989  C CA  . GLY A 1 134 ? -10.377 21.411 -13.974 1.00 62.84  ? 142  GLY A CA  1 
ATOM 990  C C   . GLY A 1 134 ? -10.496 22.646 -14.838 1.00 67.78  ? 142  GLY A C   1 
ATOM 991  O O   . GLY A 1 134 ? -11.389 22.727 -15.680 1.00 70.50  ? 142  GLY A O   1 
ATOM 992  N N   . ASN A 1 135 ? -9.572  23.593 -14.666 1.00 68.33  ? 143  ASN A N   1 
ATOM 993  C CA  . ASN A 1 135 ? -9.650  24.890 -15.384 1.00 68.21  ? 143  ASN A CA  1 
ATOM 994  C C   . ASN A 1 135 ? -9.639  24.776 -16.907 1.00 67.83  ? 143  ASN A C   1 
ATOM 995  O O   . ASN A 1 135 ? -10.228 25.590 -17.614 1.00 67.39  ? 143  ASN A O   1 
ATOM 996  C CB  . ASN A 1 135 ? -8.468  25.762 -15.018 1.00 70.41  ? 143  ASN A CB  1 
ATOM 997  C CG  . ASN A 1 135 ? -8.341  25.994 -13.539 1.00 67.33  ? 143  ASN A CG  1 
ATOM 998  O OD1 . ASN A 1 135 ? -9.288  25.798 -12.779 1.00 70.91  ? 143  ASN A OD1 1 
ATOM 999  N ND2 . ASN A 1 135 ? -7.156  26.419 -13.117 1.00 62.59  ? 143  ASN A ND2 1 
ATOM 1000 N N   . VAL A 1 136 ? -8.918  23.775 -17.390 1.00 65.97  ? 144  VAL A N   1 
ATOM 1001 C CA  . VAL A 1 136 ? -8.721  23.558 -18.802 1.00 62.03  ? 144  VAL A CA  1 
ATOM 1002 C C   . VAL A 1 136 ? -10.015 23.081 -19.412 1.00 60.43  ? 144  VAL A C   1 
ATOM 1003 O O   . VAL A 1 136 ? -10.555 23.715 -20.308 1.00 61.90  ? 144  VAL A O   1 
ATOM 1004 C CB  . VAL A 1 136 ? -7.632  22.489 -19.038 1.00 65.01  ? 144  VAL A CB  1 
ATOM 1005 C CG1 . VAL A 1 136 ? -7.486  22.190 -20.513 1.00 64.69  ? 144  VAL A CG1 1 
ATOM 1006 C CG2 . VAL A 1 136 ? -6.302  22.947 -18.469 1.00 65.91  ? 144  VAL A CG2 1 
ATOM 1007 N N   . TYR A 1 137 ? -10.520 21.962 -18.916 1.00 60.28  ? 145  TYR A N   1 
ATOM 1008 C CA  . TYR A 1 137 ? -11.784 21.447 -19.397 1.00 63.20  ? 145  TYR A CA  1 
ATOM 1009 C C   . TYR A 1 137 ? -12.876 22.484 -19.225 1.00 70.16  ? 145  TYR A C   1 
ATOM 1010 O O   . TYR A 1 137 ? -13.823 22.521 -20.002 1.00 70.36  ? 145  TYR A O   1 
ATOM 1011 C CB  . TYR A 1 137 ? -12.169 20.194 -18.643 1.00 64.85  ? 145  TYR A CB  1 
ATOM 1012 C CG  . TYR A 1 137 ? -11.464 18.977 -19.140 1.00 68.71  ? 145  TYR A CG  1 
ATOM 1013 C CD1 . TYR A 1 137 ? -11.958 18.252 -20.214 1.00 74.47  ? 145  TYR A CD1 1 
ATOM 1014 C CD2 . TYR A 1 137 ? -10.301 18.546 -18.546 1.00 74.09  ? 145  TYR A CD2 1 
ATOM 1015 C CE1 . TYR A 1 137 ? -11.304 17.115 -20.678 1.00 77.93  ? 145  TYR A CE1 1 
ATOM 1016 C CE2 . TYR A 1 137 ? -9.635  17.422 -19.004 1.00 82.39  ? 145  TYR A CE2 1 
ATOM 1017 C CZ  . TYR A 1 137 ? -10.138 16.706 -20.068 1.00 79.66  ? 145  TYR A CZ  1 
ATOM 1018 O OH  . TYR A 1 137 ? -9.450  15.589 -20.501 1.00 86.76  ? 145  TYR A OH  1 
ATOM 1019 N N   . HIS A 1 138 ? -12.753 23.325 -18.199 1.00 73.37  ? 146  HIS A N   1 
ATOM 1020 C CA  . HIS A 1 138 ? -13.699 24.409 -18.009 1.00 71.02  ? 146  HIS A CA  1 
ATOM 1021 C C   . HIS A 1 138 ? -13.551 25.360 -19.158 1.00 71.27  ? 146  HIS A C   1 
ATOM 1022 O O   . HIS A 1 138 ? -14.470 25.540 -19.944 1.00 76.42  ? 146  HIS A O   1 
ATOM 1023 C CB  . HIS A 1 138 ? -13.445 25.144 -16.703 1.00 76.62  ? 146  HIS A CB  1 
ATOM 1024 C CG  . HIS A 1 138 ? -14.274 26.380 -16.542 1.00 83.64  ? 146  HIS A CG  1 
ATOM 1025 N ND1 . HIS A 1 138 ? -15.574 26.351 -16.080 1.00 89.56  ? 146  HIS A ND1 1 
ATOM 1026 C CD2 . HIS A 1 138 ? -13.993 27.677 -16.787 1.00 84.33  ? 146  HIS A CD2 1 
ATOM 1027 C CE1 . HIS A 1 138 ? -16.057 27.577 -16.043 1.00 87.84  ? 146  HIS A CE1 1 
ATOM 1028 N NE2 . HIS A 1 138 ? -15.114 28.403 -16.458 1.00 94.36  ? 146  HIS A NE2 1 
ATOM 1029 N N   . ALA A 1 139 ? -12.365 25.940 -19.272 1.00 69.84  ? 147  ALA A N   1 
ATOM 1030 C CA  . ALA A 1 139 ? -12.067 26.862 -20.352 1.00 71.31  ? 147  ALA A CA  1 
ATOM 1031 C C   . ALA A 1 139 ? -12.522 26.319 -21.707 1.00 74.48  ? 147  ALA A C   1 
ATOM 1032 O O   . ALA A 1 139 ? -13.143 27.042 -22.484 1.00 77.71  ? 147  ALA A O   1 
ATOM 1033 C CB  . ALA A 1 139 ? -10.582 27.165 -20.375 1.00 69.45  ? 147  ALA A CB  1 
ATOM 1034 N N   . LYS A 1 140 ? -12.223 25.049 -21.973 1.00 73.07  ? 148  LYS A N   1 
ATOM 1035 C CA  . LYS A 1 140 ? -12.556 24.448 -23.242 1.00 74.86  ? 148  LYS A CA  1 
ATOM 1036 C C   . LYS A 1 140 ? -14.043 24.532 -23.467 1.00 77.15  ? 148  LYS A C   1 
ATOM 1037 O O   . LYS A 1 140 ? -14.489 25.105 -24.454 1.00 86.47  ? 148  LYS A O   1 
ATOM 1038 C CB  . LYS A 1 140 ? -12.082 22.995 -23.307 1.00 85.75  ? 148  LYS A CB  1 
ATOM 1039 C CG  . LYS A 1 140 ? -12.544 22.218 -24.544 1.00 91.73  ? 148  LYS A CG  1 
ATOM 1040 C CD  . LYS A 1 140 ? -11.762 20.914 -24.728 1.00 98.16  ? 148  LYS A CD  1 
ATOM 1041 C CE  . LYS A 1 140 ? -12.195 20.173 -25.993 1.00 103.20 ? 148  LYS A CE  1 
ATOM 1042 N NZ  . LYS A 1 140 ? -13.122 19.035 -25.720 1.00 105.79 ? 148  LYS A NZ  1 
ATOM 1043 N N   . GLY A 1 141 ? -14.819 23.980 -22.545 1.00 79.80  ? 149  GLY A N   1 
ATOM 1044 C CA  . GLY A 1 141 ? -16.278 23.956 -22.706 1.00 81.41  ? 149  GLY A CA  1 
ATOM 1045 C C   . GLY A 1 141 ? -16.867 25.366 -22.758 1.00 88.43  ? 149  GLY A C   1 
ATOM 1046 O O   . GLY A 1 141 ? -17.864 25.622 -23.458 1.00 80.93  ? 149  GLY A O   1 
ATOM 1047 N N   . LYS A 1 142 ? -16.242 26.279 -22.011 1.00 87.63  ? 150  LYS A N   1 
ATOM 1048 C CA  . LYS A 1 142 ? -16.676 27.663 -21.954 1.00 84.76  ? 150  LYS A CA  1 
ATOM 1049 C C   . LYS A 1 142 ? -16.526 28.314 -23.322 1.00 93.70  ? 150  LYS A C   1 
ATOM 1050 O O   . LYS A 1 142 ? -17.375 29.099 -23.729 1.00 105.88 ? 150  LYS A O   1 
ATOM 1051 C CB  . LYS A 1 142 ? -15.851 28.425 -20.927 1.00 83.89  ? 150  LYS A CB  1 
ATOM 1052 C CG  . LYS A 1 142 ? -16.394 29.799 -20.572 1.00 88.24  ? 150  LYS A CG  1 
ATOM 1053 C CD  . LYS A 1 142 ? -15.269 30.797 -20.278 1.00 98.90  ? 150  LYS A CD  1 
ATOM 1054 C CE  . LYS A 1 142 ? -14.637 30.611 -18.900 1.00 98.48  ? 150  LYS A CE  1 
ATOM 1055 N NZ  . LYS A 1 142 ? -13.207 31.049 -18.831 1.00 94.13  ? 150  LYS A NZ  1 
ATOM 1056 N N   . SER A 1 143 ? -15.467 27.959 -24.045 1.00 96.75  ? 151  SER A N   1 
ATOM 1057 C CA  . SER A 1 143 ? -15.110 28.662 -25.278 1.00 94.44  ? 151  SER A CA  1 
ATOM 1058 C C   . SER A 1 143 ? -15.879 28.191 -26.513 1.00 87.67  ? 151  SER A C   1 
ATOM 1059 O O   . SER A 1 143 ? -15.453 28.444 -27.621 1.00 84.81  ? 151  SER A O   1 
ATOM 1060 C CB  . SER A 1 143 ? -13.609 28.542 -25.537 1.00 91.64  ? 151  SER A CB  1 
ATOM 1061 O OG  . SER A 1 143 ? -13.330 27.310 -26.162 1.00 91.91  ? 151  SER A OG  1 
ATOM 1062 N N   . PHE A 1 144 ? -16.997 27.506 -26.313 1.00 94.12  ? 152  PHE A N   1 
ATOM 1063 C CA  . PHE A 1 144 ? -17.958 27.211 -27.379 1.00 100.04 ? 152  PHE A CA  1 
ATOM 1064 C C   . PHE A 1 144 ? -18.833 28.446 -27.565 1.00 103.19 ? 152  PHE A C   1 
ATOM 1065 O O   . PHE A 1 144 ? -19.237 29.053 -26.581 1.00 111.28 ? 152  PHE A O   1 
ATOM 1066 C CB  . PHE A 1 144 ? -18.800 26.002 -26.953 1.00 100.62 ? 152  PHE A CB  1 
ATOM 1067 C CG  . PHE A 1 144 ? -19.907 25.628 -27.906 1.00 110.90 ? 152  PHE A CG  1 
ATOM 1068 C CD1 . PHE A 1 144 ? -21.156 26.261 -27.839 1.00 116.48 ? 152  PHE A CD1 1 
ATOM 1069 C CD2 . PHE A 1 144 ? -19.736 24.585 -28.827 1.00 107.59 ? 152  PHE A CD2 1 
ATOM 1070 C CE1 . PHE A 1 144 ? -22.194 25.894 -28.700 1.00 111.04 ? 152  PHE A CE1 1 
ATOM 1071 C CE2 . PHE A 1 144 ? -20.770 24.220 -29.689 1.00 104.18 ? 152  PHE A CE2 1 
ATOM 1072 C CZ  . PHE A 1 144 ? -21.999 24.879 -29.628 1.00 103.12 ? 152  PHE A CZ  1 
ATOM 1073 N N   . GLY A 1 145 ? -19.115 28.831 -28.808 1.00 109.47 ? 153  GLY A N   1 
ATOM 1074 C CA  . GLY A 1 145 ? -19.957 30.009 -29.083 1.00 120.60 ? 153  GLY A CA  1 
ATOM 1075 C C   . GLY A 1 145 ? -19.793 31.146 -28.072 1.00 135.81 ? 153  GLY A C   1 
ATOM 1076 O O   . GLY A 1 145 ? -18.703 31.711 -27.932 1.00 152.65 ? 153  GLY A O   1 
ATOM 1077 N N   . CYS A 1 146 ? -20.887 31.477 -27.374 1.00 150.38 ? 154  CYS A N   1 
ATOM 1078 C CA  . CYS A 1 146 ? -20.883 32.460 -26.269 1.00 154.16 ? 154  CYS A CA  1 
ATOM 1079 C C   . CYS A 1 146 ? -21.402 31.795 -24.973 1.00 171.07 ? 154  CYS A C   1 
ATOM 1080 O O   . CYS A 1 146 ? -22.000 30.718 -25.037 1.00 191.34 ? 154  CYS A O   1 
ATOM 1081 C CB  . CYS A 1 146 ? -21.763 33.662 -26.628 1.00 148.92 ? 154  CYS A CB  1 
ATOM 1082 S SG  . CYS A 1 146 ? -21.814 34.065 -28.393 1.00 145.17 ? 154  CYS A SG  1 
ATOM 1083 N N   . PRO A 1 147 ? -21.191 32.434 -23.794 1.00 176.42 ? 155  PRO A N   1 
ATOM 1084 C CA  . PRO A 1 147 ? -21.632 31.811 -22.523 1.00 167.32 ? 155  PRO A CA  1 
ATOM 1085 C C   . PRO A 1 147 ? -23.110 32.035 -22.148 1.00 152.52 ? 155  PRO A C   1 
ATOM 1086 O O   . PRO A 1 147 ? -23.737 32.998 -22.593 1.00 130.99 ? 155  PRO A O   1 
ATOM 1087 C CB  . PRO A 1 147 ? -20.696 32.439 -21.466 1.00 166.86 ? 155  PRO A CB  1 
ATOM 1088 C CG  . PRO A 1 147 ? -19.838 33.435 -22.184 1.00 173.72 ? 155  PRO A CG  1 
ATOM 1089 C CD  . PRO A 1 147 ? -20.421 33.665 -23.550 1.00 174.82 ? 155  PRO A CD  1 
ATOM 1090 N N   . PRO A 1 149 ? -27.498 32.859 -22.155 1.00 173.46 ? 157  PRO A N   1 
ATOM 1091 C CA  . PRO A 1 149 ? -28.756 32.208 -21.782 1.00 174.44 ? 157  PRO A CA  1 
ATOM 1092 C C   . PRO A 1 149 ? -29.113 31.027 -22.686 1.00 177.16 ? 157  PRO A C   1 
ATOM 1093 O O   . PRO A 1 149 ? -29.435 29.947 -22.182 1.00 171.31 ? 157  PRO A O   1 
ATOM 1094 C CB  . PRO A 1 149 ? -29.793 33.332 -21.921 1.00 172.13 ? 157  PRO A CB  1 
ATOM 1095 C CG  . PRO A 1 149 ? -29.201 34.311 -22.878 1.00 169.57 ? 157  PRO A CG  1 
ATOM 1096 C CD  . PRO A 1 149 ? -27.708 34.127 -22.878 1.00 167.29 ? 157  PRO A CD  1 
ATOM 1097 N N   . GLN A 1 150 ? -29.051 31.242 -24.003 1.00 181.22 ? 158  GLN A N   1 
ATOM 1098 C CA  . GLN A 1 150 ? -29.355 30.207 -25.006 1.00 178.73 ? 158  GLN A CA  1 
ATOM 1099 C C   . GLN A 1 150 ? -28.416 29.009 -24.899 1.00 189.21 ? 158  GLN A C   1 
ATOM 1100 O O   . GLN A 1 150 ? -28.766 27.898 -25.306 1.00 192.77 ? 158  GLN A O   1 
ATOM 1101 C CB  . GLN A 1 150 ? -29.267 30.791 -26.421 1.00 163.71 ? 158  GLN A CB  1 
ATOM 1102 N N   . ASP A 1 151 ? -27.218 29.254 -24.369 1.00 195.20 ? 159  ASP A N   1 
ATOM 1103 C CA  . ASP A 1 151 ? -26.258 28.201 -24.065 1.00 188.94 ? 159  ASP A CA  1 
ATOM 1104 C C   . ASP A 1 151 ? -26.852 27.158 -23.110 1.00 192.28 ? 159  ASP A C   1 
ATOM 1105 O O   . ASP A 1 151 ? -27.092 26.022 -23.514 1.00 202.88 ? 159  ASP A O   1 
ATOM 1106 C CB  . ASP A 1 151 ? -24.988 28.811 -23.464 1.00 186.65 ? 159  ASP A CB  1 
ATOM 1107 N N   . VAL A 1 152 ? -27.123 27.560 -21.864 1.00 186.51 ? 160  VAL A N   1 
ATOM 1108 C CA  . VAL A 1 152 ? -27.616 26.644 -20.808 1.00 174.60 ? 160  VAL A CA  1 
ATOM 1109 C C   . VAL A 1 152 ? -28.822 25.767 -21.208 1.00 169.75 ? 160  VAL A C   1 
ATOM 1110 O O   . VAL A 1 152 ? -28.969 24.647 -20.709 1.00 153.79 ? 160  VAL A O   1 
ATOM 1111 C CB  . VAL A 1 152 ? -27.984 27.422 -19.528 1.00 160.49 ? 160  VAL A CB  1 
ATOM 1112 N N   . GLY A 1 153 ? -29.673 26.283 -22.098 1.00 167.54 ? 161  GLY A N   1 
ATOM 1113 C CA  . GLY A 1 153 ? -30.808 25.529 -22.639 1.00 158.41 ? 161  GLY A CA  1 
ATOM 1114 C C   . GLY A 1 153 ? -30.413 24.437 -23.621 1.00 153.21 ? 161  GLY A C   1 
ATOM 1115 O O   . GLY A 1 153 ? -30.812 23.283 -23.458 1.00 153.12 ? 161  GLY A O   1 
ATOM 1116 N N   . GLU A 1 154 ? -29.632 24.799 -24.642 1.00 148.97 ? 162  GLU A N   1 
ATOM 1117 C CA  . GLU A 1 154 ? -29.148 23.837 -25.646 1.00 144.28 ? 162  GLU A CA  1 
ATOM 1118 C C   . GLU A 1 154 ? -27.633 23.932 -25.892 1.00 136.27 ? 162  GLU A C   1 
ATOM 1119 O O   . GLU A 1 154 ? -27.121 25.006 -26.236 1.00 128.56 ? 162  GLU A O   1 
ATOM 1120 C CB  . GLU A 1 154 ? -29.886 24.032 -26.980 1.00 146.26 ? 162  GLU A CB  1 
ATOM 1121 C CG  . GLU A 1 154 ? -29.269 23.254 -28.146 1.00 151.54 ? 162  GLU A CG  1 
ATOM 1122 C CD  . GLU A 1 154 ? -30.195 23.118 -29.344 1.00 151.65 ? 162  GLU A CD  1 
ATOM 1123 O OE1 . GLU A 1 154 ? -30.497 21.972 -29.742 1.00 141.50 ? 162  GLU A OE1 1 
ATOM 1124 O OE2 . GLU A 1 154 ? -30.618 24.156 -29.895 1.00 154.91 ? 162  GLU A OE2 1 
ATOM 1125 N N   . PHE A 1 155 ? -26.936 22.803 -25.710 1.00 125.62 ? 163  PHE A N   1 
ATOM 1126 C CA  . PHE A 1 155 ? -25.551 22.625 -26.191 1.00 115.28 ? 163  PHE A CA  1 
ATOM 1127 C C   . PHE A 1 155 ? -25.123 21.142 -26.255 1.00 100.49 ? 163  PHE A C   1 
ATOM 1128 O O   . PHE A 1 155 ? -25.704 20.291 -25.566 1.00 83.65  ? 163  PHE A O   1 
ATOM 1129 C CB  . PHE A 1 155 ? -24.529 23.464 -25.382 1.00 126.91 ? 163  PHE A CB  1 
ATOM 1130 C CG  . PHE A 1 155 ? -24.520 23.189 -23.897 1.00 134.60 ? 163  PHE A CG  1 
ATOM 1131 C CD1 . PHE A 1 155 ? -24.233 21.925 -23.398 1.00 140.66 ? 163  PHE A CD1 1 
ATOM 1132 C CD2 . PHE A 1 155 ? -24.749 24.219 -22.993 1.00 137.38 ? 163  PHE A CD2 1 
ATOM 1133 C CE1 . PHE A 1 155 ? -24.215 21.691 -22.035 1.00 140.78 ? 163  PHE A CE1 1 
ATOM 1134 C CE2 . PHE A 1 155 ? -24.734 23.990 -21.631 1.00 137.33 ? 163  PHE A CE2 1 
ATOM 1135 C CZ  . PHE A 1 155 ? -24.464 22.722 -21.151 1.00 144.48 ? 163  PHE A CZ  1 
ATOM 1136 N N   . PRO A 1 156 ? -24.088 20.836 -27.071 1.00 95.74  ? 164  PRO A N   1 
ATOM 1137 C CA  . PRO A 1 156 ? -23.696 19.462 -27.451 1.00 92.59  ? 164  PRO A CA  1 
ATOM 1138 C C   . PRO A 1 156 ? -23.183 18.577 -26.334 1.00 83.89  ? 164  PRO A C   1 
ATOM 1139 O O   . PRO A 1 156 ? -22.452 19.044 -25.463 1.00 80.38  ? 164  PRO A O   1 
ATOM 1140 C CB  . PRO A 1 156 ? -22.554 19.685 -28.458 1.00 94.35  ? 164  PRO A CB  1 
ATOM 1141 C CG  . PRO A 1 156 ? -22.729 21.077 -28.938 1.00 93.99  ? 164  PRO A CG  1 
ATOM 1142 C CD  . PRO A 1 156 ? -23.239 21.828 -27.753 1.00 96.25  ? 164  PRO A CD  1 
ATOM 1143 N N   . GLU A 1 157 ? -23.515 17.293 -26.398 1.00 77.87  ? 165  GLU A N   1 
ATOM 1144 C CA  . GLU A 1 157 ? -23.007 16.340 -25.420 1.00 84.85  ? 165  GLU A CA  1 
ATOM 1145 C C   . GLU A 1 157 ? -21.483 16.454 -25.205 1.00 82.13  ? 165  GLU A C   1 
ATOM 1146 O O   . GLU A 1 157 ? -21.009 16.297 -24.086 1.00 78.97  ? 165  GLU A O   1 
ATOM 1147 C CB  . GLU A 1 157 ? -23.392 14.887 -25.781 1.00 88.43  ? 165  GLU A CB  1 
ATOM 1148 C CG  . GLU A 1 157 ? -24.501 14.296 -24.910 1.00 92.47  ? 165  GLU A CG  1 
ATOM 1149 C CD  . GLU A 1 157 ? -24.135 14.231 -23.425 1.00 93.36  ? 165  GLU A CD  1 
ATOM 1150 N N   . GLU A 1 158 ? -20.720 16.736 -26.257 1.00 84.35  ? 166  GLU A N   1 
ATOM 1151 C CA  . GLU A 1 158 ? -19.257 16.843 -26.115 1.00 83.71  ? 166  GLU A CA  1 
ATOM 1152 C C   . GLU A 1 158 ? -18.816 18.086 -25.318 1.00 79.14  ? 166  GLU A C   1 
ATOM 1153 O O   . GLU A 1 158 ? -17.722 18.110 -24.770 1.00 83.21  ? 166  GLU A O   1 
ATOM 1154 C CB  . GLU A 1 158 ? -18.544 16.763 -27.481 1.00 86.73  ? 166  GLU A CB  1 
ATOM 1155 C CG  . GLU A 1 158 ? -18.109 15.347 -27.889 1.00 87.11  ? 166  GLU A CG  1 
ATOM 1156 C CD  . GLU A 1 158 ? -17.387 15.277 -29.242 1.00 91.85  ? 166  GLU A CD  1 
ATOM 1157 O OE1 . GLU A 1 158 ? -17.569 14.257 -29.950 1.00 93.77  ? 166  GLU A OE1 1 
ATOM 1158 O OE2 . GLU A 1 158 ? -16.646 16.227 -29.612 1.00 93.06  ? 166  GLU A OE2 1 
ATOM 1159 N N   . VAL A 1 159 ? -19.680 19.089 -25.213 1.00 86.93  ? 167  VAL A N   1 
ATOM 1160 C CA  . VAL A 1 159 ? -19.430 20.242 -24.322 1.00 84.68  ? 167  VAL A CA  1 
ATOM 1161 C C   . VAL A 1 159 ? -19.857 19.910 -22.887 1.00 83.12  ? 167  VAL A C   1 
ATOM 1162 O O   . VAL A 1 159 ? -19.087 20.129 -21.961 1.00 79.32  ? 167  VAL A O   1 
ATOM 1163 C CB  . VAL A 1 159 ? -20.166 21.523 -24.776 1.00 85.06  ? 167  VAL A CB  1 
ATOM 1164 C CG1 . VAL A 1 159 ? -19.648 22.727 -24.009 1.00 85.74  ? 167  VAL A CG1 1 
ATOM 1165 C CG2 . VAL A 1 159 ? -19.999 21.766 -26.272 1.00 86.16  ? 167  VAL A CG2 1 
ATOM 1166 N N   . ARG A 1 160 ? -21.082 19.404 -22.695 1.00 83.40  ? 168  ARG A N   1 
ATOM 1167 C CA  . ARG A 1 160 ? -21.472 18.855 -21.390 1.00 88.71  ? 168  ARG A CA  1 
ATOM 1168 C C   . ARG A 1 160 ? -20.273 18.108 -20.872 1.00 81.62  ? 168  ARG A C   1 
ATOM 1169 O O   . ARG A 1 160 ? -19.695 18.473 -19.841 1.00 85.60  ? 168  ARG A O   1 
ATOM 1170 C CB  . ARG A 1 160 ? -22.623 17.830 -21.477 1.00 101.11 ? 168  ARG A CB  1 
ATOM 1171 C CG  . ARG A 1 160 ? -24.050 18.355 -21.435 1.00 105.31 ? 168  ARG A CG  1 
ATOM 1172 C CD  . ARG A 1 160 ? -25.043 17.199 -21.362 1.00 107.70 ? 168  ARG A CD  1 
ATOM 1173 N NE  . ARG A 1 160 ? -26.149 17.368 -22.302 1.00 106.10 ? 168  ARG A NE  1 
ATOM 1174 N N   . ASP A 1 161 ? -19.897 17.070 -21.625 1.00 78.59  ? 169  ASP A N   1 
ATOM 1175 C CA  . ASP A 1 161 ? -18.846 16.137 -21.227 1.00 80.91  ? 169  ASP A CA  1 
ATOM 1176 C C   . ASP A 1 161 ? -17.647 16.904 -20.722 1.00 76.34  ? 169  ASP A C   1 
ATOM 1177 O O   . ASP A 1 161 ? -17.119 16.578 -19.672 1.00 81.60  ? 169  ASP A O   1 
ATOM 1178 C CB  . ASP A 1 161 ? -18.427 15.221 -22.393 1.00 87.26  ? 169  ASP A CB  1 
ATOM 1179 C CG  . ASP A 1 161 ? -19.462 14.118 -22.705 1.00 90.74  ? 169  ASP A CG  1 
ATOM 1180 O OD1 . ASP A 1 161 ? -20.498 14.001 -21.999 1.00 87.69  ? 169  ASP A OD1 1 
ATOM 1181 O OD2 . ASP A 1 161 ? -19.229 13.370 -23.684 1.00 89.33  ? 169  ASP A OD2 1 
ATOM 1182 N N   . ALA A 1 162 ? -17.253 17.943 -21.454 1.00 72.14  ? 170  ALA A N   1 
ATOM 1183 C CA  . ALA A 1 162 ? -16.096 18.759 -21.091 1.00 70.31  ? 170  ALA A CA  1 
ATOM 1184 C C   . ALA A 1 162 ? -16.259 19.476 -19.774 1.00 75.59  ? 170  ALA A C   1 
ATOM 1185 O O   . ALA A 1 162 ? -15.290 19.623 -19.028 1.00 81.35  ? 170  ALA A O   1 
ATOM 1186 C CB  . ALA A 1 162 ? -15.821 19.778 -22.173 1.00 72.52  ? 170  ALA A CB  1 
ATOM 1187 N N   . LEU A 1 163 ? -17.473 19.952 -19.500 1.00 74.56  ? 171  LEU A N   1 
ATOM 1188 C CA  . LEU A 1 163 ? -17.732 20.672 -18.265 1.00 74.08  ? 171  LEU A CA  1 
ATOM 1189 C C   . LEU A 1 163 ? -17.895 19.691 -17.131 1.00 75.41  ? 171  LEU A C   1 
ATOM 1190 O O   . LEU A 1 163 ? -17.169 19.756 -16.138 1.00 74.80  ? 171  LEU A O   1 
ATOM 1191 C CB  . LEU A 1 163 ? -18.957 21.553 -18.398 1.00 76.52  ? 171  LEU A CB  1 
ATOM 1192 C CG  . LEU A 1 163 ? -18.815 22.669 -19.440 1.00 76.26  ? 171  LEU A CG  1 
ATOM 1193 C CD1 . LEU A 1 163 ? -20.168 23.296 -19.756 1.00 77.10  ? 171  LEU A CD1 1 
ATOM 1194 C CD2 . LEU A 1 163 ? -17.834 23.731 -18.969 1.00 74.08  ? 171  LEU A CD2 1 
ATOM 1195 N N   . GLN A 1 164 ? -18.803 18.740 -17.277 1.00 72.89  ? 172  GLN A N   1 
ATOM 1196 C CA  . GLN A 1 164 ? -18.904 17.722 -16.240 1.00 79.99  ? 172  GLN A CA  1 
ATOM 1197 C C   . GLN A 1 164 ? -17.505 17.223 -15.849 1.00 75.58  ? 172  GLN A C   1 
ATOM 1198 O O   . GLN A 1 164 ? -17.229 17.013 -14.668 1.00 75.85  ? 172  GLN A O   1 
ATOM 1199 C CB  . GLN A 1 164 ? -19.818 16.562 -16.658 1.00 87.68  ? 172  GLN A CB  1 
ATOM 1200 C CG  . GLN A 1 164 ? -20.003 15.482 -15.590 1.00 89.56  ? 172  GLN A CG  1 
ATOM 1201 C CD  . GLN A 1 164 ? -20.568 16.017 -14.277 1.00 91.57  ? 172  GLN A CD  1 
ATOM 1202 O OE1 . GLN A 1 164 ? -21.546 16.765 -14.279 1.00 109.80 ? 172  GLN A OE1 1 
ATOM 1203 N NE2 . GLN A 1 164 ? -19.957 15.635 -13.151 1.00 85.48  ? 172  GLN A NE2 1 
ATOM 1204 N N   . ALA A 1 165 ? -16.613 17.082 -16.826 1.00 76.38  ? 173  ALA A N   1 
ATOM 1205 C CA  . ALA A 1 165 ? -15.245 16.617 -16.558 1.00 76.95  ? 173  ALA A CA  1 
ATOM 1206 C C   . ALA A 1 165 ? -14.526 17.538 -15.580 1.00 76.94  ? 173  ALA A C   1 
ATOM 1207 O O   . ALA A 1 165 ? -13.944 17.080 -14.594 1.00 76.65  ? 173  ALA A O   1 
ATOM 1208 C CB  . ALA A 1 165 ? -14.452 16.494 -17.847 1.00 76.48  ? 173  ALA A CB  1 
ATOM 1209 N N   . ALA A 1 166 ? -14.580 18.836 -15.836 1.00 75.11  ? 174  ALA A N   1 
ATOM 1210 C CA  . ALA A 1 166 ? -14.050 19.809 -14.869 1.00 82.50  ? 174  ALA A CA  1 
ATOM 1211 C C   . ALA A 1 166 ? -14.633 19.590 -13.455 1.00 85.97  ? 174  ALA A C   1 
ATOM 1212 O O   . ALA A 1 166 ? -13.888 19.412 -12.481 1.00 83.41  ? 174  ALA A O   1 
ATOM 1213 C CB  . ALA A 1 166 ? -14.330 21.232 -15.339 1.00 81.48  ? 174  ALA A CB  1 
ATOM 1214 N N   . VAL A 1 167 ? -15.962 19.587 -13.352 1.00 80.44  ? 175  VAL A N   1 
ATOM 1215 C CA  . VAL A 1 167 ? -16.621 19.301 -12.083 1.00 76.97  ? 175  VAL A CA  1 
ATOM 1216 C C   . VAL A 1 167 ? -15.906 18.152 -11.410 1.00 72.98  ? 175  VAL A C   1 
ATOM 1217 O O   . VAL A 1 167 ? -15.441 18.290 -10.293 1.00 71.14  ? 175  VAL A O   1 
ATOM 1218 C CB  . VAL A 1 167 ? -18.099 18.900 -12.251 1.00 80.08  ? 175  VAL A CB  1 
ATOM 1219 C CG1 . VAL A 1 167 ? -18.692 18.526 -10.917 1.00 79.66  ? 175  VAL A CG1 1 
ATOM 1220 C CG2 . VAL A 1 167 ? -18.921 20.029 -12.858 1.00 80.35  ? 175  VAL A CG2 1 
ATOM 1221 N N   . ASP A 1 168 ? -15.789 17.028 -12.114 1.00 74.90  ? 176  ASP A N   1 
ATOM 1222 C CA  . ASP A 1 168 ? -15.143 15.828 -11.543 1.00 72.34  ? 176  ASP A CA  1 
ATOM 1223 C C   . ASP A 1 168 ? -13.707 16.099 -11.041 1.00 68.92  ? 176  ASP A C   1 
ATOM 1224 O O   . ASP A 1 168 ? -13.281 15.520 -10.038 1.00 70.18  ? 176  ASP A O   1 
ATOM 1225 C CB  . ASP A 1 168 ? -15.137 14.662 -12.543 1.00 70.26  ? 176  ASP A CB  1 
ATOM 1226 C CG  . ASP A 1 168 ? -16.546 14.250 -13.012 1.00 72.05  ? 176  ASP A CG  1 
ATOM 1227 O OD1 . ASP A 1 168 ? -17.516 14.346 -12.248 1.00 71.94  ? 176  ASP A OD1 1 
ATOM 1228 O OD2 . ASP A 1 168 ? -16.686 13.799 -14.166 1.00 77.69  ? 176  ASP A OD2 1 
ATOM 1229 N N   . PHE A 1 169 ? -12.961 16.966 -11.725 1.00 66.26  ? 177  PHE A N   1 
ATOM 1230 C CA  . PHE A 1 169 ? -11.586 17.266 -11.291 1.00 64.93  ? 177  PHE A CA  1 
ATOM 1231 C C   . PHE A 1 169 ? -11.635 18.134 -10.057 1.00 69.20  ? 177  PHE A C   1 
ATOM 1232 O O   . PHE A 1 169 ? -10.971 17.861 -9.067  1.00 74.93  ? 177  PHE A O   1 
ATOM 1233 C CB  . PHE A 1 169 ? -10.781 17.968 -12.381 1.00 63.05  ? 177  PHE A CB  1 
ATOM 1234 C CG  . PHE A 1 169 ? -10.418 17.079 -13.518 1.00 60.61  ? 177  PHE A CG  1 
ATOM 1235 C CD1 . PHE A 1 169 ? -9.456  16.097 -13.364 1.00 59.11  ? 177  PHE A CD1 1 
ATOM 1236 C CD2 . PHE A 1 169 ? -11.045 17.204 -14.734 1.00 66.07  ? 177  PHE A CD2 1 
ATOM 1237 C CE1 . PHE A 1 169 ? -9.116  15.269 -14.404 1.00 56.06  ? 177  PHE A CE1 1 
ATOM 1238 C CE2 . PHE A 1 169 ? -10.724 16.355 -15.792 1.00 62.32  ? 177  PHE A CE2 1 
ATOM 1239 C CZ  . PHE A 1 169 ? -9.760  15.392 -15.624 1.00 57.13  ? 177  PHE A CZ  1 
ATOM 1240 N N   . TYR A 1 170 ? -12.451 19.176 -10.114 1.00 71.26  ? 178  TYR A N   1 
ATOM 1241 C CA  . TYR A 1 170 ? -12.599 20.067 -8.986  1.00 70.84  ? 178  TYR A CA  1 
ATOM 1242 C C   . TYR A 1 170 ? -12.950 19.280 -7.713  1.00 68.65  ? 178  TYR A C   1 
ATOM 1243 O O   . TYR A 1 170 ? -12.263 19.410 -6.696  1.00 68.14  ? 178  TYR A O   1 
ATOM 1244 C CB  . TYR A 1 170 ? -13.652 21.151 -9.299  1.00 73.30  ? 178  TYR A CB  1 
ATOM 1245 C CG  . TYR A 1 170 ? -13.176 22.210 -10.293 1.00 73.30  ? 178  TYR A CG  1 
ATOM 1246 C CD1 . TYR A 1 170 ? -11.911 22.783 -10.190 1.00 72.85  ? 178  TYR A CD1 1 
ATOM 1247 C CD2 . TYR A 1 170 ? -13.998 22.648 -11.321 1.00 73.05  ? 178  TYR A CD2 1 
ATOM 1248 C CE1 . TYR A 1 170 ? -11.482 23.735 -11.097 1.00 73.84  ? 178  TYR A CE1 1 
ATOM 1249 C CE2 . TYR A 1 170 ? -13.573 23.612 -12.222 1.00 68.75  ? 178  TYR A CE2 1 
ATOM 1250 C CZ  . TYR A 1 170 ? -12.321 24.146 -12.106 1.00 70.47  ? 178  TYR A CZ  1 
ATOM 1251 O OH  . TYR A 1 170 ? -11.901 25.094 -13.002 1.00 78.71  ? 178  TYR A OH  1 
ATOM 1252 N N   . GLU A 1 171 ? -13.988 18.442 -7.791  1.00 62.89  ? 179  GLU A N   1 
ATOM 1253 C CA  . GLU A 1 171 ? -14.415 17.645 -6.656  1.00 61.75  ? 179  GLU A CA  1 
ATOM 1254 C C   . GLU A 1 171 ? -13.251 16.785 -6.139  1.00 67.18  ? 179  GLU A C   1 
ATOM 1255 O O   . GLU A 1 171 ? -12.887 16.874 -4.963  1.00 72.16  ? 179  GLU A O   1 
ATOM 1256 C CB  . GLU A 1 171 ? -15.603 16.760 -7.023  1.00 64.21  ? 179  GLU A CB  1 
ATOM 1257 C CG  . GLU A 1 171 ? -16.875 17.486 -7.457  1.00 69.32  ? 179  GLU A CG  1 
ATOM 1258 C CD  . GLU A 1 171 ? -17.646 18.197 -6.335  1.00 78.63  ? 179  GLU A CD  1 
ATOM 1259 O OE1 . GLU A 1 171 ? -18.770 18.694 -6.622  1.00 87.35  ? 179  GLU A OE1 1 
ATOM 1260 O OE2 . GLU A 1 171 ? -17.159 18.284 -5.180  1.00 79.35  ? 179  GLU A OE2 1 
ATOM 1261 N N   . GLU A 1 172 ? -12.661 15.974 -7.017  1.00 67.67  ? 180  GLU A N   1 
ATOM 1262 C CA  . GLU A 1 172 ? -11.453 15.225 -6.675  1.00 71.23  ? 180  GLU A CA  1 
ATOM 1263 C C   . GLU A 1 172 ? -10.420 16.134 -6.017  1.00 66.44  ? 180  GLU A C   1 
ATOM 1264 O O   . GLU A 1 172 ? -9.855  15.817 -4.966  1.00 66.23  ? 180  GLU A O   1 
ATOM 1265 C CB  . GLU A 1 172 ? -10.807 14.623 -7.918  1.00 81.05  ? 180  GLU A CB  1 
ATOM 1266 C CG  . GLU A 1 172 ? -11.293 13.249 -8.358  1.00 90.15  ? 180  GLU A CG  1 
ATOM 1267 C CD  . GLU A 1 172 ? -10.601 12.801 -9.653  1.00 94.76  ? 180  GLU A CD  1 
ATOM 1268 O OE1 . GLU A 1 172 ? -11.263 12.801 -10.727 1.00 90.99  ? 180  GLU A OE1 1 
ATOM 1269 O OE2 . GLU A 1 172 ? -9.382  12.490 -9.603  1.00 88.36  ? 180  GLU A OE2 1 
ATOM 1270 N N   . ASN A 1 173 ? -10.144 17.263 -6.642  1.00 62.67  ? 181  ASN A N   1 
ATOM 1271 C CA  . ASN A 1 173 ? -9.222  18.193 -6.025  1.00 67.07  ? 181  ASN A CA  1 
ATOM 1272 C C   . ASN A 1 173 ? -9.643  18.490 -4.591  1.00 70.11  ? 181  ASN A C   1 
ATOM 1273 O O   . ASN A 1 173 ? -8.854  18.372 -3.661  1.00 65.67  ? 181  ASN A O   1 
ATOM 1274 C CB  . ASN A 1 173 ? -9.146  19.513 -6.773  1.00 62.94  ? 181  ASN A CB  1 
ATOM 1275 C CG  . ASN A 1 173 ? -8.343  20.527 -6.013  1.00 64.68  ? 181  ASN A CG  1 
ATOM 1276 O OD1 . ASN A 1 173 ? -8.841  21.563 -5.602  1.00 76.56  ? 181  ASN A OD1 1 
ATOM 1277 N ND2 . ASN A 1 173 ? -7.104  20.199 -5.763  1.00 70.53  ? 181  ASN A ND2 1 
ATOM 1278 N N   . LEU A 1 174 ? -10.905 18.880 -4.433  1.00 71.73  ? 182  LEU A N   1 
ATOM 1279 C CA  . LEU A 1 174 ? -11.417 19.291 -3.142  1.00 67.67  ? 182  LEU A CA  1 
ATOM 1280 C C   . LEU A 1 174 ? -11.157 18.225 -2.121  1.00 62.68  ? 182  LEU A C   1 
ATOM 1281 O O   . LEU A 1 174 ? -10.547 18.462 -1.084  1.00 64.28  ? 182  LEU A O   1 
ATOM 1282 C CB  . LEU A 1 174 ? -12.910 19.599 -3.225  1.00 67.90  ? 182  LEU A CB  1 
ATOM 1283 C CG  . LEU A 1 174 ? -13.232 21.051 -3.614  1.00 71.70  ? 182  LEU A CG  1 
ATOM 1284 C CD1 . LEU A 1 174 ? -14.694 21.219 -3.986  1.00 71.33  ? 182  LEU A CD1 1 
ATOM 1285 C CD2 . LEU A 1 174 ? -12.865 22.029 -2.496  1.00 73.17  ? 182  LEU A CD2 1 
ATOM 1286 N N   . SER A 1 175 ? -11.608 17.035 -2.443  1.00 66.14  ? 183  SER A N   1 
ATOM 1287 C CA  . SER A 1 175 ? -11.379 15.885 -1.603  1.00 70.55  ? 183  SER A CA  1 
ATOM 1288 C C   . SER A 1 175 ? -9.931  15.828 -1.110  1.00 69.06  ? 183  SER A C   1 
ATOM 1289 O O   . SER A 1 175 ? -9.676  15.780 0.088   1.00 65.49  ? 183  SER A O   1 
ATOM 1290 C CB  . SER A 1 175 ? -11.730 14.623 -2.379  1.00 71.94  ? 183  SER A CB  1 
ATOM 1291 O OG  . SER A 1 175 ? -11.418 13.488 -1.607  1.00 87.62  ? 183  SER A OG  1 
ATOM 1292 N N   . LEU A 1 176 ? -8.991  15.856 -2.044  1.00 75.23  ? 184  LEU A N   1 
ATOM 1293 C CA  . LEU A 1 176 ? -7.567  15.843 -1.716  1.00 75.82  ? 184  LEU A CA  1 
ATOM 1294 C C   . LEU A 1 176 ? -7.144  16.913 -0.729  1.00 74.72  ? 184  LEU A C   1 
ATOM 1295 O O   . LEU A 1 176 ? -6.342  16.679 0.180   1.00 75.36  ? 184  LEU A O   1 
ATOM 1296 C CB  . LEU A 1 176 ? -6.750  16.048 -2.987  1.00 86.30  ? 184  LEU A CB  1 
ATOM 1297 C CG  . LEU A 1 176 ? -6.104  14.810 -3.595  1.00 96.05  ? 184  LEU A CG  1 
ATOM 1298 C CD1 . LEU A 1 176 ? -4.880  14.417 -2.773  1.00 93.84  ? 184  LEU A CD1 1 
ATOM 1299 C CD2 . LEU A 1 176 ? -7.124  13.678 -3.715  1.00 99.09  ? 184  LEU A CD2 1 
ATOM 1300 N N   . VAL A 1 177 ? -7.673  18.105 -0.928  1.00 79.39  ? 185  VAL A N   1 
ATOM 1301 C CA  . VAL A 1 177 ? -7.186  19.289 -0.232  1.00 76.55  ? 185  VAL A CA  1 
ATOM 1302 C C   . VAL A 1 177 ? -7.830  19.446 1.153   1.00 77.37  ? 185  VAL A C   1 
ATOM 1303 O O   . VAL A 1 177 ? -7.272  20.080 2.061   1.00 71.31  ? 185  VAL A O   1 
ATOM 1304 C CB  . VAL A 1 177 ? -7.425  20.494 -1.122  1.00 75.97  ? 185  VAL A CB  1 
ATOM 1305 C CG1 . VAL A 1 177 ? -7.420  21.760 -0.322  1.00 89.51  ? 185  VAL A CG1 1 
ATOM 1306 C CG2 . VAL A 1 177 ? -6.355  20.531 -2.191  1.00 76.25  ? 185  VAL A CG2 1 
ATOM 1307 N N   . THR A 1 178 ? -9.001  18.848 1.309   1.00 72.51  ? 186  THR A N   1 
ATOM 1308 C CA  . THR A 1 178 ? -9.546  18.609 2.619   1.00 72.14  ? 186  THR A CA  1 
ATOM 1309 C C   . THR A 1 178 ? -8.580  17.781 3.491   1.00 67.44  ? 186  THR A C   1 
ATOM 1310 O O   . THR A 1 178 ? -8.279  18.167 4.622   1.00 65.06  ? 186  THR A O   1 
ATOM 1311 C CB  . THR A 1 178 ? -10.924 17.949 2.496   1.00 75.16  ? 186  THR A CB  1 
ATOM 1312 O OG1 . THR A 1 178 ? -11.753 18.767 1.656   1.00 72.48  ? 186  THR A OG1 1 
ATOM 1313 C CG2 . THR A 1 178 ? -11.567 17.829 3.848   1.00 79.16  ? 186  THR A CG2 1 
ATOM 1314 N N   . ALA A 1 179 ? -8.063  16.677 2.960   1.00 68.46  ? 187  ALA A N   1 
ATOM 1315 C CA  . ALA A 1 179 ? -7.047  15.887 3.684   1.00 66.80  ? 187  ALA A CA  1 
ATOM 1316 C C   . ALA A 1 179 ? -5.781  16.681 4.039   1.00 65.79  ? 187  ALA A C   1 
ATOM 1317 O O   . ALA A 1 179 ? -5.278  16.593 5.151   1.00 70.26  ? 187  ALA A O   1 
ATOM 1318 C CB  . ALA A 1 179 ? -6.675  14.662 2.885   1.00 67.44  ? 187  ALA A CB  1 
ATOM 1319 N N   . LEU A 1 180 ? -5.277  17.471 3.109   1.00 63.46  ? 188  LEU A N   1 
ATOM 1320 C CA  . LEU A 1 180 ? -4.048  18.220 3.370   1.00 72.47  ? 188  LEU A CA  1 
ATOM 1321 C C   . LEU A 1 180 ? -4.281  19.476 4.196   1.00 76.94  ? 188  LEU A C   1 
ATOM 1322 O O   . LEU A 1 180 ? -3.317  20.124 4.636   1.00 81.67  ? 188  LEU A O   1 
ATOM 1323 C CB  . LEU A 1 180 ? -3.392  18.622 2.058   1.00 75.67  ? 188  LEU A CB  1 
ATOM 1324 C CG  . LEU A 1 180 ? -3.006  17.456 1.154   1.00 73.03  ? 188  LEU A CG  1 
ATOM 1325 C CD1 . LEU A 1 180 ? -2.757  17.909 -0.272  1.00 69.59  ? 188  LEU A CD1 1 
ATOM 1326 C CD2 . LEU A 1 180 ? -1.783  16.784 1.730   1.00 73.44  ? 188  LEU A CD2 1 
ATOM 1327 N N   . GLY A 1 181 ? -5.549  19.839 4.374   1.00 68.57  ? 189  GLY A N   1 
ATOM 1328 C CA  . GLY A 1 181 ? -5.902  20.993 5.176   1.00 66.58  ? 189  GLY A CA  1 
ATOM 1329 C C   . GLY A 1 181 ? -5.632  22.338 4.527   1.00 69.94  ? 189  GLY A C   1 
ATOM 1330 O O   . GLY A 1 181 ? -5.393  23.327 5.221   1.00 71.64  ? 189  GLY A O   1 
ATOM 1331 N N   . ASP A 1 182 ? -5.723  22.398 3.201   1.00 73.78  ? 190  ASP A N   1 
ATOM 1332 C CA  . ASP A 1 182 ? -5.380  23.617 2.462   1.00 72.66  ? 190  ASP A CA  1 
ATOM 1333 C C   . ASP A 1 182 ? -6.621  24.465 2.140   1.00 65.31  ? 190  ASP A C   1 
ATOM 1334 O O   . ASP A 1 182 ? -7.244  24.346 1.092   1.00 55.41  ? 190  ASP A O   1 
ATOM 1335 C CB  . ASP A 1 182 ? -4.588  23.253 1.204   1.00 72.90  ? 190  ASP A CB  1 
ATOM 1336 C CG  . ASP A 1 182 ? -4.023  24.440 0.504   1.00 75.69  ? 190  ASP A CG  1 
ATOM 1337 O OD1 . ASP A 1 182 ? -4.418  25.582 0.828   1.00 83.24  ? 190  ASP A OD1 1 
ATOM 1338 O OD2 . ASP A 1 182 ? -3.176  24.222 -0.386  1.00 78.30  ? 190  ASP A OD2 1 
ATOM 1339 N N   . ARG A 1 183 ? -6.930  25.364 3.056   1.00 67.07  ? 191  ARG A N   1 
ATOM 1340 C CA  . ARG A 1 183 ? -8.070  26.257 2.905   1.00 67.49  ? 191  ARG A CA  1 
ATOM 1341 C C   . ARG A 1 183 ? -8.016  27.080 1.619   1.00 66.00  ? 191  ARG A C   1 
ATOM 1342 O O   . ARG A 1 183 ? -9.025  27.193 0.888   1.00 59.18  ? 191  ARG A O   1 
ATOM 1343 C CB  . ARG A 1 183 ? -8.141  27.199 4.101   1.00 69.04  ? 191  ARG A CB  1 
ATOM 1344 C CG  . ARG A 1 183 ? -8.228  26.505 5.457   1.00 74.60  ? 191  ARG A CG  1 
ATOM 1345 C CD  . ARG A 1 183 ? -9.531  25.742 5.618   1.00 75.79  ? 191  ARG A CD  1 
ATOM 1346 N NE  . ARG A 1 183 ? -10.663 26.628 5.905   1.00 75.44  ? 191  ARG A NE  1 
ATOM 1347 C CZ  . ARG A 1 183 ? -11.929 26.373 5.592   1.00 70.44  ? 191  ARG A CZ  1 
ATOM 1348 N NH1 . ARG A 1 183 ? -12.268 25.266 4.949   1.00 67.43  ? 191  ARG A NH1 1 
ATOM 1349 N NH2 . ARG A 1 183 ? -12.857 27.244 5.924   1.00 76.31  ? 191  ARG A NH2 1 
ATOM 1350 N N   . ALA A 1 184 ? -6.846  27.661 1.349   1.00 66.17  ? 192  ALA A N   1 
ATOM 1351 C CA  . ALA A 1 184 ? -6.663  28.487 0.147   1.00 65.86  ? 192  ALA A CA  1 
ATOM 1352 C C   . ALA A 1 184 ? -7.109  27.720 -1.084  1.00 67.77  ? 192  ALA A C   1 
ATOM 1353 O O   . ALA A 1 184 ? -7.975  28.161 -1.835  1.00 68.76  ? 192  ALA A O   1 
ATOM 1354 C CB  . ALA A 1 184 ? -5.215  28.900 0.007   1.00 63.85  ? 192  ALA A CB  1 
ATOM 1355 N N   . ALA A 1 185 ? -6.527  26.543 -1.249  1.00 71.47  ? 193  ALA A N   1 
ATOM 1356 C CA  . ALA A 1 185 ? -6.840  25.685 -2.360  1.00 73.29  ? 193  ALA A CA  1 
ATOM 1357 C C   . ALA A 1 185 ? -8.339  25.404 -2.453  1.00 75.00  ? 193  ALA A C   1 
ATOM 1358 O O   . ALA A 1 185 ? -8.895  25.456 -3.547  1.00 80.49  ? 193  ALA A O   1 
ATOM 1359 C CB  . ALA A 1 185 ? -6.055  24.396 -2.241  1.00 73.92  ? 193  ALA A CB  1 
ATOM 1360 N N   . GLN A 1 186 ? -8.998  25.112 -1.328  1.00 72.25  ? 194  GLN A N   1 
ATOM 1361 C CA  . GLN A 1 186 ? -10.457 24.885 -1.362  1.00 74.48  ? 194  GLN A CA  1 
ATOM 1362 C C   . GLN A 1 186 ? -11.128 26.145 -1.880  1.00 74.71  ? 194  GLN A C   1 
ATOM 1363 O O   . GLN A 1 186 ? -12.127 26.095 -2.595  1.00 71.63  ? 194  GLN A O   1 
ATOM 1364 C CB  . GLN A 1 186 ? -11.033 24.587 0.020   1.00 76.29  ? 194  GLN A CB  1 
ATOM 1365 C CG  . GLN A 1 186 ? -10.496 23.366 0.739   1.00 74.18  ? 194  GLN A CG  1 
ATOM 1366 C CD  . GLN A 1 186 ? -11.037 23.259 2.163   1.00 75.69  ? 194  GLN A CD  1 
ATOM 1367 O OE1 . GLN A 1 186 ? -10.971 24.223 2.925   1.00 79.10  ? 194  GLN A OE1 1 
ATOM 1368 N NE2 . GLN A 1 186 ? -11.571 22.088 2.530   1.00 72.83  ? 194  GLN A NE2 1 
ATOM 1369 N N   . GLY A 1 187 ? -10.572 27.286 -1.485  1.00 74.74  ? 195  GLY A N   1 
ATOM 1370 C CA  . GLY A 1 187 ? -11.052 28.561 -1.965  1.00 73.33  ? 195  GLY A CA  1 
ATOM 1371 C C   . GLY A 1 187 ? -11.108 28.596 -3.472  1.00 72.89  ? 195  GLY A C   1 
ATOM 1372 O O   . GLY A 1 187 ? -12.126 28.924 -4.050  1.00 76.49  ? 195  GLY A O   1 
ATOM 1373 N N   . ARG A 1 188 ? -10.008 28.232 -4.115  1.00 75.31  ? 196  ARG A N   1 
ATOM 1374 C CA  . ARG A 1 188 ? -9.886  28.428 -5.555  1.00 71.54  ? 196  ARG A CA  1 
ATOM 1375 C C   . ARG A 1 188 ? -10.854 27.499 -6.245  1.00 72.24  ? 196  ARG A C   1 
ATOM 1376 O O   . ARG A 1 188 ? -11.692 27.926 -7.052  1.00 78.23  ? 196  ARG A O   1 
ATOM 1377 C CB  . ARG A 1 188 ? -8.449  28.172 -6.020  1.00 69.12  ? 196  ARG A CB  1 
ATOM 1378 C CG  . ARG A 1 188 ? -7.414  28.999 -5.269  1.00 71.76  ? 196  ARG A CG  1 
ATOM 1379 C CD  . ARG A 1 188 ? -6.060  28.936 -5.922  1.00 74.33  ? 196  ARG A CD  1 
ATOM 1380 N NE  . ARG A 1 188 ? -5.441  27.633 -5.716  1.00 80.90  ? 196  ARG A NE  1 
ATOM 1381 C CZ  . ARG A 1 188 ? -4.660  27.315 -4.686  1.00 86.01  ? 196  ARG A CZ  1 
ATOM 1382 N NH1 . ARG A 1 188 ? -4.371  28.198 -3.725  1.00 91.65  ? 196  ARG A NH1 1 
ATOM 1383 N NH2 . ARG A 1 188 ? -4.161  26.095 -4.617  1.00 88.31  ? 196  ARG A NH2 1 
ATOM 1384 N N   . ALA A 1 189 ? -10.762 26.231 -5.870  1.00 68.34  ? 197  ALA A N   1 
ATOM 1385 C CA  . ALA A 1 189 ? -11.577 25.190 -6.447  1.00 68.65  ? 197  ALA A CA  1 
ATOM 1386 C C   . ALA A 1 189 ? -13.049 25.524 -6.324  1.00 70.31  ? 197  ALA A C   1 
ATOM 1387 O O   . ALA A 1 189 ? -13.794 25.393 -7.281  1.00 77.04  ? 197  ALA A O   1 
ATOM 1388 C CB  . ALA A 1 189 ? -11.279 23.871 -5.771  1.00 67.79  ? 197  ALA A CB  1 
ATOM 1389 N N   . PHE A 1 190 ? -13.469 25.985 -5.157  1.00 72.55  ? 198  PHE A N   1 
ATOM 1390 C CA  . PHE A 1 190 ? -14.890 26.233 -4.947  1.00 74.62  ? 198  PHE A CA  1 
ATOM 1391 C C   . PHE A 1 190 ? -15.434 27.224 -5.979  1.00 77.85  ? 198  PHE A C   1 
ATOM 1392 O O   . PHE A 1 190 ? -16.434 26.951 -6.652  1.00 76.85  ? 198  PHE A O   1 
ATOM 1393 C CB  . PHE A 1 190 ? -15.154 26.734 -3.525  1.00 71.37  ? 198  PHE A CB  1 
ATOM 1394 C CG  . PHE A 1 190 ? -15.464 25.636 -2.532  1.00 67.86  ? 198  PHE A CG  1 
ATOM 1395 C CD1 . PHE A 1 190 ? -16.491 24.715 -2.778  1.00 69.62  ? 198  PHE A CD1 1 
ATOM 1396 C CD2 . PHE A 1 190 ? -14.786 25.558 -1.327  1.00 64.42  ? 198  PHE A CD2 1 
ATOM 1397 C CE1 . PHE A 1 190 ? -16.797 23.714 -1.859  1.00 63.89  ? 198  PHE A CE1 1 
ATOM 1398 C CE2 . PHE A 1 190 ? -15.096 24.568 -0.407  1.00 64.55  ? 198  PHE A CE2 1 
ATOM 1399 C CZ  . PHE A 1 190 ? -16.096 23.643 -0.675  1.00 61.18  ? 198  PHE A CZ  1 
ATOM 1400 N N   . GLY A 1 191 ? -14.749 28.357 -6.121  1.00 80.05  ? 199  GLY A N   1 
ATOM 1401 C CA  . GLY A 1 191 ? -15.153 29.386 -7.064  1.00 80.14  ? 199  GLY A CA  1 
ATOM 1402 C C   . GLY A 1 191 ? -15.368 28.804 -8.440  1.00 82.72  ? 199  GLY A C   1 
ATOM 1403 O O   . GLY A 1 191 ? -16.497 28.781 -8.955  1.00 75.00  ? 199  GLY A O   1 
ATOM 1404 N N   . ASN A 1 192 ? -14.288 28.294 -9.024  1.00 83.85  ? 200  ASN A N   1 
ATOM 1405 C CA  . ASN A 1 192 ? -14.361 27.762 -10.373 1.00 80.86  ? 200  ASN A CA  1 
ATOM 1406 C C   . ASN A 1 192 ? -15.361 26.619 -10.439 1.00 77.85  ? 200  ASN A C   1 
ATOM 1407 O O   . ASN A 1 192 ? -16.050 26.440 -11.439 1.00 74.69  ? 200  ASN A O   1 
ATOM 1408 C CB  . ASN A 1 192 ? -12.989 27.305 -10.875 1.00 80.72  ? 200  ASN A CB  1 
ATOM 1409 C CG  . ASN A 1 192 ? -11.997 28.453 -11.032 1.00 86.09  ? 200  ASN A CG  1 
ATOM 1410 O OD1 . ASN A 1 192 ? -12.320 29.634 -10.837 1.00 80.35  ? 200  ASN A OD1 1 
ATOM 1411 N ND2 . ASN A 1 192 ? -10.768 28.100 -11.369 1.00 87.75  ? 200  ASN A ND2 1 
ATOM 1412 N N   . LEU A 1 193 ? -15.478 25.849 -9.368  1.00 76.04  ? 201  LEU A N   1 
ATOM 1413 C CA  . LEU A 1 193 ? -16.442 24.776 -9.398  1.00 69.76  ? 201  LEU A CA  1 
ATOM 1414 C C   . LEU A 1 193 ? -17.807 25.387 -9.618  1.00 72.89  ? 201  LEU A C   1 
ATOM 1415 O O   . LEU A 1 193 ? -18.599 24.851 -10.376 1.00 78.29  ? 201  LEU A O   1 
ATOM 1416 C CB  . LEU A 1 193 ? -16.416 23.942 -8.124  1.00 69.56  ? 201  LEU A CB  1 
ATOM 1417 C CG  . LEU A 1 193 ? -17.464 22.819 -8.062  1.00 74.85  ? 201  LEU A CG  1 
ATOM 1418 C CD1 . LEU A 1 193 ? -17.440 21.941 -9.289  1.00 76.46  ? 201  LEU A CD1 1 
ATOM 1419 C CD2 . LEU A 1 193 ? -17.284 21.942 -6.835  1.00 75.22  ? 201  LEU A CD2 1 
ATOM 1420 N N   . GLY A 1 194 ? -18.069 26.521 -8.973  1.00 73.39  ? 202  GLY A N   1 
ATOM 1421 C CA  . GLY A 1 194 ? -19.391 27.145 -9.022  1.00 75.35  ? 202  GLY A CA  1 
ATOM 1422 C C   . GLY A 1 194 ? -19.772 27.705 -10.384 1.00 79.17  ? 202  GLY A C   1 
ATOM 1423 O O   . GLY A 1 194 ? -20.890 27.487 -10.862 1.00 81.21  ? 202  GLY A O   1 
ATOM 1424 N N   . ASN A 1 195 ? -18.850 28.442 -11.003 1.00 79.53  ? 203  ASN A N   1 
ATOM 1425 C CA  . ASN A 1 195 ? -19.040 28.931 -12.373 1.00 78.12  ? 203  ASN A CA  1 
ATOM 1426 C C   . ASN A 1 195 ? -19.268 27.817 -13.384 1.00 81.04  ? 203  ASN A C   1 
ATOM 1427 O O   . ASN A 1 195 ? -20.050 27.977 -14.312 1.00 85.05  ? 203  ASN A O   1 
ATOM 1428 C CB  . ASN A 1 195 ? -17.828 29.708 -12.826 1.00 80.62  ? 203  ASN A CB  1 
ATOM 1429 C CG  . ASN A 1 195 ? -17.590 30.942 -12.002 1.00 85.26  ? 203  ASN A CG  1 
ATOM 1430 O OD1 . ASN A 1 195 ? -18.528 31.651 -11.663 1.00 93.42  ? 203  ASN A OD1 1 
ATOM 1431 N ND2 . ASN A 1 195 ? -16.323 31.223 -11.693 1.00 90.10  ? 203  ASN A ND2 1 
ATOM 1432 N N   . THR A 1 196 ? -18.552 26.708 -13.220 1.00 80.03  ? 204  THR A N   1 
ATOM 1433 C CA  . THR A 1 196 ? -18.738 25.526 -14.062 1.00 75.43  ? 204  THR A CA  1 
ATOM 1434 C C   . THR A 1 196 ? -20.181 25.021 -13.922 1.00 78.08  ? 204  THR A C   1 
ATOM 1435 O O   . THR A 1 196 ? -20.831 24.663 -14.907 1.00 78.56  ? 204  THR A O   1 
ATOM 1436 C CB  . THR A 1 196 ? -17.758 24.399 -13.662 1.00 72.56  ? 204  THR A CB  1 
ATOM 1437 O OG1 . THR A 1 196 ? -16.444 24.939 -13.472 1.00 63.54  ? 204  THR A OG1 1 
ATOM 1438 C CG2 . THR A 1 196 ? -17.709 23.308 -14.712 1.00 72.06  ? 204  THR A CG2 1 
ATOM 1439 N N   . HIS A 1 197 ? -20.686 25.009 -12.695 1.00 81.53  ? 205  HIS A N   1 
ATOM 1440 C CA  . HIS A 1 197 ? -22.077 24.628 -12.467 1.00 91.11  ? 205  HIS A CA  1 
ATOM 1441 C C   . HIS A 1 197 ? -23.015 25.635 -13.125 1.00 94.61  ? 205  HIS A C   1 
ATOM 1442 O O   . HIS A 1 197 ? -23.974 25.266 -13.821 1.00 99.43  ? 205  HIS A O   1 
ATOM 1443 C CB  . HIS A 1 197 ? -22.384 24.550 -10.977 1.00 88.18  ? 205  HIS A CB  1 
ATOM 1444 C CG  . HIS A 1 197 ? -21.941 23.279 -10.337 1.00 85.71  ? 205  HIS A CG  1 
ATOM 1445 N ND1 . HIS A 1 197 ? -22.405 22.044 -10.742 1.00 87.52  ? 205  HIS A ND1 1 
ATOM 1446 C CD2 . HIS A 1 197 ? -21.099 23.048 -9.304  1.00 83.14  ? 205  HIS A CD2 1 
ATOM 1447 C CE1 . HIS A 1 197 ? -21.860 21.103 -9.992  1.00 84.05  ? 205  HIS A CE1 1 
ATOM 1448 N NE2 . HIS A 1 197 ? -21.064 21.686 -9.111  1.00 91.40  ? 205  HIS A NE2 1 
ATOM 1449 N N   . TYR A 1 198 ? -22.732 26.907 -12.893 1.00 82.69  ? 206  TYR A N   1 
ATOM 1450 C CA  . TYR A 1 198 ? -23.502 27.963 -13.504 1.00 90.39  ? 206  TYR A CA  1 
ATOM 1451 C C   . TYR A 1 198 ? -23.748 27.653 -14.995 1.00 92.38  ? 206  TYR A C   1 
ATOM 1452 O O   . TYR A 1 198 ? -24.900 27.589 -15.438 1.00 92.16  ? 206  TYR A O   1 
ATOM 1453 C CB  . TYR A 1 198 ? -22.773 29.287 -13.279 1.00 94.15  ? 206  TYR A CB  1 
ATOM 1454 C CG  . TYR A 1 198 ? -23.279 30.469 -14.058 1.00 98.98  ? 206  TYR A CG  1 
ATOM 1455 C CD1 . TYR A 1 198 ? -24.620 30.813 -14.056 1.00 103.36 ? 206  TYR A CD1 1 
ATOM 1456 C CD2 . TYR A 1 198 ? -22.398 31.270 -14.760 1.00 104.42 ? 206  TYR A CD2 1 
ATOM 1457 C CE1 . TYR A 1 198 ? -25.075 31.917 -14.763 1.00 111.75 ? 206  TYR A CE1 1 
ATOM 1458 C CE2 . TYR A 1 198 ? -22.834 32.370 -15.472 1.00 114.18 ? 206  TYR A CE2 1 
ATOM 1459 C CZ  . TYR A 1 198 ? -24.171 32.694 -15.471 1.00 113.58 ? 206  TYR A CZ  1 
ATOM 1460 O OH  . TYR A 1 198 ? -24.581 33.796 -16.182 1.00 114.08 ? 206  TYR A OH  1 
ATOM 1461 N N   . LEU A 1 199 ? -22.671 27.403 -15.741 1.00 90.49  ? 207  LEU A N   1 
ATOM 1462 C CA  . LEU A 1 199 ? -22.761 27.134 -17.178 1.00 88.25  ? 207  LEU A CA  1 
ATOM 1463 C C   . LEU A 1 199 ? -23.544 25.870 -17.456 1.00 86.44  ? 207  LEU A C   1 
ATOM 1464 O O   . LEU A 1 199 ? -24.419 25.850 -18.321 1.00 99.10  ? 207  LEU A O   1 
ATOM 1465 C CB  . LEU A 1 199 ? -21.374 26.981 -17.794 1.00 91.62  ? 207  LEU A CB  1 
ATOM 1466 C CG  . LEU A 1 199 ? -20.472 28.210 -17.788 1.00 95.08  ? 207  LEU A CG  1 
ATOM 1467 C CD1 . LEU A 1 199 ? -19.070 27.850 -18.265 1.00 95.68  ? 207  LEU A CD1 1 
ATOM 1468 C CD2 . LEU A 1 199 ? -21.075 29.295 -18.660 1.00 103.57 ? 207  LEU A CD2 1 
ATOM 1469 N N   . LEU A 1 200 ? -23.230 24.814 -16.720 1.00 78.93  ? 208  LEU A N   1 
ATOM 1470 C CA  . LEU A 1 200 ? -23.956 23.561 -16.863 1.00 77.70  ? 208  LEU A CA  1 
ATOM 1471 C C   . LEU A 1 200 ? -25.456 23.680 -16.591 1.00 77.91  ? 208  LEU A C   1 
ATOM 1472 O O   . LEU A 1 200 ? -26.207 22.782 -16.934 1.00 87.42  ? 208  LEU A O   1 
ATOM 1473 C CB  . LEU A 1 200 ? -23.362 22.506 -15.936 1.00 76.29  ? 208  LEU A CB  1 
ATOM 1474 C CG  . LEU A 1 200 ? -22.179 21.744 -16.523 1.00 72.52  ? 208  LEU A CG  1 
ATOM 1475 C CD1 . LEU A 1 200 ? -21.416 21.049 -15.414 1.00 70.25  ? 208  LEU A CD1 1 
ATOM 1476 C CD2 . LEU A 1 200 ? -22.648 20.739 -17.567 1.00 74.65  ? 208  LEU A CD2 1 
ATOM 1477 N N   . GLY A 1 201 ? -25.881 24.774 -15.965 1.00 78.92  ? 209  GLY A N   1 
ATOM 1478 C CA  . GLY A 1 201 ? -27.279 24.976 -15.636 1.00 80.76  ? 209  GLY A CA  1 
ATOM 1479 C C   . GLY A 1 201 ? -27.635 24.478 -14.248 1.00 85.37  ? 209  GLY A C   1 
ATOM 1480 O O   . GLY A 1 201 ? -28.806 24.344 -13.918 1.00 85.64  ? 209  GLY A O   1 
ATOM 1481 N N   . ASN A 1 202 ? -26.628 24.200 -13.430 1.00 90.60  ? 210  ASN A N   1 
ATOM 1482 C CA  . ASN A 1 202 ? -26.860 23.675 -12.096 1.00 93.06  ? 210  ASN A CA  1 
ATOM 1483 C C   . ASN A 1 202 ? -26.710 24.838 -11.129 1.00 97.69  ? 210  ASN A C   1 
ATOM 1484 O O   . ASN A 1 202 ? -25.670 25.022 -10.511 1.00 103.94 ? 210  ASN A O   1 
ATOM 1485 C CB  . ASN A 1 202 ? -25.873 22.538 -11.784 1.00 94.19  ? 210  ASN A CB  1 
ATOM 1486 C CG  . ASN A 1 202 ? -26.013 21.338 -12.737 1.00 99.14  ? 210  ASN A CG  1 
ATOM 1487 O OD1 . ASN A 1 202 ? -27.007 21.185 -13.455 1.00 100.27 ? 210  ASN A OD1 1 
ATOM 1488 N ND2 . ASN A 1 202 ? -25.011 20.472 -12.730 1.00 101.31 ? 210  ASN A ND2 1 
ATOM 1489 N N   . PHE A 1 203 ? -27.760 25.635 -11.009 1.00 96.35  ? 211  PHE A N   1 
ATOM 1490 C CA  . PHE A 1 203 ? -27.648 26.928 -10.346 1.00 88.72  ? 211  PHE A CA  1 
ATOM 1491 C C   . PHE A 1 203 ? -27.723 26.851 -8.826  1.00 84.90  ? 211  PHE A C   1 
ATOM 1492 O O   . PHE A 1 203 ? -26.998 27.558 -8.130  1.00 79.15  ? 211  PHE A O   1 
ATOM 1493 C CB  . PHE A 1 203 ? -28.708 27.868 -10.891 1.00 92.22  ? 211  PHE A CB  1 
ATOM 1494 C CG  . PHE A 1 203 ? -28.633 28.041 -12.375 1.00 97.76  ? 211  PHE A CG  1 
ATOM 1495 C CD1 . PHE A 1 203 ? -27.554 28.701 -12.956 1.00 98.76  ? 211  PHE A CD1 1 
ATOM 1496 C CD2 . PHE A 1 203 ? -29.619 27.517 -13.196 1.00 101.00 ? 211  PHE A CD2 1 
ATOM 1497 C CE1 . PHE A 1 203 ? -27.475 28.848 -14.327 1.00 99.78  ? 211  PHE A CE1 1 
ATOM 1498 C CE2 . PHE A 1 203 ? -29.545 27.663 -14.569 1.00 102.90 ? 211  PHE A CE2 1 
ATOM 1499 C CZ  . PHE A 1 203 ? -28.471 28.328 -15.134 1.00 105.28 ? 211  PHE A CZ  1 
ATOM 1500 N N   . ARG A 1 204 ? -28.592 25.994 -8.306  1.00 85.77  ? 212  ARG A N   1 
ATOM 1501 C CA  . ARG A 1 204 ? -28.616 25.746 -6.871  1.00 86.59  ? 212  ARG A CA  1 
ATOM 1502 C C   . ARG A 1 204 ? -27.239 25.205 -6.439  1.00 91.70  ? 212  ARG A C   1 
ATOM 1503 O O   . ARG A 1 204 ? -26.661 25.671 -5.453  1.00 100.50 ? 212  ARG A O   1 
ATOM 1504 C CB  . ARG A 1 204 ? -29.743 24.780 -6.498  1.00 85.27  ? 212  ARG A CB  1 
ATOM 1505 N N   . ASP A 1 205 ? -26.700 24.251 -7.199  1.00 87.58  ? 213  ASP A N   1 
ATOM 1506 C CA  . ASP A 1 205 ? -25.324 23.779 -6.979  1.00 86.96  ? 213  ASP A CA  1 
ATOM 1507 C C   . ASP A 1 205 ? -24.271 24.888 -7.077  1.00 82.93  ? 213  ASP A C   1 
ATOM 1508 O O   . ASP A 1 205 ? -23.264 24.876 -6.377  1.00 78.38  ? 213  ASP A O   1 
ATOM 1509 C CB  . ASP A 1 205 ? -24.987 22.694 -7.986  1.00 88.97  ? 213  ASP A CB  1 
ATOM 1510 C CG  . ASP A 1 205 ? -25.567 21.369 -7.606  1.00 90.54  ? 213  ASP A CG  1 
ATOM 1511 O OD1 . ASP A 1 205 ? -25.371 20.983 -6.438  1.00 92.49  ? 213  ASP A OD1 1 
ATOM 1512 O OD2 . ASP A 1 205 ? -26.204 20.715 -8.462  1.00 90.70  ? 213  ASP A OD2 1 
ATOM 1513 N N   . ALA A 1 206 ? -24.515 25.834 -7.969  1.00 82.23  ? 214  ALA A N   1 
ATOM 1514 C CA  . ALA A 1 206 ? -23.657 26.982 -8.125  1.00 79.07  ? 214  ALA A CA  1 
ATOM 1515 C C   . ALA A 1 206 ? -23.549 27.747 -6.823  1.00 83.65  ? 214  ALA A C   1 
ATOM 1516 O O   . ALA A 1 206 ? -22.459 28.143 -6.403  1.00 82.95  ? 214  ALA A O   1 
ATOM 1517 C CB  . ALA A 1 206 ? -24.208 27.882 -9.211  1.00 76.65  ? 214  ALA A CB  1 
ATOM 1518 N N   . VAL A 1 207 ? -24.691 27.963 -6.186  1.00 94.29  ? 215  VAL A N   1 
ATOM 1519 C CA  . VAL A 1 207 ? -24.747 28.835 -5.014  1.00 98.66  ? 215  VAL A CA  1 
ATOM 1520 C C   . VAL A 1 207 ? -23.905 28.223 -3.921  1.00 83.05  ? 215  VAL A C   1 
ATOM 1521 O O   . VAL A 1 207 ? -23.061 28.871 -3.313  1.00 76.40  ? 215  VAL A O   1 
ATOM 1522 C CB  . VAL A 1 207 ? -26.189 29.007 -4.490  1.00 105.15 ? 215  VAL A CB  1 
ATOM 1523 C CG1 . VAL A 1 207 ? -26.193 29.843 -3.222  1.00 114.95 ? 215  VAL A CG1 1 
ATOM 1524 C CG2 . VAL A 1 207 ? -27.068 29.665 -5.536  1.00 108.82 ? 215  VAL A CG2 1 
ATOM 1525 N N   . ILE A 1 208 ? -24.142 26.950 -3.693  1.00 77.47  ? 216  ILE A N   1 
ATOM 1526 C CA  . ILE A 1 208 ? -23.470 26.248 -2.637  1.00 82.13  ? 216  ILE A CA  1 
ATOM 1527 C C   . ILE A 1 208 ? -21.983 26.504 -2.762  1.00 83.09  ? 216  ILE A C   1 
ATOM 1528 O O   . ILE A 1 208 ? -21.339 26.956 -1.824  1.00 79.25  ? 216  ILE A O   1 
ATOM 1529 C CB  . ILE A 1 208 ? -23.753 24.739 -2.729  1.00 85.31  ? 216  ILE A CB  1 
ATOM 1530 C CG1 . ILE A 1 208 ? -25.255 24.486 -2.563  1.00 83.59  ? 216  ILE A CG1 1 
ATOM 1531 C CG2 . ILE A 1 208 ? -22.941 23.969 -1.693  1.00 87.07  ? 216  ILE A CG2 1 
ATOM 1532 C CD1 . ILE A 1 208 ? -25.591 23.043 -2.271  1.00 87.64  ? 216  ILE A CD1 1 
ATOM 1533 N N   . ALA A 1 209 ? -21.454 26.226 -3.948  1.00 83.46  ? 217  ALA A N   1 
ATOM 1534 C CA  . ALA A 1 209 ? -20.039 26.366 -4.197  1.00 77.37  ? 217  ALA A CA  1 
ATOM 1535 C C   . ALA A 1 209 ? -19.576 27.760 -3.816  1.00 80.19  ? 217  ALA A C   1 
ATOM 1536 O O   . ALA A 1 209 ? -18.624 27.914 -3.057  1.00 89.74  ? 217  ALA A O   1 
ATOM 1537 C CB  . ALA A 1 209 ? -19.736 26.085 -5.655  1.00 78.46  ? 217  ALA A CB  1 
ATOM 1538 N N   . HIS A 1 210 ? -20.257 28.783 -4.308  1.00 78.05  ? 218  HIS A N   1 
ATOM 1539 C CA  . HIS A 1 210 ? -19.796 30.142 -4.047  1.00 81.53  ? 218  HIS A CA  1 
ATOM 1540 C C   . HIS A 1 210 ? -19.958 30.582 -2.597  1.00 74.53  ? 218  HIS A C   1 
ATOM 1541 O O   . HIS A 1 210 ? -19.163 31.374 -2.101  1.00 68.67  ? 218  HIS A O   1 
ATOM 1542 C CB  . HIS A 1 210 ? -20.464 31.130 -4.987  1.00 87.75  ? 218  HIS A CB  1 
ATOM 1543 C CG  . HIS A 1 210 ? -19.947 31.052 -6.386  1.00 91.67  ? 218  HIS A CG  1 
ATOM 1544 N ND1 . HIS A 1 210 ? -20.681 30.501 -7.416  1.00 89.81  ? 218  HIS A ND1 1 
ATOM 1545 C CD2 . HIS A 1 210 ? -18.763 31.437 -6.921  1.00 85.40  ? 218  HIS A CD2 1 
ATOM 1546 C CE1 . HIS A 1 210 ? -19.975 30.561 -8.530  1.00 93.10  ? 218  HIS A CE1 1 
ATOM 1547 N NE2 . HIS A 1 210 ? -18.807 31.119 -8.255  1.00 95.51  ? 218  HIS A NE2 1 
ATOM 1548 N N   . GLU A 1 211 ? -20.964 30.059 -1.908  1.00 73.35  ? 219  GLU A N   1 
ATOM 1549 C CA  . GLU A 1 211 ? -21.116 30.354 -0.479  1.00 75.13  ? 219  GLU A CA  1 
ATOM 1550 C C   . GLU A 1 211 ? -19.861 29.874 0.267   1.00 75.38  ? 219  GLU A C   1 
ATOM 1551 O O   . GLU A 1 211 ? -19.328 30.580 1.140   1.00 75.77  ? 219  GLU A O   1 
ATOM 1552 C CB  . GLU A 1 211 ? -22.405 29.720 0.100   1.00 78.51  ? 219  GLU A CB  1 
ATOM 1553 C CG  . GLU A 1 211 ? -23.693 30.109 -0.649  1.00 80.20  ? 219  GLU A CG  1 
ATOM 1554 C CD  . GLU A 1 211 ? -24.954 29.960 0.180   1.00 80.76  ? 219  GLU A CD  1 
ATOM 1555 O OE1 . GLU A 1 211 ? -25.219 28.841 0.676   1.00 80.47  ? 219  GLU A OE1 1 
ATOM 1556 O OE2 . GLU A 1 211 ? -25.688 30.964 0.321   1.00 78.64  ? 219  GLU A OE2 1 
ATOM 1557 N N   . GLN A 1 212 ? -19.359 28.701 -0.124  1.00 69.19  ? 220  GLN A N   1 
ATOM 1558 C CA  . GLN A 1 212 ? -18.145 28.165 0.461   1.00 65.18  ? 220  GLN A CA  1 
ATOM 1559 C C   . GLN A 1 212 ? -16.982 29.029 0.088   1.00 67.52  ? 220  GLN A C   1 
ATOM 1560 O O   . GLN A 1 212 ? -16.153 29.358 0.932   1.00 69.75  ? 220  GLN A O   1 
ATOM 1561 C CB  . GLN A 1 212 ? -17.877 26.754 -0.022  1.00 70.56  ? 220  GLN A CB  1 
ATOM 1562 C CG  . GLN A 1 212 ? -19.065 25.801 0.075   1.00 82.34  ? 220  GLN A CG  1 
ATOM 1563 C CD  . GLN A 1 212 ? -20.060 26.165 1.169   1.00 87.50  ? 220  GLN A CD  1 
ATOM 1564 O OE1 . GLN A 1 212 ? -19.686 26.523 2.292   1.00 83.34  ? 220  GLN A OE1 1 
ATOM 1565 N NE2 . GLN A 1 212 ? -21.345 26.065 0.844   1.00 93.31  ? 220  GLN A NE2 1 
ATOM 1566 N N   . ARG A 1 213 ? -16.921 29.412 -1.180  1.00 67.61  ? 221  ARG A N   1 
ATOM 1567 C CA  . ARG A 1 213 ? -15.890 30.338 -1.619  1.00 74.26  ? 221  ARG A CA  1 
ATOM 1568 C C   . ARG A 1 213 ? -15.907 31.631 -0.790  1.00 74.90  ? 221  ARG A C   1 
ATOM 1569 O O   . ARG A 1 213 ? -14.877 32.071 -0.286  1.00 80.42  ? 221  ARG A O   1 
ATOM 1570 C CB  . ARG A 1 213 ? -16.056 30.655 -3.101  1.00 77.31  ? 221  ARG A CB  1 
ATOM 1571 C CG  . ARG A 1 213 ? -14.751 30.999 -3.791  1.00 79.30  ? 221  ARG A CG  1 
ATOM 1572 C CD  . ARG A 1 213 ? -14.374 32.468 -3.665  1.00 78.60  ? 221  ARG A CD  1 
ATOM 1573 N NE  . ARG A 1 213 ? -12.945 32.646 -3.906  1.00 83.72  ? 221  ARG A NE  1 
ATOM 1574 C CZ  . ARG A 1 213 ? -11.991 32.303 -3.046  1.00 80.42  ? 221  ARG A CZ  1 
ATOM 1575 N NH1 . ARG A 1 213 ? -12.300 31.779 -1.881  1.00 77.13  ? 221  ARG A NH1 1 
ATOM 1576 N NH2 . ARG A 1 213 ? -10.718 32.488 -3.348  1.00 89.01  ? 221  ARG A NH2 1 
ATOM 1577 N N   . LEU A 1 214 ? -17.083 32.223 -0.646  1.00 72.05  ? 222  LEU A N   1 
ATOM 1578 C CA  . LEU A 1 214 ? -17.230 33.448 0.109   1.00 70.75  ? 222  LEU A CA  1 
ATOM 1579 C C   . LEU A 1 214 ? -16.738 33.254 1.540   1.00 68.55  ? 222  LEU A C   1 
ATOM 1580 O O   . LEU A 1 214 ? -15.901 34.012 2.036   1.00 66.72  ? 222  LEU A O   1 
ATOM 1581 C CB  . LEU A 1 214 ? -18.697 33.860 0.109   1.00 78.18  ? 222  LEU A CB  1 
ATOM 1582 C CG  . LEU A 1 214 ? -19.164 34.902 1.122   1.00 79.10  ? 222  LEU A CG  1 
ATOM 1583 C CD1 . LEU A 1 214 ? -18.374 36.196 0.977   1.00 79.46  ? 222  LEU A CD1 1 
ATOM 1584 C CD2 . LEU A 1 214 ? -20.657 35.124 0.923   1.00 78.97  ? 222  LEU A CD2 1 
ATOM 1585 N N   . LEU A 1 215 ? -17.271 32.239 2.207   1.00 66.22  ? 223  LEU A N   1 
ATOM 1586 C CA  . LEU A 1 215 ? -16.865 31.945 3.581   1.00 66.31  ? 223  LEU A CA  1 
ATOM 1587 C C   . LEU A 1 215 ? -15.337 31.900 3.709   1.00 70.46  ? 223  LEU A C   1 
ATOM 1588 O O   . LEU A 1 215 ? -14.739 32.577 4.555   1.00 67.52  ? 223  LEU A O   1 
ATOM 1589 C CB  . LEU A 1 215 ? -17.489 30.629 4.037   1.00 60.91  ? 223  LEU A CB  1 
ATOM 1590 C CG  . LEU A 1 215 ? -16.847 29.920 5.224   1.00 63.48  ? 223  LEU A CG  1 
ATOM 1591 C CD1 . LEU A 1 215 ? -16.431 30.871 6.326   1.00 73.20  ? 223  LEU A CD1 1 
ATOM 1592 C CD2 . LEU A 1 215 ? -17.839 28.920 5.786   1.00 65.23  ? 223  LEU A CD2 1 
ATOM 1593 N N   . ILE A 1 216 ? -14.709 31.112 2.849   1.00 76.59  ? 224  ILE A N   1 
ATOM 1594 C CA  . ILE A 1 216 ? -13.260 30.976 2.878   1.00 81.00  ? 224  ILE A CA  1 
ATOM 1595 C C   . ILE A 1 216 ? -12.613 32.343 2.609   1.00 79.94  ? 224  ILE A C   1 
ATOM 1596 O O   . ILE A 1 216 ? -11.625 32.707 3.257   1.00 79.12  ? 224  ILE A O   1 
ATOM 1597 C CB  . ILE A 1 216 ? -12.759 29.843 1.920   1.00 78.90  ? 224  ILE A CB  1 
ATOM 1598 C CG1 . ILE A 1 216 ? -13.268 28.476 2.417   1.00 76.11  ? 224  ILE A CG1 1 
ATOM 1599 C CG2 . ILE A 1 216 ? -11.233 29.794 1.863   1.00 75.30  ? 224  ILE A CG2 1 
ATOM 1600 C CD1 . ILE A 1 216 ? -13.155 27.355 1.415   1.00 74.51  ? 224  ILE A CD1 1 
ATOM 1601 N N   . ALA A 1 217 ? -13.199 33.111 1.691   1.00 80.55  ? 225  ALA A N   1 
ATOM 1602 C CA  . ALA A 1 217 ? -12.705 34.458 1.381   1.00 75.87  ? 225  ALA A CA  1 
ATOM 1603 C C   . ALA A 1 217 ? -12.733 35.350 2.620   1.00 79.11  ? 225  ALA A C   1 
ATOM 1604 O O   . ALA A 1 217 ? -11.722 35.977 2.958   1.00 73.60  ? 225  ALA A O   1 
ATOM 1605 C CB  . ALA A 1 217 ? -13.526 35.071 0.267   1.00 71.49  ? 225  ALA A CB  1 
ATOM 1606 N N   . LYS A 1 218 ? -13.887 35.381 3.297   1.00 81.16  ? 226  LYS A N   1 
ATOM 1607 C CA  . LYS A 1 218 ? -14.055 36.151 4.542   1.00 80.96  ? 226  LYS A CA  1 
ATOM 1608 C C   . LYS A 1 218 ? -13.052 35.696 5.596   1.00 77.68  ? 226  LYS A C   1 
ATOM 1609 O O   . LYS A 1 218 ? -12.463 36.515 6.292   1.00 87.36  ? 226  LYS A O   1 
ATOM 1610 C CB  . LYS A 1 218 ? -15.482 36.020 5.103   1.00 76.89  ? 226  LYS A CB  1 
ATOM 1611 C CG  . LYS A 1 218 ? -16.582 36.485 4.163   1.00 72.50  ? 226  LYS A CG  1 
ATOM 1612 N N   . GLU A 1 219 ? -12.853 34.387 5.698   1.00 76.67  ? 227  GLU A N   1 
ATOM 1613 C CA  . GLU A 1 219 ? -11.935 33.816 6.690   1.00 74.02  ? 227  GLU A CA  1 
ATOM 1614 C C   . GLU A 1 219 ? -10.500 34.267 6.482   1.00 73.96  ? 227  GLU A C   1 
ATOM 1615 O O   . GLU A 1 219 ? -9.751  34.418 7.438   1.00 75.29  ? 227  GLU A O   1 
ATOM 1616 C CB  . GLU A 1 219 ? -12.005 32.286 6.661   1.00 75.35  ? 227  GLU A CB  1 
ATOM 1617 C CG  . GLU A 1 219 ? -10.910 31.585 7.448   1.00 75.83  ? 227  GLU A CG  1 
ATOM 1618 C CD  . GLU A 1 219 ? -10.802 30.116 7.108   1.00 79.94  ? 227  GLU A CD  1 
ATOM 1619 O OE1 . GLU A 1 219 ? -9.658  29.668 6.816   1.00 72.72  ? 227  GLU A OE1 1 
ATOM 1620 O OE2 . GLU A 1 219 ? -11.858 29.432 7.119   1.00 72.38  ? 227  GLU A OE2 1 
ATOM 1621 N N   . PHE A 1 220 ? -10.118 34.481 5.231   1.00 80.68  ? 228  PHE A N   1 
ATOM 1622 C CA  . PHE A 1 220 ? -8.758  34.892 4.913   1.00 83.25  ? 228  PHE A CA  1 
ATOM 1623 C C   . PHE A 1 220 ? -8.542  36.389 4.996   1.00 88.01  ? 228  PHE A C   1 
ATOM 1624 O O   . PHE A 1 220 ? -7.393  36.833 4.971   1.00 83.90  ? 228  PHE A O   1 
ATOM 1625 C CB  . PHE A 1 220 ? -8.381  34.432 3.502   1.00 87.15  ? 228  PHE A CB  1 
ATOM 1626 C CG  . PHE A 1 220 ? -7.646  33.126 3.474   1.00 89.05  ? 228  PHE A CG  1 
ATOM 1627 C CD1 . PHE A 1 220 ? -6.282  33.076 3.753   1.00 87.06  ? 228  PHE A CD1 1 
ATOM 1628 C CD2 . PHE A 1 220 ? -8.308  31.953 3.177   1.00 83.46  ? 228  PHE A CD2 1 
ATOM 1629 C CE1 . PHE A 1 220 ? -5.601  31.877 3.741   1.00 79.64  ? 228  PHE A CE1 1 
ATOM 1630 C CE2 . PHE A 1 220 ? -7.628  30.759 3.165   1.00 80.26  ? 228  PHE A CE2 1 
ATOM 1631 C CZ  . PHE A 1 220 ? -6.276  30.721 3.450   1.00 76.51  ? 228  PHE A CZ  1 
ATOM 1632 N N   . GLY A 1 221 ? -9.633  37.159 5.069   1.00 91.66  ? 229  GLY A N   1 
ATOM 1633 C CA  . GLY A 1 221 ? -9.572  38.611 4.886   1.00 94.79  ? 229  GLY A CA  1 
ATOM 1634 C C   . GLY A 1 221 ? -9.146  38.928 3.465   1.00 100.97 ? 229  GLY A C   1 
ATOM 1635 O O   . GLY A 1 221 ? -8.104  39.553 3.235   1.00 106.30 ? 229  GLY A O   1 
ATOM 1636 N N   . ASP A 1 222 ? -9.944  38.455 2.511   1.00 106.38 ? 230  ASP A N   1 
ATOM 1637 C CA  . ASP A 1 222 ? -9.644  38.582 1.082   1.00 103.19 ? 230  ASP A CA  1 
ATOM 1638 C C   . ASP A 1 222 ? -10.820 39.259 0.417   1.00 105.71 ? 230  ASP A C   1 
ATOM 1639 O O   . ASP A 1 222 ? -11.893 38.671 0.238   1.00 94.95  ? 230  ASP A O   1 
ATOM 1640 C CB  . ASP A 1 222 ? -9.402  37.209 0.446   1.00 98.58  ? 230  ASP A CB  1 
ATOM 1641 C CG  . ASP A 1 222 ? -9.183  37.277 -1.069  1.00 96.03  ? 230  ASP A CG  1 
ATOM 1642 O OD1 . ASP A 1 222 ? -9.688  38.218 -1.726  1.00 97.55  ? 230  ASP A OD1 1 
ATOM 1643 O OD2 . ASP A 1 222 ? -8.525  36.361 -1.609  1.00 88.71  ? 230  ASP A OD2 1 
ATOM 1644 N N   . LYS A 1 223 ? -10.612 40.507 0.039   1.00 101.85 ? 231  LYS A N   1 
ATOM 1645 C CA  . LYS A 1 223 ? -11.721 41.318 -0.387  1.00 97.77  ? 231  LYS A CA  1 
ATOM 1646 C C   . LYS A 1 223 ? -12.030 41.021 -1.847  1.00 91.14  ? 231  LYS A C   1 
ATOM 1647 O O   . LYS A 1 223 ? -13.190 40.912 -2.230  1.00 81.65  ? 231  LYS A O   1 
ATOM 1648 C CB  . LYS A 1 223 ? -11.419 42.792 -0.104  1.00 93.75  ? 231  LYS A CB  1 
ATOM 1649 C CG  . LYS A 1 223 ? -11.103 43.073 1.373   1.00 95.95  ? 231  LYS A CG  1 
ATOM 1650 C CD  . LYS A 1 223 ? -12.269 42.751 2.322   1.00 98.69  ? 231  LYS A CD  1 
ATOM 1651 C CE  . LYS A 1 223 ? -11.920 43.012 3.786   1.00 97.19  ? 231  LYS A CE  1 
ATOM 1652 N N   . ALA A 1 224 ? -10.990 40.828 -2.647  1.00 91.54  ? 232  ALA A N   1 
ATOM 1653 C CA  . ALA A 1 224 ? -11.178 40.546 -4.060  1.00 95.89  ? 232  ALA A CA  1 
ATOM 1654 C C   . ALA A 1 224 ? -12.014 39.279 -4.237  1.00 98.72  ? 232  ALA A C   1 
ATOM 1655 O O   . ALA A 1 224 ? -12.945 39.252 -5.046  1.00 97.62  ? 232  ALA A O   1 
ATOM 1656 C CB  . ALA A 1 224 ? -9.831  40.409 -4.753  1.00 98.37  ? 232  ALA A CB  1 
ATOM 1657 N N   . ALA A 1 225 ? -11.702 38.247 -3.448  1.00 94.57  ? 233  ALA A N   1 
ATOM 1658 C CA  . ALA A 1 225 ? -12.425 36.970 -3.516  1.00 89.56  ? 233  ALA A CA  1 
ATOM 1659 C C   . ALA A 1 225 ? -13.835 37.101 -2.967  1.00 86.36  ? 233  ALA A C   1 
ATOM 1660 O O   . ALA A 1 225 ? -14.759 36.437 -3.442  1.00 81.45  ? 233  ALA A O   1 
ATOM 1661 C CB  . ALA A 1 225 ? -11.675 35.890 -2.766  1.00 91.90  ? 233  ALA A CB  1 
ATOM 1662 N N   . GLU A 1 226 ? -13.986 37.957 -1.962  1.00 90.74  ? 234  GLU A N   1 
ATOM 1663 C CA  . GLU A 1 226 ? -15.307 38.384 -1.493  1.00 97.68  ? 234  GLU A CA  1 
ATOM 1664 C C   . GLU A 1 226 ? -16.039 39.097 -2.628  1.00 98.55  ? 234  GLU A C   1 
ATOM 1665 O O   . GLU A 1 226 ? -17.226 38.829 -2.911  1.00 80.68  ? 234  GLU A O   1 
ATOM 1666 C CB  . GLU A 1 226 ? -15.149 39.348 -0.317  1.00 103.87 ? 234  GLU A CB  1 
ATOM 1667 C CG  . GLU A 1 226 ? -15.909 38.954 0.937   1.00 106.67 ? 234  GLU A CG  1 
ATOM 1668 C CD  . GLU A 1 226 ? -15.295 39.563 2.183   1.00 115.83 ? 234  GLU A CD  1 
ATOM 1669 O OE1 . GLU A 1 226 ? -14.039 39.580 2.304   1.00 109.22 ? 234  GLU A OE1 1 
ATOM 1670 O OE2 . GLU A 1 226 ? -16.075 40.026 3.042   1.00 131.59 ? 234  GLU A OE2 1 
ATOM 1671 N N   . ARG A 1 227 ? -15.297 39.999 -3.275  1.00 98.62  ? 235  ARG A N   1 
ATOM 1672 C CA  . ARG A 1 227 ? -15.811 40.817 -4.355  1.00 104.38 ? 235  ARG A CA  1 
ATOM 1673 C C   . ARG A 1 227 ? -16.449 39.886 -5.374  1.00 94.57  ? 235  ARG A C   1 
ATOM 1674 O O   . ARG A 1 227 ? -17.615 40.057 -5.742  1.00 80.69  ? 235  ARG A O   1 
ATOM 1675 C CB  . ARG A 1 227 ? -14.666 41.642 -4.974  1.00 123.34 ? 235  ARG A CB  1 
ATOM 1676 C CG  . ARG A 1 227 ? -15.078 42.912 -5.707  1.00 132.01 ? 235  ARG A CG  1 
ATOM 1677 C CD  . ARG A 1 227 ? -13.958 43.367 -6.648  1.00 138.32 ? 235  ARG A CD  1 
ATOM 1678 N NE  . ARG A 1 227 ? -14.437 43.841 -7.950  1.00 146.95 ? 235  ARG A NE  1 
ATOM 1679 C CZ  . ARG A 1 227 ? -15.165 43.126 -8.811  1.00 150.69 ? 235  ARG A CZ  1 
ATOM 1680 N NH1 . ARG A 1 227 ? -15.562 41.885 -8.530  1.00 152.74 ? 235  ARG A NH1 1 
ATOM 1681 N NH2 . ARG A 1 227 ? -15.524 43.667 -9.966  1.00 157.24 ? 235  ARG A NH2 1 
ATOM 1682 N N   . ARG A 1 228 ? -15.699 38.855 -5.764  1.00 95.29  ? 236  ARG A N   1 
ATOM 1683 C CA  . ARG A 1 228 ? -16.166 37.891 -6.780  1.00 98.19  ? 236  ARG A CA  1 
ATOM 1684 C C   . ARG A 1 228 ? -17.359 37.083 -6.322  1.00 89.93  ? 236  ARG A C   1 
ATOM 1685 O O   . ARG A 1 228 ? -18.354 36.967 -7.025  1.00 88.31  ? 236  ARG A O   1 
ATOM 1686 C CB  . ARG A 1 228 ? -15.066 36.898 -7.158  1.00 92.80  ? 236  ARG A CB  1 
ATOM 1687 C CG  . ARG A 1 228 ? -13.714 37.536 -7.395  1.00 96.44  ? 236  ARG A CG  1 
ATOM 1688 C CD  . ARG A 1 228 ? -12.828 36.659 -8.253  1.00 96.49  ? 236  ARG A CD  1 
ATOM 1689 N NE  . ARG A 1 228 ? -12.076 35.721 -7.425  1.00 97.59  ? 236  ARG A NE  1 
ATOM 1690 C CZ  . ARG A 1 228 ? -10.897 35.981 -6.853  1.00 92.91  ? 236  ARG A CZ  1 
ATOM 1691 N NH1 . ARG A 1 228 ? -10.303 37.161 -7.010  1.00 95.34  ? 236  ARG A NH1 1 
ATOM 1692 N NH2 . ARG A 1 228 ? -10.305 35.052 -6.112  1.00 89.33  ? 236  ARG A NH2 1 
ATOM 1693 N N   . ALA A 1 229 ? -17.236 36.497 -5.143  1.00 86.02  ? 237  ALA A N   1 
ATOM 1694 C CA  . ALA A 1 229 ? -18.228 35.553 -4.689  1.00 88.90  ? 237  ALA A CA  1 
ATOM 1695 C C   . ALA A 1 229 ? -19.612 36.177 -4.801  1.00 86.78  ? 237  ALA A C   1 
ATOM 1696 O O   . ALA A 1 229 ? -20.524 35.581 -5.374  1.00 82.13  ? 237  ALA A O   1 
ATOM 1697 C CB  . ALA A 1 229 ? -17.932 35.115 -3.264  1.00 91.63  ? 237  ALA A CB  1 
ATOM 1698 N N   . TYR A 1 230 ? -19.745 37.398 -4.289  1.00 90.48  ? 238  TYR A N   1 
ATOM 1699 C CA  . TYR A 1 230 ? -21.014 38.116 -4.344  1.00 89.41  ? 238  TYR A CA  1 
ATOM 1700 C C   . TYR A 1 230 ? -21.442 38.260 -5.799  1.00 86.68  ? 238  TYR A C   1 
ATOM 1701 O O   . TYR A 1 230 ? -22.605 37.983 -6.180  1.00 75.17  ? 238  TYR A O   1 
ATOM 1702 C CB  . TYR A 1 230 ? -20.877 39.497 -3.684  1.00 88.77  ? 238  TYR A CB  1 
ATOM 1703 C CG  . TYR A 1 230 ? -20.658 39.448 -2.183  1.00 86.45  ? 238  TYR A CG  1 
ATOM 1704 C CD1 . TYR A 1 230 ? -21.450 38.635 -1.365  1.00 87.06  ? 238  TYR A CD1 1 
ATOM 1705 C CD2 . TYR A 1 230 ? -19.675 40.222 -1.579  1.00 82.11  ? 238  TYR A CD2 1 
ATOM 1706 C CE1 . TYR A 1 230 ? -21.258 38.589 0.009   1.00 84.54  ? 238  TYR A CE1 1 
ATOM 1707 C CE2 . TYR A 1 230 ? -19.472 40.187 -0.206  1.00 83.29  ? 238  TYR A CE2 1 
ATOM 1708 C CZ  . TYR A 1 230 ? -20.265 39.376 0.587   1.00 86.71  ? 238  TYR A CZ  1 
ATOM 1709 O OH  . TYR A 1 230 ? -20.057 39.356 1.956   1.00 83.21  ? 238  TYR A OH  1 
ATOM 1710 N N   . SER A 1 231 ? -20.481 38.668 -6.619  1.00 80.79  ? 239  SER A N   1 
ATOM 1711 C CA  . SER A 1 231 ? -20.741 38.778 -8.020  1.00 78.35  ? 239  SER A CA  1 
ATOM 1712 C C   . SER A 1 231 ? -21.312 37.465 -8.538  1.00 84.67  ? 239  SER A C   1 
ATOM 1713 O O   . SER A 1 231 ? -22.460 37.456 -9.025  1.00 76.67  ? 239  SER A O   1 
ATOM 1714 C CB  . SER A 1 231 ? -19.489 39.176 -8.785  1.00 79.92  ? 239  SER A CB  1 
ATOM 1715 O OG  . SER A 1 231 ? -19.764 39.182 -10.175 1.00 83.89  ? 239  SER A OG  1 
ATOM 1716 N N   . ASN A 1 232 ? -20.556 36.360 -8.401  1.00 87.17  ? 240  ASN A N   1 
ATOM 1717 C CA  . ASN A 1 232 ? -20.983 35.112 -9.043  1.00 87.64  ? 240  ASN A CA  1 
ATOM 1718 C C   . ASN A 1 232 ? -22.315 34.662 -8.445  1.00 88.40  ? 240  ASN A C   1 
ATOM 1719 O O   . ASN A 1 232 ? -23.186 34.188 -9.165  1.00 96.15  ? 240  ASN A O   1 
ATOM 1720 C CB  . ASN A 1 232 ? -19.909 34.009 -9.027  1.00 84.49  ? 240  ASN A CB  1 
ATOM 1721 C CG  . ASN A 1 232 ? -18.662 34.394 -9.829  1.00 88.51  ? 240  ASN A CG  1 
ATOM 1722 O OD1 . ASN A 1 232 ? -18.698 34.515 -11.055 1.00 89.33  ? 240  ASN A OD1 1 
ATOM 1723 N ND2 . ASN A 1 232 ? -17.551 34.571 -9.135  1.00 92.13  ? 240  ASN A ND2 1 
ATOM 1724 N N   . LEU A 1 233 ? -22.510 34.885 -7.152  1.00 86.49  ? 241  LEU A N   1 
ATOM 1725 C CA  . LEU A 1 233 ? -23.792 34.563 -6.521  1.00 94.53  ? 241  LEU A CA  1 
ATOM 1726 C C   . LEU A 1 233 ? -24.964 35.354 -7.097  1.00 101.78 ? 241  LEU A C   1 
ATOM 1727 O O   . LEU A 1 233 ? -26.064 34.812 -7.281  1.00 96.72  ? 241  LEU A O   1 
ATOM 1728 C CB  . LEU A 1 233 ? -23.714 34.810 -5.026  1.00 96.49  ? 241  LEU A CB  1 
ATOM 1729 C CG  . LEU A 1 233 ? -22.862 33.773 -4.306  1.00 96.81  ? 241  LEU A CG  1 
ATOM 1730 C CD1 . LEU A 1 233 ? -22.160 34.380 -3.099  1.00 93.05  ? 241  LEU A CD1 1 
ATOM 1731 C CD2 . LEU A 1 233 ? -23.726 32.570 -3.922  1.00 101.74 ? 241  LEU A CD2 1 
ATOM 1732 N N   . GLY A 1 234 ? -24.733 36.639 -7.361  1.00 101.68 ? 242  GLY A N   1 
ATOM 1733 C CA  . GLY A 1 234 ? -25.743 37.458 -8.012  1.00 98.61  ? 242  GLY A CA  1 
ATOM 1734 C C   . GLY A 1 234 ? -26.271 36.758 -9.249  1.00 93.08  ? 242  GLY A C   1 
ATOM 1735 O O   . GLY A 1 234 ? -27.466 36.528 -9.385  1.00 91.41  ? 242  GLY A O   1 
ATOM 1736 N N   . ASN A 1 235 ? -25.353 36.358 -10.119 1.00 92.82  ? 243  ASN A N   1 
ATOM 1737 C CA  . ASN A 1 235 ? -25.716 35.793 -11.414 1.00 91.07  ? 243  ASN A CA  1 
ATOM 1738 C C   . ASN A 1 235 ? -26.637 34.573 -11.345 1.00 90.56  ? 243  ASN A C   1 
ATOM 1739 O O   . ASN A 1 235 ? -27.557 34.440 -12.149 1.00 90.25  ? 243  ASN A O   1 
ATOM 1740 C CB  . ASN A 1 235 ? -24.456 35.445 -12.209 1.00 95.02  ? 243  ASN A CB  1 
ATOM 1741 C CG  . ASN A 1 235 ? -23.500 36.619 -12.332 1.00 99.78  ? 243  ASN A CG  1 
ATOM 1742 O OD1 . ASN A 1 235 ? -23.716 37.686 -11.739 1.00 104.31 ? 243  ASN A OD1 1 
ATOM 1743 N ND2 . ASN A 1 235 ? -22.427 36.423 -13.090 1.00 98.89  ? 243  ASN A ND2 1 
ATOM 1744 N N   . ALA A 1 236 ? -26.398 33.684 -10.390 1.00 94.08  ? 244  ALA A N   1 
ATOM 1745 C CA  . ALA A 1 236 ? -27.141 32.424 -10.333 1.00 99.18  ? 244  ALA A CA  1 
ATOM 1746 C C   . ALA A 1 236 ? -28.590 32.656 -9.935  1.00 110.35 ? 244  ALA A C   1 
ATOM 1747 O O   . ALA A 1 236 ? -29.513 32.061 -10.511 1.00 113.91 ? 244  ALA A O   1 
ATOM 1748 C CB  . ALA A 1 236 ? -26.482 31.460 -9.362  1.00 102.24 ? 244  ALA A CB  1 
ATOM 1749 N N   . TYR A 1 237 ? -28.780 33.522 -8.940  1.00 115.28 ? 245  TYR A N   1 
ATOM 1750 C CA  . TYR A 1 237 ? -30.113 33.827 -8.439  1.00 110.80 ? 245  TYR A CA  1 
ATOM 1751 C C   . TYR A 1 237 ? -30.937 34.398 -9.581  1.00 106.62 ? 245  TYR A C   1 
ATOM 1752 O O   . TYR A 1 237 ? -32.065 33.957 -9.821  1.00 103.89 ? 245  TYR A O   1 
ATOM 1753 C CB  . TYR A 1 237 ? -30.052 34.780 -7.229  1.00 110.12 ? 245  TYR A CB  1 
ATOM 1754 C CG  . TYR A 1 237 ? -29.767 34.062 -5.916  1.00 104.71 ? 245  TYR A CG  1 
ATOM 1755 C CD1 . TYR A 1 237 ? -30.627 33.060 -5.452  1.00 102.58 ? 245  TYR A CD1 1 
ATOM 1756 C CD2 . TYR A 1 237 ? -28.646 34.376 -5.144  1.00 104.45 ? 245  TYR A CD2 1 
ATOM 1757 C CE1 . TYR A 1 237 ? -30.379 32.388 -4.267  1.00 102.75 ? 245  TYR A CE1 1 
ATOM 1758 C CE2 . TYR A 1 237 ? -28.389 33.711 -3.951  1.00 105.67 ? 245  TYR A CE2 1 
ATOM 1759 C CZ  . TYR A 1 237 ? -29.260 32.717 -3.516  1.00 107.43 ? 245  TYR A CZ  1 
ATOM 1760 O OH  . TYR A 1 237 ? -29.025 32.038 -2.336  1.00 104.19 ? 245  TYR A OH  1 
ATOM 1761 N N   . ILE A 1 238 ? -30.340 35.334 -10.315 1.00 93.96  ? 246  ILE A N   1 
ATOM 1762 C CA  . ILE A 1 238 ? -30.927 35.823 -11.547 1.00 94.35  ? 246  ILE A CA  1 
ATOM 1763 C C   . ILE A 1 238 ? -31.497 34.680 -12.384 1.00 105.63 ? 246  ILE A C   1 
ATOM 1764 O O   . ILE A 1 238 ? -32.632 34.759 -12.847 1.00 115.93 ? 246  ILE A O   1 
ATOM 1765 C CB  . ILE A 1 238 ? -29.900 36.590 -12.379 1.00 91.11  ? 246  ILE A CB  1 
ATOM 1766 C CG1 . ILE A 1 238 ? -29.641 37.963 -11.737 1.00 97.46  ? 246  ILE A CG1 1 
ATOM 1767 C CG2 . ILE A 1 238 ? -30.386 36.736 -13.811 1.00 87.55  ? 246  ILE A CG2 1 
ATOM 1768 C CD1 . ILE A 1 238 ? -28.430 38.712 -12.267 1.00 94.84  ? 246  ILE A CD1 1 
ATOM 1769 N N   . PHE A 1 239 ? -30.725 33.615 -12.566 1.00 106.26 ? 247  PHE A N   1 
ATOM 1770 C CA  . PHE A 1 239 ? -31.189 32.480 -13.363 1.00 104.63 ? 247  PHE A CA  1 
ATOM 1771 C C   . PHE A 1 239 ? -32.260 31.643 -12.678 1.00 100.08 ? 247  PHE A C   1 
ATOM 1772 O O   . PHE A 1 239 ? -33.016 30.943 -13.349 1.00 99.62  ? 247  PHE A O   1 
ATOM 1773 C CB  . PHE A 1 239 ? -30.019 31.605 -13.805 1.00 112.31 ? 247  PHE A CB  1 
ATOM 1774 C CG  . PHE A 1 239 ? -29.365 32.086 -15.070 1.00 124.76 ? 247  PHE A CG  1 
ATOM 1775 C CD1 . PHE A 1 239 ? -28.688 33.297 -15.097 1.00 123.32 ? 247  PHE A CD1 1 
ATOM 1776 C CD2 . PHE A 1 239 ? -29.448 31.338 -16.247 1.00 132.93 ? 247  PHE A CD2 1 
ATOM 1777 C CE1 . PHE A 1 239 ? -28.094 33.748 -16.267 1.00 128.05 ? 247  PHE A CE1 1 
ATOM 1778 C CE2 . PHE A 1 239 ? -28.854 31.784 -17.421 1.00 127.39 ? 247  PHE A CE2 1 
ATOM 1779 C CZ  . PHE A 1 239 ? -28.176 32.989 -17.430 1.00 126.20 ? 247  PHE A CZ  1 
ATOM 1780 N N   . LEU A 1 240 ? -32.338 31.702 -11.356 1.00 99.47  ? 248  LEU A N   1 
ATOM 1781 C CA  . LEU A 1 240 ? -33.453 31.064 -10.650 1.00 105.76 ? 248  LEU A CA  1 
ATOM 1782 C C   . LEU A 1 240 ? -34.669 31.992 -10.609 1.00 110.08 ? 248  LEU A C   1 
ATOM 1783 O O   . LEU A 1 240 ? -35.770 31.572 -10.243 1.00 110.68 ? 248  LEU A O   1 
ATOM 1784 C CB  . LEU A 1 240 ? -33.042 30.667 -9.231  1.00 111.06 ? 248  LEU A CB  1 
ATOM 1785 C CG  . LEU A 1 240 ? -32.014 29.529 -9.102  1.00 105.68 ? 248  LEU A CG  1 
ATOM 1786 C CD1 . LEU A 1 240 ? -31.211 29.683 -7.818  1.00 102.52 ? 248  LEU A CD1 1 
ATOM 1787 C CD2 . LEU A 1 240 ? -32.675 28.153 -9.170  1.00 101.88 ? 248  LEU A CD2 1 
ATOM 1788 N N   . GLY A 1 241 ? -34.456 33.253 -10.981 1.00 111.83 ? 249  GLY A N   1 
ATOM 1789 C CA  . GLY A 1 241 ? -35.512 34.250 -10.996 1.00 113.72 ? 249  GLY A CA  1 
ATOM 1790 C C   . GLY A 1 241 ? -35.483 35.172 -9.789  1.00 120.14 ? 249  GLY A C   1 
ATOM 1791 O O   . GLY A 1 241 ? -36.164 36.196 -9.784  1.00 135.84 ? 249  GLY A O   1 
ATOM 1792 N N   . GLU A 1 242 ? -34.699 34.824 -8.768  1.00 111.11 ? 250  GLU A N   1 
ATOM 1793 C CA  . GLU A 1 242 ? -34.655 35.614 -7.535  1.00 107.49 ? 250  GLU A CA  1 
ATOM 1794 C C   . GLU A 1 242 ? -33.949 36.960 -7.765  1.00 102.94 ? 250  GLU A C   1 
ATOM 1795 O O   . GLU A 1 242 ? -32.808 37.155 -7.354  1.00 97.53  ? 250  GLU A O   1 
ATOM 1796 C CB  . GLU A 1 242 ? -33.981 34.818 -6.403  1.00 108.65 ? 250  GLU A CB  1 
ATOM 1797 C CG  . GLU A 1 242 ? -34.918 33.977 -5.539  1.00 111.45 ? 250  GLU A CG  1 
ATOM 1798 C CD  . GLU A 1 242 ? -35.102 32.557 -6.045  1.00 112.59 ? 250  GLU A CD  1 
ATOM 1799 O OE1 . GLU A 1 242 ? -35.256 32.365 -7.272  1.00 110.81 ? 250  GLU A OE1 1 
ATOM 1800 O OE2 . GLU A 1 242 ? -35.104 31.632 -5.203  1.00 110.15 ? 250  GLU A OE2 1 
ATOM 1801 N N   . PHE A 1 243 ? -34.648 37.890 -8.413  1.00 102.66 ? 251  PHE A N   1 
ATOM 1802 C CA  . PHE A 1 243 ? -34.042 39.159 -8.827  1.00 102.99 ? 251  PHE A CA  1 
ATOM 1803 C C   . PHE A 1 243 ? -33.827 40.104 -7.648  1.00 100.07 ? 251  PHE A C   1 
ATOM 1804 O O   . PHE A 1 243 ? -32.798 40.773 -7.581  1.00 100.78 ? 251  PHE A O   1 
ATOM 1805 C CB  . PHE A 1 243 ? -34.874 39.834 -9.926  1.00 104.28 ? 251  PHE A CB  1 
ATOM 1806 C CG  . PHE A 1 243 ? -35.036 38.991 -11.170 1.00 108.73 ? 251  PHE A CG  1 
ATOM 1807 C CD1 . PHE A 1 243 ? -34.096 39.044 -12.199 1.00 105.98 ? 251  PHE A CD1 1 
ATOM 1808 C CD2 . PHE A 1 243 ? -36.123 38.139 -11.309 1.00 95.99  ? 251  PHE A CD2 1 
ATOM 1809 N N   . GLU A 1 244 ? -34.785 40.153 -6.720  1.00 97.45  ? 252  GLU A N   1 
ATOM 1810 C CA  . GLU A 1 244 ? -34.630 40.952 -5.497  1.00 99.28  ? 252  GLU A CA  1 
ATOM 1811 C C   . GLU A 1 244 ? -33.433 40.449 -4.689  1.00 104.87 ? 252  GLU A C   1 
ATOM 1812 O O   . GLU A 1 244 ? -32.691 41.242 -4.114  1.00 108.58 ? 252  GLU A O   1 
ATOM 1813 C CB  . GLU A 1 244 ? -35.907 40.922 -4.643  1.00 97.86  ? 252  GLU A CB  1 
ATOM 1814 N N   . THR A 1 245 ? -33.245 39.128 -4.662  1.00 112.43 ? 253  THR A N   1 
ATOM 1815 C CA  . THR A 1 245 ? -32.057 38.515 -4.045  1.00 105.60 ? 253  THR A CA  1 
ATOM 1816 C C   . THR A 1 245 ? -30.798 38.995 -4.770  1.00 97.74  ? 253  THR A C   1 
ATOM 1817 O O   . THR A 1 245 ? -29.917 39.625 -4.180  1.00 91.78  ? 253  THR A O   1 
ATOM 1818 C CB  . THR A 1 245 ? -32.126 36.968 -4.104  1.00 103.08 ? 253  THR A CB  1 
ATOM 1819 O OG1 . THR A 1 245 ? -33.442 36.519 -3.735  1.00 100.04 ? 253  THR A OG1 1 
ATOM 1820 C CG2 . THR A 1 245 ? -31.091 36.338 -3.185  1.00 101.83 ? 253  THR A CG2 1 
ATOM 1821 N N   . ALA A 1 246 ? -30.753 38.706 -6.067  1.00 100.40 ? 254  ALA A N   1 
ATOM 1822 C CA  . ALA A 1 246 ? -29.659 39.108 -6.949  1.00 102.51 ? 254  ALA A CA  1 
ATOM 1823 C C   . ALA A 1 246 ? -29.316 40.591 -6.805  1.00 103.15 ? 254  ALA A C   1 
ATOM 1824 O O   . ALA A 1 246 ? -28.144 40.973 -6.667  1.00 98.00  ? 254  ALA A O   1 
ATOM 1825 C CB  . ALA A 1 246 ? -30.036 38.796 -8.392  1.00 99.16  ? 254  ALA A CB  1 
ATOM 1826 N N   . SER A 1 247 ? -30.358 41.413 -6.853  1.00 103.17 ? 255  SER A N   1 
ATOM 1827 C CA  . SER A 1 247 ? -30.243 42.846 -6.652  1.00 107.02 ? 255  SER A CA  1 
ATOM 1828 C C   . SER A 1 247 ? -29.319 43.178 -5.472  1.00 108.98 ? 255  SER A C   1 
ATOM 1829 O O   . SER A 1 247 ? -28.411 44.008 -5.592  1.00 106.04 ? 255  SER A O   1 
ATOM 1830 C CB  . SER A 1 247 ? -31.640 43.446 -6.444  1.00 106.50 ? 255  SER A CB  1 
ATOM 1831 O OG  . SER A 1 247 ? -31.581 44.727 -5.839  1.00 121.12 ? 255  SER A OG  1 
ATOM 1832 N N   . GLU A 1 248 ? -29.539 42.507 -4.346  1.00 110.64 ? 256  GLU A N   1 
ATOM 1833 C CA  . GLU A 1 248 ? -28.758 42.755 -3.133  1.00 115.01 ? 256  GLU A CA  1 
ATOM 1834 C C   . GLU A 1 248 ? -27.316 42.253 -3.242  1.00 112.54 ? 256  GLU A C   1 
ATOM 1835 O O   . GLU A 1 248 ? -26.380 42.976 -2.894  1.00 101.60 ? 256  GLU A O   1 
ATOM 1836 C CB  . GLU A 1 248 ? -29.439 42.111 -1.923  1.00 116.66 ? 256  GLU A CB  1 
ATOM 1837 C CG  . GLU A 1 248 ? -30.783 42.739 -1.568  1.00 122.84 ? 256  GLU A CG  1 
ATOM 1838 C CD  . GLU A 1 248 ? -30.714 43.736 -0.418  1.00 122.18 ? 256  GLU A CD  1 
ATOM 1839 O OE1 . GLU A 1 248 ? -29.745 43.693 0.370   1.00 126.27 ? 256  GLU A OE1 1 
ATOM 1840 O OE2 . GLU A 1 248 ? -31.647 44.554 -0.290  1.00 114.03 ? 256  GLU A OE2 1 
ATOM 1841 N N   . TYR A 1 249 ? -27.129 41.019 -3.708  1.00 110.14 ? 257  TYR A N   1 
ATOM 1842 C CA  . TYR A 1 249 ? -25.771 40.493 -3.828  1.00 114.77 ? 257  TYR A CA  1 
ATOM 1843 C C   . TYR A 1 249 ? -24.985 41.388 -4.758  1.00 112.91 ? 257  TYR A C   1 
ATOM 1844 O O   . TYR A 1 249 ? -23.807 41.653 -4.520  1.00 115.20 ? 257  TYR A O   1 
ATOM 1845 C CB  . TYR A 1 249 ? -25.729 39.024 -4.295  1.00 119.06 ? 257  TYR A CB  1 
ATOM 1846 C CG  . TYR A 1 249 ? -25.774 38.027 -3.144  1.00 122.77 ? 257  TYR A CG  1 
ATOM 1847 C CD1 . TYR A 1 249 ? -24.805 38.048 -2.137  1.00 115.22 ? 257  TYR A CD1 1 
ATOM 1848 C CD2 . TYR A 1 249 ? -26.789 37.073 -3.053  1.00 129.40 ? 257  TYR A CD2 1 
ATOM 1849 C CE1 . TYR A 1 249 ? -24.851 37.156 -1.075  1.00 111.94 ? 257  TYR A CE1 1 
ATOM 1850 C CE2 . TYR A 1 249 ? -26.837 36.171 -1.999  1.00 125.80 ? 257  TYR A CE2 1 
ATOM 1851 C CZ  . TYR A 1 249 ? -25.869 36.216 -1.016  1.00 118.99 ? 257  TYR A CZ  1 
ATOM 1852 O OH  . TYR A 1 249 ? -25.940 35.321 0.022   1.00 122.14 ? 257  TYR A OH  1 
ATOM 1853 N N   . TYR A 1 250 ? -25.650 41.878 -5.802  1.00 111.03 ? 258  TYR A N   1 
ATOM 1854 C CA  . TYR A 1 250 ? -25.033 42.837 -6.704  1.00 113.15 ? 258  TYR A CA  1 
ATOM 1855 C C   . TYR A 1 250 ? -24.689 44.136 -5.946  1.00 122.10 ? 258  TYR A C   1 
ATOM 1856 O O   . TYR A 1 250 ? -23.577 44.655 -6.085  1.00 118.11 ? 258  TYR A O   1 
ATOM 1857 C CB  . TYR A 1 250 ? -25.937 43.100 -7.911  1.00 103.21 ? 258  TYR A CB  1 
ATOM 1858 N N   . LYS A 1 251 ? -25.627 44.631 -5.127  1.00 130.37 ? 259  LYS A N   1 
ATOM 1859 C CA  . LYS A 1 251 ? -25.392 45.820 -4.277  1.00 128.82 ? 259  LYS A CA  1 
ATOM 1860 C C   . LYS A 1 251 ? -24.136 45.635 -3.425  1.00 130.64 ? 259  LYS A C   1 
ATOM 1861 O O   . LYS A 1 251 ? -23.229 46.473 -3.447  1.00 124.94 ? 259  LYS A O   1 
ATOM 1862 C CB  . LYS A 1 251 ? -26.592 46.105 -3.350  1.00 126.17 ? 259  LYS A CB  1 
ATOM 1863 C CG  . LYS A 1 251 ? -27.882 46.513 -4.049  1.00 121.34 ? 259  LYS A CG  1 
ATOM 1864 N N   . LYS A 1 252 ? -24.100 44.525 -2.684  1.00 132.15 ? 260  LYS A N   1 
ATOM 1865 C CA  . LYS A 1 252 ? -22.937 44.144 -1.868  1.00 127.74 ? 260  LYS A CA  1 
ATOM 1866 C C   . LYS A 1 252 ? -21.636 44.171 -2.666  1.00 124.74 ? 260  LYS A C   1 
ATOM 1867 O O   . LYS A 1 252 ? -20.598 44.553 -2.138  1.00 123.36 ? 260  LYS A O   1 
ATOM 1868 C CB  . LYS A 1 252 ? -23.113 42.734 -1.283  1.00 120.16 ? 260  LYS A CB  1 
ATOM 1869 C CG  . LYS A 1 252 ? -24.290 42.574 -0.329  1.00 116.13 ? 260  LYS A CG  1 
ATOM 1870 C CD  . LYS A 1 252 ? -24.047 41.496 0.720   1.00 108.06 ? 260  LYS A CD  1 
ATOM 1871 C CE  . LYS A 1 252 ? -22.880 41.863 1.626   1.00 110.02 ? 260  LYS A CE  1 
ATOM 1872 N NZ  . LYS A 1 252 ? -22.939 41.168 2.937   1.00 113.12 ? 260  LYS A NZ  1 
ATOM 1873 N N   . THR A 1 253 ? -21.703 43.744 -3.927  1.00 122.62 ? 261  THR A N   1 
ATOM 1874 C CA  . THR A 1 253 ? -20.528 43.688 -4.802  1.00 124.61 ? 261  THR A CA  1 
ATOM 1875 C C   . THR A 1 253 ? -19.994 45.079 -5.078  1.00 126.77 ? 261  THR A C   1 
ATOM 1876 O O   . THR A 1 253 ? -18.813 45.357 -4.852  1.00 115.94 ? 261  THR A O   1 
ATOM 1877 C CB  . THR A 1 253 ? -20.867 43.017 -6.144  1.00 120.43 ? 261  THR A CB  1 
ATOM 1878 O OG1 . THR A 1 253 ? -21.606 41.815 -5.892  1.00 123.10 ? 261  THR A OG1 1 
ATOM 1879 C CG2 . THR A 1 253 ? -19.592 42.697 -6.941  1.00 113.82 ? 261  THR A CG2 1 
ATOM 1880 N N   . LEU A 1 254 ? -20.882 45.941 -5.567  1.00 135.22 ? 262  LEU A N   1 
ATOM 1881 C CA  . LEU A 1 254 ? -20.568 47.349 -5.791  1.00 134.89 ? 262  LEU A CA  1 
ATOM 1882 C C   . LEU A 1 254 ? -20.179 47.997 -4.454  1.00 125.86 ? 262  LEU A C   1 
ATOM 1883 O O   . LEU A 1 254 ? -19.173 48.706 -4.358  1.00 110.27 ? 262  LEU A O   1 
ATOM 1884 C CB  . LEU A 1 254 ? -21.774 48.078 -6.423  1.00 139.36 ? 262  LEU A CB  1 
ATOM 1885 C CG  . LEU A 1 254 ? -22.335 47.611 -7.788  1.00 132.21 ? 262  LEU A CG  1 
ATOM 1886 C CD1 . LEU A 1 254 ? -23.616 48.365 -8.135  1.00 123.31 ? 262  LEU A CD1 1 
ATOM 1887 C CD2 . LEU A 1 254 ? -21.321 47.755 -8.918  1.00 124.93 ? 262  LEU A CD2 1 
ATOM 1888 N N   . LEU A 1 255 ? -20.970 47.714 -3.420  1.00 123.80 ? 263  LEU A N   1 
ATOM 1889 C CA  . LEU A 1 255 ? -20.694 48.194 -2.062  1.00 132.69 ? 263  LEU A CA  1 
ATOM 1890 C C   . LEU A 1 255 ? -19.305 47.776 -1.548  1.00 138.38 ? 263  LEU A C   1 
ATOM 1891 O O   . LEU A 1 255 ? -18.674 48.512 -0.782  1.00 131.35 ? 263  LEU A O   1 
ATOM 1892 C CB  . LEU A 1 255 ? -21.783 47.699 -1.093  1.00 125.55 ? 263  LEU A CB  1 
ATOM 1893 N N   . LEU A 1 256 ? -18.844 46.596 -1.972  1.00 151.74 ? 264  LEU A N   1 
ATOM 1894 C CA  . LEU A 1 256 ? -17.571 46.020 -1.508  1.00 155.00 ? 264  LEU A CA  1 
ATOM 1895 C C   . LEU A 1 256 ? -16.355 46.751 -2.078  1.00 156.28 ? 264  LEU A C   1 
ATOM 1896 O O   . LEU A 1 256 ? -15.571 47.335 -1.324  1.00 145.90 ? 264  LEU A O   1 
ATOM 1897 C CB  . LEU A 1 256 ? -17.488 44.526 -1.867  1.00 147.19 ? 264  LEU A CB  1 
ATOM 1898 N N   . ALA A 1 257 ? -16.211 46.717 -3.406  1.00 157.65 ? 265  ALA A N   1 
ATOM 1899 C CA  . ALA A 1 257 ? -15.061 47.319 -4.100  1.00 147.02 ? 265  ALA A CA  1 
ATOM 1900 C C   . ALA A 1 257 ? -14.860 48.788 -3.705  1.00 140.85 ? 265  ALA A C   1 
ATOM 1901 O O   . ALA A 1 257 ? -13.736 49.301 -3.737  1.00 133.49 ? 265  ALA A O   1 
ATOM 1902 C CB  . ALA A 1 257 ? -15.214 47.175 -5.611  1.00 137.41 ? 265  ALA A CB  1 
ATOM 1903 N N   . ARG A 1 258 ? -15.953 49.455 -3.336  1.00 133.33 ? 266  ARG A N   1 
ATOM 1904 C CA  . ARG A 1 258 ? -15.873 50.752 -2.665  1.00 138.56 ? 266  ARG A CA  1 
ATOM 1905 C C   . ARG A 1 258 ? -14.891 50.681 -1.483  1.00 136.18 ? 266  ARG A C   1 
ATOM 1906 O O   . ARG A 1 258 ? -13.793 51.240 -1.558  1.00 138.96 ? 266  ARG A O   1 
ATOM 1907 C CB  . ARG A 1 258 ? -17.266 51.222 -2.178  1.00 135.99 ? 266  ARG A CB  1 
ATOM 1908 C CG  . ARG A 1 258 ? -18.026 52.125 -3.146  1.00 121.04 ? 266  ARG A CG  1 
ATOM 1909 N N   . GLN A 1 259 ? -15.282 49.962 -0.424  1.00 129.93 ? 267  GLN A N   1 
ATOM 1910 C CA  . GLN A 1 259 ? -14.582 49.999 0.879   1.00 119.32 ? 267  GLN A CA  1 
ATOM 1911 C C   . GLN A 1 259 ? -13.061 50.012 0.720   1.00 120.65 ? 267  GLN A C   1 
ATOM 1912 O O   . GLN A 1 259 ? -12.324 50.155 1.697   1.00 121.71 ? 267  GLN A O   1 
ATOM 1913 C CB  . GLN A 1 259 ? -14.980 48.810 1.775   1.00 109.88 ? 267  GLN A CB  1 
ATOM 1914 C CG  . GLN A 1 259 ? -16.474 48.563 1.930   1.00 100.38 ? 267  GLN A CG  1 
ATOM 1915 N N   . HIS B 2 22  ? -17.772 37.404 -18.632 1.00 129.62 ? 994  HIS B N   1 
ATOM 1916 C CA  . HIS B 2 22  ? -19.017 37.628 -17.829 1.00 139.70 ? 994  HIS B CA  1 
ATOM 1917 C C   . HIS B 2 22  ? -18.806 37.236 -16.358 1.00 141.06 ? 994  HIS B C   1 
ATOM 1918 O O   . HIS B 2 22  ? -19.015 38.046 -15.445 1.00 118.52 ? 994  HIS B O   1 
ATOM 1919 C CB  . HIS B 2 22  ? -20.184 36.818 -18.416 1.00 154.27 ? 994  HIS B CB  1 
ATOM 1920 C CG  . HIS B 2 22  ? -21.539 37.358 -18.065 1.00 166.47 ? 994  HIS B CG  1 
ATOM 1921 N ND1 . HIS B 2 22  ? -22.663 37.088 -18.817 1.00 168.89 ? 994  HIS B ND1 1 
ATOM 1922 C CD2 . HIS B 2 22  ? -21.947 38.169 -17.059 1.00 170.27 ? 994  HIS B CD2 1 
ATOM 1923 C CE1 . HIS B 2 22  ? -23.706 37.699 -18.283 1.00 167.34 ? 994  HIS B CE1 1 
ATOM 1924 N NE2 . HIS B 2 22  ? -23.299 38.362 -17.216 1.00 168.10 ? 994  HIS B NE2 1 
ATOM 1925 N N   . MET B 2 23  ? -18.395 35.982 -16.151 1.00 142.94 ? 995  MET B N   1 
ATOM 1926 C CA  . MET B 2 23  ? -18.156 35.421 -14.812 1.00 125.89 ? 995  MET B CA  1 
ATOM 1927 C C   . MET B 2 23  ? -16.726 35.631 -14.334 1.00 108.86 ? 995  MET B C   1 
ATOM 1928 O O   . MET B 2 23  ? -15.787 35.800 -15.126 1.00 98.03  ? 995  MET B O   1 
ATOM 1929 C CB  . MET B 2 23  ? -18.446 33.927 -14.798 1.00 125.28 ? 995  MET B CB  1 
ATOM 1930 C CG  . MET B 2 23  ? -17.391 33.099 -15.525 1.00 129.21 ? 995  MET B CG  1 
ATOM 1931 S SD  . MET B 2 23  ? -17.959 31.480 -16.079 1.00 138.72 ? 995  MET B SD  1 
ATOM 1932 C CE  . MET B 2 23  ? -19.631 31.860 -16.578 1.00 139.07 ? 995  MET B CE  1 
ATOM 1933 N N   . GLU B 2 24  ? -16.571 35.569 -13.020 1.00 88.34  ? 996  GLU B N   1 
ATOM 1934 C CA  . GLU B 2 24  ? -15.324 35.922 -12.384 1.00 90.99  ? 996  GLU B CA  1 
ATOM 1935 C C   . GLU B 2 24  ? -14.691 34.643 -11.882 1.00 94.02  ? 996  GLU B C   1 
ATOM 1936 O O   . GLU B 2 24  ? -15.360 33.817 -11.254 1.00 90.47  ? 996  GLU B O   1 
ATOM 1937 C CB  . GLU B 2 24  ? -15.585 36.894 -11.234 1.00 97.65  ? 996  GLU B CB  1 
ATOM 1938 C CG  . GLU B 2 24  ? -15.863 38.336 -11.675 1.00 97.63  ? 996  GLU B CG  1 
ATOM 1939 C CD  . GLU B 2 24  ? -14.725 39.280 -11.312 1.00 100.92 ? 996  GLU B CD  1 
ATOM 1940 O OE1 . GLU B 2 24  ? -13.564 39.020 -11.721 1.00 102.20 ? 996  GLU B OE1 1 
ATOM 1941 O OE2 . GLU B 2 24  ? -14.991 40.274 -10.598 1.00 98.56  ? 996  GLU B OE2 1 
ATOM 1942 N N   . MET B 2 25  ? -13.406 34.478 -12.171 1.00 92.95  ? 997  MET B N   1 
ATOM 1943 C CA  . MET B 2 25  ? -12.737 33.212 -11.985 1.00 89.47  ? 997  MET B CA  1 
ATOM 1944 C C   . MET B 2 25  ? -11.576 33.371 -11.036 1.00 94.45  ? 997  MET B C   1 
ATOM 1945 O O   . MET B 2 25  ? -11.111 34.488 -10.779 1.00 93.22  ? 997  MET B O   1 
ATOM 1946 C CB  . MET B 2 25  ? -12.223 32.701 -13.319 1.00 90.14  ? 997  MET B CB  1 
ATOM 1947 C CG  . MET B 2 25  ? -13.311 32.548 -14.360 1.00 96.60  ? 997  MET B CG  1 
ATOM 1948 S SD  . MET B 2 25  ? -14.251 31.029 -14.161 1.00 110.10 ? 997  MET B SD  1 
ATOM 1949 C CE  . MET B 2 25  ? -13.022 29.871 -14.748 1.00 110.69 ? 997  MET B CE  1 
ATOM 1950 N N   . GLU B 2 26  ? -11.116 32.235 -10.517 1.00 95.39  ? 998  GLU B N   1 
ATOM 1951 C CA  . GLU B 2 26  ? -10.025 32.214 -9.563  1.00 94.17  ? 998  GLU B CA  1 
ATOM 1952 C C   . GLU B 2 26  ? -8.704  32.155 -10.324 1.00 90.66  ? 998  GLU B C   1 
ATOM 1953 O O   . GLU B 2 26  ? -8.655  31.641 -11.440 1.00 97.08  ? 998  GLU B O   1 
ATOM 1954 C CB  . GLU B 2 26  ? -10.183 31.022 -8.610  1.00 96.39  ? 998  GLU B CB  1 
ATOM 1955 C CG  . GLU B 2 26  ? -11.536 30.948 -7.873  1.00 98.80  ? 998  GLU B CG  1 
ATOM 1956 C CD  . GLU B 2 26  ? -11.806 32.122 -6.916  1.00 94.38  ? 998  GLU B CD  1 
ATOM 1957 O OE1 . GLU B 2 26  ? -10.936 32.397 -6.054  1.00 86.07  ? 998  GLU B OE1 1 
ATOM 1958 O OE2 . GLU B 2 26  ? -12.900 32.757 -7.000  1.00 75.50  ? 998  GLU B OE2 1 
ATOM 1959 N N   . PRO B 2 27  ? -7.626  32.673 -9.726  1.00 86.87  ? 999  PRO B N   1 
ATOM 1960 C CA  . PRO B 2 27  ? -6.340  32.653 -10.414 1.00 91.33  ? 999  PRO B CA  1 
ATOM 1961 C C   . PRO B 2 27  ? -5.806  31.244 -10.622 1.00 92.23  ? 999  PRO B C   1 
ATOM 1962 O O   . PRO B 2 27  ? -6.303  30.297 -10.023 1.00 92.97  ? 999  PRO B O   1 
ATOM 1963 C CB  . PRO B 2 27  ? -5.423  33.400 -9.447  1.00 97.38  ? 999  PRO B CB  1 
ATOM 1964 C CG  . PRO B 2 27  ? -6.005  33.116 -8.097  1.00 91.82  ? 999  PRO B CG  1 
ATOM 1965 C CD  . PRO B 2 27  ? -7.491  33.086 -8.316  1.00 89.62  ? 999  PRO B CD  1 
ATOM 1966 N N   . GLU B 2 28  ? -4.791  31.113 -11.466 1.00 97.92  ? 1000 GLU B N   1 
ATOM 1967 C CA  . GLU B 2 28  ? -4.131  29.829 -11.665 1.00 91.63  ? 1000 GLU B CA  1 
ATOM 1968 C C   . GLU B 2 28  ? -3.050  29.646 -10.621 1.00 85.91  ? 1000 GLU B C   1 
ATOM 1969 O O   . GLU B 2 28  ? -2.505  30.609 -10.089 1.00 75.48  ? 1000 GLU B O   1 
ATOM 1970 C CB  . GLU B 2 28  ? -3.464  29.741 -13.039 1.00 101.18 ? 1000 GLU B CB  1 
ATOM 1971 C CG  . GLU B 2 28  ? -4.392  29.717 -14.244 1.00 102.18 ? 1000 GLU B CG  1 
ATOM 1972 C CD  . GLU B 2 28  ? -4.685  31.097 -14.840 1.00 107.13 ? 1000 GLU B CD  1 
ATOM 1973 O OE1 . GLU B 2 28  ? -5.652  31.201 -15.631 1.00 99.59  ? 1000 GLU B OE1 1 
ATOM 1974 O OE2 . GLU B 2 28  ? -3.958  32.075 -14.539 1.00 108.49 ? 1000 GLU B OE2 1 
ATOM 1975 N N   . THR B 2 29  ? -2.752  28.388 -10.345 1.00 82.53  ? 1001 THR B N   1 
ATOM 1976 C CA  . THR B 2 29  ? -1.582  28.020 -9.595  1.00 86.11  ? 1001 THR B CA  1 
ATOM 1977 C C   . THR B 2 29  ? -0.485  27.635 -10.566 1.00 86.84  ? 1001 THR B C   1 
ATOM 1978 O O   . THR B 2 29  ? -0.696  26.833 -11.471 1.00 97.24  ? 1001 THR B O   1 
ATOM 1979 C CB  . THR B 2 29  ? -1.845  26.786 -8.715  1.00 93.61  ? 1001 THR B CB  1 
ATOM 1980 O OG1 . THR B 2 29  ? -2.288  25.683 -9.523  1.00 98.24  ? 1001 THR B OG1 1 
ATOM 1981 C CG2 . THR B 2 29  ? -2.890  27.086 -7.673  1.00 101.62 ? 1001 THR B CG2 1 
ATOM 1982 N N   . MET B 2 30  ? 0.706   28.156 -10.359 1.00 79.82  ? 1002 MET B N   1 
ATOM 1983 C CA  . MET B 2 30  ? 1.846   27.666 -11.102 1.00 78.73  ? 1002 MET B CA  1 
ATOM 1984 C C   . MET B 2 30  ? 2.805   27.026 -10.113 1.00 75.07  ? 1002 MET B C   1 
ATOM 1985 O O   . MET B 2 30  ? 3.089   27.607 -9.080  1.00 76.27  ? 1002 MET B O   1 
ATOM 1986 C CB  . MET B 2 30  ? 2.526   28.817 -11.840 1.00 81.69  ? 1002 MET B CB  1 
ATOM 1987 C CG  . MET B 2 30  ? 1.571   29.677 -12.673 1.00 89.05  ? 1002 MET B CG  1 
ATOM 1988 S SD  . MET B 2 30  ? 1.001   28.988 -14.248 1.00 84.96  ? 1002 MET B SD  1 
ATOM 1989 C CE  . MET B 2 30  ? 2.554   28.848 -15.116 1.00 80.03  ? 1002 MET B CE  1 
ATOM 1990 N N   . GLU B 2 31  ? 3.300   25.830 -10.418 1.00 71.60  ? 1003 GLU B N   1 
ATOM 1991 C CA  . GLU B 2 31  ? 4.320   25.212 -9.570  1.00 73.67  ? 1003 GLU B CA  1 
ATOM 1992 C C   . GLU B 2 31  ? 5.595   26.019 -9.740  1.00 75.00  ? 1003 GLU B C   1 
ATOM 1993 O O   . GLU B 2 31  ? 5.773   26.664 -10.772 1.00 76.57  ? 1003 GLU B O   1 
ATOM 1994 C CB  . GLU B 2 31  ? 4.577   23.752 -9.933  1.00 74.15  ? 1003 GLU B CB  1 
ATOM 1995 C CG  . GLU B 2 31  ? 3.346   22.945 -10.318 1.00 76.10  ? 1003 GLU B CG  1 
ATOM 1996 C CD  . GLU B 2 31  ? 2.157   23.184 -9.410  1.00 78.38  ? 1003 GLU B CD  1 
ATOM 1997 O OE1 . GLU B 2 31  ? 1.077   23.646 -9.921  1.00 75.08  ? 1003 GLU B OE1 1 
ATOM 1998 O OE2 . GLU B 2 31  ? 2.321   22.914 -8.193  1.00 71.07  ? 1003 GLU B OE2 1 
ATOM 1999 N N   . THR B 2 32  ? 6.466   25.998 -8.728  1.00 73.19  ? 1004 THR B N   1 
ATOM 2000 C CA  . THR B 2 32  ? 7.603   26.924 -8.667  1.00 73.98  ? 1004 THR B CA  1 
ATOM 2001 C C   . THR B 2 32  ? 8.914   26.255 -8.239  1.00 69.95  ? 1004 THR B C   1 
ATOM 2002 O O   . THR B 2 32  ? 8.991   25.604 -7.221  1.00 72.63  ? 1004 THR B O   1 
ATOM 2003 C CB  . THR B 2 32  ? 7.331   28.098 -7.688  1.00 76.07  ? 1004 THR B CB  1 
ATOM 2004 O OG1 . THR B 2 32  ? 7.280   27.600 -6.358  1.00 75.49  ? 1004 THR B OG1 1 
ATOM 2005 C CG2 . THR B 2 32  ? 6.014   28.816 -7.996  1.00 76.84  ? 1004 THR B CG2 1 
ATOM 2006 N N   . LYS B 2 33  ? 9.963   26.473 -9.006  1.00 70.53  ? 1005 LYS B N   1 
ATOM 2007 C CA  . LYS B 2 33  ? 11.245  25.900 -8.694  1.00 76.05  ? 1005 LYS B CA  1 
ATOM 2008 C C   . LYS B 2 33  ? 12.170  26.974 -8.152  1.00 78.03  ? 1005 LYS B C   1 
ATOM 2009 O O   . LYS B 2 33  ? 12.107  28.128 -8.575  1.00 82.39  ? 1005 LYS B O   1 
ATOM 2010 C CB  . LYS B 2 33  ? 11.866  25.295 -9.961  1.00 83.21  ? 1005 LYS B CB  1 
ATOM 2011 C CG  . LYS B 2 33  ? 10.956  24.370 -10.763 1.00 79.54  ? 1005 LYS B CG  1 
ATOM 2012 C CD  . LYS B 2 33  ? 11.796  23.434 -11.602 1.00 80.46  ? 1005 LYS B CD  1 
ATOM 2013 C CE  . LYS B 2 33  ? 10.982  22.633 -12.590 1.00 78.86  ? 1005 LYS B CE  1 
ATOM 2014 N NZ  . LYS B 2 33  ? 11.916  21.835 -13.434 1.00 79.98  ? 1005 LYS B NZ  1 
ATOM 2015 N N   . SER B 2 34  ? 13.065  26.581 -7.257  1.00 82.63  ? 1006 SER B N   1 
ATOM 2016 C CA  . SER B 2 34  ? 14.037  27.501 -6.699  1.00 86.05  ? 1006 SER B CA  1 
ATOM 2017 C C   . SER B 2 34  ? 15.476  27.036 -6.922  1.00 90.93  ? 1006 SER B C   1 
ATOM 2018 O O   . SER B 2 34  ? 15.762  25.838 -6.958  1.00 95.86  ? 1006 SER B O   1 
ATOM 2019 C CB  . SER B 2 34  ? 13.784  27.659 -5.209  1.00 88.36  ? 1006 SER B CB  1 
ATOM 2020 O OG  . SER B 2 34  ? 14.831  28.386 -4.617  1.00 96.02  ? 1006 SER B OG  1 
ATOM 2021 N N   . VAL B 2 35  ? 16.373  28.005 -7.081  1.00 90.73  ? 1007 VAL B N   1 
ATOM 2022 C CA  . VAL B 2 35  ? 17.817  27.769 -6.978  1.00 92.76  ? 1007 VAL B CA  1 
ATOM 2023 C C   . VAL B 2 35  ? 18.199  27.241 -5.599  1.00 95.80  ? 1007 VAL B C   1 
ATOM 2024 O O   . VAL B 2 35  ? 19.122  26.445 -5.475  1.00 94.47  ? 1007 VAL B O   1 
ATOM 2025 C CB  . VAL B 2 35  ? 18.634  29.059 -7.227  1.00 95.59  ? 1007 VAL B CB  1 
ATOM 2026 C CG1 . VAL B 2 35  ? 18.527  29.479 -8.673  1.00 95.79  ? 1007 VAL B CG1 1 
ATOM 2027 C CG2 . VAL B 2 35  ? 18.169  30.211 -6.345  1.00 103.14 ? 1007 VAL B CG2 1 
ATOM 2028 N N   . THR B 2 36  ? 17.466  27.693 -4.576  1.00 110.17 ? 1008 THR B N   1 
ATOM 2029 C CA  . THR B 2 36  ? 17.744  27.384 -3.165  1.00 116.71 ? 1008 THR B CA  1 
ATOM 2030 C C   . THR B 2 36  ? 17.550  25.897 -2.890  1.00 122.93 ? 1008 THR B C   1 
ATOM 2031 O O   . THR B 2 36  ? 17.927  25.402 -1.827  1.00 126.18 ? 1008 THR B O   1 
ATOM 2032 C CB  . THR B 2 36  ? 16.813  28.154 -2.168  1.00 122.48 ? 1008 THR B CB  1 
ATOM 2033 O OG1 . THR B 2 36  ? 15.548  27.482 -2.045  1.00 116.74 ? 1008 THR B OG1 1 
ATOM 2034 C CG2 . THR B 2 36  ? 16.586  29.648 -2.562  1.00 124.23 ? 1008 THR B CG2 1 
ATOM 2035 N N   . ASP B 2 37  ? 16.917  25.202 -3.834  1.00 129.05 ? 1009 ASP B N   1 
ATOM 2036 C CA  . ASP B 2 37  ? 16.751  23.753 -3.762  1.00 137.92 ? 1009 ASP B CA  1 
ATOM 2037 C C   . ASP B 2 37  ? 18.098  23.020 -3.686  1.00 156.50 ? 1009 ASP B C   1 
ATOM 2038 O O   . ASP B 2 37  ? 18.182  21.937 -3.097  1.00 161.95 ? 1009 ASP B O   1 
ATOM 2039 C CB  . ASP B 2 37  ? 15.941  23.249 -4.964  1.00 129.39 ? 1009 ASP B CB  1 
ATOM 2040 C CG  . ASP B 2 37  ? 14.483  23.725 -4.940  1.00 118.41 ? 1009 ASP B CG  1 
ATOM 2041 O OD1 . ASP B 2 37  ? 13.936  23.954 -3.836  1.00 104.58 ? 1009 ASP B OD1 1 
ATOM 2042 O OD2 . ASP B 2 37  ? 13.882  23.858 -6.033  1.00 104.48 ? 1009 ASP B OD2 1 
ATOM 2043 N N   . TYR B 2 38  ? 19.137  23.605 -4.294  1.00 169.43 ? 1010 TYR B N   1 
ATOM 2044 C CA  . TYR B 2 38  ? 20.520  23.162 -4.077  1.00 164.49 ? 1010 TYR B CA  1 
ATOM 2045 C C   . TYR B 2 38  ? 20.752  22.981 -2.566  1.00 159.40 ? 1010 TYR B C   1 
ATOM 2046 O O   . TYR B 2 38  ? 21.158  21.908 -2.114  1.00 148.89 ? 1010 TYR B O   1 
ATOM 2047 C CB  . TYR B 2 38  ? 21.523  24.185 -4.659  1.00 162.25 ? 1010 TYR B CB  1 
ATOM 2048 C CG  . TYR B 2 38  ? 22.841  23.611 -5.181  1.00 169.89 ? 1010 TYR B CG  1 
ATOM 2049 C CD1 . TYR B 2 38  ? 23.312  22.354 -4.774  1.00 175.06 ? 1010 TYR B CD1 1 
ATOM 2050 C CD2 . TYR B 2 38  ? 23.637  24.350 -6.062  1.00 167.57 ? 1010 TYR B CD2 1 
ATOM 2051 C CE1 . TYR B 2 38  ? 24.515  21.846 -5.248  1.00 170.87 ? 1010 TYR B CE1 1 
ATOM 2052 C CE2 . TYR B 2 38  ? 24.845  23.850 -6.535  1.00 170.84 ? 1010 TYR B CE2 1 
ATOM 2053 C CZ  . TYR B 2 38  ? 25.281  22.597 -6.127  1.00 172.44 ? 1010 TYR B CZ  1 
ATOM 2054 O OH  . TYR B 2 38  ? 26.477  22.085 -6.591  1.00 150.20 ? 1010 TYR B OH  1 
ATOM 2055 N N   . PHE B 2 39  ? 20.455  24.030 -1.796  1.00 157.43 ? 1011 PHE B N   1 
ATOM 2056 C CA  . PHE B 2 39  ? 20.577  24.001 -0.332  1.00 154.03 ? 1011 PHE B CA  1 
ATOM 2057 C C   . PHE B 2 39  ? 19.333  23.384 0.326   1.00 151.13 ? 1011 PHE B C   1 
ATOM 2058 O O   . PHE B 2 39  ? 19.283  22.183 0.610   1.00 131.18 ? 1011 PHE B O   1 
ATOM 2059 C CB  . PHE B 2 39  ? 20.799  25.421 0.206   1.00 150.19 ? 1011 PHE B CB  1 
ATOM 2060 C CG  . PHE B 2 39  ? 21.697  25.479 1.409   1.00 158.10 ? 1011 PHE B CG  1 
ATOM 2061 C CD1 . PHE B 2 39  ? 21.174  25.388 2.698   1.00 153.16 ? 1011 PHE B CD1 1 
ATOM 2062 C CD2 . PHE B 2 39  ? 23.075  25.622 1.255   1.00 157.12 ? 1011 PHE B CD2 1 
ATOM 2063 C CE1 . PHE B 2 39  ? 22.012  25.440 3.810   1.00 147.63 ? 1011 PHE B CE1 1 
ATOM 2064 C CE2 . PHE B 2 39  ? 23.914  25.675 2.362   1.00 149.54 ? 1011 PHE B CE2 1 
ATOM 2065 C CZ  . PHE B 2 39  ? 23.382  25.583 3.642   1.00 142.02 ? 1011 PHE B CZ  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   9    ?    ?   ?   A . n 
A 1 2   PRO 2   10   ?    ?   ?   A . n 
A 1 3   GLY 3   11   ?    ?   ?   A . n 
A 1 4   SER 4   12   12   SER SER A . n 
A 1 5   MET 5   13   13   MET MET A . n 
A 1 6   GLU 6   14   14   GLU GLU A . n 
A 1 7   ALA 7   15   15   ALA ALA A . n 
A 1 8   SER 8   16   16   SER SER A . n 
A 1 9   CYS 9   17   17   CYS CYS A . n 
A 1 10  LEU 10  18   18   LEU LEU A . n 
A 1 11  GLU 11  19   19   GLU GLU A . n 
A 1 12  LEU 12  20   20   LEU LEU A . n 
A 1 13  ALA 13  21   21   ALA ALA A . n 
A 1 14  LEU 14  22   22   LEU LEU A . n 
A 1 15  GLU 15  23   23   GLU GLU A . n 
A 1 16  GLY 16  24   24   GLY GLY A . n 
A 1 17  GLU 17  25   25   GLU GLU A . n 
A 1 18  ARG 18  26   26   ARG ARG A . n 
A 1 19  LEU 19  27   27   LEU LEU A . n 
A 1 20  CYS 20  28   28   CYS CYS A . n 
A 1 21  LYS 21  29   29   LYS LYS A . n 
A 1 22  SER 22  30   30   SER SER A . n 
A 1 23  GLY 23  31   31   GLY GLY A . n 
A 1 24  ASP 24  32   32   ASP ASP A . n 
A 1 25  CYS 25  33   33   CYS CYS A . n 
A 1 26  ARG 26  34   34   ARG ARG A . n 
A 1 27  ALA 27  35   35   ALA ALA A . n 
A 1 28  GLY 28  36   36   GLY GLY A . n 
A 1 29  VAL 29  37   37   VAL VAL A . n 
A 1 30  SER 30  38   38   SER SER A . n 
A 1 31  PHE 31  39   39   PHE PHE A . n 
A 1 32  PHE 32  40   40   PHE PHE A . n 
A 1 33  GLU 33  41   41   GLU GLU A . n 
A 1 34  ALA 34  42   42   ALA ALA A . n 
A 1 35  ALA 35  43   43   ALA ALA A . n 
A 1 36  VAL 36  44   44   VAL VAL A . n 
A 1 37  GLN 37  45   45   GLN GLN A . n 
A 1 38  VAL 38  46   46   VAL VAL A . n 
A 1 39  GLY 39  47   47   GLY GLY A . n 
A 1 40  THR 40  48   48   THR THR A . n 
A 1 41  GLU 41  49   49   GLU GLU A . n 
A 1 42  ASP 42  50   50   ASP ASP A . n 
A 1 43  LEU 43  51   51   LEU LEU A . n 
A 1 44  LYS 44  52   52   LYS LYS A . n 
A 1 45  THR 45  53   53   THR THR A . n 
A 1 46  LEU 46  54   54   LEU LEU A . n 
A 1 47  SER 47  55   55   SER SER A . n 
A 1 48  ALA 48  56   56   ALA ALA A . n 
A 1 49  ILE 49  57   57   ILE ILE A . n 
A 1 50  TYR 50  58   58   TYR TYR A . n 
A 1 51  SER 51  59   59   SER SER A . n 
A 1 52  GLN 52  60   60   GLN GLN A . n 
A 1 53  LEU 53  61   61   LEU LEU A . n 
A 1 54  GLY 54  62   62   GLY GLY A . n 
A 1 55  ASN 55  63   63   ASN ASN A . n 
A 1 56  ALA 56  64   64   ALA ALA A . n 
A 1 57  TYR 57  65   65   TYR TYR A . n 
A 1 58  PHE 58  66   66   PHE PHE A . n 
A 1 59  TYR 59  67   67   TYR TYR A . n 
A 1 60  LEU 60  68   68   LEU LEU A . n 
A 1 61  HIS 61  69   69   HIS HIS A . n 
A 1 62  ASP 62  70   70   ASP ASP A . n 
A 1 63  TYR 63  71   71   TYR TYR A . n 
A 1 64  ALA 64  72   72   ALA ALA A . n 
A 1 65  LYS 65  73   73   LYS LYS A . n 
A 1 66  ALA 66  74   74   ALA ALA A . n 
A 1 67  LEU 67  75   75   LEU LEU A . n 
A 1 68  GLU 68  76   76   GLU GLU A . n 
A 1 69  TYR 69  77   77   TYR TYR A . n 
A 1 70  HIS 70  78   78   HIS HIS A . n 
A 1 71  HIS 71  79   79   HIS HIS A . n 
A 1 72  HIS 72  80   80   HIS HIS A . n 
A 1 73  ASP 73  81   81   ASP ASP A . n 
A 1 74  LEU 74  82   82   LEU LEU A . n 
A 1 75  THR 75  83   83   THR THR A . n 
A 1 76  LEU 76  84   84   LEU LEU A . n 
A 1 77  ALA 77  85   85   ALA ALA A . n 
A 1 78  ARG 78  86   86   ARG ARG A . n 
A 1 79  THR 79  87   87   THR THR A . n 
A 1 80  ILE 80  88   88   ILE ILE A . n 
A 1 81  GLY 81  89   89   GLY GLY A . n 
A 1 82  ASP 82  90   90   ASP ASP A . n 
A 1 83  GLN 83  91   91   GLN GLN A . n 
A 1 84  LEU 84  92   92   LEU LEU A . n 
A 1 85  GLY 85  93   93   GLY GLY A . n 
A 1 86  GLU 86  94   94   GLU GLU A . n 
A 1 87  ALA 87  95   95   ALA ALA A . n 
A 1 88  LYS 88  96   96   LYS LYS A . n 
A 1 89  ALA 89  97   97   ALA ALA A . n 
A 1 90  SER 90  98   98   SER SER A . n 
A 1 91  GLY 91  99   99   GLY GLY A . n 
A 1 92  ASN 92  100  100  ASN ASN A . n 
A 1 93  LEU 93  101  101  LEU LEU A . n 
A 1 94  GLY 94  102  102  GLY GLY A . n 
A 1 95  ASN 95  103  103  ASN ASN A . n 
A 1 96  THR 96  104  104  THR THR A . n 
A 1 97  LEU 97  105  105  LEU LEU A . n 
A 1 98  LYS 98  106  106  LYS LYS A . n 
A 1 99  VAL 99  107  107  VAL VAL A . n 
A 1 100 LEU 100 108  108  LEU LEU A . n 
A 1 101 GLY 101 109  109  GLY GLY A . n 
A 1 102 ASN 102 110  110  ASN ASN A . n 
A 1 103 PHE 103 111  111  PHE PHE A . n 
A 1 104 ASP 104 112  112  ASP ASP A . n 
A 1 105 GLU 105 113  113  GLU GLU A . n 
A 1 106 ALA 106 114  114  ALA ALA A . n 
A 1 107 ILE 107 115  115  ILE ILE A . n 
A 1 108 VAL 108 116  116  VAL VAL A . n 
A 1 109 CYS 109 117  117  CYS CYS A . n 
A 1 110 CYS 110 118  118  CYS CYS A . n 
A 1 111 GLN 111 119  119  GLN GLN A . n 
A 1 112 ARG 112 120  120  ARG ARG A . n 
A 1 113 HIS 113 121  121  HIS HIS A . n 
A 1 114 LEU 114 122  122  LEU LEU A . n 
A 1 115 ASP 115 123  123  ASP ASP A . n 
A 1 116 ILE 116 124  124  ILE ILE A . n 
A 1 117 SER 117 125  125  SER SER A . n 
A 1 118 ARG 118 126  126  ARG ARG A . n 
A 1 119 GLU 119 127  127  GLU GLU A . n 
A 1 120 LEU 120 128  128  LEU LEU A . n 
A 1 121 ASN 121 129  129  ASN ASN A . n 
A 1 122 ASP 122 130  130  ASP ASP A . n 
A 1 123 LYS 123 131  131  LYS LYS A . n 
A 1 124 VAL 124 132  132  VAL VAL A . n 
A 1 125 GLY 125 133  133  GLY GLY A . n 
A 1 126 GLU 126 134  134  GLU GLU A . n 
A 1 127 ALA 127 135  135  ALA ALA A . n 
A 1 128 ARG 128 136  136  ARG ARG A . n 
A 1 129 ALA 129 137  137  ALA ALA A . n 
A 1 130 LEU 130 138  138  LEU LEU A . n 
A 1 131 TYR 131 139  139  TYR TYR A . n 
A 1 132 ASN 132 140  140  ASN ASN A . n 
A 1 133 LEU 133 141  141  LEU LEU A . n 
A 1 134 GLY 134 142  142  GLY GLY A . n 
A 1 135 ASN 135 143  143  ASN ASN A . n 
A 1 136 VAL 136 144  144  VAL VAL A . n 
A 1 137 TYR 137 145  145  TYR TYR A . n 
A 1 138 HIS 138 146  146  HIS HIS A . n 
A 1 139 ALA 139 147  147  ALA ALA A . n 
A 1 140 LYS 140 148  148  LYS LYS A . n 
A 1 141 GLY 141 149  149  GLY GLY A . n 
A 1 142 LYS 142 150  150  LYS LYS A . n 
A 1 143 SER 143 151  151  SER SER A . n 
A 1 144 PHE 144 152  152  PHE PHE A . n 
A 1 145 GLY 145 153  153  GLY GLY A . n 
A 1 146 CYS 146 154  154  CYS CYS A . n 
A 1 147 PRO 147 155  155  PRO PRO A . n 
A 1 148 GLY 148 156  ?    ?   ?   A . n 
A 1 149 PRO 149 157  157  PRO PRO A . n 
A 1 150 GLN 150 158  158  GLN GLN A . n 
A 1 151 ASP 151 159  159  ASP ASP A . n 
A 1 152 VAL 152 160  160  VAL VAL A . n 
A 1 153 GLY 153 161  161  GLY GLY A . n 
A 1 154 GLU 154 162  162  GLU GLU A . n 
A 1 155 PHE 155 163  163  PHE PHE A . n 
A 1 156 PRO 156 164  164  PRO PRO A . n 
A 1 157 GLU 157 165  165  GLU GLU A . n 
A 1 158 GLU 158 166  166  GLU GLU A . n 
A 1 159 VAL 159 167  167  VAL VAL A . n 
A 1 160 ARG 160 168  168  ARG ARG A . n 
A 1 161 ASP 161 169  169  ASP ASP A . n 
A 1 162 ALA 162 170  170  ALA ALA A . n 
A 1 163 LEU 163 171  171  LEU LEU A . n 
A 1 164 GLN 164 172  172  GLN GLN A . n 
A 1 165 ALA 165 173  173  ALA ALA A . n 
A 1 166 ALA 166 174  174  ALA ALA A . n 
A 1 167 VAL 167 175  175  VAL VAL A . n 
A 1 168 ASP 168 176  176  ASP ASP A . n 
A 1 169 PHE 169 177  177  PHE PHE A . n 
A 1 170 TYR 170 178  178  TYR TYR A . n 
A 1 171 GLU 171 179  179  GLU GLU A . n 
A 1 172 GLU 172 180  180  GLU GLU A . n 
A 1 173 ASN 173 181  181  ASN ASN A . n 
A 1 174 LEU 174 182  182  LEU LEU A . n 
A 1 175 SER 175 183  183  SER SER A . n 
A 1 176 LEU 176 184  184  LEU LEU A . n 
A 1 177 VAL 177 185  185  VAL VAL A . n 
A 1 178 THR 178 186  186  THR THR A . n 
A 1 179 ALA 179 187  187  ALA ALA A . n 
A 1 180 LEU 180 188  188  LEU LEU A . n 
A 1 181 GLY 181 189  189  GLY GLY A . n 
A 1 182 ASP 182 190  190  ASP ASP A . n 
A 1 183 ARG 183 191  191  ARG ARG A . n 
A 1 184 ALA 184 192  192  ALA ALA A . n 
A 1 185 ALA 185 193  193  ALA ALA A . n 
A 1 186 GLN 186 194  194  GLN GLN A . n 
A 1 187 GLY 187 195  195  GLY GLY A . n 
A 1 188 ARG 188 196  196  ARG ARG A . n 
A 1 189 ALA 189 197  197  ALA ALA A . n 
A 1 190 PHE 190 198  198  PHE PHE A . n 
A 1 191 GLY 191 199  199  GLY GLY A . n 
A 1 192 ASN 192 200  200  ASN ASN A . n 
A 1 193 LEU 193 201  201  LEU LEU A . n 
A 1 194 GLY 194 202  202  GLY GLY A . n 
A 1 195 ASN 195 203  203  ASN ASN A . n 
A 1 196 THR 196 204  204  THR THR A . n 
A 1 197 HIS 197 205  205  HIS HIS A . n 
A 1 198 TYR 198 206  206  TYR TYR A . n 
A 1 199 LEU 199 207  207  LEU LEU A . n 
A 1 200 LEU 200 208  208  LEU LEU A . n 
A 1 201 GLY 201 209  209  GLY GLY A . n 
A 1 202 ASN 202 210  210  ASN ASN A . n 
A 1 203 PHE 203 211  211  PHE PHE A . n 
A 1 204 ARG 204 212  212  ARG ARG A . n 
A 1 205 ASP 205 213  213  ASP ASP A . n 
A 1 206 ALA 206 214  214  ALA ALA A . n 
A 1 207 VAL 207 215  215  VAL VAL A . n 
A 1 208 ILE 208 216  216  ILE ILE A . n 
A 1 209 ALA 209 217  217  ALA ALA A . n 
A 1 210 HIS 210 218  218  HIS HIS A . n 
A 1 211 GLU 211 219  219  GLU GLU A . n 
A 1 212 GLN 212 220  220  GLN GLN A . n 
A 1 213 ARG 213 221  221  ARG ARG A . n 
A 1 214 LEU 214 222  222  LEU LEU A . n 
A 1 215 LEU 215 223  223  LEU LEU A . n 
A 1 216 ILE 216 224  224  ILE ILE A . n 
A 1 217 ALA 217 225  225  ALA ALA A . n 
A 1 218 LYS 218 226  226  LYS LYS A . n 
A 1 219 GLU 219 227  227  GLU GLU A . n 
A 1 220 PHE 220 228  228  PHE PHE A . n 
A 1 221 GLY 221 229  229  GLY GLY A . n 
A 1 222 ASP 222 230  230  ASP ASP A . n 
A 1 223 LYS 223 231  231  LYS LYS A . n 
A 1 224 ALA 224 232  232  ALA ALA A . n 
A 1 225 ALA 225 233  233  ALA ALA A . n 
A 1 226 GLU 226 234  234  GLU GLU A . n 
A 1 227 ARG 227 235  235  ARG ARG A . n 
A 1 228 ARG 228 236  236  ARG ARG A . n 
A 1 229 ALA 229 237  237  ALA ALA A . n 
A 1 230 TYR 230 238  238  TYR TYR A . n 
A 1 231 SER 231 239  239  SER SER A . n 
A 1 232 ASN 232 240  240  ASN ASN A . n 
A 1 233 LEU 233 241  241  LEU LEU A . n 
A 1 234 GLY 234 242  242  GLY GLY A . n 
A 1 235 ASN 235 243  243  ASN ASN A . n 
A 1 236 ALA 236 244  244  ALA ALA A . n 
A 1 237 TYR 237 245  245  TYR TYR A . n 
A 1 238 ILE 238 246  246  ILE ILE A . n 
A 1 239 PHE 239 247  247  PHE PHE A . n 
A 1 240 LEU 240 248  248  LEU LEU A . n 
A 1 241 GLY 241 249  249  GLY GLY A . n 
A 1 242 GLU 242 250  250  GLU GLU A . n 
A 1 243 PHE 243 251  251  PHE PHE A . n 
A 1 244 GLU 244 252  252  GLU GLU A . n 
A 1 245 THR 245 253  253  THR THR A . n 
A 1 246 ALA 246 254  254  ALA ALA A . n 
A 1 247 SER 247 255  255  SER SER A . n 
A 1 248 GLU 248 256  256  GLU GLU A . n 
A 1 249 TYR 249 257  257  TYR TYR A . n 
A 1 250 TYR 250 258  258  TYR TYR A . n 
A 1 251 LYS 251 259  259  LYS LYS A . n 
A 1 252 LYS 252 260  260  LYS LYS A . n 
A 1 253 THR 253 261  261  THR THR A . n 
A 1 254 LEU 254 262  262  LEU LEU A . n 
A 1 255 LEU 255 263  263  LEU LEU A . n 
A 1 256 LEU 256 264  264  LEU LEU A . n 
A 1 257 ALA 257 265  265  ALA ALA A . n 
A 1 258 ARG 258 266  266  ARG ARG A . n 
A 1 259 GLN 259 267  267  GLN GLN A . n 
A 1 260 LEU 260 268  ?    ?   ?   A . n 
A 1 261 LYS 261 269  ?    ?   ?   A . n 
A 1 262 ASP 262 270  ?    ?   ?   A . n 
A 1 263 ARG 263 271  ?    ?   ?   A . n 
A 1 264 ALA 264 272  ?    ?   ?   A . n 
A 1 265 VAL 265 273  ?    ?   ?   A . n 
A 1 266 GLU 266 274  ?    ?   ?   A . n 
A 1 267 ALA 267 275  ?    ?   ?   A . n 
A 1 268 GLN 268 276  ?    ?   ?   A . n 
A 1 269 SER 269 277  ?    ?   ?   A . n 
A 1 270 CYS 270 278  ?    ?   ?   A . n 
A 1 271 TYR 271 279  ?    ?   ?   A . n 
A 1 272 SER 272 280  ?    ?   ?   A . n 
A 1 273 LEU 273 281  ?    ?   ?   A . n 
A 1 274 GLY 274 282  ?    ?   ?   A . n 
A 1 275 ASN 275 283  ?    ?   ?   A . n 
A 1 276 THR 276 284  ?    ?   ?   A . n 
A 1 277 TYR 277 285  ?    ?   ?   A . n 
A 1 278 THR 278 286  ?    ?   ?   A . n 
A 1 279 LEU 279 287  ?    ?   ?   A . n 
A 1 280 LEU 280 288  ?    ?   ?   A . n 
A 1 281 GLN 281 289  ?    ?   ?   A . n 
A 1 282 ASP 282 290  ?    ?   ?   A . n 
A 1 283 TYR 283 291  ?    ?   ?   A . n 
A 1 284 GLU 284 292  ?    ?   ?   A . n 
A 1 285 LYS 285 293  ?    ?   ?   A . n 
A 1 286 ALA 286 294  ?    ?   ?   A . n 
A 1 287 ILE 287 295  ?    ?   ?   A . n 
A 1 288 ASP 288 296  ?    ?   ?   A . n 
A 1 289 TYR 289 297  ?    ?   ?   A . n 
A 1 290 HIS 290 298  ?    ?   ?   A . n 
A 1 291 LEU 291 299  ?    ?   ?   A . n 
A 1 292 LYS 292 300  ?    ?   ?   A . n 
A 1 293 HIS 293 301  ?    ?   ?   A . n 
A 1 294 LEU 294 302  ?    ?   ?   A . n 
A 1 295 ALA 295 303  ?    ?   ?   A . n 
A 1 296 ILE 296 304  ?    ?   ?   A . n 
A 1 297 ALA 297 305  ?    ?   ?   A . n 
A 1 298 GLN 298 306  ?    ?   ?   A . n 
A 1 299 GLU 299 307  ?    ?   ?   A . n 
A 1 300 LEU 300 308  ?    ?   ?   A . n 
A 1 301 ASN 301 309  ?    ?   ?   A . n 
A 1 302 ASP 302 310  ?    ?   ?   A . n 
A 1 303 ARG 303 311  ?    ?   ?   A . n 
A 1 304 ILE 304 312  ?    ?   ?   A . n 
A 1 305 GLY 305 313  ?    ?   ?   A . n 
A 1 306 GLU 306 314  ?    ?   ?   A . n 
A 1 307 GLY 307 315  ?    ?   ?   A . n 
A 1 308 ARG 308 316  ?    ?   ?   A . n 
A 1 309 ALA 309 317  ?    ?   ?   A . n 
A 1 310 CYS 310 318  ?    ?   ?   A . n 
A 1 311 TRP 311 319  ?    ?   ?   A . n 
A 1 312 SER 312 320  ?    ?   ?   A . n 
A 1 313 LEU 313 321  ?    ?   ?   A . n 
A 1 314 GLY 314 322  ?    ?   ?   A . n 
A 1 315 ASN 315 323  ?    ?   ?   A . n 
A 1 316 ALA 316 324  ?    ?   ?   A . n 
A 1 317 TYR 317 325  ?    ?   ?   A . n 
A 1 318 THR 318 326  ?    ?   ?   A . n 
A 1 319 ALA 319 327  ?    ?   ?   A . n 
A 1 320 LEU 320 328  ?    ?   ?   A . n 
A 1 321 GLY 321 329  ?    ?   ?   A . n 
A 1 322 ASN 322 330  ?    ?   ?   A . n 
A 1 323 HIS 323 331  ?    ?   ?   A . n 
A 1 324 ASP 324 332  ?    ?   ?   A . n 
A 1 325 GLN 325 333  ?    ?   ?   A . n 
A 1 326 ALA 326 334  ?    ?   ?   A . n 
A 1 327 MET 327 335  ?    ?   ?   A . n 
A 1 328 HIS 328 336  ?    ?   ?   A . n 
A 1 329 PHE 329 337  ?    ?   ?   A . n 
A 1 330 ALA 330 338  ?    ?   ?   A . n 
A 1 331 GLU 331 339  ?    ?   ?   A . n 
A 1 332 LYS 332 340  ?    ?   ?   A . n 
A 1 333 HIS 333 341  ?    ?   ?   A . n 
A 1 334 LEU 334 342  ?    ?   ?   A . n 
A 1 335 GLU 335 343  ?    ?   ?   A . n 
A 1 336 ILE 336 344  ?    ?   ?   A . n 
A 1 337 SER 337 345  ?    ?   ?   A . n 
A 1 338 ARG 338 346  ?    ?   ?   A . n 
A 1 339 GLU 339 347  ?    ?   ?   A . n 
A 1 340 VAL 340 348  ?    ?   ?   A . n 
A 1 341 GLY 341 349  ?    ?   ?   A . n 
A 1 342 ASP 342 350  ?    ?   ?   A . n 
A 1 343 LYS 343 351  ?    ?   ?   A . n 
A 1 344 SER 344 352  ?    ?   ?   A . n 
A 1 345 GLY 345 353  ?    ?   ?   A . n 
A 1 346 GLU 346 354  ?    ?   ?   A . n 
A 1 347 LEU 347 355  ?    ?   ?   A . n 
A 1 348 THR 348 356  ?    ?   ?   A . n 
A 1 349 ALA 349 357  ?    ?   ?   A . n 
A 1 350 ARG 350 358  ?    ?   ?   A . n 
A 1 351 LEU 351 359  ?    ?   ?   A . n 
A 1 352 ASN 352 360  ?    ?   ?   A . n 
A 1 353 LEU 353 361  ?    ?   ?   A . n 
A 1 354 SER 354 362  ?    ?   ?   A . n 
A 1 355 ASP 355 363  ?    ?   ?   A . n 
A 1 356 LEU 356 364  ?    ?   ?   A . n 
A 1 357 GLN 357 365  ?    ?   ?   A . n 
A 1 358 MET 358 366  ?    ?   ?   A . n 
A 1 359 VAL 359 367  ?    ?   ?   A . n 
A 1 360 LEU 360 368  ?    ?   ?   A . n 
A 1 361 GLY 361 369  ?    ?   ?   A . n 
A 1 362 LEU 362 370  ?    ?   ?   A . n 
A 1 363 SER 363 371  ?    ?   ?   A . n 
A 1 364 TYR 364 372  ?    ?   ?   A . n 
A 1 365 SER 365 373  ?    ?   ?   A . n 
A 1 366 THR 366 374  ?    ?   ?   A . n 
A 1 367 ASN 367 375  ?    ?   ?   A . n 
A 1 368 ASN 368 376  ?    ?   ?   A . n 
A 1 369 SER 369 377  ?    ?   ?   A . n 
A 1 370 ILE 370 378  ?    ?   ?   A . n 
A 1 371 MET 371 379  ?    ?   ?   A . n 
A 1 372 SER 372 380  ?    ?   ?   A . n 
A 1 373 GLU 373 381  ?    ?   ?   A . n 
A 1 374 ASN 374 382  ?    ?   ?   A . n 
A 1 375 THR 375 383  ?    ?   ?   A . n 
A 1 376 GLU 376 384  ?    ?   ?   A . n 
A 1 377 ILE 377 385  ?    ?   ?   A . n 
A 1 378 ASP 378 386  ?    ?   ?   A . n 
A 1 379 SER 379 387  ?    ?   ?   A . n 
A 1 380 SER 380 388  ?    ?   ?   A . n 
A 1 381 LEU 381 389  ?    ?   ?   A . n 
A 1 382 ASN 382 390  ?    ?   ?   A . n 
A 1 383 GLY 383 391  ?    ?   ?   A . n 
A 1 384 VAL 384 392  ?    ?   ?   A . n 
A 1 385 ARG 385 393  ?    ?   ?   A . n 
A 1 386 PRO 386 394  ?    ?   ?   A . n 
A 1 387 LYS 387 395  ?    ?   ?   A . n 
A 1 388 LEU 388 396  ?    ?   ?   A . n 
A 1 389 GLY 389 397  ?    ?   ?   A . n 
A 1 390 ARG 390 398  ?    ?   ?   A . n 
A 1 391 ARG 391 399  ?    ?   ?   A . n 
A 1 392 HIS 392 400  ?    ?   ?   A . n 
A 1 393 SER 393 401  ?    ?   ?   A . n 
A 1 394 MET 394 402  ?    ?   ?   A . n 
A 1 395 GLU 395 403  ?    ?   ?   A . n 
A 1 396 ASN 396 404  ?    ?   ?   A . n 
A 1 397 MET 397 405  ?    ?   ?   A . n 
A 1 398 GLU 398 406  ?    ?   ?   A . n 
A 1 399 LEU 399 407  ?    ?   ?   A . n 
A 1 400 MET 400 408  ?    ?   ?   A . n 
A 1 401 LYS 401 409  ?    ?   ?   A . n 
A 1 402 LEU 402 410  ?    ?   ?   A . n 
A 1 403 THR 403 411  ?    ?   ?   A . n 
A 1 404 PRO 404 412  ?    ?   ?   A . n 
A 1 405 GLU 405 413  ?    ?   ?   A . n 
A 1 406 LYS 406 414  ?    ?   ?   A . n 
B 2 1   GLY 1   973  ?    ?   ?   B . n 
B 2 2   PRO 2   974  ?    ?   ?   B . n 
B 2 3   LEU 3   975  ?    ?   ?   B . n 
B 2 4   GLY 4   976  ?    ?   ?   B . n 
B 2 5   SER 5   977  ?    ?   ?   B . n 
B 2 6   ASP 6   978  ?    ?   ?   B . n 
B 2 7   LEU 7   979  ?    ?   ?   B . n 
B 2 8   PRO 8   980  ?    ?   ?   B . n 
B 2 9   PRO 9   981  ?    ?   ?   B . n 
B 2 10  LYS 10  982  ?    ?   ?   B . n 
B 2 11  VAL 11  983  ?    ?   ?   B . n 
B 2 12  VAL 12  984  ?    ?   ?   B . n 
B 2 13  PRO 13  985  ?    ?   ?   B . n 
B 2 14  SER 14  986  ?    ?   ?   B . n 
B 2 15  LYS 15  987  ?    ?   ?   B . n 
B 2 16  GLN 16  988  ?    ?   ?   B . n 
B 2 17  LEU 17  989  ?    ?   ?   B . n 
B 2 18  LEU 18  990  ?    ?   ?   B . n 
B 2 19  HIS 19  991  ?    ?   ?   B . n 
B 2 20  SER 20  992  ?    ?   ?   B . n 
B 2 21  ASP 21  993  ?    ?   ?   B . n 
B 2 22  HIS 22  994  994  HIS HIS B . n 
B 2 23  MET 23  995  995  MET MET B . n 
B 2 24  GLU 24  996  996  GLU GLU B . n 
B 2 25  MET 25  997  997  MET MET B . n 
B 2 26  GLU 26  998  998  GLU GLU B . n 
B 2 27  PRO 27  999  999  PRO PRO B . n 
B 2 28  GLU 28  1000 1000 GLU GLU B . n 
B 2 29  THR 29  1001 1001 THR THR B . n 
B 2 30  MET 30  1002 1002 MET MET B . n 
B 2 31  GLU 31  1003 1003 GLU GLU B . n 
B 2 32  THR 32  1004 1004 THR THR B . n 
B 2 33  LYS 33  1005 1005 LYS LYS B . n 
B 2 34  SER 34  1006 1006 SER SER B . n 
B 2 35  VAL 35  1007 1007 VAL VAL B . n 
B 2 36  THR 36  1008 1008 THR THR B . n 
B 2 37  ASP 37  1009 1009 ASP ASP B . n 
B 2 38  TYR 38  1010 1010 TYR TYR B . n 
B 2 39  PHE 39  1011 1011 PHE PHE B . n 
B 2 40  SER 40  1012 ?    ?   ?   B . n 
B 2 41  LYS 41  1013 ?    ?   ?   B . n 
B 2 42  LEU 42  1014 ?    ?   ?   B . n 
B 2 43  HIS 43  1015 ?    ?   ?   B . n 
B 2 44  MET 44  1016 ?    ?   ?   B . n 
B 2 45  GLY 45  1017 ?    ?   ?   B . n 
B 2 46  SER 46  1018 ?    ?   ?   B . n 
B 2 47  VAL 47  1019 ?    ?   ?   B . n 
B 2 48  ALA 48  1020 ?    ?   ?   B . n 
B 2 49  TYR 49  1021 ?    ?   ?   B . n 
B 2 50  SER 50  1022 ?    ?   ?   B . n 
B 2 51  CYS 51  1023 ?    ?   ?   B . n 
B 2 52  THR 52  1024 ?    ?   ?   B . n 
B 2 53  SER 53  1025 ?    ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2660  ? 
1 MORE         -11   ? 
1 'SSA (A^2)'  12990 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-16 
2 'Structure model' 1 1 2020-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Derived calculations'   
3 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' diffrn_source         
2 2 'Structure model' pdbx_struct_oper_list 
3 2 'Structure model' software              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 2 'Structure model' '_software.name'                            
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? 11.0.05  3 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot        ? ? ? 0.7-pre  4 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.7.0029 5 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 70  ? ? -106.48 78.52  
2 1 ASN A 110 ? ? -103.05 72.16  
3 1 ARG A 266 ? ? -49.68  -70.22 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 29  ? CD  ? A LYS 21  CD  
2  1 Y 1 A LYS 29  ? CE  ? A LYS 21  CE  
3  1 Y 1 A LYS 29  ? NZ  ? A LYS 21  NZ  
4  1 Y 1 A ARG 34  ? CZ  ? A ARG 26  CZ  
5  1 Y 1 A ARG 34  ? NH1 ? A ARG 26  NH1 
6  1 Y 1 A ARG 34  ? NH2 ? A ARG 26  NH2 
7  1 Y 1 A TYR 67  ? CD1 ? A TYR 59  CD1 
8  1 Y 1 A TYR 67  ? CD2 ? A TYR 59  CD2 
9  1 Y 1 A TYR 67  ? CE1 ? A TYR 59  CE1 
10 1 Y 1 A TYR 67  ? CE2 ? A TYR 59  CE2 
11 1 Y 1 A TYR 67  ? CZ  ? A TYR 59  CZ  
12 1 Y 1 A TYR 67  ? OH  ? A TYR 59  OH  
13 1 Y 1 A GLN 158 ? CG  ? A GLN 150 CG  
14 1 Y 1 A GLN 158 ? CD  ? A GLN 150 CD  
15 1 Y 1 A GLN 158 ? OE1 ? A GLN 150 OE1 
16 1 Y 1 A GLN 158 ? NE2 ? A GLN 150 NE2 
17 1 Y 1 A ASP 159 ? CG  ? A ASP 151 CG  
18 1 Y 1 A ASP 159 ? OD1 ? A ASP 151 OD1 
19 1 Y 1 A ASP 159 ? OD2 ? A ASP 151 OD2 
20 1 Y 1 A VAL 160 ? CG1 ? A VAL 152 CG1 
21 1 Y 1 A VAL 160 ? CG2 ? A VAL 152 CG2 
22 1 Y 1 A GLU 165 ? OE1 ? A GLU 157 OE1 
23 1 Y 1 A GLU 165 ? OE2 ? A GLU 157 OE2 
24 1 Y 1 A ARG 168 ? CZ  ? A ARG 160 CZ  
25 1 Y 1 A ARG 168 ? NH1 ? A ARG 160 NH1 
26 1 Y 1 A ARG 168 ? NH2 ? A ARG 160 NH2 
27 1 Y 1 A ARG 212 ? CG  ? A ARG 204 CG  
28 1 Y 1 A ARG 212 ? CD  ? A ARG 204 CD  
29 1 Y 1 A ARG 212 ? NE  ? A ARG 204 NE  
30 1 Y 1 A ARG 212 ? CZ  ? A ARG 204 CZ  
31 1 Y 1 A ARG 212 ? NH1 ? A ARG 204 NH1 
32 1 Y 1 A ARG 212 ? NH2 ? A ARG 204 NH2 
33 1 Y 1 A LYS 226 ? CD  ? A LYS 218 CD  
34 1 Y 1 A LYS 226 ? CE  ? A LYS 218 CE  
35 1 Y 1 A LYS 226 ? NZ  ? A LYS 218 NZ  
36 1 Y 1 A LYS 231 ? NZ  ? A LYS 223 NZ  
37 1 Y 1 A PHE 251 ? CE1 ? A PHE 243 CE1 
38 1 Y 1 A PHE 251 ? CE2 ? A PHE 243 CE2 
39 1 Y 1 A PHE 251 ? CZ  ? A PHE 243 CZ  
40 1 Y 1 A GLU 252 ? CG  ? A GLU 244 CG  
41 1 Y 1 A GLU 252 ? CD  ? A GLU 244 CD  
42 1 Y 1 A GLU 252 ? OE1 ? A GLU 244 OE1 
43 1 Y 1 A GLU 252 ? OE2 ? A GLU 244 OE2 
44 1 Y 1 A TYR 258 ? CG  ? A TYR 250 CG  
45 1 Y 1 A TYR 258 ? CD1 ? A TYR 250 CD1 
46 1 Y 1 A TYR 258 ? CD2 ? A TYR 250 CD2 
47 1 Y 1 A TYR 258 ? CE1 ? A TYR 250 CE1 
48 1 Y 1 A TYR 258 ? CE2 ? A TYR 250 CE2 
49 1 Y 1 A TYR 258 ? CZ  ? A TYR 250 CZ  
50 1 Y 1 A TYR 258 ? OH  ? A TYR 250 OH  
51 1 Y 1 A LYS 259 ? CD  ? A LYS 251 CD  
52 1 Y 1 A LYS 259 ? CE  ? A LYS 251 CE  
53 1 Y 1 A LYS 259 ? NZ  ? A LYS 251 NZ  
54 1 Y 1 A LEU 263 ? CG  ? A LEU 255 CG  
55 1 Y 1 A LEU 263 ? CD1 ? A LEU 255 CD1 
56 1 Y 1 A LEU 263 ? CD2 ? A LEU 255 CD2 
57 1 Y 1 A LEU 264 ? CG  ? A LEU 256 CG  
58 1 Y 1 A LEU 264 ? CD1 ? A LEU 256 CD1 
59 1 Y 1 A LEU 264 ? CD2 ? A LEU 256 CD2 
60 1 Y 1 A ARG 266 ? CD  ? A ARG 258 CD  
61 1 Y 1 A ARG 266 ? NE  ? A ARG 258 NE  
62 1 Y 1 A ARG 266 ? CZ  ? A ARG 258 CZ  
63 1 Y 1 A ARG 266 ? NH1 ? A ARG 258 NH1 
64 1 Y 1 A ARG 266 ? NH2 ? A ARG 258 NH2 
65 1 Y 1 A GLN 267 ? CD  ? A GLN 259 CD  
66 1 Y 1 A GLN 267 ? OE1 ? A GLN 259 OE1 
67 1 Y 1 A GLN 267 ? NE2 ? A GLN 259 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 9    ? A GLY 1   
2   1 Y 1 A PRO 10   ? A PRO 2   
3   1 Y 1 A GLY 11   ? A GLY 3   
4   1 Y 1 A GLY 156  ? A GLY 148 
5   1 Y 1 A LEU 268  ? A LEU 260 
6   1 Y 1 A LYS 269  ? A LYS 261 
7   1 Y 1 A ASP 270  ? A ASP 262 
8   1 Y 1 A ARG 271  ? A ARG 263 
9   1 Y 1 A ALA 272  ? A ALA 264 
10  1 Y 1 A VAL 273  ? A VAL 265 
11  1 Y 1 A GLU 274  ? A GLU 266 
12  1 Y 1 A ALA 275  ? A ALA 267 
13  1 Y 1 A GLN 276  ? A GLN 268 
14  1 Y 1 A SER 277  ? A SER 269 
15  1 Y 1 A CYS 278  ? A CYS 270 
16  1 Y 1 A TYR 279  ? A TYR 271 
17  1 Y 1 A SER 280  ? A SER 272 
18  1 Y 1 A LEU 281  ? A LEU 273 
19  1 Y 1 A GLY 282  ? A GLY 274 
20  1 Y 1 A ASN 283  ? A ASN 275 
21  1 Y 1 A THR 284  ? A THR 276 
22  1 Y 1 A TYR 285  ? A TYR 277 
23  1 Y 1 A THR 286  ? A THR 278 
24  1 Y 1 A LEU 287  ? A LEU 279 
25  1 Y 1 A LEU 288  ? A LEU 280 
26  1 Y 1 A GLN 289  ? A GLN 281 
27  1 Y 1 A ASP 290  ? A ASP 282 
28  1 Y 1 A TYR 291  ? A TYR 283 
29  1 Y 1 A GLU 292  ? A GLU 284 
30  1 Y 1 A LYS 293  ? A LYS 285 
31  1 Y 1 A ALA 294  ? A ALA 286 
32  1 Y 1 A ILE 295  ? A ILE 287 
33  1 Y 1 A ASP 296  ? A ASP 288 
34  1 Y 1 A TYR 297  ? A TYR 289 
35  1 Y 1 A HIS 298  ? A HIS 290 
36  1 Y 1 A LEU 299  ? A LEU 291 
37  1 Y 1 A LYS 300  ? A LYS 292 
38  1 Y 1 A HIS 301  ? A HIS 293 
39  1 Y 1 A LEU 302  ? A LEU 294 
40  1 Y 1 A ALA 303  ? A ALA 295 
41  1 Y 1 A ILE 304  ? A ILE 296 
42  1 Y 1 A ALA 305  ? A ALA 297 
43  1 Y 1 A GLN 306  ? A GLN 298 
44  1 Y 1 A GLU 307  ? A GLU 299 
45  1 Y 1 A LEU 308  ? A LEU 300 
46  1 Y 1 A ASN 309  ? A ASN 301 
47  1 Y 1 A ASP 310  ? A ASP 302 
48  1 Y 1 A ARG 311  ? A ARG 303 
49  1 Y 1 A ILE 312  ? A ILE 304 
50  1 Y 1 A GLY 313  ? A GLY 305 
51  1 Y 1 A GLU 314  ? A GLU 306 
52  1 Y 1 A GLY 315  ? A GLY 307 
53  1 Y 1 A ARG 316  ? A ARG 308 
54  1 Y 1 A ALA 317  ? A ALA 309 
55  1 Y 1 A CYS 318  ? A CYS 310 
56  1 Y 1 A TRP 319  ? A TRP 311 
57  1 Y 1 A SER 320  ? A SER 312 
58  1 Y 1 A LEU 321  ? A LEU 313 
59  1 Y 1 A GLY 322  ? A GLY 314 
60  1 Y 1 A ASN 323  ? A ASN 315 
61  1 Y 1 A ALA 324  ? A ALA 316 
62  1 Y 1 A TYR 325  ? A TYR 317 
63  1 Y 1 A THR 326  ? A THR 318 
64  1 Y 1 A ALA 327  ? A ALA 319 
65  1 Y 1 A LEU 328  ? A LEU 320 
66  1 Y 1 A GLY 329  ? A GLY 321 
67  1 Y 1 A ASN 330  ? A ASN 322 
68  1 Y 1 A HIS 331  ? A HIS 323 
69  1 Y 1 A ASP 332  ? A ASP 324 
70  1 Y 1 A GLN 333  ? A GLN 325 
71  1 Y 1 A ALA 334  ? A ALA 326 
72  1 Y 1 A MET 335  ? A MET 327 
73  1 Y 1 A HIS 336  ? A HIS 328 
74  1 Y 1 A PHE 337  ? A PHE 329 
75  1 Y 1 A ALA 338  ? A ALA 330 
76  1 Y 1 A GLU 339  ? A GLU 331 
77  1 Y 1 A LYS 340  ? A LYS 332 
78  1 Y 1 A HIS 341  ? A HIS 333 
79  1 Y 1 A LEU 342  ? A LEU 334 
80  1 Y 1 A GLU 343  ? A GLU 335 
81  1 Y 1 A ILE 344  ? A ILE 336 
82  1 Y 1 A SER 345  ? A SER 337 
83  1 Y 1 A ARG 346  ? A ARG 338 
84  1 Y 1 A GLU 347  ? A GLU 339 
85  1 Y 1 A VAL 348  ? A VAL 340 
86  1 Y 1 A GLY 349  ? A GLY 341 
87  1 Y 1 A ASP 350  ? A ASP 342 
88  1 Y 1 A LYS 351  ? A LYS 343 
89  1 Y 1 A SER 352  ? A SER 344 
90  1 Y 1 A GLY 353  ? A GLY 345 
91  1 Y 1 A GLU 354  ? A GLU 346 
92  1 Y 1 A LEU 355  ? A LEU 347 
93  1 Y 1 A THR 356  ? A THR 348 
94  1 Y 1 A ALA 357  ? A ALA 349 
95  1 Y 1 A ARG 358  ? A ARG 350 
96  1 Y 1 A LEU 359  ? A LEU 351 
97  1 Y 1 A ASN 360  ? A ASN 352 
98  1 Y 1 A LEU 361  ? A LEU 353 
99  1 Y 1 A SER 362  ? A SER 354 
100 1 Y 1 A ASP 363  ? A ASP 355 
101 1 Y 1 A LEU 364  ? A LEU 356 
102 1 Y 1 A GLN 365  ? A GLN 357 
103 1 Y 1 A MET 366  ? A MET 358 
104 1 Y 1 A VAL 367  ? A VAL 359 
105 1 Y 1 A LEU 368  ? A LEU 360 
106 1 Y 1 A GLY 369  ? A GLY 361 
107 1 Y 1 A LEU 370  ? A LEU 362 
108 1 Y 1 A SER 371  ? A SER 363 
109 1 Y 1 A TYR 372  ? A TYR 364 
110 1 Y 1 A SER 373  ? A SER 365 
111 1 Y 1 A THR 374  ? A THR 366 
112 1 Y 1 A ASN 375  ? A ASN 367 
113 1 Y 1 A ASN 376  ? A ASN 368 
114 1 Y 1 A SER 377  ? A SER 369 
115 1 Y 1 A ILE 378  ? A ILE 370 
116 1 Y 1 A MET 379  ? A MET 371 
117 1 Y 1 A SER 380  ? A SER 372 
118 1 Y 1 A GLU 381  ? A GLU 373 
119 1 Y 1 A ASN 382  ? A ASN 374 
120 1 Y 1 A THR 383  ? A THR 375 
121 1 Y 1 A GLU 384  ? A GLU 376 
122 1 Y 1 A ILE 385  ? A ILE 377 
123 1 Y 1 A ASP 386  ? A ASP 378 
124 1 Y 1 A SER 387  ? A SER 379 
125 1 Y 1 A SER 388  ? A SER 380 
126 1 Y 1 A LEU 389  ? A LEU 381 
127 1 Y 1 A ASN 390  ? A ASN 382 
128 1 Y 1 A GLY 391  ? A GLY 383 
129 1 Y 1 A VAL 392  ? A VAL 384 
130 1 Y 1 A ARG 393  ? A ARG 385 
131 1 Y 1 A PRO 394  ? A PRO 386 
132 1 Y 1 A LYS 395  ? A LYS 387 
133 1 Y 1 A LEU 396  ? A LEU 388 
134 1 Y 1 A GLY 397  ? A GLY 389 
135 1 Y 1 A ARG 398  ? A ARG 390 
136 1 Y 1 A ARG 399  ? A ARG 391 
137 1 Y 1 A HIS 400  ? A HIS 392 
138 1 Y 1 A SER 401  ? A SER 393 
139 1 Y 1 A MET 402  ? A MET 394 
140 1 Y 1 A GLU 403  ? A GLU 395 
141 1 Y 1 A ASN 404  ? A ASN 396 
142 1 Y 1 A MET 405  ? A MET 397 
143 1 Y 1 A GLU 406  ? A GLU 398 
144 1 Y 1 A LEU 407  ? A LEU 399 
145 1 Y 1 A MET 408  ? A MET 400 
146 1 Y 1 A LYS 409  ? A LYS 401 
147 1 Y 1 A LEU 410  ? A LEU 402 
148 1 Y 1 A THR 411  ? A THR 403 
149 1 Y 1 A PRO 412  ? A PRO 404 
150 1 Y 1 A GLU 413  ? A GLU 405 
151 1 Y 1 A LYS 414  ? A LYS 406 
152 1 Y 1 B GLY 973  ? B GLY 1   
153 1 Y 1 B PRO 974  ? B PRO 2   
154 1 Y 1 B LEU 975  ? B LEU 3   
155 1 Y 1 B GLY 976  ? B GLY 4   
156 1 Y 1 B SER 977  ? B SER 5   
157 1 Y 1 B ASP 978  ? B ASP 6   
158 1 Y 1 B LEU 979  ? B LEU 7   
159 1 Y 1 B PRO 980  ? B PRO 8   
160 1 Y 1 B PRO 981  ? B PRO 9   
161 1 Y 1 B LYS 982  ? B LYS 10  
162 1 Y 1 B VAL 983  ? B VAL 11  
163 1 Y 1 B VAL 984  ? B VAL 12  
164 1 Y 1 B PRO 985  ? B PRO 13  
165 1 Y 1 B SER 986  ? B SER 14  
166 1 Y 1 B LYS 987  ? B LYS 15  
167 1 Y 1 B GLN 988  ? B GLN 16  
168 1 Y 1 B LEU 989  ? B LEU 17  
169 1 Y 1 B LEU 990  ? B LEU 18  
170 1 Y 1 B HIS 991  ? B HIS 19  
171 1 Y 1 B SER 992  ? B SER 20  
172 1 Y 1 B ASP 993  ? B ASP 21  
173 1 Y 1 B SER 1012 ? B SER 40  
174 1 Y 1 B LYS 1013 ? B LYS 41  
175 1 Y 1 B LEU 1014 ? B LEU 42  
176 1 Y 1 B HIS 1015 ? B HIS 43  
177 1 Y 1 B MET 1016 ? B MET 44  
178 1 Y 1 B GLY 1017 ? B GLY 45  
179 1 Y 1 B SER 1018 ? B SER 46  
180 1 Y 1 B VAL 1019 ? B VAL 47  
181 1 Y 1 B ALA 1020 ? B ALA 48  
182 1 Y 1 B TYR 1021 ? B TYR 49  
183 1 Y 1 B SER 1022 ? B SER 50  
184 1 Y 1 B CYS 1023 ? B CYS 51  
185 1 Y 1 B THR 1024 ? B THR 52  
186 1 Y 1 B SER 1025 ? B SER 53  
#