data_4X8P
# 
_entry.id   4X8P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4X8P         
WWPDB D_1000205251 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          4X8N 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4X8P 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, P.'        1 
'Chaturvedi, C.P.' 2 
'Brunzelle, J.S.'  3 
'Skiniotis, G.'    4 
'Brand, M.'        5 
'Shilatifard, A.'  6 
'Couture, J.-F.'   7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_id_ASTM           GEDEEP 
_citation.journal_id_CSD            2056 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            29 
_citation.language                  ? 
_citation.page_first                123 
_citation.page_last                 128 
_citation.title                     'A phosphorylation switch on RbBP5 regulates histone H3 Lys4 methylation.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1101/gad.254870.114 
_citation.pdbx_database_id_PubMed   25593305 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, P.'        1 
primary 'Chaturvedi, C.P.' 2 
primary 'Tremblay, V.'     3 
primary 'Cramet, M.'       4 
primary 'Brunzelle, J.S.'  5 
primary 'Skiniotis, G.'    6 
primary 'Brand, M.'        7 
primary 'Shilatifard, A.'  8 
primary 'Couture, J.F.'    9 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4X8P 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     51.500 
_cell.length_a_esd                 ? 
_cell.length_b                     59.100 
_cell.length_b_esd                 ? 
_cell.length_c                     70.800 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4X8P 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
'Set1/Ash2 histone methyltransferase complex subunit ASH2,Set1/Ash2 histone methyltransferase complex subunit ASH2' 20409.172 1   
? ? 'UNP residues 380-495, 539-598' ? 
2 polymer     syn 'Retinoblastoma-binding protein 5' 1575.563  1   ? ? 'UNP residues 344-355'          ? 
3 non-polymer syn GLYCEROL 92.094    1   ? ? ?                               ? 
4 water       nat water 18.015    122 ? ? ?                               ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ASH2-like protein,ASH2-like protein'         
2 'RBBP-5,Retinoblastoma-binding protein RBQ-3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SRVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSY
SWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDISGRGSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSI
NFGPCFKYPPKDLTYRPMSDMG
;
;SRVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSY
SWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDISGRGSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSI
NFGPCFKYPPKDLTYRPMSDMG
;
A ? 
2 'polypeptide(L)' no no EYEERESEFDIE EYEERESEFDIE B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ARG n 
1 3   VAL n 
1 4   LEU n 
1 5   LEU n 
1 6   ALA n 
1 7   LEU n 
1 8   HIS n 
1 9   ASP n 
1 10  ARG n 
1 11  ALA n 
1 12  PRO n 
1 13  GLN n 
1 14  LEU n 
1 15  LYS n 
1 16  ILE n 
1 17  SER n 
1 18  ASP n 
1 19  ASP n 
1 20  ARG n 
1 21  LEU n 
1 22  THR n 
1 23  VAL n 
1 24  VAL n 
1 25  GLY n 
1 26  GLU n 
1 27  LYS n 
1 28  GLY n 
1 29  TYR n 
1 30  SER n 
1 31  MET n 
1 32  VAL n 
1 33  ARG n 
1 34  ALA n 
1 35  SER n 
1 36  HIS n 
1 37  GLY n 
1 38  VAL n 
1 39  ARG n 
1 40  LYS n 
1 41  GLY n 
1 42  ALA n 
1 43  TRP n 
1 44  TYR n 
1 45  PHE n 
1 46  GLU n 
1 47  ILE n 
1 48  THR n 
1 49  VAL n 
1 50  ASP n 
1 51  GLU n 
1 52  MET n 
1 53  PRO n 
1 54  PRO n 
1 55  ASP n 
1 56  THR n 
1 57  ALA n 
1 58  ALA n 
1 59  ARG n 
1 60  LEU n 
1 61  GLY n 
1 62  TRP n 
1 63  SER n 
1 64  GLN n 
1 65  PRO n 
1 66  LEU n 
1 67  GLY n 
1 68  ASN n 
1 69  LEU n 
1 70  GLN n 
1 71  ALA n 
1 72  PRO n 
1 73  LEU n 
1 74  GLY n 
1 75  TYR n 
1 76  ASP n 
1 77  LYS n 
1 78  PHE n 
1 79  SER n 
1 80  TYR n 
1 81  SER n 
1 82  TRP n 
1 83  ARG n 
1 84  SER n 
1 85  LYS n 
1 86  LYS n 
1 87  GLY n 
1 88  THR n 
1 89  LYS n 
1 90  PHE n 
1 91  HIS n 
1 92  GLN n 
1 93  SER n 
1 94  ILE n 
1 95  GLY n 
1 96  LYS n 
1 97  HIS n 
1 98  TYR n 
1 99  SER n 
1 100 SER n 
1 101 GLY n 
1 102 TYR n 
1 103 GLY n 
1 104 GLN n 
1 105 GLY n 
1 106 ASP n 
1 107 VAL n 
1 108 LEU n 
1 109 GLY n 
1 110 PHE n 
1 111 TYR n 
1 112 ILE n 
1 113 ASN n 
1 114 LEU n 
1 115 PRO n 
1 116 GLU n 
1 117 ASP n 
1 118 ILE n 
1 119 SER n 
1 120 GLY n 
1 121 ARG n 
1 122 GLY n 
1 123 SER n 
1 124 GLU n 
1 125 ILE n 
1 126 ILE n 
1 127 PHE n 
1 128 TYR n 
1 129 LYS n 
1 130 ASN n 
1 131 GLY n 
1 132 VAL n 
1 133 ASN n 
1 134 GLN n 
1 135 GLY n 
1 136 VAL n 
1 137 ALA n 
1 138 TYR n 
1 139 LYS n 
1 140 ASP n 
1 141 ILE n 
1 142 PHE n 
1 143 GLU n 
1 144 GLY n 
1 145 VAL n 
1 146 TYR n 
1 147 PHE n 
1 148 PRO n 
1 149 ALA n 
1 150 ILE n 
1 151 SER n 
1 152 LEU n 
1 153 TYR n 
1 154 LYS n 
1 155 SER n 
1 156 CYS n 
1 157 THR n 
1 158 VAL n 
1 159 SER n 
1 160 ILE n 
1 161 ASN n 
1 162 PHE n 
1 163 GLY n 
1 164 PRO n 
1 165 CYS n 
1 166 PHE n 
1 167 LYS n 
1 168 TYR n 
1 169 PRO n 
1 170 PRO n 
1 171 LYS n 
1 172 ASP n 
1 173 LEU n 
1 174 THR n 
1 175 TYR n 
1 176 ARG n 
1 177 PRO n 
1 178 MET n 
1 179 SER n 
1 180 ASP n 
1 181 MET n 
1 182 GLY n 
2 1   GLU n 
2 2   TYR n 
2 3   GLU n 
2 4   GLU n 
2 5   ARG n 
2 6   GLU n 
2 7   SER n 
2 8   GLU n 
2 9   PHE n 
2 10  ASP n 
2 11  ILE n 
2 12  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 2   117 Human ? 'ASH2L, ASH2L1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 123 182 Human ? 'ASH2L, ASH2L1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       12 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ASH2L_HUMAN Q9UBL3 ? 1 
;RVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYS
WRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPED
;
380 
2 UNP ASH2L_HUMAN Q9UBL3 ? 1 SEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMG 539 
3 UNP RBBP5_HUMAN Q15291 ? 2 EYEERESEFDIE 344 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4X8P A 2   ? 117 ? Q9UBL3 380 ? 495 ? 286 401 
2 2 4X8P A 123 ? 182 ? Q9UBL3 539 ? 598 ? 445 504 
3 3 4X8P B 1   ? 12  ? Q15291 344 ? 355 ? 344 355 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4X8P SER A 1   ? UNP Q9UBL3 ? ? 'expression tag' 285 1 
1 4X8P ILE A 118 ? UNP Q9UBL3 ? ? linker           440 2 
1 4X8P SER A 119 ? UNP Q9UBL3 ? ? linker           441 3 
1 4X8P GLY A 120 ? UNP Q9UBL3 ? ? linker           442 4 
1 4X8P ARG A 121 ? UNP Q9UBL3 ? ? linker           443 5 
1 4X8P GLY A 122 ? UNP Q9UBL3 ? ? linker           444 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4X8P 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.45 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.81 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M magnesium chloride hexahydrate, 0.1 M BIS-TRIS, pH 5.5, 25% w/v polyethylene glycol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV++' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-03-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'Cu FINE FOCUS' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            25.54 
_reflns.entry_id                         4X8P 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.2 
_reflns.d_resolution_low                 29.6 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       11628 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            -0.7524 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -0.8622 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            1.6147 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               16.23 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.9168 
_refine.correlation_coeff_Fo_to_Fc_free          0.8840 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4X8P 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.20 
_refine.ls_d_res_low                             29.17 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     11232 
_refine.ls_number_reflns_R_free                  537 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.19 
_refine.ls_percent_reflns_R_free                 4.78 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2223 
_refine.ls_R_factor_R_free                       0.2710 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2199 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.227 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.233 
_refine.pdbx_overall_SU_R_Blow_DPI               0.311 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.282 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        4X8P 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.282 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1483 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             122 
_refine_hist.number_atoms_total               1611 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        29.17 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 1530 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.05  ? 2068 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 504  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 31   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 224  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1530 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 3.61  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 16.01 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 186  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 1862 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.41 
_refine_ls_shell.number_reflns_all                2628 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             130 
_refine_ls_shell.number_reflns_R_work             2498 
_refine_ls_shell.percent_reflns_obs               98.19 
_refine_ls_shell.percent_reflns_R_free            4.95 
_refine_ls_shell.R_factor_all                     0.2671 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3554 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2629 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     4X8P 
_struct.title                        'Crystal structure of Ash2L SPRY domain in complex with RbBP5' 
_struct.pdbx_descriptor              'Ash2L, Retinoblastoma-binding protein 5' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4X8P 
_struct_keywords.text            'histone, MLL1, epigenetics, PROTEIN BINDING' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       AA1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        179 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        182 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         501 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         504 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           163 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            485 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    164 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     486 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.86 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 7 ? 
AA3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 5   ? ARG A 10  ? LEU A 289 ARG A 294 
AA1 2 SER A 30  ? ALA A 34  ? SER A 314 ALA A 318 
AA1 3 PHE A 147 ? TYR A 153 ? PHE A 469 TYR A 475 
AA1 4 ALA A 57  ? SER A 63  ? ALA A 341 SER A 347 
AA1 5 SER A 79  ? ARG A 83  ? SER A 363 ARG A 367 
AA1 6 LYS A 89  ? HIS A 91  ? LYS A 373 HIS A 375 
AA1 7 ILE A 94  ? LYS A 96  ? ILE A 378 LYS A 380 
AA2 1 LYS A 15  ? ILE A 16  ? LYS A 299 ILE A 300 
AA2 2 THR A 22  ? VAL A 24  ? THR A 306 VAL A 308 
AA2 3 THR A 157 ? ASN A 161 ? THR A 479 ASN A 483 
AA2 4 GLY A 41  ? GLU A 51  ? GLY A 325 GLU A 335 
AA2 5 VAL A 107 ? LEU A 114 ? VAL A 391 LEU A 398 
AA2 6 GLU A 124 ? LYS A 129 ? GLU A 446 LYS A 451 
AA2 7 VAL A 132 ? LYS A 139 ? VAL A 454 LYS A 461 
AA3 1 LYS A 15  ? ILE A 16  ? LYS A 299 ILE A 300 
AA3 2 THR A 22  ? VAL A 24  ? THR A 306 VAL A 308 
AA3 3 THR A 157 ? ASN A 161 ? THR A 479 ASN A 483 
AA3 4 GLY A 41  ? GLU A 51  ? GLY A 325 GLU A 335 
AA3 5 ARG A 176 ? PRO A 177 ? ARG A 498 PRO A 499 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 6   ? N ALA A 290 O ARG A 33  ? O ARG A 317 
AA1 2 3 N VAL A 32  ? N VAL A 316 O ILE A 150 ? O ILE A 472 
AA1 3 4 O TYR A 153 ? O TYR A 475 N ALA A 57  ? N ALA A 341 
AA1 4 5 N TRP A 62  ? N TRP A 346 O TYR A 80  ? O TYR A 364 
AA1 5 6 N SER A 81  ? N SER A 365 O PHE A 90  ? O PHE A 374 
AA1 6 7 N LYS A 89  ? N LYS A 373 O LYS A 96  ? O LYS A 380 
AA2 1 2 N LYS A 15  ? N LYS A 299 O VAL A 24  ? O VAL A 308 
AA2 2 3 N VAL A 23  ? N VAL A 307 O VAL A 158 ? O VAL A 480 
AA2 3 4 O SER A 159 ? O SER A 481 N THR A 48  ? N THR A 332 
AA2 4 5 N ILE A 47  ? N ILE A 331 O LEU A 108 ? O LEU A 392 
AA2 5 6 N TYR A 111 ? N TYR A 395 O ILE A 126 ? O ILE A 448 
AA2 6 7 N PHE A 127 ? N PHE A 449 O GLN A 134 ? O GLN A 456 
AA3 1 2 N LYS A 15  ? N LYS A 299 O VAL A 24  ? O VAL A 308 
AA3 2 3 N VAL A 23  ? N VAL A 307 O VAL A 158 ? O VAL A 480 
AA3 3 4 O SER A 159 ? O SER A 481 N THR A 48  ? N THR A 332 
AA3 4 5 N ALA A 42  ? N ALA A 326 O ARG A 176 ? O ARG A 498 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    B 
_struct_site.pdbx_auth_comp_id    GOL 
_struct_site.pdbx_auth_seq_id     401 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue GOL B 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 ARG A 20 ? ARG A 304 . ? 4_555 ? 
2 AC1 6 HOH D .  ? HOH A 620 . ? 4_555 ? 
3 AC1 6 GLU B 8  ? GLU B 351 . ? 1_555 ? 
4 AC1 6 PHE B 9  ? PHE B 352 . ? 1_555 ? 
5 AC1 6 HOH E .  ? HOH B 502 . ? 1_555 ? 
6 AC1 6 HOH E .  ? HOH B 505 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4X8P 
_atom_sites.fract_transf_matrix[1][1]   0.019417 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016920 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014124 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? -14.259 14.299  20.441  1.00 30.20 ? 285 SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? -13.330 14.576  19.338  1.00 30.62 ? 285 SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? -12.374 13.384  19.135  1.00 32.40 ? 285 SER A C   1 
ATOM   4    O O   . SER A 1 1   ? -11.722 12.924  20.076  1.00 31.97 ? 285 SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? -12.561 15.876  19.570  1.00 35.90 ? 285 SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? -11.658 16.187  18.516  1.00 46.06 ? 285 SER A OG  1 
ATOM   7    N N   . ARG A 1 2   ? -12.337 12.872  17.901  1.00 25.41 ? 286 ARG A N   1 
ATOM   8    C CA  . ARG A 1 2   ? -11.571 11.691  17.513  1.00 23.34 ? 286 ARG A CA  1 
ATOM   9    C C   . ARG A 1 2   ? -10.290 12.041  16.764  1.00 22.22 ? 286 ARG A C   1 
ATOM   10   O O   . ARG A 1 2   ? -10.227 13.069  16.092  1.00 21.57 ? 286 ARG A O   1 
ATOM   11   C CB  . ARG A 1 2   ? -12.464 10.775  16.641  1.00 22.50 ? 286 ARG A CB  1 
ATOM   12   N N   . VAL A 1 3   ? -9.270  11.178  16.891  1.00 15.76 ? 287 VAL A N   1 
ATOM   13   C CA  . VAL A 1 3   ? -8.001  11.277  16.164  1.00 13.92 ? 287 VAL A CA  1 
ATOM   14   C C   . VAL A 1 3   ? -8.308  10.603  14.808  1.00 16.07 ? 287 VAL A C   1 
ATOM   15   O O   . VAL A 1 3   ? -8.870  9.497   14.774  1.00 14.32 ? 287 VAL A O   1 
ATOM   16   C CB  . VAL A 1 3   ? -6.797  10.626  16.926  1.00 16.89 ? 287 VAL A CB  1 
ATOM   17   C CG1 . VAL A 1 3   ? -5.470  10.869  16.190  1.00 16.11 ? 287 VAL A CG1 1 
ATOM   18   C CG2 . VAL A 1 3   ? -6.701  11.151  18.356  1.00 16.31 ? 287 VAL A CG2 1 
ATOM   19   N N   . LEU A 1 4   ? -8.067  11.328  13.701  1.00 11.88 ? 288 LEU A N   1 
ATOM   20   C CA  . LEU A 1 4   ? -8.398  10.858  12.357  1.00 11.37 ? 288 LEU A CA  1 
ATOM   21   C C   . LEU A 1 4   ? -7.315  11.250  11.355  1.00 16.76 ? 288 LEU A C   1 
ATOM   22   O O   . LEU A 1 4   ? -6.408  11.999  11.701  1.00 16.46 ? 288 LEU A O   1 
ATOM   23   C CB  . LEU A 1 4   ? -9.744  11.494  11.906  1.00 11.20 ? 288 LEU A CB  1 
ATOM   24   C CG  . LEU A 1 4   ? -10.987 11.302  12.804  1.00 14.98 ? 288 LEU A CG  1 
ATOM   25   C CD1 . LEU A 1 4   ? -12.031 12.380  12.536  1.00 13.66 ? 288 LEU A CD1 1 
ATOM   26   C CD2 . LEU A 1 4   ? -11.576 9.882   12.659  1.00 14.81 ? 288 LEU A CD2 1 
ATOM   27   N N   . LEU A 1 5   ? -7.410  10.762  10.110  1.00 13.64 ? 289 LEU A N   1 
ATOM   28   C CA  . LEU A 1 5   ? -6.518  11.232  9.047   1.00 13.10 ? 289 LEU A CA  1 
ATOM   29   C C   . LEU A 1 5   ? -6.951  12.671  8.782   1.00 14.75 ? 289 LEU A C   1 
ATOM   30   O O   . LEU A 1 5   ? -8.159  12.937  8.749   1.00 12.29 ? 289 LEU A O   1 
ATOM   31   C CB  . LEU A 1 5   ? -6.614  10.369  7.779   1.00 12.94 ? 289 LEU A CB  1 
ATOM   32   C CG  . LEU A 1 5   ? -6.036  8.936   7.946   1.00 18.05 ? 289 LEU A CG  1 
ATOM   33   C CD1 . LEU A 1 5   ? -6.291  8.087   6.706   1.00 17.63 ? 289 LEU A CD1 1 
ATOM   34   C CD2 . LEU A 1 5   ? -4.528  8.959   8.361   1.00 16.27 ? 289 LEU A CD2 1 
ATOM   35   N N   . ALA A 1 6   ? -5.982  13.618  8.760   1.00 12.53 ? 290 ALA A N   1 
ATOM   36   C CA  . ALA A 1 6   ? -6.289  15.048  8.595   1.00 12.20 ? 290 ALA A CA  1 
ATOM   37   C C   . ALA A 1 6   ? -6.734  15.416  7.179   1.00 15.51 ? 290 ALA A C   1 
ATOM   38   O O   . ALA A 1 6   ? -5.994  15.175  6.219   1.00 15.86 ? 290 ALA A O   1 
ATOM   39   C CB  . ALA A 1 6   ? -5.098  15.905  9.009   1.00 12.89 ? 290 ALA A CB  1 
ATOM   40   N N   . LEU A 1 7   ? -7.927  16.039  7.061   1.00 10.63 ? 291 LEU A N   1 
ATOM   41   C CA  . LEU A 1 7   ? -8.455  16.535  5.792   1.00 10.57 ? 291 LEU A CA  1 
ATOM   42   C C   . LEU A 1 7   ? -7.629  17.743  5.294   1.00 14.06 ? 291 LEU A C   1 
ATOM   43   O O   . LEU A 1 7   ? -7.428  17.892  4.093   1.00 12.72 ? 291 LEU A O   1 
ATOM   44   C CB  . LEU A 1 7   ? -9.947  16.912  5.917   1.00 11.63 ? 291 LEU A CB  1 
ATOM   45   C CG  . LEU A 1 7   ? -10.995 15.765  5.983   1.00 15.89 ? 291 LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 7   ? -12.391 16.319  6.268   1.00 16.04 ? 291 LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 7   ? -11.068 15.015  4.675   1.00 18.09 ? 291 LEU A CD2 1 
ATOM   48   N N   . HIS A 1 8   ? -7.095  18.555  6.234   1.00 10.32 ? 292 HIS A N   1 
ATOM   49   C CA  . HIS A 1 8   ? -6.290  19.738  5.969   1.00 10.26 ? 292 HIS A CA  1 
ATOM   50   C C   . HIS A 1 8   ? -4.809  19.463  5.686   1.00 15.56 ? 292 HIS A C   1 
ATOM   51   O O   . HIS A 1 8   ? -4.135  20.342  5.165   1.00 15.26 ? 292 HIS A O   1 
ATOM   52   C CB  . HIS A 1 8   ? -6.351  20.685  7.183   1.00 10.33 ? 292 HIS A CB  1 
ATOM   53   C CG  . HIS A 1 8   ? -7.722  21.175  7.531   1.00 13.36 ? 292 HIS A CG  1 
ATOM   54   N ND1 . HIS A 1 8   ? -8.497  21.880  6.622   1.00 14.16 ? 292 HIS A ND1 1 
ATOM   55   C CD2 . HIS A 1 8   ? -8.392  21.090  8.702   1.00 14.54 ? 292 HIS A CD2 1 
ATOM   56   C CE1 . HIS A 1 8   ? -9.593  22.212  7.275   1.00 13.66 ? 292 HIS A CE1 1 
ATOM   57   N NE2 . HIS A 1 8   ? -9.589  21.736  8.518   1.00 14.17 ? 292 HIS A NE2 1 
ATOM   58   N N   . ASP A 1 9   ? -4.289  18.310  6.122   1.00 10.88 ? 293 ASP A N   1 
ATOM   59   C CA  . ASP A 1 9   ? -2.858  17.991  6.088   1.00 9.60  ? 293 ASP A CA  1 
ATOM   60   C C   . ASP A 1 9   ? -2.578  16.675  5.359   1.00 13.54 ? 293 ASP A C   1 
ATOM   61   O O   . ASP A 1 9   ? -2.153  15.675  5.954   1.00 12.38 ? 293 ASP A O   1 
ATOM   62   C CB  . ASP A 1 9   ? -2.379  17.956  7.545   1.00 10.66 ? 293 ASP A CB  1 
ATOM   63   C CG  . ASP A 1 9   ? -0.918  18.137  7.783   1.00 12.66 ? 293 ASP A CG  1 
ATOM   64   O OD1 . ASP A 1 9   ? -0.248  18.749  6.924   1.00 14.09 ? 293 ASP A OD1 1 
ATOM   65   O OD2 . ASP A 1 9   ? -0.430  17.659  8.827   1.00 16.20 ? 293 ASP A OD2 1 
ATOM   66   N N   . ARG A 1 10  ? -2.815  16.703  4.045   1.00 10.98 ? 294 ARG A N   1 
ATOM   67   C CA  . ARG A 1 10  ? -2.694  15.563  3.153   1.00 11.50 ? 294 ARG A CA  1 
ATOM   68   C C   . ARG A 1 10  ? -2.349  15.992  1.745   1.00 16.22 ? 294 ARG A C   1 
ATOM   69   O O   . ARG A 1 10  ? -2.600  17.140  1.364   1.00 14.95 ? 294 ARG A O   1 
ATOM   70   C CB  . ARG A 1 10  ? -4.042  14.782  3.110   1.00 8.97  ? 294 ARG A CB  1 
ATOM   71   C CG  . ARG A 1 10  ? -5.224  15.594  2.618   1.00 12.54 ? 294 ARG A CG  1 
ATOM   72   C CD  . ARG A 1 10  ? -6.539  14.870  2.775   1.00 12.27 ? 294 ARG A CD  1 
ATOM   73   N NE  . ARG A 1 10  ? -7.653  15.804  2.612   1.00 17.68 ? 294 ARG A NE  1 
ATOM   74   C CZ  . ARG A 1 10  ? -8.552  15.773  1.634   1.00 21.10 ? 294 ARG A CZ  1 
ATOM   75   N NH1 . ARG A 1 10  ? -8.498  14.830  0.699   1.00 8.90  ? 294 ARG A NH1 1 
ATOM   76   N NH2 . ARG A 1 10  ? -9.522  16.675  1.591   1.00 5.87  ? 294 ARG A NH2 1 
ATOM   77   N N   . ALA A 1 11  ? -1.831  15.038  0.949   1.00 12.49 ? 295 ALA A N   1 
ATOM   78   C CA  . ALA A 1 11  ? -1.607  15.246  -0.475  1.00 11.47 ? 295 ALA A CA  1 
ATOM   79   C C   . ALA A 1 11  ? -2.983  15.110  -1.158  1.00 13.25 ? 295 ALA A C   1 
ATOM   80   O O   . ALA A 1 11  ? -3.736  14.195  -0.816  1.00 10.25 ? 295 ALA A O   1 
ATOM   81   C CB  . ALA A 1 11  ? -0.660  14.199  -1.021  1.00 11.91 ? 295 ALA A CB  1 
ATOM   82   N N   . PRO A 1 12  ? -3.328  16.039  -2.086  1.00 11.91 ? 296 PRO A N   1 
ATOM   83   C CA  . PRO A 1 12  ? -4.643  15.968  -2.781  1.00 11.94 ? 296 PRO A CA  1 
ATOM   84   C C   . PRO A 1 12  ? -4.980  14.697  -3.577  1.00 16.16 ? 296 PRO A C   1 
ATOM   85   O O   . PRO A 1 12  ? -6.163  14.433  -3.813  1.00 15.46 ? 296 PRO A O   1 
ATOM   86   C CB  . PRO A 1 12  ? -4.612  17.164  -3.740  1.00 13.81 ? 296 PRO A CB  1 
ATOM   87   C CG  . PRO A 1 12  ? -3.154  17.579  -3.837  1.00 18.19 ? 296 PRO A CG  1 
ATOM   88   C CD  . PRO A 1 12  ? -2.523  17.198  -2.538  1.00 12.94 ? 296 PRO A CD  1 
ATOM   89   N N   . GLN A 1 13  ? -3.959  13.970  -4.074  1.00 12.32 ? 297 GLN A N   1 
ATOM   90   C CA  . GLN A 1 13  ? -4.159  12.781  -4.904  1.00 12.32 ? 297 GLN A CA  1 
ATOM   91   C C   . GLN A 1 13  ? -4.621  11.536  -4.114  1.00 16.13 ? 297 GLN A C   1 
ATOM   92   O O   . GLN A 1 13  ? -5.270  10.666  -4.685  1.00 14.33 ? 297 GLN A O   1 
ATOM   93   C CB  . GLN A 1 13  ? -2.929  12.486  -5.814  1.00 13.47 ? 297 GLN A CB  1 
ATOM   94   C CG  . GLN A 1 13  ? -1.612  12.163  -5.076  1.00 12.33 ? 297 GLN A CG  1 
ATOM   95   C CD  . GLN A 1 13  ? -0.786  13.396  -4.829  1.00 14.87 ? 297 GLN A CD  1 
ATOM   96   O OE1 . GLN A 1 13  ? -1.286  14.435  -4.407  1.00 13.09 ? 297 GLN A OE1 1 
ATOM   97   N NE2 . GLN A 1 13  ? 0.500   13.330  -5.127  1.00 8.00  ? 297 GLN A NE2 1 
ATOM   98   N N   . LEU A 1 14  ? -4.301  11.474  -2.805  1.00 13.06 ? 298 LEU A N   1 
ATOM   99   C CA  . LEU A 1 14  ? -4.694  10.371  -1.937  1.00 11.97 ? 298 LEU A CA  1 
ATOM   100  C C   . LEU A 1 14  ? -6.193  10.311  -1.783  1.00 17.19 ? 298 LEU A C   1 
ATOM   101  O O   . LEU A 1 14  ? -6.877  11.340  -1.752  1.00 16.67 ? 298 LEU A O   1 
ATOM   102  C CB  . LEU A 1 14  ? -4.043  10.460  -0.546  1.00 11.02 ? 298 LEU A CB  1 
ATOM   103  C CG  . LEU A 1 14  ? -2.533  10.377  -0.475  1.00 14.31 ? 298 LEU A CG  1 
ATOM   104  C CD1 . LEU A 1 14  ? -2.053  10.762  0.902   1.00 14.75 ? 298 LEU A CD1 1 
ATOM   105  C CD2 . LEU A 1 14  ? -2.029  8.982   -0.850  1.00 13.16 ? 298 LEU A CD2 1 
ATOM   106  N N   . LYS A 1 15  ? -6.706  9.095   -1.708  1.00 14.23 ? 299 LYS A N   1 
ATOM   107  C CA  . LYS A 1 15  ? -8.132  8.905   -1.560  1.00 13.91 ? 299 LYS A CA  1 
ATOM   108  C C   . LYS A 1 15  ? -8.431  8.511   -0.109  1.00 17.79 ? 299 LYS A C   1 
ATOM   109  O O   . LYS A 1 15  ? -8.111  7.402   0.315   1.00 17.11 ? 299 LYS A O   1 
ATOM   110  C CB  . LYS A 1 15  ? -8.660  7.900   -2.611  1.00 15.82 ? 299 LYS A CB  1 
ATOM   111  C CG  . LYS A 1 15  ? -8.529  8.448   -4.062  1.00 18.83 ? 299 LYS A CG  1 
ATOM   112  C CD  . LYS A 1 15  ? -8.131  7.376   -5.076  1.00 31.52 ? 299 LYS A CD  1 
ATOM   113  C CE  . LYS A 1 15  ? -6.638  7.186   -5.230  1.00 34.20 ? 299 LYS A CE  1 
ATOM   114  N NZ  . LYS A 1 15  ? -6.317  6.019   -6.104  1.00 34.46 ? 299 LYS A NZ  1 
ATOM   115  N N   . ILE A 1 16  ? -9.017  9.451   0.643   1.00 15.18 ? 300 ILE A N   1 
ATOM   116  C CA  . ILE A 1 16  ? -9.395  9.285   2.049   1.00 15.19 ? 300 ILE A CA  1 
ATOM   117  C C   . ILE A 1 16  ? -10.863 8.902   2.176   1.00 16.99 ? 300 ILE A C   1 
ATOM   118  O O   . ILE A 1 16  ? -11.718 9.497   1.522   1.00 17.42 ? 300 ILE A O   1 
ATOM   119  C CB  . ILE A 1 16  ? -8.928  10.485  2.955   1.00 18.78 ? 300 ILE A CB  1 
ATOM   120  C CG1 . ILE A 1 16  ? -7.378  10.453  3.150   1.00 20.13 ? 300 ILE A CG1 1 
ATOM   121  C CG2 . ILE A 1 16  ? -9.590  10.460  4.355   1.00 16.87 ? 300 ILE A CG2 1 
ATOM   122  C CD1 . ILE A 1 16  ? -6.628  11.298  2.289   1.00 31.32 ? 300 ILE A CD1 1 
ATOM   123  N N   . SER A 1 17  ? -11.141 7.849   2.961   1.00 12.71 ? 301 SER A N   1 
ATOM   124  C CA  . SER A 1 17  ? -12.496 7.348   3.193   1.00 12.80 ? 301 SER A CA  1 
ATOM   125  C C   . SER A 1 17  ? -13.335 8.356   3.975   1.00 15.14 ? 301 SER A C   1 
ATOM   126  O O   . SER A 1 17  ? -12.780 9.208   4.658   1.00 16.57 ? 301 SER A O   1 
ATOM   127  C CB  . SER A 1 17  ? -12.439 6.018   3.946   1.00 14.83 ? 301 SER A CB  1 
ATOM   128  O OG  . SER A 1 17  ? -11.909 6.212   5.247   1.00 12.09 ? 301 SER A OG  1 
ATOM   129  N N   . ASP A 1 18  ? -14.657 8.256   3.888   1.00 10.91 ? 302 ASP A N   1 
ATOM   130  C CA  . ASP A 1 18  ? -15.602 9.124   4.615   1.00 10.84 ? 302 ASP A CA  1 
ATOM   131  C C   . ASP A 1 18  ? -15.343 9.131   6.120   1.00 15.84 ? 302 ASP A C   1 
ATOM   132  O O   . ASP A 1 18  ? -15.404 10.204  6.734   1.00 15.54 ? 302 ASP A O   1 
ATOM   133  C CB  . ASP A 1 18  ? -17.065 8.741   4.312   1.00 11.79 ? 302 ASP A CB  1 
ATOM   134  C CG  . ASP A 1 18  ? -17.482 8.820   2.833   1.00 19.86 ? 302 ASP A CG  1 
ATOM   135  O OD1 . ASP A 1 18  ? -16.680 9.306   2.004   1.00 18.39 ? 302 ASP A OD1 1 
ATOM   136  O OD2 . ASP A 1 18  ? -18.611 8.396   2.511   1.00 24.75 ? 302 ASP A OD2 1 
ATOM   137  N N   . ASP A 1 19  ? -14.978 7.952   6.704   1.00 12.40 ? 303 ASP A N   1 
ATOM   138  C CA  . ASP A 1 19  ? -14.675 7.857   8.138   1.00 12.97 ? 303 ASP A CA  1 
ATOM   139  C C   . ASP A 1 19  ? -13.294 8.399   8.486   1.00 16.65 ? 303 ASP A C   1 
ATOM   140  O O   . ASP A 1 19  ? -13.002 8.497   9.667   1.00 16.02 ? 303 ASP A O   1 
ATOM   141  C CB  . ASP A 1 19  ? -14.889 6.420   8.708   1.00 14.89 ? 303 ASP A CB  1 
ATOM   142  C CG  . ASP A 1 19  ? -13.925 5.336   8.244   1.00 16.91 ? 303 ASP A CG  1 
ATOM   143  O OD1 . ASP A 1 19  ? -13.025 5.637   7.440   1.00 15.90 ? 303 ASP A OD1 1 
ATOM   144  O OD2 . ASP A 1 19  ? -14.087 4.187   8.667   1.00 22.43 ? 303 ASP A OD2 1 
ATOM   145  N N   . ARG A 1 20  ? -12.441 8.745   7.460   1.00 12.94 ? 304 ARG A N   1 
ATOM   146  C CA  . ARG A 1 20  ? -11.076 9.294   7.618   1.00 11.88 ? 304 ARG A CA  1 
ATOM   147  C C   . ARG A 1 20  ? -10.116 8.348   8.363   1.00 15.21 ? 304 ARG A C   1 
ATOM   148  O O   . ARG A 1 20  ? -9.210  8.791   9.083   1.00 14.24 ? 304 ARG A O   1 
ATOM   149  C CB  . ARG A 1 20  ? -11.120 10.670  8.299   1.00 11.97 ? 304 ARG A CB  1 
ATOM   150  C CG  . ARG A 1 20  ? -11.877 11.747  7.496   1.00 18.28 ? 304 ARG A CG  1 
ATOM   151  C CD  . ARG A 1 20  ? -12.134 12.963  8.354   1.00 14.57 ? 304 ARG A CD  1 
ATOM   152  N NE  . ARG A 1 20  ? -10.889 13.476  8.933   1.00 15.32 ? 304 ARG A NE  1 
ATOM   153  C CZ  . ARG A 1 20  ? -10.818 14.535  9.729   1.00 29.09 ? 304 ARG A CZ  1 
ATOM   154  N NH1 . ARG A 1 20  ? -11.917 15.201  10.057  1.00 11.96 ? 304 ARG A NH1 1 
ATOM   155  N NH2 . ARG A 1 20  ? -9.644  14.939  10.204  1.00 19.38 ? 304 ARG A NH2 1 
ATOM   156  N N   . LEU A 1 21  ? -10.316 7.035   8.179   1.00 11.98 ? 305 LEU A N   1 
ATOM   157  C CA  . LEU A 1 21  ? -9.493  5.992   8.805   1.00 10.65 ? 305 LEU A CA  1 
ATOM   158  C C   . LEU A 1 21  ? -8.847  5.103   7.753   1.00 15.51 ? 305 LEU A C   1 
ATOM   159  O O   . LEU A 1 21  ? -7.946  4.325   8.078   1.00 17.16 ? 305 LEU A O   1 
ATOM   160  C CB  . LEU A 1 21  ? -10.344 5.151   9.772   1.00 9.55  ? 305 LEU A CB  1 
ATOM   161  C CG  . LEU A 1 21  ? -10.793 5.832   11.067  1.00 13.54 ? 305 LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 21  ? -11.694 4.884   11.884  1.00 14.00 ? 305 LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 21  ? -9.589  6.299   11.915  1.00 13.25 ? 305 LEU A CD2 1 
ATOM   164  N N   . THR A 1 22  ? -9.308  5.215   6.500   1.00 10.93 ? 306 THR A N   1 
ATOM   165  C CA  . THR A 1 22  ? -8.798  4.438   5.375   1.00 11.28 ? 306 THR A CA  1 
ATOM   166  C C   . THR A 1 22  ? -8.238  5.342   4.272   1.00 14.80 ? 306 THR A C   1 
ATOM   167  O O   . THR A 1 22  ? -8.797  6.389   3.970   1.00 12.88 ? 306 THR A O   1 
ATOM   168  C CB  . THR A 1 22  ? -9.844  3.402   4.891   1.00 16.77 ? 306 THR A CB  1 
ATOM   169  O OG1 . THR A 1 22  ? -10.157 2.511   5.957   1.00 11.50 ? 306 THR A OG1 1 
ATOM   170  C CG2 . THR A 1 22  ? -9.370  2.579   3.693   1.00 16.77 ? 306 THR A CG2 1 
ATOM   171  N N   . VAL A 1 23  ? -7.124  4.919   3.677   1.00 13.07 ? 307 VAL A N   1 
ATOM   172  C CA  . VAL A 1 23  ? -6.483  5.690   2.623   1.00 12.90 ? 307 VAL A CA  1 
ATOM   173  C C   . VAL A 1 23  ? -5.950  4.822   1.478   1.00 16.24 ? 307 VAL A C   1 
ATOM   174  O O   . VAL A 1 23  ? -5.392  3.744   1.713   1.00 15.20 ? 307 VAL A O   1 
ATOM   175  C CB  . VAL A 1 23  ? -5.480  6.745   3.170   1.00 14.97 ? 307 VAL A CB  1 
ATOM   176  C CG1 . VAL A 1 23  ? -4.353  6.093   3.983   1.00 13.99 ? 307 VAL A CG1 1 
ATOM   177  C CG2 . VAL A 1 23  ? -4.933  7.641   2.056   1.00 14.26 ? 307 VAL A CG2 1 
ATOM   178  N N   . VAL A 1 24  ? -6.186  5.283   0.234   1.00 12.98 ? 308 VAL A N   1 
ATOM   179  C CA  . VAL A 1 24  ? -5.732  4.619   -1.000  1.00 11.13 ? 308 VAL A CA  1 
ATOM   180  C C   . VAL A 1 24  ? -4.752  5.563   -1.691  1.00 13.52 ? 308 VAL A C   1 
ATOM   181  O O   . VAL A 1 24  ? -5.049  6.745   -1.823  1.00 12.82 ? 308 VAL A O   1 
ATOM   182  C CB  . VAL A 1 24  ? -6.891  4.189   -1.948  1.00 13.80 ? 308 VAL A CB  1 
ATOM   183  C CG1 . VAL A 1 24  ? -6.372  3.275   -3.069  1.00 13.07 ? 308 VAL A CG1 1 
ATOM   184  C CG2 . VAL A 1 24  ? -8.021  3.509   -1.184  1.00 13.04 ? 308 VAL A CG2 1 
ATOM   185  N N   . GLY A 1 25  ? -3.607  5.027   -2.117  1.00 10.46 ? 309 GLY A N   1 
ATOM   186  C CA  . GLY A 1 25  ? -2.556  5.782   -2.789  1.00 10.17 ? 309 GLY A CA  1 
ATOM   187  C C   . GLY A 1 25  ? -2.811  6.026   -4.263  1.00 15.41 ? 309 GLY A C   1 
ATOM   188  O O   . GLY A 1 25  ? -3.711  5.432   -4.867  1.00 14.43 ? 309 GLY A O   1 
ATOM   189  N N   . GLU A 1 26  ? -2.019  6.913   -4.854  1.00 12.62 ? 310 GLU A N   1 
ATOM   190  C CA  . GLU A 1 26  ? -2.179  7.243   -6.261  1.00 12.86 ? 310 GLU A CA  1 
ATOM   191  C C   . GLU A 1 26  ? -0.811  7.599   -6.848  1.00 14.69 ? 310 GLU A C   1 
ATOM   192  O O   . GLU A 1 26  ? -0.204  8.569   -6.412  1.00 13.21 ? 310 GLU A O   1 
ATOM   193  C CB  . GLU A 1 26  ? -3.205  8.408   -6.408  1.00 14.32 ? 310 GLU A CB  1 
ATOM   194  C CG  . GLU A 1 26  ? -3.343  8.976   -7.818  1.00 26.93 ? 310 GLU A CG  1 
ATOM   195  C CD  . GLU A 1 26  ? -4.211  8.191   -8.784  1.00 54.61 ? 310 GLU A CD  1 
ATOM   196  O OE1 . GLU A 1 26  ? -5.195  7.548   -8.345  1.00 41.79 ? 310 GLU A OE1 1 
ATOM   197  O OE2 . GLU A 1 26  ? -3.926  8.261   -10.001 1.00 55.05 ? 310 GLU A OE2 1 
ATOM   198  N N   . LYS A 1 27  ? -0.331  6.792   -7.821  1.00 12.29 ? 311 LYS A N   1 
ATOM   199  C CA  . LYS A 1 27  ? 0.945   6.983   -8.543  1.00 13.04 ? 311 LYS A CA  1 
ATOM   200  C C   . LYS A 1 27  ? 2.121   7.174   -7.566  1.00 15.67 ? 311 LYS A C   1 
ATOM   201  O O   . LYS A 1 27  ? 2.193   6.420   -6.597  1.00 15.16 ? 311 LYS A O   1 
ATOM   202  C CB  . LYS A 1 27  ? 0.840   8.117   -9.593  1.00 15.38 ? 311 LYS A CB  1 
ATOM   203  C CG  . LYS A 1 27  ? -0.322  7.948   -10.560 1.00 24.19 ? 311 LYS A CG  1 
ATOM   204  C CD  . LYS A 1 27  ? -0.278  9.007   -11.647 1.00 40.09 ? 311 LYS A CD  1 
ATOM   205  C CE  . LYS A 1 27  ? -1.449  8.902   -12.603 1.00 54.87 ? 311 LYS A CE  1 
ATOM   206  N NZ  . LYS A 1 27  ? -2.647  9.618   -12.092 1.00 67.59 ? 311 LYS A NZ  1 
ATOM   207  N N   . GLY A 1 28  ? 2.984   8.176   -7.809  1.00 11.53 ? 312 GLY A N   1 
ATOM   208  C CA  . GLY A 1 28  ? 4.156   8.492   -6.995  1.00 10.17 ? 312 GLY A CA  1 
ATOM   209  C C   . GLY A 1 28  ? 3.857   8.746   -5.526  1.00 12.94 ? 312 GLY A C   1 
ATOM   210  O O   . GLY A 1 28  ? 2.738   9.130   -5.172  1.00 11.85 ? 312 GLY A O   1 
ATOM   211  N N   . TYR A 1 29  ? 4.857   8.541   -4.655  1.00 8.99  ? 313 TYR A N   1 
ATOM   212  C CA  . TYR A 1 29  ? 4.654   8.703   -3.217  1.00 8.19  ? 313 TYR A CA  1 
ATOM   213  C C   . TYR A 1 29  ? 4.070   10.022  -2.806  1.00 12.94 ? 313 TYR A C   1 
ATOM   214  O O   . TYR A 1 29  ? 4.490   11.065  -3.293  1.00 12.26 ? 313 TYR A O   1 
ATOM   215  C CB  . TYR A 1 29  ? 5.934   8.482   -2.438  1.00 8.59  ? 313 TYR A CB  1 
ATOM   216  C CG  . TYR A 1 29  ? 6.133   7.062   -1.961  1.00 6.92  ? 313 TYR A CG  1 
ATOM   217  C CD1 . TYR A 1 29  ? 5.398   6.555   -0.887  1.00 7.07  ? 313 TYR A CD1 1 
ATOM   218  C CD2 . TYR A 1 29  ? 7.164   6.278   -2.473  1.00 6.77  ? 313 TYR A CD2 1 
ATOM   219  C CE1 . TYR A 1 29  ? 5.616   5.258   -0.408  1.00 8.91  ? 313 TYR A CE1 1 
ATOM   220  C CE2 . TYR A 1 29  ? 7.397   4.989   -1.999  1.00 6.95  ? 313 TYR A CE2 1 
ATOM   221  C CZ  . TYR A 1 29  ? 6.607   4.473   -0.982  1.00 13.12 ? 313 TYR A CZ  1 
ATOM   222  O OH  . TYR A 1 29  ? 6.847   3.198   -0.530  1.00 10.72 ? 313 TYR A OH  1 
ATOM   223  N N   . SER A 1 30  ? 3.095   9.963   -1.896  1.00 9.86  ? 314 SER A N   1 
ATOM   224  C CA  . SER A 1 30  ? 2.445   11.140  -1.335  1.00 8.94  ? 314 SER A CA  1 
ATOM   225  C C   . SER A 1 30  ? 1.935   10.786  0.070   1.00 11.45 ? 314 SER A C   1 
ATOM   226  O O   . SER A 1 30  ? 1.739   9.615   0.368   1.00 9.67  ? 314 SER A O   1 
ATOM   227  C CB  . SER A 1 30  ? 1.362   11.668  -2.262  1.00 9.31  ? 314 SER A CB  1 
ATOM   228  O OG  . SER A 1 30  ? 0.228   10.829  -2.240  1.00 14.20 ? 314 SER A OG  1 
ATOM   229  N N   . MET A 1 31  ? 1.764   11.788  0.928   1.00 10.36 ? 315 MET A N   1 
ATOM   230  C CA  . MET A 1 31  ? 1.499   11.598  2.347   1.00 11.47 ? 315 MET A CA  1 
ATOM   231  C C   . MET A 1 31  ? 0.292   12.321  2.929   1.00 16.06 ? 315 MET A C   1 
ATOM   232  O O   . MET A 1 31  ? -0.133  13.369  2.430   1.00 15.48 ? 315 MET A O   1 
ATOM   233  C CB  . MET A 1 31  ? 2.781   12.029  3.110   1.00 14.41 ? 315 MET A CB  1 
ATOM   234  C CG  . MET A 1 31  ? 2.783   11.715  4.615   1.00 19.29 ? 315 MET A CG  1 
ATOM   235  S SD  . MET A 1 31  ? 3.703   12.927  5.589   1.00 25.21 ? 315 MET A SD  1 
ATOM   236  C CE  . MET A 1 31  ? 5.321   12.799  4.798   1.00 21.42 ? 315 MET A CE  1 
ATOM   237  N N   . VAL A 1 32  ? -0.240  11.719  4.013   1.00 11.93 ? 316 VAL A N   1 
ATOM   238  C CA  . VAL A 1 32  ? -1.302  12.198  4.890   1.00 10.62 ? 316 VAL A CA  1 
ATOM   239  C C   . VAL A 1 32  ? -0.796  12.054  6.352   1.00 13.18 ? 316 VAL A C   1 
ATOM   240  O O   . VAL A 1 32  ? -0.184  11.035  6.691   1.00 12.03 ? 316 VAL A O   1 
ATOM   241  C CB  . VAL A 1 32  ? -2.680  11.487  4.648   1.00 13.12 ? 316 VAL A CB  1 
ATOM   242  C CG1 . VAL A 1 32  ? -2.602  9.964   4.814   1.00 12.08 ? 316 VAL A CG1 1 
ATOM   243  C CG2 . VAL A 1 32  ? -3.776  12.071  5.536   1.00 12.76 ? 316 VAL A CG2 1 
ATOM   244  N N   . ARG A 1 33  ? -1.028  13.071  7.196   1.00 11.30 ? 317 ARG A N   1 
ATOM   245  C CA  . ARG A 1 33  ? -0.693  12.990  8.626   1.00 11.73 ? 317 ARG A CA  1 
ATOM   246  C C   . ARG A 1 33  ? -2.028  12.853  9.378   1.00 14.42 ? 317 ARG A C   1 
ATOM   247  O O   . ARG A 1 33  ? -3.086  13.157  8.820   1.00 13.75 ? 317 ARG A O   1 
ATOM   248  C CB  . ARG A 1 33  ? 0.088   14.253  9.124   1.00 12.10 ? 317 ARG A CB  1 
ATOM   249  C CG  . ARG A 1 33  ? 1.598   14.223  8.905   1.00 16.16 ? 317 ARG A CG  1 
ATOM   250  C CD  . ARG A 1 33  ? 2.339   15.468  9.438   1.00 14.15 ? 317 ARG A CD  1 
ATOM   251  N NE  . ARG A 1 33  ? 2.069   16.641  8.596   1.00 8.32  ? 317 ARG A NE  1 
ATOM   252  C CZ  . ARG A 1 33  ? 2.801   17.009  7.552   1.00 15.66 ? 317 ARG A CZ  1 
ATOM   253  N NH1 . ARG A 1 33  ? 3.920   16.357  7.252   1.00 10.23 ? 317 ARG A NH1 1 
ATOM   254  N NH2 . ARG A 1 33  ? 2.433   18.045  6.811   1.00 10.42 ? 317 ARG A NH2 1 
ATOM   255  N N   . ALA A 1 34  ? -1.989  12.402  10.650  1.00 12.03 ? 318 ALA A N   1 
ATOM   256  C CA  . ALA A 1 34  ? -3.179  12.349  11.511  1.00 10.70 ? 318 ALA A CA  1 
ATOM   257  C C   . ALA A 1 34  ? -3.564  13.788  11.918  1.00 13.51 ? 318 ALA A C   1 
ATOM   258  O O   . ALA A 1 34  ? -2.820  14.722  11.655  1.00 11.81 ? 318 ALA A O   1 
ATOM   259  C CB  . ALA A 1 34  ? -2.894  11.534  12.752  1.00 11.37 ? 318 ALA A CB  1 
ATOM   260  N N   . SER A 1 35  ? -4.697  13.947  12.601  1.00 10.97 ? 319 SER A N   1 
ATOM   261  C CA  . SER A 1 35  ? -5.220  15.231  13.077  1.00 10.45 ? 319 SER A CA  1 
ATOM   262  C C   . SER A 1 35  ? -4.538  15.688  14.371  1.00 14.20 ? 319 SER A C   1 
ATOM   263  O O   . SER A 1 35  ? -4.587  16.869  14.698  1.00 15.24 ? 319 SER A O   1 
ATOM   264  C CB  . SER A 1 35  ? -6.716  15.102  13.343  1.00 11.99 ? 319 SER A CB  1 
ATOM   265  O OG  . SER A 1 35  ? -6.970  13.984  14.180  1.00 14.48 ? 319 SER A OG  1 
ATOM   266  N N   . HIS A 1 36  ? -3.967  14.762  15.128  1.00 9.26  ? 320 HIS A N   1 
ATOM   267  C CA  . HIS A 1 36  ? -3.333  15.072  16.416  1.00 9.79  ? 320 HIS A CA  1 
ATOM   268  C C   . HIS A 1 36  ? -1.902  14.591  16.430  1.00 13.52 ? 320 HIS A C   1 
ATOM   269  O O   . HIS A 1 36  ? -1.616  13.511  15.910  1.00 13.34 ? 320 HIS A O   1 
ATOM   270  C CB  . HIS A 1 36  ? -4.084  14.381  17.590  1.00 10.31 ? 320 HIS A CB  1 
ATOM   271  C CG  . HIS A 1 36  ? -5.524  14.780  17.769  1.00 13.14 ? 320 HIS A CG  1 
ATOM   272  N ND1 . HIS A 1 36  ? -6.430  14.702  16.737  1.00 14.77 ? 320 HIS A ND1 1 
ATOM   273  C CD2 . HIS A 1 36  ? -6.172  15.191  18.882  1.00 14.94 ? 320 HIS A CD2 1 
ATOM   274  C CE1 . HIS A 1 36  ? -7.595  15.097  17.234  1.00 14.17 ? 320 HIS A CE1 1 
ATOM   275  N NE2 . HIS A 1 36  ? -7.491  15.394  18.524  1.00 14.64 ? 320 HIS A NE2 1 
ATOM   276  N N   . GLY A 1 37  ? -1.038  15.366  17.071  1.00 9.77  ? 321 GLY A N   1 
ATOM   277  C CA  . GLY A 1 37  ? 0.368   15.031  17.235  1.00 9.69  ? 321 GLY A CA  1 
ATOM   278  C C   . GLY A 1 37  ? 0.768   14.919  18.691  1.00 14.34 ? 321 GLY A C   1 
ATOM   279  O O   . GLY A 1 37  ? -0.011  15.260  19.583  1.00 14.13 ? 321 GLY A O   1 
ATOM   280  N N   . VAL A 1 38  ? 1.986   14.410  18.943  1.00 11.87 ? 322 VAL A N   1 
ATOM   281  C CA  . VAL A 1 38  ? 2.520   14.203  20.291  1.00 11.24 ? 322 VAL A CA  1 
ATOM   282  C C   . VAL A 1 38  ? 3.858   14.903  20.474  1.00 14.30 ? 322 VAL A C   1 
ATOM   283  O O   . VAL A 1 38  ? 4.665   14.950  19.542  1.00 12.98 ? 322 VAL A O   1 
ATOM   284  C CB  . VAL A 1 38  ? 2.573   12.691  20.691  1.00 14.92 ? 322 VAL A CB  1 
ATOM   285  C CG1 . VAL A 1 38  ? 1.163   12.120  20.821  1.00 14.51 ? 322 VAL A CG1 1 
ATOM   286  C CG2 . VAL A 1 38  ? 3.422   11.862  19.714  1.00 13.49 ? 322 VAL A CG2 1 
ATOM   287  N N   . ARG A 1 39  ? 4.110   15.395  21.694  1.00 11.77 ? 323 ARG A N   1 
ATOM   288  C CA  . ARG A 1 39  ? 5.330   16.120  22.050  1.00 11.79 ? 323 ARG A CA  1 
ATOM   289  C C   . ARG A 1 39  ? 6.143   15.424  23.186  1.00 15.10 ? 323 ARG A C   1 
ATOM   290  O O   . ARG A 1 39  ? 7.364   15.515  23.204  1.00 13.89 ? 323 ARG A O   1 
ATOM   291  C CB  . ARG A 1 39  ? 4.942   17.543  22.457  1.00 13.70 ? 323 ARG A CB  1 
ATOM   292  C CG  . ARG A 1 39  ? 6.075   18.553  22.394  1.00 18.25 ? 323 ARG A CG  1 
ATOM   293  C CD  . ARG A 1 39  ? 5.535   19.957  22.624  1.00 20.86 ? 323 ARG A CD  1 
ATOM   294  N NE  . ARG A 1 39  ? 5.026   20.156  23.987  1.00 22.52 ? 323 ARG A NE  1 
ATOM   295  C CZ  . ARG A 1 39  ? 5.767   20.587  25.002  1.00 31.25 ? 323 ARG A CZ  1 
ATOM   296  N NH1 . ARG A 1 39  ? 7.056   20.854  24.826  1.00 16.31 ? 323 ARG A NH1 1 
ATOM   297  N NH2 . ARG A 1 39  ? 5.231   20.735  26.205  1.00 15.59 ? 323 ARG A NH2 1 
ATOM   298  N N   . LYS A 1 40  ? 5.458   14.775  24.132  1.00 12.73 ? 324 LYS A N   1 
ATOM   299  C CA  . LYS A 1 40  ? 6.086   14.077  25.259  1.00 13.21 ? 324 LYS A CA  1 
ATOM   300  C C   . LYS A 1 40  ? 5.371   12.744  25.541  1.00 16.51 ? 324 LYS A C   1 
ATOM   301  O O   . LYS A 1 40  ? 4.177   12.601  25.225  1.00 16.39 ? 324 LYS A O   1 
ATOM   302  C CB  . LYS A 1 40  ? 6.057   14.956  26.530  1.00 15.80 ? 324 LYS A CB  1 
ATOM   303  N N   . GLY A 1 41  ? 6.085   11.826  26.202  1.00 11.22 ? 325 GLY A N   1 
ATOM   304  C CA  . GLY A 1 41  ? 5.537   10.536  26.611  1.00 10.45 ? 325 GLY A CA  1 
ATOM   305  C C   . GLY A 1 41  ? 5.674   9.463   25.550  1.00 14.73 ? 325 GLY A C   1 
ATOM   306  O O   . GLY A 1 41  ? 6.320   9.669   24.513  1.00 14.03 ? 325 GLY A O   1 
ATOM   307  N N   . ALA A 1 42  ? 5.107   8.293   25.835  1.00 12.98 ? 326 ALA A N   1 
ATOM   308  C CA  . ALA A 1 42  ? 5.149   7.115   24.949  1.00 12.72 ? 326 ALA A CA  1 
ATOM   309  C C   . ALA A 1 42  ? 3.770   6.942   24.312  1.00 15.22 ? 326 ALA A C   1 
ATOM   310  O O   . ALA A 1 42  ? 2.755   6.984   25.013  1.00 14.84 ? 326 ALA A O   1 
ATOM   311  C CB  . ALA A 1 42  ? 5.562   5.875   25.739  1.00 12.75 ? 326 ALA A CB  1 
ATOM   312  N N   . TRP A 1 43  ? 3.727   6.851   22.982  1.00 11.71 ? 327 TRP A N   1 
ATOM   313  C CA  . TRP A 1 43  ? 2.465   6.791   22.216  1.00 11.76 ? 327 TRP A CA  1 
ATOM   314  C C   . TRP A 1 43  ? 2.424   5.647   21.209  1.00 14.65 ? 327 TRP A C   1 
ATOM   315  O O   . TRP A 1 43  ? 3.469   5.227   20.720  1.00 14.39 ? 327 TRP A O   1 
ATOM   316  C CB  . TRP A 1 43  ? 2.188   8.159   21.542  1.00 11.08 ? 327 TRP A CB  1 
ATOM   317  C CG  . TRP A 1 43  ? 2.031   9.242   22.568  1.00 12.63 ? 327 TRP A CG  1 
ATOM   318  C CD1 . TRP A 1 43  ? 3.024   9.975   23.152  1.00 15.51 ? 327 TRP A CD1 1 
ATOM   319  C CD2 . TRP A 1 43  ? 0.817   9.594   23.246  1.00 12.91 ? 327 TRP A CD2 1 
ATOM   320  N NE1 . TRP A 1 43  ? 2.499   10.785  24.135  1.00 15.38 ? 327 TRP A NE1 1 
ATOM   321  C CE2 . TRP A 1 43  ? 1.143   10.577  24.208  1.00 16.86 ? 327 TRP A CE2 1 
ATOM   322  C CE3 . TRP A 1 43  ? -0.526  9.213   23.092  1.00 14.19 ? 327 TRP A CE3 1 
ATOM   323  C CZ2 . TRP A 1 43  ? 0.184   11.153  25.040  1.00 15.80 ? 327 TRP A CZ2 1 
ATOM   324  C CZ3 . TRP A 1 43  ? -1.483  9.806   23.900  1.00 15.61 ? 327 TRP A CZ3 1 
ATOM   325  C CH2 . TRP A 1 43  ? -1.128  10.771  24.851  1.00 16.33 ? 327 TRP A CH2 1 
ATOM   326  N N   . TYR A 1 44  ? 1.219   5.151   20.897  1.00 10.93 ? 328 TYR A N   1 
ATOM   327  C CA  . TYR A 1 44  ? 1.049   4.020   19.983  1.00 10.09 ? 328 TYR A CA  1 
ATOM   328  C C   . TYR A 1 44  ? -0.162  4.109   19.053  1.00 13.17 ? 328 TYR A C   1 
ATOM   329  O O   . TYR A 1 44  ? -1.194  4.658   19.422  1.00 12.43 ? 328 TYR A O   1 
ATOM   330  C CB  . TYR A 1 44  ? 0.954   2.733   20.820  1.00 10.85 ? 328 TYR A CB  1 
ATOM   331  C CG  . TYR A 1 44  ? 1.243   1.458   20.061  1.00 12.32 ? 328 TYR A CG  1 
ATOM   332  C CD1 . TYR A 1 44  ? 2.548   1.021   19.869  1.00 14.05 ? 328 TYR A CD1 1 
ATOM   333  C CD2 . TYR A 1 44  ? 0.213   0.644   19.613  1.00 13.03 ? 328 TYR A CD2 1 
ATOM   334  C CE1 . TYR A 1 44  ? 2.821   -0.149  19.174  1.00 13.82 ? 328 TYR A CE1 1 
ATOM   335  C CE2 . TYR A 1 44  ? 0.474   -0.536  18.924  1.00 13.92 ? 328 TYR A CE2 1 
ATOM   336  C CZ  . TYR A 1 44  ? 1.779   -0.937  18.725  1.00 18.97 ? 328 TYR A CZ  1 
ATOM   337  O OH  . TYR A 1 44  ? 2.043   -2.126  18.105  1.00 19.90 ? 328 TYR A OH  1 
ATOM   338  N N   . PHE A 1 45  ? -0.040  3.512   17.848  1.00 10.69 ? 329 PHE A N   1 
ATOM   339  C CA  . PHE A 1 45  ? -1.139  3.367   16.884  1.00 9.21  ? 329 PHE A CA  1 
ATOM   340  C C   . PHE A 1 45  ? -0.839  2.181   15.986  1.00 11.18 ? 329 PHE A C   1 
ATOM   341  O O   . PHE A 1 45  ? 0.319   1.777   15.878  1.00 8.84  ? 329 PHE A O   1 
ATOM   342  C CB  . PHE A 1 45  ? -1.403  4.655   16.052  1.00 9.87  ? 329 PHE A CB  1 
ATOM   343  C CG  . PHE A 1 45  ? -0.317  5.032   15.064  1.00 9.46  ? 329 PHE A CG  1 
ATOM   344  C CD1 . PHE A 1 45  ? -0.377  4.603   13.740  1.00 11.04 ? 329 PHE A CD1 1 
ATOM   345  C CD2 . PHE A 1 45  ? 0.769   5.810   15.458  1.00 9.40  ? 329 PHE A CD2 1 
ATOM   346  C CE1 . PHE A 1 45  ? 0.617   4.977   12.823  1.00 12.15 ? 329 PHE A CE1 1 
ATOM   347  C CE2 . PHE A 1 45  ? 1.754   6.190   14.539  1.00 10.80 ? 329 PHE A CE2 1 
ATOM   348  C CZ  . PHE A 1 45  ? 1.680   5.761   13.229  1.00 9.36  ? 329 PHE A CZ  1 
ATOM   349  N N   . GLU A 1 46  ? -1.879  1.624   15.351  1.00 8.33  ? 330 GLU A N   1 
ATOM   350  C CA  . GLU A 1 46  ? -1.739  0.506   14.420  1.00 8.65  ? 330 GLU A CA  1 
ATOM   351  C C   . GLU A 1 46  ? -2.164  0.895   13.017  1.00 14.83 ? 330 GLU A C   1 
ATOM   352  O O   . GLU A 1 46  ? -3.038  1.753   12.845  1.00 15.69 ? 330 GLU A O   1 
ATOM   353  C CB  . GLU A 1 46  ? -2.601  -0.689  14.859  1.00 9.56  ? 330 GLU A CB  1 
ATOM   354  C CG  . GLU A 1 46  ? -1.963  -1.559  15.925  1.00 15.74 ? 330 GLU A CG  1 
ATOM   355  C CD  . GLU A 1 46  ? -2.794  -2.738  16.376  1.00 16.64 ? 330 GLU A CD  1 
ATOM   356  O OE1 . GLU A 1 46  ? -4.034  -2.694  16.208  1.00 12.01 ? 330 GLU A OE1 1 
ATOM   357  O OE2 . GLU A 1 46  ? -2.222  -3.652  17.009  1.00 18.66 ? 330 GLU A OE2 1 
ATOM   358  N N   . ILE A 1 47  ? -1.583  0.223   12.015  1.00 11.91 ? 331 ILE A N   1 
ATOM   359  C CA  . ILE A 1 47  ? -1.980  0.355   10.614  1.00 11.32 ? 331 ILE A CA  1 
ATOM   360  C C   . ILE A 1 47  ? -2.209  -1.054  10.038  1.00 16.08 ? 331 ILE A C   1 
ATOM   361  O O   . ILE A 1 47  ? -1.364  -1.928  10.183  1.00 14.04 ? 331 ILE A O   1 
ATOM   362  C CB  . ILE A 1 47  ? -1.020  1.242   9.739   1.00 13.98 ? 331 ILE A CB  1 
ATOM   363  C CG1 . ILE A 1 47  ? -1.126  2.757   10.110  1.00 12.36 ? 331 ILE A CG1 1 
ATOM   364  C CG2 . ILE A 1 47  ? -1.283  1.043   8.220   1.00 14.73 ? 331 ILE A CG2 1 
ATOM   365  C CD1 . ILE A 1 47  ? 0.126   3.594   9.702   1.00 16.26 ? 331 ILE A CD1 1 
ATOM   366  N N   . THR A 1 48  ? -3.356  -1.264  9.385   1.00 14.43 ? 332 THR A N   1 
ATOM   367  C CA  . THR A 1 48  ? -3.648  -2.526  8.733   1.00 13.89 ? 332 THR A CA  1 
ATOM   368  C C   . THR A 1 48  ? -3.513  -2.350  7.225   1.00 16.90 ? 332 THR A C   1 
ATOM   369  O O   . THR A 1 48  ? -4.135  -1.451  6.678   1.00 15.70 ? 332 THR A O   1 
ATOM   370  C CB  . THR A 1 48  ? -5.007  -3.068  9.217   1.00 20.75 ? 332 THR A CB  1 
ATOM   371  O OG1 . THR A 1 48  ? -4.905  -3.319  10.623  1.00 17.03 ? 332 THR A OG1 1 
ATOM   372  C CG2 . THR A 1 48  ? -5.440  -4.341  8.484   1.00 18.37 ? 332 THR A CG2 1 
ATOM   373  N N   . VAL A 1 49  ? -2.711  -3.215  6.553   1.00 14.68 ? 333 VAL A N   1 
ATOM   374  C CA  . VAL A 1 49  ? -2.556  -3.193  5.087   1.00 13.72 ? 333 VAL A CA  1 
ATOM   375  C C   . VAL A 1 49  ? -3.736  -4.019  4.543   1.00 16.77 ? 333 VAL A C   1 
ATOM   376  O O   . VAL A 1 49  ? -3.704  -5.256  4.578   1.00 16.68 ? 333 VAL A O   1 
ATOM   377  C CB  . VAL A 1 49  ? -1.170  -3.720  4.594   1.00 16.09 ? 333 VAL A CB  1 
ATOM   378  C CG1 . VAL A 1 49  ? -1.088  -3.717  3.069   1.00 14.82 ? 333 VAL A CG1 1 
ATOM   379  C CG2 . VAL A 1 49  ? -0.030  -2.903  5.183   1.00 15.87 ? 333 VAL A CG2 1 
ATOM   380  N N   . ASP A 1 50  ? -4.800  -3.333  4.104   1.00 13.43 ? 334 ASP A N   1 
ATOM   381  C CA  . ASP A 1 50  ? -6.017  -4.005  3.614   1.00 13.33 ? 334 ASP A CA  1 
ATOM   382  C C   . ASP A 1 50  ? -5.798  -4.640  2.241   1.00 18.12 ? 334 ASP A C   1 
ATOM   383  O O   . ASP A 1 50  ? -6.274  -5.751  1.981   1.00 18.10 ? 334 ASP A O   1 
ATOM   384  C CB  . ASP A 1 50  ? -7.200  -3.028  3.585   1.00 14.19 ? 334 ASP A CB  1 
ATOM   385  C CG  . ASP A 1 50  ? -7.404  -2.267  4.886   1.00 20.57 ? 334 ASP A CG  1 
ATOM   386  O OD1 . ASP A 1 50  ? -7.343  -2.904  5.969   1.00 20.99 ? 334 ASP A OD1 1 
ATOM   387  O OD2 . ASP A 1 50  ? -7.619  -1.041  4.822   1.00 20.09 ? 334 ASP A OD2 1 
ATOM   388  N N   . GLU A 1 51  ? -5.060  -3.934  1.372   1.00 14.61 ? 335 GLU A N   1 
ATOM   389  C CA  . GLU A 1 51  ? -4.749  -4.410  0.036   1.00 14.41 ? 335 GLU A CA  1 
ATOM   390  C C   . GLU A 1 51  ? -3.434  -3.813  -0.441  1.00 18.25 ? 335 GLU A C   1 
ATOM   391  O O   . GLU A 1 51  ? -3.216  -2.608  -0.343  1.00 18.02 ? 335 GLU A O   1 
ATOM   392  C CB  . GLU A 1 51  ? -5.883  -4.084  -0.941  1.00 15.55 ? 335 GLU A CB  1 
ATOM   393  C CG  . GLU A 1 51  ? -5.898  -4.978  -2.169  1.00 26.92 ? 335 GLU A CG  1 
ATOM   394  C CD  . GLU A 1 51  ? -7.102  -4.714  -3.050  1.00 50.08 ? 335 GLU A CD  1 
ATOM   395  O OE1 . GLU A 1 51  ? -7.092  -3.692  -3.773  1.00 32.38 ? 335 GLU A OE1 1 
ATOM   396  O OE2 . GLU A 1 51  ? -8.081  -5.491  -2.973  1.00 52.21 ? 335 GLU A OE2 1 
ATOM   397  N N   . MET A 1 52  ? -2.571  -4.670  -0.977  1.00 13.47 ? 336 MET A N   1 
ATOM   398  C CA  . MET A 1 52  ? -1.300  -4.259  -1.501  1.00 13.21 ? 336 MET A CA  1 
ATOM   399  C C   . MET A 1 52  ? -1.099  -5.003  -2.809  1.00 19.73 ? 336 MET A C   1 
ATOM   400  O O   . MET A 1 52  ? -0.426  -6.031  -2.833  1.00 18.78 ? 336 MET A O   1 
ATOM   401  C CB  . MET A 1 52  ? -0.160  -4.468  -0.482  1.00 14.74 ? 336 MET A CB  1 
ATOM   402  C CG  . MET A 1 52  ? 1.111   -3.758  -0.876  1.00 17.15 ? 336 MET A CG  1 
ATOM   403  S SD  . MET A 1 52  ? 2.205   -3.434  0.515   1.00 19.90 ? 336 MET A SD  1 
ATOM   404  C CE  . MET A 1 52  ? 1.573   -1.896  1.059   1.00 16.07 ? 336 MET A CE  1 
ATOM   405  N N   . PRO A 1 53  ? -1.707  -4.488  -3.913  1.00 18.84 ? 337 PRO A N   1 
ATOM   406  C CA  . PRO A 1 53  ? -1.566  -5.146  -5.225  1.00 19.30 ? 337 PRO A CA  1 
ATOM   407  C C   . PRO A 1 53  ? -0.116  -5.107  -5.730  1.00 26.05 ? 337 PRO A C   1 
ATOM   408  O O   . PRO A 1 53  ? 0.692   -4.396  -5.122  1.00 25.72 ? 337 PRO A O   1 
ATOM   409  C CB  . PRO A 1 53  ? -2.486  -4.309  -6.129  1.00 20.96 ? 337 PRO A CB  1 
ATOM   410  C CG  . PRO A 1 53  ? -3.450  -3.624  -5.181  1.00 25.12 ? 337 PRO A CG  1 
ATOM   411  C CD  . PRO A 1 53  ? -2.559  -3.287  -4.023  1.00 20.26 ? 337 PRO A CD  1 
ATOM   412  N N   . PRO A 1 54  ? 0.268   -5.866  -6.797  1.00 23.93 ? 338 PRO A N   1 
ATOM   413  C CA  . PRO A 1 54  ? 1.678   -5.833  -7.244  1.00 23.70 ? 338 PRO A CA  1 
ATOM   414  C C   . PRO A 1 54  ? 2.134   -4.430  -7.641  1.00 24.59 ? 338 PRO A C   1 
ATOM   415  O O   . PRO A 1 54  ? 1.327   -3.631  -8.139  1.00 23.78 ? 338 PRO A O   1 
ATOM   416  C CB  . PRO A 1 54  ? 1.708   -6.800  -8.439  1.00 25.70 ? 338 PRO A CB  1 
ATOM   417  C CG  . PRO A 1 54  ? 0.497   -7.690  -8.241  1.00 30.59 ? 338 PRO A CG  1 
ATOM   418  C CD  . PRO A 1 54  ? -0.537  -6.789  -7.634  1.00 26.06 ? 338 PRO A CD  1 
ATOM   419  N N   . ASP A 1 55  ? 3.415   -4.123  -7.347  1.00 19.00 ? 339 ASP A N   1 
ATOM   420  C CA  . ASP A 1 55  ? 4.101   -2.849  -7.623  1.00 18.73 ? 339 ASP A CA  1 
ATOM   421  C C   . ASP A 1 55  ? 3.780   -1.724  -6.634  1.00 21.23 ? 339 ASP A C   1 
ATOM   422  O O   . ASP A 1 55  ? 4.490   -0.721  -6.633  1.00 23.74 ? 339 ASP A O   1 
ATOM   423  C CB  . ASP A 1 55  ? 3.946   -2.368  -9.090  1.00 21.14 ? 339 ASP A CB  1 
ATOM   424  C CG  . ASP A 1 55  ? 4.377   -3.351  -10.165 1.00 36.23 ? 339 ASP A CG  1 
ATOM   425  O OD1 . ASP A 1 55  ? 5.326   -4.132  -9.918  1.00 37.27 ? 339 ASP A OD1 1 
ATOM   426  O OD2 . ASP A 1 55  ? 3.805   -3.299  -11.277 1.00 46.17 ? 339 ASP A OD2 1 
ATOM   427  N N   . THR A 1 56  ? 2.756   -1.890  -5.785  1.00 13.54 ? 340 THR A N   1 
ATOM   428  C CA  . THR A 1 56  ? 2.403   -0.897  -4.772  1.00 13.29 ? 340 THR A CA  1 
ATOM   429  C C   . THR A 1 56  ? 3.277   -1.064  -3.523  1.00 15.91 ? 340 THR A C   1 
ATOM   430  O O   . THR A 1 56  ? 3.843   -2.132  -3.294  1.00 15.72 ? 340 THR A O   1 
ATOM   431  C CB  . THR A 1 56  ? 0.883   -0.871  -4.455  1.00 18.76 ? 340 THR A CB  1 
ATOM   432  O OG1 . THR A 1 56  ? 0.540   -1.964  -3.614  1.00 14.62 ? 340 THR A OG1 1 
ATOM   433  C CG2 . THR A 1 56  ? -0.019  -0.813  -5.717  1.00 16.45 ? 340 THR A CG2 1 
ATOM   434  N N   . ALA A 1 57  ? 3.369   -0.009  -2.716  1.00 11.45 ? 341 ALA A N   1 
ATOM   435  C CA  . ALA A 1 57  ? 4.176   0.023   -1.507  1.00 11.10 ? 341 ALA A CA  1 
ATOM   436  C C   . ALA A 1 57  ? 3.739   1.136   -0.563  1.00 13.03 ? 341 ALA A C   1 
ATOM   437  O O   . ALA A 1 57  ? 3.132   2.131   -0.984  1.00 10.94 ? 341 ALA A O   1 
ATOM   438  C CB  . ALA A 1 57  ? 5.661   0.204   -1.865  1.00 11.63 ? 341 ALA A CB  1 
ATOM   439  N N   . ALA A 1 58  ? 4.126   0.987   0.707   1.00 8.37  ? 342 ALA A N   1 
ATOM   440  C CA  . ALA A 1 58  ? 3.838   1.954   1.757   1.00 8.18  ? 342 ALA A CA  1 
ATOM   441  C C   . ALA A 1 58  ? 5.107   2.277   2.553   1.00 11.35 ? 342 ALA A C   1 
ATOM   442  O O   . ALA A 1 58  ? 5.990   1.440   2.666   1.00 10.34 ? 342 ALA A O   1 
ATOM   443  C CB  . ALA A 1 58  ? 2.783   1.377   2.696   1.00 8.71  ? 342 ALA A CB  1 
ATOM   444  N N   . ARG A 1 59  ? 5.196   3.503   3.086   1.00 9.24  ? 343 ARG A N   1 
ATOM   445  C CA  . ARG A 1 59  ? 6.255   3.928   4.009   1.00 8.69  ? 343 ARG A CA  1 
ATOM   446  C C   . ARG A 1 59  ? 5.469   4.600   5.099   1.00 11.40 ? 343 ARG A C   1 
ATOM   447  O O   . ARG A 1 59  ? 4.839   5.628   4.882   1.00 11.77 ? 343 ARG A O   1 
ATOM   448  C CB  . ARG A 1 59  ? 7.345   4.818   3.370   1.00 8.15  ? 343 ARG A CB  1 
ATOM   449  C CG  . ARG A 1 59  ? 8.142   4.088   2.293   1.00 15.83 ? 343 ARG A CG  1 
ATOM   450  C CD  . ARG A 1 59  ? 9.314   4.878   1.745   1.00 16.04 ? 343 ARG A CD  1 
ATOM   451  N NE  . ARG A 1 59  ? 9.878   4.242   0.552   1.00 9.06  ? 343 ARG A NE  1 
ATOM   452  C CZ  . ARG A 1 59  ? 10.956  4.676   -0.089  1.00 20.03 ? 343 ARG A CZ  1 
ATOM   453  N NH1 . ARG A 1 59  ? 11.637  5.715   0.371   1.00 8.53  ? 343 ARG A NH1 1 
ATOM   454  N NH2 . ARG A 1 59  ? 11.383  4.050   -1.175  1.00 9.96  ? 343 ARG A NH2 1 
ATOM   455  N N   . LEU A 1 60  ? 5.426   3.938   6.246   1.00 8.29  ? 344 LEU A N   1 
ATOM   456  C CA  . LEU A 1 60  ? 4.604   4.271   7.400   1.00 7.82  ? 344 LEU A CA  1 
ATOM   457  C C   . LEU A 1 60  ? 5.415   4.695   8.616   1.00 11.86 ? 344 LEU A C   1 
ATOM   458  O O   . LEU A 1 60  ? 6.539   4.231   8.811   1.00 11.92 ? 344 LEU A O   1 
ATOM   459  C CB  . LEU A 1 60  ? 3.752   3.012   7.714   1.00 7.18  ? 344 LEU A CB  1 
ATOM   460  C CG  . LEU A 1 60  ? 2.943   2.424   6.520   1.00 11.45 ? 344 LEU A CG  1 
ATOM   461  C CD1 . LEU A 1 60  ? 2.272   1.101   6.905   1.00 10.81 ? 344 LEU A CD1 1 
ATOM   462  C CD2 . LEU A 1 60  ? 1.877   3.438   5.995   1.00 12.86 ? 344 LEU A CD2 1 
ATOM   463  N N   . GLY A 1 61  ? 4.848   5.573   9.435   1.00 7.25  ? 345 GLY A N   1 
ATOM   464  C CA  . GLY A 1 61  ? 5.579   6.024   10.608  1.00 6.70  ? 345 GLY A CA  1 
ATOM   465  C C   . GLY A 1 61  ? 5.112   7.310   11.241  1.00 11.08 ? 345 GLY A C   1 
ATOM   466  O O   . GLY A 1 61  ? 3.935   7.461   11.550  1.00 11.13 ? 345 GLY A O   1 
ATOM   467  N N   . TRP A 1 62  ? 6.062   8.215   11.482  1.00 10.69 ? 346 TRP A N   1 
ATOM   468  C CA  . TRP A 1 62  ? 5.849   9.469   12.192  1.00 11.33 ? 346 TRP A CA  1 
ATOM   469  C C   . TRP A 1 62  ? 6.480   10.635  11.446  1.00 15.97 ? 346 TRP A C   1 
ATOM   470  O O   . TRP A 1 62  ? 7.602   10.527  10.939  1.00 13.24 ? 346 TRP A O   1 
ATOM   471  C CB  . TRP A 1 62  ? 6.462   9.405   13.605  1.00 9.54  ? 346 TRP A CB  1 
ATOM   472  C CG  . TRP A 1 62  ? 5.964   8.295   14.487  1.00 10.03 ? 346 TRP A CG  1 
ATOM   473  C CD1 . TRP A 1 62  ? 6.535   7.067   14.651  1.00 12.84 ? 346 TRP A CD1 1 
ATOM   474  C CD2 . TRP A 1 62  ? 4.871   8.359   15.424  1.00 9.21  ? 346 TRP A CD2 1 
ATOM   475  N NE1 . TRP A 1 62  ? 5.826   6.333   15.576  1.00 12.12 ? 346 TRP A NE1 1 
ATOM   476  C CE2 . TRP A 1 62  ? 4.809   7.107   16.080  1.00 12.96 ? 346 TRP A CE2 1 
ATOM   477  C CE3 . TRP A 1 62  ? 3.961   9.368   15.797  1.00 10.25 ? 346 TRP A CE3 1 
ATOM   478  C CZ2 . TRP A 1 62  ? 3.886   6.839   17.103  1.00 12.24 ? 346 TRP A CZ2 1 
ATOM   479  C CZ3 . TRP A 1 62  ? 3.002   9.085   16.768  1.00 12.21 ? 346 TRP A CZ3 1 
ATOM   480  C CH2 . TRP A 1 62  ? 2.972   7.835   17.414  1.00 12.99 ? 346 TRP A CH2 1 
ATOM   481  N N   . SER A 1 63  ? 5.761   11.764  11.421  1.00 13.22 ? 347 SER A N   1 
ATOM   482  C CA  . SER A 1 63  ? 6.238   12.975  10.775  1.00 12.92 ? 347 SER A CA  1 
ATOM   483  C C   . SER A 1 63  ? 5.975   14.216  11.595  1.00 17.04 ? 347 SER A C   1 
ATOM   484  O O   . SER A 1 63  ? 4.876   14.386  12.148  1.00 15.19 ? 347 SER A O   1 
ATOM   485  C CB  . SER A 1 63  ? 5.569   13.160  9.414   1.00 13.59 ? 347 SER A CB  1 
ATOM   486  O OG  . SER A 1 63  ? 6.014   14.370  8.823   1.00 14.14 ? 347 SER A OG  1 
ATOM   487  N N   . GLN A 1 64  ? 6.954   15.145  11.564  1.00 13.25 ? 348 GLN A N   1 
ATOM   488  C CA  . GLN A 1 64  ? 6.793   16.469  12.155  1.00 13.37 ? 348 GLN A CA  1 
ATOM   489  C C   . GLN A 1 64  ? 5.892   17.310  11.215  1.00 16.62 ? 348 GLN A C   1 
ATOM   490  O O   . GLN A 1 64  ? 5.759   16.940  10.045  1.00 14.38 ? 348 GLN A O   1 
ATOM   491  C CB  . GLN A 1 64  ? 8.136   17.165  12.311  1.00 14.44 ? 348 GLN A CB  1 
ATOM   492  C CG  . GLN A 1 64  ? 9.020   16.551  13.373  1.00 21.56 ? 348 GLN A CG  1 
ATOM   493  C CD  . GLN A 1 64  ? 10.012  17.532  13.922  1.00 28.55 ? 348 GLN A CD  1 
ATOM   494  O OE1 . GLN A 1 64  ? 10.104  18.677  13.480  1.00 22.31 ? 348 GLN A OE1 1 
ATOM   495  N NE2 . GLN A 1 64  ? 10.661  17.149  14.997  1.00 27.45 ? 348 GLN A NE2 1 
ATOM   496  N N   . PRO A 1 65  ? 5.291   18.443  11.667  1.00 14.81 ? 349 PRO A N   1 
ATOM   497  C CA  . PRO A 1 65  ? 4.439   19.243  10.754  1.00 15.14 ? 349 PRO A CA  1 
ATOM   498  C C   . PRO A 1 65  ? 5.089   19.692  9.424   1.00 19.16 ? 349 PRO A C   1 
ATOM   499  O O   . PRO A 1 65  ? 4.383   19.890  8.436   1.00 17.07 ? 349 PRO A O   1 
ATOM   500  C CB  . PRO A 1 65  ? 4.043   20.450  11.618  1.00 16.67 ? 349 PRO A CB  1 
ATOM   501  C CG  . PRO A 1 65  ? 4.125   19.952  13.013  1.00 20.93 ? 349 PRO A CG  1 
ATOM   502  C CD  . PRO A 1 65  ? 5.298   19.025  13.031  1.00 16.67 ? 349 PRO A CD  1 
ATOM   503  N N   . LEU A 1 66  ? 6.425   19.821  9.379   1.00 17.47 ? 350 LEU A N   1 
ATOM   504  C CA  . LEU A 1 66  ? 7.102   20.272  8.153   1.00 17.57 ? 350 LEU A CA  1 
ATOM   505  C C   . LEU A 1 66  ? 7.406   19.195  7.122   1.00 18.31 ? 350 LEU A C   1 
ATOM   506  O O   . LEU A 1 66  ? 7.973   19.510  6.076   1.00 16.19 ? 350 LEU A O   1 
ATOM   507  C CB  . LEU A 1 66  ? 8.358   21.123  8.466   1.00 17.88 ? 350 LEU A CB  1 
ATOM   508  C CG  . LEU A 1 66  ? 8.100   22.516  9.032   1.00 22.83 ? 350 LEU A CG  1 
ATOM   509  C CD1 . LEU A 1 66  ? 9.361   23.073  9.689   1.00 22.44 ? 350 LEU A CD1 1 
ATOM   510  C CD2 . LEU A 1 66  ? 7.584   23.468  7.951   1.00 27.16 ? 350 LEU A CD2 1 
ATOM   511  N N   . GLY A 1 67  ? 7.080   17.937  7.440   1.00 14.57 ? 351 GLY A N   1 
ATOM   512  C CA  . GLY A 1 67  ? 7.286   16.818  6.529   1.00 13.59 ? 351 GLY A CA  1 
ATOM   513  C C   . GLY A 1 67  ? 6.567   17.036  5.211   1.00 16.09 ? 351 GLY A C   1 
ATOM   514  O O   . GLY A 1 67  ? 5.377   17.370  5.202   1.00 13.45 ? 351 GLY A O   1 
ATOM   515  N N   . ASN A 1 68  ? 7.317   16.934  4.095   1.00 13.28 ? 352 ASN A N   1 
ATOM   516  C CA  . ASN A 1 68  ? 6.824   17.143  2.724   1.00 12.23 ? 352 ASN A CA  1 
ATOM   517  C C   . ASN A 1 68  ? 5.692   16.142  2.390   1.00 15.45 ? 352 ASN A C   1 
ATOM   518  O O   . ASN A 1 68  ? 5.895   14.914  2.439   1.00 14.24 ? 352 ASN A O   1 
ATOM   519  C CB  . ASN A 1 68  ? 8.002   17.007  1.719   1.00 10.24 ? 352 ASN A CB  1 
ATOM   520  C CG  . ASN A 1 68  ? 7.729   17.457  0.300   1.00 23.88 ? 352 ASN A CG  1 
ATOM   521  O OD1 . ASN A 1 68  ? 6.597   17.515  -0.169  1.00 13.08 ? 352 ASN A OD1 1 
ATOM   522  N ND2 . ASN A 1 68  ? 8.776   17.756  -0.440  1.00 21.85 ? 352 ASN A ND2 1 
ATOM   523  N N   . LEU A 1 69  ? 4.501   16.674  2.063   1.00 12.63 ? 353 LEU A N   1 
ATOM   524  C CA  . LEU A 1 69  ? 3.332   15.855  1.719   1.00 11.80 ? 353 LEU A CA  1 
ATOM   525  C C   . LEU A 1 69  ? 3.428   15.247  0.324   1.00 15.44 ? 353 LEU A C   1 
ATOM   526  O O   . LEU A 1 69  ? 2.757   14.253  0.054   1.00 16.10 ? 353 LEU A O   1 
ATOM   527  C CB  . LEU A 1 69  ? 2.016   16.630  1.906   1.00 11.28 ? 353 LEU A CB  1 
ATOM   528  C CG  . LEU A 1 69  ? 1.642   17.028  3.355   1.00 13.02 ? 353 LEU A CG  1 
ATOM   529  C CD1 . LEU A 1 69  ? 0.532   18.037  3.353   1.00 9.59  ? 353 LEU A CD1 1 
ATOM   530  C CD2 . LEU A 1 69  ? 1.270   15.807  4.224   1.00 13.57 ? 353 LEU A CD2 1 
ATOM   531  N N   . GLN A 1 70  ? 4.294   15.817  -0.543  1.00 11.92 ? 354 GLN A N   1 
ATOM   532  C CA  . GLN A 1 70  ? 4.549   15.391  -1.918  1.00 10.95 ? 354 GLN A CA  1 
ATOM   533  C C   . GLN A 1 70  ? 5.881   14.640  -2.038  1.00 15.48 ? 354 GLN A C   1 
ATOM   534  O O   . GLN A 1 70  ? 6.693   14.901  -2.932  1.00 15.40 ? 354 GLN A O   1 
ATOM   535  C CB  . GLN A 1 70  ? 4.485   16.607  -2.881  1.00 12.04 ? 354 GLN A CB  1 
ATOM   536  C CG  . GLN A 1 70  ? 3.093   17.277  -2.936  1.00 11.86 ? 354 GLN A CG  1 
ATOM   537  C CD  . GLN A 1 70  ? 2.030   16.423  -3.596  1.00 19.80 ? 354 GLN A CD  1 
ATOM   538  O OE1 . GLN A 1 70  ? 2.311   15.400  -4.231  1.00 15.21 ? 354 GLN A OE1 1 
ATOM   539  N NE2 . GLN A 1 70  ? 0.776   16.859  -3.520  1.00 14.70 ? 354 GLN A NE2 1 
ATOM   540  N N   . ALA A 1 71  ? 6.103   13.698  -1.122  1.00 11.04 ? 355 ALA A N   1 
ATOM   541  C CA  . ALA A 1 71  ? 7.316   12.901  -1.061  1.00 10.46 ? 355 ALA A CA  1 
ATOM   542  C C   . ALA A 1 71  ? 7.030   11.701  -0.172  1.00 14.52 ? 355 ALA A C   1 
ATOM   543  O O   . ALA A 1 71  ? 6.060   11.758  0.598   1.00 14.42 ? 355 ALA A O   1 
ATOM   544  C CB  . ALA A 1 71  ? 8.450   13.736  -0.466  1.00 11.23 ? 355 ALA A CB  1 
ATOM   545  N N   . PRO A 1 72  ? 7.803   10.588  -0.256  1.00 11.00 ? 356 PRO A N   1 
ATOM   546  C CA  . PRO A 1 72  ? 7.538   9.465   0.666   1.00 11.12 ? 356 PRO A CA  1 
ATOM   547  C C   . PRO A 1 72  ? 7.848   9.864   2.099   1.00 14.46 ? 356 PRO A C   1 
ATOM   548  O O   . PRO A 1 72  ? 8.523   10.873  2.327   1.00 14.96 ? 356 PRO A O   1 
ATOM   549  C CB  . PRO A 1 72  ? 8.505   8.373   0.192   1.00 12.78 ? 356 PRO A CB  1 
ATOM   550  C CG  . PRO A 1 72  ? 9.593   9.088   -0.528  1.00 16.25 ? 356 PRO A CG  1 
ATOM   551  C CD  . PRO A 1 72  ? 8.983   10.324  -1.106  1.00 11.49 ? 356 PRO A CD  1 
ATOM   552  N N   . LEU A 1 73  ? 7.366   9.086   3.064   1.00 11.38 ? 357 LEU A N   1 
ATOM   553  C CA  . LEU A 1 73  ? 7.690   9.347   4.464   1.00 10.07 ? 357 LEU A CA  1 
ATOM   554  C C   . LEU A 1 73  ? 9.145   8.938   4.625   1.00 9.41  ? 357 LEU A C   1 
ATOM   555  O O   . LEU A 1 73  ? 9.575   7.985   3.983   1.00 8.49  ? 357 LEU A O   1 
ATOM   556  C CB  . LEU A 1 73  ? 6.753   8.572   5.409   1.00 10.00 ? 357 LEU A CB  1 
ATOM   557  C CG  . LEU A 1 73  ? 6.826   8.988   6.902   1.00 14.69 ? 357 LEU A CG  1 
ATOM   558  C CD1 . LEU A 1 73  ? 6.102   10.303  7.132   1.00 15.41 ? 357 LEU A CD1 1 
ATOM   559  C CD2 . LEU A 1 73  ? 6.144   7.976   7.774   1.00 11.31 ? 357 LEU A CD2 1 
ATOM   560  N N   . GLY A 1 74  ? 9.904   9.702   5.392   1.00 7.21  ? 358 GLY A N   1 
ATOM   561  C CA  . GLY A 1 74  ? 11.341  9.469   5.573   1.00 8.48  ? 358 GLY A CA  1 
ATOM   562  C C   . GLY A 1 74  ? 12.203  10.239  4.583   1.00 11.58 ? 358 GLY A C   1 
ATOM   563  O O   . GLY A 1 74  ? 13.431  10.155  4.624   1.00 10.97 ? 358 GLY A O   1 
ATOM   564  N N   . TYR A 1 75  ? 11.569  11.011  3.694   1.00 10.13 ? 359 TYR A N   1 
ATOM   565  C CA  . TYR A 1 75  ? 12.247  11.808  2.656   1.00 10.96 ? 359 TYR A CA  1 
ATOM   566  C C   . TYR A 1 75  ? 13.249  12.861  3.179   1.00 14.22 ? 359 TYR A C   1 
ATOM   567  O O   . TYR A 1 75  ? 14.318  13.049  2.588   1.00 13.06 ? 359 TYR A O   1 
ATOM   568  C CB  . TYR A 1 75  ? 11.177  12.492  1.769   1.00 12.31 ? 359 TYR A CB  1 
ATOM   569  C CG  . TYR A 1 75  ? 11.669  13.669  0.951   1.00 12.52 ? 359 TYR A CG  1 
ATOM   570  C CD1 . TYR A 1 75  ? 12.404  13.474  -0.216  1.00 13.59 ? 359 TYR A CD1 1 
ATOM   571  C CD2 . TYR A 1 75  ? 11.340  14.980  1.305   1.00 12.46 ? 359 TYR A CD2 1 
ATOM   572  C CE1 . TYR A 1 75  ? 12.840  14.553  -0.986  1.00 13.34 ? 359 TYR A CE1 1 
ATOM   573  C CE2 . TYR A 1 75  ? 11.809  16.069  0.564   1.00 12.63 ? 359 TYR A CE2 1 
ATOM   574  C CZ  . TYR A 1 75  ? 12.562  15.848  -0.578  1.00 18.25 ? 359 TYR A CZ  1 
ATOM   575  O OH  . TYR A 1 75  ? 12.990  16.902  -1.346  1.00 18.93 ? 359 TYR A OH  1 
ATOM   576  N N   . ASP A 1 76  ? 12.848  13.598  4.221   1.00 10.83 ? 360 ASP A N   1 
ATOM   577  C CA  . ASP A 1 76  ? 13.608  14.711  4.788   1.00 11.17 ? 360 ASP A CA  1 
ATOM   578  C C   . ASP A 1 76  ? 13.902  14.502  6.290   1.00 14.63 ? 360 ASP A C   1 
ATOM   579  O O   . ASP A 1 76  ? 13.694  13.407  6.801   1.00 13.98 ? 360 ASP A O   1 
ATOM   580  C CB  . ASP A 1 76  ? 12.820  16.023  4.512   1.00 12.71 ? 360 ASP A CB  1 
ATOM   581  C CG  . ASP A 1 76  ? 11.363  15.983  4.988   1.00 16.58 ? 360 ASP A CG  1 
ATOM   582  O OD1 . ASP A 1 76  ? 11.075  15.267  5.969   1.00 18.29 ? 360 ASP A OD1 1 
ATOM   583  O OD2 . ASP A 1 76  ? 10.520  16.678  4.384   1.00 16.90 ? 360 ASP A OD2 1 
ATOM   584  N N   . LYS A 1 77  ? 14.420  15.526  6.983   1.00 12.52 ? 361 LYS A N   1 
ATOM   585  C CA  . LYS A 1 77  ? 14.747  15.436  8.416   1.00 12.63 ? 361 LYS A CA  1 
ATOM   586  C C   . LYS A 1 77  ? 13.493  15.337  9.312   1.00 14.30 ? 361 LYS A C   1 
ATOM   587  O O   . LYS A 1 77  ? 13.596  14.966  10.479  1.00 13.67 ? 361 LYS A O   1 
ATOM   588  C CB  . LYS A 1 77  ? 15.591  16.650  8.847   1.00 14.03 ? 361 LYS A CB  1 
ATOM   589  N N   . PHE A 1 78  ? 12.325  15.677  8.765   1.00 10.89 ? 362 PHE A N   1 
ATOM   590  C CA  . PHE A 1 78  ? 11.076  15.730  9.527   1.00 10.78 ? 362 PHE A CA  1 
ATOM   591  C C   . PHE A 1 78  ? 10.375  14.421  9.792   1.00 14.32 ? 362 PHE A C   1 
ATOM   592  O O   . PHE A 1 78  ? 9.486   14.391  10.635  1.00 14.50 ? 362 PHE A O   1 
ATOM   593  C CB  . PHE A 1 78  ? 10.118  16.790  8.951   1.00 12.07 ? 362 PHE A CB  1 
ATOM   594  C CG  . PHE A 1 78  ? 10.759  18.149  8.781   1.00 14.40 ? 362 PHE A CG  1 
ATOM   595  C CD1 . PHE A 1 78  ? 11.082  18.632  7.512   1.00 17.60 ? 362 PHE A CD1 1 
ATOM   596  C CD2 . PHE A 1 78  ? 11.117  18.913  9.891   1.00 16.82 ? 362 PHE A CD2 1 
ATOM   597  C CE1 . PHE A 1 78  ? 11.698  19.876  7.356   1.00 18.25 ? 362 PHE A CE1 1 
ATOM   598  C CE2 . PHE A 1 78  ? 11.736  20.160  9.734   1.00 19.25 ? 362 PHE A CE2 1 
ATOM   599  C CZ  . PHE A 1 78  ? 12.010  20.639  8.466   1.00 17.71 ? 362 PHE A CZ  1 
ATOM   600  N N   . SER A 1 79  ? 10.760  13.341  9.096   1.00 9.87  ? 363 SER A N   1 
ATOM   601  C CA  . SER A 1 79  ? 10.054  12.080  9.253   1.00 9.67  ? 363 SER A CA  1 
ATOM   602  C C   . SER A 1 79  ? 10.908  10.856  9.224   1.00 14.23 ? 363 SER A C   1 
ATOM   603  O O   . SER A 1 79  ? 12.005  10.862  8.661   1.00 15.20 ? 363 SER A O   1 
ATOM   604  C CB  . SER A 1 79  ? 8.926   11.962  8.226   1.00 10.70 ? 363 SER A CB  1 
ATOM   605  O OG  . SER A 1 79  ? 9.452   11.874  6.914   1.00 12.82 ? 363 SER A OG  1 
ATOM   606  N N   . TYR A 1 80  ? 10.355  9.781   9.805   1.00 10.62 ? 364 TYR A N   1 
ATOM   607  C CA  . TYR A 1 80  ? 10.968  8.465   9.952   1.00 10.79 ? 364 TYR A CA  1 
ATOM   608  C C   . TYR A 1 80  ? 9.968   7.418   9.499   1.00 13.83 ? 364 TYR A C   1 
ATOM   609  O O   . TYR A 1 80  ? 8.853   7.359   10.029  1.00 13.44 ? 364 TYR A O   1 
ATOM   610  C CB  . TYR A 1 80  ? 11.350  8.227   11.426  1.00 11.64 ? 364 TYR A CB  1 
ATOM   611  C CG  . TYR A 1 80  ? 12.313  9.255   11.982  1.00 13.06 ? 364 TYR A CG  1 
ATOM   612  C CD1 . TYR A 1 80  ? 11.850  10.437  12.567  1.00 14.45 ? 364 TYR A CD1 1 
ATOM   613  C CD2 . TYR A 1 80  ? 13.683  9.041   11.948  1.00 13.52 ? 364 TYR A CD2 1 
ATOM   614  C CE1 . TYR A 1 80  ? 12.733  11.385  13.079  1.00 12.76 ? 364 TYR A CE1 1 
ATOM   615  C CE2 . TYR A 1 80  ? 14.571  9.952   12.517  1.00 14.11 ? 364 TYR A CE2 1 
ATOM   616  C CZ  . TYR A 1 80  ? 14.094  11.127  13.072  1.00 19.99 ? 364 TYR A CZ  1 
ATOM   617  O OH  . TYR A 1 80  ? 14.992  12.054  13.548  1.00 22.44 ? 364 TYR A OH  1 
ATOM   618  N N   . SER A 1 81  ? 10.352  6.617   8.493   1.00 8.99  ? 365 SER A N   1 
ATOM   619  C CA  . SER A 1 81  ? 9.464   5.605   7.938   1.00 7.95  ? 365 SER A CA  1 
ATOM   620  C C   . SER A 1 81  ? 9.996   4.174   7.899   1.00 11.09 ? 365 SER A C   1 
ATOM   621  O O   . SER A 1 81  ? 11.192  3.926   8.044   1.00 10.19 ? 365 SER A O   1 
ATOM   622  C CB  . SER A 1 81  ? 8.997   6.010   6.548   1.00 8.51  ? 365 SER A CB  1 
ATOM   623  O OG  . SER A 1 81  ? 10.055  5.908   5.616   1.00 9.95  ? 365 SER A OG  1 
ATOM   624  N N   . TRP A 1 82  ? 9.059   3.250   7.684   1.00 8.54  ? 366 TRP A N   1 
ATOM   625  C CA  . TRP A 1 82  ? 9.235   1.803   7.573   1.00 8.47  ? 366 TRP A CA  1 
ATOM   626  C C   . TRP A 1 82  ? 8.586   1.379   6.268   1.00 10.56 ? 366 TRP A C   1 
ATOM   627  O O   . TRP A 1 82  ? 7.381   1.479   6.144   1.00 10.46 ? 366 TRP A O   1 
ATOM   628  C CB  . TRP A 1 82  ? 8.508   1.110   8.750   1.00 6.34  ? 366 TRP A CB  1 
ATOM   629  C CG  . TRP A 1 82  ? 8.796   -0.356  8.889   1.00 6.97  ? 366 TRP A CG  1 
ATOM   630  C CD1 . TRP A 1 82  ? 9.861   -1.050  8.378   1.00 9.46  ? 366 TRP A CD1 1 
ATOM   631  C CD2 . TRP A 1 82  ? 8.003   -1.308  9.616   1.00 6.59  ? 366 TRP A CD2 1 
ATOM   632  N NE1 . TRP A 1 82  ? 9.771   -2.377  8.729   1.00 9.25  ? 366 TRP A NE1 1 
ATOM   633  C CE2 . TRP A 1 82  ? 8.638   -2.563  9.494   1.00 10.92 ? 366 TRP A CE2 1 
ATOM   634  C CE3 . TRP A 1 82  ? 6.806   -1.221  10.348  1.00 7.84  ? 366 TRP A CE3 1 
ATOM   635  C CZ2 . TRP A 1 82  ? 8.136   -3.717  10.111  1.00 10.37 ? 366 TRP A CZ2 1 
ATOM   636  C CZ3 . TRP A 1 82  ? 6.342   -2.354  10.995  1.00 9.87  ? 366 TRP A CZ3 1 
ATOM   637  C CH2 . TRP A 1 82  ? 6.995   -3.587  10.863  1.00 10.42 ? 366 TRP A CH2 1 
ATOM   638  N N   . ARG A 1 83  ? 9.371   0.920   5.304   1.00 8.77  ? 367 ARG A N   1 
ATOM   639  C CA  . ARG A 1 83  ? 8.863   0.510   3.992   1.00 8.71  ? 367 ARG A CA  1 
ATOM   640  C C   . ARG A 1 83  ? 8.353   -0.942  3.952   1.00 13.71 ? 367 ARG A C   1 
ATOM   641  O O   . ARG A 1 83  ? 9.032   -1.843  4.425   1.00 12.87 ? 367 ARG A O   1 
ATOM   642  C CB  . ARG A 1 83  ? 9.949   0.746   2.909   1.00 6.83  ? 367 ARG A CB  1 
ATOM   643  C CG  . ARG A 1 83  ? 9.518   0.362   1.479   1.00 3.78  ? 367 ARG A CG  1 
ATOM   644  C CD  . ARG A 1 83  ? 10.568  0.688   0.438   1.00 5.05  ? 367 ARG A CD  1 
ATOM   645  N NE  . ARG A 1 83  ? 11.818  -0.058  0.618   1.00 9.57  ? 367 ARG A NE  1 
ATOM   646  C CZ  . ARG A 1 83  ? 12.861  0.029   -0.199  1.00 20.60 ? 367 ARG A CZ  1 
ATOM   647  N NH1 . ARG A 1 83  ? 12.806  0.803   -1.274  1.00 8.05  ? 367 ARG A NH1 1 
ATOM   648  N NH2 . ARG A 1 83  ? 13.961  -0.675  0.042   1.00 9.89  ? 367 ARG A NH2 1 
ATOM   649  N N   . SER A 1 84  ? 7.189   -1.160  3.307   1.00 11.95 ? 368 SER A N   1 
ATOM   650  C CA  . SER A 1 84  ? 6.576   -2.459  3.059   1.00 11.64 ? 368 SER A CA  1 
ATOM   651  C C   . SER A 1 84  ? 7.564   -3.392  2.340   1.00 14.71 ? 368 SER A C   1 
ATOM   652  O O   . SER A 1 84  ? 7.831   -4.482  2.822   1.00 12.67 ? 368 SER A O   1 
ATOM   653  C CB  . SER A 1 84  ? 5.321   -2.275  2.213   1.00 15.27 ? 368 SER A CB  1 
ATOM   654  O OG  . SER A 1 84  ? 5.663   -1.593  1.018   1.00 18.64 ? 368 SER A OG  1 
ATOM   655  N N   . LYS A 1 85  ? 8.116   -2.936  1.209   1.00 14.03 ? 369 LYS A N   1 
ATOM   656  C CA  . LYS A 1 85  ? 9.132   -3.615  0.401   1.00 13.74 ? 369 LYS A CA  1 
ATOM   657  C C   . LYS A 1 85  ? 10.432  -3.698  1.227   1.00 17.63 ? 369 LYS A C   1 
ATOM   658  O O   . LYS A 1 85  ? 10.986  -2.660  1.580   1.00 17.47 ? 369 LYS A O   1 
ATOM   659  C CB  . LYS A 1 85  ? 9.367   -2.795  -0.901  1.00 16.40 ? 369 LYS A CB  1 
ATOM   660  C CG  . LYS A 1 85  ? 10.319  -3.424  -1.926  1.00 27.91 ? 369 LYS A CG  1 
ATOM   661  C CD  . LYS A 1 85  ? 11.171  -2.354  -2.618  1.00 38.33 ? 369 LYS A CD  1 
ATOM   662  C CE  . LYS A 1 85  ? 10.900  -2.171  -4.099  1.00 46.71 ? 369 LYS A CE  1 
ATOM   663  N NZ  . LYS A 1 85  ? 11.423  -0.858  -4.598  1.00 48.44 ? 369 LYS A NZ  1 
ATOM   664  N N   . LYS A 1 86  ? 10.886  -4.934  1.564   1.00 14.30 ? 370 LYS A N   1 
ATOM   665  C CA  . LYS A 1 86  ? 12.137  -5.241  2.296   1.00 13.70 ? 370 LYS A CA  1 
ATOM   666  C C   . LYS A 1 86  ? 12.274  -4.816  3.785   1.00 15.74 ? 370 LYS A C   1 
ATOM   667  O O   . LYS A 1 86  ? 13.314  -5.085  4.386   1.00 16.32 ? 370 LYS A O   1 
ATOM   668  C CB  . LYS A 1 86  ? 13.397  -4.856  1.467   1.00 16.02 ? 370 LYS A CB  1 
ATOM   669  C CG  . LYS A 1 86  ? 13.506  -5.556  0.094   1.00 17.84 ? 370 LYS A CG  1 
ATOM   670  C CD  . LYS A 1 86  ? 14.839  -5.246  -0.623  1.00 25.68 ? 370 LYS A CD  1 
ATOM   671  C CE  . LYS A 1 86  ? 14.896  -3.879  -1.254  1.00 38.13 ? 370 LYS A CE  1 
ATOM   672  N NZ  . LYS A 1 86  ? 16.262  -3.563  -1.751  1.00 49.33 ? 370 LYS A NZ  1 
ATOM   673  N N   . GLY A 1 87  ? 11.245  -4.190  4.363   1.00 12.69 ? 371 GLY A N   1 
ATOM   674  C CA  . GLY A 1 87  ? 11.225  -3.740  5.759   1.00 11.51 ? 371 GLY A CA  1 
ATOM   675  C C   . GLY A 1 87  ? 12.258  -2.672  6.076   1.00 14.93 ? 371 GLY A C   1 
ATOM   676  O O   . GLY A 1 87  ? 12.657  -2.500  7.235   1.00 13.06 ? 371 GLY A O   1 
ATOM   677  N N   . THR A 1 88  ? 12.683  -1.932  5.040   1.00 12.45 ? 372 THR A N   1 
ATOM   678  C CA  . THR A 1 88  ? 13.711  -0.889  5.125   1.00 13.09 ? 372 THR A CA  1 
ATOM   679  C C   . THR A 1 88  ? 13.254  0.306   5.979   1.00 16.04 ? 372 THR A C   1 
ATOM   680  O O   . THR A 1 88  ? 12.081  0.693   5.921   1.00 14.98 ? 372 THR A O   1 
ATOM   681  C CB  . THR A 1 88  ? 14.081  -0.426  3.696   1.00 18.64 ? 372 THR A CB  1 
ATOM   682  O OG1 . THR A 1 88  ? 14.265  -1.570  2.863   1.00 16.06 ? 372 THR A OG1 1 
ATOM   683  C CG2 . THR A 1 88  ? 15.334  0.443   3.656   1.00 16.68 ? 372 THR A CG2 1 
ATOM   684  N N   . LYS A 1 89  ? 14.180  0.875   6.771   1.00 10.47 ? 373 LYS A N   1 
ATOM   685  C CA  . LYS A 1 89  ? 13.868  2.084   7.531   1.00 10.84 ? 373 LYS A CA  1 
ATOM   686  C C   . LYS A 1 89  ? 14.402  3.292   6.728   1.00 14.38 ? 373 LYS A C   1 
ATOM   687  O O   . LYS A 1 89  ? 15.495  3.194   6.154   1.00 13.56 ? 373 LYS A O   1 
ATOM   688  C CB  . LYS A 1 89  ? 14.393  2.046   8.988   1.00 11.72 ? 373 LYS A CB  1 
ATOM   689  C CG  . LYS A 1 89  ? 15.908  1.913   9.163   1.00 11.97 ? 373 LYS A CG  1 
ATOM   690  C CD  . LYS A 1 89  ? 16.279  1.800   10.636  1.00 9.01  ? 373 LYS A CD  1 
ATOM   691  C CE  . LYS A 1 89  ? 17.761  1.916   10.805  1.00 11.39 ? 373 LYS A CE  1 
ATOM   692  N NZ  . LYS A 1 89  ? 18.165  1.742   12.229  1.00 8.25  ? 373 LYS A NZ  1 
ATOM   693  N N   . PHE A 1 90  ? 13.613  4.392   6.636   1.00 9.78  ? 374 PHE A N   1 
ATOM   694  C CA  . PHE A 1 90  ? 14.019  5.608   5.894   1.00 8.54  ? 374 PHE A CA  1 
ATOM   695  C C   . PHE A 1 90  ? 13.957  6.899   6.718   1.00 12.12 ? 374 PHE A C   1 
ATOM   696  O O   . PHE A 1 90  ? 12.987  7.157   7.448   1.00 9.05  ? 374 PHE A O   1 
ATOM   697  C CB  . PHE A 1 90  ? 13.185  5.800   4.617   1.00 9.47  ? 374 PHE A CB  1 
ATOM   698  C CG  . PHE A 1 90  ? 13.530  4.882   3.470   1.00 9.58  ? 374 PHE A CG  1 
ATOM   699  C CD1 . PHE A 1 90  ? 12.899  3.649   3.331   1.00 9.35  ? 374 PHE A CD1 1 
ATOM   700  C CD2 . PHE A 1 90  ? 14.442  5.275   2.491   1.00 9.43  ? 374 PHE A CD2 1 
ATOM   701  C CE1 . PHE A 1 90  ? 13.198  2.814   2.256   1.00 8.88  ? 374 PHE A CE1 1 
ATOM   702  C CE2 . PHE A 1 90  ? 14.754  4.424   1.424   1.00 10.64 ? 374 PHE A CE2 1 
ATOM   703  C CZ  . PHE A 1 90  ? 14.154  3.192   1.329   1.00 7.54  ? 374 PHE A CZ  1 
ATOM   704  N N   . HIS A 1 91  ? 15.013  7.711   6.576   1.00 9.82  ? 375 HIS A N   1 
ATOM   705  C CA  . HIS A 1 91  ? 15.161  9.036   7.186   1.00 8.92  ? 375 HIS A CA  1 
ATOM   706  C C   . HIS A 1 91  ? 16.103  9.830   6.311   1.00 12.76 ? 375 HIS A C   1 
ATOM   707  O O   . HIS A 1 91  ? 17.174  9.328   5.965   1.00 12.56 ? 375 HIS A O   1 
ATOM   708  C CB  . HIS A 1 91  ? 15.685  8.973   8.632   1.00 8.87  ? 375 HIS A CB  1 
ATOM   709  C CG  . HIS A 1 91  ? 15.735  10.317  9.291   1.00 10.81 ? 375 HIS A CG  1 
ATOM   710  N ND1 . HIS A 1 91  ? 14.605  11.111  9.389   1.00 11.69 ? 375 HIS A ND1 1 
ATOM   711  C CD2 . HIS A 1 91  ? 16.772  10.957  9.876   1.00 11.23 ? 375 HIS A CD2 1 
ATOM   712  C CE1 . HIS A 1 91  ? 14.991  12.198  10.035  1.00 10.53 ? 375 HIS A CE1 1 
ATOM   713  N NE2 . HIS A 1 91  ? 16.285  12.158  10.334  1.00 10.70 ? 375 HIS A NE2 1 
ATOM   714  N N   . GLN A 1 92  ? 15.695  11.055  5.922   1.00 9.42  ? 376 GLN A N   1 
ATOM   715  C CA  . GLN A 1 92  ? 16.472  11.931  5.032   1.00 9.65  ? 376 GLN A CA  1 
ATOM   716  C C   . GLN A 1 92  ? 16.823  11.267  3.685   1.00 14.43 ? 376 GLN A C   1 
ATOM   717  O O   . GLN A 1 92  ? 17.875  11.551  3.098   1.00 16.29 ? 376 GLN A O   1 
ATOM   718  C CB  . GLN A 1 92  ? 17.725  12.490  5.748   1.00 10.98 ? 376 GLN A CB  1 
ATOM   719  C CG  . GLN A 1 92  ? 17.392  13.680  6.627   1.00 13.60 ? 376 GLN A CG  1 
ATOM   720  C CD  . GLN A 1 92  ? 18.608  14.279  7.299   1.00 28.79 ? 376 GLN A CD  1 
ATOM   721  O OE1 . GLN A 1 92  ? 18.886  15.477  7.179   1.00 27.89 ? 376 GLN A OE1 1 
ATOM   722  N NE2 . GLN A 1 92  ? 19.336  13.476  8.047   1.00 12.29 ? 376 GLN A NE2 1 
ATOM   723  N N   . SER A 1 93  ? 15.924  10.373  3.212   1.00 10.37 ? 377 SER A N   1 
ATOM   724  C CA  . SER A 1 93  ? 15.982  9.627   1.950   1.00 8.64  ? 377 SER A CA  1 
ATOM   725  C C   . SER A 1 93  ? 17.030  8.518   1.934   1.00 14.23 ? 377 SER A C   1 
ATOM   726  O O   . SER A 1 93  ? 17.374  8.009   0.868   1.00 13.93 ? 377 SER A O   1 
ATOM   727  C CB  . SER A 1 93  ? 16.141  10.575  0.764   1.00 9.79  ? 377 SER A CB  1 
ATOM   728  O OG  . SER A 1 93  ? 14.992  11.389  0.595   1.00 12.36 ? 377 SER A OG  1 
ATOM   729  N N   . ILE A 1 94  ? 17.500  8.124   3.137   1.00 12.63 ? 378 ILE A N   1 
ATOM   730  C CA  . ILE A 1 94  ? 18.489  7.076   3.369   1.00 11.81 ? 378 ILE A CA  1 
ATOM   731  C C   . ILE A 1 94  ? 17.785  5.832   3.898   1.00 13.33 ? 378 ILE A C   1 
ATOM   732  O O   . ILE A 1 94  ? 17.250  5.832   5.012   1.00 10.20 ? 378 ILE A O   1 
ATOM   733  C CB  . ILE A 1 94  ? 19.619  7.541   4.344   1.00 14.59 ? 378 ILE A CB  1 
ATOM   734  C CG1 . ILE A 1 94  ? 20.342  8.805   3.817   1.00 15.28 ? 378 ILE A CG1 1 
ATOM   735  C CG2 . ILE A 1 94  ? 20.610  6.377   4.656   1.00 13.63 ? 378 ILE A CG2 1 
ATOM   736  C CD1 . ILE A 1 94  ? 21.312  8.600   2.525   1.00 16.66 ? 378 ILE A CD1 1 
ATOM   737  N N   . GLY A 1 95  ? 17.849  4.773   3.109   1.00 10.32 ? 379 GLY A N   1 
ATOM   738  C CA  . GLY A 1 95  ? 17.287  3.488   3.480   1.00 9.66  ? 379 GLY A CA  1 
ATOM   739  C C   . GLY A 1 95  ? 18.315  2.639   4.189   1.00 15.03 ? 379 GLY A C   1 
ATOM   740  O O   . GLY A 1 95  ? 19.429  2.484   3.695   1.00 13.39 ? 379 GLY A O   1 
ATOM   741  N N   . LYS A 1 96  ? 17.963  2.097   5.365   1.00 12.75 ? 380 LYS A N   1 
ATOM   742  C CA  . LYS A 1 96  ? 18.894  1.226   6.084   1.00 13.20 ? 380 LYS A CA  1 
ATOM   743  C C   . LYS A 1 96  ? 18.193  -0.080  6.413   1.00 16.97 ? 380 LYS A C   1 
ATOM   744  O O   . LYS A 1 96  ? 16.977  -0.065  6.602   1.00 16.45 ? 380 LYS A O   1 
ATOM   745  C CB  . LYS A 1 96  ? 19.402  1.906   7.365   1.00 14.56 ? 380 LYS A CB  1 
ATOM   746  C CG  . LYS A 1 96  ? 20.462  2.958   7.109   1.00 21.16 ? 380 LYS A CG  1 
ATOM   747  C CD  . LYS A 1 96  ? 20.856  3.722   8.359   1.00 27.02 ? 380 LYS A CD  1 
ATOM   748  C CE  . LYS A 1 96  ? 22.111  4.547   8.119   1.00 30.19 ? 380 LYS A CE  1 
ATOM   749  N NZ  . LYS A 1 96  ? 22.308  5.579   9.172   1.00 29.05 ? 380 LYS A NZ  1 
ATOM   750  N N   . HIS A 1 97  ? 18.940  -1.196  6.507   1.00 13.03 ? 381 HIS A N   1 
ATOM   751  C CA  . HIS A 1 97  ? 18.341  -2.475  6.888   1.00 14.31 ? 381 HIS A CA  1 
ATOM   752  C C   . HIS A 1 97  ? 17.681  -2.334  8.275   1.00 16.30 ? 381 HIS A C   1 
ATOM   753  O O   . HIS A 1 97  ? 18.217  -1.667  9.168   1.00 16.43 ? 381 HIS A O   1 
ATOM   754  C CB  . HIS A 1 97  ? 19.347  -3.646  6.891   1.00 16.16 ? 381 HIS A CB  1 
ATOM   755  C CG  . HIS A 1 97  ? 18.716  -4.941  7.353   1.00 20.87 ? 381 HIS A CG  1 
ATOM   756  N ND1 . HIS A 1 97  ? 18.001  -5.759  6.475   1.00 22.64 ? 381 HIS A ND1 1 
ATOM   757  C CD2 . HIS A 1 97  ? 18.616  -5.459  8.606   1.00 22.76 ? 381 HIS A CD2 1 
ATOM   758  C CE1 . HIS A 1 97  ? 17.524  -6.747  7.213   1.00 21.97 ? 381 HIS A CE1 1 
ATOM   759  N NE2 . HIS A 1 97  ? 17.862  -6.611  8.499   1.00 22.32 ? 381 HIS A NE2 1 
ATOM   760  N N   . TYR A 1 98  ? 16.509  -2.935  8.428   1.00 11.99 ? 382 TYR A N   1 
ATOM   761  C CA  . TYR A 1 98  ? 15.781  -2.892  9.685   1.00 11.29 ? 382 TYR A CA  1 
ATOM   762  C C   . TYR A 1 98  ? 15.059  -4.220  9.966   1.00 13.94 ? 382 TYR A C   1 
ATOM   763  O O   . TYR A 1 98  ? 15.366  -4.903  10.928  1.00 11.74 ? 382 TYR A O   1 
ATOM   764  C CB  . TYR A 1 98  ? 14.837  -1.669  9.726   1.00 11.28 ? 382 TYR A CB  1 
ATOM   765  C CG  . TYR A 1 98  ? 13.950  -1.640  10.947  1.00 12.01 ? 382 TYR A CG  1 
ATOM   766  C CD1 . TYR A 1 98  ? 14.486  -1.449  12.219  1.00 13.70 ? 382 TYR A CD1 1 
ATOM   767  C CD2 . TYR A 1 98  ? 12.573  -1.818  10.837  1.00 13.00 ? 382 TYR A CD2 1 
ATOM   768  C CE1 . TYR A 1 98  ? 13.682  -1.480  13.355  1.00 12.90 ? 382 TYR A CE1 1 
ATOM   769  C CE2 . TYR A 1 98  ? 11.751  -1.817  11.969  1.00 13.73 ? 382 TYR A CE2 1 
ATOM   770  C CZ  . TYR A 1 98  ? 12.310  -1.627  13.224  1.00 16.25 ? 382 TYR A CZ  1 
ATOM   771  O OH  . TYR A 1 98  ? 11.521  -1.602  14.350  1.00 14.89 ? 382 TYR A OH  1 
ATOM   772  N N   . SER A 1 99  ? 14.104  -4.586  9.136   1.00 12.19 ? 383 SER A N   1 
ATOM   773  C CA  . SER A 1 99  ? 13.375  -5.822  9.388   1.00 11.66 ? 383 SER A CA  1 
ATOM   774  C C   . SER A 1 99  ? 13.167  -6.527  8.062   1.00 17.72 ? 383 SER A C   1 
ATOM   775  O O   . SER A 1 99  ? 13.735  -6.105  7.052   1.00 18.18 ? 383 SER A O   1 
ATOM   776  C CB  . SER A 1 99  ? 12.049  -5.510  10.094  1.00 10.42 ? 383 SER A CB  1 
ATOM   777  O OG  . SER A 1 99  ? 11.089  -4.922  9.231   1.00 14.41 ? 383 SER A OG  1 
ATOM   778  N N   . SER A 1 100 ? 12.380  -7.596  8.053   1.00 15.86 ? 384 SER A N   1 
ATOM   779  C CA  . SER A 1 100 ? 12.012  -8.240  6.800   1.00 17.44 ? 384 SER A CA  1 
ATOM   780  C C   . SER A 1 100 ? 10.747  -7.462  6.368   1.00 21.82 ? 384 SER A C   1 
ATOM   781  O O   . SER A 1 100 ? 10.207  -6.685  7.177   1.00 23.41 ? 384 SER A O   1 
ATOM   782  C CB  . SER A 1 100 ? 11.743  -9.731  7.003   1.00 21.47 ? 384 SER A CB  1 
ATOM   783  O OG  . SER A 1 100 ? 10.699  -9.936  7.938   1.00 29.00 ? 384 SER A OG  1 
ATOM   784  N N   . GLY A 1 101 ? 10.321  -7.617  5.115   1.00 15.11 ? 385 GLY A N   1 
ATOM   785  C CA  . GLY A 1 101 ? 9.168   -6.879  4.603   1.00 13.76 ? 385 GLY A CA  1 
ATOM   786  C C   . GLY A 1 101 ? 7.822   -7.127  5.254   1.00 16.47 ? 385 GLY A C   1 
ATOM   787  O O   . GLY A 1 101 ? 7.660   -8.018  6.093   1.00 17.21 ? 385 GLY A O   1 
ATOM   788  N N   . TYR A 1 102 ? 6.842   -6.310  4.881   1.00 12.09 ? 386 TYR A N   1 
ATOM   789  C CA  . TYR A 1 102 ? 5.452   -6.454  5.324   1.00 10.56 ? 386 TYR A CA  1 
ATOM   790  C C   . TYR A 1 102 ? 4.549   -6.193  4.120   1.00 12.95 ? 386 TYR A C   1 
ATOM   791  O O   . TYR A 1 102 ? 4.980   -5.542  3.170   1.00 10.64 ? 386 TYR A O   1 
ATOM   792  C CB  . TYR A 1 102 ? 5.088   -5.553  6.549   1.00 10.47 ? 386 TYR A CB  1 
ATOM   793  C CG  . TYR A 1 102 ? 5.121   -4.057  6.310   1.00 10.32 ? 386 TYR A CG  1 
ATOM   794  C CD1 . TYR A 1 102 ? 4.047   -3.401  5.700   1.00 11.48 ? 386 TYR A CD1 1 
ATOM   795  C CD2 . TYR A 1 102 ? 6.168   -3.277  6.801   1.00 9.88  ? 386 TYR A CD2 1 
ATOM   796  C CE1 . TYR A 1 102 ? 4.050   -2.017  5.527   1.00 11.32 ? 386 TYR A CE1 1 
ATOM   797  C CE2 . TYR A 1 102 ? 6.183   -1.897  6.631   1.00 9.57  ? 386 TYR A CE2 1 
ATOM   798  C CZ  . TYR A 1 102 ? 5.127   -1.272  5.986   1.00 16.41 ? 386 TYR A CZ  1 
ATOM   799  O OH  . TYR A 1 102 ? 5.175   0.079   5.774   1.00 13.57 ? 386 TYR A OH  1 
ATOM   800  N N   . GLY A 1 103 ? 3.316   -6.673  4.174   1.00 11.17 ? 387 GLY A N   1 
ATOM   801  C CA  . GLY A 1 103 ? 2.401   -6.513  3.059   1.00 11.16 ? 387 GLY A CA  1 
ATOM   802  C C   . GLY A 1 103 ? 0.963   -6.739  3.439   1.00 16.40 ? 387 GLY A C   1 
ATOM   803  O O   . GLY A 1 103 ? 0.588   -6.534  4.596   1.00 16.12 ? 387 GLY A O   1 
ATOM   804  N N   . GLN A 1 104 ? 0.150   -7.161  2.449   1.00 12.55 ? 388 GLN A N   1 
ATOM   805  C CA  . GLN A 1 104 ? -1.275  -7.390  2.593   1.00 12.96 ? 388 GLN A CA  1 
ATOM   806  C C   . GLN A 1 104 ? -1.612  -8.281  3.797   1.00 17.61 ? 388 GLN A C   1 
ATOM   807  O O   . GLN A 1 104 ? -1.010  -9.341  3.976   1.00 18.01 ? 388 GLN A O   1 
ATOM   808  C CB  . GLN A 1 104 ? -1.864  -7.958  1.285   1.00 13.88 ? 388 GLN A CB  1 
ATOM   809  C CG  . GLN A 1 104 ? -3.384  -8.083  1.321   1.00 15.87 ? 388 GLN A CG  1 
ATOM   810  C CD  . GLN A 1 104 ? -3.983  -8.219  -0.054  1.00 30.74 ? 388 GLN A CD  1 
ATOM   811  O OE1 . GLN A 1 104 ? -3.600  -7.531  -1.014  1.00 29.06 ? 388 GLN A OE1 1 
ATOM   812  N NE2 . GLN A 1 104 ? -4.964  -9.095  -0.167  1.00 18.25 ? 388 GLN A NE2 1 
ATOM   813  N N   . GLY A 1 105 ? -2.559  -7.821  4.601   1.00 13.26 ? 389 GLY A N   1 
ATOM   814  C CA  . GLY A 1 105 ? -3.026  -8.552  5.769   1.00 12.70 ? 389 GLY A CA  1 
ATOM   815  C C   . GLY A 1 105 ? -2.241  -8.297  7.038   1.00 15.89 ? 389 GLY A C   1 
ATOM   816  O O   . GLY A 1 105 ? -2.718  -8.647  8.116   1.00 15.16 ? 389 GLY A O   1 
ATOM   817  N N   . ASP A 1 106 ? -1.009  -7.732  6.928   1.00 13.12 ? 390 ASP A N   1 
ATOM   818  C CA  . ASP A 1 106 ? -0.159  -7.447  8.101   1.00 12.06 ? 390 ASP A CA  1 
ATOM   819  C C   . ASP A 1 106 ? -0.669  -6.266  8.918   1.00 15.62 ? 390 ASP A C   1 
ATOM   820  O O   . ASP A 1 106 ? -1.181  -5.284  8.353   1.00 14.77 ? 390 ASP A O   1 
ATOM   821  C CB  . ASP A 1 106 ? 1.299   -7.218  7.682   1.00 13.34 ? 390 ASP A CB  1 
ATOM   822  C CG  . ASP A 1 106 ? 2.011   -8.470  7.203   1.00 15.26 ? 390 ASP A CG  1 
ATOM   823  O OD1 . ASP A 1 106 ? 1.671   -9.580  7.692   1.00 14.15 ? 390 ASP A OD1 1 
ATOM   824  O OD2 . ASP A 1 106 ? 2.947   -8.343  6.394   1.00 18.65 ? 390 ASP A OD2 1 
ATOM   825  N N   . VAL A 1 107 ? -0.551  -6.374  10.255  1.00 13.05 ? 391 VAL A N   1 
ATOM   826  C CA  . VAL A 1 107 ? -0.962  -5.301  11.174  1.00 11.96 ? 391 VAL A CA  1 
ATOM   827  C C   . VAL A 1 107 ? 0.307   -4.711  11.742  1.00 14.64 ? 391 VAL A C   1 
ATOM   828  O O   . VAL A 1 107 ? 1.002   -5.358  12.540  1.00 13.78 ? 391 VAL A O   1 
ATOM   829  C CB  . VAL A 1 107 ? -1.969  -5.716  12.287  1.00 13.90 ? 391 VAL A CB  1 
ATOM   830  C CG1 . VAL A 1 107 ? -2.288  -4.532  13.201  1.00 12.97 ? 391 VAL A CG1 1 
ATOM   831  C CG2 . VAL A 1 107 ? -3.261  -6.289  11.690  1.00 13.03 ? 391 VAL A CG2 1 
ATOM   832  N N   . LEU A 1 108 ? 0.611   -3.477  11.338  1.00 10.79 ? 392 LEU A N   1 
ATOM   833  C CA  . LEU A 1 108 ? 1.839   -2.825  11.800  1.00 10.01 ? 392 LEU A CA  1 
ATOM   834  C C   . LEU A 1 108 ? 1.584   -1.929  12.995  1.00 13.78 ? 392 LEU A C   1 
ATOM   835  O O   . LEU A 1 108 ? 0.544   -1.281  13.073  1.00 14.85 ? 392 LEU A O   1 
ATOM   836  C CB  . LEU A 1 108 ? 2.607   -2.093  10.646  1.00 9.57  ? 392 LEU A CB  1 
ATOM   837  C CG  . LEU A 1 108 ? 3.009   -2.898  9.385   1.00 11.95 ? 392 LEU A CG  1 
ATOM   838  C CD1 . LEU A 1 108 ? 3.482   -4.299  9.721   1.00 8.44  ? 392 LEU A CD1 1 
ATOM   839  C CD2 . LEU A 1 108 ? 1.846   -2.952  8.368   1.00 12.98 ? 392 LEU A CD2 1 
ATOM   840  N N   . GLY A 1 109 ? 2.520   -1.955  13.928  1.00 9.48  ? 393 GLY A N   1 
ATOM   841  C CA  . GLY A 1 109 ? 2.483   -1.216  15.182  1.00 8.95  ? 393 GLY A CA  1 
ATOM   842  C C   . GLY A 1 109 ? 3.495   -0.102  15.204  1.00 12.63 ? 393 GLY A C   1 
ATOM   843  O O   . GLY A 1 109 ? 4.609   -0.265  14.699  1.00 11.43 ? 393 GLY A O   1 
ATOM   844  N N   . PHE A 1 110 ? 3.086   1.065   15.716  1.00 11.20 ? 394 PHE A N   1 
ATOM   845  C CA  . PHE A 1 110 ? 3.958   2.249   15.704  1.00 11.47 ? 394 PHE A CA  1 
ATOM   846  C C   . PHE A 1 110 ? 4.100   2.843   17.068  1.00 13.83 ? 394 PHE A C   1 
ATOM   847  O O   . PHE A 1 110 ? 3.127   3.358   17.613  1.00 13.27 ? 394 PHE A O   1 
ATOM   848  C CB  . PHE A 1 110 ? 3.443   3.286   14.693  1.00 12.77 ? 394 PHE A CB  1 
ATOM   849  C CG  . PHE A 1 110 ? 3.412   2.714   13.298  1.00 13.47 ? 394 PHE A CG  1 
ATOM   850  C CD1 . PHE A 1 110 ? 2.326   1.955   12.862  1.00 14.35 ? 394 PHE A CD1 1 
ATOM   851  C CD2 . PHE A 1 110 ? 4.522   2.827   12.459  1.00 13.28 ? 394 PHE A CD2 1 
ATOM   852  C CE1 . PHE A 1 110 ? 2.347   1.333   11.610  1.00 14.93 ? 394 PHE A CE1 1 
ATOM   853  C CE2 . PHE A 1 110 ? 4.537   2.206   11.205  1.00 14.73 ? 394 PHE A CE2 1 
ATOM   854  C CZ  . PHE A 1 110 ? 3.460   1.450   10.799  1.00 13.00 ? 394 PHE A CZ  1 
ATOM   855  N N   . TYR A 1 111 ? 5.315   2.752   17.619  1.00 9.43  ? 395 TYR A N   1 
ATOM   856  C CA  . TYR A 1 111 ? 5.641   3.275   18.950  1.00 9.55  ? 395 TYR A CA  1 
ATOM   857  C C   . TYR A 1 111 ? 6.605   4.462   18.844  1.00 12.43 ? 395 TYR A C   1 
ATOM   858  O O   . TYR A 1 111 ? 7.534   4.445   18.046  1.00 12.32 ? 395 TYR A O   1 
ATOM   859  C CB  . TYR A 1 111 ? 6.251   2.146   19.804  1.00 9.31  ? 395 TYR A CB  1 
ATOM   860  C CG  . TYR A 1 111 ? 6.813   2.562   21.148  1.00 11.06 ? 395 TYR A CG  1 
ATOM   861  C CD1 . TYR A 1 111 ? 6.061   2.425   22.315  1.00 12.18 ? 395 TYR A CD1 1 
ATOM   862  C CD2 . TYR A 1 111 ? 8.124   3.029   21.265  1.00 11.72 ? 395 TYR A CD2 1 
ATOM   863  C CE1 . TYR A 1 111 ? 6.588   2.779   23.560  1.00 11.78 ? 395 TYR A CE1 1 
ATOM   864  C CE2 . TYR A 1 111 ? 8.658   3.388   22.501  1.00 12.27 ? 395 TYR A CE2 1 
ATOM   865  C CZ  . TYR A 1 111 ? 7.891   3.249   23.645  1.00 15.86 ? 395 TYR A CZ  1 
ATOM   866  O OH  . TYR A 1 111 ? 8.435   3.595   24.852  1.00 16.06 ? 395 TYR A OH  1 
ATOM   867  N N   . ILE A 1 112 ? 6.378   5.474   19.653  1.00 9.65  ? 396 ILE A N   1 
ATOM   868  C CA  . ILE A 1 112 ? 7.273   6.620   19.796  1.00 9.28  ? 396 ILE A CA  1 
ATOM   869  C C   . ILE A 1 112 ? 7.411   6.922   21.295  1.00 13.84 ? 396 ILE A C   1 
ATOM   870  O O   . ILE A 1 112 ? 6.444   6.785   22.040  1.00 13.67 ? 396 ILE A O   1 
ATOM   871  C CB  . ILE A 1 112 ? 6.880   7.876   18.951  1.00 12.18 ? 396 ILE A CB  1 
ATOM   872  C CG1 . ILE A 1 112 ? 8.105   8.785   18.703  1.00 11.71 ? 396 ILE A CG1 1 
ATOM   873  C CG2 . ILE A 1 112 ? 5.704   8.665   19.563  1.00 13.86 ? 396 ILE A CG2 1 
ATOM   874  C CD1 . ILE A 1 112 ? 7.988   9.727   17.486  1.00 10.85 ? 396 ILE A CD1 1 
ATOM   875  N N   . ASN A 1 113 ? 8.615   7.277   21.728  1.00 10.94 ? 397 ASN A N   1 
ATOM   876  C CA  . ASN A 1 113 ? 8.864   7.701   23.092  1.00 10.38 ? 397 ASN A CA  1 
ATOM   877  C C   . ASN A 1 113 ? 9.584   9.020   23.041  1.00 13.59 ? 397 ASN A C   1 
ATOM   878  O O   . ASN A 1 113 ? 10.700  9.086   22.509  1.00 12.95 ? 397 ASN A O   1 
ATOM   879  C CB  . ASN A 1 113 ? 9.701   6.701   23.894  1.00 8.41  ? 397 ASN A CB  1 
ATOM   880  C CG  . ASN A 1 113 ? 9.744   7.065   25.365  1.00 19.87 ? 397 ASN A CG  1 
ATOM   881  O OD1 . ASN A 1 113 ? 8.771   7.541   25.934  1.00 17.87 ? 397 ASN A OD1 1 
ATOM   882  N ND2 . ASN A 1 113 ? 10.884  6.929   25.997  1.00 16.82 ? 397 ASN A ND2 1 
ATOM   883  N N   . LEU A 1 114 ? 8.967   10.059  23.608  1.00 11.57 ? 398 LEU A N   1 
ATOM   884  C CA  . LEU A 1 114 ? 9.575   11.394  23.668  1.00 13.07 ? 398 LEU A CA  1 
ATOM   885  C C   . LEU A 1 114 ? 9.762   11.756  25.171  1.00 20.17 ? 398 LEU A C   1 
ATOM   886  O O   . LEU A 1 114 ? 8.853   12.317  25.784  1.00 19.87 ? 398 LEU A O   1 
ATOM   887  C CB  . LEU A 1 114 ? 8.718   12.429  22.874  1.00 12.82 ? 398 LEU A CB  1 
ATOM   888  C CG  . LEU A 1 114 ? 8.425   12.057  21.372  1.00 17.05 ? 398 LEU A CG  1 
ATOM   889  C CD1 . LEU A 1 114 ? 7.293   12.907  20.782  1.00 16.98 ? 398 LEU A CD1 1 
ATOM   890  C CD2 . LEU A 1 114 ? 9.658   12.208  20.504  1.00 16.93 ? 398 LEU A CD2 1 
ATOM   891  N N   . PRO A 1 115 ? 10.887  11.336  25.811  1.00 19.24 ? 399 PRO A N   1 
ATOM   892  C CA  . PRO A 1 115 ? 11.061  11.598  27.258  1.00 25.40 ? 399 PRO A CA  1 
ATOM   893  C C   . PRO A 1 115 ? 11.114  13.073  27.628  1.00 57.04 ? 399 PRO A C   1 
ATOM   894  O O   . PRO A 1 115 ? 11.557  13.870  26.814  1.00 31.39 ? 399 PRO A O   1 
ATOM   895  C CB  . PRO A 1 115 ? 12.387  10.898  27.598  1.00 26.03 ? 399 PRO A CB  1 
ATOM   896  C CG  . PRO A 1 115 ? 12.625  9.936   26.481  1.00 28.41 ? 399 PRO A CG  1 
ATOM   897  C CD  . PRO A 1 115 ? 12.054  10.616  25.266  1.00 22.41 ? 399 PRO A CD  1 
ATOM   898  N N   . GLY A 1 122 ? 16.506  9.723   26.415  1.00 23.70 ? 444 GLY A N   1 
ATOM   899  C CA  . GLY A 1 122 ? 16.685  9.408   25.011  1.00 23.04 ? 444 GLY A CA  1 
ATOM   900  C C   . GLY A 1 122 ? 15.394  8.934   24.316  1.00 23.90 ? 444 GLY A C   1 
ATOM   901  O O   . GLY A 1 122 ? 14.766  7.954   24.714  1.00 24.13 ? 444 GLY A O   1 
ATOM   902  N N   . SER A 1 123 ? 15.016  9.654   23.263  1.00 18.01 ? 445 SER A N   1 
ATOM   903  C CA  . SER A 1 123 ? 13.834  9.391   22.446  1.00 16.07 ? 445 SER A CA  1 
ATOM   904  C C   . SER A 1 123 ? 14.013  8.115   21.591  1.00 18.66 ? 445 SER A C   1 
ATOM   905  O O   . SER A 1 123 ? 15.155  7.749   21.292  1.00 17.69 ? 445 SER A O   1 
ATOM   906  C CB  . SER A 1 123 ? 13.566  10.594  21.557  1.00 16.40 ? 445 SER A CB  1 
ATOM   907  O OG  . SER A 1 123 ? 14.761  10.896  20.865  1.00 18.47 ? 445 SER A OG  1 
ATOM   908  N N   . GLU A 1 124 ? 12.897  7.435   21.231  1.00 14.59 ? 446 GLU A N   1 
ATOM   909  C CA  . GLU A 1 124 ? 12.917  6.196   20.427  1.00 14.84 ? 446 GLU A CA  1 
ATOM   910  C C   . GLU A 1 124 ? 11.742  6.069   19.474  1.00 15.31 ? 446 GLU A C   1 
ATOM   911  O O   . GLU A 1 124 ? 10.607  6.362   19.854  1.00 13.20 ? 446 GLU A O   1 
ATOM   912  C CB  . GLU A 1 124 ? 12.823  4.942   21.328  1.00 16.32 ? 446 GLU A CB  1 
ATOM   913  C CG  . GLU A 1 124 ? 13.972  4.683   22.276  1.00 28.99 ? 446 GLU A CG  1 
ATOM   914  C CD  . GLU A 1 124 ? 13.656  3.485   23.143  1.00 40.63 ? 446 GLU A CD  1 
ATOM   915  O OE1 . GLU A 1 124 ? 13.027  3.664   24.211  1.00 39.63 ? 446 GLU A OE1 1 
ATOM   916  O OE2 . GLU A 1 124 ? 13.939  2.354   22.695  1.00 32.92 ? 446 GLU A OE2 1 
ATOM   917  N N   . ILE A 1 125 ? 12.007  5.486   18.295  1.00 11.27 ? 447 ILE A N   1 
ATOM   918  C CA  . ILE A 1 125 ? 10.994  5.075   17.324  1.00 10.73 ? 447 ILE A CA  1 
ATOM   919  C C   . ILE A 1 125 ? 11.116  3.558   17.186  1.00 13.60 ? 447 ILE A C   1 
ATOM   920  O O   . ILE A 1 125 ? 12.207  3.050   16.933  1.00 12.73 ? 447 ILE A O   1 
ATOM   921  C CB  . ILE A 1 125 ? 10.988  5.823   15.961  1.00 13.17 ? 447 ILE A CB  1 
ATOM   922  C CG1 . ILE A 1 125 ? 10.552  7.282   16.154  1.00 13.35 ? 447 ILE A CG1 1 
ATOM   923  C CG2 . ILE A 1 125 ? 10.036  5.108   14.949  1.00 13.01 ? 447 ILE A CG2 1 
ATOM   924  C CD1 . ILE A 1 125 ? 10.707  8.130   14.973  1.00 13.82 ? 447 ILE A CD1 1 
ATOM   925  N N   . ILE A 1 126 ? 9.995   2.837   17.405  1.00 10.06 ? 448 ILE A N   1 
ATOM   926  C CA  . ILE A 1 126 ? 9.963   1.372   17.362  1.00 9.04  ? 448 ILE A CA  1 
ATOM   927  C C   . ILE A 1 126 ? 8.794   0.905   16.512  1.00 12.09 ? 448 ILE A C   1 
ATOM   928  O O   . ILE A 1 126 ? 7.681   1.397   16.673  1.00 12.52 ? 448 ILE A O   1 
ATOM   929  C CB  . ILE A 1 126 ? 9.948   0.750   18.807  1.00 10.76 ? 448 ILE A CB  1 
ATOM   930  C CG1 . ILE A 1 126 ? 11.162  1.231   19.664  1.00 10.68 ? 448 ILE A CG1 1 
ATOM   931  C CG2 . ILE A 1 126 ? 9.847   -0.797  18.784  1.00 8.43  ? 448 ILE A CG2 1 
ATOM   932  C CD1 . ILE A 1 126 ? 11.080  0.890   21.114  1.00 10.58 ? 448 ILE A CD1 1 
ATOM   933  N N   . PHE A 1 127 ? 9.048   -0.060  15.631  1.00 8.97  ? 449 PHE A N   1 
ATOM   934  C CA  . PHE A 1 127 ? 8.025   -0.635  14.761  1.00 8.71  ? 449 PHE A CA  1 
ATOM   935  C C   . PHE A 1 127 ? 7.710   -2.078  15.169  1.00 12.79 ? 449 PHE A C   1 
ATOM   936  O O   . PHE A 1 127 ? 8.567   -2.792  15.682  1.00 12.56 ? 449 PHE A O   1 
ATOM   937  C CB  . PHE A 1 127 ? 8.446   -0.543  13.281  1.00 10.02 ? 449 PHE A CB  1 
ATOM   938  C CG  . PHE A 1 127 ? 8.730   0.858   12.770  1.00 11.81 ? 449 PHE A CG  1 
ATOM   939  C CD1 . PHE A 1 127 ? 9.995   1.204   12.303  1.00 13.11 ? 449 PHE A CD1 1 
ATOM   940  C CD2 . PHE A 1 127 ? 7.728   1.821   12.729  1.00 13.11 ? 449 PHE A CD2 1 
ATOM   941  C CE1 . PHE A 1 127 ? 10.251  2.490   11.817  1.00 14.01 ? 449 PHE A CE1 1 
ATOM   942  C CE2 . PHE A 1 127 ? 7.991   3.114   12.249  1.00 15.34 ? 449 PHE A CE2 1 
ATOM   943  C CZ  . PHE A 1 127 ? 9.251   3.442   11.801  1.00 13.14 ? 449 PHE A CZ  1 
ATOM   944  N N   . TYR A 1 128 ? 6.465   -2.475  14.995  1.00 10.48 ? 450 TYR A N   1 
ATOM   945  C CA  . TYR A 1 128 ? 5.997   -3.812  15.335  1.00 9.88  ? 450 TYR A CA  1 
ATOM   946  C C   . TYR A 1 128 ? 5.322   -4.413  14.110  1.00 11.84 ? 450 TYR A C   1 
ATOM   947  O O   . TYR A 1 128 ? 4.668   -3.695  13.365  1.00 9.10  ? 450 TYR A O   1 
ATOM   948  C CB  . TYR A 1 128 ? 4.966   -3.734  16.473  1.00 11.43 ? 450 TYR A CB  1 
ATOM   949  C CG  . TYR A 1 128 ? 5.506   -3.382  17.840  1.00 13.56 ? 450 TYR A CG  1 
ATOM   950  C CD1 . TYR A 1 128 ? 5.888   -2.074  18.147  1.00 15.11 ? 450 TYR A CD1 1 
ATOM   951  C CD2 . TYR A 1 128 ? 5.519   -4.325  18.869  1.00 13.83 ? 450 TYR A CD2 1 
ATOM   952  C CE1 . TYR A 1 128 ? 6.330   -1.732  19.422  1.00 14.62 ? 450 TYR A CE1 1 
ATOM   953  C CE2 . TYR A 1 128 ? 5.933   -3.987  20.155  1.00 14.67 ? 450 TYR A CE2 1 
ATOM   954  C CZ  . TYR A 1 128 ? 6.336   -2.689  20.425  1.00 19.25 ? 450 TYR A CZ  1 
ATOM   955  O OH  . TYR A 1 128 ? 6.744   -2.348  21.683  1.00 16.89 ? 450 TYR A OH  1 
ATOM   956  N N   . LYS A 1 129 ? 5.454   -5.727  13.925  1.00 9.93  ? 451 LYS A N   1 
ATOM   957  C CA  . LYS A 1 129 ? 4.790   -6.454  12.852  1.00 10.71 ? 451 LYS A CA  1 
ATOM   958  C C   . LYS A 1 129 ? 4.032   -7.604  13.473  1.00 15.74 ? 451 LYS A C   1 
ATOM   959  O O   . LYS A 1 129 ? 4.649   -8.501  14.062  1.00 16.90 ? 451 LYS A O   1 
ATOM   960  C CB  . LYS A 1 129 ? 5.766   -6.958  11.777  1.00 12.88 ? 451 LYS A CB  1 
ATOM   961  C CG  . LYS A 1 129 ? 5.034   -7.668  10.636  1.00 14.86 ? 451 LYS A CG  1 
ATOM   962  C CD  . LYS A 1 129 ? 5.933   -7.946  9.470   1.00 22.61 ? 451 LYS A CD  1 
ATOM   963  C CE  . LYS A 1 129 ? 6.176   -9.420  9.279   1.00 22.77 ? 451 LYS A CE  1 
ATOM   964  N NZ  . LYS A 1 129 ? 6.541   -9.733  7.872   1.00 18.81 ? 451 LYS A NZ  1 
ATOM   965  N N   . ASN A 1 130 ? 2.694   -7.562  13.372  1.00 11.57 ? 452 ASN A N   1 
ATOM   966  C CA  . ASN A 1 130 ? 1.805   -8.593  13.933  1.00 11.78 ? 452 ASN A CA  1 
ATOM   967  C C   . ASN A 1 130 ? 2.161   -8.893  15.422  1.00 14.85 ? 452 ASN A C   1 
ATOM   968  O O   . ASN A 1 130 ? 2.343   -10.043 15.835  1.00 13.47 ? 452 ASN A O   1 
ATOM   969  C CB  . ASN A 1 130 ? 1.762   -9.851  13.010  1.00 8.02  ? 452 ASN A CB  1 
ATOM   970  C CG  . ASN A 1 130 ? 1.306   -9.538  11.597  1.00 13.69 ? 452 ASN A CG  1 
ATOM   971  O OD1 . ASN A 1 130 ? 0.383   -8.759  11.374  1.00 9.17  ? 452 ASN A OD1 1 
ATOM   972  N ND2 . ASN A 1 130 ? 1.910   -10.168 10.603  1.00 12.40 ? 452 ASN A ND2 1 
ATOM   973  N N   . GLY A 1 131 ? 2.294   -7.805  16.181  1.00 13.14 ? 453 GLY A N   1 
ATOM   974  C CA  . GLY A 1 131 ? 2.634   -7.783  17.600  1.00 12.87 ? 453 GLY A CA  1 
ATOM   975  C C   . GLY A 1 131 ? 4.058   -8.150  17.954  1.00 16.43 ? 453 GLY A C   1 
ATOM   976  O O   . GLY A 1 131 ? 4.339   -8.378  19.125  1.00 16.93 ? 453 GLY A O   1 
ATOM   977  N N   . VAL A 1 132 ? 4.975   -8.209  16.969  1.00 12.20 ? 454 VAL A N   1 
ATOM   978  C CA  . VAL A 1 132 ? 6.370   -8.563  17.237  1.00 10.82 ? 454 VAL A CA  1 
ATOM   979  C C   . VAL A 1 132 ? 7.224   -7.305  17.124  1.00 15.39 ? 454 VAL A C   1 
ATOM   980  O O   . VAL A 1 132 ? 7.314   -6.717  16.035  1.00 13.90 ? 454 VAL A O   1 
ATOM   981  C CB  . VAL A 1 132 ? 6.898   -9.697  16.297  1.00 12.57 ? 454 VAL A CB  1 
ATOM   982  C CG1 . VAL A 1 132 ? 8.335   -10.114 16.659  1.00 11.42 ? 454 VAL A CG1 1 
ATOM   983  C CG2 . VAL A 1 132 ? 5.960   -10.902 16.288  1.00 11.64 ? 454 VAL A CG2 1 
ATOM   984  N N   . ASN A 1 133 ? 7.907   -6.941  18.228  1.00 12.42 ? 455 ASN A N   1 
ATOM   985  C CA  . ASN A 1 133 ? 8.803   -5.783  18.269  1.00 12.67 ? 455 ASN A CA  1 
ATOM   986  C C   . ASN A 1 133 ? 9.938   -5.991  17.256  1.00 16.21 ? 455 ASN A C   1 
ATOM   987  O O   . ASN A 1 133 ? 10.667  -6.985  17.346  1.00 13.63 ? 455 ASN A O   1 
ATOM   988  C CB  . ASN A 1 133 ? 9.346   -5.584  19.692  1.00 10.95 ? 455 ASN A CB  1 
ATOM   989  C CG  . ASN A 1 133 ? 10.057  -4.285  19.933  1.00 19.11 ? 455 ASN A CG  1 
ATOM   990  O OD1 . ASN A 1 133 ? 10.983  -3.895  19.207  1.00 12.80 ? 455 ASN A OD1 1 
ATOM   991  N ND2 . ASN A 1 133 ? 9.745   -3.663  21.061  1.00 11.10 ? 455 ASN A ND2 1 
ATOM   992  N N   . GLN A 1 134 ? 10.070  -5.059  16.274  1.00 13.17 ? 456 GLN A N   1 
ATOM   993  C CA  . GLN A 1 134 ? 11.098  -5.192  15.233  1.00 12.06 ? 456 GLN A CA  1 
ATOM   994  C C   . GLN A 1 134 ? 12.435  -4.564  15.560  1.00 16.26 ? 456 GLN A C   1 
ATOM   995  O O   . GLN A 1 134 ? 13.346  -4.598  14.726  1.00 15.77 ? 456 GLN A O   1 
ATOM   996  C CB  . GLN A 1 134 ? 10.576  -4.772  13.842  1.00 13.22 ? 456 GLN A CB  1 
ATOM   997  C CG  . GLN A 1 134 ? 9.316   -5.519  13.376  1.00 16.99 ? 456 GLN A CG  1 
ATOM   998  C CD  . GLN A 1 134 ? 9.533   -6.991  13.155  1.00 28.62 ? 456 GLN A CD  1 
ATOM   999  O OE1 . GLN A 1 134 ? 10.359  -7.413  12.346  1.00 29.67 ? 456 GLN A OE1 1 
ATOM   1000 N NE2 . GLN A 1 134 ? 8.783   -7.801  13.855  1.00 17.48 ? 456 GLN A NE2 1 
ATOM   1001 N N   . GLY A 1 135 ? 12.565  -4.057  16.789  1.00 13.20 ? 457 GLY A N   1 
ATOM   1002 C CA  . GLY A 1 135 ? 13.775  -3.396  17.278  1.00 12.29 ? 457 GLY A CA  1 
ATOM   1003 C C   . GLY A 1 135 ? 13.665  -1.883  17.196  1.00 16.06 ? 457 GLY A C   1 
ATOM   1004 O O   . GLY A 1 135 ? 12.683  -1.344  16.652  1.00 14.21 ? 457 GLY A O   1 
ATOM   1005 N N   . VAL A 1 136 ? 14.655  -1.188  17.763  1.00 13.70 ? 458 VAL A N   1 
ATOM   1006 C CA  . VAL A 1 136 ? 14.758  0.282   17.739  1.00 13.51 ? 458 VAL A CA  1 
ATOM   1007 C C   . VAL A 1 136 ? 15.153  0.717   16.310  1.00 16.90 ? 458 VAL A C   1 
ATOM   1008 O O   . VAL A 1 136 ? 16.276  0.416   15.868  1.00 16.37 ? 458 VAL A O   1 
ATOM   1009 C CB  . VAL A 1 136 ? 15.761  0.819   18.811  1.00 16.81 ? 458 VAL A CB  1 
ATOM   1010 C CG1 . VAL A 1 136 ? 15.955  2.337   18.680  1.00 16.92 ? 458 VAL A CG1 1 
ATOM   1011 C CG2 . VAL A 1 136 ? 15.295  0.471   20.223  1.00 16.13 ? 458 VAL A CG2 1 
ATOM   1012 N N   . ALA A 1 137 ? 14.229  1.394   15.576  1.00 12.15 ? 459 ALA A N   1 
ATOM   1013 C CA  . ALA A 1 137 ? 14.560  1.870   14.224  1.00 11.33 ? 459 ALA A CA  1 
ATOM   1014 C C   . ALA A 1 137 ? 15.425  3.140   14.348  1.00 15.34 ? 459 ALA A C   1 
ATOM   1015 O O   . ALA A 1 137 ? 16.458  3.248   13.688  1.00 13.68 ? 459 ALA A O   1 
ATOM   1016 C CB  . ALA A 1 137 ? 13.294  2.163   13.423  1.00 11.68 ? 459 ALA A CB  1 
ATOM   1017 N N   . TYR A 1 138 ? 15.005  4.085   15.211  1.00 12.54 ? 460 TYR A N   1 
ATOM   1018 C CA  . TYR A 1 138 ? 15.754  5.333   15.444  1.00 12.47 ? 460 TYR A CA  1 
ATOM   1019 C C   . TYR A 1 138 ? 15.729  5.748   16.882  1.00 15.74 ? 460 TYR A C   1 
ATOM   1020 O O   . TYR A 1 138 ? 14.706  5.613   17.549  1.00 15.38 ? 460 TYR A O   1 
ATOM   1021 C CB  . TYR A 1 138 ? 15.225  6.502   14.577  1.00 12.10 ? 460 TYR A CB  1 
ATOM   1022 C CG  . TYR A 1 138 ? 15.239  6.213   13.094  1.00 11.24 ? 460 TYR A CG  1 
ATOM   1023 C CD1 . TYR A 1 138 ? 14.095  5.742   12.441  1.00 12.32 ? 460 TYR A CD1 1 
ATOM   1024 C CD2 . TYR A 1 138 ? 16.401  6.375   12.345  1.00 10.55 ? 460 TYR A CD2 1 
ATOM   1025 C CE1 . TYR A 1 138 ? 14.105  5.477   11.072  1.00 12.20 ? 460 TYR A CE1 1 
ATOM   1026 C CE2 . TYR A 1 138 ? 16.436  6.059   10.989  1.00 10.45 ? 460 TYR A CE2 1 
ATOM   1027 C CZ  . TYR A 1 138 ? 15.285  5.620   10.356  1.00 14.05 ? 460 TYR A CZ  1 
ATOM   1028 O OH  . TYR A 1 138 ? 15.314  5.372   9.010   1.00 12.21 ? 460 TYR A OH  1 
ATOM   1029 N N   . LYS A 1 139 ? 16.850  6.299   17.337  1.00 13.70 ? 461 LYS A N   1 
ATOM   1030 C CA  . LYS A 1 139 ? 17.030  6.855   18.678  1.00 14.69 ? 461 LYS A CA  1 
ATOM   1031 C C   . LYS A 1 139 ? 17.538  8.306   18.589  1.00 20.21 ? 461 LYS A C   1 
ATOM   1032 O O   . LYS A 1 139 ? 18.081  8.714   17.543  1.00 18.71 ? 461 LYS A O   1 
ATOM   1033 C CB  . LYS A 1 139 ? 17.942  5.973   19.564  1.00 17.63 ? 461 LYS A CB  1 
ATOM   1034 C CG  . LYS A 1 139 ? 19.294  5.576   18.948  1.00 31.20 ? 461 LYS A CG  1 
ATOM   1035 C CD  . LYS A 1 139 ? 20.402  5.267   19.973  1.00 33.74 ? 461 LYS A CD  1 
ATOM   1036 C CE  . LYS A 1 139 ? 20.129  4.092   20.888  1.00 41.00 ? 461 LYS A CE  1 
ATOM   1037 N NZ  . LYS A 1 139 ? 19.859  4.534   22.285  1.00 45.30 ? 461 LYS A NZ  1 
ATOM   1038 N N   . ASP A 1 140 ? 17.330  9.096   19.676  1.00 17.33 ? 462 ASP A N   1 
ATOM   1039 C CA  . ASP A 1 140 ? 17.771  10.504  19.754  1.00 17.28 ? 462 ASP A CA  1 
ATOM   1040 C C   . ASP A 1 140 ? 17.310  11.297  18.510  1.00 19.74 ? 462 ASP A C   1 
ATOM   1041 O O   . ASP A 1 140 ? 18.106  11.919  17.808  1.00 18.96 ? 462 ASP A O   1 
ATOM   1042 C CB  . ASP A 1 140 ? 19.295  10.584  19.999  1.00 18.66 ? 462 ASP A CB  1 
ATOM   1043 C CG  . ASP A 1 140 ? 19.758  9.803   21.219  1.00 30.29 ? 462 ASP A CG  1 
ATOM   1044 O OD1 . ASP A 1 140 ? 19.282  10.104  22.333  1.00 31.37 ? 462 ASP A OD1 1 
ATOM   1045 O OD2 . ASP A 1 140 ? 20.596  8.889   21.056  1.00 40.65 ? 462 ASP A OD2 1 
ATOM   1046 N N   . ILE A 1 141 ? 16.010  11.208  18.220  1.00 15.71 ? 463 ILE A N   1 
ATOM   1047 C CA  . ILE A 1 141 ? 15.404  11.828  17.038  1.00 15.87 ? 463 ILE A CA  1 
ATOM   1048 C C   . ILE A 1 141 ? 15.316  13.366  17.123  1.00 22.45 ? 463 ILE A C   1 
ATOM   1049 O O   . ILE A 1 141 ? 15.413  13.938  18.220  1.00 21.47 ? 463 ILE A O   1 
ATOM   1050 C CB  . ILE A 1 141 ? 14.034  11.160  16.693  1.00 17.94 ? 463 ILE A CB  1 
ATOM   1051 C CG1 . ILE A 1 141 ? 12.954  11.469  17.771  1.00 17.32 ? 463 ILE A CG1 1 
ATOM   1052 C CG2 . ILE A 1 141 ? 14.205  9.642   16.434  1.00 17.43 ? 463 ILE A CG2 1 
ATOM   1053 C CD1 . ILE A 1 141 ? 11.538  10.949  17.450  1.00 15.65 ? 463 ILE A CD1 1 
ATOM   1054 N N   . PHE A 1 142 ? 15.122  14.018  15.952  1.00 21.93 ? 464 PHE A N   1 
ATOM   1055 C CA  . PHE A 1 142 ? 14.970  15.464  15.819  1.00 23.09 ? 464 PHE A CA  1 
ATOM   1056 C C   . PHE A 1 142 ? 13.805  15.888  16.696  1.00 26.62 ? 464 PHE A C   1 
ATOM   1057 O O   . PHE A 1 142 ? 12.714  15.337  16.558  1.00 26.94 ? 464 PHE A O   1 
ATOM   1058 C CB  . PHE A 1 142 ? 14.751  15.858  14.339  1.00 25.81 ? 464 PHE A CB  1 
ATOM   1059 C CG  . PHE A 1 142 ? 14.773  17.350  14.035  1.00 28.65 ? 464 PHE A CG  1 
ATOM   1060 C CD1 . PHE A 1 142 ? 15.854  18.144  14.422  1.00 32.09 ? 464 PHE A CD1 1 
ATOM   1061 C CD2 . PHE A 1 142 ? 13.752  17.943  13.297  1.00 31.15 ? 464 PHE A CD2 1 
ATOM   1062 C CE1 . PHE A 1 142 ? 15.877  19.515  14.129  1.00 32.75 ? 464 PHE A CE1 1 
ATOM   1063 C CE2 . PHE A 1 142 ? 13.773  19.312  13.013  1.00 34.17 ? 464 PHE A CE2 1 
ATOM   1064 C CZ  . PHE A 1 142 ? 14.834  20.089  13.433  1.00 32.08 ? 464 PHE A CZ  1 
ATOM   1065 N N   . GLU A 1 143 ? 14.061  16.778  17.666  1.00 22.18 ? 465 GLU A N   1 
ATOM   1066 C CA  . GLU A 1 143 ? 13.038  17.226  18.620  1.00 22.43 ? 465 GLU A CA  1 
ATOM   1067 C C   . GLU A 1 143 ? 11.908  17.997  17.941  1.00 24.31 ? 465 GLU A C   1 
ATOM   1068 O O   . GLU A 1 143 ? 12.143  18.716  16.973  1.00 23.15 ? 465 GLU A O   1 
ATOM   1069 C CB  . GLU A 1 143 ? 13.660  18.084  19.751  1.00 24.04 ? 465 GLU A CB  1 
ATOM   1070 N N   . GLY A 1 144 ? 10.703  17.839  18.480  1.00 20.58 ? 466 GLY A N   1 
ATOM   1071 C CA  . GLY A 1 144 ? 9.494   18.495  18.014  1.00 19.48 ? 466 GLY A CA  1 
ATOM   1072 C C   . GLY A 1 144 ? 8.252   17.647  18.211  1.00 21.78 ? 466 GLY A C   1 
ATOM   1073 O O   . GLY A 1 144 ? 8.276   16.641  18.928  1.00 21.56 ? 466 GLY A O   1 
ATOM   1074 N N   . VAL A 1 145 ? 7.157   18.062  17.566  1.00 15.76 ? 467 VAL A N   1 
ATOM   1075 C CA  . VAL A 1 145 ? 5.883   17.371  17.617  1.00 14.33 ? 467 VAL A CA  1 
ATOM   1076 C C   . VAL A 1 145 ? 5.853   16.312  16.518  1.00 17.78 ? 467 VAL A C   1 
ATOM   1077 O O   . VAL A 1 145 ? 6.241   16.604  15.390  1.00 15.80 ? 467 VAL A O   1 
ATOM   1078 C CB  . VAL A 1 145 ? 4.712   18.374  17.523  1.00 16.22 ? 467 VAL A CB  1 
ATOM   1079 C CG1 . VAL A 1 145 ? 3.375   17.658  17.329  1.00 14.96 ? 467 VAL A CG1 1 
ATOM   1080 C CG2 . VAL A 1 145 ? 4.675   19.252  18.771  1.00 15.92 ? 467 VAL A CG2 1 
ATOM   1081 N N   . TYR A 1 146 ? 5.412   15.077  16.867  1.00 14.31 ? 468 TYR A N   1 
ATOM   1082 C CA  . TYR A 1 146 ? 5.301   13.964  15.924  1.00 13.53 ? 468 TYR A CA  1 
ATOM   1083 C C   . TYR A 1 146 ? 3.879   13.504  15.732  1.00 16.14 ? 468 TYR A C   1 
ATOM   1084 O O   . TYR A 1 146 ? 3.132   13.350  16.697  1.00 15.54 ? 468 TYR A O   1 
ATOM   1085 C CB  . TYR A 1 146 ? 6.218   12.798  16.305  1.00 13.71 ? 468 TYR A CB  1 
ATOM   1086 C CG  . TYR A 1 146 ? 7.650   13.068  15.926  1.00 13.96 ? 468 TYR A CG  1 
ATOM   1087 C CD1 . TYR A 1 146 ? 8.541   13.616  16.845  1.00 16.01 ? 468 TYR A CD1 1 
ATOM   1088 C CD2 . TYR A 1 146 ? 8.108   12.827  14.631  1.00 13.59 ? 468 TYR A CD2 1 
ATOM   1089 C CE1 . TYR A 1 146 ? 9.853   13.906  16.490  1.00 15.50 ? 468 TYR A CE1 1 
ATOM   1090 C CE2 . TYR A 1 146 ? 9.417   13.112  14.266  1.00 13.32 ? 468 TYR A CE2 1 
ATOM   1091 C CZ  . TYR A 1 146 ? 10.290  13.639  15.204  1.00 20.77 ? 468 TYR A CZ  1 
ATOM   1092 O OH  . TYR A 1 146 ? 11.589  13.914  14.861  1.00 20.55 ? 468 TYR A OH  1 
ATOM   1093 N N   . PHE A 1 147 ? 3.507   13.316  14.463  1.00 11.14 ? 469 PHE A N   1 
ATOM   1094 C CA  . PHE A 1 147 ? 2.185   12.904  14.051  1.00 10.65 ? 469 PHE A CA  1 
ATOM   1095 C C   . PHE A 1 147 ? 2.188   11.517  13.413  1.00 14.80 ? 469 PHE A C   1 
ATOM   1096 O O   . PHE A 1 147 ? 3.033   11.272  12.544  1.00 13.53 ? 469 PHE A O   1 
ATOM   1097 C CB  . PHE A 1 147 ? 1.654   13.896  12.984  1.00 12.45 ? 469 PHE A CB  1 
ATOM   1098 C CG  . PHE A 1 147 ? 1.215   15.257  13.471  1.00 13.14 ? 469 PHE A CG  1 
ATOM   1099 C CD1 . PHE A 1 147 ? 2.149   16.253  13.738  1.00 15.38 ? 469 PHE A CD1 1 
ATOM   1100 C CD2 . PHE A 1 147 ? -0.133  15.558  13.612  1.00 14.96 ? 469 PHE A CD2 1 
ATOM   1101 C CE1 . PHE A 1 147 ? 1.745   17.512  14.185  1.00 16.77 ? 469 PHE A CE1 1 
ATOM   1102 C CE2 . PHE A 1 147 ? -0.542  16.819  14.066  1.00 18.06 ? 469 PHE A CE2 1 
ATOM   1103 C CZ  . PHE A 1 147 ? 0.401   17.789  14.351  1.00 16.14 ? 469 PHE A CZ  1 
ATOM   1104 N N   . PRO A 1 148 ? 1.179   10.646  13.707  1.00 11.91 ? 470 PRO A N   1 
ATOM   1105 C CA  . PRO A 1 148 ? 1.034   9.409   12.923  1.00 11.82 ? 470 PRO A CA  1 
ATOM   1106 C C   . PRO A 1 148 ? 0.957   9.795   11.428  1.00 15.36 ? 470 PRO A C   1 
ATOM   1107 O O   . PRO A 1 148 ? 0.337   10.818  11.092  1.00 12.67 ? 470 PRO A O   1 
ATOM   1108 C CB  . PRO A 1 148 ? -0.299  8.852   13.420  1.00 13.24 ? 470 PRO A CB  1 
ATOM   1109 C CG  . PRO A 1 148 ? -0.439  9.401   14.803  1.00 16.21 ? 470 PRO A CG  1 
ATOM   1110 C CD  . PRO A 1 148 ? 0.073   10.785  14.681  1.00 12.04 ? 470 PRO A CD  1 
ATOM   1111 N N   . ALA A 1 149 ? 1.701   9.080   10.557  1.00 12.60 ? 471 ALA A N   1 
ATOM   1112 C CA  . ALA A 1 149 ? 1.756   9.463   9.141   1.00 12.62 ? 471 ALA A CA  1 
ATOM   1113 C C   . ALA A 1 149 ? 1.777   8.278   8.181   1.00 15.74 ? 471 ALA A C   1 
ATOM   1114 O O   . ALA A 1 149 ? 2.413   7.261   8.455   1.00 14.62 ? 471 ALA A O   1 
ATOM   1115 C CB  . ALA A 1 149 ? 2.968   10.371  8.896   1.00 12.93 ? 471 ALA A CB  1 
ATOM   1116 N N   . ILE A 1 150 ? 1.100   8.430   7.033   1.00 11.67 ? 472 ILE A N   1 
ATOM   1117 C CA  . ILE A 1 150 ? 1.004   7.377   6.012   1.00 9.27  ? 472 ILE A CA  1 
ATOM   1118 C C   . ILE A 1 150 ? 1.499   7.910   4.678   1.00 12.36 ? 472 ILE A C   1 
ATOM   1119 O O   . ILE A 1 150 ? 1.010   8.930   4.223   1.00 12.40 ? 472 ILE A O   1 
ATOM   1120 C CB  . ILE A 1 150 ? -0.480  6.852   5.896   1.00 11.83 ? 472 ILE A CB  1 
ATOM   1121 C CG1 . ILE A 1 150 ? -0.928  6.088   7.168   1.00 13.14 ? 472 ILE A CG1 1 
ATOM   1122 C CG2 . ILE A 1 150 ? -0.686  5.973   4.647   1.00 10.02 ? 472 ILE A CG2 1 
ATOM   1123 C CD1 . ILE A 1 150 ? -2.449  6.025   7.427   1.00 8.62  ? 472 ILE A CD1 1 
ATOM   1124 N N   . SER A 1 151 ? 2.409   7.190   4.016   1.00 10.27 ? 473 SER A N   1 
ATOM   1125 C CA  . SER A 1 151 ? 2.806   7.537   2.652   1.00 10.38 ? 473 SER A CA  1 
ATOM   1126 C C   . SER A 1 151 ? 2.652   6.318   1.789   1.00 14.06 ? 473 SER A C   1 
ATOM   1127 O O   . SER A 1 151 ? 3.032   5.220   2.199   1.00 13.69 ? 473 SER A O   1 
ATOM   1128 C CB  . SER A 1 151 ? 4.186   8.184   2.563   1.00 10.60 ? 473 SER A CB  1 
ATOM   1129 O OG  . SER A 1 151 ? 5.215   7.224   2.657   1.00 16.36 ? 473 SER A OG  1 
ATOM   1130 N N   . LEU A 1 152 ? 1.980   6.493   0.645   1.00 10.98 ? 474 LEU A N   1 
ATOM   1131 C CA  . LEU A 1 152 ? 1.643   5.391   -0.241  1.00 10.37 ? 474 LEU A CA  1 
ATOM   1132 C C   . LEU A 1 152 ? 2.090   5.605   -1.667  1.00 12.69 ? 474 LEU A C   1 
ATOM   1133 O O   . LEU A 1 152 ? 2.017   6.714   -2.202  1.00 10.85 ? 474 LEU A O   1 
ATOM   1134 C CB  . LEU A 1 152 ? 0.133   5.096   -0.211  1.00 10.64 ? 474 LEU A CB  1 
ATOM   1135 C CG  . LEU A 1 152 ? -0.545  4.888   1.145   1.00 13.98 ? 474 LEU A CG  1 
ATOM   1136 C CD1 . LEU A 1 152 ? -2.036  4.844   0.985   1.00 14.18 ? 474 LEU A CD1 1 
ATOM   1137 C CD2 . LEU A 1 152 ? -0.064  3.599   1.825   1.00 12.46 ? 474 LEU A CD2 1 
ATOM   1138 N N   . TYR A 1 153 ? 2.552   4.506   -2.273  1.00 10.13 ? 475 TYR A N   1 
ATOM   1139 C CA  . TYR A 1 153 ? 3.011   4.407   -3.651  1.00 9.08  ? 475 TYR A CA  1 
ATOM   1140 C C   . TYR A 1 153 ? 2.005   3.567   -4.394  1.00 12.39 ? 475 TYR A C   1 
ATOM   1141 O O   . TYR A 1 153 ? 1.823   2.386   -4.081  1.00 11.25 ? 475 TYR A O   1 
ATOM   1142 C CB  . TYR A 1 153 ? 4.400   3.739   -3.736  1.00 10.05 ? 475 TYR A CB  1 
ATOM   1143 C CG  . TYR A 1 153 ? 4.891   3.596   -5.168  1.00 11.49 ? 475 TYR A CG  1 
ATOM   1144 C CD1 . TYR A 1 153 ? 5.276   4.711   -5.908  1.00 13.13 ? 475 TYR A CD1 1 
ATOM   1145 C CD2 . TYR A 1 153 ? 4.902   2.357   -5.803  1.00 11.84 ? 475 TYR A CD2 1 
ATOM   1146 C CE1 . TYR A 1 153 ? 5.687   4.593   -7.235  1.00 15.74 ? 475 TYR A CE1 1 
ATOM   1147 C CE2 . TYR A 1 153 ? 5.338   2.223   -7.123  1.00 12.56 ? 475 TYR A CE2 1 
ATOM   1148 C CZ  . TYR A 1 153 ? 5.724   3.347   -7.838  1.00 18.91 ? 475 TYR A CZ  1 
ATOM   1149 O OH  . TYR A 1 153 ? 6.169   3.232   -9.133  1.00 16.01 ? 475 TYR A OH  1 
ATOM   1150 N N   . LYS A 1 154 ? 1.356   4.177   -5.399  1.00 9.98  ? 476 LYS A N   1 
ATOM   1151 C CA  . LYS A 1 154 ? 0.359   3.529   -6.225  1.00 8.76  ? 476 LYS A CA  1 
ATOM   1152 C C   . LYS A 1 154 ? -0.878  3.102   -5.415  1.00 15.65 ? 476 LYS A C   1 
ATOM   1153 O O   . LYS A 1 154 ? -0.975  3.437   -4.228  1.00 15.95 ? 476 LYS A O   1 
ATOM   1154 C CB  . LYS A 1 154 ? 1.000   2.435   -7.103  1.00 10.45 ? 476 LYS A CB  1 
ATOM   1155 C CG  . LYS A 1 154 ? 1.927   3.011   -8.168  1.00 11.81 ? 476 LYS A CG  1 
ATOM   1156 C CD  . LYS A 1 154 ? 2.379   1.970   -9.184  1.00 20.39 ? 476 LYS A CD  1 
ATOM   1157 C CE  . LYS A 1 154 ? 2.879   2.630   -10.445 1.00 21.52 ? 476 LYS A CE  1 
ATOM   1158 N NZ  . LYS A 1 154 ? 3.624   1.677   -11.306 1.00 24.48 ? 476 LYS A NZ  1 
ATOM   1159 N N   . SER A 1 155 ? -1.810  2.378   -6.043  1.00 13.81 ? 477 SER A N   1 
ATOM   1160 C CA  . SER A 1 155 ? -3.105  1.986   -5.492  1.00 15.17 ? 477 SER A CA  1 
ATOM   1161 C C   . SER A 1 155 ? -3.207  0.948   -4.361  1.00 19.13 ? 477 SER A C   1 
ATOM   1162 O O   . SER A 1 155 ? -4.087  0.083   -4.419  1.00 19.08 ? 477 SER A O   1 
ATOM   1163 C CB  . SER A 1 155 ? -4.104  1.699   -6.616  1.00 19.83 ? 477 SER A CB  1 
ATOM   1164 O OG  . SER A 1 155 ? -4.343  2.877   -7.369  1.00 34.18 ? 477 SER A OG  1 
ATOM   1165 N N   . CYS A 1 156 ? -2.396  1.076   -3.306  1.00 14.78 ? 478 CYS A N   1 
ATOM   1166 C CA  . CYS A 1 156 ? -2.550  0.194   -2.148  1.00 14.32 ? 478 CYS A CA  1 
ATOM   1167 C C   . CYS A 1 156 ? -3.476  0.877   -1.139  1.00 16.21 ? 478 CYS A C   1 
ATOM   1168 O O   . CYS A 1 156 ? -3.582  2.107   -1.133  1.00 15.18 ? 478 CYS A O   1 
ATOM   1169 C CB  . CYS A 1 156 ? -1.212  -0.193  -1.524  1.00 14.83 ? 478 CYS A CB  1 
ATOM   1170 S SG  . CYS A 1 156 ? -0.172  1.212   -1.083  1.00 19.10 ? 478 CYS A SG  1 
ATOM   1171 N N   . THR A 1 157 ? -4.147  0.072   -0.303  1.00 11.26 ? 479 THR A N   1 
ATOM   1172 C CA  . THR A 1 157 ? -5.125  0.519   0.694   1.00 11.75 ? 479 THR A CA  1 
ATOM   1173 C C   . THR A 1 157 ? -4.675  0.151   2.100   1.00 16.06 ? 479 THR A C   1 
ATOM   1174 O O   . THR A 1 157 ? -4.301  -0.997  2.343   1.00 15.63 ? 479 THR A O   1 
ATOM   1175 C CB  . THR A 1 157 ? -6.509  -0.075  0.358   1.00 12.69 ? 479 THR A CB  1 
ATOM   1176 O OG1 . THR A 1 157 ? -6.789  0.250   -0.988  1.00 11.76 ? 479 THR A OG1 1 
ATOM   1177 C CG2 . THR A 1 157 ? -7.629  0.460   1.243   1.00 11.15 ? 479 THR A CG2 1 
ATOM   1178 N N   . VAL A 1 158 ? -4.673  1.142   3.011   1.00 12.48 ? 480 VAL A N   1 
ATOM   1179 C CA  . VAL A 1 158 ? -4.294  0.922   4.409   1.00 12.17 ? 480 VAL A CA  1 
ATOM   1180 C C   . VAL A 1 158 ? -5.340  1.584   5.327   1.00 14.83 ? 480 VAL A C   1 
ATOM   1181 O O   . VAL A 1 158 ? -5.962  2.590   4.954   1.00 12.42 ? 480 VAL A O   1 
ATOM   1182 C CB  . VAL A 1 158 ? -2.813  1.300   4.789   1.00 15.69 ? 480 VAL A CB  1 
ATOM   1183 C CG1 . VAL A 1 158 ? -1.779  0.689   3.824   1.00 15.22 ? 480 VAL A CG1 1 
ATOM   1184 C CG2 . VAL A 1 158 ? -2.611  2.815   4.919   1.00 14.97 ? 480 VAL A CG2 1 
ATOM   1185 N N   . SER A 1 159 ? -5.523  0.999   6.520   1.00 11.58 ? 481 SER A N   1 
ATOM   1186 C CA  . SER A 1 159 ? -6.435  1.464   7.548   1.00 11.03 ? 481 SER A CA  1 
ATOM   1187 C C   . SER A 1 159 ? -5.664  1.753   8.828   1.00 14.29 ? 481 SER A C   1 
ATOM   1188 O O   . SER A 1 159 ? -4.851  0.953   9.256   1.00 13.69 ? 481 SER A O   1 
ATOM   1189 C CB  . SER A 1 159 ? -7.546  0.448   7.790   1.00 12.69 ? 481 SER A CB  1 
ATOM   1190 O OG  . SER A 1 159 ? -8.492  0.537   6.739   1.00 18.03 ? 481 SER A OG  1 
ATOM   1191 N N   . ILE A 1 160 ? -5.900  2.916   9.411   1.00 12.38 ? 482 ILE A N   1 
ATOM   1192 C CA  . ILE A 1 160 ? -5.232  3.356   10.638  1.00 10.50 ? 482 ILE A CA  1 
ATOM   1193 C C   . ILE A 1 160 ? -6.173  3.175   11.843  1.00 11.67 ? 482 ILE A C   1 
ATOM   1194 O O   . ILE A 1 160 ? -7.360  3.453   11.746  1.00 8.59  ? 482 ILE A O   1 
ATOM   1195 C CB  . ILE A 1 160 ? -4.666  4.813   10.492  1.00 12.42 ? 482 ILE A CB  1 
ATOM   1196 C CG1 . ILE A 1 160 ? -3.750  5.216   11.696  1.00 12.58 ? 482 ILE A CG1 1 
ATOM   1197 C CG2 . ILE A 1 160 ? -5.770  5.855   10.232  1.00 9.67  ? 482 ILE A CG2 1 
ATOM   1198 C CD1 . ILE A 1 160 ? -2.562  6.129   11.309  1.00 15.28 ? 482 ILE A CD1 1 
ATOM   1199 N N   . ASN A 1 161 ? -5.627  2.690   12.956  1.00 9.42  ? 483 ASN A N   1 
ATOM   1200 C CA  . ASN A 1 161 ? -6.352  2.506   14.210  1.00 9.77  ? 483 ASN A CA  1 
ATOM   1201 C C   . ASN A 1 161 ? -5.563  3.271   15.279  1.00 12.32 ? 483 ASN A C   1 
ATOM   1202 O O   . ASN A 1 161 ? -4.438  2.901   15.583  1.00 11.19 ? 483 ASN A O   1 
ATOM   1203 C CB  . ASN A 1 161 ? -6.467  0.993   14.557  1.00 8.91  ? 483 ASN A CB  1 
ATOM   1204 C CG  . ASN A 1 161 ? -7.133  0.698   15.880  1.00 21.06 ? 483 ASN A CG  1 
ATOM   1205 O OD1 . ASN A 1 161 ? -7.786  1.554   16.479  1.00 14.53 ? 483 ASN A OD1 1 
ATOM   1206 N ND2 . ASN A 1 161 ? -6.989  -0.529  16.371  1.00 11.55 ? 483 ASN A ND2 1 
ATOM   1207 N N   . PHE A 1 162 ? -6.119  4.370   15.793  1.00 9.94  ? 484 PHE A N   1 
ATOM   1208 C CA  . PHE A 1 162 ? -5.430  5.166   16.814  1.00 8.98  ? 484 PHE A CA  1 
ATOM   1209 C C   . PHE A 1 162 ? -5.663  4.637   18.234  1.00 12.41 ? 484 PHE A C   1 
ATOM   1210 O O   . PHE A 1 162 ? -5.032  5.103   19.175  1.00 12.14 ? 484 PHE A O   1 
ATOM   1211 C CB  . PHE A 1 162 ? -5.803  6.644   16.700  1.00 10.06 ? 484 PHE A CB  1 
ATOM   1212 C CG  . PHE A 1 162 ? -5.515  7.259   15.351  1.00 10.99 ? 484 PHE A CG  1 
ATOM   1213 C CD1 . PHE A 1 162 ? -6.535  7.429   14.412  1.00 10.86 ? 484 PHE A CD1 1 
ATOM   1214 C CD2 . PHE A 1 162 ? -4.221  7.650   15.007  1.00 10.08 ? 484 PHE A CD2 1 
ATOM   1215 C CE1 . PHE A 1 162 ? -6.276  8.051   13.191  1.00 10.92 ? 484 PHE A CE1 1 
ATOM   1216 C CE2 . PHE A 1 162 ? -3.959  8.242   13.774  1.00 11.61 ? 484 PHE A CE2 1 
ATOM   1217 C CZ  . PHE A 1 162 ? -4.981  8.440   12.871  1.00 9.51  ? 484 PHE A CZ  1 
ATOM   1218 N N   . GLY A 1 163 ? -6.531  3.644   18.365  1.00 9.41  ? 485 GLY A N   1 
ATOM   1219 C CA  . GLY A 1 163 ? -6.870  3.056   19.652  1.00 9.38  ? 485 GLY A CA  1 
ATOM   1220 C C   . GLY A 1 163 ? -8.268  3.452   20.104  1.00 14.11 ? 485 GLY A C   1 
ATOM   1221 O O   . GLY A 1 163 ? -9.012  4.054   19.325  1.00 12.07 ? 485 GLY A O   1 
ATOM   1222 N N   . PRO A 1 164 ? -8.673  3.154   21.358  1.00 14.00 ? 486 PRO A N   1 
ATOM   1223 C CA  . PRO A 1 164 ? -7.901  2.511   22.442  1.00 13.96 ? 486 PRO A CA  1 
ATOM   1224 C C   . PRO A 1 164 ? -7.675  1.010   22.289  1.00 19.87 ? 486 PRO A C   1 
ATOM   1225 O O   . PRO A 1 164 ? -6.721  0.468   22.856  1.00 21.00 ? 486 PRO A O   1 
ATOM   1226 C CB  . PRO A 1 164 ? -8.712  2.871   23.698  1.00 15.57 ? 486 PRO A CB  1 
ATOM   1227 C CG  . PRO A 1 164 ? -10.134 2.949   23.207  1.00 19.81 ? 486 PRO A CG  1 
ATOM   1228 C CD  . PRO A 1 164 ? -10.033 3.535   21.814  1.00 15.93 ? 486 PRO A CD  1 
ATOM   1229 N N   . CYS A 1 165 ? -8.500  0.361   21.474  1.00 18.40 ? 487 CYS A N   1 
ATOM   1230 C CA  . CYS A 1 165 ? -8.480  -1.084  21.234  1.00 19.93 ? 487 CYS A CA  1 
ATOM   1231 C C   . CYS A 1 165 ? -7.596  -1.491  20.046  1.00 19.89 ? 487 CYS A C   1 
ATOM   1232 O O   . CYS A 1 165 ? -7.978  -1.316  18.887  1.00 19.05 ? 487 CYS A O   1 
ATOM   1233 C CB  . CYS A 1 165 ? -9.909  -1.614  21.095  1.00 22.29 ? 487 CYS A CB  1 
ATOM   1234 S SG  . CYS A 1 165 ? -10.993 -1.181  22.491  1.00 27.80 ? 487 CYS A SG  1 
ATOM   1235 N N   . PHE A 1 166 ? -6.410  -2.048  20.343  1.00 13.23 ? 488 PHE A N   1 
ATOM   1236 C CA  . PHE A 1 166 ? -5.493  -2.541  19.321  1.00 10.51 ? 488 PHE A CA  1 
ATOM   1237 C C   . PHE A 1 166 ? -5.672  -4.055  19.096  1.00 12.89 ? 488 PHE A C   1 
ATOM   1238 O O   . PHE A 1 166 ? -6.073  -4.765  20.007  1.00 11.48 ? 488 PHE A O   1 
ATOM   1239 C CB  . PHE A 1 166 ? -4.038  -2.185  19.688  1.00 10.85 ? 488 PHE A CB  1 
ATOM   1240 C CG  . PHE A 1 166 ? -3.790  -0.694  19.784  1.00 11.36 ? 488 PHE A CG  1 
ATOM   1241 C CD1 . PHE A 1 166 ? -3.371  -0.119  20.979  1.00 12.91 ? 488 PHE A CD1 1 
ATOM   1242 C CD2 . PHE A 1 166 ? -4.013  0.140   18.685  1.00 11.45 ? 488 PHE A CD2 1 
ATOM   1243 C CE1 . PHE A 1 166 ? -3.177  1.265   21.078  1.00 13.65 ? 488 PHE A CE1 1 
ATOM   1244 C CE2 . PHE A 1 166 ? -3.808  1.520   18.781  1.00 14.14 ? 488 PHE A CE2 1 
ATOM   1245 C CZ  . PHE A 1 166 ? -3.384  2.074   19.976  1.00 12.45 ? 488 PHE A CZ  1 
ATOM   1246 N N   . LYS A 1 167 ? -5.395  -4.537  17.877  1.00 10.04 ? 489 LYS A N   1 
ATOM   1247 C CA  . LYS A 1 167 ? -5.462  -5.966  17.551  1.00 9.18  ? 489 LYS A CA  1 
ATOM   1248 C C   . LYS A 1 167 ? -4.332  -6.730  18.277  1.00 14.78 ? 489 LYS A C   1 
ATOM   1249 O O   . LYS A 1 167 ? -4.561  -7.826  18.798  1.00 15.07 ? 489 LYS A O   1 
ATOM   1250 C CB  . LYS A 1 167 ? -5.378  -6.196  16.033  1.00 10.71 ? 489 LYS A CB  1 
ATOM   1251 C CG  . LYS A 1 167 ? -6.679  -5.908  15.292  1.00 15.79 ? 489 LYS A CG  1 
ATOM   1252 C CD  . LYS A 1 167 ? -6.499  -6.076  13.799  1.00 20.44 ? 489 LYS A CD  1 
ATOM   1253 C CE  . LYS A 1 167 ? -7.653  -5.501  13.012  1.00 29.50 ? 489 LYS A CE  1 
ATOM   1254 N NZ  . LYS A 1 167 ? -7.564  -4.018  12.868  1.00 27.83 ? 489 LYS A NZ  1 
ATOM   1255 N N   . TYR A 1 168 ? -3.123  -6.128  18.320  1.00 11.25 ? 490 TYR A N   1 
ATOM   1256 C CA  . TYR A 1 168 ? -1.933  -6.699  18.945  1.00 11.06 ? 490 TYR A CA  1 
ATOM   1257 C C   . TYR A 1 168 ? -1.377  -5.682  19.948  1.00 14.84 ? 490 TYR A C   1 
ATOM   1258 O O   . TYR A 1 168 ? -0.348  -5.086  19.655  1.00 14.88 ? 490 TYR A O   1 
ATOM   1259 C CB  . TYR A 1 168 ? -0.857  -7.004  17.877  1.00 11.89 ? 490 TYR A CB  1 
ATOM   1260 C CG  . TYR A 1 168 ? -1.217  -8.010  16.795  1.00 12.58 ? 490 TYR A CG  1 
ATOM   1261 C CD1 . TYR A 1 168 ? -1.801  -7.601  15.600  1.00 13.49 ? 490 TYR A CD1 1 
ATOM   1262 C CD2 . TYR A 1 168 ? -0.878  -9.359  16.929  1.00 12.91 ? 490 TYR A CD2 1 
ATOM   1263 C CE1 . TYR A 1 168 ? -2.086  -8.517  14.582  1.00 13.51 ? 490 TYR A CE1 1 
ATOM   1264 C CE2 . TYR A 1 168 ? -1.114  -10.273 15.899  1.00 12.62 ? 490 TYR A CE2 1 
ATOM   1265 C CZ  . TYR A 1 168 ? -1.734  -9.851  14.735  1.00 16.98 ? 490 TYR A CZ  1 
ATOM   1266 O OH  . TYR A 1 168 ? -1.952  -10.748 13.722  1.00 17.54 ? 490 TYR A OH  1 
ATOM   1267 N N   . PRO A 1 169 ? -1.998  -5.433  21.128  1.00 12.71 ? 491 PRO A N   1 
ATOM   1268 C CA  . PRO A 1 169 ? -1.408  -4.442  22.041  1.00 13.21 ? 491 PRO A CA  1 
ATOM   1269 C C   . PRO A 1 169 ? -0.064  -4.908  22.638  1.00 16.62 ? 491 PRO A C   1 
ATOM   1270 O O   . PRO A 1 169 ? 0.013   -5.997  23.196  1.00 14.65 ? 491 PRO A O   1 
ATOM   1271 C CB  . PRO A 1 169 ? -2.507  -4.199  23.083  1.00 14.75 ? 491 PRO A CB  1 
ATOM   1272 C CG  . PRO A 1 169 ? -3.338  -5.398  23.046  1.00 18.55 ? 491 PRO A CG  1 
ATOM   1273 C CD  . PRO A 1 169 ? -3.206  -6.051  21.712  1.00 13.72 ? 491 PRO A CD  1 
ATOM   1274 N N   . PRO A 1 170 ? 1.021   -4.114  22.476  1.00 14.22 ? 492 PRO A N   1 
ATOM   1275 C CA  . PRO A 1 170 ? 2.327   -4.518  23.046  1.00 14.49 ? 492 PRO A CA  1 
ATOM   1276 C C   . PRO A 1 170 ? 2.341   -4.674  24.564  1.00 17.80 ? 492 PRO A C   1 
ATOM   1277 O O   . PRO A 1 170 ? 1.781   -3.858  25.302  1.00 16.58 ? 492 PRO A O   1 
ATOM   1278 C CB  . PRO A 1 170 ? 3.284   -3.414  22.596  1.00 16.86 ? 492 PRO A CB  1 
ATOM   1279 C CG  . PRO A 1 170 ? 2.571   -2.694  21.508  1.00 20.80 ? 492 PRO A CG  1 
ATOM   1280 C CD  . PRO A 1 170 ? 1.111   -2.808  21.799  1.00 15.84 ? 492 PRO A CD  1 
ATOM   1281 N N   . LYS A 1 171 ? 2.983   -5.752  25.024  1.00 14.48 ? 493 LYS A N   1 
ATOM   1282 C CA  . LYS A 1 171 ? 3.109   -6.062  26.446  1.00 12.80 ? 493 LYS A CA  1 
ATOM   1283 C C   . LYS A 1 171 ? 4.505   -5.755  26.940  1.00 14.75 ? 493 LYS A C   1 
ATOM   1284 O O   . LYS A 1 171 ? 4.738   -5.788  28.147  1.00 14.81 ? 493 LYS A O   1 
ATOM   1285 C CB  . LYS A 1 171 ? 2.756   -7.546  26.708  1.00 14.60 ? 493 LYS A CB  1 
ATOM   1286 C CG  . LYS A 1 171 ? 1.323   -7.939  26.298  1.00 17.57 ? 493 LYS A CG  1 
ATOM   1287 C CD  . LYS A 1 171 ? 0.254   -7.130  27.034  1.00 23.66 ? 493 LYS A CD  1 
ATOM   1288 C CE  . LYS A 1 171 ? -1.156  -7.393  26.542  1.00 30.86 ? 493 LYS A CE  1 
ATOM   1289 N NZ  . LYS A 1 171 ? -1.689  -8.688  27.042  1.00 27.39 ? 493 LYS A NZ  1 
ATOM   1290 N N   . ASP A 1 172 ? 5.427   -5.423  26.014  1.00 10.99 ? 494 ASP A N   1 
ATOM   1291 C CA  . ASP A 1 172 ? 6.841   -5.166  26.295  1.00 10.64 ? 494 ASP A CA  1 
ATOM   1292 C C   . ASP A 1 172 ? 7.218   -3.763  26.776  1.00 16.88 ? 494 ASP A C   1 
ATOM   1293 O O   . ASP A 1 172 ? 8.297   -3.579  27.352  1.00 18.01 ? 494 ASP A O   1 
ATOM   1294 C CB  . ASP A 1 172 ? 7.702   -5.559  25.081  1.00 11.71 ? 494 ASP A CB  1 
ATOM   1295 C CG  . ASP A 1 172 ? 7.337   -4.937  23.746  1.00 15.15 ? 494 ASP A CG  1 
ATOM   1296 O OD1 . ASP A 1 172 ? 7.990   -5.276  22.739  1.00 19.04 ? 494 ASP A OD1 1 
ATOM   1297 O OD2 . ASP A 1 172 ? 6.424   -4.109  23.711  1.00 15.90 ? 494 ASP A OD2 1 
ATOM   1298 N N   . LEU A 1 173 ? 6.374   -2.777  26.487  1.00 13.61 ? 495 LEU A N   1 
ATOM   1299 C CA  . LEU A 1 173 ? 6.617   -1.373  26.793  1.00 14.26 ? 495 LEU A CA  1 
ATOM   1300 C C   . LEU A 1 173 ? 5.331   -0.700  27.177  1.00 18.15 ? 495 LEU A C   1 
ATOM   1301 O O   . LEU A 1 173 ? 4.264   -1.055  26.669  1.00 17.38 ? 495 LEU A O   1 
ATOM   1302 C CB  . LEU A 1 173 ? 7.191   -0.632  25.543  1.00 14.67 ? 495 LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 173 ? 8.518   -1.132  24.932  1.00 19.87 ? 495 LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 173 ? 8.757   -0.516  23.581  1.00 19.84 ? 495 LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 173 ? 9.708   -0.866  25.857  1.00 21.85 ? 495 LEU A CD2 1 
ATOM   1306 N N   . THR A 1 174 ? 5.445   0.327   28.015  1.00 15.90 ? 496 THR A N   1 
ATOM   1307 C CA  . THR A 1 174 ? 4.318   1.155   28.451  1.00 15.87 ? 496 THR A CA  1 
ATOM   1308 C C   . THR A 1 174 ? 4.093   2.247   27.384  1.00 18.16 ? 496 THR A C   1 
ATOM   1309 O O   . THR A 1 174 ? 5.063   2.753   26.821  1.00 16.76 ? 496 THR A O   1 
ATOM   1310 C CB  . THR A 1 174 ? 4.597   1.761   29.835  1.00 20.26 ? 496 THR A CB  1 
ATOM   1311 O OG1 . THR A 1 174 ? 5.590   2.772   29.697  1.00 23.54 ? 496 THR A OG1 1 
ATOM   1312 C CG2 . THR A 1 174 ? 5.068   0.723   30.853  1.00 16.02 ? 496 THR A CG2 1 
ATOM   1313 N N   . TYR A 1 175 ? 2.815   2.589   27.107  1.00 14.34 ? 497 TYR A N   1 
ATOM   1314 C CA  . TYR A 1 175 ? 2.424   3.613   26.123  1.00 13.70 ? 497 TYR A CA  1 
ATOM   1315 C C   . TYR A 1 175 ? 0.985   4.048   26.404  1.00 17.22 ? 497 TYR A C   1 
ATOM   1316 O O   . TYR A 1 175 ? 0.234   3.339   27.068  1.00 16.13 ? 497 TYR A O   1 
ATOM   1317 C CB  . TYR A 1 175 ? 2.486   3.030   24.664  1.00 13.18 ? 497 TYR A CB  1 
ATOM   1318 C CG  . TYR A 1 175 ? 1.562   1.840   24.477  1.00 15.23 ? 497 TYR A CG  1 
ATOM   1319 C CD1 . TYR A 1 175 ? 0.207   2.019   24.196  1.00 17.90 ? 497 TYR A CD1 1 
ATOM   1320 C CD2 . TYR A 1 175 ? 2.014   0.543   24.695  1.00 15.80 ? 497 TYR A CD2 1 
ATOM   1321 C CE1 . TYR A 1 175 ? -0.666  0.937   24.113  1.00 19.71 ? 497 TYR A CE1 1 
ATOM   1322 C CE2 . TYR A 1 175 ? 1.149   -0.548  24.625  1.00 17.27 ? 497 TYR A CE2 1 
ATOM   1323 C CZ  . TYR A 1 175 ? -0.188  -0.348  24.327  1.00 26.72 ? 497 TYR A CZ  1 
ATOM   1324 O OH  . TYR A 1 175 ? -1.039  -1.421  24.247  1.00 29.88 ? 497 TYR A OH  1 
ATOM   1325 N N   . ARG A 1 176 ? 0.581   5.157   25.808  1.00 14.37 ? 498 ARG A N   1 
ATOM   1326 C CA  . ARG A 1 176 ? -0.812  5.565   25.803  1.00 13.70 ? 498 ARG A CA  1 
ATOM   1327 C C   . ARG A 1 176 ? -1.292  5.358   24.331  1.00 16.24 ? 498 ARG A C   1 
ATOM   1328 O O   . ARG A 1 176 ? -0.475  5.547   23.410  1.00 16.28 ? 498 ARG A O   1 
ATOM   1329 C CB  . ARG A 1 176 ? -0.951  7.046   26.189  1.00 14.15 ? 498 ARG A CB  1 
ATOM   1330 C CG  . ARG A 1 176 ? -0.711  7.352   27.665  1.00 21.90 ? 498 ARG A CG  1 
ATOM   1331 C CD  . ARG A 1 176 ? -1.749  8.320   28.180  1.00 23.94 ? 498 ARG A CD  1 
ATOM   1332 N NE  . ARG A 1 176 ? -1.289  9.703   28.141  1.00 31.64 ? 498 ARG A NE  1 
ATOM   1333 C CZ  . ARG A 1 176 ? -2.083  10.769  28.187  1.00 42.59 ? 498 ARG A CZ  1 
ATOM   1334 N NH1 . ARG A 1 176 ? -3.404  10.624  28.220  1.00 23.99 ? 498 ARG A NH1 1 
ATOM   1335 N NH2 . ARG A 1 176 ? -1.565  11.989  28.161  1.00 35.62 ? 498 ARG A NH2 1 
ATOM   1336 N N   . PRO A 1 177 ? -2.572  4.992   24.052  1.00 9.94  ? 499 PRO A N   1 
ATOM   1337 C CA  . PRO A 1 177 ? -3.006  4.950   22.634  1.00 9.55  ? 499 PRO A CA  1 
ATOM   1338 C C   . PRO A 1 177 ? -3.092  6.382   22.073  1.00 14.27 ? 499 PRO A C   1 
ATOM   1339 O O   . PRO A 1 177 ? -3.394  7.300   22.847  1.00 14.06 ? 499 PRO A O   1 
ATOM   1340 C CB  . PRO A 1 177 ? -4.407  4.326   22.705  1.00 10.36 ? 499 PRO A CB  1 
ATOM   1341 C CG  . PRO A 1 177 ? -4.932  4.705   24.087  1.00 13.97 ? 499 PRO A CG  1 
ATOM   1342 C CD  . PRO A 1 177 ? -3.703  4.757   24.986  1.00 10.13 ? 499 PRO A CD  1 
ATOM   1343 N N   . MET A 1 178 ? -2.851  6.591   20.754  1.00 10.92 ? 500 MET A N   1 
ATOM   1344 C CA  . MET A 1 178 ? -2.983  7.945   20.149  1.00 10.94 ? 500 MET A CA  1 
ATOM   1345 C C   . MET A 1 178 ? -4.356  8.558   20.412  1.00 16.01 ? 500 MET A C   1 
ATOM   1346 O O   . MET A 1 178 ? -4.469  9.778   20.494  1.00 16.49 ? 500 MET A O   1 
ATOM   1347 C CB  . MET A 1 178 ? -2.750  7.940   18.617  1.00 12.33 ? 500 MET A CB  1 
ATOM   1348 C CG  . MET A 1 178 ? -1.293  7.991   18.208  1.00 14.67 ? 500 MET A CG  1 
ATOM   1349 S SD  . MET A 1 178 ? -0.341  9.428   18.787  1.00 16.07 ? 500 MET A SD  1 
ATOM   1350 C CE  . MET A 1 178 ? -1.442  10.814  18.287  1.00 11.84 ? 500 MET A CE  1 
ATOM   1351 N N   . SER A 1 179 ? -5.398  7.711   20.512  1.00 12.70 ? 501 SER A N   1 
ATOM   1352 C CA  . SER A 1 179 ? -6.781  8.095   20.793  1.00 13.25 ? 501 SER A CA  1 
ATOM   1353 C C   . SER A 1 179 ? -6.905  8.905   22.111  1.00 18.43 ? 501 SER A C   1 
ATOM   1354 O O   . SER A 1 179 ? -7.843  9.698   22.252  1.00 18.18 ? 501 SER A O   1 
ATOM   1355 C CB  . SER A 1 179 ? -7.670  6.854   20.853  1.00 16.12 ? 501 SER A CB  1 
ATOM   1356 O OG  . SER A 1 179 ? -7.250  5.964   21.878  1.00 21.42 ? 501 SER A OG  1 
ATOM   1357 N N   . ASP A 1 180 ? -5.941  8.731   23.058  1.00 15.38 ? 502 ASP A N   1 
ATOM   1358 C CA  . ASP A 1 180 ? -5.919  9.511   24.305  1.00 15.59 ? 502 ASP A CA  1 
ATOM   1359 C C   . ASP A 1 180 ? -5.755  11.012  24.022  1.00 18.72 ? 502 ASP A C   1 
ATOM   1360 O O   . ASP A 1 180 ? -6.103  11.811  24.874  1.00 17.24 ? 502 ASP A O   1 
ATOM   1361 C CB  . ASP A 1 180 ? -4.821  9.021   25.267  1.00 16.44 ? 502 ASP A CB  1 
ATOM   1362 C CG  . ASP A 1 180 ? -5.255  7.901   26.191  1.00 15.98 ? 502 ASP A CG  1 
ATOM   1363 O OD1 . ASP A 1 180 ? -6.416  7.449   26.083  1.00 17.16 ? 502 ASP A OD1 1 
ATOM   1364 O OD2 . ASP A 1 180 ? -4.431  7.450   26.987  1.00 19.25 ? 502 ASP A OD2 1 
ATOM   1365 N N   . MET A 1 181 ? -5.296  11.385  22.800  1.00 16.69 ? 503 MET A N   1 
ATOM   1366 C CA  . MET A 1 181 ? -5.140  12.782  22.361  1.00 17.03 ? 503 MET A CA  1 
ATOM   1367 C C   . MET A 1 181 ? -6.489  13.430  22.033  1.00 20.42 ? 503 MET A C   1 
ATOM   1368 O O   . MET A 1 181 ? -6.601  14.660  22.042  1.00 19.08 ? 503 MET A O   1 
ATOM   1369 C CB  . MET A 1 181 ? -4.232  12.877  21.125  1.00 19.97 ? 503 MET A CB  1 
ATOM   1370 C CG  . MET A 1 181 ? -2.753  12.725  21.421  1.00 25.13 ? 503 MET A CG  1 
ATOM   1371 S SD  . MET A 1 181 ? -2.144  13.595  22.894  1.00 31.54 ? 503 MET A SD  1 
ATOM   1372 C CE  . MET A 1 181 ? -2.349  15.254  22.430  1.00 28.72 ? 503 MET A CE  1 
ATOM   1373 N N   . GLY A 1 182 ? -7.471  12.595  21.690  1.00 17.05 ? 504 GLY A N   1 
ATOM   1374 C CA  . GLY A 1 182 ? -8.811  13.018  21.315  1.00 29.10 ? 504 GLY A CA  1 
ATOM   1375 C C   . GLY A 1 182 ? -9.596  13.548  22.496  1.00 50.17 ? 504 GLY A C   1 
ATOM   1376 O O   . GLY A 1 182 ? -10.140 14.648  22.428  1.00 20.89 ? 504 GLY A O   1 
ATOM   1377 N N   . GLU B 2 1   ? 9.768   4.541   -21.975 1.00 18.12 ? 344 GLU B N   1 
ATOM   1378 C CA  . GLU B 2 1   ? 9.489   5.852   -21.383 1.00 18.41 ? 344 GLU B CA  1 
ATOM   1379 C C   . GLU B 2 1   ? 9.536   5.804   -19.865 1.00 21.35 ? 344 GLU B C   1 
ATOM   1380 O O   . GLU B 2 1   ? 9.019   4.864   -19.255 1.00 20.03 ? 344 GLU B O   1 
ATOM   1381 C CB  . GLU B 2 1   ? 8.153   6.427   -21.866 1.00 20.39 ? 344 GLU B CB  1 
ATOM   1382 C CG  . GLU B 2 1   ? 8.323   7.461   -22.969 1.00 37.37 ? 344 GLU B CG  1 
ATOM   1383 C CD  . GLU B 2 1   ? 7.106   8.317   -23.280 1.00 77.11 ? 344 GLU B CD  1 
ATOM   1384 O OE1 . GLU B 2 1   ? 6.317   8.608   -22.350 1.00 74.49 ? 344 GLU B OE1 1 
ATOM   1385 O OE2 . GLU B 2 1   ? 6.968   8.735   -24.453 1.00 78.60 ? 344 GLU B OE2 1 
ATOM   1386 N N   . TYR B 2 2   ? 10.177  6.806   -19.254 1.00 18.01 ? 345 TYR B N   1 
ATOM   1387 C CA  . TYR B 2 2   ? 10.316  6.821   -17.806 1.00 17.62 ? 345 TYR B CA  1 
ATOM   1388 C C   . TYR B 2 2   ? 9.002   7.041   -17.076 1.00 22.24 ? 345 TYR B C   1 
ATOM   1389 O O   . TYR B 2 2   ? 8.203   7.898   -17.466 1.00 21.94 ? 345 TYR B O   1 
ATOM   1390 C CB  . TYR B 2 2   ? 11.385  7.821   -17.332 1.00 17.90 ? 345 TYR B CB  1 
ATOM   1391 C CG  . TYR B 2 2   ? 11.737  7.609   -15.876 1.00 19.49 ? 345 TYR B CG  1 
ATOM   1392 C CD1 . TYR B 2 2   ? 12.574  6.563   -15.486 1.00 20.43 ? 345 TYR B CD1 1 
ATOM   1393 C CD2 . TYR B 2 2   ? 11.156  8.391   -14.876 1.00 20.36 ? 345 TYR B CD2 1 
ATOM   1394 C CE1 . TYR B 2 2   ? 12.850  6.320   -14.146 1.00 19.86 ? 345 TYR B CE1 1 
ATOM   1395 C CE2 . TYR B 2 2   ? 11.429  8.158   -13.527 1.00 21.13 ? 345 TYR B CE2 1 
ATOM   1396 C CZ  . TYR B 2 2   ? 12.279  7.122   -13.171 1.00 24.99 ? 345 TYR B CZ  1 
ATOM   1397 O OH  . TYR B 2 2   ? 12.552  6.865   -11.860 1.00 22.74 ? 345 TYR B OH  1 
ATOM   1398 N N   . GLU B 2 3   ? 8.795   6.253   -16.003 1.00 18.51 ? 346 GLU B N   1 
ATOM   1399 C CA  . GLU B 2 3   ? 7.642   6.352   -15.108 1.00 17.90 ? 346 GLU B CA  1 
ATOM   1400 C C   . GLU B 2 3   ? 8.167   6.374   -13.692 1.00 19.98 ? 346 GLU B C   1 
ATOM   1401 O O   . GLU B 2 3   ? 9.130   5.652   -13.383 1.00 19.67 ? 346 GLU B O   1 
ATOM   1402 C CB  . GLU B 2 3   ? 6.670   5.190   -15.300 1.00 19.44 ? 346 GLU B CB  1 
ATOM   1403 C CG  . GLU B 2 3   ? 5.743   5.408   -16.485 1.00 35.87 ? 346 GLU B CG  1 
ATOM   1404 C CD  . GLU B 2 3   ? 4.722   4.313   -16.728 1.00 68.16 ? 346 GLU B CD  1 
ATOM   1405 O OE1 . GLU B 2 3   ? 4.101   3.840   -15.748 1.00 67.93 ? 346 GLU B OE1 1 
ATOM   1406 O OE2 . GLU B 2 3   ? 4.523   3.949   -17.909 1.00 70.74 ? 346 GLU B OE2 1 
ATOM   1407 N N   . GLU B 2 4   ? 7.550   7.205   -12.834 1.00 15.28 ? 347 GLU B N   1 
ATOM   1408 C CA  . GLU B 2 4   ? 7.974   7.376   -11.448 1.00 14.94 ? 347 GLU B CA  1 
ATOM   1409 C C   . GLU B 2 4   ? 8.006   6.046   -10.682 1.00 17.75 ? 347 GLU B C   1 
ATOM   1410 O O   . GLU B 2 4   ? 7.051   5.272   -10.747 1.00 17.63 ? 347 GLU B O   1 
ATOM   1411 C CB  . GLU B 2 4   ? 7.136   8.439   -10.736 1.00 16.32 ? 347 GLU B CB  1 
ATOM   1412 C CG  . GLU B 2 4   ? 7.699   8.768   -9.359  1.00 21.65 ? 347 GLU B CG  1 
ATOM   1413 C CD  . GLU B 2 4   ? 6.996   9.860   -8.589  1.00 17.94 ? 347 GLU B CD  1 
ATOM   1414 O OE1 . GLU B 2 4   ? 6.193   10.609  -9.190  1.00 12.56 ? 347 GLU B OE1 1 
ATOM   1415 O OE2 . GLU B 2 4   ? 7.195   9.915   -7.358  1.00 9.80  ? 347 GLU B OE2 1 
ATOM   1416 N N   . ARG B 2 5   ? 9.154   5.759   -10.051 1.00 12.73 ? 348 ARG B N   1 
ATOM   1417 C CA  . ARG B 2 5   ? 9.420   4.513   -9.328  1.00 11.86 ? 348 ARG B CA  1 
ATOM   1418 C C   . ARG B 2 5   ? 9.195   4.667   -7.838  1.00 13.22 ? 348 ARG B C   1 
ATOM   1419 O O   . ARG B 2 5   ? 9.199   5.774   -7.317  1.00 12.03 ? 348 ARG B O   1 
ATOM   1420 C CB  . ARG B 2 5   ? 10.877  4.058   -9.592  1.00 12.78 ? 348 ARG B CB  1 
ATOM   1421 C CG  . ARG B 2 5   ? 11.128  3.579   -11.034 1.00 14.84 ? 348 ARG B CG  1 
ATOM   1422 C CD  . ARG B 2 5   ? 12.536  3.053   -11.223 1.00 26.55 ? 348 ARG B CD  1 
ATOM   1423 N NE  . ARG B 2 5   ? 12.742  1.769   -10.550 1.00 31.33 ? 348 ARG B NE  1 
ATOM   1424 C CZ  . ARG B 2 5   ? 12.544  0.574   -11.105 1.00 42.46 ? 348 ARG B CZ  1 
ATOM   1425 N NH1 . ARG B 2 5   ? 12.131  0.476   -12.360 1.00 33.19 ? 348 ARG B NH1 1 
ATOM   1426 N NH2 . ARG B 2 5   ? 12.755  -0.529  -10.406 1.00 26.03 ? 348 ARG B NH2 1 
ATOM   1427 N N   . GLU B 2 6   ? 9.036   3.547   -7.143  1.00 11.40 ? 349 GLU B N   1 
ATOM   1428 C CA  . GLU B 2 6   ? 8.879   3.470   -5.681  1.00 10.48 ? 349 GLU B CA  1 
ATOM   1429 C C   . GLU B 2 6   ? 10.136  4.104   -4.976  1.00 13.99 ? 349 GLU B C   1 
ATOM   1430 O O   . GLU B 2 6   ? 10.010  4.827   -3.972  1.00 13.47 ? 349 GLU B O   1 
ATOM   1431 C CB  . GLU B 2 6   ? 8.683   1.982   -5.307  1.00 11.15 ? 349 GLU B CB  1 
ATOM   1432 C CG  . GLU B 2 6   ? 8.236   1.720   -3.886  1.00 17.39 ? 349 GLU B CG  1 
ATOM   1433 C CD  . GLU B 2 6   ? 9.285   1.880   -2.799  1.00 29.46 ? 349 GLU B CD  1 
ATOM   1434 O OE1 . GLU B 2 6   ? 10.494  1.664   -3.059  1.00 14.41 ? 349 GLU B OE1 1 
ATOM   1435 O OE2 . GLU B 2 6   ? 8.879   2.214   -1.667  1.00 13.19 ? 349 GLU B OE2 1 
ATOM   1436 N N   . SER B 2 7   ? 11.329  3.851   -5.532  1.00 10.06 ? 350 SER B N   1 
ATOM   1437 C CA  . SER B 2 7   ? 12.597  4.362   -5.003  1.00 9.78  ? 350 SER B CA  1 
ATOM   1438 C C   . SER B 2 7   ? 13.020  5.714   -5.619  1.00 13.59 ? 350 SER B C   1 
ATOM   1439 O O   . SER B 2 7   ? 14.195  6.062   -5.509  1.00 11.54 ? 350 SER B O   1 
ATOM   1440 C CB  . SER B 2 7   ? 13.701  3.333   -5.217  1.00 14.24 ? 350 SER B CB  1 
ATOM   1441 O OG  . SER B 2 7   ? 13.875  3.052   -6.598  1.00 20.37 ? 350 SER B OG  1 
ATOM   1442 N N   . GLU B 2 8   ? 12.069  6.475   -6.246  1.00 10.06 ? 351 GLU B N   1 
ATOM   1443 C CA  . GLU B 2 8   ? 12.293  7.777   -6.909  1.00 10.08 ? 351 GLU B CA  1 
ATOM   1444 C C   . GLU B 2 8   ? 13.145  8.827   -6.135  1.00 14.41 ? 351 GLU B C   1 
ATOM   1445 O O   . GLU B 2 8   ? 13.979  9.509   -6.734  1.00 12.16 ? 351 GLU B O   1 
ATOM   1446 C CB  . GLU B 2 8   ? 10.944  8.422   -7.267  1.00 11.17 ? 351 GLU B CB  1 
ATOM   1447 C CG  . GLU B 2 8   ? 11.027  9.505   -8.339  1.00 12.13 ? 351 GLU B CG  1 
ATOM   1448 C CD  . GLU B 2 8   ? 11.431  9.019   -9.718  1.00 12.49 ? 351 GLU B CD  1 
ATOM   1449 O OE1 . GLU B 2 8   ? 11.094  7.870   -10.080 1.00 14.08 ? 351 GLU B OE1 1 
ATOM   1450 O OE2 . GLU B 2 8   ? 12.163  9.760   -10.404 1.00 17.69 ? 351 GLU B OE2 1 
ATOM   1451 N N   . PHE B 2 9   ? 12.885  8.980   -4.829  1.00 10.68 ? 352 PHE B N   1 
ATOM   1452 C CA  . PHE B 2 9   ? 13.513  9.999   -3.978  1.00 9.83  ? 352 PHE B CA  1 
ATOM   1453 C C   . PHE B 2 9   ? 14.725  9.476   -3.203  1.00 13.97 ? 352 PHE B C   1 
ATOM   1454 O O   . PHE B 2 9   ? 15.414  10.261  -2.555  1.00 14.68 ? 352 PHE B O   1 
ATOM   1455 C CB  . PHE B 2 9   ? 12.463  10.560  -2.987  1.00 10.99 ? 352 PHE B CB  1 
ATOM   1456 C CG  . PHE B 2 9   ? 11.202  11.142  -3.591  1.00 12.34 ? 352 PHE B CG  1 
ATOM   1457 C CD1 . PHE B 2 9   ? 10.227  10.315  -4.139  1.00 13.46 ? 352 PHE B CD1 1 
ATOM   1458 C CD2 . PHE B 2 9   ? 10.964  12.514  -3.559  1.00 13.61 ? 352 PHE B CD2 1 
ATOM   1459 C CE1 . PHE B 2 9   ? 9.056   10.847  -4.660  1.00 13.81 ? 352 PHE B CE1 1 
ATOM   1460 C CE2 . PHE B 2 9   ? 9.789   13.048  -4.080  1.00 15.66 ? 352 PHE B CE2 1 
ATOM   1461 C CZ  . PHE B 2 9   ? 8.835   12.209  -4.611  1.00 14.20 ? 352 PHE B CZ  1 
ATOM   1462 N N   . ASP B 2 10  ? 14.980  8.162   -3.254  1.00 12.14 ? 353 ASP B N   1 
ATOM   1463 C CA  . ASP B 2 10  ? 16.045  7.531   -2.471  1.00 11.74 ? 353 ASP B CA  1 
ATOM   1464 C C   . ASP B 2 10  ? 17.454  7.762   -2.943  1.00 15.89 ? 353 ASP B C   1 
ATOM   1465 O O   . ASP B 2 10  ? 17.759  7.559   -4.111  1.00 16.84 ? 353 ASP B O   1 
ATOM   1466 C CB  . ASP B 2 10  ? 15.780  6.024   -2.241  1.00 12.77 ? 353 ASP B CB  1 
ATOM   1467 C CG  . ASP B 2 10  ? 14.359  5.683   -1.808  1.00 10.41 ? 353 ASP B CG  1 
ATOM   1468 O OD1 . ASP B 2 10  ? 13.618  6.604   -1.402  1.00 10.39 ? 353 ASP B OD1 1 
ATOM   1469 O OD2 . ASP B 2 10  ? 13.975  4.523   -1.938  1.00 10.88 ? 353 ASP B OD2 1 
ATOM   1470 N N   . ILE B 2 11  ? 18.320  8.125   -1.996  1.00 11.55 ? 354 ILE B N   1 
ATOM   1471 C CA  . ILE B 2 11  ? 19.755  8.323   -2.162  1.00 10.89 ? 354 ILE B CA  1 
ATOM   1472 C C   . ILE B 2 11  ? 20.461  6.950   -2.092  1.00 17.76 ? 354 ILE B C   1 
ATOM   1473 O O   . ILE B 2 11  ? 21.364  6.666   -2.901  1.00 17.68 ? 354 ILE B O   1 
ATOM   1474 C CB  . ILE B 2 11  ? 20.275  9.281   -1.062  1.00 11.92 ? 354 ILE B CB  1 
ATOM   1475 C CG1 . ILE B 2 11  ? 19.537  10.643  -1.138  1.00 9.83  ? 354 ILE B CG1 1 
ATOM   1476 C CG2 . ILE B 2 11  ? 21.828  9.438   -1.131  1.00 9.43  ? 354 ILE B CG2 1 
ATOM   1477 C CD1 . ILE B 2 11  ? 19.668  11.538  0.132   1.00 4.77  ? 354 ILE B CD1 1 
ATOM   1478 N N   . GLU B 2 12  ? 20.037  6.123   -1.099  1.00 15.10 ? 355 GLU B N   1 
ATOM   1479 C CA  . GLU B 2 12  ? 20.525  4.777   -0.790  1.00 48.59 ? 355 GLU B CA  1 
ATOM   1480 C C   . GLU B 2 12  ? 19.352  3.953   -0.277  1.00 67.65 ? 355 GLU B C   1 
ATOM   1481 O O   . GLU B 2 12  ? 18.454  4.511   0.350   1.00 27.36 ? 355 GLU B O   1 
ATOM   1482 C CB  . GLU B 2 12  ? 21.629  4.828   0.282   1.00 49.91 ? 355 GLU B CB  1 
HETATM 1483 C C1  . GOL C 3 .   ? 10.161  12.711  -9.477  1.00 21.67 ? 401 GOL B C1  1 
HETATM 1484 O O1  . GOL C 3 .   ? 10.378  13.206  -10.797 1.00 23.79 ? 401 GOL B O1  1 
HETATM 1485 C C2  . GOL C 3 .   ? 10.245  13.791  -8.420  1.00 22.25 ? 401 GOL B C2  1 
HETATM 1486 O O2  . GOL C 3 .   ? 10.685  15.041  -8.981  1.00 20.49 ? 401 GOL B O2  1 
HETATM 1487 C C3  . GOL C 3 .   ? 8.903   13.970  -7.746  1.00 19.76 ? 401 GOL B C3  1 
HETATM 1488 O O3  . GOL C 3 .   ? 8.897   15.127  -6.918  1.00 16.76 ? 401 GOL B O3  1 
HETATM 1489 O O   . HOH D 4 .   ? -20.205 9.838   1.234   1.00 14.08 ? 601 HOH A O   1 
HETATM 1490 O O   . HOH D 4 .   ? -0.681  -8.313  22.436  1.00 12.02 ? 602 HOH A O   1 
HETATM 1491 O O   . HOH D 4 .   ? -3.232  18.951  15.280  1.00 12.27 ? 603 HOH A O   1 
HETATM 1492 O O   . HOH D 4 .   ? -0.482  -12.830 13.560  1.00 20.14 ? 604 HOH A O   1 
HETATM 1493 O O   . HOH D 4 .   ? -14.184 10.267  1.195   1.00 15.27 ? 605 HOH A O   1 
HETATM 1494 O O   . HOH D 4 .   ? 3.694   -7.720  23.394  1.00 15.95 ? 606 HOH A O   1 
HETATM 1495 O O   . HOH D 4 .   ? 1.958   -11.441 18.088  1.00 13.49 ? 607 HOH A O   1 
HETATM 1496 O O   . HOH D 4 .   ? -7.065  11.041  -6.680  1.00 26.41 ? 608 HOH A O   1 
HETATM 1497 O O   . HOH D 4 .   ? 5.991   -10.556 12.905  1.00 20.82 ? 609 HOH A O   1 
HETATM 1498 O O   . HOH D 4 .   ? -6.282  13.486  -0.191  1.00 16.80 ? 610 HOH A O   1 
HETATM 1499 O O   . HOH D 4 .   ? 8.142   17.044  -3.763  1.00 12.47 ? 611 HOH A O   1 
HETATM 1500 O O   . HOH D 4 .   ? -9.126  16.475  20.460  1.00 23.30 ? 612 HOH A O   1 
HETATM 1501 O O   . HOH D 4 .   ? 9.000   -7.861  22.817  1.00 27.98 ? 613 HOH A O   1 
HETATM 1502 O O   . HOH D 4 .   ? 16.858  -2.617  18.690  1.00 18.29 ? 614 HOH A O   1 
HETATM 1503 O O   . HOH D 4 .   ? 12.972  -2.619  20.690  1.00 16.44 ? 615 HOH A O   1 
HETATM 1504 O O   . HOH D 4 .   ? 10.775  18.711  2.475   1.00 23.06 ? 616 HOH A O   1 
HETATM 1505 O O   . HOH D 4 .   ? 3.061   -12.000 7.330   1.00 30.21 ? 617 HOH A O   1 
HETATM 1506 O O   . HOH D 4 .   ? 15.415  15.358  1.400   1.00 12.34 ? 618 HOH A O   1 
HETATM 1507 O O   . HOH D 4 .   ? 2.275   19.799  24.489  1.00 24.49 ? 619 HOH A O   1 
HETATM 1508 O O   . HOH D 4 .   ? -15.515 11.659  9.156   1.00 29.54 ? 620 HOH A O   1 
HETATM 1509 O O   . HOH D 4 .   ? 15.002  17.811  0.421   1.00 12.06 ? 621 HOH A O   1 
HETATM 1510 O O   . HOH D 4 .   ? 6.139   -4.646  30.339  1.00 31.62 ? 622 HOH A O   1 
HETATM 1511 O O   . HOH D 4 .   ? -6.990  -5.620  22.571  1.00 22.30 ? 623 HOH A O   1 
HETATM 1512 O O   . HOH D 4 .   ? -7.168  -8.850  19.355  1.00 17.72 ? 624 HOH A O   1 
HETATM 1513 O O   . HOH D 4 .   ? 2.851   -12.852 15.561  1.00 30.56 ? 625 HOH A O   1 
HETATM 1514 O O   . HOH D 4 .   ? -10.201 16.912  12.354  1.00 32.01 ? 626 HOH A O   1 
HETATM 1515 O O   . HOH D 4 .   ? -13.159 12.141  4.297   1.00 13.03 ? 627 HOH A O   1 
HETATM 1516 O O   . HOH D 4 .   ? 3.885   -12.399 10.675  1.00 20.85 ? 628 HOH A O   1 
HETATM 1517 O O   . HOH D 4 .   ? -8.447  18.036  9.214   1.00 22.50 ? 629 HOH A O   1 
HETATM 1518 O O   . HOH D 4 .   ? 7.932   -8.684  20.665  1.00 23.13 ? 630 HOH A O   1 
HETATM 1519 O O   . HOH D 4 .   ? 18.146  -1.253  12.358  1.00 27.42 ? 631 HOH A O   1 
HETATM 1520 O O   . HOH D 4 .   ? 15.578  17.875  5.519   1.00 17.63 ? 632 HOH A O   1 
HETATM 1521 O O   . HOH D 4 .   ? 6.567   21.657  28.811  1.00 22.78 ? 633 HOH A O   1 
HETATM 1522 O O   . HOH D 4 .   ? 3.901   20.073  5.022   1.00 24.94 ? 634 HOH A O   1 
HETATM 1523 O O   . HOH D 4 .   ? -13.981 13.890  15.488  1.00 29.42 ? 635 HOH A O   1 
HETATM 1524 O O   . HOH D 4 .   ? 8.720   -10.873 13.305  1.00 20.95 ? 636 HOH A O   1 
HETATM 1525 O O   . HOH D 4 .   ? 1.991   15.183  24.004  1.00 12.06 ? 637 HOH A O   1 
HETATM 1526 O O   . HOH D 4 .   ? 11.149  -9.432  19.379  1.00 28.30 ? 638 HOH A O   1 
HETATM 1527 O O   . HOH D 4 .   ? -12.459 7.289   -0.840  1.00 19.26 ? 639 HOH A O   1 
HETATM 1528 O O   . HOH D 4 .   ? -12.207 9.882   -1.932  1.00 24.57 ? 640 HOH A O   1 
HETATM 1529 O O   . HOH D 4 .   ? -14.678 17.318  16.766  1.00 28.83 ? 641 HOH A O   1 
HETATM 1530 O O   . HOH D 4 .   ? 7.243   -12.793 9.791   1.00 33.92 ? 642 HOH A O   1 
HETATM 1531 O O   . HOH D 4 .   ? 6.483   20.918  1.787   1.00 19.47 ? 643 HOH A O   1 
HETATM 1532 O O   . HOH D 4 .   ? -4.521  19.129  10.332  1.00 22.28 ? 644 HOH A O   1 
HETATM 1533 O O   . HOH D 4 .   ? 14.085  19.502  4.476   1.00 24.94 ? 645 HOH A O   1 
HETATM 1534 O O   . HOH D 4 .   ? -1.917  4.409   -8.923  1.00 3.10  ? 646 HOH A O   1 
HETATM 1535 O O   . HOH D 4 .   ? 8.744   14.059  5.568   1.00 14.25 ? 647 HOH A O   1 
HETATM 1536 O O   . HOH D 4 .   ? 16.646  -3.220  3.501   1.00 12.46 ? 648 HOH A O   1 
HETATM 1537 O O   . HOH D 4 .   ? 8.103   13.501  3.093   1.00 7.88  ? 649 HOH A O   1 
HETATM 1538 O O   . HOH D 4 .   ? 15.278  -4.092  6.051   1.00 13.44 ? 650 HOH A O   1 
HETATM 1539 O O   . HOH D 4 .   ? 5.331   -3.228  -1.046  1.00 10.55 ? 651 HOH A O   1 
HETATM 1540 O O   . HOH D 4 .   ? 11.613  7.804   2.336   1.00 11.05 ? 652 HOH A O   1 
HETATM 1541 O O   . HOH D 4 .   ? 1.713   -5.186  15.202  1.00 10.45 ? 653 HOH A O   1 
HETATM 1542 O O   . HOH D 4 .   ? 0.281   8.445   -3.614  1.00 8.87  ? 654 HOH A O   1 
HETATM 1543 O O   . HOH D 4 .   ? 17.609  5.388   7.747   1.00 16.85 ? 655 HOH A O   1 
HETATM 1544 O O   . HOH D 4 .   ? -15.979 5.346   5.416   1.00 20.72 ? 656 HOH A O   1 
HETATM 1545 O O   . HOH D 4 .   ? -10.010 8.617   18.516  1.00 17.44 ? 657 HOH A O   1 
HETATM 1546 O O   . HOH D 4 .   ? 19.258  6.087   15.414  1.00 18.21 ? 658 HOH A O   1 
HETATM 1547 O O   . HOH D 4 .   ? 0.814   0.467   28.394  1.00 26.38 ? 659 HOH A O   1 
HETATM 1548 O O   . HOH D 4 .   ? -0.725  11.767  -8.742  1.00 15.46 ? 660 HOH A O   1 
HETATM 1549 O O   . HOH D 4 .   ? -8.246  6.555   24.267  1.00 15.87 ? 661 HOH A O   1 
HETATM 1550 O O   . HOH D 4 .   ? 19.341  7.549   8.564   1.00 22.34 ? 662 HOH A O   1 
HETATM 1551 O O   . HOH D 4 .   ? -15.656 5.911   2.073   1.00 18.25 ? 663 HOH A O   1 
HETATM 1552 O O   . HOH D 4 .   ? 20.839  -0.970  9.761   1.00 20.74 ? 664 HOH A O   1 
HETATM 1553 O O   . HOH D 4 .   ? 17.619  11.510  13.678  1.00 23.84 ? 665 HOH A O   1 
HETATM 1554 O O   . HOH D 4 .   ? -1.529  0.709   -8.658  1.00 24.68 ? 666 HOH A O   1 
HETATM 1555 O O   . HOH D 4 .   ? 2.540   8.364   27.502  1.00 15.76 ? 667 HOH A O   1 
HETATM 1556 O O   . HOH D 4 .   ? -12.975 6.947   15.171  1.00 17.20 ? 668 HOH A O   1 
HETATM 1557 O O   . HOH D 4 .   ? -18.318 8.300   8.007   1.00 27.44 ? 669 HOH A O   1 
HETATM 1558 O O   . HOH D 4 .   ? 3.989   19.694  2.295   1.00 16.12 ? 670 HOH A O   1 
HETATM 1559 O O   . HOH D 4 .   ? -10.164 1.127   18.100  1.00 27.74 ? 671 HOH A O   1 
HETATM 1560 O O   . HOH D 4 .   ? -8.869  4.866   16.025  1.00 19.58 ? 672 HOH A O   1 
HETATM 1561 O O   . HOH D 4 .   ? 3.049   -4.999  -3.659  1.00 34.05 ? 673 HOH A O   1 
HETATM 1562 O O   . HOH D 4 .   ? 0.464   19.167  -1.981  1.00 27.33 ? 674 HOH A O   1 
HETATM 1563 O O   . HOH D 4 .   ? 19.551  0.851   0.479   1.00 46.62 ? 675 HOH A O   1 
HETATM 1564 O O   . HOH D 4 .   ? 14.842  -7.314  3.952   1.00 22.17 ? 676 HOH A O   1 
HETATM 1565 O O   . HOH D 4 .   ? -5.245  -0.882  11.952  1.00 18.45 ? 677 HOH A O   1 
HETATM 1566 O O   . HOH D 4 .   ? 9.539   -7.631  1.156   1.00 21.93 ? 678 HOH A O   1 
HETATM 1567 O O   . HOH D 4 .   ? 16.868  17.770  18.098  1.00 24.30 ? 679 HOH A O   1 
HETATM 1568 O O   . HOH D 4 .   ? -9.312  -0.031  -1.659  1.00 21.71 ? 680 HOH A O   1 
HETATM 1569 O O   . HOH D 4 .   ? -7.711  -0.657  11.277  1.00 32.29 ? 681 HOH A O   1 
HETATM 1570 O O   . HOH D 4 .   ? 17.756  9.273   14.849  1.00 21.96 ? 682 HOH A O   1 
HETATM 1571 O O   . HOH D 4 .   ? -10.179 7.429   15.851  1.00 17.26 ? 683 HOH A O   1 
HETATM 1572 O O   . HOH D 4 .   ? 1.752   10.930  28.299  1.00 31.92 ? 684 HOH A O   1 
HETATM 1573 O O   . HOH D 4 .   ? 21.950  -0.830  5.829   1.00 21.33 ? 685 HOH A O   1 
HETATM 1574 O O   . HOH D 4 .   ? 7.401   -1.034  -7.386  1.00 29.13 ? 686 HOH A O   1 
HETATM 1575 O O   . HOH D 4 .   ? 2.300   -2.610  27.635  1.00 25.94 ? 687 HOH A O   1 
HETATM 1576 O O   . HOH D 4 .   ? -12.475 2.716   7.196   1.00 30.31 ? 688 HOH A O   1 
HETATM 1577 O O   . HOH D 4 .   ? 3.496   -6.901  -1.484  1.00 24.21 ? 689 HOH A O   1 
HETATM 1578 O O   . HOH D 4 .   ? -5.702  -2.545  23.169  1.00 24.95 ? 690 HOH A O   1 
HETATM 1579 O O   . HOH D 4 .   ? -9.239  1.611   11.234  1.00 20.45 ? 691 HOH A O   1 
HETATM 1580 O O   . HOH D 4 .   ? -0.736  19.107  0.257   1.00 23.59 ? 692 HOH A O   1 
HETATM 1581 O O   . HOH D 4 .   ? 19.060  -0.886  2.778   1.00 39.66 ? 693 HOH A O   1 
HETATM 1582 O O   . HOH D 4 .   ? 21.119  7.949   16.576  1.00 32.48 ? 694 HOH A O   1 
HETATM 1583 O O   . HOH D 4 .   ? -11.297 3.660   1.043   1.00 26.90 ? 695 HOH A O   1 
HETATM 1584 O O   . HOH D 4 .   ? -11.356 1.434   9.707   1.00 36.01 ? 696 HOH A O   1 
HETATM 1585 O O   . HOH D 4 .   ? -5.062  1.399   -10.059 1.00 34.93 ? 697 HOH A O   1 
HETATM 1586 O O   . HOH D 4 .   ? -5.613  -1.174  -2.891  1.00 12.01 ? 698 HOH A O   1 
HETATM 1587 O O   . HOH D 4 .   ? 0.312   -3.797  17.177  1.00 13.26 ? 699 HOH A O   1 
HETATM 1588 O O   . HOH D 4 .   ? 9.225   16.563  21.583  1.00 23.84 ? 700 HOH A O   1 
HETATM 1589 O O   . HOH D 4 .   ? 0.831   15.680  -8.373  1.00 40.57 ? 701 HOH A O   1 
HETATM 1590 O O   . HOH D 4 .   ? -5.374  -1.847  -7.974  1.00 47.83 ? 702 HOH A O   1 
HETATM 1591 O O   . HOH D 4 .   ? -5.712  -2.339  14.287  1.00 15.47 ? 703 HOH A O   1 
HETATM 1592 O O   . HOH D 4 .   ? -10.448 5.943   0.047   1.00 25.70 ? 704 HOH A O   1 
HETATM 1593 O O   . HOH D 4 .   ? -10.711 6.788   -7.275  1.00 30.24 ? 705 HOH A O   1 
HETATM 1594 O O   . HOH E 4 .   ? 14.722  10.702  -8.988  1.00 17.76 ? 501 HOH B O   1 
HETATM 1595 O O   . HOH E 4 .   ? 10.202  16.920  -5.450  1.00 14.22 ? 502 HOH B O   1 
HETATM 1596 O O   . HOH E 4 .   ? 23.143  6.364   -4.886  1.00 27.71 ? 503 HOH B O   1 
HETATM 1597 O O   . HOH E 4 .   ? 10.456  3.786   -14.849 1.00 12.09 ? 504 HOH B O   1 
HETATM 1598 O O   . HOH E 4 .   ? 10.154  15.682  -12.188 1.00 20.71 ? 505 HOH B O   1 
HETATM 1599 O O   . HOH E 4 .   ? 11.873  8.680   -20.576 1.00 32.14 ? 506 HOH B O   1 
HETATM 1600 O O   . HOH E 4 .   ? 13.269  8.992   0.119   1.00 16.38 ? 507 HOH B O   1 
HETATM 1601 O O   . HOH E 4 .   ? 8.537   2.150   -20.822 1.00 23.95 ? 508 HOH B O   1 
HETATM 1602 O O   . HOH E 4 .   ? 9.032   0.864   -8.771  1.00 14.09 ? 509 HOH B O   1 
HETATM 1603 O O   . HOH E 4 .   ? 12.092  0.955   -7.539  1.00 4.81  ? 510 HOH B O   1 
HETATM 1604 O O   . HOH E 4 .   ? 8.702   10.849  -12.596 1.00 10.33 ? 511 HOH B O   1 
HETATM 1605 O O   . HOH E 4 .   ? 7.349   7.743   -5.795  1.00 12.19 ? 512 HOH B O   1 
HETATM 1606 O O   . HOH E 4 .   ? 5.351   9.002   -13.895 1.00 19.07 ? 513 HOH B O   1 
HETATM 1607 O O   . HOH E 4 .   ? 11.207  6.990   -2.949  1.00 9.70  ? 514 HOH B O   1 
HETATM 1608 O O   . HOH E 4 .   ? 3.756   10.034  -9.951  1.00 20.36 ? 515 HOH B O   1 
HETATM 1609 O O   . HOH E 4 .   ? 4.487   5.913   -11.052 1.00 21.42 ? 516 HOH B O   1 
HETATM 1610 O O   . HOH E 4 .   ? 15.353  2.169   -2.243  1.00 19.94 ? 517 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   285 285 SER SER A . n 
A 1 2   ARG 2   286 286 ARG ARG A . n 
A 1 3   VAL 3   287 287 VAL VAL A . n 
A 1 4   LEU 4   288 288 LEU LEU A . n 
A 1 5   LEU 5   289 289 LEU LEU A . n 
A 1 6   ALA 6   290 290 ALA ALA A . n 
A 1 7   LEU 7   291 291 LEU LEU A . n 
A 1 8   HIS 8   292 292 HIS HIS A . n 
A 1 9   ASP 9   293 293 ASP ASP A . n 
A 1 10  ARG 10  294 294 ARG ARG A . n 
A 1 11  ALA 11  295 295 ALA ALA A . n 
A 1 12  PRO 12  296 296 PRO PRO A . n 
A 1 13  GLN 13  297 297 GLN GLN A . n 
A 1 14  LEU 14  298 298 LEU LEU A . n 
A 1 15  LYS 15  299 299 LYS LYS A . n 
A 1 16  ILE 16  300 300 ILE ILE A . n 
A 1 17  SER 17  301 301 SER SER A . n 
A 1 18  ASP 18  302 302 ASP ASP A . n 
A 1 19  ASP 19  303 303 ASP ASP A . n 
A 1 20  ARG 20  304 304 ARG ARG A . n 
A 1 21  LEU 21  305 305 LEU LEU A . n 
A 1 22  THR 22  306 306 THR THR A . n 
A 1 23  VAL 23  307 307 VAL VAL A . n 
A 1 24  VAL 24  308 308 VAL VAL A . n 
A 1 25  GLY 25  309 309 GLY GLY A . n 
A 1 26  GLU 26  310 310 GLU GLU A . n 
A 1 27  LYS 27  311 311 LYS LYS A . n 
A 1 28  GLY 28  312 312 GLY GLY A . n 
A 1 29  TYR 29  313 313 TYR TYR A . n 
A 1 30  SER 30  314 314 SER SER A . n 
A 1 31  MET 31  315 315 MET MET A . n 
A 1 32  VAL 32  316 316 VAL VAL A . n 
A 1 33  ARG 33  317 317 ARG ARG A . n 
A 1 34  ALA 34  318 318 ALA ALA A . n 
A 1 35  SER 35  319 319 SER SER A . n 
A 1 36  HIS 36  320 320 HIS HIS A . n 
A 1 37  GLY 37  321 321 GLY GLY A . n 
A 1 38  VAL 38  322 322 VAL VAL A . n 
A 1 39  ARG 39  323 323 ARG ARG A . n 
A 1 40  LYS 40  324 324 LYS LYS A . n 
A 1 41  GLY 41  325 325 GLY GLY A . n 
A 1 42  ALA 42  326 326 ALA ALA A . n 
A 1 43  TRP 43  327 327 TRP TRP A . n 
A 1 44  TYR 44  328 328 TYR TYR A . n 
A 1 45  PHE 45  329 329 PHE PHE A . n 
A 1 46  GLU 46  330 330 GLU GLU A . n 
A 1 47  ILE 47  331 331 ILE ILE A . n 
A 1 48  THR 48  332 332 THR THR A . n 
A 1 49  VAL 49  333 333 VAL VAL A . n 
A 1 50  ASP 50  334 334 ASP ASP A . n 
A 1 51  GLU 51  335 335 GLU GLU A . n 
A 1 52  MET 52  336 336 MET MET A . n 
A 1 53  PRO 53  337 337 PRO PRO A . n 
A 1 54  PRO 54  338 338 PRO PRO A . n 
A 1 55  ASP 55  339 339 ASP ASP A . n 
A 1 56  THR 56  340 340 THR THR A . n 
A 1 57  ALA 57  341 341 ALA ALA A . n 
A 1 58  ALA 58  342 342 ALA ALA A . n 
A 1 59  ARG 59  343 343 ARG ARG A . n 
A 1 60  LEU 60  344 344 LEU LEU A . n 
A 1 61  GLY 61  345 345 GLY GLY A . n 
A 1 62  TRP 62  346 346 TRP TRP A . n 
A 1 63  SER 63  347 347 SER SER A . n 
A 1 64  GLN 64  348 348 GLN GLN A . n 
A 1 65  PRO 65  349 349 PRO PRO A . n 
A 1 66  LEU 66  350 350 LEU LEU A . n 
A 1 67  GLY 67  351 351 GLY GLY A . n 
A 1 68  ASN 68  352 352 ASN ASN A . n 
A 1 69  LEU 69  353 353 LEU LEU A . n 
A 1 70  GLN 70  354 354 GLN GLN A . n 
A 1 71  ALA 71  355 355 ALA ALA A . n 
A 1 72  PRO 72  356 356 PRO PRO A . n 
A 1 73  LEU 73  357 357 LEU LEU A . n 
A 1 74  GLY 74  358 358 GLY GLY A . n 
A 1 75  TYR 75  359 359 TYR TYR A . n 
A 1 76  ASP 76  360 360 ASP ASP A . n 
A 1 77  LYS 77  361 361 LYS LYS A . n 
A 1 78  PHE 78  362 362 PHE PHE A . n 
A 1 79  SER 79  363 363 SER SER A . n 
A 1 80  TYR 80  364 364 TYR TYR A . n 
A 1 81  SER 81  365 365 SER SER A . n 
A 1 82  TRP 82  366 366 TRP TRP A . n 
A 1 83  ARG 83  367 367 ARG ARG A . n 
A 1 84  SER 84  368 368 SER SER A . n 
A 1 85  LYS 85  369 369 LYS LYS A . n 
A 1 86  LYS 86  370 370 LYS LYS A . n 
A 1 87  GLY 87  371 371 GLY GLY A . n 
A 1 88  THR 88  372 372 THR THR A . n 
A 1 89  LYS 89  373 373 LYS LYS A . n 
A 1 90  PHE 90  374 374 PHE PHE A . n 
A 1 91  HIS 91  375 375 HIS HIS A . n 
A 1 92  GLN 92  376 376 GLN GLN A . n 
A 1 93  SER 93  377 377 SER SER A . n 
A 1 94  ILE 94  378 378 ILE ILE A . n 
A 1 95  GLY 95  379 379 GLY GLY A . n 
A 1 96  LYS 96  380 380 LYS LYS A . n 
A 1 97  HIS 97  381 381 HIS HIS A . n 
A 1 98  TYR 98  382 382 TYR TYR A . n 
A 1 99  SER 99  383 383 SER SER A . n 
A 1 100 SER 100 384 384 SER SER A . n 
A 1 101 GLY 101 385 385 GLY GLY A . n 
A 1 102 TYR 102 386 386 TYR TYR A . n 
A 1 103 GLY 103 387 387 GLY GLY A . n 
A 1 104 GLN 104 388 388 GLN GLN A . n 
A 1 105 GLY 105 389 389 GLY GLY A . n 
A 1 106 ASP 106 390 390 ASP ASP A . n 
A 1 107 VAL 107 391 391 VAL VAL A . n 
A 1 108 LEU 108 392 392 LEU LEU A . n 
A 1 109 GLY 109 393 393 GLY GLY A . n 
A 1 110 PHE 110 394 394 PHE PHE A . n 
A 1 111 TYR 111 395 395 TYR TYR A . n 
A 1 112 ILE 112 396 396 ILE ILE A . n 
A 1 113 ASN 113 397 397 ASN ASN A . n 
A 1 114 LEU 114 398 398 LEU LEU A . n 
A 1 115 PRO 115 399 399 PRO PRO A . n 
A 1 116 GLU 116 400 ?   ?   ?   A . n 
A 1 117 ASP 117 401 ?   ?   ?   A . n 
A 1 118 ILE 118 440 ?   ?   ?   A . n 
A 1 119 SER 119 441 ?   ?   ?   A . n 
A 1 120 GLY 120 442 ?   ?   ?   A . n 
A 1 121 ARG 121 443 ?   ?   ?   A . n 
A 1 122 GLY 122 444 444 GLY SER A . n 
A 1 123 SER 123 445 445 SER SER A . n 
A 1 124 GLU 124 446 446 GLU GLU A . n 
A 1 125 ILE 125 447 447 ILE ILE A . n 
A 1 126 ILE 126 448 448 ILE ILE A . n 
A 1 127 PHE 127 449 449 PHE PHE A . n 
A 1 128 TYR 128 450 450 TYR TYR A . n 
A 1 129 LYS 129 451 451 LYS LYS A . n 
A 1 130 ASN 130 452 452 ASN ASN A . n 
A 1 131 GLY 131 453 453 GLY GLY A . n 
A 1 132 VAL 132 454 454 VAL VAL A . n 
A 1 133 ASN 133 455 455 ASN ASN A . n 
A 1 134 GLN 134 456 456 GLN GLN A . n 
A 1 135 GLY 135 457 457 GLY GLY A . n 
A 1 136 VAL 136 458 458 VAL VAL A . n 
A 1 137 ALA 137 459 459 ALA ALA A . n 
A 1 138 TYR 138 460 460 TYR TYR A . n 
A 1 139 LYS 139 461 461 LYS LYS A . n 
A 1 140 ASP 140 462 462 ASP ASP A . n 
A 1 141 ILE 141 463 463 ILE ILE A . n 
A 1 142 PHE 142 464 464 PHE PHE A . n 
A 1 143 GLU 143 465 465 GLU GLU A . n 
A 1 144 GLY 144 466 466 GLY GLY A . n 
A 1 145 VAL 145 467 467 VAL VAL A . n 
A 1 146 TYR 146 468 468 TYR TYR A . n 
A 1 147 PHE 147 469 469 PHE PHE A . n 
A 1 148 PRO 148 470 470 PRO PRO A . n 
A 1 149 ALA 149 471 471 ALA ALA A . n 
A 1 150 ILE 150 472 472 ILE ILE A . n 
A 1 151 SER 151 473 473 SER SER A . n 
A 1 152 LEU 152 474 474 LEU LEU A . n 
A 1 153 TYR 153 475 475 TYR TYR A . n 
A 1 154 LYS 154 476 476 LYS LYS A . n 
A 1 155 SER 155 477 477 SER SER A . n 
A 1 156 CYS 156 478 478 CYS CYS A . n 
A 1 157 THR 157 479 479 THR THR A . n 
A 1 158 VAL 158 480 480 VAL VAL A . n 
A 1 159 SER 159 481 481 SER SER A . n 
A 1 160 ILE 160 482 482 ILE ILE A . n 
A 1 161 ASN 161 483 483 ASN ASN A . n 
A 1 162 PHE 162 484 484 PHE PHE A . n 
A 1 163 GLY 163 485 485 GLY GLY A . n 
A 1 164 PRO 164 486 486 PRO PRO A . n 
A 1 165 CYS 165 487 487 CYS CYS A . n 
A 1 166 PHE 166 488 488 PHE PHE A . n 
A 1 167 LYS 167 489 489 LYS LYS A . n 
A 1 168 TYR 168 490 490 TYR TYR A . n 
A 1 169 PRO 169 491 491 PRO PRO A . n 
A 1 170 PRO 170 492 492 PRO PRO A . n 
A 1 171 LYS 171 493 493 LYS LYS A . n 
A 1 172 ASP 172 494 494 ASP ASP A . n 
A 1 173 LEU 173 495 495 LEU LEU A . n 
A 1 174 THR 174 496 496 THR THR A . n 
A 1 175 TYR 175 497 497 TYR TYR A . n 
A 1 176 ARG 176 498 498 ARG ARG A . n 
A 1 177 PRO 177 499 499 PRO PRO A . n 
A 1 178 MET 178 500 500 MET MET A . n 
A 1 179 SER 179 501 501 SER SER A . n 
A 1 180 ASP 180 502 502 ASP ASP A . n 
A 1 181 MET 181 503 503 MET MET A . n 
A 1 182 GLY 182 504 504 GLY GLY A . n 
B 2 1   GLU 1   344 344 GLU GLU B . n 
B 2 2   TYR 2   345 345 TYR TYR B . n 
B 2 3   GLU 3   346 346 GLU GLU B . n 
B 2 4   GLU 4   347 347 GLU GLU B . n 
B 2 5   ARG 5   348 348 ARG ARG B . n 
B 2 6   GLU 6   349 349 GLU GLU B . n 
B 2 7   SER 7   350 350 SER SER B . n 
B 2 8   GLU 8   351 351 GLU GLU B . n 
B 2 9   PHE 9   352 352 PHE PHE B . n 
B 2 10  ASP 10  353 353 ASP ASP B . n 
B 2 11  ILE 11  354 354 ILE ILE B . n 
B 2 12  GLU 12  355 355 GLU GLU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 GOL 1   401 3968 GOL GOL B . 
D 4 HOH 1   601 123  HOH HOH A . 
D 4 HOH 2   602 125  HOH HOH A . 
D 4 HOH 3   603 182  HOH HOH A . 
D 4 HOH 4   604 180  HOH HOH A . 
D 4 HOH 5   605 62   HOH HOH A . 
D 4 HOH 6   606 124  HOH HOH A . 
D 4 HOH 7   607 35   HOH HOH A . 
D 4 HOH 8   608 117  HOH HOH A . 
D 4 HOH 9   609 96   HOH HOH A . 
D 4 HOH 10  610 13   HOH HOH A . 
D 4 HOH 11  611 68   HOH HOH A . 
D 4 HOH 12  612 100  HOH HOH A . 
D 4 HOH 13  613 118  HOH HOH A . 
D 4 HOH 14  614 32   HOH HOH A . 
D 4 HOH 15  615 27   HOH HOH A . 
D 4 HOH 16  616 161  HOH HOH A . 
D 4 HOH 17  617 166  HOH HOH A . 
D 4 HOH 18  618 55   HOH HOH A . 
D 4 HOH 19  619 46   HOH HOH A . 
D 4 HOH 20  620 99   HOH HOH A . 
D 4 HOH 21  621 34   HOH HOH A . 
D 4 HOH 22  622 132  HOH HOH A . 
D 4 HOH 23  623 205  HOH HOH A . 
D 4 HOH 24  624 92   HOH HOH A . 
D 4 HOH 25  625 206  HOH HOH A . 
D 4 HOH 26  626 136  HOH HOH A . 
D 4 HOH 27  627 44   HOH HOH A . 
D 4 HOH 28  628 72   HOH HOH A . 
D 4 HOH 29  629 64   HOH HOH A . 
D 4 HOH 30  630 59   HOH HOH A . 
D 4 HOH 31  631 97   HOH HOH A . 
D 4 HOH 32  632 16   HOH HOH A . 
D 4 HOH 33  633 70   HOH HOH A . 
D 4 HOH 34  634 60   HOH HOH A . 
D 4 HOH 35  635 121  HOH HOH A . 
D 4 HOH 36  636 130  HOH HOH A . 
D 4 HOH 37  637 24   HOH HOH A . 
D 4 HOH 38  638 153  HOH HOH A . 
D 4 HOH 39  639 93   HOH HOH A . 
D 4 HOH 40  640 87   HOH HOH A . 
D 4 HOH 41  641 67   HOH HOH A . 
D 4 HOH 42  642 155  HOH HOH A . 
D 4 HOH 43  643 74   HOH HOH A . 
D 4 HOH 44  644 84   HOH HOH A . 
D 4 HOH 45  645 115  HOH HOH A . 
D 4 HOH 46  646 1    HOH HOH A . 
D 4 HOH 47  647 5    HOH HOH A . 
D 4 HOH 48  648 6    HOH HOH A . 
D 4 HOH 49  649 7    HOH HOH A . 
D 4 HOH 50  650 10   HOH HOH A . 
D 4 HOH 51  651 11   HOH HOH A . 
D 4 HOH 52  652 12   HOH HOH A . 
D 4 HOH 53  653 14   HOH HOH A . 
D 4 HOH 54  654 17   HOH HOH A . 
D 4 HOH 55  655 18   HOH HOH A . 
D 4 HOH 56  656 22   HOH HOH A . 
D 4 HOH 57  657 23   HOH HOH A . 
D 4 HOH 58  658 26   HOH HOH A . 
D 4 HOH 59  659 28   HOH HOH A . 
D 4 HOH 60  660 30   HOH HOH A . 
D 4 HOH 61  661 31   HOH HOH A . 
D 4 HOH 62  662 33   HOH HOH A . 
D 4 HOH 63  663 37   HOH HOH A . 
D 4 HOH 64  664 38   HOH HOH A . 
D 4 HOH 65  665 39   HOH HOH A . 
D 4 HOH 66  666 41   HOH HOH A . 
D 4 HOH 67  667 43   HOH HOH A . 
D 4 HOH 68  668 47   HOH HOH A . 
D 4 HOH 69  669 50   HOH HOH A . 
D 4 HOH 70  670 51   HOH HOH A . 
D 4 HOH 71  671 52   HOH HOH A . 
D 4 HOH 72  672 53   HOH HOH A . 
D 4 HOH 73  673 57   HOH HOH A . 
D 4 HOH 74  674 65   HOH HOH A . 
D 4 HOH 75  675 66   HOH HOH A . 
D 4 HOH 76  676 71   HOH HOH A . 
D 4 HOH 77  677 75   HOH HOH A . 
D 4 HOH 78  678 77   HOH HOH A . 
D 4 HOH 79  679 78   HOH HOH A . 
D 4 HOH 80  680 81   HOH HOH A . 
D 4 HOH 81  681 83   HOH HOH A . 
D 4 HOH 82  682 86   HOH HOH A . 
D 4 HOH 83  683 90   HOH HOH A . 
D 4 HOH 84  684 101  HOH HOH A . 
D 4 HOH 85  685 108  HOH HOH A . 
D 4 HOH 86  686 116  HOH HOH A . 
D 4 HOH 87  687 128  HOH HOH A . 
D 4 HOH 88  688 129  HOH HOH A . 
D 4 HOH 89  689 131  HOH HOH A . 
D 4 HOH 90  690 133  HOH HOH A . 
D 4 HOH 91  691 135  HOH HOH A . 
D 4 HOH 92  692 137  HOH HOH A . 
D 4 HOH 93  693 140  HOH HOH A . 
D 4 HOH 94  694 144  HOH HOH A . 
D 4 HOH 95  695 149  HOH HOH A . 
D 4 HOH 96  696 157  HOH HOH A . 
D 4 HOH 97  697 159  HOH HOH A . 
D 4 HOH 98  698 179  HOH HOH A . 
D 4 HOH 99  699 181  HOH HOH A . 
D 4 HOH 100 700 183  HOH HOH A . 
D 4 HOH 101 701 192  HOH HOH A . 
D 4 HOH 102 702 200  HOH HOH A . 
D 4 HOH 103 703 204  HOH HOH A . 
D 4 HOH 104 704 207  HOH HOH A . 
D 4 HOH 105 705 214  HOH HOH A . 
E 4 HOH 1   501 126  HOH HOH B . 
E 4 HOH 2   502 73   HOH HOH B . 
E 4 HOH 3   503 91   HOH HOH B . 
E 4 HOH 4   504 19   HOH HOH B . 
E 4 HOH 5   505 82   HOH HOH B . 
E 4 HOH 6   506 45   HOH HOH B . 
E 4 HOH 7   507 40   HOH HOH B . 
E 4 HOH 8   508 63   HOH HOH B . 
E 4 HOH 9   509 29   HOH HOH B . 
E 4 HOH 10  510 2    HOH HOH B . 
E 4 HOH 11  511 3    HOH HOH B . 
E 4 HOH 12  512 4    HOH HOH B . 
E 4 HOH 13  513 61   HOH HOH B . 
E 4 HOH 14  514 122  HOH HOH B . 
E 4 HOH 15  515 127  HOH HOH B . 
E 4 HOH 16  516 139  HOH HOH B . 
E 4 HOH 17  517 154  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1090 ? 
1 MORE         -4   ? 
1 'SSA (A^2)'  8590 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-01-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.0 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? d*TREK ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? d*TREK ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .      4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 311 ? ? 51.55   -133.62 
2 1 ASP A 339 ? ? 78.90   -12.14  
3 1 GLN A 354 ? ? -104.08 46.84   
4 1 TYR A 382 ? ? -143.35 -63.97  
5 1 LYS A 476 ? ? 63.65   -173.65 
6 1 SER A 477 ? ? -70.04  47.21   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 286 ? CG  ? A ARG 2   CG  
2  1 Y 1 A ARG 286 ? CD  ? A ARG 2   CD  
3  1 Y 1 A ARG 286 ? NE  ? A ARG 2   NE  
4  1 Y 1 A ARG 286 ? CZ  ? A ARG 2   CZ  
5  1 Y 1 A ARG 286 ? NH1 ? A ARG 2   NH1 
6  1 Y 1 A ARG 286 ? NH2 ? A ARG 2   NH2 
7  1 Y 1 A LYS 324 ? CG  ? A LYS 40  CG  
8  1 Y 1 A LYS 324 ? CD  ? A LYS 40  CD  
9  1 Y 1 A LYS 324 ? CE  ? A LYS 40  CE  
10 1 Y 1 A LYS 324 ? NZ  ? A LYS 40  NZ  
11 1 Y 1 A LYS 361 ? CG  ? A LYS 77  CG  
12 1 Y 1 A LYS 361 ? CD  ? A LYS 77  CD  
13 1 Y 1 A LYS 361 ? CE  ? A LYS 77  CE  
14 1 Y 1 A LYS 361 ? NZ  ? A LYS 77  NZ  
15 1 Y 1 A GLU 465 ? CG  ? A GLU 143 CG  
16 1 Y 1 A GLU 465 ? CD  ? A GLU 143 CD  
17 1 Y 1 A GLU 465 ? OE1 ? A GLU 143 OE1 
18 1 Y 1 A GLU 465 ? OE2 ? A GLU 143 OE2 
19 1 Y 1 B GLU 355 ? CG  ? B GLU 12  CG  
20 1 Y 1 B GLU 355 ? CD  ? B GLU 12  CD  
21 1 Y 1 B GLU 355 ? OE1 ? B GLU 12  OE1 
22 1 Y 1 B GLU 355 ? OE2 ? B GLU 12  OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLU 400 ? A GLU 116 
2 1 Y 1 A ASP 401 ? A ASP 117 
3 1 Y 1 A ILE 440 ? A ILE 118 
4 1 Y 1 A SER 441 ? A SER 119 
5 1 Y 1 A GLY 442 ? A GLY 120 
6 1 Y 1 A ARG 443 ? A ARG 121 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 GLYCEROL GOL 
4 water    HOH 
#