data_4YOZ
# 
_entry.id   4YOZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YOZ         
WWPDB D_1000207844 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'E7 complex with Rb' 1GUX unspecified 
PDB .                    4YOO unspecified 
PDB .                    4YOS unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YOZ 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liban, T.J.'      1 
'Guiley, K.Z.'     2 
'Felthousen, J.G.' 3 
'Ramanan, P.'      4 
'Litovchick, L.'   5 
'Rubin, S.M.'      6 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_id_ASTM           GEDEEP 
_citation.journal_id_CSD            2056 
_citation.journal_id_ISSN           1549-5477 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            29 
_citation.language                  ? 
_citation.page_first                961 
_citation.page_last                 974 
_citation.title                     'Structural mechanisms of DREAM complex assembly and regulation.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1101/gad.257568.114 
_citation.pdbx_database_id_PubMed   25917549 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Guiley, K.Z.'     1 ? 
primary 'Liban, T.J.'      2 ? 
primary 'Felthousen, J.G.' 3 ? 
primary 'Ramanan, P.'      4 ? 
primary 'Litovchick, L.'   5 ? 
primary 'Rubin, S.M.'      6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   120.32 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4YOZ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     99.690 
_cell.length_a_esd                 ? 
_cell.length_b                     76.550 
_cell.length_b_esd                 ? 
_cell.length_c                     74.680 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4YOZ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Retinoblastoma-like protein 1,Retinoblastoma-like protein 1' 43265.965 1   ? ? 
'unp residues 391-593,unp residues 391-593' ? 
2 polymer     man 'HPV E7 peptide'                                              1160.255  1   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                                                 96.063    4   ? ? ? ? 
4 water       nat water                                                         18.015    111 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'107 kDa retinoblastoma-associated protein,p107,pRb1,107 kDa retinoblastoma-associated protein,p107,pRb1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GEFTQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEIL
YYKILETVMVQETRRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGL
SRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNNRPKRTGSLALFYRKVYHLASVRLRD
LCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLK
SIKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQ
;
;GEFTQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEIL
YYKILETVMVQETRRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGL
SRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNNRPKRTGSLALFYRKVYHLASVRLRD
LCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLK
SIKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQ
;
A ? 
2 'polypeptide(L)' no no DLYCYEQLN DLYCYEQLN B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLU n 
1 3   PHE n 
1 4   THR n 
1 5   GLN n 
1 6   SER n 
1 7   VAL n 
1 8   SER n 
1 9   ARG n 
1 10  LEU n 
1 11  GLN n 
1 12  SER n 
1 13  ILE n 
1 14  VAL n 
1 15  ALA n 
1 16  GLY n 
1 17  LEU n 
1 18  LYS n 
1 19  ASN n 
1 20  ALA n 
1 21  PRO n 
1 22  SER n 
1 23  ASP n 
1 24  GLN n 
1 25  LEU n 
1 26  ILE n 
1 27  ASN n 
1 28  ILE n 
1 29  PHE n 
1 30  GLU n 
1 31  SER n 
1 32  CYS n 
1 33  VAL n 
1 34  ARG n 
1 35  ASN n 
1 36  PRO n 
1 37  VAL n 
1 38  GLU n 
1 39  ASN n 
1 40  ILE n 
1 41  MET n 
1 42  LYS n 
1 43  ILE n 
1 44  LEU n 
1 45  LYS n 
1 46  GLY n 
1 47  ILE n 
1 48  GLY n 
1 49  GLU n 
1 50  THR n 
1 51  PHE n 
1 52  CYS n 
1 53  GLN n 
1 54  HIS n 
1 55  TYR n 
1 56  THR n 
1 57  GLN n 
1 58  SER n 
1 59  THR n 
1 60  ASP n 
1 61  GLU n 
1 62  GLN n 
1 63  PRO n 
1 64  GLY n 
1 65  SER n 
1 66  HIS n 
1 67  ILE n 
1 68  ASP n 
1 69  PHE n 
1 70  ALA n 
1 71  VAL n 
1 72  ASN n 
1 73  ARG n 
1 74  LEU n 
1 75  LYS n 
1 76  LEU n 
1 77  ALA n 
1 78  GLU n 
1 79  ILE n 
1 80  LEU n 
1 81  TYR n 
1 82  TYR n 
1 83  LYS n 
1 84  ILE n 
1 85  LEU n 
1 86  GLU n 
1 87  THR n 
1 88  VAL n 
1 89  MET n 
1 90  VAL n 
1 91  GLN n 
1 92  GLU n 
1 93  THR n 
1 94  ARG n 
1 95  ARG n 
1 96  LEU n 
1 97  HIS n 
1 98  GLY n 
1 99  MET n 
1 100 ASP n 
1 101 MET n 
1 102 SER n 
1 103 VAL n 
1 104 LEU n 
1 105 LEU n 
1 106 GLU n 
1 107 GLN n 
1 108 ASP n 
1 109 ILE n 
1 110 PHE n 
1 111 HIS n 
1 112 ARG n 
1 113 SER n 
1 114 LEU n 
1 115 MET n 
1 116 ALA n 
1 117 CYS n 
1 118 CYS n 
1 119 LEU n 
1 120 GLU n 
1 121 ILE n 
1 122 VAL n 
1 123 LEU n 
1 124 PHE n 
1 125 ALA n 
1 126 TYR n 
1 127 SER n 
1 128 SER n 
1 129 PRO n 
1 130 ARG n 
1 131 THR n 
1 132 PHE n 
1 133 PRO n 
1 134 TRP n 
1 135 ILE n 
1 136 ILE n 
1 137 GLU n 
1 138 VAL n 
1 139 LEU n 
1 140 ASN n 
1 141 LEU n 
1 142 GLN n 
1 143 PRO n 
1 144 PHE n 
1 145 TYR n 
1 146 PHE n 
1 147 TYR n 
1 148 LYS n 
1 149 VAL n 
1 150 ILE n 
1 151 GLU n 
1 152 VAL n 
1 153 VAL n 
1 154 ILE n 
1 155 ARG n 
1 156 SER n 
1 157 GLU n 
1 158 GLU n 
1 159 GLY n 
1 160 LEU n 
1 161 SER n 
1 162 ARG n 
1 163 ASP n 
1 164 MET n 
1 165 VAL n 
1 166 LYS n 
1 167 HIS n 
1 168 LEU n 
1 169 ASN n 
1 170 SER n 
1 171 ILE n 
1 172 GLU n 
1 173 GLU n 
1 174 GLN n 
1 175 ILE n 
1 176 LEU n 
1 177 GLU n 
1 178 SER n 
1 179 LEU n 
1 180 ALA n 
1 181 TRP n 
1 182 SER n 
1 183 HIS n 
1 184 ASP n 
1 185 SER n 
1 186 ALA n 
1 187 LEU n 
1 188 TRP n 
1 189 GLU n 
1 190 ALA n 
1 191 LEU n 
1 192 GLN n 
1 193 VAL n 
1 194 SER n 
1 195 ALA n 
1 196 ASN n 
1 197 LYS n 
1 198 VAL n 
1 199 PRO n 
1 200 THR n 
1 201 CYS n 
1 202 GLU n 
1 203 GLU n 
1 204 VAL n 
1 205 ILE n 
1 206 PHE n 
1 207 PRO n 
1 208 ASN n 
1 209 ASN n 
1 210 PHE n 
1 211 GLU n 
1 212 THR n 
1 213 GLY n 
1 214 ASN n 
1 215 ASN n 
1 216 ARG n 
1 217 PRO n 
1 218 LYS n 
1 219 ARG n 
1 220 THR n 
1 221 GLY n 
1 222 SER n 
1 223 LEU n 
1 224 ALA n 
1 225 LEU n 
1 226 PHE n 
1 227 TYR n 
1 228 ARG n 
1 229 LYS n 
1 230 VAL n 
1 231 TYR n 
1 232 HIS n 
1 233 LEU n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 ARG n 
1 238 LEU n 
1 239 ARG n 
1 240 ASP n 
1 241 LEU n 
1 242 CYS n 
1 243 LEU n 
1 244 LYS n 
1 245 LEU n 
1 246 ASP n 
1 247 VAL n 
1 248 SER n 
1 249 ASN n 
1 250 GLU n 
1 251 LEU n 
1 252 ARG n 
1 253 ARG n 
1 254 LYS n 
1 255 ILE n 
1 256 TRP n 
1 257 THR n 
1 258 CYS n 
1 259 PHE n 
1 260 GLU n 
1 261 PHE n 
1 262 THR n 
1 263 LEU n 
1 264 VAL n 
1 265 HIS n 
1 266 CYS n 
1 267 PRO n 
1 268 ASP n 
1 269 LEU n 
1 270 MET n 
1 271 LYS n 
1 272 ASP n 
1 273 ARG n 
1 274 HIS n 
1 275 LEU n 
1 276 ASP n 
1 277 GLN n 
1 278 LEU n 
1 279 LEU n 
1 280 LEU n 
1 281 CYS n 
1 282 ALA n 
1 283 PHE n 
1 284 TYR n 
1 285 ILE n 
1 286 MET n 
1 287 ALA n 
1 288 LYS n 
1 289 VAL n 
1 290 THR n 
1 291 LYS n 
1 292 GLU n 
1 293 GLU n 
1 294 ARG n 
1 295 THR n 
1 296 PHE n 
1 297 GLN n 
1 298 GLU n 
1 299 ILE n 
1 300 MET n 
1 301 LYS n 
1 302 SER n 
1 303 TYR n 
1 304 ARG n 
1 305 ASN n 
1 306 GLN n 
1 307 PRO n 
1 308 GLN n 
1 309 ALA n 
1 310 ASN n 
1 311 SER n 
1 312 HIS n 
1 313 VAL n 
1 314 TYR n 
1 315 ARG n 
1 316 SER n 
1 317 VAL n 
1 318 LEU n 
1 319 LEU n 
1 320 LYS n 
1 321 SER n 
1 322 ILE n 
1 323 LYS n 
1 324 GLU n 
1 325 GLU n 
1 326 ARG n 
1 327 GLY n 
1 328 ASP n 
1 329 LEU n 
1 330 ILE n 
1 331 LYS n 
1 332 PHE n 
1 333 TYR n 
1 334 ASN n 
1 335 THR n 
1 336 ILE n 
1 337 TYR n 
1 338 VAL n 
1 339 GLY n 
1 340 ARG n 
1 341 VAL n 
1 342 LYS n 
1 343 SER n 
1 344 PHE n 
1 345 ALA n 
1 346 LEU n 
1 347 LYS n 
1 348 TYR n 
1 349 ASP n 
1 350 LEU n 
1 351 ALA n 
1 352 ASN n 
1 353 GLN n 
1 354 ASP n 
1 355 HIS n 
1 356 MET n 
1 357 MET n 
1 358 ASP n 
1 359 ALA n 
1 360 PRO n 
1 361 PRO n 
1 362 LEU n 
1 363 SER n 
1 364 PRO n 
1 365 PHE n 
1 366 PRO n 
1 367 HIS n 
1 368 ILE n 
1 369 LYS n 
1 370 GLN n 
1 371 GLN n 
2 1   ASP n 
2 2   LEU n 
2 3   TYR n 
2 4   CYS n 
2 5   TYR n 
2 6   GLU n 
2 7   GLN n 
2 8   LEU n 
2 9   ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   206 Human ? RBL1 ? ? ? ? ? ? 'Homo sapiens'         9606  ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 207 371 Human ? RBL1 ? ? ? ? ? ? 'Homo sapiens'         9606  ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   9   ?     ? ?    ? ? ? ? ? ? 'Human papillomavirus' 10566 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.details 
_struct_ref.entity_id 
_struct_ref.id 
_struct_ref.seq_align 
_struct_ref.seq_dif 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_align_end 
RBL1_HUMAN UNP ? 1 1 ? ? P28749 ?        
;TQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYK
ILETVMVQETRRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRD
MVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIF
;
391 ? 
RBL1_HUMAN UNP ? 1 2 ? ? P28749 P28749-2 
;TGINRPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTK
EERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNINDDFEMIDCDLEDATKTPDCSSGPVKEERGDLIKFYNT
IYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQ
;
777 ? 
4YOZ       PDB ? 2 3 ? ? 4YOZ   ?        ? 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YOZ A 4   ? 206 ? P28749 391 ? 593 ? 391 593 
2 2 4YOZ A 212 ? 371 ? P28749 777 ? 972 ? 777 972 
3 3 4YOZ B 1   ? 9   ? 4YOZ   21  ? 29  ? 21  29  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4YOZ GLY A 1   ? UNP P28749 ?   ?   'expression tag' 388 1  
1 4YOZ GLU A 2   ? UNP P28749 ?   ?   'expression tag' 389 2  
1 4YOZ PHE A 3   ? UNP P28749 ?   ?   'expression tag' 390 3  
1 4YOZ PRO A 207 ? UNP P28749 ?   ?   linker           594 4  
1 4YOZ ASN A 208 ? UNP P28749 ?   ?   linker           773 5  
1 4YOZ ASN A 209 ? UNP P28749 ?   ?   linker           774 6  
1 4YOZ PHE A 210 ? UNP P28749 ?   ?   linker           775 7  
1 4YOZ GLU A 211 ? UNP P28749 ?   ?   linker           776 8  
2 4YOZ ASN A 214 ? UNP P28749 ILE 779 conflict         779 9  
2 4YOZ ?   A ?   ? UNP P28749 PRO 888 deletion         ?   10 
2 4YOZ ?   A ?   ? UNP P28749 ARG 889 deletion         ?   11 
2 4YOZ ?   A ?   ? UNP P28749 GLU 890 deletion         ?   12 
2 4YOZ ?   A ?   ? UNP P28749 VAL 891 deletion         ?   13 
2 4YOZ ?   A ?   ? UNP P28749 VAL 892 deletion         ?   14 
2 4YOZ ?   A ?   ? UNP P28749 ALA 893 deletion         ?   15 
2 4YOZ ?   A ?   ? UNP P28749 TYR 894 deletion         ?   16 
2 4YOZ ?   A ?   ? UNP P28749 ASN 895 deletion         ?   17 
2 4YOZ ?   A ?   ? UNP P28749 LYS 896 deletion         ?   18 
2 4YOZ ?   A ?   ? UNP P28749 ASN 897 deletion         ?   19 
2 4YOZ ?   A ?   ? UNP P28749 ILE 898 deletion         ?   20 
2 4YOZ ?   A ?   ? UNP P28749 ASN 899 deletion         ?   21 
2 4YOZ ?   A ?   ? UNP P28749 ASP 900 deletion         ?   22 
2 4YOZ ?   A ?   ? UNP P28749 ASP 901 deletion         ?   23 
2 4YOZ ?   A ?   ? UNP P28749 PHE 902 deletion         ?   24 
2 4YOZ ?   A ?   ? UNP P28749 GLU 903 deletion         ?   25 
2 4YOZ ?   A ?   ? UNP P28749 MET 904 deletion         ?   26 
2 4YOZ ?   A ?   ? UNP P28749 ILE 905 deletion         ?   27 
2 4YOZ ?   A ?   ? UNP P28749 ASP 906 deletion         ?   28 
2 4YOZ ?   A ?   ? UNP P28749 CYS 907 deletion         ?   29 
2 4YOZ ?   A ?   ? UNP P28749 ASP 908 deletion         ?   30 
2 4YOZ ?   A ?   ? UNP P28749 LEU 909 deletion         ?   31 
2 4YOZ ?   A ?   ? UNP P28749 GLU 910 deletion         ?   32 
2 4YOZ ?   A ?   ? UNP P28749 ASP 911 deletion         ?   33 
2 4YOZ ?   A ?   ? UNP P28749 ALA 912 deletion         ?   34 
2 4YOZ ?   A ?   ? UNP P28749 THR 913 deletion         ?   35 
2 4YOZ ?   A ?   ? UNP P28749 LYS 914 deletion         ?   36 
2 4YOZ ?   A ?   ? UNP P28749 THR 915 deletion         ?   37 
2 4YOZ ?   A ?   ? UNP P28749 PRO 916 deletion         ?   38 
2 4YOZ ?   A ?   ? UNP P28749 ASP 917 deletion         ?   39 
2 4YOZ ?   A ?   ? UNP P28749 CYS 918 deletion         ?   40 
2 4YOZ ?   A ?   ? UNP P28749 SER 919 deletion         ?   41 
2 4YOZ ?   A ?   ? UNP P28749 SER 920 deletion         ?   42 
2 4YOZ ?   A ?   ? UNP P28749 GLY 921 deletion         ?   43 
2 4YOZ ?   A ?   ? UNP P28749 PRO 922 deletion         ?   44 
2 4YOZ ?   A ?   ? UNP P28749 VAL 923 deletion         ?   45 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YOZ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.88 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.25 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Hepes, Ammonium Sulfate, PEG 400' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-11-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03320 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.03320 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4YOZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.2 
_reflns.d_resolution_low                 57.2 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       21552 
_reflns.number_obs                       21552 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.2 
_reflns.pdbx_Rmerge_I_obs                0.073 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.25 
_reflns_shell.d_res_low                   2.37 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        94.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                .314 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4YOZ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.245 
_refine.ls_d_res_low                             57.195 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     21549 
_refine.ls_number_reflns_R_free                  2000 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.69 
_refine.ls_percent_reflns_R_free                 9.28 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1888 
_refine.ls_R_factor_R_free                       0.2400 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1837 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.38 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.94 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.24 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2881 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             111 
_refine_hist.number_atoms_total               3012 
_refine_hist.d_res_high                       2.245 
_refine_hist.d_res_low                        57.195 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  ? 2952 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.873  ? 3990 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.793 ? 1097 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.033  ? 449  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 499  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2451 2.3012  . . 141 1385 94.00 . . . 0.2617 . 0.2180 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3012 2.3634  . . 145 1413 94.00 . . . 0.2767 . 0.2101 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3634 2.4330  . . 145 1412 94.00 . . . 0.2616 . 0.2045 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4330 2.5115  . . 142 1398 94.00 . . . 0.2379 . 0.1858 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5115 2.6013  . . 145 1420 94.00 . . . 0.2364 . 0.1809 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6013 2.7054  . . 143 1389 93.00 . . . 0.2381 . 0.1718 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7054 2.8286  . . 143 1400 93.00 . . . 0.2367 . 0.1738 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8286 2.9777  . . 145 1415 93.00 . . . 0.2264 . 0.1897 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9777 3.1642  . . 143 1392 93.00 . . . 0.2955 . 0.1996 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1642 3.4085  . . 142 1392 93.00 . . . 0.2652 . 0.1941 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4085 3.7515  . . 143 1392 92.00 . . . 0.2397 . 0.1762 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7515 4.2942  . . 141 1386 92.00 . . . 0.1941 . 0.1600 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2942 5.4095  . . 141 1381 90.00 . . . 0.2195 . 0.1689 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4095 57.2138 . . 141 1374 88.00 . . . 0.2483 . 0.1974 . . . . . . . . . . 
# 
_struct.entry_id                     4YOZ 
_struct.title                        'p107 pocket domain in complex with HPV E7 peptide' 
_struct.pdbx_descriptor              'p107 pocket domain, ASP-LEU-TYR-CYS-TYR-GLU-GLN-LEU-ASN' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YOZ 
_struct_keywords.text            'Pocket protein, Cyclin Box, Transcriptional regulator, Cell Cycle, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 4   ? VAL A 14  ? THR A 391 VAL A 401 1 ? 11 
HELX_P HELX_P2  AA2 SER A 22  ? SER A 31  ? SER A 409 SER A 418 1 ? 10 
HELX_P HELX_P3  AA3 PRO A 36  ? THR A 56  ? PRO A 423 THR A 443 1 ? 21 
HELX_P HELX_P4  AA4 HIS A 66  ? GLN A 91  ? HIS A 453 GLN A 478 1 ? 26 
HELX_P HELX_P5  AA5 GLU A 92  ? HIS A 97  ? GLU A 479 HIS A 484 1 ? 6  
HELX_P HELX_P6  AA6 MET A 101 ? GLU A 106 ? MET A 488 GLU A 493 1 ? 6  
HELX_P HELX_P7  AA7 GLN A 107 ? TYR A 126 ? GLN A 494 TYR A 513 1 ? 20 
HELX_P HELX_P8  AA8 PRO A 133 ? LEU A 139 ? PRO A 520 LEU A 526 1 ? 7  
HELX_P HELX_P9  AA9 GLN A 142 ? TYR A 147 ? GLN A 529 TYR A 534 1 ? 6  
HELX_P HELX_P10 AB1 TYR A 147 ? GLU A 157 ? TYR A 534 GLU A 544 1 ? 11 
HELX_P HELX_P11 AB2 SER A 161 ? SER A 178 ? SER A 548 SER A 565 1 ? 18 
HELX_P HELX_P12 AB3 LEU A 179 ? SER A 182 ? LEU A 566 SER A 569 5 ? 4  
HELX_P HELX_P13 AB4 SER A 185 ? SER A 194 ? SER A 572 SER A 581 1 ? 10 
HELX_P HELX_P14 AB5 THR A 200 ? ILE A 205 ? THR A 587 ILE A 592 1 ? 6  
HELX_P HELX_P15 AB6 ARG A 219 ? LEU A 245 ? ARG A 784 LEU A 810 1 ? 27 
HELX_P HELX_P16 AB7 SER A 248 ? CYS A 266 ? SER A 813 CYS A 831 1 ? 19 
HELX_P HELX_P17 AB8 PRO A 267 ? LYS A 271 ? PRO A 832 LYS A 836 5 ? 5  
HELX_P HELX_P18 AB9 HIS A 274 ? THR A 290 ? HIS A 839 THR A 855 1 ? 17 
HELX_P HELX_P19 AC1 THR A 295 ? ARG A 304 ? THR A 860 ARG A 869 1 ? 10 
HELX_P HELX_P20 AC2 SER A 311 ? SER A 316 ? SER A 876 SER A 881 1 ? 6  
HELX_P HELX_P21 AC3 ASP A 328 ? ILE A 336 ? ASP A 929 ILE A 937 1 ? 9  
HELX_P HELX_P22 AC4 ILE A 336 ? LEU A 346 ? ILE A 937 LEU A 947 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 132 A . ? PHE 519 A PRO 133 A ? PRO 520 A 1 4.00 
2 LEU 8   B . ? LEU 28  B ASN 9   B ? ASN 29  B 1 8.57 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 317 ? LEU A 318 ? VAL A 882 LEU A 883 
AA1 2 ARG A 326 ? GLY A 327 ? ARG A 927 GLY A 928 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    317 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     882 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   GLY 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    327 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    GLY 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     928 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 1001 ? 6 'binding site for residue SO4 A 1001' 
AC2 Software A SO4 1002 ? 3 'binding site for residue SO4 A 1002' 
AC3 Software A SO4 1003 ? 3 'binding site for residue SO4 A 1003' 
AC4 Software A SO4 1004 ? 3 'binding site for residue SO4 A 1004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 TYR A 55  ? TYR A 442 . ? 4_545 ? 
2  AC1 6 ARG A 73  ? ARG A 460 . ? 4_545 ? 
3  AC1 6 ARG A 95  ? ARG A 482 . ? 1_555 ? 
4  AC1 6 LEU A 96  ? LEU A 483 . ? 1_555 ? 
5  AC1 6 SER A 128 ? SER A 515 . ? 4_545 ? 
6  AC1 6 ARG A 130 ? ARG A 517 . ? 4_545 ? 
7  AC2 3 ARG A 9   ? ARG A 396 . ? 1_555 ? 
8  AC2 3 SER A 161 ? SER A 548 . ? 1_555 ? 
9  AC2 3 ARG A 162 ? ARG A 549 . ? 1_555 ? 
10 AC3 3 ARG A 252 ? ARG A 817 . ? 1_555 ? 
11 AC3 3 ARG A 253 ? ARG A 818 . ? 1_555 ? 
12 AC3 3 GLN B 7   ? GLN B 27  . ? 4_546 ? 
13 AC4 3 ARG A 219 ? ARG A 784 . ? 1_555 ? 
14 AC4 3 GLY A 221 ? GLY A 786 . ? 1_555 ? 
15 AC4 3 SER A 222 ? SER A 787 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YOZ 
_atom_sites.fract_transf_matrix[1][1]   0.010031 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005866 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013063 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015512 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 2   ? 42.228  23.863  -3.248  1.00 66.88  ? 389  GLU A N   1 
ATOM   2    C CA  . GLU A 1 2   ? 41.826  23.156  -2.037  1.00 60.62  ? 389  GLU A CA  1 
ATOM   3    C C   . GLU A 1 2   ? 40.317  23.194  -1.838  1.00 48.00  ? 389  GLU A C   1 
ATOM   4    O O   . GLU A 1 2   ? 39.708  24.260  -1.855  1.00 49.89  ? 389  GLU A O   1 
ATOM   5    C CB  . GLU A 1 2   ? 42.520  23.751  -0.812  1.00 67.79  ? 389  GLU A CB  1 
ATOM   6    C CG  . GLU A 1 2   ? 42.371  22.911  0.445   1.00 74.84  ? 389  GLU A CG  1 
ATOM   7    C CD  . GLU A 1 2   ? 42.297  23.751  1.708   1.00 83.43  ? 389  GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 2   ? 42.156  24.988  1.598   1.00 84.42  ? 389  GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 2   ? 42.383  23.171  2.812   1.00 87.77  ? 389  GLU A OE2 1 
ATOM   10   N N   . PHE A 1 3   ? 39.714  22.025  -1.658  1.00 43.96  ? 390  PHE A N   1 
ATOM   11   C CA  . PHE A 1 3   ? 38.293  21.942  -1.359  1.00 37.32  ? 390  PHE A CA  1 
ATOM   12   C C   . PHE A 1 3   ? 38.045  22.255  0.105   1.00 38.24  ? 390  PHE A C   1 
ATOM   13   O O   . PHE A 1 3   ? 38.939  22.105  0.941   1.00 37.82  ? 390  PHE A O   1 
ATOM   14   C CB  . PHE A 1 3   ? 37.742  20.556  -1.702  1.00 35.51  ? 390  PHE A CB  1 
ATOM   15   C CG  . PHE A 1 3   ? 37.805  20.233  -3.162  1.00 43.42  ? 390  PHE A CG  1 
ATOM   16   C CD1 . PHE A 1 3   ? 36.811  20.671  -4.022  1.00 41.41  ? 390  PHE A CD1 1 
ATOM   17   C CD2 . PHE A 1 3   ? 38.867  19.507  -3.680  1.00 53.23  ? 390  PHE A CD2 1 
ATOM   18   C CE1 . PHE A 1 3   ? 36.868  20.386  -5.368  1.00 45.25  ? 390  PHE A CE1 1 
ATOM   19   C CE2 . PHE A 1 3   ? 38.931  19.216  -5.028  1.00 53.57  ? 390  PHE A CE2 1 
ATOM   20   C CZ  . PHE A 1 3   ? 37.931  19.657  -5.874  1.00 53.79  ? 390  PHE A CZ  1 
ATOM   21   N N   . THR A 1 4   ? 36.833  22.704  0.410   1.00 35.39  ? 391  THR A N   1 
ATOM   22   C CA  . THR A 1 4   ? 36.421  22.870  1.794   1.00 33.93  ? 391  THR A CA  1 
ATOM   23   C C   . THR A 1 4   ? 36.308  21.489  2.425   1.00 38.60  ? 391  THR A C   1 
ATOM   24   O O   . THR A 1 4   ? 36.226  20.484  1.714   1.00 36.52  ? 391  THR A O   1 
ATOM   25   C CB  . THR A 1 4   ? 35.082  23.605  1.914   1.00 37.75  ? 391  THR A CB  1 
ATOM   26   O OG1 . THR A 1 4   ? 34.037  22.767  1.412   1.00 29.60  ? 391  THR A OG1 1 
ATOM   27   C CG2 . THR A 1 4   ? 35.113  24.908  1.128   1.00 39.50  ? 391  THR A CG2 1 
ATOM   28   N N   . GLN A 1 5   ? 36.318  21.437  3.752   1.00 38.01  ? 392  GLN A N   1 
ATOM   29   C CA  . GLN A 1 5   ? 36.310  20.162  4.458   1.00 36.75  ? 392  GLN A CA  1 
ATOM   30   C C   . GLN A 1 5   ? 35.077  19.332  4.114   1.00 37.94  ? 392  GLN A C   1 
ATOM   31   O O   . GLN A 1 5   ? 35.170  18.119  3.912   1.00 28.57  ? 392  GLN A O   1 
ATOM   32   C CB  . GLN A 1 5   ? 36.399  20.396  5.968   1.00 38.34  ? 392  GLN A CB  1 
ATOM   33   C CG  . GLN A 1 5   ? 37.411  21.464  6.374   1.00 53.79  ? 392  GLN A CG  1 
ATOM   34   C CD  . GLN A 1 5   ? 38.824  21.188  5.868   1.00 68.32  ? 392  GLN A CD  1 
ATOM   35   O OE1 . GLN A 1 5   ? 39.183  20.049  5.559   1.00 71.05  ? 392  GLN A OE1 1 
ATOM   36   N NE2 . GLN A 1 5   ? 39.636  22.240  5.786   1.00 72.10  ? 392  GLN A NE2 1 
ATOM   37   N N   . SER A 1 6   ? 33.927  19.991  4.025   1.00 32.01  ? 393  SER A N   1 
ATOM   38   C CA  . SER A 1 6   ? 32.680  19.312  3.677   1.00 26.36  ? 393  SER A CA  1 
ATOM   39   C C   . SER A 1 6   ? 32.684  18.718  2.270   1.00 27.47  ? 393  SER A C   1 
ATOM   40   O O   . SER A 1 6   ? 32.225  17.592  2.071   1.00 28.27  ? 393  SER A O   1 
ATOM   41   C CB  . SER A 1 6   ? 31.496  20.273  3.820   1.00 28.84  ? 393  SER A CB  1 
ATOM   42   O OG  . SER A 1 6   ? 30.929  20.199  5.118   1.00 43.53  ? 393  SER A OG  1 
ATOM   43   N N   . VAL A 1 7   ? 33.189  19.465  1.293   1.00 25.16  ? 394  VAL A N   1 
ATOM   44   C CA  . VAL A 1 7   ? 33.191  18.971  -0.082  1.00 27.77  ? 394  VAL A CA  1 
ATOM   45   C C   . VAL A 1 7   ? 34.247  17.875  -0.263  1.00 27.30  ? 394  VAL A C   1 
ATOM   46   O O   . VAL A 1 7   ? 34.018  16.901  -0.987  1.00 26.93  ? 394  VAL A O   1 
ATOM   47   C CB  . VAL A 1 7   ? 33.417  20.110  -1.102  1.00 27.55  ? 394  VAL A CB  1 
ATOM   48   C CG1 . VAL A 1 7   ? 33.629  19.552  -2.506  1.00 27.61  ? 394  VAL A CG1 1 
ATOM   49   C CG2 . VAL A 1 7   ? 32.227  21.059  -1.100  1.00 24.02  ? 394  VAL A CG2 1 
ATOM   50   N N   . SER A 1 8   ? 35.381  18.002  0.418   1.00 27.30  ? 395  SER A N   1 
ATOM   51   C CA  . SER A 1 8   ? 36.405  16.964  0.327   1.00 28.54  ? 395  SER A CA  1 
ATOM   52   C C   . SER A 1 8   ? 35.922  15.686  1.011   1.00 27.87  ? 395  SER A C   1 
ATOM   53   O O   . SER A 1 8   ? 36.163  14.588  0.518   1.00 32.46  ? 395  SER A O   1 
ATOM   54   C CB  . SER A 1 8   ? 37.736  17.435  0.931   1.00 38.95  ? 395  SER A CB  1 
ATOM   55   O OG  . SER A 1 8   ? 37.693  17.449  2.346   1.00 46.33  ? 395  SER A OG  1 
ATOM   56   N N   . ARG A 1 9   ? 35.231  15.832  2.139   1.00 32.49  ? 396  ARG A N   1 
ATOM   57   C CA  . ARG A 1 9   ? 34.628  14.687  2.816   1.00 33.52  ? 396  ARG A CA  1 
ATOM   58   C C   . ARG A 1 9   ? 33.623  13.997  1.905   1.00 31.37  ? 396  ARG A C   1 
ATOM   59   O O   . ARG A 1 9   ? 33.616  12.772  1.776   1.00 31.27  ? 396  ARG A O   1 
ATOM   60   C CB  . ARG A 1 9   ? 33.940  15.111  4.114   1.00 31.46  ? 396  ARG A CB  1 
ATOM   61   C CG  . ARG A 1 9   ? 33.181  13.978  4.791   1.00 32.18  ? 396  ARG A CG  1 
ATOM   62   C CD  . ARG A 1 9   ? 34.107  12.790  5.068   1.00 38.68  ? 396  ARG A CD  1 
ATOM   63   N NE  . ARG A 1 9   ? 35.176  13.148  5.997   1.00 43.67  ? 396  ARG A NE  1 
ATOM   64   C CZ  . ARG A 1 9   ? 35.045  13.131  7.320   1.00 42.85  ? 396  ARG A CZ  1 
ATOM   65   N NH1 . ARG A 1 9   ? 33.890  12.767  7.865   1.00 42.33  ? 396  ARG A NH1 1 
ATOM   66   N NH2 . ARG A 1 9   ? 36.064  13.474  8.097   1.00 40.26  ? 396  ARG A NH2 1 
ATOM   67   N N   . LEU A 1 10  ? 32.775  14.801  1.278   1.00 27.78  ? 397  LEU A N   1 
ATOM   68   C CA  . LEU A 1 10  ? 31.825  14.301  0.295   1.00 26.88  ? 397  LEU A CA  1 
ATOM   69   C C   . LEU A 1 10  ? 32.543  13.517  -0.798  1.00 30.32  ? 397  LEU A C   1 
ATOM   70   O O   . LEU A 1 10  ? 32.128  12.411  -1.153  1.00 30.04  ? 397  LEU A O   1 
ATOM   71   C CB  . LEU A 1 10  ? 31.037  15.459  -0.311  1.00 31.14  ? 397  LEU A CB  1 
ATOM   72   C CG  . LEU A 1 10  ? 29.681  15.133  -0.916  1.00 40.69  ? 397  LEU A CG  1 
ATOM   73   C CD1 . LEU A 1 10  ? 28.832  14.388  0.096   1.00 50.82  ? 397  LEU A CD1 1 
ATOM   74   C CD2 . LEU A 1 10  ? 29.000  16.419  -1.343  1.00 39.75  ? 397  LEU A CD2 1 
ATOM   75   N N   . GLN A 1 11  ? 33.627  14.095  -1.315  1.00 24.09  ? 398  GLN A N   1 
ATOM   76   C CA  . GLN A 1 11  ? 34.445  13.456  -2.343  1.00 28.05  ? 398  GLN A CA  1 
ATOM   77   C C   . GLN A 1 11  ? 35.044  12.127  -1.882  1.00 35.09  ? 398  GLN A C   1 
ATOM   78   O O   . GLN A 1 11  ? 35.220  11.208  -2.685  1.00 33.82  ? 398  GLN A O   1 
ATOM   79   C CB  . GLN A 1 11  ? 35.572  14.393  -2.788  1.00 34.96  ? 398  GLN A CB  1 
ATOM   80   C CG  . GLN A 1 11  ? 35.105  15.548  -3.659  1.00 45.70  ? 398  GLN A CG  1 
ATOM   81   C CD  . GLN A 1 11  ? 36.233  16.489  -4.045  1.00 52.88  ? 398  GLN A CD  1 
ATOM   82   O OE1 . GLN A 1 11  ? 37.323  16.449  -3.470  1.00 49.23  ? 398  GLN A OE1 1 
ATOM   83   N NE2 . GLN A 1 11  ? 35.975  17.341  -5.031  1.00 57.59  ? 398  GLN A NE2 1 
ATOM   84   N N   . SER A 1 12  ? 35.371  12.036  -0.596  1.00 34.07  ? 399  SER A N   1 
ATOM   85   C CA  . SER A 1 12  ? 35.904  10.802  -0.032  1.00 36.38  ? 399  SER A CA  1 
ATOM   86   C C   . SER A 1 12  ? 34.827  9.722   0.013   1.00 28.28  ? 399  SER A C   1 
ATOM   87   O O   . SER A 1 12  ? 35.094  8.557   -0.265  1.00 32.64  ? 399  SER A O   1 
ATOM   88   C CB  . SER A 1 12  ? 36.466  11.037  1.374   1.00 38.75  ? 399  SER A CB  1 
ATOM   89   O OG  . SER A 1 12  ? 37.592  11.896  1.341   1.00 51.86  ? 399  SER A OG  1 
ATOM   90   N N   . ILE A 1 13  ? 33.612  10.120  0.366   1.00 25.99  ? 400  ILE A N   1 
ATOM   91   C CA  . ILE A 1 13  ? 32.506  9.184   0.489   1.00 31.54  ? 400  ILE A CA  1 
ATOM   92   C C   . ILE A 1 13  ? 32.156  8.547   -0.858  1.00 36.59  ? 400  ILE A C   1 
ATOM   93   O O   . ILE A 1 13  ? 31.887  7.348   -0.938  1.00 32.83  ? 400  ILE A O   1 
ATOM   94   C CB  . ILE A 1 13  ? 31.260  9.876   1.076   1.00 29.30  ? 400  ILE A CB  1 
ATOM   95   C CG1 . ILE A 1 13  ? 31.550  10.360  2.500   1.00 31.81  ? 400  ILE A CG1 1 
ATOM   96   C CG2 . ILE A 1 13  ? 30.064  8.934   1.074   1.00 21.38  ? 400  ILE A CG2 1 
ATOM   97   C CD1 . ILE A 1 13  ? 30.386  11.097  3.150   1.00 27.05  ? 400  ILE A CD1 1 
ATOM   98   N N   . VAL A 1 14  ? 32.192  9.350   -1.916  1.00 31.42  ? 401  VAL A N   1 
ATOM   99   C CA  . VAL A 1 14  ? 31.754  8.906   -3.233  1.00 27.57  ? 401  VAL A CA  1 
ATOM   100  C C   . VAL A 1 14  ? 32.878  8.346   -4.101  1.00 35.02  ? 401  VAL A C   1 
ATOM   101  O O   . VAL A 1 14  ? 32.648  7.987   -5.258  1.00 37.38  ? 401  VAL A O   1 
ATOM   102  C CB  . VAL A 1 14  ? 31.092  10.056  -4.004  1.00 22.46  ? 401  VAL A CB  1 
ATOM   103  C CG1 . VAL A 1 14  ? 29.983  10.670  -3.172  1.00 22.01  ? 401  VAL A CG1 1 
ATOM   104  C CG2 . VAL A 1 14  ? 32.131  11.108  -4.379  1.00 24.35  ? 401  VAL A CG2 1 
ATOM   105  N N   . ALA A 1 15  ? 34.085  8.269   -3.545  1.00 30.48  ? 402  ALA A N   1 
ATOM   106  C CA  . ALA A 1 15  ? 35.257  7.880   -4.320  1.00 31.78  ? 402  ALA A CA  1 
ATOM   107  C C   . ALA A 1 15  ? 35.177  6.436   -4.812  1.00 44.34  ? 402  ALA A C   1 
ATOM   108  O O   . ALA A 1 15  ? 34.945  5.513   -4.032  1.00 44.39  ? 402  ALA A O   1 
ATOM   109  C CB  . ALA A 1 15  ? 36.523  8.086   -3.496  1.00 33.34  ? 402  ALA A CB  1 
ATOM   110  N N   . GLY A 1 16  ? 35.374  6.256   -6.114  1.00 29.91  ? 403  GLY A N   1 
ATOM   111  C CA  . GLY A 1 16  ? 35.393  4.939   -6.718  1.00 31.76  ? 403  GLY A CA  1 
ATOM   112  C C   . GLY A 1 16  ? 34.013  4.360   -6.962  1.00 34.09  ? 403  GLY A C   1 
ATOM   113  O O   . GLY A 1 16  ? 33.880  3.179   -7.270  1.00 40.78  ? 403  GLY A O   1 
ATOM   114  N N   . LEU A 1 17  ? 32.986  5.194   -6.849  1.00 32.29  ? 404  LEU A N   1 
ATOM   115  C CA  . LEU A 1 17  ? 31.611  4.723   -6.953  1.00 30.32  ? 404  LEU A CA  1 
ATOM   116  C C   . LEU A 1 17  ? 30.872  5.368   -8.113  1.00 34.53  ? 404  LEU A C   1 
ATOM   117  O O   . LEU A 1 17  ? 31.290  6.395   -8.639  1.00 43.13  ? 404  LEU A O   1 
ATOM   118  C CB  . LEU A 1 17  ? 30.846  4.985   -5.657  1.00 26.54  ? 404  LEU A CB  1 
ATOM   119  C CG  . LEU A 1 17  ? 31.319  4.239   -4.411  1.00 27.26  ? 404  LEU A CG  1 
ATOM   120  C CD1 . LEU A 1 17  ? 30.340  4.478   -3.271  1.00 26.26  ? 404  LEU A CD1 1 
ATOM   121  C CD2 . LEU A 1 17  ? 31.487  2.751   -4.692  1.00 26.90  ? 404  LEU A CD2 1 
ATOM   122  N N   . LYS A 1 18  ? 29.757  4.752   -8.488  1.00 37.72  ? 405  LYS A N   1 
ATOM   123  C CA  . LYS A 1 18  ? 28.982  5.148   -9.656  1.00 32.23  ? 405  LYS A CA  1 
ATOM   124  C C   . LYS A 1 18  ? 27.607  5.662   -9.257  1.00 27.83  ? 405  LYS A C   1 
ATOM   125  O O   . LYS A 1 18  ? 27.118  5.384   -8.163  1.00 29.99  ? 405  LYS A O   1 
ATOM   126  C CB  . LYS A 1 18  ? 28.815  3.973   -10.625 1.00 38.73  ? 405  LYS A CB  1 
ATOM   127  C CG  . LYS A 1 18  ? 30.104  3.384   -11.162 1.00 44.70  ? 405  LYS A CG  1 
ATOM   128  C CD  . LYS A 1 18  ? 29.802  2.324   -12.212 1.00 50.12  ? 405  LYS A CD  1 
ATOM   129  C CE  . LYS A 1 18  ? 28.879  1.242   -11.661 1.00 46.74  ? 405  LYS A CE  1 
ATOM   130  N NZ  . LYS A 1 18  ? 28.289  0.396   -12.734 1.00 43.58  ? 405  LYS A NZ  1 
ATOM   131  N N   . ASN A 1 19  ? 26.991  6.407   -10.166 1.00 28.82  ? 406  ASN A N   1 
ATOM   132  C CA  . ASN A 1 19  ? 25.631  6.910   -10.003 1.00 29.69  ? 406  ASN A CA  1 
ATOM   133  C C   . ASN A 1 19  ? 24.632  5.851   -10.496 1.00 29.48  ? 406  ASN A C   1 
ATOM   134  O O   . ASN A 1 19  ? 23.500  6.158   -10.855 1.00 37.33  ? 406  ASN A O   1 
ATOM   135  C CB  . ASN A 1 19  ? 25.429  8.266   -10.704 1.00 32.09  ? 406  ASN A CB  1 
ATOM   136  C CG  . ASN A 1 19  ? 25.788  8.239   -12.176 1.00 34.06  ? 406  ASN A CG  1 
ATOM   137  O OD1 . ASN A 1 19  ? 26.781  7.637   -12.579 1.00 38.08  ? 406  ASN A OD1 1 
ATOM   138  N ND2 . ASN A 1 19  ? 24.979  8.909   -12.987 1.00 34.50  ? 406  ASN A ND2 1 
ATOM   139  N N   . ALA A 1 20  ? 25.118  4.620   -10.605 1.00 31.82  ? 407  ALA A N   1 
ATOM   140  C CA  . ALA A 1 20  ? 24.299  3.444   -10.898 1.00 33.45  ? 407  ALA A CA  1 
ATOM   141  C C   . ALA A 1 20  ? 24.370  2.436   -9.733  1.00 28.97  ? 407  ALA A C   1 
ATOM   142  O O   . ALA A 1 20  ? 25.250  2.539   -8.880  1.00 26.27  ? 407  ALA A O   1 
ATOM   143  C CB  . ALA A 1 20  ? 24.764  2.799   -12.205 1.00 23.56  ? 407  ALA A CB  1 
ATOM   144  N N   . PRO A 1 21  ? 23.422  1.481   -9.666  1.00 25.13  ? 408  PRO A N   1 
ATOM   145  C CA  . PRO A 1 21  ? 23.524  0.443   -8.627  1.00 22.54  ? 408  PRO A CA  1 
ATOM   146  C C   . PRO A 1 21  ? 24.796  -0.391  -8.755  1.00 28.54  ? 408  PRO A C   1 
ATOM   147  O O   . PRO A 1 21  ? 25.215  -0.682  -9.874  1.00 26.49  ? 408  PRO A O   1 
ATOM   148  C CB  . PRO A 1 21  ? 22.299  -0.449  -8.876  1.00 25.10  ? 408  PRO A CB  1 
ATOM   149  C CG  . PRO A 1 21  ? 21.392  0.335   -9.738  1.00 33.86  ? 408  PRO A CG  1 
ATOM   150  C CD  . PRO A 1 21  ? 22.232  1.300   -10.516 1.00 27.46  ? 408  PRO A CD  1 
ATOM   151  N N   . SER A 1 22  ? 25.394  -0.761  -7.626  1.00 24.92  ? 409  SER A N   1 
ATOM   152  C CA  . SER A 1 22  ? 26.511  -1.701  -7.607  1.00 32.07  ? 409  SER A CA  1 
ATOM   153  C C   . SER A 1 22  ? 26.027  -3.114  -7.907  1.00 34.94  ? 409  SER A C   1 
ATOM   154  O O   . SER A 1 22  ? 24.826  -3.393  -7.831  1.00 30.95  ? 409  SER A O   1 
ATOM   155  C CB  . SER A 1 22  ? 27.218  -1.678  -6.254  1.00 40.80  ? 409  SER A CB  1 
ATOM   156  O OG  . SER A 1 22  ? 26.444  -2.352  -5.278  1.00 26.96  ? 409  SER A OG  1 
ATOM   157  N N   . ASP A 1 23  ? 26.962  -3.991  -8.271  1.00 36.63  ? 410  ASP A N   1 
ATOM   158  C CA  . ASP A 1 23  ? 26.659  -5.402  -8.521  1.00 32.85  ? 410  ASP A CA  1 
ATOM   159  C C   . ASP A 1 23  ? 25.952  -6.048  -7.331  1.00 35.92  ? 410  ASP A C   1 
ATOM   160  O O   . ASP A 1 23  ? 25.013  -6.822  -7.508  1.00 37.96  ? 410  ASP A O   1 
ATOM   161  C CB  . ASP A 1 23  ? 27.940  -6.182  -8.846  1.00 39.35  ? 410  ASP A CB  1 
ATOM   162  C CG  . ASP A 1 23  ? 28.321  -6.104  -10.318 1.00 44.11  ? 410  ASP A CG  1 
ATOM   163  O OD1 . ASP A 1 23  ? 27.953  -5.113  -10.983 1.00 44.90  ? 410  ASP A OD1 1 
ATOM   164  O OD2 . ASP A 1 23  ? 28.991  -7.038  -10.811 1.00 52.46  ? 410  ASP A OD2 1 
ATOM   165  N N   . GLN A 1 24  ? 26.410  -5.726  -6.123  1.00 34.55  ? 411  GLN A N   1 
ATOM   166  C CA  . GLN A 1 24  ? 25.787  -6.226  -4.903  1.00 40.56  ? 411  GLN A CA  1 
ATOM   167  C C   . GLN A 1 24  ? 24.326  -5.806  -4.779  1.00 41.29  ? 411  GLN A C   1 
ATOM   168  O O   . GLN A 1 24  ? 23.465  -6.616  -4.432  1.00 40.84  ? 411  GLN A O   1 
ATOM   169  C CB  . GLN A 1 24  ? 26.553  -5.744  -3.672  1.00 50.89  ? 411  GLN A CB  1 
ATOM   170  C CG  . GLN A 1 24  ? 27.586  -6.725  -3.146  1.00 59.07  ? 411  GLN A CG  1 
ATOM   171  C CD  . GLN A 1 24  ? 27.893  -6.490  -1.681  1.00 66.64  ? 411  GLN A CD  1 
ATOM   172  O OE1 . GLN A 1 24  ? 27.012  -6.107  -0.907  1.00 67.81  ? 411  GLN A OE1 1 
ATOM   173  N NE2 . GLN A 1 24  ? 29.147  -6.708  -1.291  1.00 66.69  ? 411  GLN A NE2 1 
ATOM   174  N N   . LEU A 1 25  ? 24.052  -4.534  -5.054  1.00 33.92  ? 412  LEU A N   1 
ATOM   175  C CA  . LEU A 1 25  ? 22.694  -4.015  -4.946  1.00 27.19  ? 412  LEU A CA  1 
ATOM   176  C C   . LEU A 1 25  ? 21.797  -4.632  -6.014  1.00 26.45  ? 412  LEU A C   1 
ATOM   177  O O   . LEU A 1 25  ? 20.659  -5.009  -5.741  1.00 31.80  ? 412  LEU A O   1 
ATOM   178  C CB  . LEU A 1 25  ? 22.693  -2.488  -5.057  1.00 31.74  ? 412  LEU A CB  1 
ATOM   179  C CG  . LEU A 1 25  ? 21.359  -1.775  -4.819  1.00 30.89  ? 412  LEU A CG  1 
ATOM   180  C CD1 . LEU A 1 25  ? 20.730  -2.197  -3.503  1.00 25.78  ? 412  LEU A CD1 1 
ATOM   181  C CD2 . LEU A 1 25  ? 21.549  -0.270  -4.850  1.00 26.99  ? 412  LEU A CD2 1 
ATOM   182  N N   . ILE A 1 26  ? 22.322  -4.733  -7.230  1.00 35.34  ? 413  ILE A N   1 
ATOM   183  C CA  . ILE A 1 26  ? 21.606  -5.341  -8.346  1.00 30.71  ? 413  ILE A CA  1 
ATOM   184  C C   . ILE A 1 26  ? 21.152  -6.755  -8.000  1.00 33.16  ? 413  ILE A C   1 
ATOM   185  O O   . ILE A 1 26  ? 20.018  -7.139  -8.290  1.00 37.06  ? 413  ILE A O   1 
ATOM   186  C CB  . ILE A 1 26  ? 22.484  -5.364  -9.617  1.00 33.73  ? 413  ILE A CB  1 
ATOM   187  C CG1 . ILE A 1 26  ? 22.552  -3.961  -10.231 1.00 33.58  ? 413  ILE A CG1 1 
ATOM   188  C CG2 . ILE A 1 26  ? 21.962  -6.380  -10.632 1.00 33.47  ? 413  ILE A CG2 1 
ATOM   189  C CD1 . ILE A 1 26  ? 23.573  -3.830  -11.352 1.00 34.43  ? 413  ILE A CD1 1 
ATOM   190  N N   . ASN A 1 27  ? 22.035  -7.517  -7.362  1.00 33.79  ? 414  ASN A N   1 
ATOM   191  C CA  . ASN A 1 27  ? 21.710  -8.875  -6.933  1.00 46.16  ? 414  ASN A CA  1 
ATOM   192  C C   . ASN A 1 27  ? 20.549  -8.900  -5.947  1.00 43.21  ? 414  ASN A C   1 
ATOM   193  O O   . ASN A 1 27  ? 19.692  -9.783  -6.001  1.00 37.49  ? 414  ASN A O   1 
ATOM   194  C CB  . ASN A 1 27  ? 22.933  -9.546  -6.309  1.00 54.50  ? 414  ASN A CB  1 
ATOM   195  C CG  . ASN A 1 27  ? 23.854  -10.154 -7.345  1.00 61.79  ? 414  ASN A CG  1 
ATOM   196  O OD1 . ASN A 1 27  ? 23.404  -10.834 -8.267  1.00 66.01  ? 414  ASN A OD1 1 
ATOM   197  N ND2 . ASN A 1 27  ? 25.152  -9.909  -7.201  1.00 59.72  ? 414  ASN A ND2 1 
ATOM   198  N N   . ILE A 1 28  ? 20.530  -7.928  -5.043  1.00 37.13  ? 415  ILE A N   1 
ATOM   199  C CA  . ILE A 1 28  ? 19.433  -7.806  -4.096  1.00 33.76  ? 415  ILE A CA  1 
ATOM   200  C C   . ILE A 1 28  ? 18.149  -7.463  -4.848  1.00 36.98  ? 415  ILE A C   1 
ATOM   201  O O   . ILE A 1 28  ? 17.100  -8.058  -4.594  1.00 38.42  ? 415  ILE A O   1 
ATOM   202  C CB  . ILE A 1 28  ? 19.739  -6.749  -3.025  1.00 36.56  ? 415  ILE A CB  1 
ATOM   203  C CG1 . ILE A 1 28  ? 20.709  -7.327  -1.991  1.00 32.95  ? 415  ILE A CG1 1 
ATOM   204  C CG2 . ILE A 1 28  ? 18.460  -6.262  -2.353  1.00 26.22  ? 415  ILE A CG2 1 
ATOM   205  C CD1 . ILE A 1 28  ? 21.133  -6.337  -0.934  1.00 34.12  ? 415  ILE A CD1 1 
ATOM   206  N N   . PHE A 1 29  ? 18.250  -6.520  -5.784  1.00 33.51  ? 416  PHE A N   1 
ATOM   207  C CA  . PHE A 1 29  ? 17.135  -6.154  -6.654  1.00 32.16  ? 416  PHE A CA  1 
ATOM   208  C C   . PHE A 1 29  ? 16.544  -7.376  -7.364  1.00 33.19  ? 416  PHE A C   1 
ATOM   209  O O   . PHE A 1 29  ? 15.327  -7.527  -7.464  1.00 32.95  ? 416  PHE A O   1 
ATOM   210  C CB  . PHE A 1 29  ? 17.581  -5.129  -7.706  1.00 25.67  ? 416  PHE A CB  1 
ATOM   211  C CG  . PHE A 1 29  ? 17.794  -3.739  -7.169  1.00 28.95  ? 416  PHE A CG  1 
ATOM   212  C CD1 . PHE A 1 29  ? 17.445  -3.412  -5.868  1.00 22.68  ? 416  PHE A CD1 1 
ATOM   213  C CD2 . PHE A 1 29  ? 18.345  -2.754  -7.978  1.00 25.33  ? 416  PHE A CD2 1 
ATOM   214  C CE1 . PHE A 1 29  ? 17.646  -2.123  -5.386  1.00 23.88  ? 416  PHE A CE1 1 
ATOM   215  C CE2 . PHE A 1 29  ? 18.542  -1.472  -7.506  1.00 21.79  ? 416  PHE A CE2 1 
ATOM   216  C CZ  . PHE A 1 29  ? 18.192  -1.155  -6.207  1.00 26.44  ? 416  PHE A CZ  1 
ATOM   217  N N   . GLU A 1 30  ? 17.413  -8.247  -7.858  1.00 30.51  ? 417  GLU A N   1 
ATOM   218  C CA  . GLU A 1 30  ? 16.971  -9.375  -8.671  1.00 40.14  ? 417  GLU A CA  1 
ATOM   219  C C   . GLU A 1 30  ? 16.465  -10.564 -7.858  1.00 39.09  ? 417  GLU A C   1 
ATOM   220  O O   . GLU A 1 30  ? 15.838  -11.466 -8.409  1.00 43.57  ? 417  GLU A O   1 
ATOM   221  C CB  . GLU A 1 30  ? 18.103  -9.815  -9.598  1.00 40.79  ? 417  GLU A CB  1 
ATOM   222  C CG  . GLU A 1 30  ? 18.346  -8.815  -10.713 1.00 44.14  ? 417  GLU A CG  1 
ATOM   223  C CD  . GLU A 1 30  ? 19.573  -9.122  -11.534 1.00 52.35  ? 417  GLU A CD  1 
ATOM   224  O OE1 . GLU A 1 30  ? 19.638  -8.650  -12.688 1.00 51.40  ? 417  GLU A OE1 1 
ATOM   225  O OE2 . GLU A 1 30  ? 20.473  -9.823  -11.023 1.00 61.17  ? 417  GLU A OE2 1 
ATOM   226  N N   . SER A 1 31  ? 16.717  -10.563 -6.553  1.00 41.03  ? 418  SER A N   1 
ATOM   227  C CA  . SER A 1 31  ? 16.191  -11.621 -5.693  1.00 40.86  ? 418  SER A CA  1 
ATOM   228  C C   . SER A 1 31  ? 14.753  -11.297 -5.281  1.00 46.08  ? 418  SER A C   1 
ATOM   229  O O   . SER A 1 31  ? 14.090  -12.095 -4.621  1.00 53.16  ? 418  SER A O   1 
ATOM   230  C CB  . SER A 1 31  ? 17.071  -11.815 -4.455  1.00 39.71  ? 418  SER A CB  1 
ATOM   231  O OG  . SER A 1 31  ? 16.898  -10.762 -3.522  1.00 45.93  ? 418  SER A OG  1 
ATOM   232  N N   . CYS A 1 32  ? 14.280  -10.120 -5.676  1.00 41.19  ? 419  CYS A N   1 
ATOM   233  C CA  . CYS A 1 32  ? 12.905  -9.715  -5.402  1.00 38.51  ? 419  CYS A CA  1 
ATOM   234  C C   . CYS A 1 32  ? 11.934  -10.271 -6.432  1.00 38.28  ? 419  CYS A C   1 
ATOM   235  O O   . CYS A 1 32  ? 12.232  -10.288 -7.628  1.00 36.96  ? 419  CYS A O   1 
ATOM   236  C CB  . CYS A 1 32  ? 12.786  -8.192  -5.376  1.00 34.76  ? 419  CYS A CB  1 
ATOM   237  S SG  . CYS A 1 32  ? 13.674  -7.387  -4.039  1.00 43.57  ? 419  CYS A SG  1 
ATOM   238  N N   . VAL A 1 33  ? 10.772  -10.716 -5.960  1.00 37.96  ? 420  VAL A N   1 
ATOM   239  C CA  . VAL A 1 33  ? 9.671   -11.086 -6.842  1.00 39.82  ? 420  VAL A CA  1 
ATOM   240  C C   . VAL A 1 33  ? 9.398   -9.951  -7.826  1.00 37.39  ? 420  VAL A C   1 
ATOM   241  O O   . VAL A 1 33  ? 9.224   -10.178 -9.020  1.00 40.88  ? 420  VAL A O   1 
ATOM   242  C CB  . VAL A 1 33  ? 8.386   -11.407 -6.048  1.00 43.18  ? 420  VAL A CB  1 
ATOM   243  C CG1 . VAL A 1 33  ? 7.201   -11.572 -6.986  1.00 48.19  ? 420  VAL A CG1 1 
ATOM   244  C CG2 . VAL A 1 33  ? 8.581   -12.658 -5.205  1.00 47.67  ? 420  VAL A CG2 1 
ATOM   245  N N   . ARG A 1 34  ? 9.367   -8.724  -7.318  1.00 36.68  ? 421  ARG A N   1 
ATOM   246  C CA  . ARG A 1 34  ? 9.284   -7.558  -8.189  1.00 41.03  ? 421  ARG A CA  1 
ATOM   247  C C   . ARG A 1 34  ? 10.560  -6.723  -8.068  1.00 35.67  ? 421  ARG A C   1 
ATOM   248  O O   . ARG A 1 34  ? 10.783  -6.059  -7.059  1.00 31.58  ? 421  ARG A O   1 
ATOM   249  C CB  . ARG A 1 34  ? 8.037   -6.729  -7.855  1.00 27.63  ? 421  ARG A CB  1 
ATOM   250  C CG  . ARG A 1 34  ? 6.746   -7.531  -7.993  1.00 29.32  ? 421  ARG A CG  1 
ATOM   251  C CD  . ARG A 1 34  ? 5.497   -6.727  -7.655  1.00 28.49  ? 421  ARG A CD  1 
ATOM   252  N NE  . ARG A 1 34  ? 5.431   -6.359  -6.243  1.00 30.52  ? 421  ARG A NE  1 
ATOM   253  C CZ  . ARG A 1 34  ? 5.098   -7.195  -5.262  1.00 35.18  ? 421  ARG A CZ  1 
ATOM   254  N NH1 . ARG A 1 34  ? 4.806   -8.465  -5.528  1.00 37.44  ? 421  ARG A NH1 1 
ATOM   255  N NH2 . ARG A 1 34  ? 5.063   -6.762  -4.009  1.00 32.36  ? 421  ARG A NH2 1 
ATOM   256  N N   . ASN A 1 35  ? 11.383  -6.762  -9.114  1.00 37.30  ? 422  ASN A N   1 
ATOM   257  C CA  . ASN A 1 35  ? 12.658  -6.049  -9.154  1.00 34.42  ? 422  ASN A CA  1 
ATOM   258  C C   . ASN A 1 35  ? 12.434  -4.549  -9.324  1.00 32.38  ? 422  ASN A C   1 
ATOM   259  O O   . ASN A 1 35  ? 11.943  -4.114  -10.360 1.00 33.46  ? 422  ASN A O   1 
ATOM   260  C CB  . ASN A 1 35  ? 13.527  -6.594  -10.297 1.00 37.53  ? 422  ASN A CB  1 
ATOM   261  C CG  . ASN A 1 35  ? 14.920  -5.974  -10.342 1.00 38.35  ? 422  ASN A CG  1 
ATOM   262  O OD1 . ASN A 1 35  ? 15.178  -4.939  -9.741  1.00 35.81  ? 422  ASN A OD1 1 
ATOM   263  N ND2 . ASN A 1 35  ? 15.823  -6.616  -11.071 1.00 45.33  ? 422  ASN A ND2 1 
ATOM   264  N N   . PRO A 1 36  ? 12.803  -3.759  -8.300  1.00 23.14  ? 423  PRO A N   1 
ATOM   265  C CA  . PRO A 1 36  ? 12.615  -2.302  -8.231  1.00 21.65  ? 423  PRO A CA  1 
ATOM   266  C C   . PRO A 1 36  ? 13.511  -1.466  -9.153  1.00 26.87  ? 423  PRO A C   1 
ATOM   267  O O   . PRO A 1 36  ? 13.241  -0.270  -9.287  1.00 30.98  ? 423  PRO A O   1 
ATOM   268  C CB  . PRO A 1 36  ? 12.933  -1.986  -6.770  1.00 20.83  ? 423  PRO A CB  1 
ATOM   269  C CG  . PRO A 1 36  ? 13.957  -3.012  -6.402  1.00 21.46  ? 423  PRO A CG  1 
ATOM   270  C CD  . PRO A 1 36  ? 13.515  -4.271  -7.113  1.00 23.30  ? 423  PRO A CD  1 
ATOM   271  N N   . VAL A 1 37  ? 14.560  -2.055  -9.732  1.00 29.51  ? 424  VAL A N   1 
ATOM   272  C CA  . VAL A 1 37  ? 15.624  -1.275  -10.381 1.00 32.96  ? 424  VAL A CA  1 
ATOM   273  C C   . VAL A 1 37  ? 15.135  -0.255  -11.424 1.00 29.75  ? 424  VAL A C   1 
ATOM   274  O O   . VAL A 1 37  ? 15.688  0.837   -11.530 1.00 28.58  ? 424  VAL A O   1 
ATOM   275  C CB  . VAL A 1 37  ? 16.683  -2.202  -11.049 1.00 30.48  ? 424  VAL A CB  1 
ATOM   276  C CG1 . VAL A 1 37  ? 16.081  -3.034  -12.179 1.00 25.24  ? 424  VAL A CG1 1 
ATOM   277  C CG2 . VAL A 1 37  ? 17.882  -1.383  -11.549 1.00 23.29  ? 424  VAL A CG2 1 
ATOM   278  N N   . GLU A 1 38  ? 14.090  -0.589  -12.170 1.00 28.43  ? 425  GLU A N   1 
ATOM   279  C CA  . GLU A 1 38  ? 13.592  0.313   -13.203 1.00 27.39  ? 425  GLU A CA  1 
ATOM   280  C C   . GLU A 1 38  ? 12.770  1.451   -12.617 1.00 22.31  ? 425  GLU A C   1 
ATOM   281  O O   . GLU A 1 38  ? 12.891  2.596   -13.046 1.00 26.71  ? 425  GLU A O   1 
ATOM   282  C CB  . GLU A 1 38  ? 12.760  -0.453  -14.233 1.00 36.01  ? 425  GLU A CB  1 
ATOM   283  C CG  . GLU A 1 38  ? 13.591  -1.259  -15.216 1.00 54.46  ? 425  GLU A CG  1 
ATOM   284  C CD  . GLU A 1 38  ? 14.407  -0.378  -16.142 1.00 68.35  ? 425  GLU A CD  1 
ATOM   285  O OE1 . GLU A 1 38  ? 13.919  -0.071  -17.252 1.00 77.05  ? 425  GLU A OE1 1 
ATOM   286  O OE2 . GLU A 1 38  ? 15.534  0.011   -15.762 1.00 67.87  ? 425  GLU A OE2 1 
ATOM   287  N N   . ASN A 1 39  ? 11.930  1.139   -11.639 1.00 22.67  ? 426  ASN A N   1 
ATOM   288  C CA  . ASN A 1 39  ? 11.116  2.167   -11.014 1.00 24.20  ? 426  ASN A CA  1 
ATOM   289  C C   . ASN A 1 39  ? 11.969  3.125   -10.194 1.00 26.45  ? 426  ASN A C   1 
ATOM   290  O O   . ASN A 1 39  ? 11.648  4.309   -10.083 1.00 25.82  ? 426  ASN A O   1 
ATOM   291  C CB  . ASN A 1 39  ? 10.030  1.539   -10.147 1.00 22.08  ? 426  ASN A CB  1 
ATOM   292  C CG  . ASN A 1 39  ? 9.072   0.687   -10.955 1.00 37.39  ? 426  ASN A CG  1 
ATOM   293  O OD1 . ASN A 1 39  ? 8.980   0.825   -12.174 1.00 37.30  ? 426  ASN A OD1 1 
ATOM   294  N ND2 . ASN A 1 39  ? 8.353   -0.202  -10.279 1.00 40.84  ? 426  ASN A ND2 1 
ATOM   295  N N   . ILE A 1 40  ? 13.059  2.614   -9.630  1.00 25.75  ? 427  ILE A N   1 
ATOM   296  C CA  . ILE A 1 40  ? 13.993  3.455   -8.886  1.00 19.79  ? 427  ILE A CA  1 
ATOM   297  C C   . ILE A 1 40  ? 14.684  4.430   -9.838  1.00 24.70  ? 427  ILE A C   1 
ATOM   298  O O   . ILE A 1 40  ? 14.753  5.627   -9.557  1.00 25.13  ? 427  ILE A O   1 
ATOM   299  C CB  . ILE A 1 40  ? 15.039  2.611   -8.134  1.00 19.28  ? 427  ILE A CB  1 
ATOM   300  C CG1 . ILE A 1 40  ? 14.380  1.868   -6.972  1.00 18.50  ? 427  ILE A CG1 1 
ATOM   301  C CG2 . ILE A 1 40  ? 16.185  3.476   -7.627  1.00 17.57  ? 427  ILE A CG2 1 
ATOM   302  C CD1 . ILE A 1 40  ? 15.300  0.867   -6.289  1.00 17.41  ? 427  ILE A CD1 1 
ATOM   303  N N   . MET A 1 41  ? 15.172  3.920   -10.970 1.00 17.83  ? 428  MET A N   1 
ATOM   304  C CA  . MET A 1 41  ? 15.750  4.773   -12.010 1.00 19.99  ? 428  MET A CA  1 
ATOM   305  C C   . MET A 1 41  ? 14.791  5.879   -12.449 1.00 23.74  ? 428  MET A C   1 
ATOM   306  O O   . MET A 1 41  ? 15.197  7.027   -12.631 1.00 24.24  ? 428  MET A O   1 
ATOM   307  C CB  . MET A 1 41  ? 16.153  3.943   -13.231 1.00 28.87  ? 428  MET A CB  1 
ATOM   308  C CG  . MET A 1 41  ? 17.401  3.097   -13.034 1.00 41.42  ? 428  MET A CG  1 
ATOM   309  S SD  . MET A 1 41  ? 17.719  1.981   -14.422 1.00 85.18  ? 428  MET A SD  1 
ATOM   310  C CE  . MET A 1 41  ? 17.940  3.158   -15.756 1.00 68.67  ? 428  MET A CE  1 
ATOM   311  N N   . LYS A 1 42  ? 13.523  5.525   -12.627 1.00 25.30  ? 429  LYS A N   1 
ATOM   312  C CA  . LYS A 1 42  ? 12.508  6.486   -13.053 1.00 21.28  ? 429  LYS A CA  1 
ATOM   313  C C   . LYS A 1 42  ? 12.307  7.600   -12.025 1.00 20.83  ? 429  LYS A C   1 
ATOM   314  O O   . LYS A 1 42  ? 12.196  8.767   -12.389 1.00 20.65  ? 429  LYS A O   1 
ATOM   315  C CB  . LYS A 1 42  ? 11.182  5.773   -13.325 1.00 21.41  ? 429  LYS A CB  1 
ATOM   316  C CG  . LYS A 1 42  ? 11.147  5.032   -14.648 1.00 19.39  ? 429  LYS A CG  1 
ATOM   317  C CD  . LYS A 1 42  ? 9.806   4.347   -14.876 1.00 27.63  ? 429  LYS A CD  1 
ATOM   318  C CE  . LYS A 1 42  ? 9.791   3.606   -16.210 1.00 26.14  ? 429  LYS A CE  1 
ATOM   319  N NZ  . LYS A 1 42  ? 8.505   2.886   -16.441 1.00 37.01  ? 429  LYS A NZ  1 
ATOM   320  N N   . ILE A 1 43  ? 12.264  7.239   -10.747 1.00 15.00  ? 430  ILE A N   1 
ATOM   321  C CA  . ILE A 1 43  ? 12.180  8.226   -9.675  1.00 16.26  ? 430  ILE A CA  1 
ATOM   322  C C   . ILE A 1 43  ? 13.381  9.190   -9.706  1.00 23.55  ? 430  ILE A C   1 
ATOM   323  O O   . ILE A 1 43  ? 13.203  10.411  -9.654  1.00 21.68  ? 430  ILE A O   1 
ATOM   324  C CB  . ILE A 1 43  ? 12.082  7.542   -8.292  1.00 15.26  ? 430  ILE A CB  1 
ATOM   325  C CG1 . ILE A 1 43  ? 10.718  6.856   -8.129  1.00 17.44  ? 430  ILE A CG1 1 
ATOM   326  C CG2 . ILE A 1 43  ? 12.291  8.551   -7.177  1.00 19.56  ? 430  ILE A CG2 1 
ATOM   327  C CD1 . ILE A 1 43  ? 10.582  5.987   -6.878  1.00 14.06  ? 430  ILE A CD1 1 
ATOM   328  N N   . LEU A 1 44  ? 14.597  8.654   -9.816  1.00 25.66  ? 431  LEU A N   1 
ATOM   329  C CA  . LEU A 1 44  ? 15.788  9.510   -9.885  1.00 25.92  ? 431  LEU A CA  1 
ATOM   330  C C   . LEU A 1 44  ? 15.767  10.404  -11.125 1.00 26.72  ? 431  LEU A C   1 
ATOM   331  O O   . LEU A 1 44  ? 16.209  11.555  -11.084 1.00 13.96  ? 431  LEU A O   1 
ATOM   332  C CB  . LEU A 1 44  ? 17.070  8.679   -9.881  1.00 22.38  ? 431  LEU A CB  1 
ATOM   333  C CG  . LEU A 1 44  ? 17.368  7.817   -8.653  1.00 31.91  ? 431  LEU A CG  1 
ATOM   334  C CD1 . LEU A 1 44  ? 18.846  7.441   -8.621  1.00 42.11  ? 431  LEU A CD1 1 
ATOM   335  C CD2 . LEU A 1 44  ? 16.953  8.504   -7.366  1.00 26.15  ? 431  LEU A CD2 1 
ATOM   336  N N   . LYS A 1 45  ? 15.242  9.870   -12.222 1.00 19.98  ? 432  LYS A N   1 
ATOM   337  C CA  . LYS A 1 45  ? 15.115  10.637  -13.453 1.00 23.23  ? 432  LYS A CA  1 
ATOM   338  C C   . LYS A 1 45  ? 14.096  11.777  -13.291 1.00 22.16  ? 432  LYS A C   1 
ATOM   339  O O   . LYS A 1 45  ? 14.330  12.895  -13.739 1.00 22.34  ? 432  LYS A O   1 
ATOM   340  C CB  . LYS A 1 45  ? 14.710  9.721   -14.610 1.00 26.24  ? 432  LYS A CB  1 
ATOM   341  C CG  . LYS A 1 45  ? 14.830  10.371  -15.979 1.00 35.73  ? 432  LYS A CG  1 
ATOM   342  C CD  . LYS A 1 45  ? 14.396  9.432   -17.098 1.00 40.46  ? 432  LYS A CD  1 
ATOM   343  C CE  . LYS A 1 45  ? 14.487  10.123  -18.453 1.00 48.94  ? 432  LYS A CE  1 
ATOM   344  N NZ  . LYS A 1 45  ? 14.028  9.255   -19.576 1.00 53.02  ? 432  LYS A NZ  1 
ATOM   345  N N   . GLY A 1 46  ? 12.966  11.484  -12.656 1.00 16.15  ? 433  GLY A N   1 
ATOM   346  C CA  . GLY A 1 46  ? 11.951  12.490  -12.404 1.00 18.92  ? 433  GLY A CA  1 
ATOM   347  C C   . GLY A 1 46  ? 12.453  13.573  -11.458 1.00 24.48  ? 433  GLY A C   1 
ATOM   348  O O   . GLY A 1 46  ? 12.283  14.764  -11.719 1.00 20.25  ? 433  GLY A O   1 
ATOM   349  N N   . ILE A 1 47  ? 13.073  13.146  -10.359 1.00 18.02  ? 434  ILE A N   1 
ATOM   350  C CA  . ILE A 1 47  ? 13.632  14.049  -9.357  1.00 13.29  ? 434  ILE A CA  1 
ATOM   351  C C   . ILE A 1 47  ? 14.733  14.907  -9.951  1.00 18.16  ? 434  ILE A C   1 
ATOM   352  O O   . ILE A 1 47  ? 14.796  16.109  -9.707  1.00 20.53  ? 434  ILE A O   1 
ATOM   353  C CB  . ILE A 1 47  ? 14.202  13.268  -8.152  1.00 12.59  ? 434  ILE A CB  1 
ATOM   354  C CG1 . ILE A 1 47  ? 13.070  12.693  -7.299  1.00 15.43  ? 434  ILE A CG1 1 
ATOM   355  C CG2 . ILE A 1 47  ? 15.119  14.146  -7.323  1.00 12.05  ? 434  ILE A CG2 1 
ATOM   356  C CD1 . ILE A 1 47  ? 13.558  12.002  -6.028  1.00 11.72  ? 434  ILE A CD1 1 
ATOM   357  N N   . GLY A 1 48  ? 15.585  14.278  -10.752 1.00 22.74  ? 435  GLY A N   1 
ATOM   358  C CA  . GLY A 1 48  ? 16.666  14.972  -11.421 1.00 20.44  ? 435  GLY A CA  1 
ATOM   359  C C   . GLY A 1 48  ? 16.203  16.072  -12.357 1.00 23.85  ? 435  GLY A C   1 
ATOM   360  O O   . GLY A 1 48  ? 16.800  17.150  -12.396 1.00 26.24  ? 435  GLY A O   1 
ATOM   361  N N   . GLU A 1 49  ? 15.153  15.802  -13.127 1.00 21.59  ? 436  GLU A N   1 
ATOM   362  C CA  . GLU A 1 49  ? 14.646  16.789  -14.077 1.00 21.14  ? 436  GLU A CA  1 
ATOM   363  C C   . GLU A 1 49  ? 14.007  17.968  -13.350 1.00 18.16  ? 436  GLU A C   1 
ATOM   364  O O   . GLU A 1 49  ? 14.275  19.119  -13.681 1.00 24.08  ? 436  GLU A O   1 
ATOM   365  C CB  . GLU A 1 49  ? 13.637  16.162  -15.040 1.00 21.54  ? 436  GLU A CB  1 
ATOM   366  C CG  . GLU A 1 49  ? 13.000  17.171  -15.992 1.00 42.80  ? 436  GLU A CG  1 
ATOM   367  C CD  . GLU A 1 49  ? 12.100  16.527  -17.035 1.00 54.42  ? 436  GLU A CD  1 
ATOM   368  O OE1 . GLU A 1 49  ? 11.987  15.282  -17.044 1.00 62.11  ? 436  GLU A OE1 1 
ATOM   369  O OE2 . GLU A 1 49  ? 11.509  17.267  -17.851 1.00 53.47  ? 436  GLU A OE2 1 
ATOM   370  N N   . THR A 1 50  ? 13.163  17.676  -12.363 1.00 17.25  ? 437  THR A N   1 
ATOM   371  C CA  . THR A 1 50  ? 12.490  18.723  -11.595 1.00 21.75  ? 437  THR A CA  1 
ATOM   372  C C   . THR A 1 50  ? 13.499  19.599  -10.840 1.00 19.66  ? 437  THR A C   1 
ATOM   373  O O   . THR A 1 50  ? 13.352  20.829  -10.787 1.00 15.82  ? 437  THR A O   1 
ATOM   374  C CB  . THR A 1 50  ? 11.478  18.118  -10.597 1.00 14.77  ? 437  THR A CB  1 
ATOM   375  O OG1 . THR A 1 50  ? 10.486  17.385  -11.319 1.00 22.88  ? 437  THR A OG1 1 
ATOM   376  C CG2 . THR A 1 50  ? 10.798  19.201  -9.774  1.00 15.04  ? 437  THR A CG2 1 
ATOM   377  N N   . PHE A 1 51  ? 14.519  18.954  -10.272 1.00 19.86  ? 438  PHE A N   1 
ATOM   378  C CA  . PHE A 1 51  ? 15.606  19.654  -9.579  1.00 21.39  ? 438  PHE A CA  1 
ATOM   379  C C   . PHE A 1 51  ? 16.319  20.627  -10.513 1.00 21.48  ? 438  PHE A C   1 
ATOM   380  O O   . PHE A 1 51  ? 16.531  21.788  -10.168 1.00 22.16  ? 438  PHE A O   1 
ATOM   381  C CB  . PHE A 1 51  ? 16.619  18.656  -8.996  1.00 14.38  ? 438  PHE A CB  1 
ATOM   382  C CG  . PHE A 1 51  ? 17.912  19.299  -8.529  1.00 16.54  ? 438  PHE A CG  1 
ATOM   383  C CD1 . PHE A 1 51  ? 17.957  20.033  -7.349  1.00 17.43  ? 438  PHE A CD1 1 
ATOM   384  C CD2 . PHE A 1 51  ? 19.082  19.158  -9.266  1.00 16.91  ? 438  PHE A CD2 1 
ATOM   385  C CE1 . PHE A 1 51  ? 19.148  20.627  -6.914  1.00 19.90  ? 438  PHE A CE1 1 
ATOM   386  C CE2 . PHE A 1 51  ? 20.275  19.748  -8.838  1.00 22.41  ? 438  PHE A CE2 1 
ATOM   387  C CZ  . PHE A 1 51  ? 20.308  20.485  -7.664  1.00 17.17  ? 438  PHE A CZ  1 
ATOM   388  N N   . CYS A 1 52  ? 16.690  20.148  -11.697 1.00 19.08  ? 439  CYS A N   1 
ATOM   389  C CA  . CYS A 1 52  ? 17.365  20.993  -12.678 1.00 18.61  ? 439  CYS A CA  1 
ATOM   390  C C   . CYS A 1 52  ? 16.507  22.162  -13.150 1.00 19.24  ? 439  CYS A C   1 
ATOM   391  O O   . CYS A 1 52  ? 17.012  23.268  -13.347 1.00 27.92  ? 439  CYS A O   1 
ATOM   392  C CB  . CYS A 1 52  ? 17.811  20.153  -13.876 1.00 21.49  ? 439  CYS A CB  1 
ATOM   393  S SG  . CYS A 1 52  ? 19.277  19.136  -13.531 1.00 33.02  ? 439  CYS A SG  1 
ATOM   394  N N   . GLN A 1 53  ? 15.211  21.923  -13.329 1.00 18.64  ? 440  GLN A N   1 
ATOM   395  C CA  . GLN A 1 53  ? 14.295  22.975  -13.770 1.00 19.01  ? 440  GLN A CA  1 
ATOM   396  C C   . GLN A 1 53  ? 14.212  24.121  -12.762 1.00 19.19  ? 440  GLN A C   1 
ATOM   397  O O   . GLN A 1 53  ? 14.255  25.288  -13.135 1.00 24.18  ? 440  GLN A O   1 
ATOM   398  C CB  . GLN A 1 53  ? 12.901  22.403  -14.008 1.00 36.32  ? 440  GLN A CB  1 
ATOM   399  C CG  . GLN A 1 53  ? 12.787  21.454  -15.185 1.00 29.80  ? 440  GLN A CG  1 
ATOM   400  C CD  . GLN A 1 53  ? 11.405  20.833  -15.278 1.00 36.51  ? 440  GLN A CD  1 
ATOM   401  O OE1 . GLN A 1 53  ? 10.711  20.685  -14.273 1.00 43.16  ? 440  GLN A OE1 1 
ATOM   402  N NE2 . GLN A 1 53  ? 10.995  20.477  -16.486 1.00 41.97  ? 440  GLN A NE2 1 
ATOM   403  N N   . HIS A 1 54  ? 14.094  23.780  -11.483 1.00 20.51  ? 441  HIS A N   1 
ATOM   404  C CA  . HIS A 1 54  ? 14.021  24.783  -10.426 1.00 23.40  ? 441  HIS A CA  1 
ATOM   405  C C   . HIS A 1 54  ? 15.379  25.439  -10.166 1.00 18.87  ? 441  HIS A C   1 
ATOM   406  O O   . HIS A 1 54  ? 15.459  26.639  -9.909  1.00 20.90  ? 441  HIS A O   1 
ATOM   407  C CB  . HIS A 1 54  ? 13.480  24.152  -9.136  1.00 23.57  ? 441  HIS A CB  1 
ATOM   408  C CG  . HIS A 1 54  ? 11.994  23.963  -9.138  1.00 25.65  ? 441  HIS A CG  1 
ATOM   409  N ND1 . HIS A 1 54  ? 11.125  24.905  -8.631  1.00 26.05  ? 441  HIS A ND1 1 
ATOM   410  C CD2 . HIS A 1 54  ? 11.223  22.946  -9.595  1.00 19.39  ? 441  HIS A CD2 1 
ATOM   411  C CE1 . HIS A 1 54  ? 9.883   24.474  -8.767  1.00 26.62  ? 441  HIS A CE1 1 
ATOM   412  N NE2 . HIS A 1 54  ? 9.914   23.289  -9.351  1.00 19.09  ? 441  HIS A NE2 1 
ATOM   413  N N   . TYR A 1 55  ? 16.442  24.644  -10.241 1.00 18.14  ? 442  TYR A N   1 
ATOM   414  C CA  . TYR A 1 55  ? 17.796  25.129  -9.997  1.00 18.56  ? 442  TYR A CA  1 
ATOM   415  C C   . TYR A 1 55  ? 18.185  26.218  -10.998 1.00 24.12  ? 442  TYR A C   1 
ATOM   416  O O   . TYR A 1 55  ? 18.761  27.238  -10.629 1.00 21.77  ? 442  TYR A O   1 
ATOM   417  C CB  . TYR A 1 55  ? 18.778  23.959  -10.064 1.00 19.24  ? 442  TYR A CB  1 
ATOM   418  C CG  . TYR A 1 55  ? 20.204  24.273  -9.696  1.00 26.67  ? 442  TYR A CG  1 
ATOM   419  C CD1 . TYR A 1 55  ? 20.682  24.025  -8.416  1.00 17.70  ? 442  TYR A CD1 1 
ATOM   420  C CD2 . TYR A 1 55  ? 21.087  24.789  -10.638 1.00 27.09  ? 442  TYR A CD2 1 
ATOM   421  C CE1 . TYR A 1 55  ? 21.997  24.291  -8.084  1.00 24.06  ? 442  TYR A CE1 1 
ATOM   422  C CE2 . TYR A 1 55  ? 22.402  25.056  -10.315 1.00 25.41  ? 442  TYR A CE2 1 
ATOM   423  C CZ  . TYR A 1 55  ? 22.852  24.815  -9.037  1.00 24.93  ? 442  TYR A CZ  1 
ATOM   424  O OH  . TYR A 1 55  ? 24.164  25.090  -8.718  1.00 27.32  ? 442  TYR A OH  1 
ATOM   425  N N   . THR A 1 56  ? 17.840  26.004  -12.263 1.00 20.55  ? 443  THR A N   1 
ATOM   426  C CA  . THR A 1 56  ? 18.264  26.891  -13.340 1.00 28.97  ? 443  THR A CA  1 
ATOM   427  C C   . THR A 1 56  ? 17.303  28.053  -13.600 1.00 30.15  ? 443  THR A C   1 
ATOM   428  O O   . THR A 1 56  ? 17.553  28.873  -14.480 1.00 38.10  ? 443  THR A O   1 
ATOM   429  C CB  . THR A 1 56  ? 18.454  26.097  -14.654 1.00 25.13  ? 443  THR A CB  1 
ATOM   430  O OG1 . THR A 1 56  ? 17.253  25.376  -14.955 1.00 27.07  ? 443  THR A OG1 1 
ATOM   431  C CG2 . THR A 1 56  ? 19.592  25.097  -14.510 1.00 21.69  ? 443  THR A CG2 1 
ATOM   432  N N   . GLN A 1 57  ? 16.215  28.130  -12.836 1.00 37.49  ? 444  GLN A N   1 
ATOM   433  C CA  . GLN A 1 57  ? 15.230  29.209  -13.012 1.00 40.78  ? 444  GLN A CA  1 
ATOM   434  C C   . GLN A 1 57  ? 15.128  30.111  -11.775 1.00 41.20  ? 444  GLN A C   1 
ATOM   435  O O   . GLN A 1 57  ? 15.173  29.629  -10.645 1.00 40.78  ? 444  GLN A O   1 
ATOM   436  C CB  . GLN A 1 57  ? 13.857  28.619  -13.356 1.00 43.31  ? 444  GLN A CB  1 
ATOM   437  C CG  . GLN A 1 57  ? 13.806  27.982  -14.746 1.00 53.82  ? 444  GLN A CG  1 
ATOM   438  C CD  . GLN A 1 57  ? 12.493  27.273  -15.040 1.00 60.89  ? 444  GLN A CD  1 
ATOM   439  O OE1 . GLN A 1 57  ? 11.424  27.709  -14.610 1.00 68.43  ? 444  GLN A OE1 1 
ATOM   440  N NE2 . GLN A 1 57  ? 12.571  26.171  -15.782 1.00 55.98  ? 444  GLN A NE2 1 
ATOM   441  N N   . SER A 1 58  ? 14.985  31.418  -11.997 1.00 51.63  ? 445  SER A N   1 
ATOM   442  C CA  . SER A 1 58  ? 14.993  32.404  -10.908 1.00 55.15  ? 445  SER A CA  1 
ATOM   443  C C   . SER A 1 58  ? 13.595  32.789  -10.406 1.00 56.26  ? 445  SER A C   1 
ATOM   444  O O   . SER A 1 58  ? 12.719  33.145  -11.191 1.00 57.94  ? 445  SER A O   1 
ATOM   445  C CB  . SER A 1 58  ? 15.744  33.661  -11.353 1.00 56.82  ? 445  SER A CB  1 
ATOM   446  O OG  . SER A 1 58  ? 15.330  34.068  -12.644 1.00 60.51  ? 445  SER A OG  1 
ATOM   447  N N   . THR A 1 59  ? 13.406  32.702  -9.089  1.00 58.14  ? 446  THR A N   1 
ATOM   448  C CA  . THR A 1 59  ? 12.111  32.934  -8.436  1.00 69.86  ? 446  THR A CA  1 
ATOM   449  C C   . THR A 1 59  ? 11.903  34.319  -7.820  1.00 78.83  ? 446  THR A C   1 
ATOM   450  O O   . THR A 1 59  ? 10.885  34.542  -7.156  1.00 87.89  ? 446  THR A O   1 
ATOM   451  C CB  . THR A 1 59  ? 11.871  31.911  -7.315  1.00 69.85  ? 446  THR A CB  1 
ATOM   452  O OG1 . THR A 1 59  ? 13.016  31.866  -6.454  1.00 74.49  ? 446  THR A OG1 1 
ATOM   453  C CG2 . THR A 1 59  ? 11.620  30.538  -7.899  1.00 60.86  ? 446  THR A CG2 1 
ATOM   454  N N   . ASP A 1 60  ? 12.874  35.208  -8.028  1.00 72.15  ? 447  ASP A N   1 
ATOM   455  C CA  . ASP A 1 60  ? 12.989  36.532  -7.395  1.00 74.07  ? 447  ASP A CA  1 
ATOM   456  C C   . ASP A 1 60  ? 13.542  36.498  -5.970  1.00 72.53  ? 447  ASP A C   1 
ATOM   457  O O   . ASP A 1 60  ? 14.039  37.513  -5.480  1.00 77.60  ? 447  ASP A O   1 
ATOM   458  C CB  . ASP A 1 60  ? 11.630  37.249  -7.354  1.00 75.95  ? 447  ASP A CB  1 
ATOM   459  C CG  . ASP A 1 60  ? 11.468  38.271  -8.447  1.00 78.74  ? 447  ASP A CG  1 
ATOM   460  O OD1 . ASP A 1 60  ? 12.329  38.325  -9.348  1.00 80.26  ? 447  ASP A OD1 1 
ATOM   461  O OD2 . ASP A 1 60  ? 10.465  39.014  -8.404  1.00 80.95  ? 447  ASP A OD2 1 
ATOM   462  N N   . GLU A 1 61  ? 13.459  35.354  -5.299  1.00 65.39  ? 448  GLU A N   1 
ATOM   463  C CA  . GLU A 1 61  ? 14.172  35.178  -4.037  1.00 62.52  ? 448  GLU A CA  1 
ATOM   464  C C   . GLU A 1 61  ? 15.467  34.381  -4.213  1.00 57.96  ? 448  GLU A C   1 
ATOM   465  O O   . GLU A 1 61  ? 16.327  34.358  -3.333  1.00 55.98  ? 448  GLU A O   1 
ATOM   466  C CB  . GLU A 1 61  ? 13.261  34.493  -3.018  1.00 60.45  ? 448  GLU A CB  1 
ATOM   467  C CG  . GLU A 1 61  ? 11.878  35.119  -2.936  1.00 67.80  ? 448  GLU A CG  1 
ATOM   468  C CD  . GLU A 1 61  ? 10.974  34.429  -1.932  1.00 75.48  ? 448  GLU A CD  1 
ATOM   469  O OE1 . GLU A 1 61  ? 11.354  33.349  -1.428  1.00 75.95  ? 448  GLU A OE1 1 
ATOM   470  O OE2 . GLU A 1 61  ? 9.880   34.969  -1.650  1.00 76.16  ? 448  GLU A OE2 1 
ATOM   471  N N   . GLN A 1 62  ? 15.582  33.728  -5.364  1.00 55.85  ? 449  GLN A N   1 
ATOM   472  C CA  . GLN A 1 62  ? 16.658  32.780  -5.628  1.00 57.69  ? 449  GLN A CA  1 
ATOM   473  C C   . GLN A 1 62  ? 17.157  32.858  -7.069  1.00 61.00  ? 449  GLN A C   1 
ATOM   474  O O   . GLN A 1 62  ? 16.584  32.210  -7.946  1.00 67.76  ? 449  GLN A O   1 
ATOM   475  C CB  . GLN A 1 62  ? 16.208  31.354  -5.304  1.00 59.10  ? 449  GLN A CB  1 
ATOM   476  C CG  . GLN A 1 62  ? 17.319  30.326  -5.434  1.00 59.84  ? 449  GLN A CG  1 
ATOM   477  C CD  . GLN A 1 62  ? 18.598  30.768  -4.751  1.00 58.65  ? 449  GLN A CD  1 
ATOM   478  O OE1 . GLN A 1 62  ? 18.605  31.066  -3.557  1.00 61.80  ? 449  GLN A OE1 1 
ATOM   479  N NE2 . GLN A 1 62  ? 19.689  30.819  -5.509  1.00 55.04  ? 449  GLN A NE2 1 
ATOM   480  N N   . PRO A 1 63  ? 18.180  33.689  -7.332  1.00 59.81  ? 450  PRO A N   1 
ATOM   481  C CA  . PRO A 1 63  ? 18.749  33.763  -8.685  1.00 55.43  ? 450  PRO A CA  1 
ATOM   482  C C   . PRO A 1 63  ? 19.064  32.374  -9.250  1.00 53.76  ? 450  PRO A C   1 
ATOM   483  O O   . PRO A 1 63  ? 19.632  31.540  -8.542  1.00 53.86  ? 450  PRO A O   1 
ATOM   484  C CB  . PRO A 1 63  ? 20.035  34.571  -8.486  1.00 52.92  ? 450  PRO A CB  1 
ATOM   485  C CG  . PRO A 1 63  ? 19.805  35.356  -7.232  1.00 58.92  ? 450  PRO A CG  1 
ATOM   486  C CD  . PRO A 1 63  ? 18.945  34.489  -6.359  1.00 60.20  ? 450  PRO A CD  1 
ATOM   487  N N   . GLY A 1 64  ? 18.679  32.131  -10.500 1.00 51.10  ? 451  GLY A N   1 
ATOM   488  C CA  . GLY A 1 64  ? 18.910  30.847  -11.143 1.00 51.02  ? 451  GLY A CA  1 
ATOM   489  C C   . GLY A 1 64  ? 20.379  30.608  -11.434 1.00 54.70  ? 451  GLY A C   1 
ATOM   490  O O   . GLY A 1 64  ? 21.165  31.553  -11.513 1.00 56.58  ? 451  GLY A O   1 
ATOM   491  N N   . SER A 1 65  ? 20.754  29.343  -11.601 1.00 50.19  ? 452  SER A N   1 
ATOM   492  C CA  . SER A 1 65  ? 22.159  28.988  -11.752 1.00 39.23  ? 452  SER A CA  1 
ATOM   493  C C   . SER A 1 65  ? 22.383  28.024  -12.915 1.00 37.51  ? 452  SER A C   1 
ATOM   494  O O   . SER A 1 65  ? 21.457  27.342  -13.349 1.00 37.63  ? 452  SER A O   1 
ATOM   495  C CB  . SER A 1 65  ? 22.680  28.382  -10.453 1.00 42.15  ? 452  SER A CB  1 
ATOM   496  O OG  . SER A 1 65  ? 22.137  29.058  -9.333  1.00 48.71  ? 452  SER A OG  1 
ATOM   497  N N   . HIS A 1 66  ? 23.618  27.969  -13.406 1.00 37.58  ? 453  HIS A N   1 
ATOM   498  C CA  . HIS A 1 66  ? 23.936  27.237  -14.630 1.00 39.27  ? 453  HIS A CA  1 
ATOM   499  C C   . HIS A 1 66  ? 23.680  25.737  -14.499 1.00 39.31  ? 453  HIS A C   1 
ATOM   500  O O   . HIS A 1 66  ? 23.878  25.145  -13.436 1.00 36.63  ? 453  HIS A O   1 
ATOM   501  C CB  . HIS A 1 66  ? 25.391  27.481  -15.033 1.00 40.58  ? 453  HIS A CB  1 
ATOM   502  C CG  . HIS A 1 66  ? 25.691  27.125  -16.458 1.00 50.94  ? 453  HIS A CG  1 
ATOM   503  N ND1 . HIS A 1 66  ? 26.148  25.880  -16.837 1.00 43.72  ? 453  HIS A ND1 1 
ATOM   504  C CD2 . HIS A 1 66  ? 25.596  27.853  -17.597 1.00 53.29  ? 453  HIS A CD2 1 
ATOM   505  C CE1 . HIS A 1 66  ? 26.323  25.857  -18.147 1.00 46.01  ? 453  HIS A CE1 1 
ATOM   506  N NE2 . HIS A 1 66  ? 25.994  27.041  -18.631 1.00 53.88  ? 453  HIS A NE2 1 
ATOM   507  N N   . ILE A 1 67  ? 23.245  25.134  -15.599 1.00 30.10  ? 454  ILE A N   1 
ATOM   508  C CA  . ILE A 1 67  ? 22.840  23.735  -15.612 1.00 36.21  ? 454  ILE A CA  1 
ATOM   509  C C   . ILE A 1 67  ? 24.012  22.784  -15.320 1.00 32.74  ? 454  ILE A C   1 
ATOM   510  O O   . ILE A 1 67  ? 23.816  21.716  -14.741 1.00 30.38  ? 454  ILE A O   1 
ATOM   511  C CB  . ILE A 1 67  ? 22.176  23.373  -16.967 1.00 30.01  ? 454  ILE A CB  1 
ATOM   512  C CG1 . ILE A 1 67  ? 21.582  21.963  -16.925 1.00 33.95  ? 454  ILE A CG1 1 
ATOM   513  C CG2 . ILE A 1 67  ? 23.162  23.527  -18.127 1.00 28.47  ? 454  ILE A CG2 1 
ATOM   514  C CD1 . ILE A 1 67  ? 20.647  21.733  -15.773 1.00 29.61  ? 454  ILE A CD1 1 
ATOM   515  N N   . ASP A 1 68  ? 25.228  23.181  -15.683 1.00 30.83  ? 455  ASP A N   1 
ATOM   516  C CA  . ASP A 1 68  ? 26.393  22.331  -15.453 1.00 30.77  ? 455  ASP A CA  1 
ATOM   517  C C   . ASP A 1 68  ? 26.641  22.092  -13.962 1.00 30.83  ? 455  ASP A C   1 
ATOM   518  O O   . ASP A 1 68  ? 27.101  21.023  -13.571 1.00 32.41  ? 455  ASP A O   1 
ATOM   519  C CB  . ASP A 1 68  ? 27.638  22.934  -16.101 1.00 36.74  ? 455  ASP A CB  1 
ATOM   520  C CG  . ASP A 1 68  ? 27.588  22.884  -17.617 1.00 41.86  ? 455  ASP A CG  1 
ATOM   521  O OD1 . ASP A 1 68  ? 26.690  22.212  -18.163 1.00 39.67  ? 455  ASP A OD1 1 
ATOM   522  O OD2 . ASP A 1 68  ? 28.453  23.511  -18.265 1.00 50.28  ? 455  ASP A OD2 1 
ATOM   523  N N   . PHE A 1 69  ? 26.325  23.075  -13.128 1.00 29.31  ? 456  PHE A N   1 
ATOM   524  C CA  . PHE A 1 69  ? 26.471  22.892  -11.690 1.00 32.61  ? 456  PHE A CA  1 
ATOM   525  C C   . PHE A 1 69  ? 25.342  22.029  -11.134 1.00 26.23  ? 456  PHE A C   1 
ATOM   526  O O   . PHE A 1 69  ? 25.579  21.167  -10.291 1.00 31.08  ? 456  PHE A O   1 
ATOM   527  C CB  . PHE A 1 69  ? 26.530  24.239  -10.971 1.00 31.45  ? 456  PHE A CB  1 
ATOM   528  C CG  . PHE A 1 69  ? 27.844  24.942  -11.131 1.00 33.01  ? 456  PHE A CG  1 
ATOM   529  C CD1 . PHE A 1 69  ? 28.981  24.456  -10.507 1.00 32.63  ? 456  PHE A CD1 1 
ATOM   530  C CD2 . PHE A 1 69  ? 27.948  26.081  -11.912 1.00 35.89  ? 456  PHE A CD2 1 
ATOM   531  C CE1 . PHE A 1 69  ? 30.201  25.095  -10.657 1.00 32.62  ? 456  PHE A CE1 1 
ATOM   532  C CE2 . PHE A 1 69  ? 29.162  26.726  -12.064 1.00 38.69  ? 456  PHE A CE2 1 
ATOM   533  C CZ  . PHE A 1 69  ? 30.291  26.229  -11.436 1.00 35.65  ? 456  PHE A CZ  1 
ATOM   534  N N   . ALA A 1 70  ? 24.125  22.250  -11.623 1.00 18.53  ? 457  ALA A N   1 
ATOM   535  C CA  . ALA A 1 70  ? 22.976  21.429  -11.242 1.00 22.82  ? 457  ALA A CA  1 
ATOM   536  C C   . ALA A 1 70  ? 23.262  19.951  -11.459 1.00 26.05  ? 457  ALA A C   1 
ATOM   537  O O   . ALA A 1 70  ? 23.049  19.123  -10.572 1.00 14.62  ? 457  ALA A O   1 
ATOM   538  C CB  . ALA A 1 70  ? 21.749  21.834  -12.030 1.00 21.15  ? 457  ALA A CB  1 
ATOM   539  N N   . VAL A 1 71  ? 23.754  19.639  -12.652 1.00 19.60  ? 458  VAL A N   1 
ATOM   540  C CA  . VAL A 1 71  ? 24.045  18.270  -13.040 1.00 25.99  ? 458  VAL A CA  1 
ATOM   541  C C   . VAL A 1 71  ? 25.138  17.666  -12.162 1.00 29.02  ? 458  VAL A C   1 
ATOM   542  O O   . VAL A 1 71  ? 25.049  16.505  -11.759 1.00 29.63  ? 458  VAL A O   1 
ATOM   543  C CB  . VAL A 1 71  ? 24.453  18.203  -14.522 1.00 28.53  ? 458  VAL A CB  1 
ATOM   544  C CG1 . VAL A 1 71  ? 25.007  16.825  -14.874 1.00 24.25  ? 458  VAL A CG1 1 
ATOM   545  C CG2 . VAL A 1 71  ? 23.255  18.572  -15.408 1.00 23.38  ? 458  VAL A CG2 1 
ATOM   546  N N   . ASN A 1 72  ? 26.158  18.461  -11.854 1.00 30.59  ? 459  ASN A N   1 
ATOM   547  C CA  . ASN A 1 72  ? 27.210  18.010  -10.955 1.00 27.75  ? 459  ASN A CA  1 
ATOM   548  C C   . ASN A 1 72  ? 26.676  17.760  -9.545  1.00 30.76  ? 459  ASN A C   1 
ATOM   549  O O   . ASN A 1 72  ? 27.032  16.765  -8.915  1.00 25.43  ? 459  ASN A O   1 
ATOM   550  C CB  . ASN A 1 72  ? 28.351  19.016  -10.899 1.00 31.23  ? 459  ASN A CB  1 
ATOM   551  C CG  . ASN A 1 72  ? 29.277  18.764  -9.731  1.00 42.68  ? 459  ASN A CG  1 
ATOM   552  O OD1 . ASN A 1 72  ? 29.312  19.536  -8.771  1.00 48.11  ? 459  ASN A OD1 1 
ATOM   553  N ND2 . ASN A 1 72  ? 30.014  17.660  -9.791  1.00 40.25  ? 459  ASN A ND2 1 
ATOM   554  N N   . ARG A 1 73  ? 25.834  18.662  -9.048  1.00 15.44  ? 460  ARG A N   1 
ATOM   555  C CA  . ARG A 1 73  ? 25.153  18.426  -7.773  1.00 31.11  ? 460  ARG A CA  1 
ATOM   556  C C   . ARG A 1 73  ? 24.377  17.111  -7.837  1.00 22.61  ? 460  ARG A C   1 
ATOM   557  O O   . ARG A 1 73  ? 24.482  16.257  -6.956  1.00 19.48  ? 460  ARG A O   1 
ATOM   558  C CB  . ARG A 1 73  ? 24.189  19.571  -7.430  1.00 26.08  ? 460  ARG A CB  1 
ATOM   559  C CG  . ARG A 1 73  ? 24.827  20.951  -7.290  1.00 22.90  ? 460  ARG A CG  1 
ATOM   560  C CD  . ARG A 1 73  ? 25.792  21.020  -6.118  1.00 23.64  ? 460  ARG A CD  1 
ATOM   561  N NE  . ARG A 1 73  ? 26.257  22.384  -5.873  1.00 22.43  ? 460  ARG A NE  1 
ATOM   562  C CZ  . ARG A 1 73  ? 27.369  22.900  -6.389  1.00 31.45  ? 460  ARG A CZ  1 
ATOM   563  N NH1 . ARG A 1 73  ? 28.135  22.165  -7.186  1.00 32.03  ? 460  ARG A NH1 1 
ATOM   564  N NH2 . ARG A 1 73  ? 27.717  24.152  -6.111  1.00 28.17  ? 460  ARG A NH2 1 
ATOM   565  N N   . LEU A 1 74  ? 23.600  16.965  -8.904  1.00 17.71  ? 461  LEU A N   1 
ATOM   566  C CA  . LEU A 1 74  ? 22.714  15.830  -9.069  1.00 17.47  ? 461  LEU A CA  1 
ATOM   567  C C   . LEU A 1 74  ? 23.492  14.522  -9.114  1.00 21.93  ? 461  LEU A C   1 
ATOM   568  O O   . LEU A 1 74  ? 23.182  13.579  -8.385  1.00 30.98  ? 461  LEU A O   1 
ATOM   569  C CB  . LEU A 1 74  ? 21.877  15.993  -10.337 1.00 23.82  ? 461  LEU A CB  1 
ATOM   570  C CG  . LEU A 1 74  ? 20.906  14.840  -10.580 1.00 32.86  ? 461  LEU A CG  1 
ATOM   571  C CD1 . LEU A 1 74  ? 19.932  14.736  -9.418  1.00 25.14  ? 461  LEU A CD1 1 
ATOM   572  C CD2 . LEU A 1 74  ? 20.174  15.029  -11.896 1.00 42.52  ? 461  LEU A CD2 1 
ATOM   573  N N   . LYS A 1 75  ? 24.508  14.488  -9.970  1.00 15.10  ? 462  LYS A N   1 
ATOM   574  C CA  . LYS A 1 75  ? 25.390  13.335  -10.113 1.00 24.99  ? 462  LYS A CA  1 
ATOM   575  C C   . LYS A 1 75  ? 25.950  12.870  -8.773  1.00 24.39  ? 462  LYS A C   1 
ATOM   576  O O   . LYS A 1 75  ? 25.936  11.679  -8.461  1.00 24.56  ? 462  LYS A O   1 
ATOM   577  C CB  . LYS A 1 75  ? 26.538  13.667  -11.069 1.00 24.00  ? 462  LYS A CB  1 
ATOM   578  C CG  . LYS A 1 75  ? 27.382  12.461  -11.456 1.00 42.95  ? 462  LYS A CG  1 
ATOM   579  C CD  . LYS A 1 75  ? 27.608  12.405  -12.960 1.00 54.55  ? 462  LYS A CD  1 
ATOM   580  C CE  . LYS A 1 75  ? 28.261  11.091  -13.383 1.00 55.00  ? 462  LYS A CE  1 
ATOM   581  N NZ  . LYS A 1 75  ? 29.607  10.912  -12.775 1.00 56.01  ? 462  LYS A NZ  1 
ATOM   582  N N   . LEU A 1 76  ? 26.435  13.820  -7.983  1.00 22.45  ? 463  LEU A N   1 
ATOM   583  C CA  . LEU A 1 76  ? 26.991  13.517  -6.671  1.00 27.35  ? 463  LEU A CA  1 
ATOM   584  C C   . LEU A 1 76  ? 25.927  12.927  -5.741  1.00 21.34  ? 463  LEU A C   1 
ATOM   585  O O   . LEU A 1 76  ? 26.188  11.989  -4.997  1.00 17.54  ? 463  LEU A O   1 
ATOM   586  C CB  . LEU A 1 76  ? 27.600  14.775  -6.054  1.00 29.71  ? 463  LEU A CB  1 
ATOM   587  C CG  . LEU A 1 76  ? 28.992  14.628  -5.455  1.00 40.14  ? 463  LEU A CG  1 
ATOM   588  C CD1 . LEU A 1 76  ? 29.937  14.038  -6.482  1.00 44.68  ? 463  LEU A CD1 1 
ATOM   589  C CD2 . LEU A 1 76  ? 29.490  15.982  -4.976  1.00 43.99  ? 463  LEU A CD2 1 
ATOM   590  N N   . ALA A 1 77  ? 24.724  13.481  -5.788  1.00 20.06  ? 464  ALA A N   1 
ATOM   591  C CA  . ALA A 1 77  ? 23.649  12.993  -4.936  1.00 21.03  ? 464  ALA A CA  1 
ATOM   592  C C   . ALA A 1 77  ? 23.219  11.583  -5.353  1.00 17.91  ? 464  ALA A C   1 
ATOM   593  O O   . ALA A 1 77  ? 22.876  10.759  -4.508  1.00 21.69  ? 464  ALA A O   1 
ATOM   594  C CB  . ALA A 1 77  ? 22.459  13.956  -4.973  1.00 13.31  ? 464  ALA A CB  1 
ATOM   595  N N   . GLU A 1 78  ? 23.247  11.311  -6.653  1.00 16.85  ? 465  GLU A N   1 
ATOM   596  C CA  . GLU A 1 78  ? 22.888  9.990   -7.161  1.00 14.36  ? 465  GLU A CA  1 
ATOM   597  C C   . GLU A 1 78  ? 23.905  8.934   -6.730  1.00 15.03  ? 465  GLU A C   1 
ATOM   598  O O   . GLU A 1 78  ? 23.534  7.803   -6.411  1.00 20.41  ? 465  GLU A O   1 
ATOM   599  C CB  . GLU A 1 78  ? 22.761  10.011  -8.684  1.00 30.49  ? 465  GLU A CB  1 
ATOM   600  C CG  . GLU A 1 78  ? 21.538  10.759  -9.177  1.00 32.73  ? 465  GLU A CG  1 
ATOM   601  C CD  . GLU A 1 78  ? 21.370  10.704  -10.685 1.00 37.77  ? 465  GLU A CD  1 
ATOM   602  O OE1 . GLU A 1 78  ? 22.389  10.660  -11.412 1.00 33.59  ? 465  GLU A OE1 1 
ATOM   603  O OE2 . GLU A 1 78  ? 20.206  10.703  -11.141 1.00 50.89  ? 465  GLU A OE2 1 
ATOM   604  N N   . ILE A 1 79  ? 25.183  9.305   -6.715  1.00 26.27  ? 466  ILE A N   1 
ATOM   605  C CA  . ILE A 1 79  ? 26.213  8.395   -6.235  1.00 27.57  ? 466  ILE A CA  1 
ATOM   606  C C   . ILE A 1 79  ? 25.960  8.085   -4.763  1.00 27.10  ? 466  ILE A C   1 
ATOM   607  O O   . ILE A 1 79  ? 26.010  6.930   -4.352  1.00 30.31  ? 466  ILE A O   1 
ATOM   608  C CB  . ILE A 1 79  ? 27.630  8.964   -6.415  1.00 26.55  ? 466  ILE A CB  1 
ATOM   609  C CG1 . ILE A 1 79  ? 27.945  9.178   -7.897  1.00 25.89  ? 466  ILE A CG1 1 
ATOM   610  C CG2 . ILE A 1 79  ? 28.661  8.014   -5.826  1.00 26.81  ? 466  ILE A CG2 1 
ATOM   611  C CD1 . ILE A 1 79  ? 29.362  9.693   -8.157  1.00 26.37  ? 466  ILE A CD1 1 
ATOM   612  N N   . LEU A 1 80  ? 25.665  9.119   -3.978  1.00 22.53  ? 467  LEU A N   1 
ATOM   613  C CA  . LEU A 1 80  ? 25.349  8.942   -2.560  1.00 17.29  ? 467  LEU A CA  1 
ATOM   614  C C   . LEU A 1 80  ? 24.106  8.079   -2.349  1.00 19.87  ? 467  LEU A C   1 
ATOM   615  O O   . LEU A 1 80  ? 24.054  7.265   -1.428  1.00 18.32  ? 467  LEU A O   1 
ATOM   616  C CB  . LEU A 1 80  ? 25.140  10.295  -1.890  1.00 21.44  ? 467  LEU A CB  1 
ATOM   617  C CG  . LEU A 1 80  ? 26.245  10.905  -1.043  1.00 29.85  ? 467  LEU A CG  1 
ATOM   618  C CD1 . LEU A 1 80  ? 25.761  12.241  -0.523  1.00 28.58  ? 467  LEU A CD1 1 
ATOM   619  C CD2 . LEU A 1 80  ? 26.609  9.977   0.102   1.00 31.48  ? 467  LEU A CD2 1 
ATOM   620  N N   . TYR A 1 81  ? 23.101  8.278   -3.199  1.00 14.35  ? 468  TYR A N   1 
ATOM   621  C CA  . TYR A 1 81  ? 21.848  7.549   -3.079  1.00 14.00  ? 468  TYR A CA  1 
ATOM   622  C C   . TYR A 1 81  ? 22.052  6.036   -3.162  1.00 19.53  ? 468  TYR A C   1 
ATOM   623  O O   . TYR A 1 81  ? 21.630  5.311   -2.270  1.00 17.98  ? 468  TYR A O   1 
ATOM   624  C CB  . TYR A 1 81  ? 20.857  8.010   -4.153  1.00 16.03  ? 468  TYR A CB  1 
ATOM   625  C CG  . TYR A 1 81  ? 19.649  7.113   -4.282  1.00 20.70  ? 468  TYR A CG  1 
ATOM   626  C CD1 . TYR A 1 81  ? 18.527  7.301   -3.483  1.00 19.91  ? 468  TYR A CD1 1 
ATOM   627  C CD2 . TYR A 1 81  ? 19.631  6.074   -5.203  1.00 13.92  ? 468  TYR A CD2 1 
ATOM   628  C CE1 . TYR A 1 81  ? 17.420  6.473   -3.602  1.00 16.28  ? 468  TYR A CE1 1 
ATOM   629  C CE2 . TYR A 1 81  ? 18.539  5.244   -5.322  1.00 21.92  ? 468  TYR A CE2 1 
ATOM   630  C CZ  . TYR A 1 81  ? 17.437  5.445   -4.526  1.00 19.43  ? 468  TYR A CZ  1 
ATOM   631  O OH  . TYR A 1 81  ? 16.356  4.605   -4.659  1.00 20.22  ? 468  TYR A OH  1 
ATOM   632  N N   . TYR A 1 82  ? 22.690  5.567   -4.232  1.00 15.24  ? 469  TYR A N   1 
ATOM   633  C CA  . TYR A 1 82  ? 22.903  4.139   -4.423  1.00 22.59  ? 469  TYR A CA  1 
ATOM   634  C C   . TYR A 1 82  ? 23.835  3.549   -3.367  1.00 25.90  ? 469  TYR A C   1 
ATOM   635  O O   . TYR A 1 82  ? 23.720  2.378   -3.018  1.00 27.68  ? 469  TYR A O   1 
ATOM   636  C CB  . TYR A 1 82  ? 23.453  3.859   -5.822  1.00 22.64  ? 469  TYR A CB  1 
ATOM   637  C CG  . TYR A 1 82  ? 22.408  3.977   -6.902  1.00 16.29  ? 469  TYR A CG  1 
ATOM   638  C CD1 . TYR A 1 82  ? 21.361  3.066   -6.982  1.00 19.33  ? 469  TYR A CD1 1 
ATOM   639  C CD2 . TYR A 1 82  ? 22.467  4.994   -7.842  1.00 16.07  ? 469  TYR A CD2 1 
ATOM   640  C CE1 . TYR A 1 82  ? 20.399  3.170   -7.967  1.00 16.13  ? 469  TYR A CE1 1 
ATOM   641  C CE2 . TYR A 1 82  ? 21.510  5.107   -8.829  1.00 18.19  ? 469  TYR A CE2 1 
ATOM   642  C CZ  . TYR A 1 82  ? 20.480  4.192   -8.888  1.00 19.61  ? 469  TYR A CZ  1 
ATOM   643  O OH  . TYR A 1 82  ? 19.533  4.303   -9.878  1.00 28.52  ? 469  TYR A OH  1 
ATOM   644  N N   . LYS A 1 83  ? 24.750  4.363   -2.855  1.00 22.57  ? 470  LYS A N   1 
ATOM   645  C CA  . LYS A 1 83  ? 25.631  3.918   -1.783  1.00 22.56  ? 470  LYS A CA  1 
ATOM   646  C C   . LYS A 1 83  ? 24.844  3.665   -0.501  1.00 26.44  ? 470  LYS A C   1 
ATOM   647  O O   . LYS A 1 83  ? 24.970  2.611   0.118   1.00 26.65  ? 470  LYS A O   1 
ATOM   648  C CB  . LYS A 1 83  ? 26.732  4.947   -1.521  1.00 19.64  ? 470  LYS A CB  1 
ATOM   649  C CG  . LYS A 1 83  ? 27.798  4.463   -0.538  1.00 21.48  ? 470  LYS A CG  1 
ATOM   650  C CD  . LYS A 1 83  ? 28.760  5.597   -0.172  1.00 26.84  ? 470  LYS A CD  1 
ATOM   651  C CE  . LYS A 1 83  ? 30.020  5.069   0.517   1.00 32.85  ? 470  LYS A CE  1 
ATOM   652  N NZ  . LYS A 1 83  ? 29.725  4.499   1.861   1.00 25.15  1 470  LYS A NZ  1 
ATOM   653  N N   . ILE A 1 84  ? 24.031  4.640   -0.106  1.00 20.79  ? 471  ILE A N   1 
ATOM   654  C CA  . ILE A 1 84  ? 23.278  4.538   1.140   1.00 21.62  ? 471  ILE A CA  1 
ATOM   655  C C   . ILE A 1 84  ? 22.187  3.478   1.018   1.00 22.58  ? 471  ILE A C   1 
ATOM   656  O O   . ILE A 1 84  ? 21.954  2.711   1.951   1.00 17.84  ? 471  ILE A O   1 
ATOM   657  C CB  . ILE A 1 84  ? 22.655  5.897   1.534   1.00 19.01  ? 471  ILE A CB  1 
ATOM   658  C CG1 . ILE A 1 84  ? 23.760  6.926   1.795   1.00 21.42  ? 471  ILE A CG1 1 
ATOM   659  C CG2 . ILE A 1 84  ? 21.754  5.762   2.766   1.00 16.15  ? 471  ILE A CG2 1 
ATOM   660  C CD1 . ILE A 1 84  ? 23.251  8.335   2.003   1.00 17.85  ? 471  ILE A CD1 1 
ATOM   661  N N   . LEU A 1 85  ? 21.530  3.433   -0.139  1.00 21.03  ? 472  LEU A N   1 
ATOM   662  C CA  . LEU A 1 85  ? 20.507  2.427   -0.398  1.00 15.53  ? 472  LEU A CA  1 
ATOM   663  C C   . LEU A 1 85  ? 21.089  1.011   -0.287  1.00 17.68  ? 472  LEU A C   1 
ATOM   664  O O   . LEU A 1 85  ? 20.456  0.118   0.269   1.00 23.13  ? 472  LEU A O   1 
ATOM   665  C CB  . LEU A 1 85  ? 19.884  2.640   -1.778  1.00 16.62  ? 472  LEU A CB  1 
ATOM   666  C CG  . LEU A 1 85  ? 18.884  1.571   -2.229  1.00 26.13  ? 472  LEU A CG  1 
ATOM   667  C CD1 . LEU A 1 85  ? 17.702  1.494   -1.268  1.00 20.88  ? 472  LEU A CD1 1 
ATOM   668  C CD2 . LEU A 1 85  ? 18.413  1.812   -3.669  1.00 17.32  ? 472  LEU A CD2 1 
ATOM   669  N N   . GLU A 1 86  ? 22.297  0.809   -0.804  1.00 22.45  ? 473  GLU A N   1 
ATOM   670  C CA  . GLU A 1 86  ? 22.926  -0.502  -0.715  1.00 23.54  ? 473  GLU A CA  1 
ATOM   671  C C   . GLU A 1 86  ? 23.200  -0.856  0.742   1.00 24.45  ? 473  GLU A C   1 
ATOM   672  O O   . GLU A 1 86  ? 22.931  -1.972  1.171   1.00 23.63  ? 473  GLU A O   1 
ATOM   673  C CB  . GLU A 1 86  ? 24.220  -0.560  -1.524  1.00 27.89  ? 473  GLU A CB  1 
ATOM   674  C CG  . GLU A 1 86  ? 24.919  -1.926  -1.429  1.00 34.47  ? 473  GLU A CG  1 
ATOM   675  C CD  . GLU A 1 86  ? 26.173  -2.019  -2.278  1.00 38.49  ? 473  GLU A CD  1 
ATOM   676  O OE1 . GLU A 1 86  ? 26.360  -1.164  -3.167  1.00 44.02  ? 473  GLU A OE1 1 
ATOM   677  O OE2 . GLU A 1 86  ? 26.975  -2.952  -2.059  1.00 44.69  ? 473  GLU A OE2 1 
ATOM   678  N N   . THR A 1 87  ? 23.724  0.104   1.500   1.00 21.90  ? 474  THR A N   1 
ATOM   679  C CA  . THR A 1 87  ? 23.981  -0.097  2.922   1.00 23.48  ? 474  THR A CA  1 
ATOM   680  C C   . THR A 1 87  ? 22.693  -0.433  3.671   1.00 19.84  ? 474  THR A C   1 
ATOM   681  O O   . THR A 1 87  ? 22.662  -1.345  4.496   1.00 22.59  ? 474  THR A O   1 
ATOM   682  C CB  . THR A 1 87  ? 24.635  1.146   3.564   1.00 27.64  ? 474  THR A CB  1 
ATOM   683  O OG1 . THR A 1 87  ? 25.899  1.400   2.939   1.00 26.42  ? 474  THR A OG1 1 
ATOM   684  C CG2 . THR A 1 87  ? 24.846  0.927   5.061   1.00 25.29  ? 474  THR A CG2 1 
ATOM   685  N N   . VAL A 1 88  ? 21.627  0.300   3.371   1.00 24.10  ? 475  VAL A N   1 
ATOM   686  C CA  . VAL A 1 88  ? 20.343  0.053   4.013   1.00 23.70  ? 475  VAL A CA  1 
ATOM   687  C C   . VAL A 1 88  ? 19.811  -1.341  3.684   1.00 19.99  ? 475  VAL A C   1 
ATOM   688  O O   . VAL A 1 88  ? 19.364  -2.060  4.574   1.00 22.32  ? 475  VAL A O   1 
ATOM   689  C CB  . VAL A 1 88  ? 19.299  1.117   3.608   1.00 23.56  ? 475  VAL A CB  1 
ATOM   690  C CG1 . VAL A 1 88  ? 17.933  0.750   4.140   1.00 15.83  ? 475  VAL A CG1 1 
ATOM   691  C CG2 . VAL A 1 88  ? 19.720  2.481   4.125   1.00 18.82  ? 475  VAL A CG2 1 
ATOM   692  N N   . MET A 1 89  ? 19.877  -1.728  2.415   1.00 27.24  ? 476  MET A N   1 
ATOM   693  C CA  . MET A 1 89  ? 19.319  -3.008  1.982   1.00 32.52  ? 476  MET A CA  1 
ATOM   694  C C   . MET A 1 89  ? 20.085  -4.199  2.548   1.00 33.35  ? 476  MET A C   1 
ATOM   695  O O   . MET A 1 89  ? 19.485  -5.199  2.935   1.00 36.78  ? 476  MET A O   1 
ATOM   696  C CB  . MET A 1 89  ? 19.286  -3.089  0.455   1.00 37.93  ? 476  MET A CB  1 
ATOM   697  C CG  . MET A 1 89  ? 18.234  -2.199  -0.182  1.00 37.29  ? 476  MET A CG  1 
ATOM   698  S SD  . MET A 1 89  ? 16.589  -2.500  0.494   1.00 47.24  ? 476  MET A SD  1 
ATOM   699  C CE  . MET A 1 89  ? 16.338  -1.057  1.504   1.00 31.35  ? 476  MET A CE  1 
ATOM   700  N N   . VAL A 1 90  ? 21.407  -4.084  2.596   1.00 28.91  ? 477  VAL A N   1 
ATOM   701  C CA  . VAL A 1 90  ? 22.255  -5.152  3.105   1.00 31.96  ? 477  VAL A CA  1 
ATOM   702  C C   . VAL A 1 90  ? 21.983  -5.447  4.584   1.00 32.98  ? 477  VAL A C   1 
ATOM   703  O O   . VAL A 1 90  ? 21.892  -6.608  4.988   1.00 30.09  ? 477  VAL A O   1 
ATOM   704  C CB  . VAL A 1 90  ? 23.745  -4.807  2.906   1.00 34.87  ? 477  VAL A CB  1 
ATOM   705  C CG1 . VAL A 1 90  ? 24.634  -5.742  3.702   1.00 39.26  ? 477  VAL A CG1 1 
ATOM   706  C CG2 . VAL A 1 90  ? 24.099  -4.861  1.428   1.00 38.24  ? 477  VAL A CG2 1 
ATOM   707  N N   . GLN A 1 91  ? 21.827  -4.390  5.378   1.00 26.14  ? 478  GLN A N   1 
ATOM   708  C CA  . GLN A 1 91  ? 21.659  -4.520  6.822   1.00 30.36  ? 478  GLN A CA  1 
ATOM   709  C C   . GLN A 1 91  ? 20.212  -4.800  7.222   1.00 31.16  ? 478  GLN A C   1 
ATOM   710  O O   . GLN A 1 91  ? 19.912  -4.966  8.400   1.00 41.52  ? 478  GLN A O   1 
ATOM   711  C CB  . GLN A 1 91  ? 22.156  -3.250  7.518   1.00 30.36  ? 478  GLN A CB  1 
ATOM   712  C CG  . GLN A 1 91  ? 23.609  -2.929  7.216   1.00 44.68  ? 478  GLN A CG  1 
ATOM   713  C CD  . GLN A 1 91  ? 24.078  -1.630  7.844   1.00 54.33  ? 478  GLN A CD  1 
ATOM   714  O OE1 . GLN A 1 91  ? 23.270  -0.799  8.262   1.00 59.77  ? 478  GLN A OE1 1 
ATOM   715  N NE2 . GLN A 1 91  ? 25.394  -1.450  7.911   1.00 55.82  ? 478  GLN A NE2 1 
ATOM   716  N N   . GLU A 1 92  ? 19.319  -4.847  6.240   1.00 25.45  ? 479  GLU A N   1 
ATOM   717  C CA  . GLU A 1 92  ? 17.905  -5.076  6.508   1.00 34.21  ? 479  GLU A CA  1 
ATOM   718  C C   . GLU A 1 92  ? 17.647  -6.465  7.099   1.00 39.41  ? 479  GLU A C   1 
ATOM   719  O O   . GLU A 1 92  ? 18.296  -7.446  6.726   1.00 35.95  ? 479  GLU A O   1 
ATOM   720  C CB  . GLU A 1 92  ? 17.086  -4.890  5.230   1.00 38.84  ? 479  GLU A CB  1 
ATOM   721  C CG  . GLU A 1 92  ? 15.592  -4.821  5.471   1.00 45.20  ? 479  GLU A CG  1 
ATOM   722  C CD  . GLU A 1 92  ? 15.215  -3.718  6.445   1.00 50.32  ? 479  GLU A CD  1 
ATOM   723  O OE1 . GLU A 1 92  ? 15.277  -2.530  6.059   1.00 41.02  ? 479  GLU A OE1 1 
ATOM   724  O OE2 . GLU A 1 92  ? 14.863  -4.045  7.601   1.00 55.53  ? 479  GLU A OE2 1 
ATOM   725  N N   . THR A 1 93  ? 16.690  -6.532  8.021   1.00 35.42  ? 480  THR A N   1 
ATOM   726  C CA  . THR A 1 93  ? 16.342  -7.776  8.700   1.00 35.23  ? 480  THR A CA  1 
ATOM   727  C C   . THR A 1 93  ? 15.854  -8.849  7.729   1.00 31.08  ? 480  THR A C   1 
ATOM   728  O O   . THR A 1 93  ? 16.266  -10.009 7.813   1.00 35.54  ? 480  THR A O   1 
ATOM   729  C CB  . THR A 1 93  ? 15.263  -7.530  9.776   1.00 42.72  ? 480  THR A CB  1 
ATOM   730  O OG1 . THR A 1 93  ? 15.850  -6.837  10.882  1.00 49.69  ? 480  THR A OG1 1 
ATOM   731  C CG2 . THR A 1 93  ? 14.676  -8.846  10.272  1.00 45.73  ? 480  THR A CG2 1 
ATOM   732  N N   . ARG A 1 94  ? 14.985  -8.459  6.803   1.00 29.62  ? 481  ARG A N   1 
ATOM   733  C CA  . ARG A 1 94  ? 14.438  -9.407  5.841   1.00 34.76  ? 481  ARG A CA  1 
ATOM   734  C C   . ARG A 1 94  ? 15.533  -9.988  4.948   1.00 30.23  ? 481  ARG A C   1 
ATOM   735  O O   . ARG A 1 94  ? 15.480  -11.158 4.576   1.00 29.83  ? 481  ARG A O   1 
ATOM   736  C CB  . ARG A 1 94  ? 13.348  -8.748  4.990   1.00 38.90  ? 481  ARG A CB  1 
ATOM   737  C CG  . ARG A 1 94  ? 12.016  -8.575  5.716   1.00 42.07  ? 481  ARG A CG  1 
ATOM   738  C CD  . ARG A 1 94  ? 10.940  -7.989  4.800   1.00 52.45  ? 481  ARG A CD  1 
ATOM   739  N NE  . ARG A 1 94  ? 10.468  -8.950  3.804   1.00 52.71  ? 481  ARG A NE  1 
ATOM   740  C CZ  . ARG A 1 94  ? 9.360   -9.676  3.929   1.00 47.33  ? 481  ARG A CZ  1 
ATOM   741  N NH1 . ARG A 1 94  ? 8.600   -9.554  5.010   1.00 48.78  ? 481  ARG A NH1 1 
ATOM   742  N NH2 . ARG A 1 94  ? 9.011   -10.526 2.972   1.00 37.98  ? 481  ARG A NH2 1 
ATOM   743  N N   . ARG A 1 95  ? 16.524  -9.168  4.616   1.00 29.64  ? 482  ARG A N   1 
ATOM   744  C CA  . ARG A 1 95  ? 17.647  -9.608  3.792   1.00 31.24  ? 482  ARG A CA  1 
ATOM   745  C C   . ARG A 1 95  ? 18.446  -10.678 4.531   1.00 27.35  ? 482  ARG A C   1 
ATOM   746  O O   . ARG A 1 95  ? 18.804  -11.709 3.959   1.00 30.42  ? 482  ARG A O   1 
ATOM   747  C CB  . ARG A 1 95  ? 18.543  -8.416  3.420   1.00 30.27  ? 482  ARG A CB  1 
ATOM   748  C CG  . ARG A 1 95  ? 19.342  -8.576  2.121   1.00 25.29  ? 482  ARG A CG  1 
ATOM   749  C CD  . ARG A 1 95  ? 20.517  -9.525  2.255   1.00 28.50  ? 482  ARG A CD  1 
ATOM   750  N NE  . ARG A 1 95  ? 21.479  -9.083  3.259   1.00 31.88  ? 482  ARG A NE  1 
ATOM   751  C CZ  . ARG A 1 95  ? 22.436  -9.855  3.764   1.00 33.01  ? 482  ARG A CZ  1 
ATOM   752  N NH1 . ARG A 1 95  ? 22.556  -11.112 3.361   1.00 34.44  ? 482  ARG A NH1 1 
ATOM   753  N NH2 . ARG A 1 95  ? 23.271  -9.375  4.676   1.00 30.45  ? 482  ARG A NH2 1 
ATOM   754  N N   . LEU A 1 96  ? 18.710  -10.430 5.809   1.00 31.14  ? 483  LEU A N   1 
ATOM   755  C CA  . LEU A 1 96  ? 19.489  -11.351 6.632   1.00 30.29  ? 483  LEU A CA  1 
ATOM   756  C C   . LEU A 1 96  ? 18.756  -12.664 6.876   1.00 33.53  ? 483  LEU A C   1 
ATOM   757  O O   . LEU A 1 96  ? 19.387  -13.700 7.082   1.00 29.25  ? 483  LEU A O   1 
ATOM   758  C CB  . LEU A 1 96  ? 19.849  -10.689 7.963   1.00 35.99  ? 483  LEU A CB  1 
ATOM   759  C CG  . LEU A 1 96  ? 20.871  -9.558  7.828   1.00 39.62  ? 483  LEU A CG  1 
ATOM   760  C CD1 . LEU A 1 96  ? 20.789  -8.593  8.997   1.00 41.71  ? 483  LEU A CD1 1 
ATOM   761  C CD2 . LEU A 1 96  ? 22.275  -10.146 7.717   1.00 37.82  ? 483  LEU A CD2 1 
ATOM   762  N N   . HIS A 1 97  ? 17.426  -12.622 6.852   1.00 32.72  ? 484  HIS A N   1 
ATOM   763  C CA  . HIS A 1 97  ? 16.624  -13.834 7.013   1.00 34.18  ? 484  HIS A CA  1 
ATOM   764  C C   . HIS A 1 97  ? 16.254  -14.448 5.666   1.00 28.57  ? 484  HIS A C   1 
ATOM   765  O O   . HIS A 1 97  ? 15.543  -15.443 5.613   1.00 29.49  ? 484  HIS A O   1 
ATOM   766  C CB  . HIS A 1 97  ? 15.352  -13.543 7.815   1.00 35.52  ? 484  HIS A CB  1 
ATOM   767  C CG  . HIS A 1 97  ? 15.573  -13.459 9.292   1.00 36.69  ? 484  HIS A CG  1 
ATOM   768  N ND1 . HIS A 1 97  ? 15.641  -12.260 9.969   1.00 41.88  ? 484  HIS A ND1 1 
ATOM   769  C CD2 . HIS A 1 97  ? 15.743  -14.426 10.224  1.00 37.04  ? 484  HIS A CD2 1 
ATOM   770  C CE1 . HIS A 1 97  ? 15.842  -12.492 11.253  1.00 43.72  ? 484  HIS A CE1 1 
ATOM   771  N NE2 . HIS A 1 97  ? 15.906  -13.799 11.435  1.00 42.71  ? 484  HIS A NE2 1 
ATOM   772  N N   . GLY A 1 98  ? 16.725  -13.841 4.582   1.00 28.25  ? 485  GLY A N   1 
ATOM   773  C CA  . GLY A 1 98  ? 16.500  -14.373 3.247   1.00 31.69  ? 485  GLY A CA  1 
ATOM   774  C C   . GLY A 1 98  ? 15.067  -14.232 2.770   1.00 34.42  ? 485  GLY A C   1 
ATOM   775  O O   . GLY A 1 98  ? 14.562  -15.068 2.020   1.00 37.52  ? 485  GLY A O   1 
ATOM   776  N N   . MET A 1 99  ? 14.405  -13.168 3.206   1.00 30.96  ? 486  MET A N   1 
ATOM   777  C CA  . MET A 1 99  ? 13.012  -12.946 2.840   1.00 32.14  ? 486  MET A CA  1 
ATOM   778  C C   . MET A 1 99  ? 12.869  -11.888 1.760   1.00 28.38  ? 486  MET A C   1 
ATOM   779  O O   . MET A 1 99  ? 13.644  -10.935 1.698   1.00 29.02  ? 486  MET A O   1 
ATOM   780  C CB  . MET A 1 99  ? 12.196  -12.565 4.070   1.00 25.18  ? 486  MET A CB  1 
ATOM   781  C CG  . MET A 1 99  ? 12.083  -13.702 5.066   1.00 26.52  ? 486  MET A CG  1 
ATOM   782  S SD  . MET A 1 99  ? 11.386  -13.163 6.626   1.00 52.94  ? 486  MET A SD  1 
ATOM   783  C CE  . MET A 1 99  ? 9.795   -12.553 6.070   1.00 59.95  ? 486  MET A CE  1 
ATOM   784  N N   . ASP A 1 100 ? 11.874  -12.082 0.902   1.00 33.55  ? 487  ASP A N   1 
ATOM   785  C CA  . ASP A 1 100 ? 11.635  -11.204 -0.235  1.00 33.49  ? 487  ASP A CA  1 
ATOM   786  C C   . ASP A 1 100 ? 11.399  -9.765  0.214   1.00 29.62  ? 487  ASP A C   1 
ATOM   787  O O   . ASP A 1 100 ? 10.574  -9.497  1.085   1.00 31.59  ? 487  ASP A O   1 
ATOM   788  C CB  . ASP A 1 100 ? 10.446  -11.715 -1.046  1.00 33.01  ? 487  ASP A CB  1 
ATOM   789  C CG  . ASP A 1 100 ? 10.315  -11.024 -2.381  1.00 36.79  ? 487  ASP A CG  1 
ATOM   790  O OD1 . ASP A 1 100 ? 11.041  -11.399 -3.326  1.00 35.83  ? 487  ASP A OD1 1 
ATOM   791  O OD2 . ASP A 1 100 ? 9.478   -10.107 -2.483  1.00 39.13  ? 487  ASP A OD2 1 
ATOM   792  N N   . MET A 1 101 ? 12.170  -8.854  -0.361  1.00 26.66  ? 488  MET A N   1 
ATOM   793  C CA  . MET A 1 101 ? 12.128  -7.442  0.003   1.00 29.54  ? 488  MET A CA  1 
ATOM   794  C C   . MET A 1 101 ? 11.291  -6.556  -0.923  1.00 27.76  ? 488  MET A C   1 
ATOM   795  O O   . MET A 1 101 ? 11.395  -5.329  -0.852  1.00 25.23  ? 488  MET A O   1 
ATOM   796  C CB  . MET A 1 101 ? 13.546  -6.898  0.123   1.00 31.25  ? 488  MET A CB  1 
ATOM   797  C CG  . MET A 1 101 ? 14.086  -7.060  1.543   1.00 43.20  ? 488  MET A CG  1 
ATOM   798  S SD  . MET A 1 101 ? 15.793  -6.546  1.740   1.00 45.91  ? 488  MET A SD  1 
ATOM   799  C CE  . MET A 1 101 ? 16.508  -7.480  0.395   1.00 22.89  ? 488  MET A CE  1 
ATOM   800  N N   . SER A 1 102 ? 10.532  -7.172  -1.829  1.00 27.95  ? 489  SER A N   1 
ATOM   801  C CA  . SER A 1 102 ? 9.751   -6.436  -2.827  1.00 29.50  ? 489  SER A CA  1 
ATOM   802  C C   . SER A 1 102 ? 8.938   -5.289  -2.233  1.00 29.24  ? 489  SER A C   1 
ATOM   803  O O   . SER A 1 102 ? 9.017   -4.159  -2.711  1.00 28.60  ? 489  SER A O   1 
ATOM   804  C CB  . SER A 1 102 ? 8.800   -7.378  -3.571  1.00 31.38  ? 489  SER A CB  1 
ATOM   805  O OG  . SER A 1 102 ? 9.509   -8.347  -4.323  1.00 27.43  ? 489  SER A OG  1 
ATOM   806  N N   . VAL A 1 103 ? 8.173   -5.578  -1.186  1.00 31.76  ? 490  VAL A N   1 
ATOM   807  C CA  . VAL A 1 103 ? 7.308   -4.574  -0.579  1.00 34.95  ? 490  VAL A CA  1 
ATOM   808  C C   . VAL A 1 103 ? 8.141   -3.455  0.048   1.00 37.74  ? 490  VAL A C   1 
ATOM   809  O O   . VAL A 1 103 ? 7.770   -2.278  -0.005  1.00 31.79  ? 490  VAL A O   1 
ATOM   810  C CB  . VAL A 1 103 ? 6.373   -5.199  0.478   1.00 25.96  ? 490  VAL A CB  1 
ATOM   811  C CG1 . VAL A 1 103 ? 5.505   -4.128  1.122   1.00 31.29  ? 490  VAL A CG1 1 
ATOM   812  C CG2 . VAL A 1 103 ? 5.495   -6.269  -0.164  1.00 18.61  ? 490  VAL A CG2 1 
ATOM   813  N N   . LEU A 1 104 ? 9.279   -3.828  0.623   1.00 32.34  ? 491  LEU A N   1 
ATOM   814  C CA  . LEU A 1 104 ? 10.186  -2.852  1.211   1.00 27.94  ? 491  LEU A CA  1 
ATOM   815  C C   . LEU A 1 104 ? 10.703  -1.888  0.145   1.00 22.53  ? 491  LEU A C   1 
ATOM   816  O O   . LEU A 1 104 ? 10.648  -0.667  0.307   1.00 18.89  ? 491  LEU A O   1 
ATOM   817  C CB  . LEU A 1 104 ? 11.356  -3.554  1.892   1.00 25.95  ? 491  LEU A CB  1 
ATOM   818  C CG  . LEU A 1 104 ? 12.050  -2.758  2.992   1.00 38.02  ? 491  LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 104 ? 11.318  -2.944  4.317   1.00 45.28  ? 491  LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 104 ? 13.501  -3.172  3.106   1.00 37.54  ? 491  LEU A CD2 1 
ATOM   821  N N   . LEU A 1 105 ? 11.174  -2.452  -0.961  1.00 24.80  ? 492  LEU A N   1 
ATOM   822  C CA  . LEU A 1 105 ? 11.850  -1.676  -1.993  1.00 25.81  ? 492  LEU A CA  1 
ATOM   823  C C   . LEU A 1 105 ? 10.912  -0.914  -2.927  1.00 26.17  ? 492  LEU A C   1 
ATOM   824  O O   . LEU A 1 105 ? 11.365  -0.087  -3.710  1.00 24.21  ? 492  LEU A O   1 
ATOM   825  C CB  . LEU A 1 105 ? 12.747  -2.595  -2.815  1.00 26.90  ? 492  LEU A CB  1 
ATOM   826  C CG  . LEU A 1 105 ? 14.153  -2.781  -2.245  1.00 34.52  ? 492  LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 105 ? 14.813  -4.028  -2.826  1.00 23.92  ? 492  LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 105 ? 14.993  -1.537  -2.529  1.00 29.66  ? 492  LEU A CD2 1 
ATOM   829  N N   . GLU A 1 106 ? 9.618   -1.203  -2.859  1.00 22.85  ? 493  GLU A N   1 
ATOM   830  C CA  . GLU A 1 106 ? 8.650   -0.578  -3.753  1.00 22.61  ? 493  GLU A CA  1 
ATOM   831  C C   . GLU A 1 106 ? 7.942   0.638   -3.145  1.00 30.14  ? 493  GLU A C   1 
ATOM   832  O O   . GLU A 1 106 ? 6.984   1.146   -3.732  1.00 33.09  ? 493  GLU A O   1 
ATOM   833  C CB  . GLU A 1 106 ? 7.618   -1.606  -4.234  1.00 23.69  ? 493  GLU A CB  1 
ATOM   834  C CG  . GLU A 1 106 ? 6.658   -2.117  -3.178  1.00 35.03  ? 493  GLU A CG  1 
ATOM   835  C CD  . GLU A 1 106 ? 5.809   -3.282  -3.678  1.00 40.90  ? 493  GLU A CD  1 
ATOM   836  O OE1 . GLU A 1 106 ? 6.056   -3.777  -4.801  1.00 32.00  ? 493  GLU A OE1 1 
ATOM   837  O OE2 . GLU A 1 106 ? 4.895   -3.706  -2.941  1.00 48.92  ? 493  GLU A OE2 1 
ATOM   838  N N   . GLN A 1 107 ? 8.382   1.104   -1.975  1.00 26.89  ? 494  GLN A N   1 
ATOM   839  C CA  . GLN A 1 107 ? 7.735   2.275   -1.385  1.00 27.96  ? 494  GLN A CA  1 
ATOM   840  C C   . GLN A 1 107 ? 8.382   3.545   -1.934  1.00 20.04  ? 494  GLN A C   1 
ATOM   841  O O   . GLN A 1 107 ? 9.516   3.880   -1.599  1.00 16.78  ? 494  GLN A O   1 
ATOM   842  C CB  . GLN A 1 107 ? 7.837   2.257   0.147   1.00 28.07  ? 494  GLN A CB  1 
ATOM   843  C CG  . GLN A 1 107 ? 7.317   0.988   0.820   1.00 34.61  ? 494  GLN A CG  1 
ATOM   844  C CD  . GLN A 1 107 ? 5.865   0.675   0.478   1.00 41.95  ? 494  GLN A CD  1 
ATOM   845  O OE1 . GLN A 1 107 ? 5.015   1.567   0.424   1.00 43.33  ? 494  GLN A OE1 1 
ATOM   846  N NE2 . GLN A 1 107 ? 5.578   -0.601  0.244   1.00 37.34  ? 494  GLN A NE2 1 
ATOM   847  N N   . ASP A 1 108 ? 7.625   4.272   -2.746  1.00 21.14  ? 495  ASP A N   1 
ATOM   848  C CA  . ASP A 1 108 ? 8.154   5.434   -3.458  1.00 25.70  ? 495  ASP A CA  1 
ATOM   849  C C   . ASP A 1 108 ? 8.635   6.529   -2.519  1.00 21.18  ? 495  ASP A C   1 
ATOM   850  O O   . ASP A 1 108 ? 9.613   7.219   -2.812  1.00 16.87  ? 495  ASP A O   1 
ATOM   851  C CB  . ASP A 1 108 ? 7.098   6.009   -4.399  1.00 25.19  ? 495  ASP A CB  1 
ATOM   852  C CG  . ASP A 1 108 ? 6.754   5.070   -5.528  1.00 34.09  ? 495  ASP A CG  1 
ATOM   853  O OD1 . ASP A 1 108 ? 7.561   4.160   -5.810  1.00 48.39  ? 495  ASP A OD1 1 
ATOM   854  O OD2 . ASP A 1 108 ? 5.681   5.248   -6.141  1.00 37.92  ? 495  ASP A OD2 1 
ATOM   855  N N   . ILE A 1 109 ? 7.952   6.681   -1.389  1.00 14.87  ? 496  ILE A N   1 
ATOM   856  C CA  . ILE A 1 109 ? 8.245   7.786   -0.496  1.00 16.85  ? 496  ILE A CA  1 
ATOM   857  C C   . ILE A 1 109 ? 9.636   7.614   0.100   1.00 16.14  ? 496  ILE A C   1 
ATOM   858  O O   . ILE A 1 109 ? 10.323  8.603   0.342   1.00 22.98  ? 496  ILE A O   1 
ATOM   859  C CB  . ILE A 1 109 ? 7.179   7.934   0.629   1.00 23.43  ? 496  ILE A CB  1 
ATOM   860  C CG1 . ILE A 1 109 ? 7.360   9.264   1.364   1.00 22.64  ? 496  ILE A CG1 1 
ATOM   861  C CG2 . ILE A 1 109 ? 7.216   6.755   1.603   1.00 21.86  ? 496  ILE A CG2 1 
ATOM   862  C CD1 . ILE A 1 109 ? 7.077   10.497  0.499   1.00 17.33  ? 496  ILE A CD1 1 
ATOM   863  N N   . PHE A 1 110 ? 10.076  6.370   0.295   1.00 19.61  ? 497  PHE A N   1 
ATOM   864  C CA  . PHE A 1 110 ? 11.408  6.142   0.857   1.00 14.59  ? 497  PHE A CA  1 
ATOM   865  C C   . PHE A 1 110 ? 12.485  6.592   -0.120  1.00 20.32  ? 497  PHE A C   1 
ATOM   866  O O   . PHE A 1 110 ? 13.397  7.338   0.243   1.00 26.47  ? 497  PHE A O   1 
ATOM   867  C CB  . PHE A 1 110 ? 11.635  4.669   1.231   1.00 17.41  ? 497  PHE A CB  1 
ATOM   868  C CG  . PHE A 1 110 ? 13.051  4.383   1.676   1.00 20.24  ? 497  PHE A CG  1 
ATOM   869  C CD1 . PHE A 1 110 ? 13.986  3.873   0.790   1.00 16.04  ? 497  PHE A CD1 1 
ATOM   870  C CD2 . PHE A 1 110 ? 13.456  4.677   2.968   1.00 21.50  ? 497  PHE A CD2 1 
ATOM   871  C CE1 . PHE A 1 110 ? 15.296  3.638   1.193   1.00 23.21  ? 497  PHE A CE1 1 
ATOM   872  C CE2 . PHE A 1 110 ? 14.759  4.444   3.377   1.00 21.52  ? 497  PHE A CE2 1 
ATOM   873  C CZ  . PHE A 1 110 ? 15.683  3.926   2.487   1.00 14.88  ? 497  PHE A CZ  1 
ATOM   874  N N   . HIS A 1 111 ? 12.382  6.130   -1.363  1.00 22.16  ? 498  HIS A N   1 
ATOM   875  C CA  . HIS A 1 111 ? 13.374  6.467   -2.379  1.00 18.91  ? 498  HIS A CA  1 
ATOM   876  C C   . HIS A 1 111 ? 13.411  7.963   -2.671  1.00 19.03  ? 498  HIS A C   1 
ATOM   877  O O   . HIS A 1 111 ? 14.492  8.547   -2.795  1.00 18.87  ? 498  HIS A O   1 
ATOM   878  C CB  . HIS A 1 111 ? 13.104  5.683   -3.662  1.00 14.50  ? 498  HIS A CB  1 
ATOM   879  C CG  . HIS A 1 111 ? 13.208  4.199   -3.488  1.00 19.33  ? 498  HIS A CG  1 
ATOM   880  N ND1 . HIS A 1 111 ? 14.406  3.560   -3.247  1.00 18.07  ? 498  HIS A ND1 1 
ATOM   881  C CD2 . HIS A 1 111 ? 12.263  3.226   -3.511  1.00 21.01  ? 498  HIS A CD2 1 
ATOM   882  C CE1 . HIS A 1 111 ? 14.196  2.259   -3.130  1.00 19.96  ? 498  HIS A CE1 1 
ATOM   883  N NE2 . HIS A 1 111 ? 12.904  2.031   -3.289  1.00 24.47  ? 498  HIS A NE2 1 
ATOM   884  N N   . ARG A 1 112 ? 12.238  8.581   -2.783  1.00 19.96  ? 499  ARG A N   1 
ATOM   885  C CA  . ARG A 1 112 ? 12.170  10.021  -3.028  1.00 16.79  ? 499  ARG A CA  1 
ATOM   886  C C   . ARG A 1 112 ? 12.812  10.777  -1.880  1.00 10.75  ? 499  ARG A C   1 
ATOM   887  O O   . ARG A 1 112 ? 13.581  11.711  -2.102  1.00 15.05  ? 499  ARG A O   1 
ATOM   888  C CB  . ARG A 1 112 ? 10.722  10.492  -3.212  1.00 13.33  ? 499  ARG A CB  1 
ATOM   889  C CG  . ARG A 1 112 ? 10.006  9.895   -4.424  1.00 10.73  ? 499  ARG A CG  1 
ATOM   890  C CD  . ARG A 1 112 ? 8.513   10.226  -4.382  1.00 15.74  ? 499  ARG A CD  1 
ATOM   891  N NE  . ARG A 1 112 ? 8.272   11.659  -4.519  1.00 15.68  ? 499  ARG A NE  1 
ATOM   892  C CZ  . ARG A 1 112 ? 7.347   12.335  -3.846  1.00 21.60  ? 499  ARG A CZ  1 
ATOM   893  N NH1 . ARG A 1 112 ? 6.570   11.710  -2.970  1.00 23.91  1 499  ARG A NH1 1 
ATOM   894  N NH2 . ARG A 1 112 ? 7.207   13.640  -4.042  1.00 23.23  ? 499  ARG A NH2 1 
ATOM   895  N N   . SER A 1 113 ? 12.487  10.373  -0.654  1.00 13.35  ? 500  SER A N   1 
ATOM   896  C CA  . SER A 1 113 ? 13.021  11.039  0.524   1.00 10.22  ? 500  SER A CA  1 
ATOM   897  C C   . SER A 1 113 ? 14.528  10.874  0.606   1.00 13.72  ? 500  SER A C   1 
ATOM   898  O O   . SER A 1 113 ? 15.233  11.810  0.989   1.00 15.75  ? 500  SER A O   1 
ATOM   899  C CB  . SER A 1 113 ? 12.361  10.504  1.802   1.00 13.87  ? 500  SER A CB  1 
ATOM   900  O OG  . SER A 1 113 ? 10.996  10.888  1.867   1.00 13.51  ? 500  SER A OG  1 
ATOM   901  N N   . LEU A 1 114 ? 15.018  9.687   0.248   1.00 13.39  ? 501  LEU A N   1 
ATOM   902  C CA  . LEU A 1 114 ? 16.455  9.399   0.318   1.00 15.48  ? 501  LEU A CA  1 
ATOM   903  C C   . LEU A 1 114 ? 17.218  10.227  -0.703  1.00 12.49  ? 501  LEU A C   1 
ATOM   904  O O   . LEU A 1 114 ? 18.260  10.801  -0.395  1.00 15.29  ? 501  LEU A O   1 
ATOM   905  C CB  . LEU A 1 114 ? 16.733  7.908   0.095   1.00 11.89  ? 501  LEU A CB  1 
ATOM   906  C CG  . LEU A 1 114 ? 18.207  7.484   0.169   1.00 22.49  ? 501  LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 114 ? 18.816  7.851   1.521   1.00 15.12  ? 501  LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 114 ? 18.379  5.985   -0.106  1.00 16.35  ? 501  LEU A CD2 1 
ATOM   909  N N   . MET A 1 115 ? 16.685  10.291  -1.918  1.00 11.28  ? 502  MET A N   1 
ATOM   910  C CA  . MET A 1 115 ? 17.291  11.097  -2.967  1.00 22.56  ? 502  MET A CA  1 
ATOM   911  C C   . MET A 1 115 ? 17.275  12.590  -2.606  1.00 18.19  ? 502  MET A C   1 
ATOM   912  O O   . MET A 1 115 ? 18.237  13.307  -2.880  1.00 21.44  ? 502  MET A O   1 
ATOM   913  C CB  . MET A 1 115 ? 16.578  10.860  -4.300  1.00 27.04  ? 502  MET A CB  1 
ATOM   914  C CG  . MET A 1 115 ? 17.207  11.598  -5.465  1.00 30.64  ? 502  MET A CG  1 
ATOM   915  S SD  . MET A 1 115 ? 18.956  11.203  -5.645  1.00 32.53  ? 502  MET A SD  1 
ATOM   916  C CE  . MET A 1 115 ? 19.507  12.629  -6.572  1.00 27.15  ? 502  MET A CE  1 
ATOM   917  N N   . ALA A 1 116 ? 16.193  13.053  -1.986  1.00 19.99  ? 503  ALA A N   1 
ATOM   918  C CA  . ALA A 1 116 ? 16.115  14.448  -1.552  1.00 25.28  ? 503  ALA A CA  1 
ATOM   919  C C   . ALA A 1 116 ? 17.108  14.729  -0.441  1.00 19.14  ? 503  ALA A C   1 
ATOM   920  O O   . ALA A 1 116 ? 17.751  15.781  -0.427  1.00 14.25  ? 503  ALA A O   1 
ATOM   921  C CB  . ALA A 1 116 ? 14.723  14.800  -1.087  1.00 10.11  ? 503  ALA A CB  1 
ATOM   922  N N   . CYS A 1 117 ? 17.212  13.797  0.502   1.00 18.06  ? 504  CYS A N   1 
ATOM   923  C CA  . CYS A 1 117 ? 18.168  13.956  1.585   1.00 22.30  ? 504  CYS A CA  1 
ATOM   924  C C   . CYS A 1 117 ? 19.589  13.967  1.033   1.00 18.31  ? 504  CYS A C   1 
ATOM   925  O O   . CYS A 1 117 ? 20.437  14.711  1.513   1.00 23.65  ? 504  CYS A O   1 
ATOM   926  C CB  . CYS A 1 117 ? 18.013  12.855  2.636   1.00 20.77  ? 504  CYS A CB  1 
ATOM   927  S SG  . CYS A 1 117 ? 18.748  13.304  4.234   1.00 28.47  ? 504  CYS A SG  1 
ATOM   928  N N   . CYS A 1 118 ? 19.843  13.153  0.014   1.00 19.36  ? 505  CYS A N   1 
ATOM   929  C CA  . CYS A 1 118 ? 21.162  13.146  -0.614  1.00 24.64  ? 505  CYS A CA  1 
ATOM   930  C C   . CYS A 1 118 ? 21.429  14.488  -1.284  1.00 22.65  ? 505  CYS A C   1 
ATOM   931  O O   . CYS A 1 118 ? 22.533  15.026  -1.187  1.00 21.91  ? 505  CYS A O   1 
ATOM   932  C CB  . CYS A 1 118 ? 21.288  12.006  -1.626  1.00 30.33  ? 505  CYS A CB  1 
ATOM   933  S SG  . CYS A 1 118 ? 21.396  10.351  -0.872  1.00 27.48  ? 505  CYS A SG  1 
ATOM   934  N N   . LEU A 1 119 ? 20.412  15.037  -1.944  1.00 20.95  ? 506  LEU A N   1 
ATOM   935  C CA  . LEU A 1 119 ? 20.552  16.341  -2.587  1.00 24.35  ? 506  LEU A CA  1 
ATOM   936  C C   . LEU A 1 119 ? 20.813  17.419  -1.544  1.00 22.18  ? 506  LEU A C   1 
ATOM   937  O O   . LEU A 1 119 ? 21.632  18.313  -1.752  1.00 18.06  ? 506  LEU A O   1 
ATOM   938  C CB  . LEU A 1 119 ? 19.307  16.683  -3.405  1.00 23.22  ? 506  LEU A CB  1 
ATOM   939  C CG  . LEU A 1 119 ? 19.255  16.042  -4.795  1.00 23.80  ? 506  LEU A CG  1 
ATOM   940  C CD1 . LEU A 1 119 ? 17.857  16.130  -5.392  1.00 11.32  ? 506  LEU A CD1 1 
ATOM   941  C CD2 . LEU A 1 119 ? 20.286  16.680  -5.719  1.00 17.41  ? 506  LEU A CD2 1 
ATOM   942  N N   . GLU A 1 120 ? 20.125  17.308  -0.412  1.00 22.02  ? 507  GLU A N   1 
ATOM   943  C CA  . GLU A 1 120 ? 20.296  18.249  0.687   1.00 20.65  ? 507  GLU A CA  1 
ATOM   944  C C   . GLU A 1 120 ? 21.705  18.177  1.269   1.00 21.46  ? 507  GLU A C   1 
ATOM   945  O O   . GLU A 1 120 ? 22.290  19.206  1.600   1.00 23.85  ? 507  GLU A O   1 
ATOM   946  C CB  . GLU A 1 120 ? 19.257  17.987  1.779   1.00 21.99  ? 507  GLU A CB  1 
ATOM   947  C CG  . GLU A 1 120 ? 19.427  18.836  3.026   1.00 22.05  ? 507  GLU A CG  1 
ATOM   948  C CD  . GLU A 1 120 ? 19.297  20.327  2.758   1.00 29.09  ? 507  GLU A CD  1 
ATOM   949  O OE1 . GLU A 1 120 ? 18.674  20.712  1.744   1.00 33.11  ? 507  GLU A OE1 1 
ATOM   950  O OE2 . GLU A 1 120 ? 19.821  21.117  3.568   1.00 37.97  ? 507  GLU A OE2 1 
ATOM   951  N N   . ILE A 1 121 ? 22.244  16.963  1.391   1.00 18.89  ? 508  ILE A N   1 
ATOM   952  C CA  . ILE A 1 121 ? 23.622  16.777  1.849   1.00 22.17  ? 508  ILE A CA  1 
ATOM   953  C C   . ILE A 1 121 ? 24.599  17.510  0.938   1.00 24.04  ? 508  ILE A C   1 
ATOM   954  O O   . ILE A 1 121 ? 25.475  18.235  1.398   1.00 19.68  ? 508  ILE A O   1 
ATOM   955  C CB  . ILE A 1 121 ? 24.012  15.282  1.897   1.00 23.35  ? 508  ILE A CB  1 
ATOM   956  C CG1 . ILE A 1 121 ? 23.283  14.583  3.037   1.00 27.71  ? 508  ILE A CG1 1 
ATOM   957  C CG2 . ILE A 1 121 ? 25.517  15.117  2.074   1.00 20.52  ? 508  ILE A CG2 1 
ATOM   958  C CD1 . ILE A 1 121 ? 23.560  15.219  4.357   1.00 37.36  ? 508  ILE A CD1 1 
ATOM   959  N N   . VAL A 1 122 ? 24.426  17.320  -0.365  1.00 13.70  ? 509  VAL A N   1 
ATOM   960  C CA  . VAL A 1 122 ? 25.318  17.901  -1.350  1.00 18.76  ? 509  VAL A CA  1 
ATOM   961  C C   . VAL A 1 122 ? 25.218  19.425  -1.339  1.00 22.98  ? 509  VAL A C   1 
ATOM   962  O O   . VAL A 1 122 ? 26.232  20.120  -1.269  1.00 19.54  ? 509  VAL A O   1 
ATOM   963  C CB  . VAL A 1 122 ? 25.004  17.354  -2.754  1.00 24.62  ? 509  VAL A CB  1 
ATOM   964  C CG1 . VAL A 1 122 ? 25.806  18.084  -3.816  1.00 25.89  ? 509  VAL A CG1 1 
ATOM   965  C CG2 . VAL A 1 122 ? 25.271  15.855  -2.799  1.00 19.21  ? 509  VAL A CG2 1 
ATOM   966  N N   . LEU A 1 123 ? 23.990  19.931  -1.394  1.00 21.76  ? 510  LEU A N   1 
ATOM   967  C CA  . LEU A 1 123 ? 23.735  21.367  -1.329  1.00 18.51  ? 510  LEU A CA  1 
ATOM   968  C C   . LEU A 1 123 ? 24.339  21.997  -0.085  1.00 21.36  ? 510  LEU A C   1 
ATOM   969  O O   . LEU A 1 123 ? 24.943  23.066  -0.156  1.00 20.46  ? 510  LEU A O   1 
ATOM   970  C CB  . LEU A 1 123 ? 22.227  21.649  -1.366  1.00 13.08  ? 510  LEU A CB  1 
ATOM   971  C CG  . LEU A 1 123 ? 21.553  21.404  -2.718  1.00 19.51  ? 510  LEU A CG  1 
ATOM   972  C CD1 . LEU A 1 123 ? 20.032  21.602  -2.625  1.00 12.20  ? 510  LEU A CD1 1 
ATOM   973  C CD2 . LEU A 1 123 ? 22.152  22.303  -3.797  1.00 13.28  ? 510  LEU A CD2 1 
ATOM   974  N N   . PHE A 1 124 ? 24.169  21.343  1.057   1.00 25.35  ? 511  PHE A N   1 
ATOM   975  C CA  . PHE A 1 124 ? 24.739  21.855  2.297   1.00 24.62  ? 511  PHE A CA  1 
ATOM   976  C C   . PHE A 1 124 ? 26.261  21.905  2.221   1.00 24.96  ? 511  PHE A C   1 
ATOM   977  O O   . PHE A 1 124 ? 26.874  22.896  2.617   1.00 20.34  ? 511  PHE A O   1 
ATOM   978  C CB  . PHE A 1 124 ? 24.313  21.004  3.491   1.00 26.28  ? 511  PHE A CB  1 
ATOM   979  C CG  . PHE A 1 124 ? 24.999  21.386  4.767   1.00 29.18  ? 511  PHE A CG  1 
ATOM   980  C CD1 . PHE A 1 124 ? 24.739  22.607  5.367   1.00 30.81  ? 511  PHE A CD1 1 
ATOM   981  C CD2 . PHE A 1 124 ? 25.915  20.534  5.360   1.00 31.59  ? 511  PHE A CD2 1 
ATOM   982  C CE1 . PHE A 1 124 ? 25.371  22.968  6.543   1.00 29.81  ? 511  PHE A CE1 1 
ATOM   983  C CE2 . PHE A 1 124 ? 26.551  20.889  6.534   1.00 34.63  ? 511  PHE A CE2 1 
ATOM   984  C CZ  . PHE A 1 124 ? 26.275  22.110  7.125   1.00 35.09  ? 511  PHE A CZ  1 
ATOM   985  N N   . ALA A 1 125 ? 26.860  20.835  1.702   1.00 20.30  ? 512  ALA A N   1 
ATOM   986  C CA  . ALA A 1 125 ? 28.319  20.726  1.619   1.00 20.61  ? 512  ALA A CA  1 
ATOM   987  C C   . ALA A 1 125 ? 28.935  21.867  0.818   1.00 21.25  ? 512  ALA A C   1 
ATOM   988  O O   . ALA A 1 125 ? 30.082  22.254  1.055   1.00 27.89  ? 512  ALA A O   1 
ATOM   989  C CB  . ALA A 1 125 ? 28.715  19.382  1.008   1.00 16.51  ? 512  ALA A CB  1 
ATOM   990  N N   . TYR A 1 126 ? 28.172  22.391  -0.137  1.00 21.73  ? 513  TYR A N   1 
ATOM   991  C CA  . TYR A 1 126 ? 28.636  23.479  -0.992  1.00 25.15  ? 513  TYR A CA  1 
ATOM   992  C C   . TYR A 1 126 ? 28.214  24.853  -0.481  1.00 22.22  ? 513  TYR A C   1 
ATOM   993  O O   . TYR A 1 126 ? 28.470  25.855  -1.141  1.00 28.50  ? 513  TYR A O   1 
ATOM   994  C CB  . TYR A 1 126 ? 28.137  23.279  -2.430  1.00 18.17  ? 513  TYR A CB  1 
ATOM   995  C CG  . TYR A 1 126 ? 28.961  22.266  -3.201  1.00 26.01  ? 513  TYR A CG  1 
ATOM   996  C CD1 . TYR A 1 126 ? 30.089  22.658  -3.917  1.00 28.42  ? 513  TYR A CD1 1 
ATOM   997  C CD2 . TYR A 1 126 ? 28.622  20.919  -3.200  1.00 20.38  ? 513  TYR A CD2 1 
ATOM   998  C CE1 . TYR A 1 126 ? 30.848  21.737  -4.617  1.00 28.30  ? 513  TYR A CE1 1 
ATOM   999  C CE2 . TYR A 1 126 ? 29.380  19.990  -3.889  1.00 25.57  ? 513  TYR A CE2 1 
ATOM   1000 C CZ  . TYR A 1 126 ? 30.488  20.403  -4.599  1.00 31.16  ? 513  TYR A CZ  1 
ATOM   1001 O OH  . TYR A 1 126 ? 31.238  19.478  -5.290  1.00 28.67  ? 513  TYR A OH  1 
ATOM   1002 N N   . SER A 1 127 ? 27.584  24.889  0.692   1.00 20.73  ? 514  SER A N   1 
ATOM   1003 C CA  . SER A 1 127 ? 27.031  26.124  1.259   1.00 22.34  ? 514  SER A CA  1 
ATOM   1004 C C   . SER A 1 127 ? 26.066  26.769  0.281   1.00 23.05  ? 514  SER A C   1 
ATOM   1005 O O   . SER A 1 127 ? 26.149  27.970  0.005   1.00 23.35  ? 514  SER A O   1 
ATOM   1006 C CB  . SER A 1 127 ? 28.134  27.123  1.630   1.00 18.15  ? 514  SER A CB  1 
ATOM   1007 O OG  . SER A 1 127 ? 28.915  26.659  2.718   1.00 37.51  ? 514  SER A OG  1 
ATOM   1008 N N   . SER A 1 128 ? 25.164  25.956  -0.256  1.00 23.57  ? 515  SER A N   1 
ATOM   1009 C CA  . SER A 1 128 ? 24.183  26.433  -1.213  1.00 19.78  ? 515  SER A CA  1 
ATOM   1010 C C   . SER A 1 128 ? 23.285  27.494  -0.590  1.00 23.83  ? 515  SER A C   1 
ATOM   1011 O O   . SER A 1 128 ? 22.938  27.412  0.587   1.00 22.04  ? 515  SER A O   1 
ATOM   1012 C CB  . SER A 1 128 ? 23.340  25.277  -1.742  1.00 17.95  ? 515  SER A CB  1 
ATOM   1013 O OG  . SER A 1 128 ? 22.342  25.750  -2.627  1.00 22.54  ? 515  SER A OG  1 
ATOM   1014 N N   . PRO A 1 129 ? 22.936  28.516  -1.380  1.00 18.53  ? 516  PRO A N   1 
ATOM   1015 C CA  . PRO A 1 129 ? 21.932  29.516  -1.011  1.00 18.52  ? 516  PRO A CA  1 
ATOM   1016 C C   . PRO A 1 129 ? 20.540  28.901  -0.970  1.00 26.03  ? 516  PRO A C   1 
ATOM   1017 O O   . PRO A 1 129 ? 19.607  29.537  -0.479  1.00 19.63  ? 516  PRO A O   1 
ATOM   1018 C CB  . PRO A 1 129 ? 22.042  30.561  -2.123  1.00 18.63  ? 516  PRO A CB  1 
ATOM   1019 C CG  . PRO A 1 129 ? 22.552  29.796  -3.300  1.00 16.06  ? 516  PRO A CG  1 
ATOM   1020 C CD  . PRO A 1 129 ? 23.495  28.769  -2.719  1.00 16.54  ? 516  PRO A CD  1 
ATOM   1021 N N   . ARG A 1 130 ? 20.385  27.687  -1.497  1.00 26.74  ? 517  ARG A N   1 
ATOM   1022 C CA  . ARG A 1 130 ? 19.053  27.114  -1.544  1.00 19.18  ? 517  ARG A CA  1 
ATOM   1023 C C   . ARG A 1 130 ? 18.853  26.365  -0.246  1.00 25.88  ? 517  ARG A C   1 
ATOM   1024 O O   . ARG A 1 130 ? 19.187  25.185  -0.114  1.00 31.81  ? 517  ARG A O   1 
ATOM   1025 C CB  . ARG A 1 130 ? 18.911  26.190  -2.757  1.00 15.53  ? 517  ARG A CB  1 
ATOM   1026 C CG  . ARG A 1 130 ? 19.113  26.931  -4.076  1.00 19.10  ? 517  ARG A CG  1 
ATOM   1027 C CD  . ARG A 1 130 ? 19.322  26.030  -5.285  1.00 15.37  ? 517  ARG A CD  1 
ATOM   1028 N NE  . ARG A 1 130 ? 19.247  26.824  -6.509  1.00 18.85  ? 517  ARG A NE  1 
ATOM   1029 C CZ  . ARG A 1 130 ? 20.258  27.530  -7.015  1.00 24.27  ? 517  ARG A CZ  1 
ATOM   1030 N NH1 . ARG A 1 130 ? 21.444  27.520  -6.426  1.00 23.55  ? 517  ARG A NH1 1 
ATOM   1031 N NH2 . ARG A 1 130 ? 20.084  28.244  -8.119  1.00 18.46  ? 517  ARG A NH2 1 
ATOM   1032 N N   . THR A 1 131 ? 18.177  27.046  0.666   1.00 24.76  ? 518  THR A N   1 
ATOM   1033 C CA  . THR A 1 131 ? 18.130  26.647  2.061   1.00 22.53  ? 518  THR A CA  1 
ATOM   1034 C C   . THR A 1 131 ? 16.923  25.759  2.259   1.00 20.65  ? 518  THR A C   1 
ATOM   1035 O O   . THR A 1 131 ? 15.858  26.030  1.706   1.00 19.38  ? 518  THR A O   1 
ATOM   1036 C CB  . THR A 1 131 ? 18.044  27.872  2.995   1.00 27.93  ? 518  THR A CB  1 
ATOM   1037 O OG1 . THR A 1 131 ? 18.965  28.879  2.556   1.00 34.57  ? 518  THR A OG1 1 
ATOM   1038 C CG2 . THR A 1 131 ? 18.352  27.493  4.433   1.00 23.99  ? 518  THR A CG2 1 
ATOM   1039 N N   . PHE A 1 132 ? 17.103  24.689  3.023   1.00 22.42  ? 519  PHE A N   1 
ATOM   1040 C CA  . PHE A 1 132 ? 15.997  23.846  3.429   1.00 28.23  ? 519  PHE A CA  1 
ATOM   1041 C C   . PHE A 1 132 ? 14.906  24.732  4.042   1.00 28.09  ? 519  PHE A C   1 
ATOM   1042 O O   . PHE A 1 132 ? 15.223  25.654  4.794   1.00 30.65  ? 519  PHE A O   1 
ATOM   1043 C CB  . PHE A 1 132 ? 16.474  22.789  4.430   1.00 26.41  ? 519  PHE A CB  1 
ATOM   1044 C CG  . PHE A 1 132 ? 15.433  21.773  4.763   1.00 25.10  ? 519  PHE A CG  1 
ATOM   1045 C CD1 . PHE A 1 132 ? 15.302  20.625  3.997   1.00 20.01  ? 519  PHE A CD1 1 
ATOM   1046 C CD2 . PHE A 1 132 ? 14.562  21.977  5.821   1.00 21.70  ? 519  PHE A CD2 1 
ATOM   1047 C CE1 . PHE A 1 132 ? 14.330  19.690  4.292   1.00 16.45  ? 519  PHE A CE1 1 
ATOM   1048 C CE2 . PHE A 1 132 ? 13.584  21.047  6.119   1.00 16.43  ? 519  PHE A CE2 1 
ATOM   1049 C CZ  . PHE A 1 132 ? 13.466  19.906  5.352   1.00 15.73  ? 519  PHE A CZ  1 
ATOM   1050 N N   . PRO A 1 133 ? 13.624  24.445  3.739   1.00 21.25  ? 520  PRO A N   1 
ATOM   1051 C CA  . PRO A 1 133 ? 13.171  23.301  2.934   1.00 22.62  ? 520  PRO A CA  1 
ATOM   1052 C C   . PRO A 1 133 ? 13.064  23.510  1.423   1.00 25.21  ? 520  PRO A C   1 
ATOM   1053 O O   . PRO A 1 133 ? 12.110  22.982  0.851   1.00 22.94  ? 520  PRO A O   1 
ATOM   1054 C CB  . PRO A 1 133 ? 11.773  23.060  3.491   1.00 20.75  ? 520  PRO A CB  1 
ATOM   1055 C CG  . PRO A 1 133 ? 11.270  24.465  3.724   1.00 16.17  ? 520  PRO A CG  1 
ATOM   1056 C CD  . PRO A 1 133 ? 12.483  25.238  4.236   1.00 14.99  ? 520  PRO A CD  1 
ATOM   1057 N N   . TRP A 1 134 ? 14.043  24.140  0.781   1.00 20.40  ? 521  TRP A N   1 
ATOM   1058 C CA  . TRP A 1 134 ? 13.964  24.382  -0.656  1.00 20.16  ? 521  TRP A CA  1 
ATOM   1059 C C   . TRP A 1 134 ? 13.812  23.059  -1.412  1.00 24.15  ? 521  TRP A C   1 
ATOM   1060 O O   . TRP A 1 134 ? 12.910  22.907  -2.244  1.00 16.22  ? 521  TRP A O   1 
ATOM   1061 C CB  . TRP A 1 134 ? 15.204  25.143  -1.149  1.00 17.54  ? 521  TRP A CB  1 
ATOM   1062 C CG  . TRP A 1 134 ? 15.212  25.471  -2.617  1.00 13.61  ? 521  TRP A CG  1 
ATOM   1063 C CD1 . TRP A 1 134 ? 14.722  26.602  -3.210  1.00 16.39  ? 521  TRP A CD1 1 
ATOM   1064 C CD2 . TRP A 1 134 ? 15.752  24.666  -3.677  1.00 17.37  ? 521  TRP A CD2 1 
ATOM   1065 N NE1 . TRP A 1 134 ? 14.916  26.544  -4.571  1.00 14.23  ? 521  TRP A NE1 1 
ATOM   1066 C CE2 . TRP A 1 134 ? 15.545  25.370  -4.882  1.00 12.83  ? 521  TRP A CE2 1 
ATOM   1067 C CE3 . TRP A 1 134 ? 16.386  23.418  -3.722  1.00 16.58  ? 521  TRP A CE3 1 
ATOM   1068 C CZ2 . TRP A 1 134 ? 15.953  24.866  -6.118  1.00 19.93  ? 521  TRP A CZ2 1 
ATOM   1069 C CZ3 . TRP A 1 134 ? 16.783  22.919  -4.947  1.00 11.71  ? 521  TRP A CZ3 1 
ATOM   1070 C CH2 . TRP A 1 134 ? 16.568  23.643  -6.131  1.00 21.55  ? 521  TRP A CH2 1 
ATOM   1071 N N   . ILE A 1 135 ? 14.673  22.095  -1.095  1.00 19.47  ? 522  ILE A N   1 
ATOM   1072 C CA  . ILE A 1 135 ? 14.718  20.850  -1.854  1.00 17.21  ? 522  ILE A CA  1 
ATOM   1073 C C   . ILE A 1 135 ? 13.399  20.062  -1.760  1.00 15.04  ? 522  ILE A C   1 
ATOM   1074 O O   . ILE A 1 135 ? 12.936  19.529  -2.768  1.00 13.91  ? 522  ILE A O   1 
ATOM   1075 C CB  . ILE A 1 135 ? 15.940  19.954  -1.418  1.00 16.91  ? 522  ILE A CB  1 
ATOM   1076 C CG1 . ILE A 1 135 ? 16.061  18.726  -2.323  1.00 18.08  ? 522  ILE A CG1 1 
ATOM   1077 C CG2 . ILE A 1 135 ? 15.880  19.555  0.063   1.00 20.50  ? 522  ILE A CG2 1 
ATOM   1078 C CD1 . ILE A 1 135 ? 16.343  19.067  -3.771  1.00 24.51  ? 522  ILE A CD1 1 
ATOM   1079 N N   . ILE A 1 136 ? 12.761  20.022  -0.589  1.00 14.44  ? 523  ILE A N   1 
ATOM   1080 C CA  . ILE A 1 136 ? 11.515  19.253  -0.469  1.00 14.46  ? 523  ILE A CA  1 
ATOM   1081 C C   . ILE A 1 136 ? 10.268  20.006  -0.944  1.00 18.79  ? 523  ILE A C   1 
ATOM   1082 O O   . ILE A 1 136 ? 9.216   19.401  -1.172  1.00 22.57  ? 523  ILE A O   1 
ATOM   1083 C CB  . ILE A 1 136 ? 11.277  18.773  0.970   1.00 12.36  ? 523  ILE A CB  1 
ATOM   1084 C CG1 . ILE A 1 136 ? 11.241  19.949  1.938   1.00 10.98  ? 523  ILE A CG1 1 
ATOM   1085 C CG2 . ILE A 1 136 ? 12.351  17.750  1.378   1.00 14.53  ? 523  ILE A CG2 1 
ATOM   1086 C CD1 . ILE A 1 136 ? 10.533  19.641  3.241   1.00 19.84  ? 523  ILE A CD1 1 
ATOM   1087 N N   . GLU A 1 137 ? 10.368  21.319  -1.109  1.00 20.31  ? 524  GLU A N   1 
ATOM   1088 C CA  . GLU A 1 137 ? 9.265   22.052  -1.724  1.00 23.11  ? 524  GLU A CA  1 
ATOM   1089 C C   . GLU A 1 137 ? 9.317   21.878  -3.234  1.00 20.21  ? 524  GLU A C   1 
ATOM   1090 O O   . GLU A 1 137 ? 8.286   21.727  -3.894  1.00 22.35  ? 524  GLU A O   1 
ATOM   1091 C CB  . GLU A 1 137 ? 9.305   23.526  -1.339  1.00 26.84  ? 524  GLU A CB  1 
ATOM   1092 C CG  . GLU A 1 137 ? 8.896   23.764  0.102   1.00 36.02  ? 524  GLU A CG  1 
ATOM   1093 C CD  . GLU A 1 137 ? 8.986   25.221  0.499   1.00 46.56  ? 524  GLU A CD  1 
ATOM   1094 O OE1 . GLU A 1 137 ? 9.663   25.988  -0.216  1.00 49.33  ? 524  GLU A OE1 1 
ATOM   1095 O OE2 . GLU A 1 137 ? 8.377   25.597  1.524   1.00 51.61  ? 524  GLU A OE2 1 
ATOM   1096 N N   . VAL A 1 138 ? 10.534  21.884  -3.763  1.00 18.59  ? 525  VAL A N   1 
ATOM   1097 C CA  . VAL A 1 138 ? 10.789  21.693  -5.182  1.00 16.69  ? 525  VAL A CA  1 
ATOM   1098 C C   . VAL A 1 138 ? 10.367  20.297  -5.641  1.00 16.49  ? 525  VAL A C   1 
ATOM   1099 O O   . VAL A 1 138 ? 9.844   20.123  -6.745  1.00 13.58  ? 525  VAL A O   1 
ATOM   1100 C CB  . VAL A 1 138 ? 12.288  21.930  -5.496  1.00 21.59  ? 525  VAL A CB  1 
ATOM   1101 C CG1 . VAL A 1 138 ? 12.725  21.181  -6.740  1.00 18.61  ? 525  VAL A CG1 1 
ATOM   1102 C CG2 . VAL A 1 138 ? 12.575  23.424  -5.620  1.00 15.12  ? 525  VAL A CG2 1 
ATOM   1103 N N   . LEU A 1 139 ? 10.584  19.309  -4.779  1.00 13.80  ? 526  LEU A N   1 
ATOM   1104 C CA  . LEU A 1 139 ? 10.293  17.916  -5.110  1.00 20.20  ? 526  LEU A CA  1 
ATOM   1105 C C   . LEU A 1 139 ? 8.931   17.451  -4.592  1.00 18.49  ? 526  LEU A C   1 
ATOM   1106 O O   . LEU A 1 139 ? 8.583   16.282  -4.730  1.00 17.90  ? 526  LEU A O   1 
ATOM   1107 C CB  . LEU A 1 139 ? 11.390  17.003  -4.559  1.00 22.27  ? 526  LEU A CB  1 
ATOM   1108 C CG  . LEU A 1 139 ? 12.786  17.162  -5.158  1.00 26.11  ? 526  LEU A CG  1 
ATOM   1109 C CD1 . LEU A 1 139 ? 13.742  16.192  -4.496  1.00 23.31  ? 526  LEU A CD1 1 
ATOM   1110 C CD2 . LEU A 1 139 ? 12.760  16.942  -6.667  1.00 26.91  ? 526  LEU A CD2 1 
ATOM   1111 N N   . ASN A 1 140 ? 8.183   18.366  -3.982  1.00 17.03  ? 527  ASN A N   1 
ATOM   1112 C CA  . ASN A 1 140 ? 6.871   18.068  -3.416  1.00 22.45  ? 527  ASN A CA  1 
ATOM   1113 C C   . ASN A 1 140 ? 6.888   16.931  -2.403  1.00 26.69  ? 527  ASN A C   1 
ATOM   1114 O O   . ASN A 1 140 ? 6.049   16.030  -2.447  1.00 23.90  ? 527  ASN A O   1 
ATOM   1115 C CB  . ASN A 1 140 ? 5.865   17.750  -4.529  1.00 23.43  ? 527  ASN A CB  1 
ATOM   1116 C CG  . ASN A 1 140 ? 5.186   18.995  -5.067  1.00 30.43  ? 527  ASN A CG  1 
ATOM   1117 O OD1 . ASN A 1 140 ? 4.331   19.577  -4.404  1.00 32.62  ? 527  ASN A OD1 1 
ATOM   1118 N ND2 . ASN A 1 140 ? 5.571   19.415  -6.267  1.00 22.32  ? 527  ASN A ND2 1 
ATOM   1119 N N   . LEU A 1 141 ? 7.844   16.978  -1.485  1.00 19.28  ? 528  LEU A N   1 
ATOM   1120 C CA  . LEU A 1 141 ? 7.911   15.986  -0.428  1.00 21.47  ? 528  LEU A CA  1 
ATOM   1121 C C   . LEU A 1 141 ? 7.352   16.534  0.877   1.00 19.19  ? 528  LEU A C   1 
ATOM   1122 O O   . LEU A 1 141 ? 7.841   17.531  1.410   1.00 19.34  ? 528  LEU A O   1 
ATOM   1123 C CB  . LEU A 1 141 ? 9.347   15.513  -0.233  1.00 25.24  ? 528  LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 141 ? 9.813   14.511  -1.283  1.00 24.73  ? 528  LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 141 ? 11.314  14.457  -1.313  1.00 20.15  ? 528  LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 141 ? 9.236   13.131  -0.995  1.00 17.00  ? 528  LEU A CD2 1 
ATOM   1127 N N   . GLN A 1 142 ? 6.316   15.872  1.377   1.00 15.93  ? 529  GLN A N   1 
ATOM   1128 C CA  . GLN A 1 142 ? 5.712   16.212  2.659   1.00 17.81  ? 529  GLN A CA  1 
ATOM   1129 C C   . GLN A 1 142 ? 6.721   16.083  3.784   1.00 19.77  ? 529  GLN A C   1 
ATOM   1130 O O   . GLN A 1 142 ? 7.336   15.030  3.943   1.00 27.08  ? 529  GLN A O   1 
ATOM   1131 C CB  . GLN A 1 142 ? 4.504   15.311  2.943   1.00 22.62  ? 529  GLN A CB  1 
ATOM   1132 C CG  . GLN A 1 142 ? 3.283   15.618  2.105   1.00 25.35  ? 529  GLN A CG  1 
ATOM   1133 C CD  . GLN A 1 142 ? 2.577   16.869  2.574   1.00 40.33  ? 529  GLN A CD  1 
ATOM   1134 O OE1 . GLN A 1 142 ? 2.596   17.195  3.762   1.00 36.78  ? 529  GLN A OE1 1 
ATOM   1135 N NE2 . GLN A 1 142 ? 1.945   17.579  1.645   1.00 52.42  ? 529  GLN A NE2 1 
ATOM   1136 N N   . PRO A 1 143 ? 6.894   17.161  4.566   1.00 23.18  ? 530  PRO A N   1 
ATOM   1137 C CA  . PRO A 1 143 ? 7.757   17.176  5.752   1.00 19.74  ? 530  PRO A CA  1 
ATOM   1138 C C   . PRO A 1 143 ? 7.459   16.016  6.700   1.00 14.68  ? 530  PRO A C   1 
ATOM   1139 O O   . PRO A 1 143 ? 8.378   15.412  7.239   1.00 12.26  ? 530  PRO A O   1 
ATOM   1140 C CB  . PRO A 1 143 ? 7.417   18.520  6.420   1.00 15.82  ? 530  PRO A CB  1 
ATOM   1141 C CG  . PRO A 1 143 ? 6.966   19.388  5.306   1.00 18.55  ? 530  PRO A CG  1 
ATOM   1142 C CD  . PRO A 1 143 ? 6.262   18.473  4.322   1.00 17.29  ? 530  PRO A CD  1 
ATOM   1143 N N   . PHE A 1 144 ? 6.181   15.715  6.889   1.00 20.00  ? 531  PHE A N   1 
ATOM   1144 C CA  . PHE A 1 144 ? 5.754   14.670  7.815   1.00 14.92  ? 531  PHE A CA  1 
ATOM   1145 C C   . PHE A 1 144 ? 6.295   13.294  7.410   1.00 17.51  ? 531  PHE A C   1 
ATOM   1146 O O   . PHE A 1 144 ? 6.591   12.452  8.262   1.00 23.35  ? 531  PHE A O   1 
ATOM   1147 C CB  . PHE A 1 144 ? 4.222   14.646  7.892   1.00 16.44  ? 531  PHE A CB  1 
ATOM   1148 C CG  . PHE A 1 144 ? 3.663   13.589  8.813   1.00 15.73  ? 531  PHE A CG  1 
ATOM   1149 C CD1 . PHE A 1 144 ? 3.839   13.680  10.184  1.00 13.93  ? 531  PHE A CD1 1 
ATOM   1150 C CD2 . PHE A 1 144 ? 2.941   12.517  8.301   1.00 13.89  ? 531  PHE A CD2 1 
ATOM   1151 C CE1 . PHE A 1 144 ? 3.313   12.718  11.027  1.00 22.99  ? 531  PHE A CE1 1 
ATOM   1152 C CE2 . PHE A 1 144 ? 2.420   11.552  9.133   1.00 21.16  ? 531  PHE A CE2 1 
ATOM   1153 C CZ  . PHE A 1 144 ? 2.606   11.650  10.502  1.00 29.80  ? 531  PHE A CZ  1 
ATOM   1154 N N   . TYR A 1 145 ? 6.391   13.056  6.107   1.00 13.44  ? 532  TYR A N   1 
ATOM   1155 C CA  . TYR A 1 145 ? 6.943   11.805  5.605   1.00 14.42  ? 532  TYR A CA  1 
ATOM   1156 C C   . TYR A 1 145 ? 8.465   11.851  5.537   1.00 19.40  ? 532  TYR A C   1 
ATOM   1157 O O   . TYR A 1 145 ? 9.147   10.921  5.957   1.00 25.23  ? 532  TYR A O   1 
ATOM   1158 C CB  . TYR A 1 145 ? 6.363   11.490  4.227   1.00 24.24  ? 532  TYR A CB  1 
ATOM   1159 C CG  . TYR A 1 145 ? 4.861   11.296  4.220   1.00 27.85  ? 532  TYR A CG  1 
ATOM   1160 C CD1 . TYR A 1 145 ? 4.221   10.615  5.247   1.00 31.59  ? 532  TYR A CD1 1 
ATOM   1161 C CD2 . TYR A 1 145 ? 4.085   11.794  3.183   1.00 29.53  ? 532  TYR A CD2 1 
ATOM   1162 C CE1 . TYR A 1 145 ? 2.846   10.433  5.236   1.00 33.13  ? 532  TYR A CE1 1 
ATOM   1163 C CE2 . TYR A 1 145 ? 2.717   11.621  3.165   1.00 30.60  ? 532  TYR A CE2 1 
ATOM   1164 C CZ  . TYR A 1 145 ? 2.103   10.941  4.192   1.00 31.56  ? 532  TYR A CZ  1 
ATOM   1165 O OH  . TYR A 1 145 ? 0.737   10.773  4.165   1.00 45.45  ? 532  TYR A OH  1 
ATOM   1166 N N   . PHE A 1 146 ? 8.984   12.965  5.035   1.00 22.25  ? 533  PHE A N   1 
ATOM   1167 C CA  . PHE A 1 146 ? 10.400  13.093  4.713   1.00 20.05  ? 533  PHE A CA  1 
ATOM   1168 C C   . PHE A 1 146 ? 11.343  12.912  5.899   1.00 14.84  ? 533  PHE A C   1 
ATOM   1169 O O   . PHE A 1 146 ? 12.342  12.207  5.784   1.00 19.42  ? 533  PHE A O   1 
ATOM   1170 C CB  . PHE A 1 146 ? 10.667  14.455  4.065   1.00 19.81  ? 533  PHE A CB  1 
ATOM   1171 C CG  . PHE A 1 146 ? 12.123  14.766  3.904   1.00 20.88  ? 533  PHE A CG  1 
ATOM   1172 C CD1 . PHE A 1 146 ? 12.856  14.203  2.865   1.00 22.98  ? 533  PHE A CD1 1 
ATOM   1173 C CD2 . PHE A 1 146 ? 12.767  15.619  4.790   1.00 15.97  ? 533  PHE A CD2 1 
ATOM   1174 C CE1 . PHE A 1 146 ? 14.211  14.483  2.716   1.00 17.44  ? 533  PHE A CE1 1 
ATOM   1175 C CE2 . PHE A 1 146 ? 14.120  15.901  4.644   1.00 23.12  ? 533  PHE A CE2 1 
ATOM   1176 C CZ  . PHE A 1 146 ? 14.839  15.331  3.606   1.00 18.41  ? 533  PHE A CZ  1 
ATOM   1177 N N   . TYR A 1 147 ? 11.034  13.542  7.030   1.00 15.79  ? 534  TYR A N   1 
ATOM   1178 C CA  . TYR A 1 147 ? 11.959  13.583  8.165   1.00 18.57  ? 534  TYR A CA  1 
ATOM   1179 C C   . TYR A 1 147 ? 12.434  12.188  8.601   1.00 21.81  ? 534  TYR A C   1 
ATOM   1180 O O   . TYR A 1 147 ? 13.520  12.042  9.169   1.00 23.21  ? 534  TYR A O   1 
ATOM   1181 C CB  . TYR A 1 147 ? 11.310  14.295  9.361   1.00 17.44  ? 534  TYR A CB  1 
ATOM   1182 C CG  . TYR A 1 147 ? 10.524  13.350  10.228  1.00 21.24  ? 534  TYR A CG  1 
ATOM   1183 C CD1 . TYR A 1 147 ? 11.109  12.739  11.337  1.00 19.13  ? 534  TYR A CD1 1 
ATOM   1184 C CD2 . TYR A 1 147 ? 9.206   13.040  9.924   1.00 18.06  ? 534  TYR A CD2 1 
ATOM   1185 C CE1 . TYR A 1 147 ? 10.398  11.852  12.115  1.00 22.74  ? 534  TYR A CE1 1 
ATOM   1186 C CE2 . TYR A 1 147 ? 8.489   12.155  10.700  1.00 18.44  ? 534  TYR A CE2 1 
ATOM   1187 C CZ  . TYR A 1 147 ? 9.088   11.566  11.789  1.00 16.88  ? 534  TYR A CZ  1 
ATOM   1188 O OH  . TYR A 1 147 ? 8.377   10.686  12.557  1.00 24.04  ? 534  TYR A OH  1 
ATOM   1189 N N   . LYS A 1 148 ? 11.616  11.171  8.344   1.00 24.89  ? 535  LYS A N   1 
ATOM   1190 C CA  . LYS A 1 148 ? 11.913  9.805   8.778   1.00 28.06  ? 535  LYS A CA  1 
ATOM   1191 C C   . LYS A 1 148 ? 13.186  9.234   8.152   1.00 22.99  ? 535  LYS A C   1 
ATOM   1192 O O   . LYS A 1 148 ? 13.808  8.339   8.715   1.00 23.93  ? 535  LYS A O   1 
ATOM   1193 C CB  . LYS A 1 148 ? 10.731  8.872   8.465   1.00 33.57  ? 535  LYS A CB  1 
ATOM   1194 C CG  . LYS A 1 148 ? 9.497   9.127   9.317   1.00 37.25  ? 535  LYS A CG  1 
ATOM   1195 C CD  . LYS A 1 148 ? 8.627   7.877   9.493   1.00 38.80  ? 535  LYS A CD  1 
ATOM   1196 C CE  . LYS A 1 148 ? 7.810   7.538   8.255   1.00 34.20  ? 535  LYS A CE  1 
ATOM   1197 N NZ  . LYS A 1 148 ? 8.540   6.626   7.332   1.00 29.61  ? 535  LYS A NZ  1 
ATOM   1198 N N   . VAL A 1 149 ? 13.571  9.745   6.988   1.00 17.35  ? 536  VAL A N   1 
ATOM   1199 C CA  . VAL A 1 149 ? 14.738  9.220   6.289   1.00 12.86  ? 536  VAL A CA  1 
ATOM   1200 C C   . VAL A 1 149 ? 16.054  9.737   6.895   1.00 16.21  ? 536  VAL A C   1 
ATOM   1201 O O   . VAL A 1 149 ? 17.095  9.088   6.780   1.00 17.16  ? 536  VAL A O   1 
ATOM   1202 C CB  . VAL A 1 149 ? 14.683  9.575   4.777   1.00 22.86  ? 536  VAL A CB  1 
ATOM   1203 C CG1 . VAL A 1 149 ? 15.072  11.031  4.541   1.00 12.77  ? 536  VAL A CG1 1 
ATOM   1204 C CG2 . VAL A 1 149 ? 15.573  8.637   3.968   1.00 18.95  ? 536  VAL A CG2 1 
ATOM   1205 N N   . ILE A 1 150 ? 16.004  10.890  7.556   1.00 15.32  ? 537  ILE A N   1 
ATOM   1206 C CA  . ILE A 1 150 ? 17.215  11.515  8.092   1.00 18.51  ? 537  ILE A CA  1 
ATOM   1207 C C   . ILE A 1 150 ? 17.956  10.590  9.058   1.00 20.90  ? 537  ILE A C   1 
ATOM   1208 O O   . ILE A 1 150 ? 19.175  10.413  8.958   1.00 25.61  ? 537  ILE A O   1 
ATOM   1209 C CB  . ILE A 1 150 ? 16.880  12.846  8.800   1.00 19.90  ? 537  ILE A CB  1 
ATOM   1210 C CG1 . ILE A 1 150 ? 16.290  13.843  7.793   1.00 15.14  ? 537  ILE A CG1 1 
ATOM   1211 C CG2 . ILE A 1 150 ? 18.115  13.427  9.480   1.00 19.70  ? 537  ILE A CG2 1 
ATOM   1212 C CD1 . ILE A 1 150 ? 15.630  15.049  8.433   1.00 18.24  ? 537  ILE A CD1 1 
ATOM   1213 N N   . GLU A 1 151 ? 17.212  9.990   9.980   1.00 20.24  ? 538  GLU A N   1 
ATOM   1214 C CA  . GLU A 1 151 ? 17.786  9.062   10.945  1.00 23.58  ? 538  GLU A CA  1 
ATOM   1215 C C   . GLU A 1 151 ? 18.323  7.807   10.250  1.00 24.05  ? 538  GLU A C   1 
ATOM   1216 O O   . GLU A 1 151 ? 19.281  7.185   10.723  1.00 23.40  ? 538  GLU A O   1 
ATOM   1217 C CB  . GLU A 1 151 ? 16.745  8.686   12.002  1.00 29.72  ? 538  GLU A CB  1 
ATOM   1218 C CG  . GLU A 1 151 ? 17.298  7.903   13.180  1.00 42.64  ? 538  GLU A CG  1 
ATOM   1219 C CD  . GLU A 1 151 ? 16.299  7.787   14.321  1.00 52.99  ? 538  GLU A CD  1 
ATOM   1220 O OE1 . GLU A 1 151 ? 15.136  7.410   14.059  1.00 52.31  ? 538  GLU A OE1 1 
ATOM   1221 O OE2 . GLU A 1 151 ? 16.675  8.082   15.477  1.00 53.25  ? 538  GLU A OE2 1 
ATOM   1222 N N   . VAL A 1 152 ? 17.717  7.435   9.126   1.00 18.55  ? 539  VAL A N   1 
ATOM   1223 C CA  . VAL A 1 152 ? 18.215  6.284   8.377   1.00 23.97  ? 539  VAL A CA  1 
ATOM   1224 C C   . VAL A 1 152 ? 19.545  6.639   7.719   1.00 25.46  ? 539  VAL A C   1 
ATOM   1225 O O   . VAL A 1 152 ? 20.484  5.849   7.751   1.00 22.38  ? 539  VAL A O   1 
ATOM   1226 C CB  . VAL A 1 152 ? 17.223  5.803   7.297   1.00 26.84  ? 539  VAL A CB  1 
ATOM   1227 C CG1 . VAL A 1 152 ? 17.806  4.607   6.552   1.00 28.28  ? 539  VAL A CG1 1 
ATOM   1228 C CG2 . VAL A 1 152 ? 15.883  5.443   7.916   1.00 22.81  ? 539  VAL A CG2 1 
ATOM   1229 N N   . VAL A 1 153 ? 19.614  7.830   7.124   1.00 24.10  ? 540  VAL A N   1 
ATOM   1230 C CA  . VAL A 1 153 ? 20.849  8.329   6.516   1.00 21.78  ? 540  VAL A CA  1 
ATOM   1231 C C   . VAL A 1 153 ? 21.984  8.418   7.533   1.00 21.18  ? 540  VAL A C   1 
ATOM   1232 O O   . VAL A 1 153 ? 23.092  7.946   7.283   1.00 25.56  ? 540  VAL A O   1 
ATOM   1233 C CB  . VAL A 1 153 ? 20.650  9.719   5.884   1.00 19.92  ? 540  VAL A CB  1 
ATOM   1234 C CG1 . VAL A 1 153 ? 21.997  10.368  5.572   1.00 15.38  ? 540  VAL A CG1 1 
ATOM   1235 C CG2 . VAL A 1 153 ? 19.779  9.625   4.634   1.00 14.63  ? 540  VAL A CG2 1 
ATOM   1236 N N   . ILE A 1 154 ? 21.696  9.022   8.681   1.00 22.58  ? 541  ILE A N   1 
ATOM   1237 C CA  . ILE A 1 154 ? 22.694  9.194   9.730   1.00 30.68  ? 541  ILE A CA  1 
ATOM   1238 C C   . ILE A 1 154 ? 23.234  7.835   10.188  1.00 27.35  ? 541  ILE A C   1 
ATOM   1239 O O   . ILE A 1 154 ? 24.430  7.677   10.407  1.00 31.58  ? 541  ILE A O   1 
ATOM   1240 C CB  . ILE A 1 154 ? 22.110  9.988   10.930  1.00 18.31  ? 541  ILE A CB  1 
ATOM   1241 C CG1 . ILE A 1 154 ? 21.798  11.424  10.490  1.00 20.40  ? 541  ILE A CG1 1 
ATOM   1242 C CG2 . ILE A 1 154 ? 23.086  9.998   12.102  1.00 20.14  ? 541  ILE A CG2 1 
ATOM   1243 C CD1 . ILE A 1 154 ? 21.248  12.322  11.580  1.00 15.45  ? 541  ILE A CD1 1 
ATOM   1244 N N   . ARG A 1 155 ? 22.348  6.851   10.291  1.00 21.59  ? 542  ARG A N   1 
ATOM   1245 C CA  . ARG A 1 155 ? 22.736  5.491   10.643  1.00 28.53  ? 542  ARG A CA  1 
ATOM   1246 C C   . ARG A 1 155 ? 23.564  4.810   9.558   1.00 33.52  ? 542  ARG A C   1 
ATOM   1247 O O   . ARG A 1 155 ? 24.542  4.129   9.849   1.00 35.97  ? 542  ARG A O   1 
ATOM   1248 C CB  . ARG A 1 155 ? 21.498  4.636   10.918  1.00 34.56  ? 542  ARG A CB  1 
ATOM   1249 C CG  . ARG A 1 155 ? 20.839  4.835   12.272  1.00 42.42  ? 542  ARG A CG  1 
ATOM   1250 C CD  . ARG A 1 155 ? 19.552  4.019   12.336  1.00 50.69  ? 542  ARG A CD  1 
ATOM   1251 N NE  . ARG A 1 155 ? 19.688  2.758   11.606  1.00 56.52  ? 542  ARG A NE  1 
ATOM   1252 C CZ  . ARG A 1 155 ? 18.775  2.268   10.772  1.00 61.40  ? 542  ARG A CZ  1 
ATOM   1253 N NH1 . ARG A 1 155 ? 17.642  2.924   10.557  1.00 53.52  ? 542  ARG A NH1 1 
ATOM   1254 N NH2 . ARG A 1 155 ? 18.992  1.115   10.153  1.00 69.06  ? 542  ARG A NH2 1 
ATOM   1255 N N   . SER A 1 156 ? 23.158  4.985   8.305   1.00 30.55  ? 543  SER A N   1 
ATOM   1256 C CA  . SER A 1 156 ? 23.693  4.169   7.218   1.00 27.47  ? 543  SER A CA  1 
ATOM   1257 C C   . SER A 1 156 ? 24.953  4.716   6.547   1.00 32.98  ? 543  SER A C   1 
ATOM   1258 O O   . SER A 1 156 ? 25.591  4.012   5.768   1.00 42.97  ? 543  SER A O   1 
ATOM   1259 C CB  . SER A 1 156 ? 22.609  3.964   6.168   1.00 23.32  ? 543  SER A CB  1 
ATOM   1260 O OG  . SER A 1 156 ? 21.445  3.432   6.777   1.00 33.15  ? 543  SER A OG  1 
ATOM   1261 N N   . GLU A 1 157 ? 25.311  5.961   6.830   1.00 23.34  ? 544  GLU A N   1 
ATOM   1262 C CA  . GLU A 1 157 ? 26.557  6.499   6.307   1.00 32.90  ? 544  GLU A CA  1 
ATOM   1263 C C   . GLU A 1 157 ? 27.376  7.089   7.446   1.00 40.96  ? 544  GLU A C   1 
ATOM   1264 O O   . GLU A 1 157 ? 27.044  8.148   7.989   1.00 46.12  ? 544  GLU A O   1 
ATOM   1265 C CB  . GLU A 1 157 ? 26.283  7.554   5.228   1.00 36.89  ? 544  GLU A CB  1 
ATOM   1266 C CG  . GLU A 1 157 ? 27.541  8.148   4.597   1.00 39.21  ? 544  GLU A CG  1 
ATOM   1267 C CD  . GLU A 1 157 ? 28.522  7.088   4.111   1.00 37.59  ? 544  GLU A CD  1 
ATOM   1268 O OE1 . GLU A 1 157 ? 28.242  6.433   3.084   1.00 33.10  ? 544  GLU A OE1 1 
ATOM   1269 O OE2 . GLU A 1 157 ? 29.575  6.912   4.758   1.00 38.10  ? 544  GLU A OE2 1 
ATOM   1270 N N   . GLU A 1 158 ? 28.470  6.413   7.776   1.00 31.42  ? 545  GLU A N   1 
ATOM   1271 C CA  . GLU A 1 158 ? 29.300  6.799   8.910   1.00 41.49  ? 545  GLU A CA  1 
ATOM   1272 C C   . GLU A 1 158 ? 30.370  7.787   8.471   1.00 26.91  ? 545  GLU A C   1 
ATOM   1273 O O   . GLU A 1 158 ? 31.054  8.388   9.295   1.00 34.10  ? 545  GLU A O   1 
ATOM   1274 C CB  . GLU A 1 158 ? 29.942  5.563   9.555   1.00 49.69  ? 545  GLU A CB  1 
ATOM   1275 C CG  . GLU A 1 158 ? 29.014  4.785   10.486  1.00 58.47  ? 545  GLU A CG  1 
ATOM   1276 C CD  . GLU A 1 158 ? 29.029  5.316   11.917  1.00 68.40  ? 545  GLU A CD  1 
ATOM   1277 O OE1 . GLU A 1 158 ? 30.087  5.218   12.577  1.00 73.43  ? 545  GLU A OE1 1 
ATOM   1278 O OE2 . GLU A 1 158 ? 27.986  5.829   12.381  1.00 66.72  ? 545  GLU A OE2 1 
ATOM   1279 N N   . GLY A 1 159 ? 30.504  7.940   7.159   1.00 23.40  ? 546  GLY A N   1 
ATOM   1280 C CA  . GLY A 1 159 ? 31.464  8.860   6.584   1.00 27.57  ? 546  GLY A CA  1 
ATOM   1281 C C   . GLY A 1 159 ? 30.999  10.304  6.644   1.00 31.42  ? 546  GLY A C   1 
ATOM   1282 O O   . GLY A 1 159 ? 31.773  11.216  6.356   1.00 30.93  ? 546  GLY A O   1 
ATOM   1283 N N   . LEU A 1 160 ? 29.737  10.516  7.013   1.00 28.36  ? 547  LEU A N   1 
ATOM   1284 C CA  . LEU A 1 160 ? 29.231  11.874  7.207   1.00 28.88  ? 547  LEU A CA  1 
ATOM   1285 C C   . LEU A 1 160 ? 29.960  12.543  8.362   1.00 28.44  ? 547  LEU A C   1 
ATOM   1286 O O   . LEU A 1 160 ? 30.188  11.934  9.407   1.00 36.44  ? 547  LEU A O   1 
ATOM   1287 C CB  . LEU A 1 160 ? 27.720  11.880  7.471   1.00 23.69  ? 547  LEU A CB  1 
ATOM   1288 C CG  . LEU A 1 160 ? 26.812  11.353  6.359   1.00 27.39  ? 547  LEU A CG  1 
ATOM   1289 C CD1 . LEU A 1 160 ? 25.341  11.547  6.722   1.00 28.96  ? 547  LEU A CD1 1 
ATOM   1290 C CD2 . LEU A 1 160 ? 27.142  12.015  5.033   1.00 25.15  ? 547  LEU A CD2 1 
ATOM   1291 N N   . SER A 1 161 ? 30.322  13.802  8.164   1.00 30.22  ? 548  SER A N   1 
ATOM   1292 C CA  . SER A 1 161 ? 31.005  14.579  9.193   1.00 32.61  ? 548  SER A CA  1 
ATOM   1293 C C   . SER A 1 161 ? 30.057  14.967  10.324  1.00 29.43  ? 548  SER A C   1 
ATOM   1294 O O   . SER A 1 161 ? 28.829  14.853  10.197  1.00 21.55  ? 548  SER A O   1 
ATOM   1295 C CB  . SER A 1 161 ? 31.632  15.831  8.587   1.00 30.21  ? 548  SER A CB  1 
ATOM   1296 O OG  . SER A 1 161 ? 30.630  16.680  8.061   1.00 31.25  ? 548  SER A OG  1 
ATOM   1297 N N   . ARG A 1 162 ? 30.638  15.377  11.446  1.00 29.51  ? 549  ARG A N   1 
ATOM   1298 C CA  . ARG A 1 162 ? 29.869  15.938  12.552  1.00 33.96  ? 549  ARG A CA  1 
ATOM   1299 C C   . ARG A 1 162 ? 29.001  17.122  12.105  1.00 32.82  ? 549  ARG A C   1 
ATOM   1300 O O   . ARG A 1 162 ? 27.844  17.247  12.524  1.00 29.06  ? 549  ARG A O   1 
ATOM   1301 C CB  . ARG A 1 162 ? 30.810  16.367  13.678  1.00 40.59  ? 549  ARG A CB  1 
ATOM   1302 C CG  . ARG A 1 162 ? 31.541  15.206  14.340  1.00 50.51  ? 549  ARG A CG  1 
ATOM   1303 C CD  . ARG A 1 162 ? 32.808  15.670  15.044  1.00 57.84  ? 549  ARG A CD  1 
ATOM   1304 N NE  . ARG A 1 162 ? 33.766  16.231  14.096  1.00 66.13  ? 549  ARG A NE  1 
ATOM   1305 C CZ  . ARG A 1 162 ? 34.970  16.689  14.423  1.00 71.04  ? 549  ARG A CZ  1 
ATOM   1306 N NH1 . ARG A 1 162 ? 35.378  16.658  15.685  1.00 73.41  ? 549  ARG A NH1 1 
ATOM   1307 N NH2 . ARG A 1 162 ? 35.769  17.181  13.484  1.00 72.83  ? 549  ARG A NH2 1 
ATOM   1308 N N   . ASP A 1 163 ? 29.553  17.978  11.245  1.00 27.43  ? 550  ASP A N   1 
ATOM   1309 C CA  . ASP A 1 163 ? 28.825  19.151  10.750  1.00 27.84  ? 550  ASP A CA  1 
ATOM   1310 C C   . ASP A 1 163 ? 27.667  18.765  9.832   1.00 27.88  ? 550  ASP A C   1 
ATOM   1311 O O   . ASP A 1 163 ? 26.602  19.379  9.881   1.00 38.37  ? 550  ASP A O   1 
ATOM   1312 C CB  . ASP A 1 163 ? 29.770  20.111  10.022  1.00 32.22  ? 550  ASP A CB  1 
ATOM   1313 C CG  . ASP A 1 163 ? 30.553  20.998  10.980  1.00 49.69  ? 550  ASP A CG  1 
ATOM   1314 O OD1 . ASP A 1 163 ? 30.175  21.070  12.169  1.00 55.14  ? 550  ASP A OD1 1 
ATOM   1315 O OD2 . ASP A 1 163 ? 31.543  21.629  10.546  1.00 55.63  ? 550  ASP A OD2 1 
ATOM   1316 N N   . MET A 1 164 ? 27.878  17.754  8.996   1.00 25.46  ? 551  MET A N   1 
ATOM   1317 C CA  . MET A 1 164 ? 26.813  17.227  8.150   1.00 26.96  ? 551  MET A CA  1 
ATOM   1318 C C   . MET A 1 164 ? 25.689  16.630  8.995   1.00 22.49  ? 551  MET A C   1 
ATOM   1319 O O   . MET A 1 164 ? 24.516  16.898  8.747   1.00 24.95  ? 551  MET A O   1 
ATOM   1320 C CB  . MET A 1 164 ? 27.354  16.173  7.181   1.00 32.02  ? 551  MET A CB  1 
ATOM   1321 C CG  . MET A 1 164 ? 28.271  16.715  6.092   1.00 40.77  ? 551  MET A CG  1 
ATOM   1322 S SD  . MET A 1 164 ? 29.018  15.410  5.079   1.00 51.87  ? 551  MET A SD  1 
ATOM   1323 C CE  . MET A 1 164 ? 30.305  16.338  4.251   1.00 44.34  ? 551  MET A CE  1 
ATOM   1324 N N   . VAL A 1 165 ? 26.051  15.824  9.992   1.00 22.86  ? 552  VAL A N   1 
ATOM   1325 C CA  . VAL A 1 165 ? 25.062  15.210  10.887  1.00 23.85  ? 552  VAL A CA  1 
ATOM   1326 C C   . VAL A 1 165 ? 24.299  16.280  11.673  1.00 18.97  ? 552  VAL A C   1 
ATOM   1327 O O   . VAL A 1 165 ? 23.085  16.204  11.830  1.00 22.18  ? 552  VAL A O   1 
ATOM   1328 C CB  . VAL A 1 165 ? 25.727  14.211  11.860  1.00 25.49  ? 552  VAL A CB  1 
ATOM   1329 C CG1 . VAL A 1 165 ? 24.785  13.831  12.992  1.00 24.60  ? 552  VAL A CG1 1 
ATOM   1330 C CG2 . VAL A 1 165 ? 26.183  12.965  11.107  1.00 21.90  ? 552  VAL A CG2 1 
ATOM   1331 N N   . LYS A 1 166 ? 25.015  17.296  12.135  1.00 22.97  ? 553  LYS A N   1 
ATOM   1332 C CA  . LYS A 1 166 ? 24.395  18.420  12.827  1.00 25.74  ? 553  LYS A CA  1 
ATOM   1333 C C   . LYS A 1 166 ? 23.337  19.087  11.948  1.00 24.84  ? 553  LYS A C   1 
ATOM   1334 O O   . LYS A 1 166 ? 22.225  19.375  12.394  1.00 27.43  ? 553  LYS A O   1 
ATOM   1335 C CB  . LYS A 1 166 ? 25.459  19.436  13.234  1.00 37.14  ? 553  LYS A CB  1 
ATOM   1336 C CG  . LYS A 1 166 ? 25.136  20.224  14.484  1.00 47.53  ? 553  LYS A CG  1 
ATOM   1337 C CD  . LYS A 1 166 ? 26.309  21.113  14.872  1.00 54.59  ? 553  LYS A CD  1 
ATOM   1338 C CE  . LYS A 1 166 ? 27.622  20.337  14.854  1.00 58.42  ? 553  LYS A CE  1 
ATOM   1339 N NZ  . LYS A 1 166 ? 27.587  19.123  15.722  1.00 58.72  ? 553  LYS A NZ  1 
ATOM   1340 N N   . HIS A 1 167 ? 23.690  19.319  10.690  1.00 19.96  ? 554  HIS A N   1 
ATOM   1341 C CA  . HIS A 1 167 ? 22.762  19.916  9.749   1.00 16.65  ? 554  HIS A CA  1 
ATOM   1342 C C   . HIS A 1 167 ? 21.518  19.054  9.563   1.00 16.55  ? 554  HIS A C   1 
ATOM   1343 O O   . HIS A 1 167 ? 20.395  19.564  9.538   1.00 19.38  ? 554  HIS A O   1 
ATOM   1344 C CB  . HIS A 1 167 ? 23.439  20.146  8.401   1.00 24.26  ? 554  HIS A CB  1 
ATOM   1345 C CG  . HIS A 1 167 ? 22.538  20.764  7.382   1.00 28.07  ? 554  HIS A CG  1 
ATOM   1346 N ND1 . HIS A 1 167 ? 21.959  22.002  7.557   1.00 26.09  ? 554  HIS A ND1 1 
ATOM   1347 C CD2 . HIS A 1 167 ? 22.098  20.308  6.185   1.00 27.95  ? 554  HIS A CD2 1 
ATOM   1348 C CE1 . HIS A 1 167 ? 21.213  22.289  6.506   1.00 24.18  ? 554  HIS A CE1 1 
ATOM   1349 N NE2 . HIS A 1 167 ? 21.279  21.277  5.659   1.00 23.21  ? 554  HIS A NE2 1 
ATOM   1350 N N   . LEU A 1 168 ? 21.719  17.748  9.437   1.00 16.80  ? 555  LEU A N   1 
ATOM   1351 C CA  . LEU A 1 168 ? 20.606  16.830  9.247   1.00 19.38  ? 555  LEU A CA  1 
ATOM   1352 C C   . LEU A 1 168 ? 19.706  16.809  10.471  1.00 18.11  ? 555  LEU A C   1 
ATOM   1353 O O   . LEU A 1 168 ? 18.487  16.767  10.351  1.00 17.52  ? 555  LEU A O   1 
ATOM   1354 C CB  . LEU A 1 168 ? 21.115  15.424  8.944   1.00 22.31  ? 555  LEU A CB  1 
ATOM   1355 C CG  . LEU A 1 168 ? 21.746  15.280  7.563   1.00 32.22  ? 555  LEU A CG  1 
ATOM   1356 C CD1 . LEU A 1 168 ? 22.460  13.941  7.444   1.00 35.12  ? 555  LEU A CD1 1 
ATOM   1357 C CD2 . LEU A 1 168 ? 20.682  15.428  6.492   1.00 28.37  ? 555  LEU A CD2 1 
ATOM   1358 N N   . ASN A 1 169 ? 20.308  16.836  11.651  1.00 21.15  ? 556  ASN A N   1 
ATOM   1359 C CA  . ASN A 1 169 ? 19.519  16.953  12.869  1.00 20.32  ? 556  ASN A CA  1 
ATOM   1360 C C   . ASN A 1 169 ? 18.790  18.299  12.957  1.00 25.19  ? 556  ASN A C   1 
ATOM   1361 O O   . ASN A 1 169 ? 17.690  18.372  13.503  1.00 28.83  ? 556  ASN A O   1 
ATOM   1362 C CB  . ASN A 1 169 ? 20.404  16.735  14.094  1.00 18.48  ? 556  ASN A CB  1 
ATOM   1363 C CG  . ASN A 1 169 ? 20.792  15.267  14.274  1.00 27.31  ? 556  ASN A CG  1 
ATOM   1364 O OD1 . ASN A 1 169 ? 20.022  14.370  13.939  1.00 29.89  ? 556  ASN A OD1 1 
ATOM   1365 N ND2 . ASN A 1 169 ? 21.987  15.023  14.795  1.00 25.21  ? 556  ASN A ND2 1 
ATOM   1366 N N   . SER A 1 170 ? 19.383  19.354  12.400  1.00 20.44  ? 557  SER A N   1 
ATOM   1367 C CA  . SER A 1 170 ? 18.757  20.677  12.448  1.00 22.28  ? 557  SER A CA  1 
ATOM   1368 C C   . SER A 1 170 ? 17.496  20.714  11.606  1.00 20.36  ? 557  SER A C   1 
ATOM   1369 O O   . SER A 1 170 ? 16.485  21.265  12.023  1.00 16.60  ? 557  SER A O   1 
ATOM   1370 C CB  . SER A 1 170 ? 19.716  21.774  11.972  1.00 19.67  ? 557  SER A CB  1 
ATOM   1371 O OG  . SER A 1 170 ? 20.881  21.823  12.773  1.00 36.65  ? 557  SER A OG  1 
ATOM   1372 N N   . ILE A 1 171 ? 17.552  20.134  10.416  1.00 16.98  ? 558  ILE A N   1 
ATOM   1373 C CA  . ILE A 1 171 ? 16.399  20.207  9.534   1.00 23.92  ? 558  ILE A CA  1 
ATOM   1374 C C   . ILE A 1 171 ? 15.318  19.218  9.970   1.00 21.84  ? 558  ILE A C   1 
ATOM   1375 O O   . ILE A 1 171 ? 14.153  19.389  9.636   1.00 25.41  ? 558  ILE A O   1 
ATOM   1376 C CB  . ILE A 1 171 ? 16.787  19.965  8.057   1.00 25.38  ? 558  ILE A CB  1 
ATOM   1377 C CG1 . ILE A 1 171 ? 17.303  18.547  7.840   1.00 26.84  ? 558  ILE A CG1 1 
ATOM   1378 C CG2 . ILE A 1 171 ? 17.829  20.987  7.604   1.00 15.65  ? 558  ILE A CG2 1 
ATOM   1379 C CD1 . ILE A 1 171 ? 17.623  18.260  6.390   1.00 29.17  ? 558  ILE A CD1 1 
ATOM   1380 N N   . GLU A 1 172 ? 15.697  18.194  10.729  1.00 21.88  ? 559  GLU A N   1 
ATOM   1381 C CA  . GLU A 1 172 ? 14.701  17.316  11.333  1.00 21.80  ? 559  GLU A CA  1 
ATOM   1382 C C   . GLU A 1 172 ? 13.949  18.081  12.417  1.00 18.74  ? 559  GLU A C   1 
ATOM   1383 O O   . GLU A 1 172 ? 12.718  18.038  12.494  1.00 12.68  ? 559  GLU A O   1 
ATOM   1384 C CB  . GLU A 1 172 ? 15.345  16.059  11.920  1.00 23.96  ? 559  GLU A CB  1 
ATOM   1385 C CG  . GLU A 1 172 ? 14.345  15.138  12.600  1.00 28.59  ? 559  GLU A CG  1 
ATOM   1386 C CD  . GLU A 1 172 ? 15.007  14.009  13.372  1.00 40.74  ? 559  GLU A CD  1 
ATOM   1387 O OE1 . GLU A 1 172 ? 15.442  14.248  14.523  1.00 39.73  ? 559  GLU A OE1 1 
ATOM   1388 O OE2 . GLU A 1 172 ? 15.084  12.883  12.830  1.00 38.90  ? 559  GLU A OE2 1 
ATOM   1389 N N   . GLU A 1 173 ? 14.706  18.797  13.243  1.00 16.77  ? 560  GLU A N   1 
ATOM   1390 C CA  . GLU A 1 173 ? 14.127  19.667  14.261  1.00 21.19  ? 560  GLU A CA  1 
ATOM   1391 C C   . GLU A 1 173 ? 13.219  20.733  13.655  1.00 16.52  ? 560  GLU A C   1 
ATOM   1392 O O   . GLU A 1 173 ? 12.171  21.045  14.217  1.00 17.69  ? 560  GLU A O   1 
ATOM   1393 C CB  . GLU A 1 173 ? 15.229  20.324  15.091  1.00 20.99  ? 560  GLU A CB  1 
ATOM   1394 C CG  . GLU A 1 173 ? 16.020  19.331  15.929  1.00 30.38  ? 560  GLU A CG  1 
ATOM   1395 C CD  . GLU A 1 173 ? 16.891  20.005  16.968  1.00 36.17  ? 560  GLU A CD  1 
ATOM   1396 O OE1 . GLU A 1 173 ? 16.772  21.238  17.130  1.00 38.96  ? 560  GLU A OE1 1 
ATOM   1397 O OE2 . GLU A 1 173 ? 17.687  19.300  17.627  1.00 38.77  ? 560  GLU A OE2 1 
ATOM   1398 N N   . GLN A 1 174 ? 13.616  21.277  12.507  1.00 18.03  ? 561  GLN A N   1 
ATOM   1399 C CA  . GLN A 1 174 ? 12.811  22.283  11.818  1.00 20.32  ? 561  GLN A CA  1 
ATOM   1400 C C   . GLN A 1 174 ? 11.462  21.708  11.399  1.00 15.60  ? 561  GLN A C   1 
ATOM   1401 O O   . GLN A 1 174 ? 10.437  22.389  11.445  1.00 19.71  ? 561  GLN A O   1 
ATOM   1402 C CB  . GLN A 1 174 ? 13.534  22.819  10.582  1.00 21.65  ? 561  GLN A CB  1 
ATOM   1403 C CG  . GLN A 1 174 ? 14.712  23.723  10.862  1.00 32.67  ? 561  GLN A CG  1 
ATOM   1404 C CD  . GLN A 1 174 ? 15.341  24.231  9.584   1.00 37.33  ? 561  GLN A CD  1 
ATOM   1405 O OE1 . GLN A 1 174 ? 14.658  24.401  8.571   1.00 34.90  ? 561  GLN A OE1 1 
ATOM   1406 N NE2 . GLN A 1 174 ? 16.648  24.467  9.616   1.00 35.70  ? 561  GLN A NE2 1 
ATOM   1407 N N   . ILE A 1 175 ? 11.475  20.452  10.975  1.00 17.67  ? 562  ILE A N   1 
ATOM   1408 C CA  . ILE A 1 175 ? 10.252  19.775  10.552  1.00 18.38  ? 562  ILE A CA  1 
ATOM   1409 C C   . ILE A 1 175 ? 9.369   19.498  11.762  1.00 14.81  ? 562  ILE A C   1 
ATOM   1410 O O   . ILE A 1 175 ? 8.167   19.784  11.759  1.00 23.58  ? 562  ILE A O   1 
ATOM   1411 C CB  . ILE A 1 175 ? 10.574  18.464  9.816   1.00 13.74  ? 562  ILE A CB  1 
ATOM   1412 C CG1 . ILE A 1 175 ? 11.302  18.777  8.508   1.00 21.18  ? 562  ILE A CG1 1 
ATOM   1413 C CG2 . ILE A 1 175 ? 9.303   17.643  9.563   1.00 11.94  ? 562  ILE A CG2 1 
ATOM   1414 C CD1 . ILE A 1 175 ? 11.928  17.568  7.830   1.00 20.78  ? 562  ILE A CD1 1 
ATOM   1415 N N   . LEU A 1 176 ? 9.985   18.946  12.799  1.00 14.80  ? 563  LEU A N   1 
ATOM   1416 C CA  . LEU A 1 176 ? 9.286   18.612  14.035  1.00 17.77  ? 563  LEU A CA  1 
ATOM   1417 C C   . LEU A 1 176 ? 8.675   19.827  14.737  1.00 18.89  ? 563  LEU A C   1 
ATOM   1418 O O   . LEU A 1 176 ? 7.594   19.727  15.309  1.00 16.75  ? 563  LEU A O   1 
ATOM   1419 C CB  . LEU A 1 176 ? 10.239  17.902  14.992  1.00 17.12  ? 563  LEU A CB  1 
ATOM   1420 C CG  . LEU A 1 176 ? 10.762  16.557  14.492  1.00 22.09  ? 563  LEU A CG  1 
ATOM   1421 C CD1 . LEU A 1 176 ? 11.735  15.947  15.502  1.00 17.19  ? 563  LEU A CD1 1 
ATOM   1422 C CD2 . LEU A 1 176 ? 9.592   15.628  14.206  1.00 14.17  ? 563  LEU A CD2 1 
ATOM   1423 N N   . GLU A 1 177 ? 9.382   20.957  14.713  1.00 19.43  ? 564  GLU A N   1 
ATOM   1424 C CA  . GLU A 1 177 ? 8.951   22.152  15.444  1.00 21.89  ? 564  GLU A CA  1 
ATOM   1425 C C   . GLU A 1 177 ? 7.916   23.020  14.719  1.00 22.27  ? 564  GLU A C   1 
ATOM   1426 O O   . GLU A 1 177 ? 7.111   23.677  15.372  1.00 22.81  ? 564  GLU A O   1 
ATOM   1427 C CB  . GLU A 1 177 ? 10.169  23.019  15.811  1.00 14.86  ? 564  GLU A CB  1 
ATOM   1428 C CG  . GLU A 1 177 ? 10.739  23.833  14.666  1.00 22.00  ? 564  GLU A CG  1 
ATOM   1429 C CD  . GLU A 1 177 ? 12.107  24.423  14.977  1.00 25.81  ? 564  GLU A CD  1 
ATOM   1430 O OE1 . GLU A 1 177 ? 12.627  24.201  16.091  1.00 26.97  ? 564  GLU A OE1 1 
ATOM   1431 O OE2 . GLU A 1 177 ? 12.664  25.111  14.096  1.00 27.48  1 564  GLU A OE2 1 
ATOM   1432 N N   . SER A 1 178 ? 7.988   23.090  13.389  1.00 13.33  ? 565  SER A N   1 
ATOM   1433 C CA  . SER A 1 178 ? 7.086   23.946  12.618  1.00 24.84  ? 565  SER A CA  1 
ATOM   1434 C C   . SER A 1 178 ? 6.515   23.270  11.361  1.00 20.67  ? 565  SER A C   1 
ATOM   1435 O O   . SER A 1 178 ? 5.296   23.188  11.191  1.00 17.85  ? 565  SER A O   1 
ATOM   1436 C CB  . SER A 1 178 ? 7.780   25.273  12.245  1.00 13.49  ? 565  SER A CB  1 
ATOM   1437 O OG  . SER A 1 178 ? 8.861   25.075  11.356  1.00 30.99  ? 565  SER A OG  1 
ATOM   1438 N N   . LEU A 1 179 ? 7.400   22.864  10.452  1.00 11.98  ? 566  LEU A N   1 
ATOM   1439 C CA  . LEU A 1 179 ? 7.002   22.495  9.084   1.00 23.68  ? 566  LEU A CA  1 
ATOM   1440 C C   . LEU A 1 179 ? 5.944   21.394  8.967   1.00 20.38  ? 566  LEU A C   1 
ATOM   1441 O O   . LEU A 1 179 ? 5.075   21.463  8.102   1.00 19.49  ? 566  LEU A O   1 
ATOM   1442 C CB  . LEU A 1 179 ? 8.228   22.077  8.280   1.00 12.23  ? 566  LEU A CB  1 
ATOM   1443 C CG  . LEU A 1 179 ? 9.329   23.129  8.160   1.00 24.41  ? 566  LEU A CG  1 
ATOM   1444 C CD1 . LEU A 1 179 ? 10.467  22.591  7.303   1.00 13.74  ? 566  LEU A CD1 1 
ATOM   1445 C CD2 . LEU A 1 179 ? 8.773   24.444  7.591   1.00 16.43  ? 566  LEU A CD2 1 
ATOM   1446 N N   . ALA A 1 180 ? 6.009   20.386  9.827   1.00 22.57  ? 567  ALA A N   1 
ATOM   1447 C CA  . ALA A 1 180 ? 5.044   19.290  9.759   1.00 23.59  ? 567  ALA A CA  1 
ATOM   1448 C C   . ALA A 1 180 ? 3.683   19.709  10.302  1.00 20.42  ? 567  ALA A C   1 
ATOM   1449 O O   . ALA A 1 180 ? 2.723   18.948  10.224  1.00 16.34  ? 567  ALA A O   1 
ATOM   1450 C CB  . ALA A 1 180 ? 5.560   18.078  10.516  1.00 23.13  ? 567  ALA A CB  1 
ATOM   1451 N N   . TRP A 1 181 ? 3.617   20.907  10.881  1.00 15.49  ? 568  TRP A N   1 
ATOM   1452 C CA  . TRP A 1 181 ? 2.385   21.414  11.484  1.00 15.50  ? 568  TRP A CA  1 
ATOM   1453 C C   . TRP A 1 181 ? 1.611   22.392  10.606  1.00 16.96  ? 568  TRP A C   1 
ATOM   1454 O O   . TRP A 1 181 ? 0.564   22.893  11.017  1.00 14.41  ? 568  TRP A O   1 
ATOM   1455 C CB  . TRP A 1 181 ? 2.693   22.079  12.824  1.00 17.74  ? 568  TRP A CB  1 
ATOM   1456 C CG  . TRP A 1 181 ? 3.370   21.168  13.791  1.00 22.01  ? 568  TRP A CG  1 
ATOM   1457 C CD1 . TRP A 1 181 ? 4.710   21.079  14.039  1.00 21.17  ? 568  TRP A CD1 1 
ATOM   1458 C CD2 . TRP A 1 181 ? 2.738   20.213  14.649  1.00 18.34  ? 568  TRP A CD2 1 
ATOM   1459 N NE1 . TRP A 1 181 ? 4.949   20.128  15.000  1.00 22.17  ? 568  TRP A NE1 1 
ATOM   1460 C CE2 . TRP A 1 181 ? 3.754   19.582  15.391  1.00 18.16  ? 568  TRP A CE2 1 
ATOM   1461 C CE3 . TRP A 1 181 ? 1.409   19.837  14.868  1.00 21.62  ? 568  TRP A CE3 1 
ATOM   1462 C CZ2 . TRP A 1 181 ? 3.484   18.594  16.338  1.00 18.32  ? 568  TRP A CZ2 1 
ATOM   1463 C CZ3 . TRP A 1 181 ? 1.143   18.853  15.803  1.00 18.82  ? 568  TRP A CZ3 1 
ATOM   1464 C CH2 . TRP A 1 181 ? 2.177   18.240  16.523  1.00 14.49  ? 568  TRP A CH2 1 
ATOM   1465 N N   . SER A 1 182 ? 2.126   22.676  9.414   1.00 13.88  ? 569  SER A N   1 
ATOM   1466 C CA  . SER A 1 182 ? 1.439   23.574  8.493   1.00 20.14  ? 569  SER A CA  1 
ATOM   1467 C C   . SER A 1 182 ? 0.068   23.007  8.155   1.00 25.93  ? 569  SER A C   1 
ATOM   1468 O O   . SER A 1 182 ? -0.130  21.794  8.196   1.00 26.21  ? 569  SER A O   1 
ATOM   1469 C CB  . SER A 1 182 ? 2.252   23.779  7.213   1.00 22.85  ? 569  SER A CB  1 
ATOM   1470 O OG  . SER A 1 182 ? 2.171   22.630  6.388   1.00 26.62  ? 569  SER A OG  1 
ATOM   1471 N N   . HIS A 1 183 ? -0.876  23.885  7.833   1.00 19.76  ? 570  HIS A N   1 
ATOM   1472 C CA  . HIS A 1 183 ? -2.254  23.472  7.601   1.00 25.03  ? 570  HIS A CA  1 
ATOM   1473 C C   . HIS A 1 183 ? -2.409  22.422  6.495   1.00 21.78  ? 570  HIS A C   1 
ATOM   1474 O O   . HIS A 1 183 ? -3.377  21.673  6.492   1.00 22.90  ? 570  HIS A O   1 
ATOM   1475 C CB  . HIS A 1 183 ? -3.118  24.691  7.267   1.00 26.88  ? 570  HIS A CB  1 
ATOM   1476 C CG  . HIS A 1 183 ? -2.774  25.329  5.958   1.00 34.23  ? 570  HIS A CG  1 
ATOM   1477 N ND1 . HIS A 1 183 ? -1.931  26.416  5.858   1.00 35.04  ? 570  HIS A ND1 1 
ATOM   1478 C CD2 . HIS A 1 183 ? -3.157  25.032  4.694   1.00 37.38  ? 570  HIS A CD2 1 
ATOM   1479 C CE1 . HIS A 1 183 ? -1.811  26.761  4.588   1.00 38.63  ? 570  HIS A CE1 1 
ATOM   1480 N NE2 . HIS A 1 183 ? -2.545  25.938  3.861   1.00 41.75  ? 570  HIS A NE2 1 
ATOM   1481 N N   . ASP A 1 184 ? -1.487  22.396  5.540   1.00 14.34  ? 571  ASP A N   1 
ATOM   1482 C CA  . ASP A 1 184 ? -1.568  21.433  4.442   1.00 26.99  ? 571  ASP A CA  1 
ATOM   1483 C C   . ASP A 1 184 ? -0.688  20.185  4.647   1.00 20.46  ? 571  ASP A C   1 
ATOM   1484 O O   . ASP A 1 184 ? -0.509  19.387  3.732   1.00 26.25  ? 571  ASP A O   1 
ATOM   1485 C CB  . ASP A 1 184 ? -1.235  22.116  3.109   1.00 28.32  ? 571  ASP A CB  1 
ATOM   1486 C CG  . ASP A 1 184 ? 0.233   22.416  2.956   1.00 37.66  ? 571  ASP A CG  1 
ATOM   1487 O OD1 . ASP A 1 184 ? 0.908   22.621  3.984   1.00 40.08  ? 571  ASP A OD1 1 
ATOM   1488 O OD2 . ASP A 1 184 ? 0.710   22.444  1.801   1.00 49.39  ? 571  ASP A OD2 1 
ATOM   1489 N N   . SER A 1 185 ? -0.095  20.054  5.827   1.00 17.83  ? 572  SER A N   1 
ATOM   1490 C CA  . SER A 1 185 ? 0.754   18.903  6.141   1.00 14.59  ? 572  SER A CA  1 
ATOM   1491 C C   . SER A 1 185 ? -0.009  17.577  6.191   1.00 16.01  ? 572  SER A C   1 
ATOM   1492 O O   . SER A 1 185 ? -1.164  17.529  6.609   1.00 12.37  ? 572  SER A O   1 
ATOM   1493 C CB  . SER A 1 185 ? 1.453   19.122  7.479   1.00 19.45  ? 572  SER A CB  1 
ATOM   1494 O OG  . SER A 1 185 ? 2.102   17.938  7.911   1.00 20.09  ? 572  SER A OG  1 
ATOM   1495 N N   . ALA A 1 186 ? 0.658   16.499  5.798   1.00 13.24  ? 573  ALA A N   1 
ATOM   1496 C CA  . ALA A 1 186 ? 0.064   15.163  5.834   1.00 16.63  ? 573  ALA A CA  1 
ATOM   1497 C C   . ALA A 1 186 ? -0.199  14.685  7.274   1.00 17.43  ? 573  ALA A C   1 
ATOM   1498 O O   . ALA A 1 186 ? -0.933  13.721  7.496   1.00 14.40  ? 573  ALA A O   1 
ATOM   1499 C CB  . ALA A 1 186 ? 0.961   14.169  5.097   1.00 13.21  ? 573  ALA A CB  1 
ATOM   1500 N N   . LEU A 1 187 ? 0.399   15.362  8.246   1.00 14.25  ? 574  LEU A N   1 
ATOM   1501 C CA  . LEU A 1 187 ? 0.117   15.072  9.648   1.00 13.41  ? 574  LEU A CA  1 
ATOM   1502 C C   . LEU A 1 187 ? -1.381  15.070  9.946   1.00 16.52  ? 574  LEU A C   1 
ATOM   1503 O O   . LEU A 1 187 ? -1.892  14.145  10.584  1.00 21.05  ? 574  LEU A O   1 
ATOM   1504 C CB  . LEU A 1 187 ? 0.799   16.088  10.548  1.00 13.42  ? 574  LEU A CB  1 
ATOM   1505 C CG  . LEU A 1 187 ? 0.314   16.047  11.996  1.00 14.60  ? 574  LEU A CG  1 
ATOM   1506 C CD1 . LEU A 1 187 ? 0.696   14.729  12.666  1.00 12.20  ? 574  LEU A CD1 1 
ATOM   1507 C CD2 . LEU A 1 187 ? 0.890   17.228  12.744  1.00 18.06  ? 574  LEU A CD2 1 
ATOM   1508 N N   . TRP A 1 188 ? -2.076  16.105  9.473   1.00 12.23  ? 575  TRP A N   1 
ATOM   1509 C CA  . TRP A 1 188 ? -3.506  16.254  9.734   1.00 15.06  ? 575  TRP A CA  1 
ATOM   1510 C C   . TRP A 1 188 ? -4.319  15.107  9.131   1.00 15.32  ? 575  TRP A C   1 
ATOM   1511 O O   . TRP A 1 188 ? -5.290  14.654  9.728   1.00 18.11  ? 575  TRP A O   1 
ATOM   1512 C CB  . TRP A 1 188 ? -3.995  17.612  9.217   1.00 14.93  ? 575  TRP A CB  1 
ATOM   1513 C CG  . TRP A 1 188 ? -3.229  18.730  9.848   1.00 14.14  ? 575  TRP A CG  1 
ATOM   1514 C CD1 . TRP A 1 188 ? -2.338  19.569  9.237   1.00 13.97  ? 575  TRP A CD1 1 
ATOM   1515 C CD2 . TRP A 1 188 ? -3.238  19.092  11.233  1.00 20.05  ? 575  TRP A CD2 1 
ATOM   1516 N NE1 . TRP A 1 188 ? -1.806  20.446  10.158  1.00 15.87  ? 575  TRP A NE1 1 
ATOM   1517 C CE2 . TRP A 1 188 ? -2.344  20.174  11.391  1.00 26.38  ? 575  TRP A CE2 1 
ATOM   1518 C CE3 . TRP A 1 188 ? -3.923  18.612  12.358  1.00 14.93  ? 575  TRP A CE3 1 
ATOM   1519 C CZ2 . TRP A 1 188 ? -2.119  20.785  12.624  1.00 25.36  ? 575  TRP A CZ2 1 
ATOM   1520 C CZ3 . TRP A 1 188 ? -3.700  19.217  13.581  1.00 15.61  ? 575  TRP A CZ3 1 
ATOM   1521 C CH2 . TRP A 1 188 ? -2.804  20.294  13.704  1.00 27.15  ? 575  TRP A CH2 1 
ATOM   1522 N N   . GLU A 1 189 ? -3.907  14.640  7.957   1.00 18.38  ? 576  GLU A N   1 
ATOM   1523 C CA  . GLU A 1 189 ? -4.516  13.477  7.323   1.00 19.76  ? 576  GLU A CA  1 
ATOM   1524 C C   . GLU A 1 189 ? -4.401  12.244  8.207   1.00 21.42  ? 576  GLU A C   1 
ATOM   1525 O O   . GLU A 1 189 ? -5.368  11.496  8.392   1.00 17.91  ? 576  GLU A O   1 
ATOM   1526 C CB  . GLU A 1 189 ? -3.861  13.197  5.970   1.00 19.82  ? 576  GLU A CB  1 
ATOM   1527 C CG  . GLU A 1 189 ? -4.018  14.324  4.955   1.00 22.34  ? 576  GLU A CG  1 
ATOM   1528 C CD  . GLU A 1 189 ? -3.421  13.981  3.602   1.00 34.80  ? 576  GLU A CD  1 
ATOM   1529 O OE1 . GLU A 1 189 ? -3.825  12.954  3.010   1.00 36.46  ? 576  GLU A OE1 1 
ATOM   1530 O OE2 . GLU A 1 189 ? -2.544  14.739  3.131   1.00 41.13  1 576  GLU A OE2 1 
ATOM   1531 N N   . ALA A 1 190 ? -3.201  12.042  8.740   1.00 12.00  ? 577  ALA A N   1 
ATOM   1532 C CA  . ALA A 1 190 ? -2.899  10.900  9.595   1.00 18.36  ? 577  ALA A CA  1 
ATOM   1533 C C   . ALA A 1 190 ? -3.695  10.950  10.893  1.00 21.40  ? 577  ALA A C   1 
ATOM   1534 O O   . ALA A 1 190 ? -4.195  9.926   11.363  1.00 20.57  ? 577  ALA A O   1 
ATOM   1535 C CB  . ALA A 1 190 ? -1.400  10.849  9.893   1.00 18.74  ? 577  ALA A CB  1 
ATOM   1536 N N   . LEU A 1 191 ? -3.809  12.142  11.472  1.00 12.94  ? 578  LEU A N   1 
ATOM   1537 C CA  . LEU A 1 191 ? -4.596  12.310  12.692  1.00 24.88  ? 578  LEU A CA  1 
ATOM   1538 C C   . LEU A 1 191 ? -6.062  12.052  12.381  1.00 20.23  ? 578  LEU A C   1 
ATOM   1539 O O   . LEU A 1 191 ? -6.792  11.477  13.193  1.00 16.81  ? 578  LEU A O   1 
ATOM   1540 C CB  . LEU A 1 191 ? -4.411  13.713  13.290  1.00 15.31  ? 578  LEU A CB  1 
ATOM   1541 C CG  . LEU A 1 191 ? -3.176  13.903  14.185  1.00 23.10  ? 578  LEU A CG  1 
ATOM   1542 C CD1 . LEU A 1 191 ? -3.028  15.350  14.669  1.00 18.57  ? 578  LEU A CD1 1 
ATOM   1543 C CD2 . LEU A 1 191 ? -3.236  12.957  15.370  1.00 26.33  ? 578  LEU A CD2 1 
ATOM   1544 N N   . GLN A 1 192 ? -6.476  12.475  11.190  1.00 14.32  ? 579  GLN A N   1 
ATOM   1545 C CA  . GLN A 1 192 ? -7.866  12.358  10.761  1.00 14.16  ? 579  GLN A CA  1 
ATOM   1546 C C   . GLN A 1 192 ? -8.330  10.900  10.700  1.00 14.54  ? 579  GLN A C   1 
ATOM   1547 O O   . GLN A 1 192 ? -9.395  10.564  11.214  1.00 16.93  ? 579  GLN A O   1 
ATOM   1548 C CB  . GLN A 1 192 ? -8.042  13.033  9.398   1.00 14.72  ? 579  GLN A CB  1 
ATOM   1549 C CG  . GLN A 1 192 ? -9.467  13.092  8.872   1.00 18.38  ? 579  GLN A CG  1 
ATOM   1550 C CD  . GLN A 1 192 ? -9.534  13.741  7.506   1.00 19.75  ? 579  GLN A CD  1 
ATOM   1551 O OE1 . GLN A 1 192 ? -9.219  14.920  7.345   1.00 29.14  ? 579  GLN A OE1 1 
ATOM   1552 N NE2 . GLN A 1 192 ? -9.914  12.966  6.507   1.00 14.20  ? 579  GLN A NE2 1 
ATOM   1553 N N   . VAL A 1 193 ? -7.534  10.023  10.091  1.00 18.94  ? 580  VAL A N   1 
ATOM   1554 C CA  . VAL A 1 193 ? -7.959  8.629   9.973   1.00 18.56  ? 580  VAL A CA  1 
ATOM   1555 C C   . VAL A 1 193 ? -7.846  7.927   11.330  1.00 21.55  ? 580  VAL A C   1 
ATOM   1556 O O   . VAL A 1 193 ? -8.375  6.835   11.531  1.00 24.54  ? 580  VAL A O   1 
ATOM   1557 C CB  . VAL A 1 193 ? -7.145  7.867   8.902   1.00 22.15  ? 580  VAL A CB  1 
ATOM   1558 C CG1 . VAL A 1 193 ? -7.140  8.648   7.583   1.00 14.45  ? 580  VAL A CG1 1 
ATOM   1559 C CG2 . VAL A 1 193 ? -5.726  7.592   9.386   1.00 25.86  ? 580  VAL A CG2 1 
ATOM   1560 N N   . SER A 1 194 ? -7.158  8.581   12.259  1.00 24.81  ? 581  SER A N   1 
ATOM   1561 C CA  . SER A 1 194 ? -7.048  8.130   13.644  1.00 25.09  ? 581  SER A CA  1 
ATOM   1562 C C   . SER A 1 194 ? -8.110  8.771   14.539  1.00 24.23  ? 581  SER A C   1 
ATOM   1563 O O   . SER A 1 194 ? -7.991  8.743   15.764  1.00 24.44  ? 581  SER A O   1 
ATOM   1564 C CB  . SER A 1 194 ? -5.648  8.399   14.189  1.00 31.23  ? 581  SER A CB  1 
ATOM   1565 O OG  . SER A 1 194 ? -4.729  7.453   13.668  1.00 38.85  ? 581  SER A OG  1 
ATOM   1566 N N   . ALA A 1 195 ? -9.088  9.424   13.915  1.00 27.53  ? 582  ALA A N   1 
ATOM   1567 C CA  . ALA A 1 195 ? -10.196 10.068  14.623  1.00 22.84  ? 582  ALA A CA  1 
ATOM   1568 C C   . ALA A 1 195 ? -9.690  11.222  15.465  1.00 22.32  ? 582  ALA A C   1 
ATOM   1569 O O   . ALA A 1 195 ? -10.214 11.487  16.543  1.00 29.27  ? 582  ALA A O   1 
ATOM   1570 C CB  . ALA A 1 195 ? -10.952 9.062   15.495  1.00 23.69  ? 582  ALA A CB  1 
ATOM   1571 N N   . ASN A 1 196 ? -8.647  11.883  14.967  1.00 23.73  ? 583  ASN A N   1 
ATOM   1572 C CA  . ASN A 1 196 ? -8.037  13.030  15.632  1.00 28.49  ? 583  ASN A CA  1 
ATOM   1573 C C   . ASN A 1 196 ? -7.645  12.739  17.070  1.00 35.34  ? 583  ASN A C   1 
ATOM   1574 O O   . ASN A 1 196 ? -7.646  13.626  17.924  1.00 41.54  ? 583  ASN A O   1 
ATOM   1575 C CB  . ASN A 1 196 ? -8.976  14.232  15.562  1.00 25.04  ? 583  ASN A CB  1 
ATOM   1576 C CG  . ASN A 1 196 ? -9.115  14.762  14.155  1.00 25.76  ? 583  ASN A CG  1 
ATOM   1577 O OD1 . ASN A 1 196 ? -8.193  14.642  13.345  1.00 31.97  ? 583  ASN A OD1 1 
ATOM   1578 N ND2 . ASN A 1 196 ? -10.268 15.338  13.847  1.00 22.35  ? 583  ASN A ND2 1 
ATOM   1579 N N   . LYS A 1 197 ? -7.280  11.489  17.320  1.00 30.04  ? 584  LYS A N   1 
ATOM   1580 C CA  . LYS A 1 197 ? -6.781  11.100  18.622  1.00 25.23  ? 584  LYS A CA  1 
ATOM   1581 C C   . LYS A 1 197 ? -5.270  11.276  18.622  1.00 28.62  ? 584  LYS A C   1 
ATOM   1582 O O   . LYS A 1 197 ? -4.546  10.559  17.934  1.00 36.33  ? 584  LYS A O   1 
ATOM   1583 C CB  . LYS A 1 197 ? -7.160  9.652   18.945  1.00 28.60  ? 584  LYS A CB  1 
ATOM   1584 C CG  . LYS A 1 197 ? -6.837  9.236   20.371  1.00 39.51  ? 584  LYS A CG  1 
ATOM   1585 C CD  . LYS A 1 197 ? -7.094  7.751   20.599  1.00 51.96  ? 584  LYS A CD  1 
ATOM   1586 C CE  . LYS A 1 197 ? -6.129  6.884   19.798  1.00 61.49  ? 584  LYS A CE  1 
ATOM   1587 N NZ  . LYS A 1 197 ? -4.702  7.143   20.155  1.00 65.86  ? 584  LYS A NZ  1 
ATOM   1588 N N   . VAL A 1 198 ? -4.804  12.248  19.391  1.00 29.01  ? 585  VAL A N   1 
ATOM   1589 C CA  . VAL A 1 198 ? -3.380  12.534  19.496  1.00 27.18  ? 585  VAL A CA  1 
ATOM   1590 C C   . VAL A 1 198 ? -2.746  11.645  20.559  1.00 31.70  ? 585  VAL A C   1 
ATOM   1591 O O   . VAL A 1 198 ? -3.218  11.595  21.693  1.00 29.74  ? 585  VAL A O   1 
ATOM   1592 C CB  . VAL A 1 198 ? -3.138  14.015  19.839  1.00 24.57  ? 585  VAL A CB  1 
ATOM   1593 C CG1 . VAL A 1 198 ? -1.654  14.303  19.972  1.00 24.19  ? 585  VAL A CG1 1 
ATOM   1594 C CG2 . VAL A 1 198 ? -3.785  14.914  18.783  1.00 22.84  ? 585  VAL A CG2 1 
ATOM   1595 N N   . PRO A 1 199 ? -1.675  10.928  20.196  1.00 36.27  ? 586  PRO A N   1 
ATOM   1596 C CA  . PRO A 1 199 ? -1.046  10.053  21.189  1.00 28.66  ? 586  PRO A CA  1 
ATOM   1597 C C   . PRO A 1 199 ? -0.409  10.843  22.333  1.00 31.90  ? 586  PRO A C   1 
ATOM   1598 O O   . PRO A 1 199 ? 0.265   11.844  22.094  1.00 27.01  ? 586  PRO A O   1 
ATOM   1599 C CB  . PRO A 1 199 ? 0.009   9.301   20.375  1.00 33.10  ? 586  PRO A CB  1 
ATOM   1600 C CG  . PRO A 1 199 ? 0.286   10.162  19.205  1.00 31.36  ? 586  PRO A CG  1 
ATOM   1601 C CD  . PRO A 1 199 ? -0.997  10.871  18.889  1.00 36.42  ? 586  PRO A CD  1 
ATOM   1602 N N   . THR A 1 200 ? -0.651  10.407  23.566  1.00 34.23  ? 587  THR A N   1 
ATOM   1603 C CA  . THR A 1 200 ? -0.042  11.036  24.733  1.00 32.73  ? 587  THR A CA  1 
ATOM   1604 C C   . THR A 1 200 ? 1.427   10.628  24.809  1.00 29.83  ? 587  THR A C   1 
ATOM   1605 O O   . THR A 1 200 ? 1.830   9.642   24.197  1.00 33.98  ? 587  THR A O   1 
ATOM   1606 C CB  . THR A 1 200 ? -0.763  10.650  26.041  1.00 33.16  ? 587  THR A CB  1 
ATOM   1607 O OG1 . THR A 1 200 ? -0.375  9.330   26.435  1.00 34.21  ? 587  THR A OG1 1 
ATOM   1608 C CG2 . THR A 1 200 ? -2.268  10.693  25.858  1.00 31.79  ? 587  THR A CG2 1 
ATOM   1609 N N   . CYS A 1 201 ? 2.228   11.391  25.546  1.00 30.08  ? 588  CYS A N   1 
ATOM   1610 C CA  . CYS A 1 201 ? 3.655   11.100  25.660  1.00 37.86  ? 588  CYS A CA  1 
ATOM   1611 C C   . CYS A 1 201 ? 3.904   9.692   26.199  1.00 36.02  ? 588  CYS A C   1 
ATOM   1612 O O   . CYS A 1 201 ? 4.732   8.952   25.667  1.00 36.52  ? 588  CYS A O   1 
ATOM   1613 C CB  . CYS A 1 201 ? 4.343   12.137  26.547  1.00 31.30  ? 588  CYS A CB  1 
ATOM   1614 S SG  . CYS A 1 201 ? 6.126   11.878  26.736  1.00 43.36  ? 588  CYS A SG  1 
ATOM   1615 N N   . GLU A 1 202 ? 3.170   9.328   27.244  1.00 34.88  ? 589  GLU A N   1 
ATOM   1616 C CA  . GLU A 1 202 ? 3.296   8.017   27.862  1.00 38.89  ? 589  GLU A CA  1 
ATOM   1617 C C   . GLU A 1 202 ? 3.046   6.897   26.853  1.00 37.00  ? 589  GLU A C   1 
ATOM   1618 O O   . GLU A 1 202 ? 3.710   5.862   26.878  1.00 39.67  ? 589  GLU A O   1 
ATOM   1619 C CB  . GLU A 1 202 ? 2.326   7.899   29.040  1.00 48.06  ? 589  GLU A CB  1 
ATOM   1620 C CG  . GLU A 1 202 ? 2.673   6.804   30.029  1.00 63.95  ? 589  GLU A CG  1 
ATOM   1621 C CD  . GLU A 1 202 ? 1.768   6.818   31.249  1.00 77.51  ? 589  GLU A CD  1 
ATOM   1622 O OE1 . GLU A 1 202 ? 0.755   6.085   31.250  1.00 82.40  ? 589  GLU A OE1 1 
ATOM   1623 O OE2 . GLU A 1 202 ? 2.070   7.565   32.206  1.00 78.13  ? 589  GLU A OE2 1 
ATOM   1624 N N   . GLU A 1 203 ? 2.095   7.119   25.955  1.00 34.31  ? 590  GLU A N   1 
ATOM   1625 C CA  . GLU A 1 203 ? 1.755   6.127   24.945  1.00 44.07  ? 590  GLU A CA  1 
ATOM   1626 C C   . GLU A 1 203 ? 2.904   5.851   23.972  1.00 51.08  ? 590  GLU A C   1 
ATOM   1627 O O   . GLU A 1 203 ? 3.178   4.694   23.656  1.00 51.72  ? 590  GLU A O   1 
ATOM   1628 C CB  . GLU A 1 203 ? 0.505   6.567   24.180  1.00 39.05  ? 590  GLU A CB  1 
ATOM   1629 C CG  . GLU A 1 203 ? -0.766  6.438   25.005  1.00 48.88  ? 590  GLU A CG  1 
ATOM   1630 C CD  . GLU A 1 203 ? -1.969  7.090   24.357  1.00 50.37  ? 590  GLU A CD  1 
ATOM   1631 O OE1 . GLU A 1 203 ? -1.792  8.100   23.651  1.00 52.65  ? 590  GLU A OE1 1 
ATOM   1632 O OE2 . GLU A 1 203 ? -3.097  6.594   24.562  1.00 54.66  ? 590  GLU A OE2 1 
ATOM   1633 N N   . VAL A 1 204 ? 3.570   6.898   23.488  1.00 33.85  ? 591  VAL A N   1 
ATOM   1634 C CA  . VAL A 1 204 ? 4.637   6.699   22.507  1.00 34.42  ? 591  VAL A CA  1 
ATOM   1635 C C   . VAL A 1 204 ? 6.073   6.590   23.048  1.00 35.85  ? 591  VAL A C   1 
ATOM   1636 O O   . VAL A 1 204 ? 6.964   6.173   22.311  1.00 45.97  ? 591  VAL A O   1 
ATOM   1637 C CB  . VAL A 1 204 ? 4.624   7.832   21.449  1.00 32.89  ? 591  VAL A CB  1 
ATOM   1638 C CG1 . VAL A 1 204 ? 3.293   7.848   20.711  1.00 31.70  ? 591  VAL A CG1 1 
ATOM   1639 C CG2 . VAL A 1 204 ? 4.896   9.179   22.098  1.00 31.98  ? 591  VAL A CG2 1 
ATOM   1640 N N   . ILE A 1 205 ? 6.320   6.926   24.313  1.00 41.41  ? 592  ILE A N   1 
ATOM   1641 C CA  . ILE A 1 205 ? 7.699   6.838   24.814  1.00 41.98  ? 592  ILE A CA  1 
ATOM   1642 C C   . ILE A 1 205 ? 7.963   5.491   25.464  1.00 46.39  ? 592  ILE A C   1 
ATOM   1643 O O   . ILE A 1 205 ? 9.035   5.255   26.014  1.00 48.32  ? 592  ILE A O   1 
ATOM   1644 C CB  . ILE A 1 205 ? 8.055   7.952   25.827  1.00 42.53  ? 592  ILE A CB  1 
ATOM   1645 C CG1 . ILE A 1 205 ? 7.268   7.791   27.131  1.00 46.53  ? 592  ILE A CG1 1 
ATOM   1646 C CG2 . ILE A 1 205 ? 7.878   9.321   25.196  1.00 45.60  ? 592  ILE A CG2 1 
ATOM   1647 C CD1 . ILE A 1 205 ? 7.712   8.727   28.240  1.00 41.41  ? 592  ILE A CD1 1 
ATOM   1648 N N   . PHE A 1 206 ? 6.973   4.611   25.407  1.00 52.34  ? 593  PHE A N   1 
ATOM   1649 C CA  . PHE A 1 206 ? 7.164   3.240   25.843  1.00 56.29  ? 593  PHE A CA  1 
ATOM   1650 C C   . PHE A 1 206 ? 6.744   2.296   24.724  1.00 57.73  ? 593  PHE A C   1 
ATOM   1651 O O   . PHE A 1 206 ? 5.776   2.558   24.008  1.00 55.79  ? 593  PHE A O   1 
ATOM   1652 C CB  . PHE A 1 206 ? 6.385   2.966   27.133  1.00 57.20  ? 593  PHE A CB  1 
ATOM   1653 C CG  . PHE A 1 206 ? 6.826   3.819   28.289  1.00 53.22  ? 593  PHE A CG  1 
ATOM   1654 C CD1 . PHE A 1 206 ? 8.077   3.640   28.861  1.00 49.71  ? 593  PHE A CD1 1 
ATOM   1655 C CD2 . PHE A 1 206 ? 5.999   4.807   28.797  1.00 50.36  ? 593  PHE A CD2 1 
ATOM   1656 C CE1 . PHE A 1 206 ? 8.492   4.431   29.915  1.00 44.78  ? 593  PHE A CE1 1 
ATOM   1657 C CE2 . PHE A 1 206 ? 6.409   5.599   29.857  1.00 48.17  ? 593  PHE A CE2 1 
ATOM   1658 C CZ  . PHE A 1 206 ? 7.656   5.412   30.414  1.00 43.31  ? 593  PHE A CZ  1 
ATOM   1659 N N   . PRO A 1 207 ? 7.497   1.214   24.568  1.00 62.20  ? 594  PRO A N   1 
ATOM   1660 C CA  . PRO A 1 207 ? 7.258   0.247   23.504  1.00 64.06  ? 594  PRO A CA  1 
ATOM   1661 C C   . PRO A 1 207 ? 5.905   -0.439  23.658  1.00 63.32  ? 594  PRO A C   1 
ATOM   1662 O O   . PRO A 1 207 ? 5.058   -0.366  22.766  1.00 65.32  ? 594  PRO A O   1 
ATOM   1663 C CB  . PRO A 1 207 ? 8.390   -0.767  23.691  1.00 20.00  ? 594  PRO A CB  1 
ATOM   1664 C CG  . PRO A 1 207 ? 8.680   -0.745  25.151  1.00 20.00  ? 594  PRO A CG  1 
ATOM   1665 C CD  . PRO A 1 207 ? 7.729   0.254   25.731  1.00 20.00  ? 594  PRO A CD  1 
ATOM   1666 N N   . ASN A 1 215 ? -5.576  -5.109  13.166  1.00 66.98  ? 780  ASN A N   1 
ATOM   1667 C CA  . ASN A 1 215 ? -5.983  -4.184  12.107  1.00 58.33  ? 780  ASN A CA  1 
ATOM   1668 C C   . ASN A 1 215 ? -5.978  -2.683  12.458  1.00 58.15  ? 780  ASN A C   1 
ATOM   1669 O O   . ASN A 1 215 ? -7.038  -2.076  12.577  1.00 57.37  ? 780  ASN A O   1 
ATOM   1670 C CB  . ASN A 1 215 ? -7.387  -4.591  11.636  1.00 53.49  ? 780  ASN A CB  1 
ATOM   1671 C CG  . ASN A 1 215 ? -7.772  -3.965  10.319  1.00 50.95  ? 780  ASN A CG  1 
ATOM   1672 O OD1 . ASN A 1 215 ? -6.944  -3.356  9.644   1.00 50.42  ? 780  ASN A OD1 1 
ATOM   1673 N ND2 . ASN A 1 215 ? -9.033  -4.124  9.936   1.00 54.29  ? 780  ASN A ND2 1 
ATOM   1674 N N   . ARG A 1 216 ? -4.786  -2.095  12.605  1.00 60.19  ? 781  ARG A N   1 
ATOM   1675 C CA  . ARG A 1 216 ? -4.606  -0.674  12.981  1.00 54.17  ? 781  ARG A CA  1 
ATOM   1676 C C   . ARG A 1 216 ? -4.988  0.307   11.872  1.00 45.96  ? 781  ARG A C   1 
ATOM   1677 O O   . ARG A 1 216 ? -4.881  -0.029  10.695  1.00 47.77  ? 781  ARG A O   1 
ATOM   1678 C CB  . ARG A 1 216 ? -3.144  -0.387  13.357  1.00 51.18  ? 781  ARG A CB  1 
ATOM   1679 C CG  . ARG A 1 216 ? -2.280  -1.621  13.560  1.00 60.00  ? 781  ARG A CG  1 
ATOM   1680 C CD  . ARG A 1 216 ? -2.631  -2.375  14.846  1.00 65.99  ? 781  ARG A CD  1 
ATOM   1681 N NE  . ARG A 1 216 ? -1.956  -3.665  14.913  1.00 74.20  ? 781  ARG A NE  1 
ATOM   1682 C CZ  . ARG A 1 216 ? -2.452  -4.735  15.532  1.00 78.48  ? 781  ARG A CZ  1 
ATOM   1683 N NH1 . ARG A 1 216 ? -3.616  -4.663  16.170  1.00 78.34  ? 781  ARG A NH1 1 
ATOM   1684 N NH2 . ARG A 1 216 ? -1.774  -5.877  15.539  1.00 82.88  ? 781  ARG A NH2 1 
ATOM   1685 N N   . PRO A 1 217 ? -5.398  1.539   12.241  1.00 41.57  ? 782  PRO A N   1 
ATOM   1686 C CA  . PRO A 1 217 ? -5.504  2.608   11.234  1.00 32.24  ? 782  PRO A CA  1 
ATOM   1687 C C   . PRO A 1 217 ? -4.151  2.841   10.567  1.00 39.73  ? 782  PRO A C   1 
ATOM   1688 O O   . PRO A 1 217 ? -3.139  2.730   11.260  1.00 40.81  ? 782  PRO A O   1 
ATOM   1689 C CB  . PRO A 1 217 ? -5.918  3.839   12.053  1.00 30.25  ? 782  PRO A CB  1 
ATOM   1690 C CG  . PRO A 1 217 ? -6.511  3.288   13.317  1.00 37.89  ? 782  PRO A CG  1 
ATOM   1691 C CD  . PRO A 1 217 ? -5.768  2.007   13.590  1.00 39.47  ? 782  PRO A CD  1 
ATOM   1692 N N   . LYS A 1 218 ? -4.103  3.139   9.270   1.00 33.18  ? 783  LYS A N   1 
ATOM   1693 C CA  . LYS A 1 218 ? -2.799  3.419   8.674   1.00 47.65  ? 783  LYS A CA  1 
ATOM   1694 C C   . LYS A 1 218 ? -2.268  4.740   9.236   1.00 42.85  ? 783  LYS A C   1 
ATOM   1695 O O   . LYS A 1 218 ? -3.055  5.603   9.640   1.00 30.94  ? 783  LYS A O   1 
ATOM   1696 C CB  . LYS A 1 218 ? -2.849  3.461   7.140   1.00 47.45  ? 783  LYS A CB  1 
ATOM   1697 C CG  . LYS A 1 218 ? -1.466  3.753   6.549   1.00 56.05  ? 783  LYS A CG  1 
ATOM   1698 C CD  . LYS A 1 218 ? -1.347  3.659   5.044   1.00 56.96  ? 783  LYS A CD  1 
ATOM   1699 C CE  . LYS A 1 218 ? 0.044   3.125   4.689   1.00 66.22  ? 783  LYS A CE  1 
ATOM   1700 N NZ  . LYS A 1 218 ? 0.574   3.636   3.390   1.00 67.62  ? 783  LYS A NZ  1 
ATOM   1701 N N   . ARG A 1 219 ? -0.936  4.851   9.288   1.00 43.82  ? 784  ARG A N   1 
ATOM   1702 C CA  . ARG A 1 219 ? -0.194  6.010   9.797   1.00 49.25  ? 784  ARG A CA  1 
ATOM   1703 C C   . ARG A 1 219 ? -0.124  5.991   11.320  1.00 49.06  ? 784  ARG A C   1 
ATOM   1704 O O   . ARG A 1 219 ? 0.458   6.891   11.925  1.00 48.39  ? 784  ARG A O   1 
ATOM   1705 C CB  . ARG A 1 219 ? -0.789  7.336   9.302   1.00 49.17  ? 784  ARG A CB  1 
ATOM   1706 C CG  . ARG A 1 219 ? -0.826  7.460   7.791   1.00 51.78  ? 784  ARG A CG  1 
ATOM   1707 C CD  . ARG A 1 219 ? 0.566   7.304   7.195   1.00 56.55  ? 784  ARG A CD  1 
ATOM   1708 N NE  . ARG A 1 219 ? 0.522   6.974   5.774   1.00 59.59  ? 784  ARG A NE  1 
ATOM   1709 C CZ  . ARG A 1 219 ? 1.595   6.884   4.996   1.00 70.01  ? 784  ARG A CZ  1 
ATOM   1710 N NH1 . ARG A 1 219 ? 2.801   7.105   5.503   1.00 77.37  ? 784  ARG A NH1 1 
ATOM   1711 N NH2 . ARG A 1 219 ? 1.465   6.577   3.712   1.00 71.96  ? 784  ARG A NH2 1 
ATOM   1712 N N   . THR A 1 220 ? -0.742  4.982   11.931  1.00 40.23  ? 785  THR A N   1 
ATOM   1713 C CA  . THR A 1 220 ? -0.626  4.756   13.372  1.00 43.69  ? 785  THR A CA  1 
ATOM   1714 C C   . THR A 1 220 ? 0.838   4.739   13.803  1.00 41.11  ? 785  THR A C   1 
ATOM   1715 O O   . THR A 1 220 ? 1.238   5.479   14.701  1.00 36.02  ? 785  THR A O   1 
ATOM   1716 C CB  . THR A 1 220 ? -1.284  3.427   13.792  1.00 44.86  ? 785  THR A CB  1 
ATOM   1717 O OG1 . THR A 1 220 ? -2.706  3.529   13.648  1.00 47.93  ? 785  THR A OG1 1 
ATOM   1718 C CG2 . THR A 1 220 ? -0.950  3.094   15.239  1.00 43.64  ? 785  THR A CG2 1 
ATOM   1719 N N   . GLY A 1 221 ? 1.627   3.891   13.148  1.00 38.85  ? 786  GLY A N   1 
ATOM   1720 C CA  . GLY A 1 221 ? 3.061   3.842   13.366  1.00 39.24  ? 786  GLY A CA  1 
ATOM   1721 C C   . GLY A 1 221 ? 3.731   5.172   13.064  1.00 33.23  ? 786  GLY A C   1 
ATOM   1722 O O   . GLY A 1 221 ? 4.590   5.620   13.815  1.00 34.34  ? 786  GLY A O   1 
ATOM   1723 N N   . SER A 1 222 ? 3.331   5.808   11.966  1.00 31.95  ? 787  SER A N   1 
ATOM   1724 C CA  . SER A 1 222 ? 3.844   7.132   11.620  1.00 29.01  ? 787  SER A CA  1 
ATOM   1725 C C   . SER A 1 222 ? 3.478   8.183   12.669  1.00 24.76  ? 787  SER A C   1 
ATOM   1726 O O   . SER A 1 222 ? 4.296   9.031   13.015  1.00 30.86  ? 787  SER A O   1 
ATOM   1727 C CB  . SER A 1 222 ? 3.323   7.569   10.250  1.00 32.05  ? 787  SER A CB  1 
ATOM   1728 O OG  . SER A 1 222 ? 4.080   6.975   9.212   1.00 36.93  ? 787  SER A OG  1 
ATOM   1729 N N   . LEU A 1 223 ? 2.245   8.127   13.164  1.00 24.96  ? 788  LEU A N   1 
ATOM   1730 C CA  . LEU A 1 223 ? 1.805   9.032   14.216  1.00 23.67  ? 788  LEU A CA  1 
ATOM   1731 C C   . LEU A 1 223 ? 2.631   8.838   15.475  1.00 25.03  ? 788  LEU A C   1 
ATOM   1732 O O   . LEU A 1 223 ? 3.096   9.812   16.072  1.00 25.30  ? 788  LEU A O   1 
ATOM   1733 C CB  . LEU A 1 223 ? 0.326   8.825   14.536  1.00 27.60  ? 788  LEU A CB  1 
ATOM   1734 C CG  . LEU A 1 223 ? -0.691  9.648   13.751  1.00 31.09  ? 788  LEU A CG  1 
ATOM   1735 C CD1 . LEU A 1 223 ? -2.077  9.405   14.316  1.00 32.11  ? 788  LEU A CD1 1 
ATOM   1736 C CD2 . LEU A 1 223 ? -0.334  11.133  13.795  1.00 28.70  ? 788  LEU A CD2 1 
ATOM   1737 N N   . ALA A 1 224 ? 2.810   7.577   15.867  1.00 20.65  ? 789  ALA A N   1 
ATOM   1738 C CA  . ALA A 1 224 ? 3.553   7.234   17.080  1.00 26.13  ? 789  ALA A CA  1 
ATOM   1739 C C   . ALA A 1 224 ? 5.002   7.708   17.025  1.00 24.93  ? 789  ALA A C   1 
ATOM   1740 O O   . ALA A 1 224 ? 5.501   8.286   17.990  1.00 30.79  ? 789  ALA A O   1 
ATOM   1741 C CB  . ALA A 1 224 ? 3.507   5.724   17.332  1.00 17.86  ? 789  ALA A CB  1 
ATOM   1742 N N   . LEU A 1 225 ? 5.675   7.460   15.904  1.00 20.18  ? 790  LEU A N   1 
ATOM   1743 C CA  . LEU A 1 225 ? 7.066   7.881   15.746  1.00 24.53  ? 790  LEU A CA  1 
ATOM   1744 C C   . LEU A 1 225 ? 7.204   9.402   15.732  1.00 18.87  ? 790  LEU A C   1 
ATOM   1745 O O   . LEU A 1 225 ? 8.075   9.952   16.400  1.00 23.72  ? 790  LEU A O   1 
ATOM   1746 C CB  . LEU A 1 225 ? 7.682   7.303   14.467  1.00 25.92  ? 790  LEU A CB  1 
ATOM   1747 C CG  . LEU A 1 225 ? 9.098   7.827   14.155  1.00 34.05  ? 790  LEU A CG  1 
ATOM   1748 C CD1 . LEU A 1 225 ? 10.088  7.512   15.279  1.00 24.55  ? 790  LEU A CD1 1 
ATOM   1749 C CD2 . LEU A 1 225 ? 9.627   7.306   12.826  1.00 33.85  ? 790  LEU A CD2 1 
ATOM   1750 N N   . PHE A 1 226 ? 6.353   10.075  14.963  1.00 18.43  ? 791  PHE A N   1 
ATOM   1751 C CA  . PHE A 1 226 ? 6.426   11.530  14.855  1.00 13.80  ? 791  PHE A CA  1 
ATOM   1752 C C   . PHE A 1 226 ? 6.273   12.178  16.231  1.00 14.28  ? 791  PHE A C   1 
ATOM   1753 O O   . PHE A 1 226 ? 7.100   12.994  16.635  1.00 14.50  ? 791  PHE A O   1 
ATOM   1754 C CB  . PHE A 1 226 ? 5.363   12.051  13.891  1.00 13.05  ? 791  PHE A CB  1 
ATOM   1755 C CG  . PHE A 1 226 ? 5.261   13.548  13.855  1.00 22.03  ? 791  PHE A CG  1 
ATOM   1756 C CD1 . PHE A 1 226 ? 6.189   14.300  13.161  1.00 18.66  ? 791  PHE A CD1 1 
ATOM   1757 C CD2 . PHE A 1 226 ? 4.229   14.201  14.507  1.00 16.11  ? 791  PHE A CD2 1 
ATOM   1758 C CE1 . PHE A 1 226 ? 6.097   15.677  13.135  1.00 15.86  ? 791  PHE A CE1 1 
ATOM   1759 C CE2 . PHE A 1 226 ? 4.135   15.573  14.481  1.00 13.38  ? 791  PHE A CE2 1 
ATOM   1760 C CZ  . PHE A 1 226 ? 5.072   16.310  13.798  1.00 14.91  ? 791  PHE A CZ  1 
ATOM   1761 N N   . TYR A 1 227 ? 5.241   11.777  16.964  1.00 14.63  ? 792  TYR A N   1 
ATOM   1762 C CA  . TYR A 1 227 ? 4.975   12.367  18.272  1.00 27.44  ? 792  TYR A CA  1 
ATOM   1763 C C   . TYR A 1 227 ? 6.016   11.968  19.313  1.00 26.34  ? 792  TYR A C   1 
ATOM   1764 O O   . TYR A 1 227 ? 6.301   12.735  20.233  1.00 26.77  ? 792  TYR A O   1 
ATOM   1765 C CB  . TYR A 1 227 ? 3.572   11.994  18.751  1.00 23.63  ? 792  TYR A CB  1 
ATOM   1766 C CG  . TYR A 1 227 ? 2.528   12.972  18.279  1.00 26.63  ? 792  TYR A CG  1 
ATOM   1767 C CD1 . TYR A 1 227 ? 2.331   14.173  18.948  1.00 25.27  ? 792  TYR A CD1 1 
ATOM   1768 C CD2 . TYR A 1 227 ? 1.749   12.707  17.158  1.00 22.39  ? 792  TYR A CD2 1 
ATOM   1769 C CE1 . TYR A 1 227 ? 1.385   15.081  18.522  1.00 24.21  ? 792  TYR A CE1 1 
ATOM   1770 C CE2 . TYR A 1 227 ? 0.794   13.614  16.726  1.00 21.27  ? 792  TYR A CE2 1 
ATOM   1771 C CZ  . TYR A 1 227 ? 0.617   14.798  17.415  1.00 24.32  ? 792  TYR A CZ  1 
ATOM   1772 O OH  . TYR A 1 227 ? -0.325  15.708  17.001  1.00 22.23  ? 792  TYR A OH  1 
ATOM   1773 N N   . ARG A 1 228 ? 6.586   10.776  19.168  1.00 22.87  ? 793  ARG A N   1 
ATOM   1774 C CA  . ARG A 1 228 ? 7.720   10.393  20.002  1.00 31.67  ? 793  ARG A CA  1 
ATOM   1775 C C   . ARG A 1 228 ? 8.875   11.375  19.808  1.00 17.70  ? 793  ARG A C   1 
ATOM   1776 O O   . ARG A 1 228 ? 9.511   11.799  20.771  1.00 23.23  ? 793  ARG A O   1 
ATOM   1777 C CB  . ARG A 1 228 ? 8.184   8.967   19.689  1.00 34.87  ? 793  ARG A CB  1 
ATOM   1778 C CG  . ARG A 1 228 ? 9.269   8.462   20.630  1.00 40.95  ? 793  ARG A CG  1 
ATOM   1779 C CD  . ARG A 1 228 ? 9.811   7.106   20.207  1.00 45.48  ? 793  ARG A CD  1 
ATOM   1780 N NE  . ARG A 1 228 ? 10.633  7.199   19.004  1.00 55.88  ? 793  ARG A NE  1 
ATOM   1781 C CZ  . ARG A 1 228 ? 11.931  7.487   19.004  1.00 62.49  ? 793  ARG A CZ  1 
ATOM   1782 N NH1 . ARG A 1 228 ? 12.562  7.715   20.148  1.00 67.77  ? 793  ARG A NH1 1 
ATOM   1783 N NH2 . ARG A 1 228 ? 12.600  7.550   17.859  1.00 60.80  ? 793  ARG A NH2 1 
ATOM   1784 N N   . LYS A 1 229 ? 9.139   11.738  18.558  1.00 18.19  ? 794  LYS A N   1 
ATOM   1785 C CA  . LYS A 1 229 ? 10.205  12.691  18.250  1.00 23.93  ? 794  LYS A CA  1 
ATOM   1786 C C   . LYS A 1 229 ? 9.861   14.084  18.770  1.00 18.11  ? 794  LYS A C   1 
ATOM   1787 O O   . LYS A 1 229 ? 10.729  14.805  19.266  1.00 23.70  ? 794  LYS A O   1 
ATOM   1788 C CB  . LYS A 1 229 ? 10.464  12.743  16.743  1.00 24.91  ? 794  LYS A CB  1 
ATOM   1789 C CG  . LYS A 1 229 ? 10.941  11.436  16.155  1.00 32.30  ? 794  LYS A CG  1 
ATOM   1790 C CD  . LYS A 1 229 ? 12.317  11.075  16.664  1.00 42.52  ? 794  LYS A CD  1 
ATOM   1791 C CE  . LYS A 1 229 ? 13.378  11.408  15.632  1.00 51.64  ? 794  LYS A CE  1 
ATOM   1792 N NZ  . LYS A 1 229 ? 13.108  10.703  14.348  1.00 58.59  ? 794  LYS A NZ  1 
ATOM   1793 N N   . VAL A 1 230 ? 8.589   14.450  18.648  1.00 15.95  ? 795  VAL A N   1 
ATOM   1794 C CA  . VAL A 1 230 ? 8.098   15.746  19.108  1.00 15.93  ? 795  VAL A CA  1 
ATOM   1795 C C   . VAL A 1 230 ? 8.200   15.860  20.623  1.00 25.32  ? 795  VAL A C   1 
ATOM   1796 O O   . VAL A 1 230 ? 8.736   16.840  21.146  1.00 21.07  ? 795  VAL A O   1 
ATOM   1797 C CB  . VAL A 1 230 ? 6.634   15.979  18.674  1.00 18.28  ? 795  VAL A CB  1 
ATOM   1798 C CG1 . VAL A 1 230 ? 6.037   17.190  19.388  1.00 15.51  ? 795  VAL A CG1 1 
ATOM   1799 C CG2 . VAL A 1 230 ? 6.553   16.151  17.166  1.00 18.07  ? 795  VAL A CG2 1 
ATOM   1800 N N   . TYR A 1 231 ? 7.690   14.850  21.322  1.00 17.56  ? 796  TYR A N   1 
ATOM   1801 C CA  . TYR A 1 231 ? 7.756   14.822  22.778  1.00 26.95  ? 796  TYR A CA  1 
ATOM   1802 C C   . TYR A 1 231 ? 9.203   14.815  23.257  1.00 27.90  ? 796  TYR A C   1 
ATOM   1803 O O   . TYR A 1 231 ? 9.538   15.483  24.236  1.00 33.00  ? 796  TYR A O   1 
ATOM   1804 C CB  . TYR A 1 231 ? 7.007   13.608  23.330  1.00 24.04  ? 796  TYR A CB  1 
ATOM   1805 C CG  . TYR A 1 231 ? 5.500   13.768  23.333  1.00 22.71  ? 796  TYR A CG  1 
ATOM   1806 C CD1 . TYR A 1 231 ? 4.909   14.913  23.847  1.00 29.35  ? 796  TYR A CD1 1 
ATOM   1807 C CD2 . TYR A 1 231 ? 4.670   12.776  22.824  1.00 18.73  ? 796  TYR A CD2 1 
ATOM   1808 C CE1 . TYR A 1 231 ? 3.530   15.067  23.858  1.00 29.53  ? 796  TYR A CE1 1 
ATOM   1809 C CE2 . TYR A 1 231 ? 3.290   12.921  22.829  1.00 18.62  ? 796  TYR A CE2 1 
ATOM   1810 C CZ  . TYR A 1 231 ? 2.730   14.070  23.350  1.00 27.41  ? 796  TYR A CZ  1 
ATOM   1811 O OH  . TYR A 1 231 ? 1.367   14.229  23.369  1.00 31.28  ? 796  TYR A OH  1 
ATOM   1812 N N   . HIS A 1 232 ? 10.058  14.068  22.560  1.00 22.91  ? 797  HIS A N   1 
ATOM   1813 C CA  . HIS A 1 232 ? 11.475  14.009  22.912  1.00 24.87  ? 797  HIS A CA  1 
ATOM   1814 C C   . HIS A 1 232 ? 12.158  15.358  22.731  1.00 26.82  ? 797  HIS A C   1 
ATOM   1815 O O   . HIS A 1 232 ? 12.956  15.774  23.569  1.00 27.72  ? 797  HIS A O   1 
ATOM   1816 C CB  . HIS A 1 232 ? 12.207  12.951  22.077  1.00 30.90  ? 797  HIS A CB  1 
ATOM   1817 C CG  . HIS A 1 232 ? 13.683  12.899  22.330  1.00 42.82  ? 797  HIS A CG  1 
ATOM   1818 N ND1 . HIS A 1 232 ? 14.227  12.299  23.446  1.00 50.02  ? 797  HIS A ND1 1 
ATOM   1819 C CD2 . HIS A 1 232 ? 14.729  13.384  21.618  1.00 47.96  ? 797  HIS A CD2 1 
ATOM   1820 C CE1 . HIS A 1 232 ? 15.543  12.411  23.408  1.00 45.54  ? 797  HIS A CE1 1 
ATOM   1821 N NE2 . HIS A 1 232 ? 15.874  13.064  22.308  1.00 47.10  ? 797  HIS A NE2 1 
ATOM   1822 N N   . LEU A 1 233 ? 11.847  16.031  21.626  1.00 23.68  ? 798  LEU A N   1 
ATOM   1823 C CA  . LEU A 1 233 ? 12.453  17.321  21.318  1.00 25.75  ? 798  LEU A CA  1 
ATOM   1824 C C   . LEU A 1 233 ? 12.018  18.389  22.316  1.00 28.76  ? 798  LEU A C   1 
ATOM   1825 O O   . LEU A 1 233 ? 12.836  19.166  22.814  1.00 26.55  ? 798  LEU A O   1 
ATOM   1826 C CB  . LEU A 1 233 ? 12.087  17.761  19.901  1.00 27.76  ? 798  LEU A CB  1 
ATOM   1827 C CG  . LEU A 1 233 ? 12.624  19.125  19.460  1.00 23.70  ? 798  LEU A CG  1 
ATOM   1828 C CD1 . LEU A 1 233 ? 14.145  19.112  19.433  1.00 24.61  ? 798  LEU A CD1 1 
ATOM   1829 C CD2 . LEU A 1 233 ? 12.062  19.512  18.106  1.00 23.18  ? 798  LEU A CD2 1 
ATOM   1830 N N   . ALA A 1 234 ? 10.723  18.420  22.600  1.00 22.41  ? 799  ALA A N   1 
ATOM   1831 C CA  . ALA A 1 234 ? 10.162  19.428  23.486  1.00 26.44  ? 799  ALA A CA  1 
ATOM   1832 C C   . ALA A 1 234 ? 10.659  19.244  24.917  1.00 21.98  ? 799  ALA A C   1 
ATOM   1833 O O   . ALA A 1 234 ? 10.814  20.215  25.654  1.00 27.67  ? 799  ALA A O   1 
ATOM   1834 C CB  . ALA A 1 234 ? 8.634   19.387  23.435  1.00 23.81  ? 799  ALA A CB  1 
ATOM   1835 N N   . SER A 1 235 ? 10.918  17.999  25.305  1.00 22.46  ? 800  SER A N   1 
ATOM   1836 C CA  . SER A 1 235 ? 11.391  17.718  26.656  1.00 31.29  ? 800  SER A CA  1 
ATOM   1837 C C   . SER A 1 235 ? 12.814  18.232  26.844  1.00 28.86  ? 800  SER A C   1 
ATOM   1838 O O   . SER A 1 235 ? 13.161  18.736  27.910  1.00 30.14  ? 800  SER A O   1 
ATOM   1839 C CB  . SER A 1 235 ? 11.323  16.219  26.961  1.00 29.72  ? 800  SER A CB  1 
ATOM   1840 O OG  . SER A 1 235 ? 12.168  15.482  26.099  1.00 38.98  ? 800  SER A OG  1 
ATOM   1841 N N   . VAL A 1 236 ? 13.628  18.107  25.800  1.00 29.86  ? 801  VAL A N   1 
ATOM   1842 C CA  . VAL A 1 236 ? 15.004  18.588  25.832  1.00 25.98  ? 801  VAL A CA  1 
ATOM   1843 C C   . VAL A 1 236 ? 15.022  20.107  25.951  1.00 26.78  ? 801  VAL A C   1 
ATOM   1844 O O   . VAL A 1 236 ? 15.790  20.675  26.732  1.00 30.02  ? 801  VAL A O   1 
ATOM   1845 C CB  . VAL A 1 236 ? 15.785  18.146  24.579  1.00 34.05  ? 801  VAL A CB  1 
ATOM   1846 C CG1 . VAL A 1 236 ? 17.147  18.828  24.520  1.00 36.83  ? 801  VAL A CG1 1 
ATOM   1847 C CG2 . VAL A 1 236 ? 15.944  16.628  24.567  1.00 33.75  ? 801  VAL A CG2 1 
ATOM   1848 N N   . ARG A 1 237 ? 14.151  20.758  25.190  1.00 25.60  ? 802  ARG A N   1 
ATOM   1849 C CA  . ARG A 1 237 ? 14.035  22.208  25.245  1.00 33.64  ? 802  ARG A CA  1 
ATOM   1850 C C   . ARG A 1 237 ? 13.479  22.680  26.590  1.00 35.14  ? 802  ARG A C   1 
ATOM   1851 O O   . ARG A 1 237 ? 13.960  23.662  27.152  1.00 33.14  ? 802  ARG A O   1 
ATOM   1852 C CB  . ARG A 1 237 ? 13.168  22.705  24.085  1.00 27.67  ? 802  ARG A CB  1 
ATOM   1853 C CG  . ARG A 1 237 ? 13.836  22.464  22.738  1.00 23.62  ? 802  ARG A CG  1 
ATOM   1854 C CD  . ARG A 1 237 ? 12.999  22.913  21.562  1.00 23.22  ? 802  ARG A CD  1 
ATOM   1855 N NE  . ARG A 1 237 ? 13.724  22.686  20.314  1.00 27.80  ? 802  ARG A NE  1 
ATOM   1856 C CZ  . ARG A 1 237 ? 13.250  22.964  19.105  1.00 27.69  ? 802  ARG A CZ  1 
ATOM   1857 N NH1 . ARG A 1 237 ? 12.034  23.483  18.963  1.00 22.04  1 802  ARG A NH1 1 
ATOM   1858 N NH2 . ARG A 1 237 ? 13.993  22.720  18.035  1.00 19.80  ? 802  ARG A NH2 1 
ATOM   1859 N N   . LEU A 1 238 ? 12.484  21.972  27.115  1.00 31.43  ? 803  LEU A N   1 
ATOM   1860 C CA  . LEU A 1 238 ? 11.905  22.346  28.400  1.00 28.90  ? 803  LEU A CA  1 
ATOM   1861 C C   . LEU A 1 238 ? 12.903  22.154  29.537  1.00 36.70  ? 803  LEU A C   1 
ATOM   1862 O O   . LEU A 1 238 ? 12.954  22.958  30.472  1.00 38.48  ? 803  LEU A O   1 
ATOM   1863 C CB  . LEU A 1 238 ? 10.634  21.547  28.680  1.00 26.44  ? 803  LEU A CB  1 
ATOM   1864 C CG  . LEU A 1 238 ? 9.981   21.862  30.031  1.00 30.42  ? 803  LEU A CG  1 
ATOM   1865 C CD1 . LEU A 1 238 ? 9.747   23.363  30.181  1.00 29.62  ? 803  LEU A CD1 1 
ATOM   1866 C CD2 . LEU A 1 238 ? 8.678   21.095  30.209  1.00 27.33  ? 803  LEU A CD2 1 
ATOM   1867 N N   . ARG A 1 239 ? 13.702  21.094  29.452  1.00 39.17  ? 804  ARG A N   1 
ATOM   1868 C CA  . ARG A 1 239 ? 14.726  20.840  30.459  1.00 43.12  ? 804  ARG A CA  1 
ATOM   1869 C C   . ARG A 1 239 ? 15.755  21.965  30.499  1.00 41.46  ? 804  ARG A C   1 
ATOM   1870 O O   . ARG A 1 239 ? 16.192  22.380  31.578  1.00 36.82  ? 804  ARG A O   1 
ATOM   1871 C CB  . ARG A 1 239 ? 15.420  19.497  30.206  1.00 50.07  ? 804  ARG A CB  1 
ATOM   1872 C CG  . ARG A 1 239 ? 15.127  18.453  31.277  1.00 62.24  ? 804  ARG A CG  1 
ATOM   1873 C CD  . ARG A 1 239 ? 15.672  17.072  30.919  1.00 69.51  ? 804  ARG A CD  1 
ATOM   1874 N NE  . ARG A 1 239 ? 15.096  16.027  31.766  1.00 73.75  ? 804  ARG A NE  1 
ATOM   1875 C CZ  . ARG A 1 239 ? 15.672  15.536  32.862  1.00 79.95  ? 804  ARG A CZ  1 
ATOM   1876 N NH1 . ARG A 1 239 ? 16.857  15.985  33.258  1.00 81.07  ? 804  ARG A NH1 1 
ATOM   1877 N NH2 . ARG A 1 239 ? 15.062  14.591  33.563  1.00 83.17  ? 804  ARG A NH2 1 
ATOM   1878 N N   . ASP A 1 240 ? 16.139  22.461  29.325  1.00 40.36  ? 805  ASP A N   1 
ATOM   1879 C CA  . ASP A 1 240 ? 17.129  23.531  29.259  1.00 44.93  ? 805  ASP A CA  1 
ATOM   1880 C C   . ASP A 1 240 ? 16.567  24.821  29.843  1.00 41.60  ? 805  ASP A C   1 
ATOM   1881 O O   . ASP A 1 240 ? 17.238  25.504  30.622  1.00 42.03  ? 805  ASP A O   1 
ATOM   1882 C CB  . ASP A 1 240 ? 17.596  23.766  27.820  1.00 47.96  ? 805  ASP A CB  1 
ATOM   1883 C CG  . ASP A 1 240 ? 18.601  24.905  27.715  1.00 56.75  ? 805  ASP A CG  1 
ATOM   1884 O OD1 . ASP A 1 240 ? 18.212  26.010  27.281  1.00 62.56  ? 805  ASP A OD1 1 
ATOM   1885 O OD2 . ASP A 1 240 ? 19.777  24.702  28.084  1.00 52.46  1 805  ASP A OD2 1 
ATOM   1886 N N   . LEU A 1 241 ? 15.336  25.146  29.457  1.00 33.52  ? 806  LEU A N   1 
ATOM   1887 C CA  . LEU A 1 241 ? 14.657  26.333  29.954  1.00 36.53  ? 806  LEU A CA  1 
ATOM   1888 C C   . LEU A 1 241 ? 14.544  26.324  31.472  1.00 35.81  ? 806  LEU A C   1 
ATOM   1889 O O   . LEU A 1 241 ? 14.873  27.307  32.130  1.00 39.57  ? 806  LEU A O   1 
ATOM   1890 C CB  . LEU A 1 241 ? 13.268  26.446  29.336  1.00 39.43  ? 806  LEU A CB  1 
ATOM   1891 C CG  . LEU A 1 241 ? 13.173  27.246  28.045  1.00 39.70  ? 806  LEU A CG  1 
ATOM   1892 C CD1 . LEU A 1 241 ? 11.764  27.149  27.510  1.00 39.98  ? 806  LEU A CD1 1 
ATOM   1893 C CD2 . LEU A 1 241 ? 13.559  28.691  28.306  1.00 44.33  ? 806  LEU A CD2 1 
ATOM   1894 N N   . CYS A 1 242 ? 14.077  25.205  32.016  1.00 34.17  ? 807  CYS A N   1 
ATOM   1895 C CA  . CYS A 1 242 ? 13.921  25.047  33.454  1.00 36.01  ? 807  CYS A CA  1 
ATOM   1896 C C   . CYS A 1 242 ? 15.249  25.209  34.177  1.00 51.27  ? 807  CYS A C   1 
ATOM   1897 O O   . CYS A 1 242 ? 15.296  25.694  35.306  1.00 58.48  ? 807  CYS A O   1 
ATOM   1898 C CB  . CYS A 1 242 ? 13.316  23.684  33.779  1.00 35.57  ? 807  CYS A CB  1 
ATOM   1899 S SG  . CYS A 1 242 ? 11.578  23.533  33.365  1.00 41.95  ? 807  CYS A SG  1 
ATOM   1900 N N   . LEU A 1 243 ? 16.326  24.797  33.519  1.00 46.47  ? 808  LEU A N   1 
ATOM   1901 C CA  . LEU A 1 243 ? 17.662  24.921  34.083  1.00 47.04  ? 808  LEU A CA  1 
ATOM   1902 C C   . LEU A 1 243 ? 18.090  26.385  34.129  1.00 51.59  ? 808  LEU A C   1 
ATOM   1903 O O   . LEU A 1 243 ? 18.505  26.888  35.172  1.00 53.65  ? 808  LEU A O   1 
ATOM   1904 C CB  . LEU A 1 243 ? 18.656  24.093  33.268  1.00 46.19  ? 808  LEU A CB  1 
ATOM   1905 C CG  . LEU A 1 243 ? 20.023  23.783  33.872  1.00 58.78  ? 808  LEU A CG  1 
ATOM   1906 C CD1 . LEU A 1 243 ? 20.466  22.395  33.431  1.00 59.07  ? 808  LEU A CD1 1 
ATOM   1907 C CD2 . LEU A 1 243 ? 21.051  24.831  33.462  1.00 63.86  ? 808  LEU A CD2 1 
ATOM   1908 N N   . LYS A 1 244 ? 17.977  27.069  32.995  1.00 52.29  ? 809  LYS A N   1 
ATOM   1909 C CA  . LYS A 1 244 ? 18.407  28.459  32.901  1.00 57.41  ? 809  LYS A CA  1 
ATOM   1910 C C   . LYS A 1 244 ? 17.495  29.381  33.702  1.00 55.74  ? 809  LYS A C   1 
ATOM   1911 O O   . LYS A 1 244 ? 17.902  30.466  34.116  1.00 57.37  ? 809  LYS A O   1 
ATOM   1912 C CB  . LYS A 1 244 ? 18.468  28.901  31.438  1.00 60.25  ? 809  LYS A CB  1 
ATOM   1913 C CG  . LYS A 1 244 ? 19.592  28.233  30.661  1.00 69.39  ? 809  LYS A CG  1 
ATOM   1914 C CD  . LYS A 1 244 ? 19.806  28.865  29.295  1.00 75.07  ? 809  LYS A CD  1 
ATOM   1915 C CE  . LYS A 1 244 ? 21.082  28.337  28.649  1.00 77.10  ? 809  LYS A CE  1 
ATOM   1916 N NZ  . LYS A 1 244 ? 21.366  28.985  27.340  1.00 77.62  ? 809  LYS A NZ  1 
ATOM   1917 N N   . LEU A 1 245 ? 16.259  28.943  33.917  1.00 54.83  ? 810  LEU A N   1 
ATOM   1918 C CA  . LEU A 1 245 ? 15.326  29.693  34.746  1.00 55.52  ? 810  LEU A CA  1 
ATOM   1919 C C   . LEU A 1 245 ? 15.313  29.161  36.178  1.00 57.43  ? 810  LEU A C   1 
ATOM   1920 O O   . LEU A 1 245 ? 14.609  29.694  37.032  1.00 52.66  ? 810  LEU A O   1 
ATOM   1921 C CB  . LEU A 1 245 ? 13.923  29.656  34.132  1.00 49.41  ? 810  LEU A CB  1 
ATOM   1922 C CG  . LEU A 1 245 ? 13.761  30.586  32.926  1.00 38.25  ? 810  LEU A CG  1 
ATOM   1923 C CD1 . LEU A 1 245 ? 12.591  30.171  32.040  1.00 35.89  ? 810  LEU A CD1 1 
ATOM   1924 C CD2 . LEU A 1 245 ? 13.599  32.029  33.382  1.00 39.89  ? 810  LEU A CD2 1 
ATOM   1925 N N   . ASP A 1 246 ? 16.117  28.124  36.421  1.00 58.27  ? 811  ASP A N   1 
ATOM   1926 C CA  . ASP A 1 246 ? 16.249  27.468  37.727  1.00 62.04  ? 811  ASP A CA  1 
ATOM   1927 C C   . ASP A 1 246 ? 14.878  27.255  38.361  1.00 56.47  ? 811  ASP A C   1 
ATOM   1928 O O   . ASP A 1 246 ? 14.487  27.942  39.306  1.00 52.52  ? 811  ASP A O   1 
ATOM   1929 C CB  . ASP A 1 246 ? 17.178  28.259  38.661  1.00 71.44  ? 811  ASP A CB  1 
ATOM   1930 C CG  . ASP A 1 246 ? 17.157  27.735  40.099  1.00 79.12  ? 811  ASP A CG  1 
ATOM   1931 O OD1 . ASP A 1 246 ? 17.566  26.574  40.317  1.00 81.82  ? 811  ASP A OD1 1 
ATOM   1932 O OD2 . ASP A 1 246 ? 16.759  28.490  41.013  1.00 80.28  ? 811  ASP A OD2 1 
ATOM   1933 N N   . VAL A 1 247 ? 14.139  26.311  37.800  1.00 53.40  ? 812  VAL A N   1 
ATOM   1934 C CA  . VAL A 1 247 ? 12.799  26.006  38.267  1.00 54.63  ? 812  VAL A CA  1 
ATOM   1935 C C   . VAL A 1 247 ? 12.804  24.643  38.952  1.00 50.72  ? 812  VAL A C   1 
ATOM   1936 O O   . VAL A 1 247 ? 13.633  23.790  38.639  1.00 47.47  ? 812  VAL A O   1 
ATOM   1937 C CB  . VAL A 1 247 ? 11.789  26.025  37.100  1.00 57.61  ? 812  VAL A CB  1 
ATOM   1938 C CG1 . VAL A 1 247 ? 10.377  25.937  37.615  1.00 63.08  ? 812  VAL A CG1 1 
ATOM   1939 C CG2 . VAL A 1 247 ? 11.958  27.293  36.283  1.00 59.15  ? 812  VAL A CG2 1 
ATOM   1940 N N   . SER A 1 248 ? 11.903  24.457  39.911  1.00 50.33  ? 813  SER A N   1 
ATOM   1941 C CA  . SER A 1 248 ? 11.739  23.169  40.567  1.00 50.29  ? 813  SER A CA  1 
ATOM   1942 C C   . SER A 1 248 ? 11.306  22.123  39.554  1.00 51.63  ? 813  SER A C   1 
ATOM   1943 O O   . SER A 1 248 ? 10.660  22.446  38.557  1.00 49.04  ? 813  SER A O   1 
ATOM   1944 C CB  . SER A 1 248 ? 10.711  23.261  41.694  1.00 47.48  ? 813  SER A CB  1 
ATOM   1945 O OG  . SER A 1 248 ? 9.411   23.464  41.168  1.00 45.80  ? 813  SER A OG  1 
ATOM   1946 N N   . ASN A 1 249 ? 11.664  20.870  39.813  1.00 57.44  ? 814  ASN A N   1 
ATOM   1947 C CA  . ASN A 1 249 ? 11.280  19.768  38.939  1.00 65.16  ? 814  ASN A CA  1 
ATOM   1948 C C   . ASN A 1 249 ? 9.778   19.501  38.976  1.00 62.00  ? 814  ASN A C   1 
ATOM   1949 O O   . ASN A 1 249 ? 9.230   18.877  38.066  1.00 65.91  ? 814  ASN A O   1 
ATOM   1950 C CB  . ASN A 1 249 ? 12.048  18.499  39.317  1.00 70.15  ? 814  ASN A CB  1 
ATOM   1951 C CG  . ASN A 1 249 ? 13.521  18.583  38.961  1.00 72.51  ? 814  ASN A CG  1 
ATOM   1952 O OD1 . ASN A 1 249 ? 14.008  19.628  38.530  1.00 69.21  ? 814  ASN A OD1 1 
ATOM   1953 N ND2 . ASN A 1 249 ? 14.239  17.481  39.148  1.00 76.08  ? 814  ASN A ND2 1 
ATOM   1954 N N   . GLU A 1 250 ? 9.117   19.976  40.028  1.00 57.58  ? 815  GLU A N   1 
ATOM   1955 C CA  . GLU A 1 250 ? 7.678   19.792  40.172  1.00 56.70  ? 815  GLU A CA  1 
ATOM   1956 C C   . GLU A 1 250 ? 6.898   20.720  39.246  1.00 49.19  ? 815  GLU A C   1 
ATOM   1957 O O   . GLU A 1 250 ? 5.876   20.328  38.684  1.00 45.68  ? 815  GLU A O   1 
ATOM   1958 C CB  . GLU A 1 250 ? 7.247   20.012  41.626  1.00 66.44  ? 815  GLU A CB  1 
ATOM   1959 C CG  . GLU A 1 250 ? 5.735   20.159  41.837  1.00 74.45  ? 815  GLU A CG  1 
ATOM   1960 C CD  . GLU A 1 250 ? 4.958   18.849  41.704  1.00 82.72  ? 815  GLU A CD  1 
ATOM   1961 O OE1 . GLU A 1 250 ? 5.377   17.956  40.935  1.00 85.89  ? 815  GLU A OE1 1 
ATOM   1962 O OE2 . GLU A 1 250 ? 3.914   18.713  42.379  1.00 84.80  ? 815  GLU A OE2 1 
ATOM   1963 N N   . LEU A 1 251 ? 7.373   21.952  39.090  1.00 47.22  ? 816  LEU A N   1 
ATOM   1964 C CA  . LEU A 1 251 ? 6.750   22.865  38.142  1.00 45.06  ? 816  LEU A CA  1 
ATOM   1965 C C   . LEU A 1 251 ? 7.085   22.416  36.724  1.00 42.80  ? 816  LEU A C   1 
ATOM   1966 O O   . LEU A 1 251 ? 6.264   22.542  35.819  1.00 43.21  ? 816  LEU A O   1 
ATOM   1967 C CB  . LEU A 1 251 ? 7.200   24.309  38.373  1.00 43.62  ? 816  LEU A CB  1 
ATOM   1968 C CG  . LEU A 1 251 ? 6.638   25.332  37.380  1.00 43.18  ? 816  LEU A CG  1 
ATOM   1969 C CD1 . LEU A 1 251 ? 5.123   25.204  37.251  1.00 38.68  ? 816  LEU A CD1 1 
ATOM   1970 C CD2 . LEU A 1 251 ? 7.006   26.741  37.786  1.00 47.63  ? 816  LEU A CD2 1 
ATOM   1971 N N   . ARG A 1 252 ? 8.291   21.883  36.544  1.00 44.87  ? 817  ARG A N   1 
ATOM   1972 C CA  . ARG A 1 252 ? 8.697   21.318  35.259  1.00 43.92  ? 817  ARG A CA  1 
ATOM   1973 C C   . ARG A 1 252 ? 7.701   20.253  34.803  1.00 40.43  ? 817  ARG A C   1 
ATOM   1974 O O   . ARG A 1 252 ? 7.212   20.287  33.675  1.00 36.31  ? 817  ARG A O   1 
ATOM   1975 C CB  . ARG A 1 252 ? 10.104  20.722  35.349  1.00 41.56  ? 817  ARG A CB  1 
ATOM   1976 C CG  . ARG A 1 252 ? 10.657  20.221  34.019  1.00 38.64  ? 817  ARG A CG  1 
ATOM   1977 C CD  . ARG A 1 252 ? 12.070  19.672  34.178  1.00 40.39  ? 817  ARG A CD  1 
ATOM   1978 N NE  . ARG A 1 252 ? 12.090  18.459  34.993  1.00 46.85  ? 817  ARG A NE  1 
ATOM   1979 C CZ  . ARG A 1 252 ? 13.196  17.825  35.365  1.00 52.82  ? 817  ARG A CZ  1 
ATOM   1980 N NH1 . ARG A 1 252 ? 14.383  18.287  34.998  1.00 55.00  ? 817  ARG A NH1 1 
ATOM   1981 N NH2 . ARG A 1 252 ? 13.117  16.731  36.111  1.00 55.03  ? 817  ARG A NH2 1 
ATOM   1982 N N   . ARG A 1 253 ? 7.391   19.324  35.700  1.00 43.77  ? 818  ARG A N   1 
ATOM   1983 C CA  . ARG A 1 253 ? 6.422   18.272  35.418  1.00 42.09  ? 818  ARG A CA  1 
ATOM   1984 C C   . ARG A 1 253 ? 5.032   18.856  35.154  1.00 39.87  ? 818  ARG A C   1 
ATOM   1985 O O   . ARG A 1 253 ? 4.276   18.329  34.340  1.00 33.53  ? 818  ARG A O   1 
ATOM   1986 C CB  . ARG A 1 253 ? 6.372   17.278  36.580  1.00 45.99  ? 818  ARG A CB  1 
ATOM   1987 C CG  . ARG A 1 253 ? 5.608   15.997  36.284  1.00 58.93  ? 818  ARG A CG  1 
ATOM   1988 C CD  . ARG A 1 253 ? 5.482   15.144  37.539  1.00 71.23  ? 818  ARG A CD  1 
ATOM   1989 N NE  . ARG A 1 253 ? 4.747   13.905  37.298  1.00 77.31  ? 818  ARG A NE  1 
ATOM   1990 C CZ  . ARG A 1 253 ? 5.306   12.701  37.237  1.00 80.12  ? 818  ARG A CZ  1 
ATOM   1991 N NH1 . ARG A 1 253 ? 6.614   12.563  37.407  1.00 79.18  ? 818  ARG A NH1 1 
ATOM   1992 N NH2 . ARG A 1 253 ? 4.554   11.631  37.013  1.00 82.67  ? 818  ARG A NH2 1 
ATOM   1993 N N   . LYS A 1 254 ? 4.702   19.948  35.842  1.00 38.88  ? 819  LYS A N   1 
ATOM   1994 C CA  . LYS A 1 254 ? 3.420   20.622  35.639  1.00 39.61  ? 819  LYS A CA  1 
ATOM   1995 C C   . LYS A 1 254 ? 3.377   21.365  34.306  1.00 35.03  ? 819  LYS A C   1 
ATOM   1996 O O   . LYS A 1 254 ? 2.357   21.358  33.612  1.00 36.95  ? 819  LYS A O   1 
ATOM   1997 C CB  . LYS A 1 254 ? 3.133   21.591  36.791  1.00 36.05  ? 819  LYS A CB  1 
ATOM   1998 C CG  . LYS A 1 254 ? 2.740   20.905  38.087  1.00 38.25  ? 819  LYS A CG  1 
ATOM   1999 C CD  . LYS A 1 254 ? 2.719   21.879  39.262  1.00 44.83  ? 819  LYS A CD  1 
ATOM   2000 C CE  . LYS A 1 254 ? 2.416   21.157  40.567  1.00 51.31  ? 819  LYS A CE  1 
ATOM   2001 N NZ  . LYS A 1 254 ? 2.586   22.034  41.765  1.00 57.26  ? 819  LYS A NZ  1 
ATOM   2002 N N   . ILE A 1 255 ? 4.482   22.017  33.960  1.00 36.04  ? 820  ILE A N   1 
ATOM   2003 C CA  . ILE A 1 255 ? 4.597   22.703  32.675  1.00 36.26  ? 820  ILE A CA  1 
ATOM   2004 C C   . ILE A 1 255 ? 4.500   21.690  31.538  1.00 34.21  ? 820  ILE A C   1 
ATOM   2005 O O   . ILE A 1 255 ? 3.781   21.903  30.558  1.00 29.71  ? 820  ILE A O   1 
ATOM   2006 C CB  . ILE A 1 255 ? 5.923   23.491  32.571  1.00 35.95  ? 820  ILE A CB  1 
ATOM   2007 C CG1 . ILE A 1 255 ? 5.900   24.693  33.519  1.00 37.64  ? 820  ILE A CG1 1 
ATOM   2008 C CG2 . ILE A 1 255 ? 6.177   23.939  31.138  1.00 35.43  ? 820  ILE A CG2 1 
ATOM   2009 C CD1 . ILE A 1 255 ? 7.248   25.371  33.702  1.00 33.14  ? 820  ILE A CD1 1 
ATOM   2010 N N   . TRP A 1 256 ? 5.217   20.580  31.691  1.00 37.52  ? 821  TRP A N   1 
ATOM   2011 C CA  . TRP A 1 256 ? 5.171   19.482  30.730  1.00 30.05  ? 821  TRP A CA  1 
ATOM   2012 C C   . TRP A 1 256 ? 3.757   18.929  30.557  1.00 35.13  ? 821  TRP A C   1 
ATOM   2013 O O   . TRP A 1 256 ? 3.332   18.631  29.436  1.00 33.55  ? 821  TRP A O   1 
ATOM   2014 C CB  . TRP A 1 256 ? 6.115   18.357  31.160  1.00 28.03  ? 821  TRP A CB  1 
ATOM   2015 C CG  . TRP A 1 256 ? 6.083   17.177  30.239  1.00 29.29  ? 821  TRP A CG  1 
ATOM   2016 C CD1 . TRP A 1 256 ? 5.550   15.947  30.497  1.00 29.89  ? 821  TRP A CD1 1 
ATOM   2017 C CD2 . TRP A 1 256 ? 6.594   17.119  28.903  1.00 27.33  ? 821  TRP A CD2 1 
ATOM   2018 N NE1 . TRP A 1 256 ? 5.706   15.125  29.408  1.00 33.26  ? 821  TRP A NE1 1 
ATOM   2019 C CE2 . TRP A 1 256 ? 6.343   15.822  28.414  1.00 31.34  ? 821  TRP A CE2 1 
ATOM   2020 C CE3 . TRP A 1 256 ? 7.242   18.038  28.073  1.00 31.81  ? 821  TRP A CE3 1 
ATOM   2021 C CZ2 . TRP A 1 256 ? 6.721   15.419  27.135  1.00 29.83  ? 821  TRP A CZ2 1 
ATOM   2022 C CZ3 . TRP A 1 256 ? 7.615   17.637  26.801  1.00 28.90  ? 821  TRP A CZ3 1 
ATOM   2023 C CH2 . TRP A 1 256 ? 7.354   16.339  26.347  1.00 25.23  ? 821  TRP A CH2 1 
ATOM   2024 N N   . THR A 1 257 ? 3.039   18.792  31.671  1.00 34.63  ? 822  THR A N   1 
ATOM   2025 C CA  . THR A 1 257 ? 1.667   18.287  31.660  1.00 34.64  ? 822  THR A CA  1 
ATOM   2026 C C   . THR A 1 257 ? 0.737   19.226  30.890  1.00 31.21  ? 822  THR A C   1 
ATOM   2027 O O   . THR A 1 257 ? -0.144  18.784  30.151  1.00 28.37  ? 822  THR A O   1 
ATOM   2028 C CB  . THR A 1 257 ? 1.126   18.095  33.101  1.00 38.14  ? 822  THR A CB  1 
ATOM   2029 O OG1 . THR A 1 257 ? 1.881   17.077  33.770  1.00 39.09  ? 822  THR A OG1 1 
ATOM   2030 C CG2 . THR A 1 257 ? -0.324  17.678  33.080  1.00 30.58  ? 822  THR A CG2 1 
ATOM   2031 N N   . CYS A 1 258 ? 0.941   20.527  31.062  1.00 29.29  ? 823  CYS A N   1 
ATOM   2032 C CA  . CYS A 1 258 ? 0.141   21.522  30.360  1.00 26.78  ? 823  CYS A CA  1 
ATOM   2033 C C   . CYS A 1 258 ? 0.455   21.515  28.864  1.00 27.41  ? 823  CYS A C   1 
ATOM   2034 O O   . CYS A 1 258 ? -0.442  21.615  28.028  1.00 24.11  ? 823  CYS A O   1 
ATOM   2035 C CB  . CYS A 1 258 ? 0.388   22.913  30.937  1.00 27.78  ? 823  CYS A CB  1 
ATOM   2036 S SG  . CYS A 1 258 ? -0.621  24.217  30.197  1.00 38.55  ? 823  CYS A SG  1 
ATOM   2037 N N   . PHE A 1 259 ? 1.737   21.408  28.538  1.00 24.25  ? 824  PHE A N   1 
ATOM   2038 C CA  . PHE A 1 259 ? 2.162   21.357  27.148  1.00 26.62  ? 824  PHE A CA  1 
ATOM   2039 C C   . PHE A 1 259 ? 1.577   20.141  26.431  1.00 27.31  ? 824  PHE A C   1 
ATOM   2040 O O   . PHE A 1 259 ? 1.085   20.247  25.311  1.00 20.63  ? 824  PHE A O   1 
ATOM   2041 C CB  . PHE A 1 259 ? 3.687   21.335  27.054  1.00 22.48  ? 824  PHE A CB  1 
ATOM   2042 C CG  . PHE A 1 259 ? 4.194   21.109  25.666  1.00 28.28  ? 824  PHE A CG  1 
ATOM   2043 C CD1 . PHE A 1 259 ? 4.140   22.125  24.722  1.00 26.27  ? 824  PHE A CD1 1 
ATOM   2044 C CD2 . PHE A 1 259 ? 4.712   19.877  25.296  1.00 24.92  ? 824  PHE A CD2 1 
ATOM   2045 C CE1 . PHE A 1 259 ? 4.600   21.915  23.433  1.00 24.52  ? 824  PHE A CE1 1 
ATOM   2046 C CE2 . PHE A 1 259 ? 5.173   19.663  24.013  1.00 26.25  ? 824  PHE A CE2 1 
ATOM   2047 C CZ  . PHE A 1 259 ? 5.117   20.682  23.080  1.00 23.34  ? 824  PHE A CZ  1 
ATOM   2048 N N   . GLU A 1 260 ? 1.640   18.985  27.080  1.00 32.55  ? 825  GLU A N   1 
ATOM   2049 C CA  . GLU A 1 260 ? 1.066   17.773  26.510  1.00 31.00  ? 825  GLU A CA  1 
ATOM   2050 C C   . GLU A 1 260 ? -0.435  17.945  26.298  1.00 32.88  ? 825  GLU A C   1 
ATOM   2051 O O   . GLU A 1 260 ? -0.975  17.528  25.270  1.00 29.03  ? 825  GLU A O   1 
ATOM   2052 C CB  . GLU A 1 260 ? 1.344   16.568  27.408  1.00 28.30  ? 825  GLU A CB  1 
ATOM   2053 C CG  . GLU A 1 260 ? 0.621   15.308  26.982  1.00 36.07  ? 825  GLU A CG  1 
ATOM   2054 C CD  . GLU A 1 260 ? 1.033   14.106  27.803  1.00 48.47  ? 825  GLU A CD  1 
ATOM   2055 O OE1 . GLU A 1 260 ? 2.217   14.035  28.189  1.00 61.97  ? 825  GLU A OE1 1 
ATOM   2056 O OE2 . GLU A 1 260 ? 0.177   13.237  28.068  1.00 48.73  1 825  GLU A OE2 1 
ATOM   2057 N N   . PHE A 1 261 ? -1.095  18.583  27.264  1.00 28.93  ? 826  PHE A N   1 
ATOM   2058 C CA  . PHE A 1 261 ? -2.524  18.850  27.161  1.00 27.94  ? 826  PHE A CA  1 
ATOM   2059 C C   . PHE A 1 261 ? -2.855  19.645  25.908  1.00 27.63  ? 826  PHE A C   1 
ATOM   2060 O O   . PHE A 1 261 ? -3.865  19.388  25.254  1.00 25.81  ? 826  PHE A O   1 
ATOM   2061 C CB  . PHE A 1 261 ? -3.041  19.605  28.389  1.00 25.20  ? 826  PHE A CB  1 
ATOM   2062 C CG  . PHE A 1 261 ? -4.447  20.111  28.229  1.00 27.21  ? 826  PHE A CG  1 
ATOM   2063 C CD1 . PHE A 1 261 ? -5.529  19.260  28.415  1.00 33.38  ? 826  PHE A CD1 1 
ATOM   2064 C CD2 . PHE A 1 261 ? -4.692  21.430  27.877  1.00 27.96  ? 826  PHE A CD2 1 
ATOM   2065 C CE1 . PHE A 1 261 ? -6.825  19.714  28.258  1.00 32.27  ? 826  PHE A CE1 1 
ATOM   2066 C CE2 . PHE A 1 261 ? -5.987  21.892  27.715  1.00 33.10  ? 826  PHE A CE2 1 
ATOM   2067 C CZ  . PHE A 1 261 ? -7.055  21.033  27.907  1.00 35.31  ? 826  PHE A CZ  1 
ATOM   2068 N N   . THR A 1 262 ? -2.017  20.622  25.581  1.00 27.19  ? 827  THR A N   1 
ATOM   2069 C CA  . THR A 1 262 ? -2.274  21.440  24.406  1.00 24.71  ? 827  THR A CA  1 
ATOM   2070 C C   . THR A 1 262 ? -2.019  20.636  23.133  1.00 25.23  ? 827  THR A C   1 
ATOM   2071 O O   . THR A 1 262 ? -2.743  20.789  22.164  1.00 25.99  ? 827  THR A O   1 
ATOM   2072 C CB  . THR A 1 262 ? -1.431  22.740  24.399  1.00 28.15  ? 827  THR A CB  1 
ATOM   2073 O OG1 . THR A 1 262 ? -0.034  22.432  24.500  1.00 35.20  ? 827  THR A OG1 1 
ATOM   2074 C CG2 . THR A 1 262 ? -1.835  23.632  25.562  1.00 24.94  ? 827  THR A CG2 1 
ATOM   2075 N N   . LEU A 1 263 ? -1.010  19.769  23.138  1.00 19.03  ? 828  LEU A N   1 
ATOM   2076 C CA  . LEU A 1 263 ? -0.770  18.890  21.986  1.00 23.51  ? 828  LEU A CA  1 
ATOM   2077 C C   . LEU A 1 263 ? -1.889  17.881  21.791  1.00 18.05  ? 828  LEU A C   1 
ATOM   2078 O O   . LEU A 1 263 ? -2.334  17.643  20.672  1.00 34.40  ? 828  LEU A O   1 
ATOM   2079 C CB  . LEU A 1 263 ? 0.555   18.133  22.130  1.00 21.15  ? 828  LEU A CB  1 
ATOM   2080 C CG  . LEU A 1 263 ? 1.849   18.918  21.925  1.00 27.30  ? 828  LEU A CG  1 
ATOM   2081 C CD1 . LEU A 1 263 ? 3.027   17.970  21.774  1.00 31.71  ? 828  LEU A CD1 1 
ATOM   2082 C CD2 . LEU A 1 263 ? 1.733   19.838  20.716  1.00 29.13  ? 828  LEU A CD2 1 
ATOM   2083 N N   . VAL A 1 264 ? -2.315  17.266  22.888  1.00 29.55  ? 829  VAL A N   1 
ATOM   2084 C CA  . VAL A 1 264 ? -3.314  16.202  22.845  1.00 24.00  ? 829  VAL A CA  1 
ATOM   2085 C C   . VAL A 1 264 ? -4.748  16.702  22.729  1.00 30.57  ? 829  VAL A C   1 
ATOM   2086 O O   . VAL A 1 264 ? -5.527  16.191  21.921  1.00 33.17  ? 829  VAL A O   1 
ATOM   2087 C CB  . VAL A 1 264 ? -3.200  15.305  24.102  1.00 27.92  ? 829  VAL A CB  1 
ATOM   2088 C CG1 . VAL A 1 264 ? -4.289  14.242  24.116  1.00 27.49  ? 829  VAL A CG1 1 
ATOM   2089 C CG2 . VAL A 1 264 ? -1.831  14.654  24.146  1.00 25.48  ? 829  VAL A CG2 1 
ATOM   2090 N N   . HIS A 1 265 ? -5.121  17.655  23.576  1.00 32.07  ? 830  HIS A N   1 
ATOM   2091 C CA  . HIS A 1 265 ? -6.496  18.138  23.569  1.00 34.19  ? 830  HIS A CA  1 
ATOM   2092 C C   . HIS A 1 265 ? -6.751  19.490  22.902  1.00 33.31  ? 830  HIS A C   1 
ATOM   2093 O O   . HIS A 1 265 ? -7.905  19.899  22.786  1.00 34.59  ? 830  HIS A O   1 
ATOM   2094 C CB  . HIS A 1 265 ? -7.023  18.145  25.000  1.00 37.18  ? 830  HIS A CB  1 
ATOM   2095 C CG  . HIS A 1 265 ? -7.214  16.771  25.558  1.00 43.40  ? 830  HIS A CG  1 
ATOM   2096 N ND1 . HIS A 1 265 ? -8.095  15.865  25.005  1.00 42.63  ? 830  HIS A ND1 1 
ATOM   2097 C CD2 . HIS A 1 265 ? -6.618  16.134  26.593  1.00 43.30  ? 830  HIS A CD2 1 
ATOM   2098 C CE1 . HIS A 1 265 ? -8.044  14.734  25.686  1.00 42.56  ? 830  HIS A CE1 1 
ATOM   2099 N NE2 . HIS A 1 265 ? -7.157  14.871  26.656  1.00 42.20  ? 830  HIS A NE2 1 
ATOM   2100 N N   . CYS A 1 266 ? -5.700  20.181  22.461  1.00 29.58  ? 831  CYS A N   1 
ATOM   2101 C CA  . CYS A 1 266 ? -5.891  21.356  21.606  1.00 26.20  ? 831  CYS A CA  1 
ATOM   2102 C C   . CYS A 1 266 ? -4.926  21.353  20.427  1.00 28.47  ? 831  CYS A C   1 
ATOM   2103 O O   . CYS A 1 266 ? -4.202  22.328  20.225  1.00 26.25  ? 831  CYS A O   1 
ATOM   2104 C CB  . CYS A 1 266 ? -5.690  22.652  22.394  1.00 25.30  ? 831  CYS A CB  1 
ATOM   2105 S SG  . CYS A 1 266 ? -6.521  22.761  23.985  1.00 38.40  ? 831  CYS A SG  1 
ATOM   2106 N N   . PRO A 1 267 ? -4.931  20.278  19.625  1.00 25.88  ? 832  PRO A N   1 
ATOM   2107 C CA  . PRO A 1 267 ? -3.864  20.167  18.624  1.00 21.57  ? 832  PRO A CA  1 
ATOM   2108 C C   . PRO A 1 267 ? -3.968  21.209  17.509  1.00 25.80  ? 832  PRO A C   1 
ATOM   2109 O O   . PRO A 1 267 ? -2.954  21.506  16.878  1.00 24.67  ? 832  PRO A O   1 
ATOM   2110 C CB  . PRO A 1 267 ? -4.049  18.752  18.070  1.00 17.18  ? 832  PRO A CB  1 
ATOM   2111 C CG  . PRO A 1 267 ? -5.503  18.445  18.304  1.00 24.13  ? 832  PRO A CG  1 
ATOM   2112 C CD  . PRO A 1 267 ? -5.867  19.138  19.577  1.00 25.46  ? 832  PRO A CD  1 
ATOM   2113 N N   . ASP A 1 268 ? -5.164  21.749  17.280  1.00 27.59  ? 833  ASP A N   1 
ATOM   2114 C CA  . ASP A 1 268 ? -5.363  22.793  16.274  1.00 27.53  ? 833  ASP A CA  1 
ATOM   2115 C C   . ASP A 1 268 ? -4.515  24.044  16.556  1.00 32.65  ? 833  ASP A C   1 
ATOM   2116 O O   . ASP A 1 268 ? -4.174  24.785  15.631  1.00 31.76  ? 833  ASP A O   1 
ATOM   2117 C CB  . ASP A 1 268 ? -6.846  23.177  16.184  1.00 28.83  ? 833  ASP A CB  1 
ATOM   2118 C CG  . ASP A 1 268 ? -7.347  23.889  17.429  1.00 39.39  ? 833  ASP A CG  1 
ATOM   2119 O OD1 . ASP A 1 268 ? -7.467  25.133  17.396  1.00 44.09  ? 833  ASP A OD1 1 
ATOM   2120 O OD2 . ASP A 1 268 ? -7.621  23.208  18.441  1.00 41.83  ? 833  ASP A OD2 1 
ATOM   2121 N N   . LEU A 1 269 ? -4.176  24.272  17.826  1.00 26.67  ? 834  LEU A N   1 
ATOM   2122 C CA  . LEU A 1 269 ? -3.330  25.408  18.207  1.00 27.81  ? 834  LEU A CA  1 
ATOM   2123 C C   . LEU A 1 269 ? -1.961  25.363  17.532  1.00 27.19  ? 834  LEU A C   1 
ATOM   2124 O O   . LEU A 1 269 ? -1.338  26.403  17.320  1.00 29.39  ? 834  LEU A O   1 
ATOM   2125 C CB  . LEU A 1 269 ? -3.139  25.462  19.724  1.00 19.42  ? 834  LEU A CB  1 
ATOM   2126 C CG  . LEU A 1 269 ? -4.331  25.962  20.546  1.00 30.09  ? 834  LEU A CG  1 
ATOM   2127 C CD1 . LEU A 1 269 ? -4.008  25.951  22.033  1.00 28.12  ? 834  LEU A CD1 1 
ATOM   2128 C CD2 . LEU A 1 269 ? -4.734  27.352  20.097  1.00 28.51  ? 834  LEU A CD2 1 
ATOM   2129 N N   . MET A 1 270 ? -1.495  24.159  17.205  1.00 18.59  ? 835  MET A N   1 
ATOM   2130 C CA  . MET A 1 270 ? -0.197  23.995  16.559  1.00 20.15  ? 835  MET A CA  1 
ATOM   2131 C C   . MET A 1 270 ? -0.238  24.283  15.060  1.00 21.33  ? 835  MET A C   1 
ATOM   2132 O O   . MET A 1 270 ? 0.802   24.515  14.452  1.00 23.92  ? 835  MET A O   1 
ATOM   2133 C CB  . MET A 1 270 ? 0.343   22.580  16.774  1.00 25.94  ? 835  MET A CB  1 
ATOM   2134 C CG  . MET A 1 270 ? 1.282   22.431  17.964  1.00 31.97  ? 835  MET A CG  1 
ATOM   2135 S SD  . MET A 1 270 ? 2.626   23.635  17.977  1.00 27.27  ? 835  MET A SD  1 
ATOM   2136 C CE  . MET A 1 270 ? 3.462   23.279  16.439  1.00 21.52  ? 835  MET A CE  1 
ATOM   2137 N N   . LYS A 1 271 ? -1.427  24.259  14.464  1.00 19.56  ? 836  LYS A N   1 
ATOM   2138 C CA  . LYS A 1 271 ? -1.523  24.425  13.017  1.00 20.67  ? 836  LYS A CA  1 
ATOM   2139 C C   . LYS A 1 271 ? -0.932  25.764  12.579  1.00 24.04  ? 836  LYS A C   1 
ATOM   2140 O O   . LYS A 1 271 ? -1.350  26.825  13.049  1.00 17.38  ? 836  LYS A O   1 
ATOM   2141 C CB  . LYS A 1 271 ? -2.978  24.311  12.546  1.00 18.91  ? 836  LYS A CB  1 
ATOM   2142 C CG  . LYS A 1 271 ? -3.123  24.400  11.023  1.00 24.70  ? 836  LYS A CG  1 
ATOM   2143 C CD  . LYS A 1 271 ? -4.515  24.016  10.549  1.00 21.67  ? 836  LYS A CD  1 
ATOM   2144 C CE  . LYS A 1 271 ? -5.554  25.020  11.009  1.00 22.88  ? 836  LYS A CE  1 
ATOM   2145 N NZ  . LYS A 1 271 ? -6.884  24.705  10.432  1.00 22.57  ? 836  LYS A NZ  1 
ATOM   2146 N N   . ASP A 1 272 ? 0.045   25.689  11.678  1.00 20.52  ? 837  ASP A N   1 
ATOM   2147 C CA  . ASP A 1 272 ? 0.749   26.860  11.155  1.00 25.29  ? 837  ASP A CA  1 
ATOM   2148 C C   . ASP A 1 272 ? 1.475   27.661  12.233  1.00 22.57  ? 837  ASP A C   1 
ATOM   2149 O O   . ASP A 1 272 ? 1.778   28.833  12.047  1.00 20.07  ? 837  ASP A O   1 
ATOM   2150 C CB  . ASP A 1 272 ? -0.223  27.768  10.403  1.00 18.50  ? 837  ASP A CB  1 
ATOM   2151 C CG  . ASP A 1 272 ? -0.713  27.142  9.126   1.00 21.91  ? 837  ASP A CG  1 
ATOM   2152 O OD1 . ASP A 1 272 ? 0.111   26.500  8.441   1.00 26.70  ? 837  ASP A OD1 1 
ATOM   2153 O OD2 . ASP A 1 272 ? -1.916  27.280  8.812   1.00 24.81  1 837  ASP A OD2 1 
ATOM   2154 N N   . ARG A 1 273 ? 1.792   27.016  13.347  1.00 18.88  ? 838  ARG A N   1 
ATOM   2155 C CA  . ARG A 1 273 ? 2.511   27.696  14.408  1.00 21.77  ? 838  ARG A CA  1 
ATOM   2156 C C   . ARG A 1 273 ? 3.788   26.935  14.737  1.00 23.64  ? 838  ARG A C   1 
ATOM   2157 O O   . ARG A 1 273 ? 4.183   26.022  14.014  1.00 21.62  ? 838  ARG A O   1 
ATOM   2158 C CB  . ARG A 1 273 ? 1.635   27.865  15.651  1.00 17.76  ? 838  ARG A CB  1 
ATOM   2159 C CG  . ARG A 1 273 ? 0.455   28.796  15.431  1.00 24.88  ? 838  ARG A CG  1 
ATOM   2160 C CD  . ARG A 1 273 ? -0.133  29.316  16.736  1.00 25.60  ? 838  ARG A CD  1 
ATOM   2161 N NE  . ARG A 1 273 ? -1.258  30.210  16.471  1.00 29.50  ? 838  ARG A NE  1 
ATOM   2162 C CZ  . ARG A 1 273 ? -2.528  29.819  16.426  1.00 20.82  ? 838  ARG A CZ  1 
ATOM   2163 N NH1 . ARG A 1 273 ? -2.839  28.550  16.649  1.00 25.87  1 838  ARG A NH1 1 
ATOM   2164 N NH2 . ARG A 1 273 ? -3.487  30.694  16.166  1.00 22.28  ? 838  ARG A NH2 1 
ATOM   2165 N N   . HIS A 1 274 ? 4.446   27.357  15.808  1.00 22.68  ? 839  HIS A N   1 
ATOM   2166 C CA  . HIS A 1 274 ? 5.747   26.831  16.196  1.00 25.16  ? 839  HIS A CA  1 
ATOM   2167 C C   . HIS A 1 274 ? 5.634   26.131  17.542  1.00 20.39  ? 839  HIS A C   1 
ATOM   2168 O O   . HIS A 1 274 ? 4.995   26.643  18.469  1.00 24.72  ? 839  HIS A O   1 
ATOM   2169 C CB  . HIS A 1 274 ? 6.770   27.970  16.254  1.00 18.36  ? 839  HIS A CB  1 
ATOM   2170 C CG  . HIS A 1 274 ? 8.193   27.519  16.353  1.00 23.54  ? 839  HIS A CG  1 
ATOM   2171 N ND1 . HIS A 1 274 ? 8.722   26.964  17.498  1.00 27.61  ? 839  HIS A ND1 1 
ATOM   2172 C CD2 . HIS A 1 274 ? 9.209   27.580  15.461  1.00 20.98  ? 839  HIS A CD2 1 
ATOM   2173 C CE1 . HIS A 1 274 ? 9.999   26.687  17.302  1.00 26.94  ? 839  HIS A CE1 1 
ATOM   2174 N NE2 . HIS A 1 274 ? 10.320  27.051  16.073  1.00 24.82  ? 839  HIS A NE2 1 
ATOM   2175 N N   . LEU A 1 275 ? 6.244   24.957  17.633  1.00 16.80  ? 840  LEU A N   1 
ATOM   2176 C CA  . LEU A 1 275 ? 6.241   24.153  18.848  1.00 21.59  ? 840  LEU A CA  1 
ATOM   2177 C C   . LEU A 1 275 ? 6.667   24.925  20.100  1.00 25.47  ? 840  LEU A C   1 
ATOM   2178 O O   . LEU A 1 275 ? 6.094   24.745  21.176  1.00 25.23  ? 840  LEU A O   1 
ATOM   2179 C CB  . LEU A 1 275 ? 7.160   22.951  18.664  1.00 21.32  ? 840  LEU A CB  1 
ATOM   2180 C CG  . LEU A 1 275 ? 6.784   21.699  19.444  1.00 22.36  ? 840  LEU A CG  1 
ATOM   2181 C CD1 . LEU A 1 275 ? 5.490   21.124  18.892  1.00 19.29  ? 840  LEU A CD1 1 
ATOM   2182 C CD2 . LEU A 1 275 ? 7.913   20.679  19.370  1.00 31.08  ? 840  LEU A CD2 1 
ATOM   2183 N N   . ASP A 1 276 ? 7.676   25.780  19.960  1.00 18.91  ? 841  ASP A N   1 
ATOM   2184 C CA  . ASP A 1 276 ? 8.210   26.494  21.112  1.00 25.29  ? 841  ASP A CA  1 
ATOM   2185 C C   . ASP A 1 276 ? 7.226   27.545  21.620  1.00 28.12  ? 841  ASP A C   1 
ATOM   2186 O O   . ASP A 1 276 ? 7.253   27.909  22.790  1.00 26.67  ? 841  ASP A O   1 
ATOM   2187 C CB  . ASP A 1 276 ? 9.553   27.146  20.774  1.00 23.80  ? 841  ASP A CB  1 
ATOM   2188 C CG  . ASP A 1 276 ? 10.644  26.121  20.461  1.00 26.64  ? 841  ASP A CG  1 
ATOM   2189 O OD1 . ASP A 1 276 ? 11.725  26.527  19.983  1.00 31.65  ? 841  ASP A OD1 1 
ATOM   2190 O OD2 . ASP A 1 276 ? 10.424  24.913  20.682  1.00 22.81  1 841  ASP A OD2 1 
ATOM   2191 N N   . GLN A 1 277 ? 6.351   28.021  20.745  1.00 30.63  ? 842  GLN A N   1 
ATOM   2192 C CA  . GLN A 1 277 ? 5.353   29.004  21.149  1.00 30.38  ? 842  GLN A CA  1 
ATOM   2193 C C   . GLN A 1 277 ? 4.391   28.402  22.166  1.00 31.87  ? 842  GLN A C   1 
ATOM   2194 O O   . GLN A 1 277 ? 4.011   29.063  23.137  1.00 29.92  ? 842  GLN A O   1 
ATOM   2195 C CB  . GLN A 1 277 ? 4.597   29.541  19.929  1.00 25.52  ? 842  GLN A CB  1 
ATOM   2196 C CG  . GLN A 1 277 ? 5.445   30.485  19.071  1.00 24.82  ? 842  GLN A CG  1 
ATOM   2197 C CD  . GLN A 1 277 ? 4.976   30.570  17.631  1.00 20.76  ? 842  GLN A CD  1 
ATOM   2198 O OE1 . GLN A 1 277 ? 4.108   29.813  17.208  1.00 23.87  ? 842  GLN A OE1 1 
ATOM   2199 N NE2 . GLN A 1 277 ? 5.561   31.487  16.868  1.00 21.45  ? 842  GLN A NE2 1 
ATOM   2200 N N   . LEU A 1 278 ? 4.017   27.142  21.959  1.00 23.51  ? 843  LEU A N   1 
ATOM   2201 C CA  . LEU A 1 278 ? 3.133   26.458  22.895  1.00 25.16  ? 843  LEU A CA  1 
ATOM   2202 C C   . LEU A 1 278 ? 3.876   26.091  24.170  1.00 27.23  ? 843  LEU A C   1 
ATOM   2203 O O   . LEU A 1 278 ? 3.295   26.064  25.253  1.00 28.58  ? 843  LEU A O   1 
ATOM   2204 C CB  . LEU A 1 278 ? 2.526   25.204  22.255  1.00 28.90  ? 843  LEU A CB  1 
ATOM   2205 C CG  . LEU A 1 278 ? 1.115   25.375  21.675  1.00 29.60  ? 843  LEU A CG  1 
ATOM   2206 C CD1 . LEU A 1 278 ? 1.098   26.456  20.619  1.00 30.20  ? 843  LEU A CD1 1 
ATOM   2207 C CD2 . LEU A 1 278 ? 0.601   24.070  21.103  1.00 35.75  ? 843  LEU A CD2 1 
ATOM   2208 N N   . LEU A 1 279 ? 5.169   25.822  24.040  1.00 27.28  ? 844  LEU A N   1 
ATOM   2209 C CA  . LEU A 1 279 ? 5.968   25.411  25.186  1.00 32.74  ? 844  LEU A CA  1 
ATOM   2210 C C   . LEU A 1 279 ? 6.229   26.589  26.124  1.00 31.68  ? 844  LEU A C   1 
ATOM   2211 O O   . LEU A 1 279 ? 6.227   26.431  27.342  1.00 35.39  ? 844  LEU A O   1 
ATOM   2212 C CB  . LEU A 1 279 ? 7.292   24.789  24.725  1.00 32.78  ? 844  LEU A CB  1 
ATOM   2213 C CG  . LEU A 1 279 ? 8.143   24.134  25.818  1.00 39.66  ? 844  LEU A CG  1 
ATOM   2214 C CD1 . LEU A 1 279 ? 7.406   22.964  26.462  1.00 40.38  ? 844  LEU A CD1 1 
ATOM   2215 C CD2 . LEU A 1 279 ? 9.503   23.691  25.281  1.00 30.19  ? 844  LEU A CD2 1 
ATOM   2216 N N   . LEU A 1 280 ? 6.440   27.771  25.554  1.00 31.01  ? 845  LEU A N   1 
ATOM   2217 C CA  . LEU A 1 280 ? 6.713   28.960  26.356  1.00 33.46  ? 845  LEU A CA  1 
ATOM   2218 C C   . LEU A 1 280 ? 5.444   29.428  27.059  1.00 31.38  ? 845  LEU A C   1 
ATOM   2219 O O   . LEU A 1 280 ? 5.484   29.866  28.208  1.00 30.88  ? 845  LEU A O   1 
ATOM   2220 C CB  . LEU A 1 280 ? 7.292   30.082  25.488  1.00 25.94  ? 845  LEU A CB  1 
ATOM   2221 C CG  . LEU A 1 280 ? 8.655   29.809  24.848  1.00 39.48  ? 845  LEU A CG  1 
ATOM   2222 C CD1 . LEU A 1 280 ? 9.076   30.955  23.936  1.00 38.73  ? 845  LEU A CD1 1 
ATOM   2223 C CD2 . LEU A 1 280 ? 9.715   29.554  25.907  1.00 39.41  ? 845  LEU A CD2 1 
ATOM   2224 N N   . CYS A 1 281 ? 4.317   29.330  26.364  1.00 30.97  ? 846  CYS A N   1 
ATOM   2225 C CA  . CYS A 1 281 ? 3.028   29.655  26.962  1.00 26.79  ? 846  CYS A CA  1 
ATOM   2226 C C   . CYS A 1 281 ? 2.694   28.684  28.087  1.00 31.11  ? 846  CYS A C   1 
ATOM   2227 O O   . CYS A 1 281 ? 2.175   29.085  29.130  1.00 34.08  ? 846  CYS A O   1 
ATOM   2228 C CB  . CYS A 1 281 ? 1.924   29.641  25.905  1.00 25.40  ? 846  CYS A CB  1 
ATOM   2229 S SG  . CYS A 1 281 ? 2.037   31.013  24.743  1.00 29.13  ? 846  CYS A SG  1 
ATOM   2230 N N   . ALA A 1 282 ? 2.991   27.405  27.873  1.00 29.65  ? 847  ALA A N   1 
ATOM   2231 C CA  . ALA A 1 282 ? 2.794   26.407  28.914  1.00 29.12  ? 847  ALA A CA  1 
ATOM   2232 C C   . ALA A 1 282 ? 3.616   26.769  30.143  1.00 32.74  ? 847  ALA A C   1 
ATOM   2233 O O   . ALA A 1 282 ? 3.145   26.634  31.272  1.00 32.30  ? 847  ALA A O   1 
ATOM   2234 C CB  . ALA A 1 282 ? 3.161   25.014  28.408  1.00 25.14  ? 847  ALA A CB  1 
ATOM   2235 N N   . PHE A 1 283 ? 4.836   27.248  29.916  1.00 34.68  ? 848  PHE A N   1 
ATOM   2236 C CA  . PHE A 1 283 ? 5.755   27.589  31.002  1.00 33.82  ? 848  PHE A CA  1 
ATOM   2237 C C   . PHE A 1 283 ? 5.187   28.657  31.943  1.00 36.13  ? 848  PHE A C   1 
ATOM   2238 O O   . PHE A 1 283 ? 5.179   28.497  33.172  1.00 39.01  ? 848  PHE A O   1 
ATOM   2239 C CB  . PHE A 1 283 ? 7.092   28.063  30.410  1.00 29.67  ? 848  PHE A CB  1 
ATOM   2240 C CG  . PHE A 1 283 ? 8.259   27.927  31.348  1.00 31.15  ? 848  PHE A CG  1 
ATOM   2241 C CD1 . PHE A 1 283 ? 9.269   27.011  31.102  1.00 30.75  ? 848  PHE A CD1 1 
ATOM   2242 C CD2 . PHE A 1 283 ? 8.349   28.724  32.478  1.00 44.63  ? 848  PHE A CD2 1 
ATOM   2243 C CE1 . PHE A 1 283 ? 10.341  26.889  31.969  1.00 32.35  ? 848  PHE A CE1 1 
ATOM   2244 C CE2 . PHE A 1 283 ? 9.414   28.606  33.349  1.00 34.74  ? 848  PHE A CE2 1 
ATOM   2245 C CZ  . PHE A 1 283 ? 10.409  27.684  33.095  1.00 34.35  ? 848  PHE A CZ  1 
ATOM   2246 N N   . TYR A 1 284 ? 4.714   29.743  31.334  1.00 33.21  ? 849  TYR A N   1 
ATOM   2247 C CA  . TYR A 1 284 ? 4.257   30.943  32.052  1.00 36.13  ? 849  TYR A CA  1 
ATOM   2248 C C   . TYR A 1 284 ? 2.949   30.672  32.800  1.00 40.15  ? 849  TYR A C   1 
ATOM   2249 O O   . TYR A 1 284 ? 2.845   30.957  33.999  1.00 35.76  ? 849  TYR A O   1 
ATOM   2250 C CB  . TYR A 1 284 ? 4.096   32.130  31.078  1.00 32.93  ? 849  TYR A CB  1 
ATOM   2251 C CG  . TYR A 1 284 ? 3.506   33.387  31.714  1.00 42.08  ? 849  TYR A CG  1 
ATOM   2252 C CD1 . TYR A 1 284 ? 4.297   34.282  32.435  1.00 44.96  ? 849  TYR A CD1 1 
ATOM   2253 C CD2 . TYR A 1 284 ? 2.150   33.673  31.598  1.00 37.43  ? 849  TYR A CD2 1 
ATOM   2254 C CE1 . TYR A 1 284 ? 3.742   35.418  33.031  1.00 45.44  ? 849  TYR A CE1 1 
ATOM   2255 C CE2 . TYR A 1 284 ? 1.593   34.795  32.182  1.00 40.82  ? 849  TYR A CE2 1 
ATOM   2256 C CZ  . TYR A 1 284 ? 2.387   35.664  32.899  1.00 44.82  ? 849  TYR A CZ  1 
ATOM   2257 O OH  . TYR A 1 284 ? 1.802   36.764  33.475  1.00 47.42  ? 849  TYR A OH  1 
ATOM   2258 N N   . ILE A 1 285 ? 1.976   30.078  32.109  1.00 35.75  ? 850  ILE A N   1 
ATOM   2259 C CA  . ILE A 1 285 ? 0.654   29.897  32.700  1.00 46.19  ? 850  ILE A CA  1 
ATOM   2260 C C   . ILE A 1 285 ? 0.727   28.931  33.880  1.00 45.74  ? 850  ILE A C   1 
ATOM   2261 O O   . ILE A 1 285 ? 0.010   29.089  34.867  1.00 45.51  ? 850  ILE A O   1 
ATOM   2262 C CB  . ILE A 1 285 ? -0.399  29.400  31.653  1.00 37.35  ? 850  ILE A CB  1 
ATOM   2263 C CG1 . ILE A 1 285 ? -1.819  29.684  32.154  1.00 42.00  ? 850  ILE A CG1 1 
ATOM   2264 C CG2 . ILE A 1 285 ? -0.221  27.922  31.310  1.00 32.57  ? 850  ILE A CG2 1 
ATOM   2265 C CD1 . ILE A 1 285 ? -2.896  29.356  31.153  1.00 41.48  ? 850  ILE A CD1 1 
ATOM   2266 N N   . MET A 1 286 ? 1.637   27.967  33.796  1.00 41.00  ? 851  MET A N   1 
ATOM   2267 C CA  . MET A 1 286 ? 1.840   27.017  34.879  1.00 41.64  ? 851  MET A CA  1 
ATOM   2268 C C   . MET A 1 286 ? 2.645   27.632  36.012  1.00 36.64  ? 851  MET A C   1 
ATOM   2269 O O   . MET A 1 286 ? 2.339   27.405  37.180  1.00 43.37  ? 851  MET A O   1 
ATOM   2270 C CB  . MET A 1 286 ? 2.535   25.754  34.373  1.00 35.75  ? 851  MET A CB  1 
ATOM   2271 C CG  . MET A 1 286 ? 1.616   24.821  33.625  1.00 31.89  ? 851  MET A CG  1 
ATOM   2272 S SD  . MET A 1 286 ? 0.167   24.373  34.591  1.00 54.07  ? 851  MET A SD  1 
ATOM   2273 C CE  . MET A 1 286 ? -1.101  25.098  33.582  1.00 37.67  ? 851  MET A CE  1 
ATOM   2274 N N   . ALA A 1 287 ? 3.676   28.402  35.672  1.00 39.05  ? 852  ALA A N   1 
ATOM   2275 C CA  . ALA A 1 287 ? 4.447   29.112  36.691  1.00 45.96  ? 852  ALA A CA  1 
ATOM   2276 C C   . ALA A 1 287 ? 3.544   30.113  37.396  1.00 48.04  ? 852  ALA A C   1 
ATOM   2277 O O   . ALA A 1 287 ? 3.652   30.321  38.604  1.00 48.93  ? 852  ALA A O   1 
ATOM   2278 C CB  . ALA A 1 287 ? 5.650   29.813  36.082  1.00 38.28  ? 852  ALA A CB  1 
ATOM   2279 N N   . LYS A 1 288 ? 2.657   30.731  36.621  1.00 44.42  ? 853  LYS A N   1 
ATOM   2280 C CA  . LYS A 1 288 ? 1.672   31.661  37.159  1.00 42.49  ? 853  LYS A CA  1 
ATOM   2281 C C   . LYS A 1 288 ? 0.772   30.990  38.193  1.00 45.30  ? 853  LYS A C   1 
ATOM   2282 O O   . LYS A 1 288 ? 0.797   31.354  39.368  1.00 44.93  ? 853  LYS A O   1 
ATOM   2283 C CB  . LYS A 1 288 ? 0.830   32.262  36.034  1.00 44.53  ? 853  LYS A CB  1 
ATOM   2284 C CG  . LYS A 1 288 ? 0.333   33.671  36.311  1.00 49.72  ? 853  LYS A CG  1 
ATOM   2285 C CD  . LYS A 1 288 ? -0.273  34.277  35.055  1.00 54.49  ? 853  LYS A CD  1 
ATOM   2286 C CE  . LYS A 1 288 ? -0.612  35.740  35.254  1.00 59.96  ? 853  LYS A CE  1 
ATOM   2287 N NZ  . LYS A 1 288 ? 0.603   36.553  35.525  1.00 60.83  ? 853  LYS A NZ  1 
ATOM   2288 N N   . VAL A 1 289 ? -0.019  30.012  37.753  1.00 43.60  ? 854  VAL A N   1 
ATOM   2289 C CA  . VAL A 1 289 ? -1.029  29.393  38.613  1.00 48.87  ? 854  VAL A CA  1 
ATOM   2290 C C   . VAL A 1 289 ? -0.454  28.716  39.857  1.00 53.89  ? 854  VAL A C   1 
ATOM   2291 O O   . VAL A 1 289 ? -1.153  28.561  40.860  1.00 63.01  ? 854  VAL A O   1 
ATOM   2292 C CB  . VAL A 1 289 ? -1.869  28.346  37.841  1.00 47.04  ? 854  VAL A CB  1 
ATOM   2293 C CG1 . VAL A 1 289 ? -2.670  29.014  36.736  1.00 44.18  ? 854  VAL A CG1 1 
ATOM   2294 C CG2 . VAL A 1 289 ? -0.984  27.239  37.284  1.00 40.74  ? 854  VAL A CG2 1 
ATOM   2295 N N   . THR A 1 290 ? 0.811   28.314  39.800  1.00 49.23  ? 855  THR A N   1 
ATOM   2296 C CA  . THR A 1 290 ? 1.435   27.644  40.939  1.00 52.83  ? 855  THR A CA  1 
ATOM   2297 C C   . THR A 1 290 ? 2.204   28.614  41.832  1.00 48.80  ? 855  THR A C   1 
ATOM   2298 O O   . THR A 1 290 ? 2.808   28.202  42.823  1.00 49.80  ? 855  THR A O   1 
ATOM   2299 C CB  . THR A 1 290 ? 2.391   26.535  40.483  1.00 47.11  ? 855  THR A CB  1 
ATOM   2300 O OG1 . THR A 1 290 ? 3.424   27.106  39.674  1.00 50.13  ? 855  THR A OG1 1 
ATOM   2301 C CG2 . THR A 1 290 ? 1.638   25.483  39.680  1.00 42.01  ? 855  THR A CG2 1 
ATOM   2302 N N   . LYS A 1 291 ? 2.183   29.894  41.463  1.00 47.29  ? 856  LYS A N   1 
ATOM   2303 C CA  . LYS A 1 291 ? 2.800   30.972  42.247  1.00 60.40  ? 856  LYS A CA  1 
ATOM   2304 C C   . LYS A 1 291 ? 4.316   30.810  42.354  1.00 57.06  ? 856  LYS A C   1 
ATOM   2305 O O   . LYS A 1 291 ? 4.950   31.306  43.284  1.00 56.57  ? 856  LYS A O   1 
ATOM   2306 C CB  . LYS A 1 291 ? 2.172   31.059  43.647  1.00 52.24  ? 856  LYS A CB  1 
ATOM   2307 C CG  . LYS A 1 291 ? 0.910   31.917  43.721  1.00 54.66  ? 856  LYS A CG  1 
ATOM   2308 C CD  . LYS A 1 291 ? -0.171  31.429  42.768  1.00 53.77  ? 856  LYS A CD  1 
ATOM   2309 C CE  . LYS A 1 291 ? -1.318  32.420  42.665  1.00 58.35  ? 856  LYS A CE  1 
ATOM   2310 N NZ  . LYS A 1 291 ? -2.282  32.022  41.602  1.00 57.17  ? 856  LYS A NZ  1 
ATOM   2311 N N   . GLU A 1 292 ? 4.879   30.098  41.387  1.00 58.69  ? 857  GLU A N   1 
ATOM   2312 C CA  . GLU A 1 292 ? 6.320   30.003  41.183  1.00 63.54  ? 857  GLU A CA  1 
ATOM   2313 C C   . GLU A 1 292 ? 6.743   31.037  40.131  1.00 68.33  ? 857  GLU A C   1 
ATOM   2314 O O   . GLU A 1 292 ? 7.849   30.983  39.594  1.00 75.92  ? 857  GLU A O   1 
ATOM   2315 C CB  . GLU A 1 292 ? 6.725   28.586  40.780  1.00 63.01  ? 857  GLU A CB  1 
ATOM   2316 C CG  . GLU A 1 292 ? 8.196   28.267  41.028  1.00 64.25  ? 857  GLU A CG  1 
ATOM   2317 C CD  . GLU A 1 292 ? 8.464   26.781  41.155  1.00 63.24  ? 857  GLU A CD  1 
ATOM   2318 O OE1 . GLU A 1 292 ? 9.633   26.371  40.989  1.00 60.42  ? 857  GLU A OE1 1 
ATOM   2319 O OE2 . GLU A 1 292 ? 7.507   26.025  41.431  1.00 63.47  ? 857  GLU A OE2 1 
ATOM   2320 N N   . GLU A 1 293 ? 5.834   31.967  39.844  1.00 63.66  ? 858  GLU A N   1 
ATOM   2321 C CA  . GLU A 1 293 ? 5.799   32.735  38.598  1.00 58.63  ? 858  GLU A CA  1 
ATOM   2322 C C   . GLU A 1 293 ? 7.114   33.324  38.104  1.00 55.26  ? 858  GLU A C   1 
ATOM   2323 O O   . GLU A 1 293 ? 7.905   33.870  38.871  1.00 59.48  ? 858  GLU A O   1 
ATOM   2324 C CB  . GLU A 1 293 ? 4.811   33.898  38.747  1.00 61.63  ? 858  GLU A CB  1 
ATOM   2325 C CG  . GLU A 1 293 ? 3.491   33.543  39.402  1.00 69.88  ? 858  GLU A CG  1 
ATOM   2326 C CD  . GLU A 1 293 ? 3.346   34.129  40.788  1.00 80.20  ? 858  GLU A CD  1 
ATOM   2327 O OE1 . GLU A 1 293 ? 2.198   34.396  41.203  1.00 84.40  ? 858  GLU A OE1 1 
ATOM   2328 O OE2 . GLU A 1 293 ? 4.378   34.323  41.464  1.00 83.75  ? 858  GLU A OE2 1 
ATOM   2329 N N   . ARG A 1 294 ? 7.321   33.195  36.796  1.00 48.76  ? 859  ARG A N   1 
ATOM   2330 C CA  . ARG A 1 294 ? 8.384   33.886  36.082  1.00 46.40  ? 859  ARG A CA  1 
ATOM   2331 C C   . ARG A 1 294 ? 7.742   34.743  34.990  1.00 41.31  ? 859  ARG A C   1 
ATOM   2332 O O   . ARG A 1 294 ? 6.741   34.341  34.400  1.00 39.77  ? 859  ARG A O   1 
ATOM   2333 C CB  . ARG A 1 294 ? 9.379   32.888  35.484  1.00 49.05  ? 859  ARG A CB  1 
ATOM   2334 C CG  . ARG A 1 294 ? 9.925   31.885  36.487  1.00 50.86  ? 859  ARG A CG  1 
ATOM   2335 C CD  . ARG A 1 294 ? 10.586  32.595  37.664  1.00 58.86  ? 859  ARG A CD  1 
ATOM   2336 N NE  . ARG A 1 294 ? 10.868  31.687  38.773  1.00 57.16  ? 859  ARG A NE  1 
ATOM   2337 C CZ  . ARG A 1 294 ? 11.921  30.878  38.819  1.00 60.17  ? 859  ARG A CZ  1 
ATOM   2338 N NH1 . ARG A 1 294 ? 12.786  30.863  37.814  1.00 62.12  ? 859  ARG A NH1 1 
ATOM   2339 N NH2 . ARG A 1 294 ? 12.107  30.081  39.864  1.00 57.85  ? 859  ARG A NH2 1 
ATOM   2340 N N   . THR A 1 295 ? 8.294   35.925  34.733  1.00 42.38  ? 860  THR A N   1 
ATOM   2341 C CA  . THR A 1 295 ? 7.751   36.786  33.686  1.00 47.21  ? 860  THR A CA  1 
ATOM   2342 C C   . THR A 1 295 ? 7.999   36.169  32.304  1.00 45.73  ? 860  THR A C   1 
ATOM   2343 O O   . THR A 1 295 ? 8.998   35.472  32.105  1.00 41.28  ? 860  THR A O   1 
ATOM   2344 C CB  . THR A 1 295 ? 8.364   38.207  33.739  1.00 49.77  ? 860  THR A CB  1 
ATOM   2345 O OG1 . THR A 1 295 ? 9.721   38.167  33.284  1.00 52.49  ? 860  THR A OG1 1 
ATOM   2346 C CG2 . THR A 1 295 ? 8.321   38.769  35.160  1.00 46.32  ? 860  THR A CG2 1 
ATOM   2347 N N   . PHE A 1 296 ? 7.085   36.407  31.360  1.00 49.46  ? 861  PHE A N   1 
ATOM   2348 C CA  . PHE A 1 296 ? 7.297   35.975  29.978  1.00 51.88  ? 861  PHE A CA  1 
ATOM   2349 C C   . PHE A 1 296 ? 8.589   36.565  29.428  1.00 52.25  ? 861  PHE A C   1 
ATOM   2350 O O   . PHE A 1 296 ? 9.269   35.945  28.605  1.00 54.09  ? 861  PHE A O   1 
ATOM   2351 C CB  . PHE A 1 296 ? 6.147   36.387  29.046  1.00 56.44  ? 861  PHE A CB  1 
ATOM   2352 C CG  . PHE A 1 296 ? 5.268   35.251  28.604  1.00 51.10  ? 861  PHE A CG  1 
ATOM   2353 C CD1 . PHE A 1 296 ? 5.732   34.298  27.708  1.00 47.97  ? 861  PHE A CD1 1 
ATOM   2354 C CD2 . PHE A 1 296 ? 3.930   35.220  28.969  1.00 46.98  ? 861  PHE A CD2 1 
ATOM   2355 C CE1 . PHE A 1 296 ? 4.905   33.277  27.277  1.00 39.31  ? 861  PHE A CE1 1 
ATOM   2356 C CE2 . PHE A 1 296 ? 3.101   34.218  28.525  1.00 47.56  ? 861  PHE A CE2 1 
ATOM   2357 C CZ  . PHE A 1 296 ? 3.597   33.225  27.672  1.00 45.21  ? 861  PHE A CZ  1 
ATOM   2358 N N   . GLN A 1 297 ? 8.912   37.775  29.876  1.00 56.87  ? 862  GLN A N   1 
ATOM   2359 C CA  . GLN A 1 297 ? 10.108  38.461  29.412  1.00 52.46  ? 862  GLN A CA  1 
ATOM   2360 C C   . GLN A 1 297 ? 11.351  37.661  29.779  1.00 47.59  ? 862  GLN A C   1 
ATOM   2361 O O   . GLN A 1 297 ? 12.190  37.410  28.917  1.00 48.89  ? 862  GLN A O   1 
ATOM   2362 C CB  . GLN A 1 297 ? 10.177  39.883  29.982  1.00 48.27  ? 862  GLN A CB  1 
ATOM   2363 C CG  . GLN A 1 297 ? 9.261   40.868  29.264  1.00 54.40  ? 862  GLN A CG  1 
ATOM   2364 C CD  . GLN A 1 297 ? 9.502   42.316  29.665  1.00 66.21  ? 862  GLN A CD  1 
ATOM   2365 O OE1 . GLN A 1 297 ? 10.002  42.600  30.754  1.00 72.93  ? 862  GLN A OE1 1 
ATOM   2366 N NE2 . GLN A 1 297 ? 9.148   43.239  28.777  1.00 67.14  ? 862  GLN A NE2 1 
ATOM   2367 N N   . GLU A 1 298 ? 11.459  37.236  31.037  1.00 45.58  ? 863  GLU A N   1 
ATOM   2368 C CA  . GLU A 1 298 ? 12.614  36.433  31.442  1.00 47.41  ? 863  GLU A CA  1 
ATOM   2369 C C   . GLU A 1 298 ? 12.532  35.019  30.884  1.00 41.13  ? 863  GLU A C   1 
ATOM   2370 O O   . GLU A 1 298 ? 13.556  34.388  30.633  1.00 38.91  ? 863  GLU A O   1 
ATOM   2371 C CB  . GLU A 1 298 ? 12.776  36.416  32.965  1.00 50.96  ? 863  GLU A CB  1 
ATOM   2372 C CG  . GLU A 1 298 ? 11.659  35.774  33.755  1.00 57.88  ? 863  GLU A CG  1 
ATOM   2373 C CD  . GLU A 1 298 ? 11.863  35.954  35.249  1.00 65.43  ? 863  GLU A CD  1 
ATOM   2374 O OE1 . GLU A 1 298 ? 13.006  36.250  35.652  1.00 73.17  ? 863  GLU A OE1 1 
ATOM   2375 O OE2 . GLU A 1 298 ? 10.889  35.820  36.016  1.00 63.17  ? 863  GLU A OE2 1 
ATOM   2376 N N   . ILE A 1 299 ? 11.315  34.531  30.676  1.00 41.33  ? 864  ILE A N   1 
ATOM   2377 C CA  . ILE A 1 299 ? 11.113  33.254  30.002  1.00 38.32  ? 864  ILE A CA  1 
ATOM   2378 C C   . ILE A 1 299 ? 11.727  33.300  28.604  1.00 38.34  ? 864  ILE A C   1 
ATOM   2379 O O   . ILE A 1 299 ? 12.443  32.385  28.196  1.00 40.27  ? 864  ILE A O   1 
ATOM   2380 C CB  . ILE A 1 299 ? 9.617   32.900  29.914  1.00 33.81  ? 864  ILE A CB  1 
ATOM   2381 C CG1 . ILE A 1 299 ? 9.127   32.377  31.265  1.00 34.94  ? 864  ILE A CG1 1 
ATOM   2382 C CG2 . ILE A 1 299 ? 9.365   31.856  28.835  1.00 36.81  ? 864  ILE A CG2 1 
ATOM   2383 C CD1 . ILE A 1 299 ? 7.655   32.064  31.301  1.00 33.89  ? 864  ILE A CD1 1 
ATOM   2384 N N   . MET A 1 300 ? 11.474  34.395  27.893  1.00 36.66  ? 865  MET A N   1 
ATOM   2385 C CA  . MET A 1 300 ? 11.942  34.541  26.520  1.00 39.94  ? 865  MET A CA  1 
ATOM   2386 C C   . MET A 1 300 ? 13.437  34.885  26.385  1.00 36.68  ? 865  MET A C   1 
ATOM   2387 O O   . MET A 1 300 ? 14.071  34.465  25.416  1.00 34.56  ? 865  MET A O   1 
ATOM   2388 C CB  . MET A 1 300 ? 11.095  35.594  25.802  1.00 41.86  ? 865  MET A CB  1 
ATOM   2389 C CG  . MET A 1 300 ? 9.736   35.068  25.328  1.00 36.10  ? 865  MET A CG  1 
ATOM   2390 S SD  . MET A 1 300 ? 8.532   36.388  25.061  1.00 70.28  ? 865  MET A SD  1 
ATOM   2391 C CE  . MET A 1 300 ? 9.603   37.731  24.557  1.00 67.16  ? 865  MET A CE  1 
ATOM   2392 N N   . LYS A 1 301 ? 14.006  35.644  27.322  1.00 39.55  ? 866  LYS A N   1 
ATOM   2393 C CA  . LYS A 1 301 ? 15.448  35.908  27.257  1.00 46.32  ? 866  LYS A CA  1 
ATOM   2394 C C   . LYS A 1 301 ? 16.215  34.606  27.509  1.00 50.31  ? 866  LYS A C   1 
ATOM   2395 O O   . LYS A 1 301 ? 17.278  34.378  26.928  1.00 52.94  ? 866  LYS A O   1 
ATOM   2396 C CB  . LYS A 1 301 ? 15.896  37.001  28.248  1.00 51.13  ? 866  LYS A CB  1 
ATOM   2397 C CG  . LYS A 1 301 ? 15.183  38.351  28.119  1.00 59.94  ? 866  LYS A CG  1 
ATOM   2398 C CD  . LYS A 1 301 ? 15.415  39.251  29.346  1.00 68.56  ? 866  LYS A CD  1 
ATOM   2399 C CE  . LYS A 1 301 ? 14.397  38.984  30.434  1.00 69.85  ? 866  LYS A CE  1 
ATOM   2400 N NZ  . LYS A 1 301 ? 14.151  40.102  31.388  1.00 68.51  ? 866  LYS A NZ  1 
ATOM   2401 N N   . SER A 1 302 ? 15.658  33.748  28.359  1.00 49.67  ? 867  SER A N   1 
ATOM   2402 C CA  . SER A 1 302 ? 16.229  32.428  28.597  1.00 49.78  ? 867  SER A CA  1 
ATOM   2403 C C   . SER A 1 302 ? 16.050  31.550  27.365  1.00 43.02  ? 867  SER A C   1 
ATOM   2404 O O   . SER A 1 302 ? 16.920  30.750  27.023  1.00 46.96  ? 867  SER A O   1 
ATOM   2405 C CB  . SER A 1 302 ? 15.580  31.772  29.816  1.00 51.00  ? 867  SER A CB  1 
ATOM   2406 O OG  . SER A 1 302 ? 15.797  32.546  30.983  1.00 56.31  ? 867  SER A OG  1 
ATOM   2407 N N   . TYR A 1 303 ? 14.915  31.717  26.697  1.00 36.49  ? 868  TYR A N   1 
ATOM   2408 C CA  . TYR A 1 303 ? 14.605  30.940  25.505  1.00 30.87  ? 868  TYR A CA  1 
ATOM   2409 C C   . TYR A 1 303 ? 15.531  31.262  24.338  1.00 39.62  ? 868  TYR A C   1 
ATOM   2410 O O   . TYR A 1 303 ? 15.957  30.362  23.620  1.00 40.28  ? 868  TYR A O   1 
ATOM   2411 C CB  . TYR A 1 303 ? 13.153  31.165  25.079  1.00 29.54  ? 868  TYR A CB  1 
ATOM   2412 C CG  . TYR A 1 303 ? 12.838  30.599  23.709  1.00 29.75  ? 868  TYR A CG  1 
ATOM   2413 C CD1 . TYR A 1 303 ? 12.738  29.229  23.509  1.00 26.34  ? 868  TYR A CD1 1 
ATOM   2414 C CD2 . TYR A 1 303 ? 12.645  31.438  22.617  1.00 32.81  ? 868  TYR A CD2 1 
ATOM   2415 C CE1 . TYR A 1 303 ? 12.455  28.708  22.259  1.00 34.86  ? 868  TYR A CE1 1 
ATOM   2416 C CE2 . TYR A 1 303 ? 12.358  30.929  21.365  1.00 28.63  ? 868  TYR A CE2 1 
ATOM   2417 C CZ  . TYR A 1 303 ? 12.268  29.562  21.191  1.00 35.78  ? 868  TYR A CZ  1 
ATOM   2418 O OH  . TYR A 1 303 ? 11.989  29.050  19.945  1.00 40.60  ? 868  TYR A OH  1 
ATOM   2419 N N   . ARG A 1 304 ? 15.848  32.542  24.160  1.00 47.27  ? 869  ARG A N   1 
ATOM   2420 C CA  . ARG A 1 304 ? 16.575  33.009  22.978  1.00 52.31  ? 869  ARG A CA  1 
ATOM   2421 C C   . ARG A 1 304 ? 18.008  32.480  22.867  1.00 51.34  ? 869  ARG A C   1 
ATOM   2422 O O   . ARG A 1 304 ? 18.617  32.547  21.799  1.00 55.76  ? 869  ARG A O   1 
ATOM   2423 C CB  . ARG A 1 304 ? 16.596  34.539  22.945  1.00 59.03  ? 869  ARG A CB  1 
ATOM   2424 C CG  . ARG A 1 304 ? 16.884  35.114  21.564  1.00 64.43  ? 869  ARG A CG  1 
ATOM   2425 C CD  . ARG A 1 304 ? 16.918  36.638  21.556  1.00 71.21  ? 869  ARG A CD  1 
ATOM   2426 N NE  . ARG A 1 304 ? 17.143  37.224  22.875  1.00 75.63  ? 869  ARG A NE  1 
ATOM   2427 C CZ  . ARG A 1 304 ? 16.195  37.800  23.610  1.00 80.17  ? 869  ARG A CZ  1 
ATOM   2428 N NH1 . ARG A 1 304 ? 14.947  37.860  23.161  1.00 84.13  ? 869  ARG A NH1 1 
ATOM   2429 N NH2 . ARG A 1 304 ? 16.492  38.314  24.798  1.00 75.87  ? 869  ARG A NH2 1 
ATOM   2430 N N   . ASN A 1 305 ? 18.547  31.952  23.959  1.00 49.66  ? 870  ASN A N   1 
ATOM   2431 C CA  . ASN A 1 305 ? 19.895  31.395  23.932  1.00 48.81  ? 870  ASN A CA  1 
ATOM   2432 C C   . ASN A 1 305 ? 19.916  29.961  23.405  1.00 51.48  ? 870  ASN A C   1 
ATOM   2433 O O   . ASN A 1 305 ? 20.977  29.348  23.285  1.00 59.62  ? 870  ASN A O   1 
ATOM   2434 C CB  . ASN A 1 305 ? 20.523  31.452  25.324  1.00 55.87  ? 870  ASN A CB  1 
ATOM   2435 C CG  . ASN A 1 305 ? 20.973  32.853  25.702  1.00 63.26  ? 870  ASN A CG  1 
ATOM   2436 O OD1 . ASN A 1 305 ? 21.436  33.621  24.857  1.00 61.05  ? 870  ASN A OD1 1 
ATOM   2437 N ND2 . ASN A 1 305 ? 20.840  33.192  26.979  1.00 68.51  ? 870  ASN A ND2 1 
ATOM   2438 N N   . GLN A 1 306 ? 18.738  29.429  23.092  1.00 41.58  ? 871  GLN A N   1 
ATOM   2439 C CA  . GLN A 1 306 ? 18.633  28.105  22.487  1.00 43.89  ? 871  GLN A CA  1 
ATOM   2440 C C   . GLN A 1 306 ? 18.881  28.194  20.977  1.00 49.14  ? 871  GLN A C   1 
ATOM   2441 O O   . GLN A 1 306 ? 18.497  29.177  20.343  1.00 45.69  ? 871  GLN A O   1 
ATOM   2442 C CB  . GLN A 1 306 ? 17.264  27.483  22.778  1.00 34.17  ? 871  GLN A CB  1 
ATOM   2443 C CG  . GLN A 1 306 ? 17.002  27.222  24.252  1.00 38.98  ? 871  GLN A CG  1 
ATOM   2444 C CD  . GLN A 1 306 ? 15.826  26.286  24.484  1.00 43.28  ? 871  GLN A CD  1 
ATOM   2445 O OE1 . GLN A 1 306 ? 15.218  25.783  23.537  1.00 38.75  ? 871  GLN A OE1 1 
ATOM   2446 N NE2 . GLN A 1 306 ? 15.504  26.046  25.751  1.00 45.44  ? 871  GLN A NE2 1 
ATOM   2447 N N   . PRO A 1 307 ? 19.528  27.166  20.401  1.00 51.96  ? 872  PRO A N   1 
ATOM   2448 C CA  . PRO A 1 307 ? 19.976  27.184  19.001  1.00 49.28  ? 872  PRO A CA  1 
ATOM   2449 C C   . PRO A 1 307 ? 18.873  27.488  17.990  1.00 44.26  ? 872  PRO A C   1 
ATOM   2450 O O   . PRO A 1 307 ? 19.108  28.230  17.039  1.00 47.81  ? 872  PRO A O   1 
ATOM   2451 C CB  . PRO A 1 307 ? 20.513  25.763  18.790  1.00 49.13  ? 872  PRO A CB  1 
ATOM   2452 C CG  . PRO A 1 307 ? 20.905  25.304  20.145  1.00 53.31  ? 872  PRO A CG  1 
ATOM   2453 C CD  . PRO A 1 307 ? 19.899  25.911  21.079  1.00 54.64  ? 872  PRO A CD  1 
ATOM   2454 N N   . GLN A 1 308 ? 17.688  26.923  18.189  1.00 40.63  ? 873  GLN A N   1 
ATOM   2455 C CA  . GLN A 1 308 ? 16.604  27.091  17.229  1.00 35.26  ? 873  GLN A CA  1 
ATOM   2456 C C   . GLN A 1 308 ? 15.924  28.443  17.393  1.00 34.06  ? 873  GLN A C   1 
ATOM   2457 O O   . GLN A 1 308 ? 15.200  28.897  16.509  1.00 29.76  ? 873  GLN A O   1 
ATOM   2458 C CB  . GLN A 1 308 ? 15.572  25.964  17.376  1.00 29.56  ? 873  GLN A CB  1 
ATOM   2459 C CG  . GLN A 1 308 ? 14.673  26.077  18.607  1.00 27.72  ? 873  GLN A CG  1 
ATOM   2460 C CD  . GLN A 1 308 ? 15.391  25.758  19.904  1.00 26.51  ? 873  GLN A CD  1 
ATOM   2461 O OE1 . GLN A 1 308 ? 16.589  25.494  19.914  1.00 29.26  ? 873  GLN A OE1 1 
ATOM   2462 N NE2 . GLN A 1 308 ? 14.655  25.777  21.007  1.00 25.82  ? 873  GLN A NE2 1 
ATOM   2463 N N   . ALA A 1 309 ? 16.178  29.101  18.517  1.00 40.19  ? 874  ALA A N   1 
ATOM   2464 C CA  . ALA A 1 309 ? 15.430  30.301  18.848  1.00 45.49  ? 874  ALA A CA  1 
ATOM   2465 C C   . ALA A 1 309 ? 15.849  31.473  17.975  1.00 50.36  ? 874  ALA A C   1 
ATOM   2466 O O   . ALA A 1 309 ? 17.003  31.893  17.976  1.00 54.65  ? 874  ALA A O   1 
ATOM   2467 C CB  . ALA A 1 309 ? 15.609  30.648  20.317  1.00 43.86  ? 874  ALA A CB  1 
ATOM   2468 N N   . ASN A 1 310 ? 14.879  31.994  17.233  1.00 48.59  ? 875  ASN A N   1 
ATOM   2469 C CA  . ASN A 1 310 ? 15.052  33.204  16.451  1.00 43.92  ? 875  ASN A CA  1 
ATOM   2470 C C   . ASN A 1 310 ? 13.999  34.195  16.907  1.00 50.19  ? 875  ASN A C   1 
ATOM   2471 O O   . ASN A 1 310 ? 13.001  33.800  17.510  1.00 53.74  ? 875  ASN A O   1 
ATOM   2472 C CB  . ASN A 1 310 ? 14.933  32.921  14.951  1.00 38.36  ? 875  ASN A CB  1 
ATOM   2473 C CG  . ASN A 1 310 ? 16.078  32.079  14.424  1.00 43.46  ? 875  ASN A CG  1 
ATOM   2474 O OD1 . ASN A 1 310 ? 15.957  30.859  14.284  1.00 40.40  ? 875  ASN A OD1 1 
ATOM   2475 N ND2 . ASN A 1 310 ? 17.203  32.727  14.133  1.00 47.21  ? 875  ASN A ND2 1 
ATOM   2476 N N   . SER A 1 311 ? 14.220  35.474  16.627  1.00 47.57  ? 876  SER A N   1 
ATOM   2477 C CA  . SER A 1 311 ? 13.347  36.525  17.133  1.00 47.01  ? 876  SER A CA  1 
ATOM   2478 C C   . SER A 1 311 ? 11.891  36.318  16.723  1.00 39.63  ? 876  SER A C   1 
ATOM   2479 O O   . SER A 1 311 ? 10.984  36.563  17.516  1.00 36.23  ? 876  SER A O   1 
ATOM   2480 C CB  . SER A 1 311 ? 13.836  37.902  16.661  1.00 48.84  ? 876  SER A CB  1 
ATOM   2481 O OG  . SER A 1 311 ? 13.785  38.024  15.249  1.00 45.18  ? 876  SER A OG  1 
ATOM   2482 N N   . HIS A 1 312 ? 11.673  35.840  15.501  1.00 32.66  ? 877  HIS A N   1 
ATOM   2483 C CA  . HIS A 1 312 ? 10.323  35.751  14.952  1.00 37.61  ? 877  HIS A CA  1 
ATOM   2484 C C   . HIS A 1 312 ? 9.434   34.777  15.722  1.00 43.38  ? 877  HIS A C   1 
ATOM   2485 O O   . HIS A 1 312 ? 8.209   34.861  15.650  1.00 41.18  ? 877  HIS A O   1 
ATOM   2486 C CB  . HIS A 1 312 ? 10.372  35.352  13.472  1.00 39.46  ? 877  HIS A CB  1 
ATOM   2487 C CG  . HIS A 1 312 ? 10.738  33.919  13.236  1.00 47.32  ? 877  HIS A CG  1 
ATOM   2488 N ND1 . HIS A 1 312 ? 9.824   32.891  13.331  1.00 52.63  ? 877  HIS A ND1 1 
ATOM   2489 C CD2 . HIS A 1 312 ? 11.917  33.344  12.897  1.00 50.06  ? 877  HIS A CD2 1 
ATOM   2490 C CE1 . HIS A 1 312 ? 10.425  31.744  13.067  1.00 50.82  ? 877  HIS A CE1 1 
ATOM   2491 N NE2 . HIS A 1 312 ? 11.695  31.991  12.801  1.00 52.42  ? 877  HIS A NE2 1 
ATOM   2492 N N   . VAL A 1 313 ? 10.049  33.861  16.463  1.00 37.30  ? 878  VAL A N   1 
ATOM   2493 C CA  . VAL A 1 313 ? 9.289   32.841  17.173  1.00 34.24  ? 878  VAL A CA  1 
ATOM   2494 C C   . VAL A 1 313 ? 8.363   33.451  18.231  1.00 33.07  ? 878  VAL A C   1 
ATOM   2495 O O   . VAL A 1 313 ? 7.194   33.077  18.306  1.00 29.65  ? 878  VAL A O   1 
ATOM   2496 C CB  . VAL A 1 313 ? 10.222  31.796  17.822  1.00 29.86  ? 878  VAL A CB  1 
ATOM   2497 C CG1 . VAL A 1 313 ? 9.431   30.826  18.693  1.00 24.70  ? 878  VAL A CG1 1 
ATOM   2498 C CG2 . VAL A 1 313 ? 10.987  31.038  16.739  1.00 28.25  ? 878  VAL A CG2 1 
ATOM   2499 N N   . TYR A 1 314 ? 8.877   34.342  19.077  1.00 32.72  ? 879  TYR A N   1 
ATOM   2500 C CA  . TYR A 1 314 ? 8.004   35.051  20.019  1.00 34.64  ? 879  TYR A CA  1 
ATOM   2501 C C   . TYR A 1 314 ? 7.574   36.456  19.576  1.00 37.61  ? 879  TYR A C   1 
ATOM   2502 O O   . TYR A 1 314 ? 6.659   37.039  20.157  1.00 40.75  ? 879  TYR A O   1 
ATOM   2503 C CB  . TYR A 1 314 ? 8.689   35.146  21.382  1.00 33.69  ? 879  TYR A CB  1 
ATOM   2504 C CG  . TYR A 1 314 ? 10.103  35.647  21.282  1.00 42.76  ? 879  TYR A CG  1 
ATOM   2505 C CD1 . TYR A 1 314 ? 10.371  37.007  21.245  1.00 42.60  ? 879  TYR A CD1 1 
ATOM   2506 C CD2 . TYR A 1 314 ? 11.172  34.763  21.205  1.00 46.94  ? 879  TYR A CD2 1 
ATOM   2507 C CE1 . TYR A 1 314 ? 11.658  37.474  21.147  1.00 45.21  ? 879  TYR A CE1 1 
ATOM   2508 C CE2 . TYR A 1 314 ? 12.467  35.222  21.105  1.00 49.57  ? 879  TYR A CE2 1 
ATOM   2509 C CZ  . TYR A 1 314 ? 12.701  36.581  21.076  1.00 48.96  ? 879  TYR A CZ  1 
ATOM   2510 O OH  . TYR A 1 314 ? 13.983  37.056  20.976  1.00 48.95  ? 879  TYR A OH  1 
ATOM   2511 N N   . ARG A 1 315 ? 8.250   37.013  18.576  1.00 36.64  ? 880  ARG A N   1 
ATOM   2512 C CA  . ARG A 1 315 ? 7.867   38.318  18.037  1.00 42.08  ? 880  ARG A CA  1 
ATOM   2513 C C   . ARG A 1 315 ? 6.797   38.233  16.947  1.00 40.78  ? 880  ARG A C   1 
ATOM   2514 O O   . ARG A 1 315 ? 5.909   39.079  16.888  1.00 35.51  ? 880  ARG A O   1 
ATOM   2515 C CB  . ARG A 1 315 ? 9.103   39.071  17.534  1.00 47.10  ? 880  ARG A CB  1 
ATOM   2516 C CG  . ARG A 1 315 ? 10.012  39.523  18.681  1.00 47.13  ? 880  ARG A CG  1 
ATOM   2517 C CD  . ARG A 1 315 ? 11.069  40.528  18.257  1.00 55.55  ? 880  ARG A CD  1 
ATOM   2518 N NE  . ARG A 1 315 ? 11.733  41.122  19.420  1.00 67.23  ? 880  ARG A NE  1 
ATOM   2519 C CZ  . ARG A 1 315 ? 12.970  40.832  19.818  1.00 71.99  ? 880  ARG A CZ  1 
ATOM   2520 N NH1 . ARG A 1 315 ? 13.707  39.963  19.143  1.00 74.63  ? 880  ARG A NH1 1 
ATOM   2521 N NH2 . ARG A 1 315 ? 13.479  41.423  20.891  1.00 71.25  ? 880  ARG A NH2 1 
ATOM   2522 N N   . SER A 1 316 ? 6.902   37.243  16.062  1.00 40.82  ? 881  SER A N   1 
ATOM   2523 C CA  . SER A 1 316 ? 5.901   37.076  15.010  1.00 36.97  ? 881  SER A CA  1 
ATOM   2524 C C   . SER A 1 316 ? 5.140   35.759  15.141  1.00 36.97  ? 881  SER A C   1 
ATOM   2525 O O   . SER A 1 316 ? 5.637   34.699  14.765  1.00 40.10  ? 881  SER A O   1 
ATOM   2526 C CB  . SER A 1 316 ? 6.569   37.158  13.636  1.00 31.81  ? 881  SER A CB  1 
ATOM   2527 O OG  . SER A 1 316 ? 5.609   37.073  12.598  1.00 33.85  ? 881  SER A OG  1 
ATOM   2528 N N   . VAL A 1 317 ? 3.900   35.840  15.603  1.00 32.43  ? 882  VAL A N   1 
ATOM   2529 C CA  . VAL A 1 317 ? 3.122   34.648  15.898  1.00 31.14  ? 882  VAL A CA  1 
ATOM   2530 C C   . VAL A 1 317 ? 1.762   34.734  15.215  1.00 30.22  ? 882  VAL A C   1 
ATOM   2531 O O   . VAL A 1 317 ? 1.160   35.803  15.153  1.00 29.32  ? 882  VAL A O   1 
ATOM   2532 C CB  . VAL A 1 317 ? 2.931   34.456  17.419  1.00 33.47  ? 882  VAL A CB  1 
ATOM   2533 C CG1 . VAL A 1 317 ? 2.202   33.148  17.713  1.00 27.24  ? 882  VAL A CG1 1 
ATOM   2534 C CG2 . VAL A 1 317 ? 4.273   34.486  18.131  1.00 37.27  ? 882  VAL A CG2 1 
ATOM   2535 N N   . LEU A 1 318 ? 1.284   33.609  14.695  1.00 30.17  ? 883  LEU A N   1 
ATOM   2536 C CA  . LEU A 1 318 ? 0.002   33.588  14.009  1.00 23.28  ? 883  LEU A CA  1 
ATOM   2537 C C   . LEU A 1 318 ? -1.145  33.801  14.990  1.00 29.34  ? 883  LEU A C   1 
ATOM   2538 O O   . LEU A 1 318 ? -1.268  33.074  15.976  1.00 25.49  ? 883  LEU A O   1 
ATOM   2539 C CB  . LEU A 1 318 ? -0.178  32.270  13.262  1.00 23.45  ? 883  LEU A CB  1 
ATOM   2540 C CG  . LEU A 1 318 ? -1.502  32.104  12.520  1.00 30.30  ? 883  LEU A CG  1 
ATOM   2541 C CD1 . LEU A 1 318 ? -1.580  33.069  11.339  1.00 29.53  ? 883  LEU A CD1 1 
ATOM   2542 C CD2 . LEU A 1 318 ? -1.668  30.664  12.069  1.00 23.44  ? 883  LEU A CD2 1 
ATOM   2543 N N   . LEU A 1 319 ? -1.977  34.805  14.716  1.00 33.20  ? 884  LEU A N   1 
ATOM   2544 C CA  . LEU A 1 319 ? -3.137  35.103  15.552  1.00 36.85  ? 884  LEU A CA  1 
ATOM   2545 C C   . LEU A 1 319 ? -4.420  34.545  14.938  1.00 51.93  ? 884  LEU A C   1 
ATOM   2546 O O   . LEU A 1 319 ? -5.070  33.679  15.519  1.00 55.76  ? 884  LEU A O   1 
ATOM   2547 C CB  . LEU A 1 319 ? -3.269  36.612  15.774  1.00 34.59  ? 884  LEU A CB  1 
ATOM   2548 C CG  . LEU A 1 319 ? -2.120  37.265  16.547  1.00 35.91  ? 884  LEU A CG  1 
ATOM   2549 C CD1 . LEU A 1 319 ? -2.443  38.712  16.879  1.00 31.47  ? 884  LEU A CD1 1 
ATOM   2550 C CD2 . LEU A 1 319 ? -1.777  36.474  17.813  1.00 28.34  ? 884  LEU A CD2 1 
ATOM   2551 N N   . LYS A 1 320 ? -4.789  35.048  13.766  1.00 59.17  ? 885  LYS A N   1 
ATOM   2552 C CA  . LYS A 1 320 ? -5.988  34.575  13.084  1.00 63.50  ? 885  LYS A CA  1 
ATOM   2553 C C   . LYS A 1 320 ? -5.903  34.812  11.582  1.00 65.31  ? 885  LYS A C   1 
ATOM   2554 O O   . LYS A 1 320 ? -6.679  35.595  11.029  1.00 69.47  ? 885  LYS A O   1 
ATOM   2555 C CB  . LYS A 1 320 ? -7.231  35.261  13.653  1.00 20.00  ? 885  LYS A CB  1 
ATOM   2556 N N   . GLU A 1 325 ? -2.900  37.933  9.962   1.00 51.62  ? 926  GLU A N   1 
ATOM   2557 C CA  . GLU A 1 325 ? -2.650  38.748  11.147  1.00 55.87  ? 926  GLU A CA  1 
ATOM   2558 C C   . GLU A 1 325 ? -1.684  38.061  12.108  1.00 52.15  ? 926  GLU A C   1 
ATOM   2559 O O   . GLU A 1 325 ? -1.856  36.885  12.456  1.00 35.47  ? 926  GLU A O   1 
ATOM   2560 C CB  . GLU A 1 325 ? -3.963  39.076  11.858  1.00 60.05  ? 926  GLU A CB  1 
ATOM   2561 C CG  . GLU A 1 325 ? -4.544  40.426  11.463  1.00 70.07  ? 926  GLU A CG  1 
ATOM   2562 C CD  . GLU A 1 325 ? -6.020  40.550  11.785  1.00 72.89  ? 926  GLU A CD  1 
ATOM   2563 O OE1 . GLU A 1 325 ? -6.629  39.536  12.187  1.00 75.44  ? 926  GLU A OE1 1 
ATOM   2564 O OE2 . GLU A 1 325 ? -6.571  41.661  11.634  1.00 72.27  ? 926  GLU A OE2 1 
ATOM   2565 N N   . ARG A 1 326 ? -0.658  38.802  12.519  1.00 49.08  ? 927  ARG A N   1 
ATOM   2566 C CA  . ARG A 1 326 ? 0.365   38.271  13.413  1.00 42.24  ? 927  ARG A CA  1 
ATOM   2567 C C   . ARG A 1 326 ? 0.688   39.268  14.516  1.00 42.35  ? 927  ARG A C   1 
ATOM   2568 O O   . ARG A 1 326 ? 0.539   40.476  14.340  1.00 49.26  ? 927  ARG A O   1 
ATOM   2569 C CB  . ARG A 1 326 ? 1.636   37.911  12.635  1.00 31.41  ? 927  ARG A CB  1 
ATOM   2570 C CG  . ARG A 1 326 ? 1.390   37.026  11.411  1.00 29.84  ? 927  ARG A CG  1 
ATOM   2571 C CD  . ARG A 1 326 ? 2.684   36.592  10.744  1.00 29.68  ? 927  ARG A CD  1 
ATOM   2572 N NE  . ARG A 1 326 ? 3.407   35.600  11.534  1.00 31.85  ? 927  ARG A NE  1 
ATOM   2573 C CZ  . ARG A 1 326 ? 3.212   34.286  11.449  1.00 39.29  ? 927  ARG A CZ  1 
ATOM   2574 N NH1 . ARG A 1 326 ? 2.311   33.795  10.609  1.00 39.80  ? 927  ARG A NH1 1 
ATOM   2575 N NH2 . ARG A 1 326 ? 3.918   33.458  12.204  1.00 34.65  ? 927  ARG A NH2 1 
ATOM   2576 N N   . GLY A 1 327 ? 1.127   38.752  15.657  1.00 35.99  ? 928  GLY A N   1 
ATOM   2577 C CA  . GLY A 1 327 ? 1.470   39.578  16.797  1.00 36.48  ? 928  GLY A CA  1 
ATOM   2578 C C   . GLY A 1 327 ? 2.535   38.861  17.592  1.00 38.20  ? 928  GLY A C   1 
ATOM   2579 O O   . GLY A 1 327 ? 2.912   37.747  17.238  1.00 39.24  ? 928  GLY A O   1 
ATOM   2580 N N   . ASP A 1 328 ? 3.032   39.479  18.658  1.00 40.50  ? 929  ASP A N   1 
ATOM   2581 C CA  . ASP A 1 328 ? 4.069   38.822  19.445  1.00 42.86  ? 929  ASP A CA  1 
ATOM   2582 C C   . ASP A 1 328 ? 3.458   37.725  20.311  1.00 38.38  ? 929  ASP A C   1 
ATOM   2583 O O   . ASP A 1 328 ? 2.240   37.516  20.292  1.00 31.79  ? 929  ASP A O   1 
ATOM   2584 C CB  . ASP A 1 328 ? 4.853   39.835  20.290  1.00 44.06  ? 929  ASP A CB  1 
ATOM   2585 C CG  . ASP A 1 328 ? 3.980   40.631  21.244  1.00 48.24  ? 929  ASP A CG  1 
ATOM   2586 O OD1 . ASP A 1 328 ? 3.140   40.038  21.950  1.00 47.33  ? 929  ASP A OD1 1 
ATOM   2587 O OD2 . ASP A 1 328 ? 4.155   41.867  21.304  1.00 60.77  ? 929  ASP A OD2 1 
ATOM   2588 N N   . LEU A 1 329 ? 4.299   37.028  21.070  1.00 29.58  ? 930  LEU A N   1 
ATOM   2589 C CA  . LEU A 1 329 ? 3.852   35.841  21.796  1.00 32.12  ? 930  LEU A CA  1 
ATOM   2590 C C   . LEU A 1 329 ? 2.850   36.186  22.893  1.00 34.26  ? 930  LEU A C   1 
ATOM   2591 O O   . LEU A 1 329 ? 1.947   35.401  23.189  1.00 35.45  ? 930  LEU A O   1 
ATOM   2592 C CB  . LEU A 1 329 ? 5.047   35.100  22.395  1.00 28.03  ? 930  LEU A CB  1 
ATOM   2593 C CG  . LEU A 1 329 ? 4.746   33.700  22.940  1.00 27.15  ? 930  LEU A CG  1 
ATOM   2594 C CD1 . LEU A 1 329 ? 4.144   32.812  21.859  1.00 26.56  ? 930  LEU A CD1 1 
ATOM   2595 C CD2 . LEU A 1 329 ? 6.009   33.069  23.506  1.00 35.56  ? 930  LEU A CD2 1 
ATOM   2596 N N   . ILE A 1 330 ? 3.018   37.365  23.484  1.00 33.91  ? 931  ILE A N   1 
ATOM   2597 C CA  . ILE A 1 330 ? 2.172   37.820  24.581  1.00 38.13  ? 931  ILE A CA  1 
ATOM   2598 C C   . ILE A 1 330 ? 0.732   38.025  24.120  1.00 39.19  ? 931  ILE A C   1 
ATOM   2599 O O   . ILE A 1 330 ? -0.213  37.661  24.821  1.00 36.50  ? 931  ILE A O   1 
ATOM   2600 C CB  . ILE A 1 330 ? 2.709   39.134  25.188  1.00 41.87  ? 931  ILE A CB  1 
ATOM   2601 C CG1 . ILE A 1 330 ? 4.157   38.947  25.659  1.00 45.47  ? 931  ILE A CG1 1 
ATOM   2602 C CG2 . ILE A 1 330 ? 1.812   39.620  26.327  1.00 38.20  ? 931  ILE A CG2 1 
ATOM   2603 C CD1 . ILE A 1 330 ? 4.802   40.221  26.182  1.00 48.96  ? 931  ILE A CD1 1 
ATOM   2604 N N   . LYS A 1 331 ? 0.573   38.604  22.935  1.00 39.07  ? 932  LYS A N   1 
ATOM   2605 C CA  . LYS A 1 331 ? -0.750  38.823  22.374  1.00 36.81  ? 932  LYS A CA  1 
ATOM   2606 C C   . LYS A 1 331 ? -1.405  37.485  22.037  1.00 40.25  ? 932  LYS A C   1 
ATOM   2607 O O   . LYS A 1 331 ? -2.612  37.314  22.214  1.00 41.77  ? 932  LYS A O   1 
ATOM   2608 C CB  . LYS A 1 331 ? -0.673  39.714  21.132  1.00 35.48  ? 932  LYS A CB  1 
ATOM   2609 C CG  . LYS A 1 331 ? -2.035  40.119  20.587  1.00 41.01  ? 932  LYS A CG  1 
ATOM   2610 C CD  . LYS A 1 331 ? -1.924  41.251  19.579  1.00 49.13  ? 932  LYS A CD  1 
ATOM   2611 C CE  . LYS A 1 331 ? -3.295  41.638  19.045  1.00 55.73  ? 932  LYS A CE  1 
ATOM   2612 N NZ  . LYS A 1 331 ? -3.232  42.787  18.097  1.00 61.71  ? 932  LYS A NZ  1 
ATOM   2613 N N   . PHE A 1 332 ? -0.601  36.538  21.560  1.00 36.30  ? 933  PHE A N   1 
ATOM   2614 C CA  . PHE A 1 332 ? -1.094  35.192  21.275  1.00 34.74  ? 933  PHE A CA  1 
ATOM   2615 C C   . PHE A 1 332 ? -1.614  34.529  22.544  1.00 33.48  ? 933  PHE A C   1 
ATOM   2616 O O   . PHE A 1 332 ? -2.693  33.938  22.554  1.00 31.67  ? 933  PHE A O   1 
ATOM   2617 C CB  . PHE A 1 332 ? -0.001  34.325  20.645  1.00 26.37  ? 933  PHE A CB  1 
ATOM   2618 C CG  . PHE A 1 332 ? -0.310  32.851  20.666  1.00 30.13  ? 933  PHE A CG  1 
ATOM   2619 C CD1 . PHE A 1 332 ? -1.232  32.309  19.785  1.00 32.25  ? 933  PHE A CD1 1 
ATOM   2620 C CD2 . PHE A 1 332 ? 0.318   32.008  21.570  1.00 30.62  ? 933  PHE A CD2 1 
ATOM   2621 C CE1 . PHE A 1 332 ? -1.522  30.949  19.804  1.00 32.92  ? 933  PHE A CE1 1 
ATOM   2622 C CE2 . PHE A 1 332 ? 0.036   30.648  21.592  1.00 31.93  ? 933  PHE A CE2 1 
ATOM   2623 C CZ  . PHE A 1 332 ? -0.886  30.120  20.708  1.00 28.14  ? 933  PHE A CZ  1 
ATOM   2624 N N   . TYR A 1 333 ? -0.831  34.636  23.610  1.00 32.74  ? 934  TYR A N   1 
ATOM   2625 C CA  . TYR A 1 333 ? -1.194  34.070  24.901  1.00 29.27  ? 934  TYR A CA  1 
ATOM   2626 C C   . TYR A 1 333 ? -2.532  34.606  25.403  1.00 32.25  ? 934  TYR A C   1 
ATOM   2627 O O   . TYR A 1 333 ? -3.420  33.838  25.768  1.00 34.27  ? 934  TYR A O   1 
ATOM   2628 C CB  . TYR A 1 333 ? -0.093  34.358  25.925  1.00 36.30  ? 934  TYR A CB  1 
ATOM   2629 C CG  . TYR A 1 333 ? -0.438  33.926  27.328  1.00 33.87  ? 934  TYR A CG  1 
ATOM   2630 C CD1 . TYR A 1 333 ? -0.310  32.599  27.716  1.00 36.31  ? 934  TYR A CD1 1 
ATOM   2631 C CD2 . TYR A 1 333 ? -0.889  34.843  28.265  1.00 33.04  ? 934  TYR A CD2 1 
ATOM   2632 C CE1 . TYR A 1 333 ? -0.625  32.198  28.996  1.00 33.62  ? 934  TYR A CE1 1 
ATOM   2633 C CE2 . TYR A 1 333 ? -1.200  34.452  29.543  1.00 34.05  ? 934  TYR A CE2 1 
ATOM   2634 C CZ  . TYR A 1 333 ? -1.072  33.128  29.903  1.00 33.08  ? 934  TYR A CZ  1 
ATOM   2635 O OH  . TYR A 1 333 ? -1.386  32.734  31.180  1.00 47.61  ? 934  TYR A OH  1 
ATOM   2636 N N   . ASN A 1 334 ? -2.675  35.927  25.403  1.00 36.99  ? 935  ASN A N   1 
ATOM   2637 C CA  . ASN A 1 334 ? -3.873  36.571  25.930  1.00 34.24  ? 935  ASN A CA  1 
ATOM   2638 C C   . ASN A 1 334 ? -5.137  36.272  25.123  1.00 36.91  ? 935  ASN A C   1 
ATOM   2639 O O   . ASN A 1 334 ? -6.153  35.868  25.683  1.00 38.78  ? 935  ASN A O   1 
ATOM   2640 C CB  . ASN A 1 334 ? -3.666  38.088  26.007  1.00 36.19  ? 935  ASN A CB  1 
ATOM   2641 C CG  . ASN A 1 334 ? -2.771  38.500  27.162  1.00 40.55  ? 935  ASN A CG  1 
ATOM   2642 O OD1 . ASN A 1 334 ? -2.935  38.029  28.287  1.00 40.40  ? 935  ASN A OD1 1 
ATOM   2643 N ND2 . ASN A 1 334 ? -1.818  39.386  26.888  1.00 44.96  ? 935  ASN A ND2 1 
ATOM   2644 N N   . THR A 1 335 ? -5.073  36.468  23.810  1.00 37.35  ? 936  THR A N   1 
ATOM   2645 C CA  . THR A 1 335 ? -6.272  36.397  22.979  1.00 33.20  ? 936  THR A CA  1 
ATOM   2646 C C   . THR A 1 335 ? -6.640  34.980  22.531  1.00 41.37  ? 936  THR A C   1 
ATOM   2647 O O   . THR A 1 335 ? -7.749  34.744  22.057  1.00 43.83  ? 936  THR A O   1 
ATOM   2648 C CB  . THR A 1 335 ? -6.127  37.278  21.720  1.00 33.47  ? 936  THR A CB  1 
ATOM   2649 O OG1 . THR A 1 335 ? -4.997  36.842  20.956  1.00 38.19  ? 936  THR A OG1 1 
ATOM   2650 C CG2 . THR A 1 335 ? -5.947  38.747  22.101  1.00 35.58  ? 936  THR A CG2 1 
ATOM   2651 N N   . ILE A 1 336 ? -5.718  34.038  22.674  1.00 41.59  ? 937  ILE A N   1 
ATOM   2652 C CA  . ILE A 1 336 ? -5.952  32.685  22.172  1.00 39.39  ? 937  ILE A CA  1 
ATOM   2653 C C   . ILE A 1 336 ? -5.688  31.610  23.219  1.00 37.58  ? 937  ILE A C   1 
ATOM   2654 O O   . ILE A 1 336 ? -6.595  30.874  23.613  1.00 39.00  ? 937  ILE A O   1 
ATOM   2655 C CB  . ILE A 1 336 ? -5.081  32.387  20.936  1.00 38.25  ? 937  ILE A CB  1 
ATOM   2656 C CG1 . ILE A 1 336 ? -5.368  33.392  19.821  1.00 43.69  ? 937  ILE A CG1 1 
ATOM   2657 C CG2 . ILE A 1 336 ? -5.324  30.971  20.445  1.00 37.42  ? 937  ILE A CG2 1 
ATOM   2658 C CD1 . ILE A 1 336 ? -4.473  33.227  18.617  1.00 47.00  ? 937  ILE A CD1 1 
ATOM   2659 N N   . TYR A 1 337 ? -4.435  31.525  23.654  1.00 30.53  ? 938  TYR A N   1 
ATOM   2660 C CA  . TYR A 1 337 ? -3.982  30.444  24.519  1.00 30.96  ? 938  TYR A CA  1 
ATOM   2661 C C   . TYR A 1 337 ? -4.737  30.346  25.847  1.00 28.18  ? 938  TYR A C   1 
ATOM   2662 O O   . TYR A 1 337 ? -5.122  29.254  26.256  1.00 29.83  ? 938  TYR A O   1 
ATOM   2663 C CB  . TYR A 1 337 ? -2.485  30.595  24.794  1.00 35.73  ? 938  TYR A CB  1 
ATOM   2664 C CG  . TYR A 1 337 ? -1.878  29.413  25.518  1.00 34.15  ? 938  TYR A CG  1 
ATOM   2665 C CD1 . TYR A 1 337 ? -1.374  28.330  24.815  1.00 27.56  ? 938  TYR A CD1 1 
ATOM   2666 C CD2 . TYR A 1 337 ? -1.813  29.383  26.907  1.00 36.06  ? 938  TYR A CD2 1 
ATOM   2667 C CE1 . TYR A 1 337 ? -0.816  27.249  25.474  1.00 31.28  ? 938  TYR A CE1 1 
ATOM   2668 C CE2 . TYR A 1 337 ? -1.263  28.309  27.572  1.00 34.44  ? 938  TYR A CE2 1 
ATOM   2669 C CZ  . TYR A 1 337 ? -0.767  27.246  26.853  1.00 29.04  ? 938  TYR A CZ  1 
ATOM   2670 O OH  . TYR A 1 337 ? -0.211  26.181  27.518  1.00 26.43  ? 938  TYR A OH  1 
ATOM   2671 N N   . VAL A 1 338 ? -4.938  31.475  26.520  1.00 29.87  ? 939  VAL A N   1 
ATOM   2672 C CA  . VAL A 1 338 ? -5.594  31.465  27.827  1.00 36.88  ? 939  VAL A CA  1 
ATOM   2673 C C   . VAL A 1 338 ? -6.987  30.859  27.743  1.00 39.23  ? 939  VAL A C   1 
ATOM   2674 O O   . VAL A 1 338 ? -7.314  29.944  28.493  1.00 46.69  ? 939  VAL A O   1 
ATOM   2675 C CB  . VAL A 1 338 ? -5.708  32.876  28.430  1.00 46.06  ? 939  VAL A CB  1 
ATOM   2676 C CG1 . VAL A 1 338 ? -6.516  32.835  29.719  1.00 52.14  ? 939  VAL A CG1 1 
ATOM   2677 C CG2 . VAL A 1 338 ? -4.335  33.446  28.701  1.00 46.12  ? 939  VAL A CG2 1 
ATOM   2678 N N   . GLY A 1 339 ? -7.794  31.359  26.815  1.00 37.27  ? 940  GLY A N   1 
ATOM   2679 C CA  . GLY A 1 339 ? -9.154  30.880  26.651  1.00 42.67  ? 940  GLY A CA  1 
ATOM   2680 C C   . GLY A 1 339 ? -9.248  29.371  26.512  1.00 41.64  ? 940  GLY A C   1 
ATOM   2681 O O   . GLY A 1 339 ? -10.147 28.744  27.070  1.00 45.28  ? 940  GLY A O   1 
ATOM   2682 N N   . ARG A 1 340 ? -8.307  28.785  25.781  1.00 41.93  ? 941  ARG A N   1 
ATOM   2683 C CA  . ARG A 1 340 ? -8.340  27.353  25.512  1.00 37.50  ? 941  ARG A CA  1 
ATOM   2684 C C   . ARG A 1 340 ? -7.835  26.512  26.685  1.00 42.71  ? 941  ARG A C   1 
ATOM   2685 O O   . ARG A 1 340 ? -8.430  25.487  27.016  1.00 53.48  ? 941  ARG A O   1 
ATOM   2686 C CB  . ARG A 1 340 ? -7.525  27.039  24.256  1.00 32.62  ? 941  ARG A CB  1 
ATOM   2687 C CG  . ARG A 1 340 ? -8.056  27.688  22.983  1.00 27.71  ? 941  ARG A CG  1 
ATOM   2688 C CD  . ARG A 1 340 ? -9.352  27.038  22.516  1.00 30.19  ? 941  ARG A CD  1 
ATOM   2689 N NE  . ARG A 1 340 ? -9.202  25.597  22.301  1.00 31.25  ? 941  ARG A NE  1 
ATOM   2690 C CZ  . ARG A 1 340 ? -8.718  25.046  21.188  1.00 36.08  ? 941  ARG A CZ  1 
ATOM   2691 N NH1 . ARG A 1 340 ? -8.324  25.807  20.175  1.00 35.15  ? 941  ARG A NH1 1 
ATOM   2692 N NH2 . ARG A 1 340 ? -8.619  23.726  21.089  1.00 34.08  ? 941  ARG A NH2 1 
ATOM   2693 N N   . VAL A 1 341 ? -6.737  26.938  27.303  1.00 39.66  ? 942  VAL A N   1 
ATOM   2694 C CA  . VAL A 1 341 ? -6.074  26.130  28.329  1.00 37.93  ? 942  VAL A CA  1 
ATOM   2695 C C   . VAL A 1 341 ? -6.395  26.507  29.789  1.00 43.70  ? 942  VAL A C   1 
ATOM   2696 O O   . VAL A 1 341 ? -5.985  25.804  30.715  1.00 44.10  ? 942  VAL A O   1 
ATOM   2697 C CB  . VAL A 1 341 ? -4.540  26.190  28.125  1.00 35.86  ? 942  VAL A CB  1 
ATOM   2698 C CG1 . VAL A 1 341 ? -3.851  24.987  28.759  1.00 40.85  ? 942  VAL A CG1 1 
ATOM   2699 C CG2 . VAL A 1 341 ? -4.217  26.230  26.634  1.00 33.43  ? 942  VAL A CG2 1 
ATOM   2700 N N   . LYS A 1 342 ? -7.147  27.581  30.010  1.00 44.17  ? 943  LYS A N   1 
ATOM   2701 C CA  . LYS A 1 342 ? -7.313  28.085  31.378  1.00 56.49  ? 943  LYS A CA  1 
ATOM   2702 C C   . LYS A 1 342 ? -8.091  27.110  32.258  1.00 62.36  ? 943  LYS A C   1 
ATOM   2703 O O   . LYS A 1 342 ? -7.856  27.037  33.462  1.00 64.63  ? 943  LYS A O   1 
ATOM   2704 C CB  . LYS A 1 342 ? -7.996  29.459  31.387  1.00 55.81  ? 943  LYS A CB  1 
ATOM   2705 C CG  . LYS A 1 342 ? -9.508  29.443  31.531  1.00 58.46  ? 943  LYS A CG  1 
ATOM   2706 C CD  . LYS A 1 342 ? -10.113 30.769  31.090  1.00 62.72  ? 943  LYS A CD  1 
ATOM   2707 C CE  . LYS A 1 342 ? -11.476 31.005  31.726  1.00 66.61  ? 943  LYS A CE  1 
ATOM   2708 N NZ  . LYS A 1 342 ? -11.438 30.902  33.216  1.00 66.99  ? 943  LYS A NZ  1 
ATOM   2709 N N   . SER A 1 343 ? -9.000  26.352  31.654  1.00 65.44  ? 944  SER A N   1 
ATOM   2710 C CA  . SER A 1 343 ? -9.767  25.362  32.397  1.00 62.15  ? 944  SER A CA  1 
ATOM   2711 C C   . SER A 1 343 ? -8.824  24.294  32.944  1.00 53.10  ? 944  SER A C   1 
ATOM   2712 O O   . SER A 1 343 ? -8.902  23.927  34.113  1.00 52.90  ? 944  SER A O   1 
ATOM   2713 C CB  . SER A 1 343 ? -10.846 24.733  31.514  1.00 66.98  ? 944  SER A CB  1 
ATOM   2714 O OG  . SER A 1 343 ? -11.738 23.949  32.286  1.00 74.22  ? 944  SER A OG  1 
ATOM   2715 N N   . PHE A 1 344 ? -7.935  23.801  32.088  1.00 51.12  ? 945  PHE A N   1 
ATOM   2716 C CA  . PHE A 1 344 ? -6.979  22.774  32.483  1.00 43.36  ? 945  PHE A CA  1 
ATOM   2717 C C   . PHE A 1 344 ? -5.957  23.321  33.473  1.00 43.79  ? 945  PHE A C   1 
ATOM   2718 O O   . PHE A 1 344 ? -5.570  22.639  34.422  1.00 48.33  ? 945  PHE A O   1 
ATOM   2719 C CB  . PHE A 1 344 ? -6.267  22.204  31.254  1.00 41.21  ? 945  PHE A CB  1 
ATOM   2720 C CG  . PHE A 1 344 ? -5.119  21.294  31.586  1.00 37.85  ? 945  PHE A CG  1 
ATOM   2721 C CD1 . PHE A 1 344 ? -5.301  19.922  31.651  1.00 41.29  ? 945  PHE A CD1 1 
ATOM   2722 C CD2 . PHE A 1 344 ? -3.858  21.810  31.834  1.00 37.20  ? 945  PHE A CD2 1 
ATOM   2723 C CE1 . PHE A 1 344 ? -4.247  19.083  31.957  1.00 44.21  ? 945  PHE A CE1 1 
ATOM   2724 C CE2 . PHE A 1 344 ? -2.800  20.975  32.140  1.00 40.63  ? 945  PHE A CE2 1 
ATOM   2725 C CZ  . PHE A 1 344 ? -2.995  19.610  32.201  1.00 39.47  ? 945  PHE A CZ  1 
ATOM   2726 N N   . ALA A 1 345 ? -5.522  24.556  33.246  1.00 43.40  ? 946  ALA A N   1 
ATOM   2727 C CA  . ALA A 1 345 ? -4.544  25.197  34.117  1.00 46.69  ? 946  ALA A CA  1 
ATOM   2728 C C   . ALA A 1 345 ? -5.126  25.461  35.502  1.00 48.31  ? 946  ALA A C   1 
ATOM   2729 O O   . ALA A 1 345 ? -4.625  24.950  36.504  1.00 49.80  ? 946  ALA A O   1 
ATOM   2730 C CB  . ALA A 1 345 ? -4.046  26.492  33.493  1.00 45.77  ? 946  ALA A CB  1 
ATOM   2731 N N   . LEU A 1 346 ? -6.185  26.261  35.550  1.00 51.36  ? 947  LEU A N   1 
ATOM   2732 C CA  . LEU A 1 346 ? -6.836  26.595  36.812  1.00 58.00  ? 947  LEU A CA  1 
ATOM   2733 C C   . LEU A 1 346 ? -7.031  25.356  37.678  1.00 60.30  ? 947  LEU A C   1 
ATOM   2734 O O   . LEU A 1 346 ? -7.418  25.455  38.842  1.00 63.14  ? 947  LEU A O   1 
ATOM   2735 C CB  . LEU A 1 346 ? -8.183  27.275  36.556  1.00 58.87  ? 947  LEU A CB  1 
ATOM   2736 C CG  . LEU A 1 346 ? -8.135  28.763  36.203  1.00 57.87  ? 947  LEU A CG  1 
ATOM   2737 C CD1 . LEU A 1 346 ? -9.539  29.344  36.133  1.00 60.43  ? 947  LEU A CD1 1 
ATOM   2738 C CD2 . LEU A 1 346 ? -7.283  29.527  37.205  1.00 53.45  ? 947  LEU A CD2 1 
ATOM   2739 N N   . LYS A 1 347 ? -6.760  24.189  37.103  1.00 58.31  ? 948  LYS A N   1 
ATOM   2740 C CA  . LYS A 1 347 ? -6.905  22.928  37.821  1.00 57.26  ? 948  LYS A CA  1 
ATOM   2741 C C   . LYS A 1 347 ? -5.630  22.575  38.579  1.00 66.23  ? 948  LYS A C   1 
ATOM   2742 O O   . LYS A 1 347 ? -5.453  21.439  39.019  1.00 72.77  ? 948  LYS A O   1 
ATOM   2743 C CB  . LYS A 1 347 ? -7.272  21.800  36.855  1.00 20.00  ? 948  LYS A CB  1 
ATOM   2744 N N   . TYR A 1 348 ? -4.746  23.555  38.729  1.00 66.59  ? 949  TYR A N   1 
ATOM   2745 C CA  . TYR A 1 348 ? -3.486  23.349  39.434  1.00 65.27  ? 949  TYR A CA  1 
ATOM   2746 C C   . TYR A 1 348 ? -3.135  24.555  40.299  1.00 67.27  ? 949  TYR A C   1 
ATOM   2747 O O   . TYR A 1 348 ? -3.489  25.688  39.975  1.00 66.73  ? 949  TYR A O   1 
ATOM   2748 C CB  . TYR A 1 348 ? -2.356  23.068  38.441  1.00 20.00  ? 949  TYR A CB  1 
ATOM   2749 C CG  . TYR A 1 348 ? -2.505  21.760  37.698  1.00 20.00  ? 949  TYR A CG  1 
ATOM   2750 C CD1 . TYR A 1 348 ? -1.697  20.672  37.999  1.00 20.00  ? 949  TYR A CD1 1 
ATOM   2751 C CD2 . TYR A 1 348 ? -3.455  21.613  36.695  1.00 20.00  ? 949  TYR A CD2 1 
ATOM   2752 C CE1 . TYR A 1 348 ? -1.830  19.474  37.322  1.00 20.00  ? 949  TYR A CE1 1 
ATOM   2753 C CE2 . TYR A 1 348 ? -3.595  20.419  36.013  1.00 20.00  ? 949  TYR A CE2 1 
ATOM   2754 C CZ  . TYR A 1 348 ? -2.780  19.353  36.331  1.00 20.00  ? 949  TYR A CZ  1 
ATOM   2755 O OH  . TYR A 1 348 ? -2.916  18.163  35.654  1.00 20.00  ? 949  TYR A OH  1 
ATOM   2756 N N   . PRO A 1 361 ? -3.917  14.537  37.475  1.00 73.20  ? 962  PRO A N   1 
ATOM   2757 C CA  . PRO A 1 361 ? -2.742  13.682  37.273  1.00 72.91  ? 962  PRO A CA  1 
ATOM   2758 C C   . PRO A 1 361 ? -1.672  14.356  36.418  1.00 68.86  ? 962  PRO A C   1 
ATOM   2759 O O   . PRO A 1 361 ? -1.999  15.124  35.512  1.00 71.16  ? 962  PRO A O   1 
ATOM   2760 C CB  . PRO A 1 361 ? -3.320  12.457  36.557  1.00 72.13  ? 962  PRO A CB  1 
ATOM   2761 C CG  . PRO A 1 361 ? -4.523  12.975  35.847  1.00 69.13  ? 962  PRO A CG  1 
ATOM   2762 C CD  . PRO A 1 361 ? -5.096  14.041  36.742  1.00 70.95  ? 962  PRO A CD  1 
ATOM   2763 N N   . LEU A 1 362 ? -0.407  14.067  36.704  1.00 62.48  ? 963  LEU A N   1 
ATOM   2764 C CA  . LEU A 1 362 ? 0.693   14.655  35.952  1.00 57.67  ? 963  LEU A CA  1 
ATOM   2765 C C   . LEU A 1 362 ? 1.317   13.635  35.004  1.00 59.26  ? 963  LEU A C   1 
ATOM   2766 O O   . LEU A 1 362 ? 1.359   12.439  35.296  1.00 63.78  ? 963  LEU A O   1 
ATOM   2767 C CB  . LEU A 1 362 ? 1.753   15.221  36.898  1.00 57.08  ? 963  LEU A CB  1 
ATOM   2768 C CG  . LEU A 1 362 ? 1.324   16.431  37.732  1.00 63.04  ? 963  LEU A CG  1 
ATOM   2769 C CD1 . LEU A 1 362 ? 2.478   16.955  38.574  1.00 64.15  ? 963  LEU A CD1 1 
ATOM   2770 C CD2 . LEU A 1 362 ? 0.762   17.529  36.838  1.00 62.52  ? 963  LEU A CD2 1 
ATOM   2771 N N   . SER A 1 363 ? 1.793   14.122  33.863  1.00 55.86  ? 964  SER A N   1 
ATOM   2772 C CA  . SER A 1 363 ? 2.367   13.269  32.830  1.00 52.03  ? 964  SER A CA  1 
ATOM   2773 C C   . SER A 1 363 ? 3.833   12.939  33.115  1.00 57.89  ? 964  SER A C   1 
ATOM   2774 O O   . SER A 1 363 ? 4.533   13.714  33.764  1.00 58.79  ? 964  SER A O   1 
ATOM   2775 C CB  . SER A 1 363 ? 2.237   13.947  31.463  1.00 45.41  ? 964  SER A CB  1 
ATOM   2776 O OG  . SER A 1 363 ? 0.881   14.210  31.151  1.00 48.17  ? 964  SER A OG  1 
ATOM   2777 N N   . PRO A 1 364 ? 4.299   11.776  32.636  1.00 63.58  ? 965  PRO A N   1 
ATOM   2778 C CA  . PRO A 1 364 ? 5.713   11.420  32.797  1.00 70.39  ? 965  PRO A CA  1 
ATOM   2779 C C   . PRO A 1 364 ? 6.637   12.300  31.957  1.00 66.39  ? 965  PRO A C   1 
ATOM   2780 O O   . PRO A 1 364 ? 6.380   12.535  30.769  1.00 57.66  ? 965  PRO A O   1 
ATOM   2781 C CB  . PRO A 1 364 ? 5.765   9.964   32.317  1.00 73.27  ? 965  PRO A CB  1 
ATOM   2782 C CG  . PRO A 1 364 ? 4.612   9.839   31.374  1.00 71.43  ? 965  PRO A CG  1 
ATOM   2783 C CD  . PRO A 1 364 ? 3.535   10.711  31.962  1.00 68.25  ? 965  PRO A CD  1 
ATOM   2784 N N   . PHE A 1 365 ? 7.714   12.770  32.576  1.00 68.00  ? 966  PHE A N   1 
ATOM   2785 C CA  . PHE A 1 365 ? 8.698   13.585  31.878  1.00 58.10  ? 966  PHE A CA  1 
ATOM   2786 C C   . PHE A 1 365 ? 9.838   12.710  31.362  1.00 55.47  ? 966  PHE A C   1 
ATOM   2787 O O   . PHE A 1 365 ? 10.538  12.072  32.148  1.00 61.11  ? 966  PHE A O   1 
ATOM   2788 C CB  . PHE A 1 365 ? 9.231   14.687  32.798  1.00 53.39  ? 966  PHE A CB  1 
ATOM   2789 C CG  . PHE A 1 365 ? 10.000  15.752  32.076  1.00 51.72  ? 966  PHE A CG  1 
ATOM   2790 C CD1 . PHE A 1 365 ? 11.321  16.011  32.394  1.00 55.90  ? 966  PHE A CD1 1 
ATOM   2791 C CD2 . PHE A 1 365 ? 9.405   16.479  31.060  1.00 43.42  ? 966  PHE A CD2 1 
ATOM   2792 C CE1 . PHE A 1 365 ? 12.029  16.988  31.720  1.00 53.06  ? 966  PHE A CE1 1 
ATOM   2793 C CE2 . PHE A 1 365 ? 10.108  17.454  30.386  1.00 38.56  ? 966  PHE A CE2 1 
ATOM   2794 C CZ  . PHE A 1 365 ? 11.419  17.710  30.714  1.00 43.48  ? 966  PHE A CZ  1 
ATOM   2795 N N   . PRO A 1 366 ? 10.018  12.675  30.032  1.00 54.54  ? 967  PRO A N   1 
ATOM   2796 C CA  . PRO A 1 366 ? 11.006  11.832  29.343  1.00 57.40  ? 967  PRO A CA  1 
ATOM   2797 C C   . PRO A 1 366 ? 12.425  11.992  29.884  1.00 58.71  ? 967  PRO A C   1 
ATOM   2798 O O   . PRO A 1 366 ? 12.753  13.068  30.378  1.00 58.87  ? 967  PRO A O   1 
ATOM   2799 C CB  . PRO A 1 366 ? 10.927  12.318  27.893  1.00 53.07  ? 967  PRO A CB  1 
ATOM   2800 C CG  . PRO A 1 366 ? 9.545   12.849  27.756  1.00 51.16  ? 967  PRO A CG  1 
ATOM   2801 C CD  . PRO A 1 366 ? 9.218   13.470  29.082  1.00 49.88  ? 967  PRO A CD  1 
ATOM   2802 N N   . ASP B 2 1   ? -6.793  37.955  35.304  1.00 58.00  ? 21   ASP B N   1 
ATOM   2803 C CA  . ASP B 2 1   ? -5.889  37.393  36.301  1.00 61.52  ? 21   ASP B CA  1 
ATOM   2804 C C   . ASP B 2 1   ? -4.802  36.543  35.654  1.00 59.53  ? 21   ASP B C   1 
ATOM   2805 O O   . ASP B 2 1   ? -3.615  36.728  35.925  1.00 58.06  ? 21   ASP B O   1 
ATOM   2806 C CB  . ASP B 2 1   ? -6.667  36.560  37.320  1.00 70.19  ? 21   ASP B CB  1 
ATOM   2807 C CG  . ASP B 2 1   ? -7.608  37.399  38.162  1.00 78.62  ? 21   ASP B CG  1 
ATOM   2808 O OD1 . ASP B 2 1   ? -7.240  37.736  39.308  1.00 80.32  ? 21   ASP B OD1 1 
ATOM   2809 O OD2 . ASP B 2 1   ? -8.715  37.724  37.681  1.00 80.95  ? 21   ASP B OD2 1 
ATOM   2810 N N   . LEU B 2 2   ? -5.210  35.613  34.797  1.00 60.03  ? 22   LEU B N   1 
ATOM   2811 C CA  . LEU B 2 2   ? -4.257  34.755  34.102  1.00 61.27  ? 22   LEU B CA  1 
ATOM   2812 C C   . LEU B 2 2   ? -3.691  35.440  32.863  1.00 55.08  ? 22   LEU B C   1 
ATOM   2813 O O   . LEU B 2 2   ? -2.863  34.871  32.154  1.00 54.07  ? 22   LEU B O   1 
ATOM   2814 C CB  . LEU B 2 2   ? -4.903  33.424  33.717  1.00 64.45  ? 22   LEU B CB  1 
ATOM   2815 C CG  . LEU B 2 2   ? -4.712  32.284  34.718  1.00 67.34  ? 22   LEU B CG  1 
ATOM   2816 C CD1 . LEU B 2 2   ? -5.274  30.976  34.174  1.00 67.31  ? 22   LEU B CD1 1 
ATOM   2817 C CD2 . LEU B 2 2   ? -3.239  32.142  35.065  1.00 68.45  ? 22   LEU B CD2 1 
ATOM   2818 N N   . TYR B 2 3   ? -4.145  36.661  32.607  1.00 53.04  ? 23   TYR B N   1 
ATOM   2819 C CA  . TYR B 2 3   ? -3.668  37.428  31.466  1.00 49.46  ? 23   TYR B CA  1 
ATOM   2820 C C   . TYR B 2 3   ? -2.292  38.027  31.747  1.00 51.27  ? 23   TYR B C   1 
ATOM   2821 O O   . TYR B 2 3   ? -1.926  38.255  32.900  1.00 52.55  ? 23   TYR B O   1 
ATOM   2822 C CB  . TYR B 2 3   ? -4.671  38.528  31.108  1.00 48.55  ? 23   TYR B CB  1 
ATOM   2823 C CG  . TYR B 2 3   ? -6.009  37.999  30.635  1.00 52.59  ? 23   TYR B CG  1 
ATOM   2824 C CD1 . TYR B 2 3   ? -6.117  37.298  29.438  1.00 54.26  ? 23   TYR B CD1 1 
ATOM   2825 C CD2 . TYR B 2 3   ? -7.167  38.205  31.379  1.00 54.72  ? 23   TYR B CD2 1 
ATOM   2826 C CE1 . TYR B 2 3   ? -7.336  36.813  28.998  1.00 50.67  ? 23   TYR B CE1 1 
ATOM   2827 C CE2 . TYR B 2 3   ? -8.391  37.723  30.946  1.00 51.68  ? 23   TYR B CE2 1 
ATOM   2828 C CZ  . TYR B 2 3   ? -8.468  37.029  29.755  1.00 56.51  ? 23   TYR B CZ  1 
ATOM   2829 O OH  . TYR B 2 3   ? -9.682  36.548  29.316  1.00 60.90  ? 23   TYR B OH  1 
ATOM   2830 N N   . CYS B 2 4   ? -1.527  38.267  30.687  1.00 52.16  ? 24   CYS B N   1 
ATOM   2831 C CA  . CYS B 2 4   ? -0.179  38.807  30.826  1.00 48.50  ? 24   CYS B CA  1 
ATOM   2832 C C   . CYS B 2 4   ? -0.144  40.297  30.492  1.00 51.08  ? 24   CYS B C   1 
ATOM   2833 O O   . CYS B 2 4   ? -0.449  40.706  29.373  1.00 54.18  ? 24   CYS B O   1 
ATOM   2834 C CB  . CYS B 2 4   ? 0.801   38.046  29.938  1.00 46.57  ? 24   CYS B CB  1 
ATOM   2835 S SG  . CYS B 2 4   ? 2.489   38.665  30.039  1.00 47.48  ? 24   CYS B SG  1 
ATOM   2836 N N   . TYR B 2 5   ? 0.230   41.101  31.477  1.00 47.84  ? 25   TYR B N   1 
ATOM   2837 C CA  . TYR B 2 5   ? 0.176   42.550  31.347  1.00 47.04  ? 25   TYR B CA  1 
ATOM   2838 C C   . TYR B 2 5   ? 1.518   43.145  30.941  1.00 49.70  ? 25   TYR B C   1 
ATOM   2839 O O   . TYR B 2 5   ? 1.679   44.362  30.891  1.00 57.93  ? 25   TYR B O   1 
ATOM   2840 C CB  . TYR B 2 5   ? -0.329  43.153  32.654  1.00 48.37  ? 25   TYR B CB  1 
ATOM   2841 C CG  . TYR B 2 5   ? -1.729  42.680  32.960  1.00 51.25  ? 25   TYR B CG  1 
ATOM   2842 C CD1 . TYR B 2 5   ? -2.837  43.382  32.496  1.00 52.53  ? 25   TYR B CD1 1 
ATOM   2843 C CD2 . TYR B 2 5   ? -1.947  41.501  33.663  1.00 50.13  ? 25   TYR B CD2 1 
ATOM   2844 C CE1 . TYR B 2 5   ? -4.125  42.939  32.753  1.00 46.02  ? 25   TYR B CE1 1 
ATOM   2845 C CE2 . TYR B 2 5   ? -3.228  41.049  33.922  1.00 48.72  ? 25   TYR B CE2 1 
ATOM   2846 C CZ  . TYR B 2 5   ? -4.314  41.772  33.467  1.00 46.46  ? 25   TYR B CZ  1 
ATOM   2847 O OH  . TYR B 2 5   ? -5.589  41.323  33.728  1.00 49.31  ? 25   TYR B OH  1 
ATOM   2848 N N   . GLU B 2 6   ? 2.482   42.273  30.667  1.00 50.06  ? 26   GLU B N   1 
ATOM   2849 C CA  . GLU B 2 6   ? 3.784   42.694  30.169  1.00 49.42  ? 26   GLU B CA  1 
ATOM   2850 C C   . GLU B 2 6   ? 3.702   43.118  28.705  1.00 53.58  ? 26   GLU B C   1 
ATOM   2851 O O   . GLU B 2 6   ? 2.770   42.746  27.995  1.00 54.75  ? 26   GLU B O   1 
ATOM   2852 C CB  . GLU B 2 6   ? 4.802   41.563  30.330  1.00 51.79  ? 26   GLU B CB  1 
ATOM   2853 C CG  . GLU B 2 6   ? 4.772   40.902  31.694  1.00 55.12  ? 26   GLU B CG  1 
ATOM   2854 C CD  . GLU B 2 6   ? 5.613   39.640  31.754  1.00 60.72  ? 26   GLU B CD  1 
ATOM   2855 O OE1 . GLU B 2 6   ? 6.743   39.653  31.222  1.00 52.62  ? 26   GLU B OE1 1 
ATOM   2856 O OE2 . GLU B 2 6   ? 5.143   38.636  32.330  1.00 62.63  ? 26   GLU B OE2 1 
ATOM   2857 N N   . GLN B 2 7   ? 4.681   43.909  28.270  1.00 60.63  ? 27   GLN B N   1 
ATOM   2858 C CA  . GLN B 2 7   ? 4.838   44.298  26.868  1.00 65.10  ? 27   GLN B CA  1 
ATOM   2859 C C   . GLN B 2 7   ? 6.305   44.070  26.445  1.00 72.96  ? 27   GLN B C   1 
ATOM   2860 O O   . GLN B 2 7   ? 7.101   43.558  27.233  1.00 69.36  ? 27   GLN B O   1 
ATOM   2861 C CB  . GLN B 2 7   ? 4.414   45.758  26.669  1.00 68.13  ? 27   GLN B CB  1 
ATOM   2862 C CG  . GLN B 2 7   ? 3.545   46.308  27.808  1.00 73.56  ? 27   GLN B CG  1 
ATOM   2863 C CD  . GLN B 2 7   ? 3.424   47.820  27.796  1.00 80.36  ? 27   GLN B CD  1 
ATOM   2864 O OE1 . GLN B 2 7   ? 3.780   48.472  26.816  1.00 88.32  ? 27   GLN B OE1 1 
ATOM   2865 N NE2 . GLN B 2 7   ? 2.943   48.388  28.899  1.00 79.70  ? 27   GLN B NE2 1 
ATOM   2866 N N   . LEU B 2 8   ? 6.666   44.451  25.220  1.00 81.33  ? 28   LEU B N   1 
ATOM   2867 C CA  . LEU B 2 8   ? 8.014   44.180  24.699  1.00 87.73  ? 28   LEU B CA  1 
ATOM   2868 C C   . LEU B 2 8   ? 8.651   45.456  24.082  1.00 98.95  ? 28   LEU B C   1 
ATOM   2869 O O   . LEU B 2 8   ? 7.943   46.448  23.903  1.00 100.94 ? 28   LEU B O   1 
ATOM   2870 C CB  . LEU B 2 8   ? 7.955   42.992  23.710  1.00 89.49  ? 28   LEU B CB  1 
ATOM   2871 C CG  . LEU B 2 8   ? 7.474   42.899  22.260  1.00 91.08  ? 28   LEU B CG  1 
ATOM   2872 C CD1 . LEU B 2 8   ? 8.400   43.567  21.274  1.00 94.89  ? 28   LEU B CD1 1 
ATOM   2873 C CD2 . LEU B 2 8   ? 7.398   41.427  21.944  1.00 88.67  ? 28   LEU B CD2 1 
ATOM   2874 N N   . ASN B 2 9   ? 9.961   45.487  23.784  1.00 104.38 ? 29   ASN B N   1 
ATOM   2875 C CA  . ASN B 2 9   ? 10.911  44.360  23.808  1.00 106.82 ? 29   ASN B CA  1 
ATOM   2876 C C   . ASN B 2 9   ? 11.226  43.794  25.187  1.00 106.61 ? 29   ASN B C   1 
ATOM   2877 O O   . ASN B 2 9   ? 11.442  44.533  26.145  1.00 108.73 ? 29   ASN B O   1 
ATOM   2878 C CB  . ASN B 2 9   ? 12.224  44.771  23.129  1.00 113.05 ? 29   ASN B CB  1 
ATOM   2879 C CG  . ASN B 2 9   ? 12.005  45.368  21.751  1.00 117.20 ? 29   ASN B CG  1 
ATOM   2880 O OD1 . ASN B 2 9   ? 10.871  45.501  21.303  1.00 116.99 ? 29   ASN B OD1 1 
ATOM   2881 N ND2 . ASN B 2 9   ? 13.093  45.693  21.055  1.00 120.91 ? 29   ASN B ND2 1 
HETATM 2882 S S   . SO4 C 3 .   ? 25.405  -12.467 5.358   1.00 27.35  ? 1001 SO4 A S   1 
HETATM 2883 O O1  . SO4 C 3 .   ? 26.810  -12.544 4.957   1.00 26.59  ? 1001 SO4 A O1  1 
HETATM 2884 O O2  . SO4 C 3 .   ? 24.525  -12.690 4.207   1.00 20.51  ? 1001 SO4 A O2  1 
HETATM 2885 O O3  . SO4 C 3 .   ? 25.133  -13.486 6.373   1.00 27.51  ? 1001 SO4 A O3  1 
HETATM 2886 O O4  . SO4 C 3 .   ? 25.161  -11.127 5.893   1.00 30.85  ? 1001 SO4 A O4  1 
HETATM 2887 S S   . SO4 D 3 .   ? 34.547  14.203  11.218  1.00 74.45  ? 1002 SO4 A S   1 
HETATM 2888 O O1  . SO4 D 3 .   ? 35.316  14.891  10.182  1.00 70.16  ? 1002 SO4 A O1  1 
HETATM 2889 O O2  . SO4 D 3 .   ? 33.732  13.151  10.613  1.00 71.86  ? 1002 SO4 A O2  1 
HETATM 2890 O O3  . SO4 D 3 .   ? 33.687  15.169  11.894  1.00 67.08  ? 1002 SO4 A O3  1 
HETATM 2891 O O4  . SO4 D 3 .   ? 35.454  13.596  12.188  1.00 78.77  ? 1002 SO4 A O4  1 
HETATM 2892 S S   . SO4 E 3 .   ? 10.843  13.832  37.151  1.00 81.37  ? 1003 SO4 A S   1 
HETATM 2893 O O1  . SO4 E 3 .   ? 11.872  13.432  36.193  1.00 79.49  ? 1003 SO4 A O1  1 
HETATM 2894 O O2  . SO4 E 3 .   ? 9.535   13.374  36.689  1.00 81.39  ? 1003 SO4 A O2  1 
HETATM 2895 O O3  . SO4 E 3 .   ? 11.132  13.229  38.449  1.00 83.70  ? 1003 SO4 A O3  1 
HETATM 2896 O O4  . SO4 E 3 .   ? 10.834  15.286  37.281  1.00 80.05  ? 1003 SO4 A O4  1 
HETATM 2897 S S   . SO4 F 3 .   ? 2.798   3.423   8.790   1.00 102.44 ? 1004 SO4 A S   1 
HETATM 2898 O O1  . SO4 F 3 .   ? 2.834   2.310   7.846   1.00 104.91 ? 1004 SO4 A O1  1 
HETATM 2899 O O2  . SO4 F 3 .   ? 2.195   4.583   8.139   1.00 100.12 ? 1004 SO4 A O2  1 
HETATM 2900 O O3  . SO4 F 3 .   ? 2.007   3.043   9.957   1.00 99.34  ? 1004 SO4 A O3  1 
HETATM 2901 O O4  . SO4 F 3 .   ? 4.159   3.753   9.205   1.00 100.54 ? 1004 SO4 A O4  1 
HETATM 2902 O O   . HOH G 4 .   ? 12.650  25.464  8.948   1.00 46.37  ? 1101 HOH A O   1 
HETATM 2903 O O   . HOH G 4 .   ? 29.065  -3.164  -3.010  1.00 42.66  ? 1102 HOH A O   1 
HETATM 2904 O O   . HOH G 4 .   ? 15.404  30.023  -8.329  1.00 35.33  ? 1103 HOH A O   1 
HETATM 2905 O O   . HOH G 4 .   ? 31.568  6.035   3.825   1.00 31.40  ? 1104 HOH A O   1 
HETATM 2906 O O   . HOH G 4 .   ? 12.333  -13.632 -4.199  1.00 30.76  ? 1105 HOH A O   1 
HETATM 2907 O O   . HOH G 4 .   ? 28.006  0.627   -3.001  1.00 29.41  ? 1106 HOH A O   1 
HETATM 2908 O O   . HOH G 4 .   ? 13.167  6.965   10.658  1.00 33.68  ? 1107 HOH A O   1 
HETATM 2909 O O   . HOH G 4 .   ? 11.427  25.748  12.047  1.00 30.68  ? 1108 HOH A O   1 
HETATM 2910 O O   . HOH G 4 .   ? 14.663  11.064  11.141  1.00 23.45  ? 1109 HOH A O   1 
HETATM 2911 O O   . HOH G 4 .   ? -0.603  10.998  6.247   1.00 28.02  ? 1110 HOH A O   1 
HETATM 2912 O O   . HOH G 4 .   ? 26.510  9.366   10.096  1.00 23.40  ? 1111 HOH A O   1 
HETATM 2913 O O   . HOH G 4 .   ? 8.548   16.655  -9.931  1.00 22.35  ? 1112 HOH A O   1 
HETATM 2914 O O   . HOH G 4 .   ? -0.908  17.758  18.611  1.00 19.57  ? 1113 HOH A O   1 
HETATM 2915 O O   . HOH G 4 .   ? -3.146  11.943  0.774   1.00 29.92  ? 1114 HOH A O   1 
HETATM 2916 O O   . HOH G 4 .   ? -8.868  4.550   10.511  1.00 19.91  ? 1115 HOH A O   1 
HETATM 2917 O O   . HOH G 4 .   ? 31.891  24.033  0.764   1.00 28.24  ? 1116 HOH A O   1 
HETATM 2918 O O   . HOH G 4 .   ? 19.067  -1.584  7.068   1.00 26.00  ? 1117 HOH A O   1 
HETATM 2919 O O   . HOH G 4 .   ? 16.269  -3.623  9.703   1.00 41.80  ? 1118 HOH A O   1 
HETATM 2920 O O   . HOH G 4 .   ? -3.204  7.360   11.508  1.00 22.60  ? 1119 HOH A O   1 
HETATM 2921 O O   . HOH G 4 .   ? 14.675  28.181  4.903   1.00 43.21  ? 1120 HOH A O   1 
HETATM 2922 O O   . HOH G 4 .   ? 9.609   2.591   -5.556  1.00 20.15  ? 1121 HOH A O   1 
HETATM 2923 O O   . HOH G 4 .   ? -9.150  23.815  28.862  1.00 42.70  ? 1122 HOH A O   1 
HETATM 2924 O O   . HOH G 4 .   ? 2.054   30.972  10.591  1.00 30.69  ? 1123 HOH A O   1 
HETATM 2925 O O   . HOH G 4 .   ? 27.043  4.785   -5.621  1.00 18.01  ? 1124 HOH A O   1 
HETATM 2926 O O   . HOH G 4 .   ? 1.151   24.629  25.912  1.00 24.31  ? 1125 HOH A O   1 
HETATM 2927 O O   . HOH G 4 .   ? 2.466   27.218  7.539   1.00 31.66  ? 1126 HOH A O   1 
HETATM 2928 O O   . HOH G 4 .   ? 7.700   18.411  -7.462  1.00 23.44  ? 1127 HOH A O   1 
HETATM 2929 O O   . HOH G 4 .   ? 29.257  1.962   1.275   1.00 33.85  ? 1128 HOH A O   1 
HETATM 2930 O O   . HOH G 4 .   ? -1.014  8.737   28.933  1.00 47.27  ? 1129 HOH A O   1 
HETATM 2931 O O   . HOH G 4 .   ? 9.249   0.471   -14.795 1.00 44.91  ? 1130 HOH A O   1 
HETATM 2932 O O   . HOH G 4 .   ? -6.614  16.087  11.536  1.00 21.52  ? 1131 HOH A O   1 
HETATM 2933 O O   . HOH G 4 .   ? 21.285  1.123   8.107   1.00 42.22  ? 1132 HOH A O   1 
HETATM 2934 O O   . HOH G 4 .   ? 11.195  -1.718  -11.270 1.00 24.91  ? 1133 HOH A O   1 
HETATM 2935 O O   . HOH G 4 .   ? 19.441  5.978   -11.983 1.00 34.80  ? 1134 HOH A O   1 
HETATM 2936 O O   . HOH G 4 .   ? 5.044   3.722   -3.318  1.00 30.36  ? 1135 HOH A O   1 
HETATM 2937 O O   . HOH G 4 .   ? -9.626  -2.376  13.328  1.00 34.62  ? 1136 HOH A O   1 
HETATM 2938 O O   . HOH G 4 .   ? 16.853  25.613  6.968   1.00 32.47  ? 1137 HOH A O   1 
HETATM 2939 O O   . HOH G 4 .   ? 7.102   32.654  13.735  1.00 32.11  ? 1138 HOH A O   1 
HETATM 2940 O O   . HOH G 4 .   ? -9.625  24.108  25.001  1.00 45.41  ? 1139 HOH A O   1 
HETATM 2941 O O   . HOH G 4 .   ? 10.219  -4.069  -5.292  1.00 31.13  ? 1140 HOH A O   1 
HETATM 2942 O O   . HOH G 4 .   ? -7.926  33.830  25.332  1.00 43.27  ? 1141 HOH A O   1 
HETATM 2943 O O   . HOH G 4 .   ? 12.722  -2.299  7.517   1.00 48.92  ? 1142 HOH A O   1 
HETATM 2944 O O   . HOH G 4 .   ? 24.953  30.232  1.059   1.00 24.54  ? 1143 HOH A O   1 
HETATM 2945 O O   . HOH G 4 .   ? 33.368  9.099   -7.691  1.00 46.72  ? 1144 HOH A O   1 
HETATM 2946 O O   . HOH G 4 .   ? -3.931  27.843  13.183  1.00 27.53  ? 1145 HOH A O   1 
HETATM 2947 O O   . HOH G 4 .   ? 3.570   25.364  11.280  1.00 15.53  ? 1146 HOH A O   1 
HETATM 2948 O O   . HOH G 4 .   ? 16.994  27.795  -7.891  1.00 21.69  ? 1147 HOH A O   1 
HETATM 2949 O O   . HOH G 4 .   ? 16.335  -10.690 0.993   1.00 35.00  ? 1148 HOH A O   1 
HETATM 2950 O O   . HOH G 4 .   ? 1.915   11.332  29.157  1.00 36.96  ? 1149 HOH A O   1 
HETATM 2951 O O   . HOH G 4 .   ? 16.913  22.696  0.474   1.00 12.02  ? 1150 HOH A O   1 
HETATM 2952 O O   . HOH G 4 .   ? -8.408  6.449   17.315  1.00 31.10  ? 1151 HOH A O   1 
HETATM 2953 O O   . HOH G 4 .   ? 17.821  16.549  17.082  1.00 41.00  ? 1152 HOH A O   1 
HETATM 2954 O O   . HOH G 4 .   ? 27.215  0.926   0.255   1.00 32.00  ? 1153 HOH A O   1 
HETATM 2955 O O   . HOH G 4 .   ? 3.104   31.114  14.892  1.00 26.73  ? 1154 HOH A O   1 
HETATM 2956 O O   . HOH G 4 .   ? 24.866  0.696   -5.016  1.00 29.52  ? 1155 HOH A O   1 
HETATM 2957 O O   . HOH G 4 .   ? 18.467  20.080  27.532  1.00 47.40  ? 1156 HOH A O   1 
HETATM 2958 O O   . HOH G 4 .   ? 26.429  4.216   2.885   1.00 32.37  ? 1157 HOH A O   1 
HETATM 2959 O O   . HOH G 4 .   ? 7.347   20.366  1.327   1.00 29.02  ? 1158 HOH A O   1 
HETATM 2960 O O   . HOH G 4 .   ? 10.425  -8.279  -11.367 1.00 35.08  ? 1159 HOH A O   1 
HETATM 2961 O O   . HOH G 4 .   ? 14.076  28.615  -6.396  1.00 30.55  ? 1160 HOH A O   1 
HETATM 2962 O O   . HOH G 4 .   ? 18.136  -12.301 1.196   1.00 19.17  ? 1161 HOH A O   1 
HETATM 2963 O O   . HOH G 4 .   ? 14.449  28.392  0.775   1.00 36.38  ? 1162 HOH A O   1 
HETATM 2964 O O   . HOH G 4 .   ? 27.809  2.226   -7.541  1.00 28.58  ? 1163 HOH A O   1 
HETATM 2965 O O   . HOH G 4 .   ? 29.259  -5.137  -5.950  1.00 44.07  ? 1164 HOH A O   1 
HETATM 2966 O O   . HOH G 4 .   ? 5.455   22.332  -3.549  1.00 30.41  ? 1165 HOH A O   1 
HETATM 2967 O O   . HOH G 4 .   ? 18.886  9.551   -13.482 1.00 31.56  ? 1166 HOH A O   1 
HETATM 2968 O O   . HOH G 4 .   ? 5.512   8.994   -2.695  1.00 28.50  ? 1167 HOH A O   1 
HETATM 2969 O O   . HOH G 4 .   ? 13.532  14.537  18.456  1.00 33.39  ? 1168 HOH A O   1 
HETATM 2970 O O   . HOH G 4 .   ? 12.293  27.597  -8.733  1.00 42.88  ? 1169 HOH A O   1 
HETATM 2971 O O   . HOH G 4 .   ? 8.612   18.699  -13.736 1.00 31.43  ? 1170 HOH A O   1 
HETATM 2972 O O   . HOH G 4 .   ? -6.680  13.504  21.463  1.00 25.08  ? 1171 HOH A O   1 
HETATM 2973 O O   . HOH G 4 .   ? 8.320   19.339  -15.815 1.00 37.32  ? 1172 HOH A O   1 
HETATM 2974 O O   . HOH G 4 .   ? 5.104   13.728  -0.337  1.00 26.92  ? 1173 HOH A O   1 
HETATM 2975 O O   . HOH G 4 .   ? 4.705   30.564  12.642  1.00 40.05  ? 1174 HOH A O   1 
HETATM 2976 O O   . HOH G 4 .   ? 16.558  21.632  20.658  1.00 47.18  ? 1175 HOH A O   1 
HETATM 2977 O O   . HOH G 4 .   ? -4.504  26.973  42.555  1.00 47.38  ? 1176 HOH A O   1 
HETATM 2978 O O   . HOH G 4 .   ? 17.088  15.873  36.324  1.00 50.36  ? 1177 HOH A O   1 
HETATM 2979 O O   . HOH G 4 .   ? 9.551   -6.653  1.836   1.00 31.18  ? 1178 HOH A O   1 
HETATM 2980 O O   . HOH G 4 .   ? 5.527   9.847   9.560   1.00 29.84  ? 1179 HOH A O   1 
HETATM 2981 O O   . HOH G 4 .   ? 3.583   19.250  -1.414  1.00 42.88  ? 1180 HOH A O   1 
HETATM 2982 O O   . HOH G 4 .   ? 14.808  -9.178  -12.515 1.00 30.77  ? 1181 HOH A O   1 
HETATM 2983 O O   . HOH G 4 .   ? 20.829  23.756  2.188   1.00 36.70  ? 1182 HOH A O   1 
HETATM 2984 O O   . HOH G 4 .   ? 25.798  22.266  10.834  1.00 27.40  ? 1183 HOH A O   1 
HETATM 2985 O O   . HOH G 4 .   ? 6.978   0.860   -18.341 1.00 41.98  ? 1184 HOH A O   1 
HETATM 2986 O O   . HOH G 4 .   ? 41.483  19.395  -1.640  1.00 34.03  ? 1185 HOH A O   1 
HETATM 2987 O O   . HOH G 4 .   ? 0.000   19.508  0.000   0.50 48.94  ? 1186 HOH A O   1 
HETATM 2988 O O   . HOH G 4 .   ? 34.607  8.498   2.953   1.00 45.49  ? 1187 HOH A O   1 
HETATM 2989 O O   . HOH G 4 .   ? 3.132   2.490   25.995  1.00 44.45  ? 1188 HOH A O   1 
HETATM 2990 O O   . HOH G 4 .   ? 21.720  24.382  9.710   1.00 41.38  ? 1189 HOH A O   1 
HETATM 2991 O O   . HOH G 4 .   ? 32.711  18.468  10.754  1.00 36.68  ? 1190 HOH A O   1 
HETATM 2992 O O   . HOH G 4 .   ? 6.049   22.831  5.333   1.00 28.94  ? 1191 HOH A O   1 
HETATM 2993 O O   . HOH G 4 .   ? 38.122  13.887  3.994   1.00 37.82  ? 1192 HOH A O   1 
HETATM 2994 O O   . HOH G 4 .   ? 28.625  9.824   11.606  1.00 51.13  ? 1193 HOH A O   1 
HETATM 2995 O O   . HOH G 4 .   ? 17.103  37.051  15.137  1.00 40.87  ? 1194 HOH A O   1 
HETATM 2996 O O   . HOH G 4 .   ? 38.678  11.834  -2.830  1.00 43.85  ? 1195 HOH A O   1 
HETATM 2997 O O   . HOH G 4 .   ? 26.216  8.259   14.282  1.00 56.63  ? 1196 HOH A O   1 
HETATM 2998 O O   . HOH G 4 .   ? 24.492  27.276  27.284  1.00 67.59  ? 1197 HOH A O   1 
HETATM 2999 O O   . HOH G 4 .   ? 9.216   -6.747  7.174   1.00 55.34  ? 1198 HOH A O   1 
HETATM 3000 O O   . HOH G 4 .   ? 44.048  28.053  1.891   1.00 52.05  ? 1199 HOH A O   1 
HETATM 3001 O O   . HOH G 4 .   ? 7.758   22.450  3.346   1.00 37.33  ? 1200 HOH A O   1 
HETATM 3002 O O   . HOH G 4 .   ? 12.249  18.896  42.954  1.00 43.31  ? 1201 HOH A O   1 
HETATM 3003 O O   . HOH G 4 .   ? 17.887  23.120  23.845  1.00 57.19  ? 1202 HOH A O   1 
HETATM 3004 O O   . HOH G 4 .   ? 27.301  2.074   -4.897  1.00 21.20  ? 1203 HOH A O   1 
HETATM 3005 O O   . HOH G 4 .   ? 3.990   27.084  9.414   1.00 37.77  ? 1204 HOH A O   1 
HETATM 3006 O O   . HOH G 4 .   ? 41.105  18.644  0.706   1.00 43.50  ? 1205 HOH A O   1 
HETATM 3007 O O   . HOH G 4 .   ? 10.247  26.527  -4.311  1.00 36.48  ? 1206 HOH A O   1 
HETATM 3008 O O   . HOH G 4 .   ? 30.398  -0.860  -4.211  1.00 37.53  ? 1207 HOH A O   1 
HETATM 3009 O O   . HOH G 4 .   ? -3.061  9.166   5.441   1.00 43.50  ? 1208 HOH A O   1 
HETATM 3010 O O   . HOH G 4 .   ? 33.327  2.916   -1.124  1.00 37.42  ? 1209 HOH A O   1 
HETATM 3011 O O   . HOH G 4 .   ? 18.764  12.081  18.861  1.00 49.35  ? 1210 HOH A O   1 
HETATM 3012 O O   . HOH H 4 .   ? -3.964  42.998  28.302  1.00 39.94  ? 101  HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 2   ? 0.5695 0.9008 1.0707 -0.1378 0.0042  -0.0209 389 GLU A N   
2    C CA  . GLU A 2   ? 0.4940 0.8230 0.9863 -0.1272 -0.0148 -0.0278 389 GLU A CA  
3    C C   . GLU A 2   ? 0.3585 0.6494 0.8159 -0.1215 -0.0167 -0.0367 389 GLU A C   
4    O O   . GLU A 2   ? 0.3984 0.6597 0.8375 -0.1338 -0.0180 -0.0410 389 GLU A O   
5    C CB  . GLU A 2   ? 0.5790 0.9176 1.0791 -0.1420 -0.0382 -0.0303 389 GLU A CB  
6    C CG  . GLU A 2   ? 0.6685 1.0137 1.1615 -0.1314 -0.0580 -0.0343 389 GLU A CG  
7    C CD  . GLU A 2   ? 0.7876 1.1192 1.2630 -0.1472 -0.0810 -0.0424 389 GLU A CD  
8    O OE1 . GLU A 2   ? 0.8112 1.1202 1.2763 -0.1645 -0.0809 -0.0471 389 GLU A OE1 
9    O OE2 . GLU A 2   ? 0.8411 1.1830 1.3106 -0.1422 -0.0987 -0.0441 389 GLU A OE2 
10   N N   . PHE A 3   ? 0.3103 0.6014 0.7588 -0.1025 -0.0166 -0.0391 390 PHE A N   
11   C CA  . PHE A 3   ? 0.2502 0.5073 0.6606 -0.0953 -0.0196 -0.0468 390 PHE A CA  
12   C C   . PHE A 3   ? 0.2702 0.5177 0.6650 -0.1008 -0.0436 -0.0546 390 PHE A C   
13   O O   . PHE A 3   ? 0.2501 0.5220 0.6649 -0.1054 -0.0593 -0.0532 390 PHE A O   
14   C CB  . PHE A 3   ? 0.2313 0.4884 0.6297 -0.0731 -0.0108 -0.0451 390 PHE A CB  
15   C CG  . PHE A 3   ? 0.3285 0.5893 0.7320 -0.0672 0.0137  -0.0404 390 PHE A CG  
16   C CD1 . PHE A 3   ? 0.3244 0.5548 0.6941 -0.0676 0.0265  -0.0405 390 PHE A CD1 
17   C CD2 . PHE A 3   ? 0.4295 0.7240 0.8688 -0.0608 0.0238  -0.0355 390 PHE A CD2 
18   C CE1 . PHE A 3   ? 0.3718 0.6060 0.7416 -0.0637 0.0484  -0.0363 390 PHE A CE1 
19   C CE2 . PHE A 3   ? 0.4341 0.7303 0.8711 -0.0554 0.0474  -0.0326 390 PHE A CE2 
20   C CZ  . PHE A 3   ? 0.4570 0.7251 0.8616 -0.0582 0.0600  -0.0337 390 PHE A CZ  
21   N N   . THR A 4   ? 0.2604 0.4708 0.6135 -0.0995 -0.0457 -0.0617 391 THR A N   
22   C CA  . THR A 4   ? 0.2532 0.4524 0.5837 -0.1018 -0.0656 -0.0707 391 THR A CA  
23   C C   . THR A 4   ? 0.3080 0.5232 0.6352 -0.0858 -0.0734 -0.0674 391 THR A C   
24   O O   . THR A 4   ? 0.2765 0.5000 0.6109 -0.0713 -0.0614 -0.0604 391 THR A O   
25   C CB  . THR A 4   ? 0.3297 0.4868 0.6179 -0.1013 -0.0626 -0.0792 391 THR A CB  
26   O OG1 . THR A 4   ? 0.2380 0.3832 0.5037 -0.0835 -0.0510 -0.0757 391 THR A OG1 
27   C CG2 . THR A 4   ? 0.3573 0.4942 0.6492 -0.1147 -0.0532 -0.0796 391 THR A CG2 
28   N N   . GLN A 5   ? 0.3034 0.5219 0.6188 -0.0891 -0.0936 -0.0724 392 GLN A N   
29   C CA  . GLN A 5   ? 0.2825 0.5174 0.5965 -0.0760 -0.1038 -0.0668 392 GLN A CA  
30   C C   . GLN A 5   ? 0.3144 0.5282 0.5990 -0.0587 -0.0919 -0.0648 392 GLN A C   
31   O O   . GLN A 5   ? 0.1879 0.4142 0.4834 -0.0447 -0.0893 -0.0564 392 GLN A O   
32   C CB  . GLN A 5   ? 0.3070 0.5453 0.6044 -0.0849 -0.1277 -0.0727 392 GLN A CB  
33   C CG  . GLN A 5   ? 0.4953 0.7427 0.8057 -0.1050 -0.1384 -0.0761 392 GLN A CG  
34   C CD  . GLN A 5   ? 0.6530 0.9351 1.0077 -0.1069 -0.1360 -0.0635 392 GLN A CD  
35   O OE1 . GLN A 5   ? 0.6734 0.9770 1.0491 -0.0922 -0.1319 -0.0527 392 GLN A OE1 
36   N NE2 . GLN A 5   ? 0.6948 0.9816 1.0629 -0.1249 -0.1378 -0.0655 392 GLN A NE2 
37   N N   . SER A 6   ? 0.2617 0.4433 0.5112 -0.0597 -0.0849 -0.0724 393 SER A N   
38   C CA  . SER A 6   ? 0.2057 0.3679 0.4280 -0.0454 -0.0741 -0.0706 393 SER A CA  
39   C C   . SER A 6   ? 0.2144 0.3782 0.4510 -0.0361 -0.0557 -0.0636 393 SER A C   
40   O O   . SER A 6   ? 0.2269 0.3901 0.4573 -0.0230 -0.0515 -0.0586 393 SER A O   
41   C CB  . SER A 6   ? 0.2593 0.3897 0.4469 -0.0487 -0.0700 -0.0800 393 SER A CB  
42   O OG  . SER A 6   ? 0.4561 0.5812 0.6164 -0.0484 -0.0823 -0.0859 393 SER A OG  
43   N N   . VAL A 7   ? 0.1791 0.3440 0.4330 -0.0438 -0.0446 -0.0633 394 VAL A N   
44   C CA  . VAL A 7   ? 0.2087 0.3750 0.4714 -0.0363 -0.0259 -0.0578 394 VAL A CA  
45   C C   . VAL A 7   ? 0.1813 0.3779 0.4781 -0.0284 -0.0248 -0.0518 394 VAL A C   
46   O O   . VAL A 7   ? 0.1771 0.3729 0.4733 -0.0160 -0.0134 -0.0491 394 VAL A O   
47   C CB  . VAL A 7   ? 0.2062 0.3654 0.4753 -0.0478 -0.0134 -0.0574 394 VAL A CB  
48   C CG1 . VAL A 7   ? 0.2011 0.3679 0.4802 -0.0415 0.0059  -0.0516 394 VAL A CG1 
49   C CG2 . VAL A 7   ? 0.1835 0.3093 0.4197 -0.0514 -0.0123 -0.0618 394 VAL A CG2 
50   N N   . SER A 8   ? 0.1624 0.3853 0.4894 -0.0350 -0.0373 -0.0503 395 SER A N   
51   C CA  . SER A 8   ? 0.1553 0.4093 0.5197 -0.0256 -0.0373 -0.0438 395 SER A CA  
52   C C   . SER A 8   ? 0.1520 0.4024 0.5047 -0.0105 -0.0464 -0.0406 395 SER A C   
53   O O   . SER A 8   ? 0.2020 0.4606 0.5709 0.0036  -0.0384 -0.0364 395 SER A O   
54   C CB  . SER A 8   ? 0.2635 0.5500 0.6664 -0.0372 -0.0507 -0.0414 395 SER A CB  
55   O OG  . SER A 8   ? 0.3596 0.6483 0.7523 -0.0412 -0.0745 -0.0423 395 SER A OG  
56   N N   . ARG A 9   ? 0.2245 0.4616 0.5485 -0.0135 -0.0622 -0.0426 396 ARG A N   
57   C CA  . ARG A 9   ? 0.2452 0.4757 0.5527 -0.0012 -0.0705 -0.0379 396 ARG A CA  
58   C C   . ARG A 9   ? 0.2323 0.4398 0.5197 0.0101  -0.0539 -0.0383 396 ARG A C   
59   O O   . ARG A 9   ? 0.2282 0.4369 0.5232 0.0233  -0.0522 -0.0329 396 ARG A O   
60   C CB  . ARG A 9   ? 0.2340 0.4531 0.5082 -0.0084 -0.0870 -0.0410 396 ARG A CB  
61   C CG  . ARG A 9   ? 0.2531 0.4637 0.5060 0.0024  -0.0940 -0.0346 396 ARG A CG  
62   C CD  . ARG A 9   ? 0.3168 0.5507 0.6023 0.0126  -0.1033 -0.0229 396 ARG A CD  
63   N NE  . ARG A 9   ? 0.3639 0.6251 0.6703 0.0040  -0.1230 -0.0198 396 ARG A NE  
64   C CZ  . ARG A 9   ? 0.3588 0.6238 0.6454 -0.0014 -0.1431 -0.0167 396 ARG A CZ  
65   N NH1 . ARG A 9   ? 0.3725 0.6166 0.6193 0.0015  -0.1443 -0.0159 396 ARG A NH1 
66   N NH2 . ARG A 9   ? 0.3147 0.6021 0.6129 -0.0106 -0.1580 -0.0134 396 ARG A NH2 
67   N N   . LEU A 10  ? 0.2026 0.3882 0.4648 0.0045  -0.0426 -0.0445 397 LEU A N   
68   C CA  . LEU A 10  ? 0.2045 0.3696 0.4473 0.0125  -0.0274 -0.0452 397 LEU A CA  
69   C C   . LEU A 10  ? 0.2357 0.4120 0.5043 0.0212  -0.0134 -0.0434 397 LEU A C   
70   O O   . LEU A 10  ? 0.2372 0.4043 0.4999 0.0325  -0.0081 -0.0421 397 LEU A O   
71   C CB  . LEU A 10  ? 0.2728 0.4181 0.4924 0.0040  -0.0182 -0.0504 397 LEU A CB  
72   C CG  . LEU A 10  ? 0.4118 0.5333 0.6010 0.0097  -0.0093 -0.0509 397 LEU A CG  
73   C CD1 . LEU A 10  ? 0.5491 0.6629 0.7188 0.0155  -0.0201 -0.0490 397 LEU A CD1 
74   C CD2 . LEU A 10  ? 0.4116 0.5162 0.5826 0.0012  -0.0038 -0.0543 397 LEU A CD2 
75   N N   . GLN A 11  ? 0.1406 0.3367 0.4381 0.0153  -0.0068 -0.0438 398 GLN A N   
76   C CA  . GLN A 11  ? 0.1764 0.3879 0.5016 0.0232  0.0088  -0.0433 398 GLN A CA  
77   C C   . GLN A 11  ? 0.2520 0.4781 0.6032 0.0378  0.0025  -0.0390 398 GLN A C   
78   O O   . GLN A 11  ? 0.2326 0.4584 0.5939 0.0497  0.0159  -0.0406 398 GLN A O   
79   C CB  . GLN A 11  ? 0.2458 0.4812 0.6013 0.0123  0.0154  -0.0428 398 GLN A CB  
80   C CG  . GLN A 11  ? 0.3939 0.6139 0.7285 0.0000  0.0275  -0.0453 398 GLN A CG  
81   C CD  . GLN A 11  ? 0.4668 0.7102 0.8323 -0.0130 0.0334  -0.0430 398 GLN A CD  
82   O OE1 . GLN A 11  ? 0.3986 0.6708 0.8010 -0.0151 0.0250  -0.0404 398 GLN A OE1 
83   N NE2 . GLN A 11  ? 0.5349 0.7669 0.8865 -0.0224 0.0474  -0.0426 398 GLN A NE2 
84   N N   . SER A 12  ? 0.2317 0.4698 0.5931 0.0368  -0.0183 -0.0337 399 SER A N   
85   C CA  . SER A 12  ? 0.2498 0.4994 0.6331 0.0504  -0.0274 -0.0263 399 SER A CA  
86   C C   . SER A 12  ? 0.1645 0.3872 0.5226 0.0615  -0.0273 -0.0256 399 SER A C   
87   O O   . SER A 12  ? 0.2182 0.4366 0.5854 0.0747  -0.0225 -0.0224 399 SER A O   
88   C CB  . SER A 12  ? 0.2711 0.5383 0.6629 0.0441  -0.0513 -0.0188 399 SER A CB  
89   O OG  . SER A 12  ? 0.4209 0.7128 0.8366 0.0335  -0.0520 -0.0184 399 SER A OG  
90   N N   . ILE A 13  ? 0.1573 0.3565 0.4738 0.0543  -0.0317 -0.0276 400 ILE A N   
91   C CA  . ILE A 13  ? 0.2451 0.4189 0.5343 0.0616  -0.0326 -0.0255 400 ILE A CA  
92   C C   . ILE A 13  ? 0.3161 0.4734 0.6008 0.0693  -0.0130 -0.0317 400 ILE A C   
93   O O   . ILE A 13  ? 0.2730 0.4171 0.5574 0.0801  -0.0125 -0.0295 400 ILE A O   
94   C CB  . ILE A 13  ? 0.2364 0.3924 0.4845 0.0515  -0.0388 -0.0271 400 ILE A CB  
95   C CG1 . ILE A 13  ? 0.2639 0.4337 0.5109 0.0443  -0.0586 -0.0226 400 ILE A CG1 
96   C CG2 . ILE A 13  ? 0.1528 0.2846 0.3747 0.0573  -0.0378 -0.0245 400 ILE A CG2 
97   C CD1 . ILE A 13  ? 0.2220 0.3762 0.4297 0.0352  -0.0631 -0.0260 400 ILE A CD1 
98   N N   . VAL A 14  ? 0.2520 0.4092 0.5324 0.0631  0.0025  -0.0391 401 VAL A N   
99   C CA  . VAL A 14  ? 0.2131 0.3538 0.4806 0.0675  0.0208  -0.0461 401 VAL A CA  
100  C C   . VAL A 14  ? 0.2916 0.4473 0.5917 0.0771  0.0357  -0.0501 401 VAL A C   
101  O O   . VAL A 14  ? 0.3306 0.4732 0.6166 0.0797  0.0520  -0.0571 401 VAL A O   
102  C CB  . VAL A 14  ? 0.1604 0.2915 0.4013 0.0555  0.0302  -0.0506 401 VAL A CB  
103  C CG1 . VAL A 14  ? 0.1689 0.2863 0.3808 0.0477  0.0176  -0.0478 401 VAL A CG1 
104  C CG2 . VAL A 14  ? 0.1694 0.3228 0.4329 0.0477  0.0372  -0.0513 401 VAL A CG2 
105  N N   . ALA A 15  ? 0.2152 0.3950 0.5476 0.0800  0.0290  -0.0441 402 ALA A N   
106  C CA  . ALA A 15  ? 0.2204 0.4138 0.5732 0.0862  0.0423  -0.0452 402 ALA A CA  
107  C C   . ALA A 15  ? 0.3878 0.5624 0.7346 0.1004  0.0494  -0.0482 402 ALA A C   
108  O O   . ALA A 15  ? 0.3913 0.5555 0.7398 0.1085  0.0370  -0.0428 402 ALA A O   
109  C CB  . ALA A 15  ? 0.2183 0.4423 0.6063 0.0860  0.0309  -0.0368 402 ALA A CB  
110  N N   . GLY A 16  ? 0.2093 0.3791 0.5479 0.1026  0.0691  -0.0566 403 GLY A N   
111  C CA  . GLY A 16  ? 0.2407 0.3926 0.5735 0.1154  0.0774  -0.0622 403 GLY A CA  
112  C C   . GLY A 16  ? 0.2935 0.4106 0.5912 0.1150  0.0768  -0.0675 403 GLY A C   
113  O O   . GLY A 16  ? 0.3868 0.4842 0.6784 0.1246  0.0798  -0.0718 403 GLY A O   
114  N N   . LEU A 17  ? 0.2808 0.3902 0.5560 0.1036  0.0729  -0.0676 404 LEU A N   
115  C CA  . LEU A 17  ? 0.2762 0.3556 0.5200 0.1020  0.0700  -0.0712 404 LEU A CA  
116  C C   . LEU A 17  ? 0.3435 0.4129 0.5555 0.0921  0.0827  -0.0794 404 LEU A C   
117  O O   . LEU A 17  ? 0.4464 0.5322 0.6600 0.0848  0.0916  -0.0801 404 LEU A O   
118  C CB  . LEU A 17  ? 0.2293 0.3067 0.4724 0.0986  0.0513  -0.0630 404 LEU A CB  
119  C CG  . LEU A 17  ? 0.2287 0.3116 0.4954 0.1071  0.0350  -0.0523 404 LEU A CG  
120  C CD1 . LEU A 17  ? 0.2225 0.2995 0.4757 0.1014  0.0173  -0.0442 404 LEU A CD1 
121  C CD2 . LEU A 17  ? 0.2298 0.2935 0.4988 0.1187  0.0380  -0.0536 404 LEU A CD2 
122  N N   . LYS A 18  ? 0.4026 0.4449 0.5858 0.0911  0.0825  -0.0845 405 LYS A N   
123  C CA  . LYS A 18  ? 0.3483 0.3786 0.4976 0.0821  0.0929  -0.0919 405 LYS A CA  
124  C C   . LYS A 18  ? 0.3040 0.3226 0.4307 0.0731  0.0831  -0.0888 405 LYS A C   
125  O O   . LYS A 18  ? 0.3323 0.3457 0.4614 0.0740  0.0675  -0.0808 405 LYS A O   
126  C CB  . LYS A 18  ? 0.4441 0.4526 0.5748 0.0867  0.1007  -0.1018 405 LYS A CB  
127  C CG  . LYS A 18  ? 0.5104 0.5285 0.6596 0.0967  0.1119  -0.1066 405 LYS A CG  
128  C CD  . LYS A 18  ? 0.5949 0.5892 0.7202 0.1000  0.1200  -0.1188 405 LYS A CD  
129  C CE  . LYS A 18  ? 0.5647 0.5299 0.6813 0.1026  0.1080  -0.1195 405 LYS A CE  
130  N NZ  . LYS A 18  ? 0.5437 0.4825 0.6298 0.1010  0.1137  -0.1325 405 LYS A NZ  
131  N N   . ASN A 19  ? 0.3272 0.3421 0.4257 0.0627  0.0895  -0.0908 406 ASN A N   
132  C CA  . ASN A 19  ? 0.3514 0.3552 0.4216 0.0527  0.0786  -0.0845 406 ASN A CA  
133  C C   . ASN A 19  ? 0.3650 0.3443 0.4107 0.0519  0.0767  -0.0903 406 ASN A C   
134  O O   . ASN A 19  ? 0.4764 0.4468 0.4954 0.0428  0.0719  -0.0878 406 ASN A O   
135  C CB  . ASN A 19  ? 0.3843 0.3961 0.4390 0.0422  0.0840  -0.0811 406 ASN A CB  
136  C CG  . ASN A 19  ? 0.4143 0.4256 0.4544 0.0396  0.1013  -0.0895 406 ASN A CG  
137  O OD1 . ASN A 19  ? 0.4582 0.4752 0.5133 0.0469  0.1140  -0.0981 406 ASN A OD1 
138  N ND2 . ASN A 19  ? 0.4316 0.4372 0.4423 0.0295  0.1022  -0.0866 406 ASN A ND2 
139  N N   . ALA A 20  ? 0.3947 0.3633 0.4511 0.0612  0.0812  -0.0987 407 ALA A N   
140  C CA  . ALA A 20  ? 0.4302 0.3722 0.4685 0.0608  0.0778  -0.1050 407 ALA A CA  
141  C C   . ALA A 20  ? 0.3693 0.3022 0.4290 0.0693  0.0662  -0.0995 407 ALA A C   
142  O O   . ALA A 20  ? 0.3202 0.2685 0.4093 0.0775  0.0633  -0.0932 407 ALA A O   
143  C CB  . ALA A 20  ? 0.3123 0.2446 0.3381 0.0632  0.0917  -0.1185 407 ALA A CB  
144  N N   . PRO A 21  ? 0.3338 0.2424 0.3788 0.0661  0.0583  -0.1002 408 PRO A N   
145  C CA  . PRO A 21  ? 0.2982 0.1954 0.3629 0.0738  0.0479  -0.0935 408 PRO A CA  
146  C C   . PRO A 21  ? 0.3664 0.2598 0.4582 0.0891  0.0565  -0.1008 408 PRO A C   
147  O O   . PRO A 21  ? 0.3460 0.2343 0.4261 0.0905  0.0684  -0.1119 408 PRO A O   
148  C CB  . PRO A 21  ? 0.3477 0.2168 0.3892 0.0653  0.0411  -0.0956 408 PRO A CB  
149  C CG  . PRO A 21  ? 0.4677 0.3402 0.4785 0.0520  0.0432  -0.0989 408 PRO A CG  
150  C CD  . PRO A 21  ? 0.3804 0.2716 0.3914 0.0543  0.0571  -0.1057 408 PRO A CD  
151  N N   . SER A 22  ? 0.3087 0.2087 0.4294 0.0984  0.0474  -0.0897 409 SER A N   
152  C CA  . SER A 22  ? 0.3930 0.2908 0.5348 0.1114  0.0506  -0.0897 409 SER A CA  
153  C C   . SER A 22  ? 0.4450 0.3069 0.5757 0.1132  0.0489  -0.0948 409 SER A C   
154  O O   . SER A 22  ? 0.4077 0.2484 0.5197 0.1037  0.0417  -0.0946 409 SER A O   
155  C CB  . SER A 22  ? 0.4868 0.4026 0.6608 0.1192  0.0386  -0.0740 409 SER A CB  
156  O OG  . SER A 22  ? 0.3173 0.2155 0.4916 0.1180  0.0231  -0.0626 409 SER A OG  
157  N N   . ASP A 23  ? 0.4645 0.3198 0.6075 0.1251  0.0557  -0.1000 410 ASP A N   
158  C CA  . ASP A 23  ? 0.4311 0.2505 0.5665 0.1285  0.0542  -0.1053 410 ASP A CA  
159  C C   . ASP A 23  ? 0.4733 0.2754 0.6159 0.1261  0.0372  -0.0899 410 ASP A C   
160  O O   . ASP A 23  ? 0.5157 0.2863 0.6403 0.1188  0.0328  -0.0927 410 ASP A O   
161  C CB  . ASP A 23  ? 0.5068 0.3260 0.6623 0.1449  0.0629  -0.1107 410 ASP A CB  
162  C CG  . ASP A 23  ? 0.5729 0.3921 0.7110 0.1462  0.0803  -0.1300 410 ASP A CG  
163  O OD1 . ASP A 23  ? 0.5853 0.4180 0.7029 0.1356  0.0864  -0.1357 410 ASP A OD1 
164  O OD2 . ASP A 23  ? 0.6810 0.4868 0.8255 0.1581  0.0878  -0.1392 410 ASP A OD2 
165  N N   . GLN A 24  ? 0.4405 0.2639 0.6085 0.1309  0.0269  -0.0730 411 GLN A N   
166  C CA  . GLN A 24  ? 0.5182 0.3305 0.6923 0.1278  0.0095  -0.0550 411 GLN A CA  
167  C C   . GLN A 24  ? 0.5384 0.3411 0.6893 0.1119  0.0021  -0.0528 411 GLN A C   
168  O O   . GLN A 24  ? 0.5441 0.3210 0.6868 0.1053  -0.0073 -0.0457 411 GLN A O   
169  C CB  . GLN A 24  ? 0.6303 0.4728 0.8307 0.1340  -0.0011 -0.0374 411 GLN A CB  
170  C CG  . GLN A 24  ? 0.7259 0.5665 0.9521 0.1478  -0.0052 -0.0285 411 GLN A CG  
171  C CD  . GLN A 24  ? 0.8088 0.6710 1.0522 0.1489  -0.0224 -0.0064 411 GLN A CD  
172  O OE1 . GLN A 24  ? 0.8271 0.6911 1.0582 0.1385  -0.0343 0.0053  411 GLN A OE1 
173  N NE2 . GLN A 24  ? 0.7946 0.6745 1.0650 0.1609  -0.0243 -0.0004 411 GLN A NE2 
174  N N   . LEU A 25  ? 0.4410 0.2651 0.5825 0.1055  0.0060  -0.0580 412 LEU A N   
175  C CA  . LEU A 25  ? 0.3655 0.1909 0.4767 0.0878  -0.0004 -0.0528 412 LEU A CA  
176  C C   . LEU A 25  ? 0.3742 0.1700 0.4609 0.0785  0.0042  -0.0664 412 LEU A C   
177  O O   . LEU A 25  ? 0.4516 0.2343 0.5225 0.0661  -0.0052 -0.0589 412 LEU A O   
178  C CB  . LEU A 25  ? 0.4155 0.2736 0.5169 0.0821  0.0039  -0.0537 412 LEU A CB  
179  C CG  . LEU A 25  ? 0.4109 0.2767 0.4859 0.0663  -0.0025 -0.0465 412 LEU A CG  
180  C CD1 . LEU A 25  ? 0.3462 0.2109 0.4225 0.0619  -0.0171 -0.0280 412 LEU A CD1 
181  C CD2 . LEU A 25  ? 0.3531 0.2484 0.4241 0.0637  0.0017  -0.0471 412 LEU A CD2 
182  N N   . ILE A 26  ? 0.4909 0.2779 0.5741 0.0838  0.0189  -0.0864 413 ILE A N   
183  C CA  . ILE A 26  ? 0.4505 0.2092 0.5072 0.0748  0.0237  -0.1020 413 ILE A CA  
184  C C   . ILE A 26  ? 0.4927 0.2169 0.5503 0.0728  0.0145  -0.0973 413 ILE A C   
185  O O   . ILE A 26  ? 0.5557 0.2589 0.5935 0.0583  0.0081  -0.1002 413 ILE A O   
186  C CB  . ILE A 26  ? 0.4915 0.2525 0.5377 0.0816  0.0402  -0.1189 413 ILE A CB  
187  C CG1 . ILE A 26  ? 0.4839 0.2738 0.5182 0.0766  0.0489  -0.1237 413 ILE A CG1 
188  C CG2 . ILE A 26  ? 0.5081 0.2354 0.5280 0.0755  0.0420  -0.1335 413 ILE A CG2 
189  C CD1 . ILE A 26  ? 0.4930 0.2931 0.5222 0.0839  0.0643  -0.1362 413 ILE A CD1 
190  N N   . ASN A 27  ? 0.4943 0.2140 0.5755 0.0863  0.0130  -0.0889 414 ASN A N   
191  C CA  . ASN A 27  ? 0.6608 0.3479 0.7453 0.0853  0.0046  -0.0816 414 ASN A CA  
192  C C   . ASN A 27  ? 0.6252 0.3081 0.7086 0.0716  -0.0122 -0.0634 414 ASN A C   
193  O O   . ASN A 27  ? 0.5659 0.2206 0.6381 0.0604  -0.0184 -0.0617 414 ASN A O   
194  C CB  . ASN A 27  ? 0.7564 0.4452 0.8693 0.1034  0.0047  -0.0730 414 ASN A CB  
195  C CG  . ASN A 27  ? 0.8534 0.5296 0.9649 0.1157  0.0189  -0.0911 414 ASN A CG  
196  O OD1 . ASN A 27  ? 0.9244 0.5704 1.0131 0.1105  0.0237  -0.1061 414 ASN A OD1 
197  N ND2 . ASN A 27  ? 0.8112 0.5113 0.9467 0.1318  0.0249  -0.0898 414 ASN A ND2 
198  N N   . ILE A 28  ? 0.5351 0.2469 0.6288 0.0719  -0.0197 -0.0491 415 ILE A N   
199  C CA  . ILE A 28  ? 0.4932 0.2134 0.5760 0.0570  -0.0330 -0.0289 415 ILE A CA  
200  C C   . ILE A 28  ? 0.5441 0.2635 0.5974 0.0384  -0.0321 -0.0365 415 ILE A C   
201  O O   . ILE A 28  ? 0.5703 0.2748 0.6146 0.0243  -0.0411 -0.0278 415 ILE A O   
202  C CB  . ILE A 28  ? 0.5130 0.2731 0.6029 0.0598  -0.0375 -0.0130 415 ILE A CB  
203  C CG1 . ILE A 28  ? 0.4584 0.2175 0.5762 0.0736  -0.0452 0.0020  415 ILE A CG1 
204  C CG2 . ILE A 28  ? 0.3831 0.1591 0.4541 0.0430  -0.0455 0.0014  415 ILE A CG2 
205  C CD1 . ILE A 28  ? 0.4585 0.2557 0.5821 0.0762  -0.0507 0.0158  415 ILE A CD1 
206  N N   . PHE A 29  ? 0.4992 0.2352 0.5390 0.0378  -0.0218 -0.0516 416 PHE A N   
207  C CA  . PHE A 29  ? 0.4910 0.2275 0.5035 0.0216  -0.0213 -0.0597 416 PHE A CA  
208  C C   . PHE A 29  ? 0.5209 0.2179 0.5222 0.0122  -0.0240 -0.0703 416 PHE A C   
209  O O   . PHE A 29  ? 0.5242 0.2174 0.5105 -0.0052 -0.0322 -0.0659 416 PHE A O   
210  C CB  . PHE A 29  ? 0.4068 0.1608 0.4075 0.0248  -0.0088 -0.0755 416 PHE A CB  
211  C CG  . PHE A 29  ? 0.4342 0.2265 0.4392 0.0278  -0.0075 -0.0659 416 PHE A CG  
212  C CD1 . PHE A 29  ? 0.3459 0.1561 0.3598 0.0260  -0.0169 -0.0465 416 PHE A CD1 
213  C CD2 . PHE A 29  ? 0.3848 0.1940 0.3835 0.0315  0.0037  -0.0766 416 PHE A CD2 
214  C CE1 . PHE A 29  ? 0.3497 0.1918 0.3660 0.0285  -0.0155 -0.0403 416 PHE A CE1 
215  C CE2 . PHE A 29  ? 0.3281 0.1685 0.3312 0.0333  0.0044  -0.0685 416 PHE A CE2 
216  C CZ  . PHE A 29  ? 0.3790 0.2348 0.3909 0.0320  -0.0053 -0.0514 416 PHE A CZ  
217  N N   . GLU A 30  ? 0.4938 0.1614 0.5039 0.0236  -0.0172 -0.0849 417 GLU A N   
218  C CA  . GLU A 30  ? 0.6333 0.2624 0.6294 0.0151  -0.0168 -0.0989 417 GLU A CA  
219  C C   . GLU A 30  ? 0.6244 0.2297 0.6311 0.0085  -0.0277 -0.0835 417 GLU A C   
220  O O   . GLU A 30  ? 0.6938 0.2733 0.6883 -0.0036 -0.0286 -0.0912 417 GLU A O   
221  C CB  . GLU A 30  ? 0.6472 0.2638 0.6390 0.0292  0.0002  -0.1176 417 GLU A CB  
222  C CG  . GLU A 30  ? 0.6905 0.3258 0.6608 0.0300  0.0102  -0.1341 417 GLU A CG  
223  C CD  . GLU A 30  ? 0.7960 0.4284 0.7648 0.0470  0.0225  -0.1489 417 GLU A CD  
224  O OE1 . GLU A 30  ? 0.7869 0.4301 0.7360 0.0449  0.0287  -0.1646 417 GLU A OE1 
225  O OE2 . GLU A 30  ? 0.9033 0.5269 0.8941 0.0621  0.0257  -0.1442 417 GLU A OE2 
226  N N   . SER A 31  ? 0.6382 0.2538 0.6670 0.0153  -0.0360 -0.0614 418 SER A N   
227  C CA  . SER A 31  ? 0.6394 0.2365 0.6767 0.0078  -0.0467 -0.0430 418 SER A CA  
228  C C   . SER A 31  ? 0.7063 0.3128 0.7319 -0.0143 -0.0597 -0.0287 418 SER A C   
229  O O   . SER A 31  ? 0.7982 0.3939 0.8278 -0.0251 -0.0683 -0.0124 418 SER A O   
230  C CB  . SER A 31  ? 0.6133 0.2194 0.6762 0.0231  -0.0505 -0.0232 418 SER A CB  
231  O OG  . SER A 31  ? 0.6798 0.3178 0.7475 0.0220  -0.0584 -0.0060 418 SER A OG  
232  N N   . CYS A 32  ? 0.6394 0.2765 0.6494 -0.0206 -0.0573 -0.0332 419 CYS A N   
233  C CA  . CYS A 32  ? 0.6021 0.2606 0.6006 -0.0404 -0.0650 -0.0203 419 CYS A CA  
234  C C   . CYS A 32  ? 0.6126 0.2485 0.5934 -0.0592 -0.0692 -0.0330 419 CYS A C   
235  O O   . CYS A 32  ? 0.6056 0.2265 0.5721 -0.0575 -0.0628 -0.0562 419 CYS A O   
236  C CB  . CYS A 32  ? 0.5418 0.2461 0.5330 -0.0380 -0.0598 -0.0186 419 CYS A CB  
237  S SG  . CYS A 32  ? 0.6370 0.3731 0.6452 -0.0215 -0.0577 -0.0023 419 CYS A SG  
238  N N   . VAL A 33  ? 0.6086 0.2438 0.5898 -0.0781 -0.0799 -0.0174 420 VAL A N   
239  C CA  . VAL A 33  ? 0.6405 0.2661 0.6066 -0.0991 -0.0858 -0.0261 420 VAL A CA  
240  C C   . VAL A 33  ? 0.6074 0.2589 0.5544 -0.1016 -0.0819 -0.0395 420 VAL A C   
241  O O   . VAL A 33  ? 0.6622 0.2994 0.5916 -0.1086 -0.0811 -0.0591 420 VAL A O   
242  C CB  . VAL A 33  ? 0.6758 0.3154 0.6496 -0.1187 -0.0962 -0.0030 420 VAL A CB  
243  C CG1 . VAL A 33  ? 0.7417 0.3865 0.7029 -0.1389 -0.1015 -0.0112 420 VAL A CG1 
244  C CG2 . VAL A 33  ? 0.7349 0.3516 0.7249 -0.1169 -0.0982 0.0101  420 VAL A CG2 
245  N N   . ARG A 34  ? 0.5828 0.2774 0.5336 -0.0946 -0.0779 -0.0285 421 ARG A N   
246  C CA  . ARG A 34  ? 0.6343 0.3548 0.5699 -0.0930 -0.0727 -0.0390 421 ARG A CA  
247  C C   . ARG A 34  ? 0.5606 0.2943 0.5006 -0.0711 -0.0606 -0.0442 421 ARG A C   
248  O O   . ARG A 34  ? 0.4959 0.2551 0.4490 -0.0624 -0.0587 -0.0298 421 ARG A O   
249  C CB  . ARG A 34  ? 0.4508 0.2109 0.3882 -0.1049 -0.0787 -0.0230 421 ARG A CB  
250  C CG  . ARG A 34  ? 0.4751 0.2272 0.4119 -0.1282 -0.0912 -0.0168 421 ARG A CG  
251  C CD  . ARG A 34  ? 0.4480 0.2431 0.3916 -0.1387 -0.0961 -0.0003 421 ARG A CD  
252  N NE  . ARG A 34  ? 0.4594 0.2796 0.4208 -0.1318 -0.0926 0.0200  421 ARG A NE  
253  C CZ  . ARG A 34  ? 0.5164 0.3297 0.4907 -0.1395 -0.0968 0.0360  421 ARG A CZ  
254  N NH1 . ARG A 34  ? 0.5564 0.3357 0.5303 -0.1543 -0.1051 0.0344  421 ARG A NH1 
255  N NH2 . ARG A 34  ? 0.4683 0.3072 0.4541 -0.1331 -0.0925 0.0535  421 ARG A NH2 
256  N N   . ASN A 35  ? 0.5908 0.3075 0.5188 -0.0634 -0.0521 -0.0653 422 ASN A N   
257  C CA  . ASN A 35  ? 0.5488 0.2768 0.4822 -0.0440 -0.0397 -0.0719 422 ASN A CA  
258  C C   . ASN A 35  ? 0.5124 0.2789 0.4390 -0.0435 -0.0365 -0.0676 422 ASN A C   
259  O O   . ASN A 35  ? 0.5311 0.3027 0.4377 -0.0521 -0.0364 -0.0762 422 ASN A O   
260  C CB  . ASN A 35  ? 0.6015 0.3007 0.5238 -0.0374 -0.0300 -0.0965 422 ASN A CB  
261  C CG  . ASN A 35  ? 0.6045 0.3159 0.5368 -0.0175 -0.0160 -0.1030 422 ASN A CG  
262  O OD1 . ASN A 35  ? 0.5584 0.3014 0.5007 -0.0110 -0.0142 -0.0914 422 ASN A OD1 
263  N ND2 . ASN A 35  ? 0.7017 0.3880 0.6324 -0.0081 -0.0057 -0.1224 422 ASN A ND2 
264  N N   . PRO A 36  ? 0.3815 0.1738 0.3240 -0.0335 -0.0345 -0.0542 423 PRO A N   
265  C CA  . PRO A 36  ? 0.3519 0.1787 0.2922 -0.0316 -0.0317 -0.0484 423 PRO A CA  
266  C C   . PRO A 36  ? 0.4187 0.2517 0.3505 -0.0231 -0.0206 -0.0615 423 PRO A C   
267  O O   . PRO A 36  ? 0.4641 0.3214 0.3916 -0.0237 -0.0192 -0.0571 423 PRO A O   
268  C CB  . PRO A 36  ? 0.3294 0.1730 0.2888 -0.0231 -0.0329 -0.0331 423 PRO A CB  
269  C CG  . PRO A 36  ? 0.3411 0.1612 0.3133 -0.0135 -0.0316 -0.0358 423 PRO A CG  
270  C CD  . PRO A 36  ? 0.3782 0.1651 0.3420 -0.0229 -0.0354 -0.0443 423 PRO A CD  
271  N N   . VAL A 37  ? 0.4591 0.2718 0.3905 -0.0150 -0.0122 -0.0763 424 VAL A N   
272  C CA  . VAL A 37  ? 0.5001 0.3226 0.4295 -0.0051 0.0006  -0.0863 424 VAL A CA  
273  C C   . VAL A 37  ? 0.4621 0.2993 0.3691 -0.0132 0.0031  -0.0896 424 VAL A C   
274  O O   . VAL A 37  ? 0.4400 0.2966 0.3495 -0.0075 0.0101  -0.0878 424 VAL A O   
275  C CB  . VAL A 37  ? 0.4769 0.2741 0.4073 0.0037  0.0110  -0.1043 424 VAL A CB  
276  C CG1 . VAL A 37  ? 0.4280 0.1984 0.3328 -0.0076 0.0101  -0.1195 424 VAL A CG1 
277  C CG2 . VAL A 37  ? 0.3792 0.1921 0.3135 0.0146  0.0258  -0.1121 424 VAL A CG2 
278  N N   . GLU A 38  ? 0.4553 0.2835 0.3413 -0.0274 -0.0040 -0.0928 425 GLU A N   
279  C CA  . GLU A 38  ? 0.4451 0.2867 0.3089 -0.0356 -0.0039 -0.0940 425 GLU A CA  
280  C C   . GLU A 38  ? 0.3686 0.2386 0.2404 -0.0381 -0.0112 -0.0760 425 GLU A C   
281  O O   . GLU A 38  ? 0.4206 0.3075 0.2867 -0.0365 -0.0072 -0.0729 425 GLU A O   
282  C CB  . GLU A 38  ? 0.5692 0.3925 0.4067 -0.0509 -0.0108 -0.1039 425 GLU A CB  
283  C CG  . GLU A 38  ? 0.8175 0.6142 0.6374 -0.0488 -0.0002 -0.1263 425 GLU A CG  
284  C CD  . GLU A 38  ? 0.9947 0.8029 0.7994 -0.0438 0.0136  -0.1338 425 GLU A CD  
285  O OE1 . GLU A 38  ? 1.1136 0.9247 0.8893 -0.0549 0.0115  -0.1380 425 GLU A OE1 
286  O OE2 . GLU A 38  ? 0.9797 0.7963 0.8027 -0.0295 0.0257  -0.1339 425 GLU A OE2 
287  N N   . ASN A 39  ? 0.3670 0.2418 0.2526 -0.0419 -0.0211 -0.0640 426 ASN A N   
288  C CA  . ASN A 39  ? 0.3740 0.2759 0.2694 -0.0428 -0.0263 -0.0483 426 ASN A CA  
289  C C   . ASN A 39  ? 0.3925 0.3091 0.3036 -0.0293 -0.0186 -0.0436 426 ASN A C   
290  O O   . ASN A 39  ? 0.3769 0.3132 0.2909 -0.0274 -0.0185 -0.0360 426 ASN A O   
291  C CB  . ASN A 39  ? 0.3423 0.2477 0.2488 -0.0506 -0.0367 -0.0370 426 ASN A CB  
292  C CG  . ASN A 39  ? 0.5448 0.4382 0.4374 -0.0667 -0.0464 -0.0404 426 ASN A CG  
293  O OD1 . ASN A 39  ? 0.5521 0.4408 0.4242 -0.0730 -0.0472 -0.0491 426 ASN A OD1 
294  N ND2 . ASN A 39  ? 0.5868 0.4754 0.4894 -0.0750 -0.0543 -0.0331 426 ASN A ND2 
295  N N   . ILE A 40  ? 0.3832 0.2895 0.3056 -0.0200 -0.0130 -0.0484 427 ILE A N   
296  C CA  . ILE A 40  ? 0.2983 0.2180 0.2355 -0.0085 -0.0069 -0.0454 427 ILE A CA  
297  C C   . ILE A 40  ? 0.3613 0.2868 0.2905 -0.0057 0.0022  -0.0519 427 ILE A C   
298  O O   . ILE A 40  ? 0.3595 0.3014 0.2941 -0.0027 0.0038  -0.0460 427 ILE A O   
299  C CB  . ILE A 40  ? 0.2903 0.1991 0.2430 0.0004  -0.0046 -0.0480 427 ILE A CB  
300  C CG1 . ILE A 40  ? 0.2782 0.1850 0.2397 -0.0024 -0.0139 -0.0368 427 ILE A CG1 
301  C CG2 . ILE A 40  ? 0.2593 0.1822 0.2262 0.0110  0.0017  -0.0476 427 ILE A CG2 
302  C CD1 . ILE A 40  ? 0.2642 0.1569 0.2403 0.0056  -0.0142 -0.0369 427 ILE A CD1 
303  N N   . MET A 41  ? 0.2835 0.1948 0.1991 -0.0073 0.0085  -0.0643 428 MET A N   
304  C CA  . MET A 41  ? 0.3129 0.2300 0.2168 -0.0070 0.0179  -0.0696 428 MET A CA  
305  C C   . MET A 41  ? 0.3596 0.2904 0.2518 -0.0143 0.0126  -0.0599 428 MET A C   
306  O O   . MET A 41  ? 0.3615 0.3040 0.2555 -0.0117 0.0177  -0.0559 428 MET A O   
307  C CB  . MET A 41  ? 0.4377 0.3369 0.3224 -0.0099 0.0253  -0.0851 428 MET A CB  
308  C CG  . MET A 41  ? 0.5957 0.4832 0.4948 0.0008  0.0352  -0.0962 428 MET A CG  
309  S SD  . MET A 41  ? 1.1663 1.0287 1.0413 -0.0020 0.0448  -0.1177 428 MET A SD  
310  C CE  . MET A 41  ? 0.9608 0.8380 0.8103 -0.0079 0.0551  -0.1200 428 MET A CE  
311  N N   . LYS A 42  ? 0.3832 0.3126 0.2655 -0.0236 0.0018  -0.0554 429 LYS A N   
312  C CA  . LYS A 42  ? 0.3301 0.2738 0.2046 -0.0298 -0.0051 -0.0448 429 LYS A CA  
313  C C   . LYS A 42  ? 0.3118 0.2730 0.2067 -0.0227 -0.0063 -0.0328 429 LYS A C   
314  O O   . LYS A 42  ? 0.3068 0.2779 0.2000 -0.0219 -0.0054 -0.0262 429 LYS A O   
315  C CB  . LYS A 42  ? 0.3354 0.2771 0.2008 -0.0414 -0.0177 -0.0418 429 LYS A CB  
316  C CG  . LYS A 42  ? 0.3244 0.2505 0.1618 -0.0517 -0.0186 -0.0534 429 LYS A CG  
317  C CD  . LYS A 42  ? 0.4315 0.3567 0.2616 -0.0653 -0.0333 -0.0500 429 LYS A CD  
318  C CE  . LYS A 42  ? 0.4292 0.3367 0.2274 -0.0770 -0.0351 -0.0639 429 LYS A CE  
319  N NZ  . LYS A 42  ? 0.5695 0.4756 0.3611 -0.0926 -0.0511 -0.0614 429 LYS A NZ  
320  N N   . ILE A 43  ? 0.2311 0.1948 0.1439 -0.0179 -0.0082 -0.0300 430 ILE A N   
321  C CA  . ILE A 43  ? 0.2366 0.2149 0.1663 -0.0107 -0.0078 -0.0220 430 ILE A CA  
322  C C   . ILE A 43  ? 0.3269 0.3065 0.2613 -0.0038 0.0011  -0.0253 430 ILE A C   
323  O O   . ILE A 43  ? 0.2990 0.2874 0.2374 -0.0014 0.0018  -0.0195 430 ILE A O   
324  C CB  . ILE A 43  ? 0.2189 0.1987 0.1625 -0.0077 -0.0105 -0.0195 430 ILE A CB  
325  C CG1 . ILE A 43  ? 0.2453 0.2290 0.1883 -0.0158 -0.0192 -0.0125 430 ILE A CG1 
326  C CG2 . ILE A 43  ? 0.2645 0.2571 0.2215 0.0001  -0.0081 -0.0152 430 ILE A CG2 
327  C CD1 . ILE A 43  ? 0.1992 0.1826 0.1526 -0.0155 -0.0218 -0.0084 430 ILE A CD1 
328  N N   . LEU A 44  ? 0.3561 0.3269 0.2919 -0.0005 0.0080  -0.0343 431 LEU A N   
329  C CA  . LEU A 44  ? 0.3558 0.3304 0.2988 0.0044  0.0166  -0.0371 431 LEU A CA  
330  C C   . LEU A 44  ? 0.3701 0.3459 0.2992 -0.0003 0.0208  -0.0352 431 LEU A C   
331  O O   . LEU A 44  ? 0.2045 0.1861 0.1400 0.0015  0.0245  -0.0314 431 LEU A O   
332  C CB  . LEU A 44  ? 0.3107 0.2788 0.2609 0.0090  0.0236  -0.0466 431 LEU A CB  
333  C CG  . LEU A 44  ? 0.4266 0.3932 0.3928 0.0146  0.0194  -0.0467 431 LEU A CG  
334  C CD1 . LEU A 44  ? 0.5511 0.5171 0.5318 0.0216  0.0269  -0.0540 431 LEU A CD1 
335  C CD2 . LEU A 44  ? 0.3465 0.3244 0.3227 0.0166  0.0130  -0.0385 431 LEU A CD2 
336  N N   . LYS A 45  ? 0.2937 0.2630 0.2024 -0.0073 0.0194  -0.0373 432 LYS A N   
337  C CA  . LYS A 45  ? 0.3403 0.3111 0.2313 -0.0132 0.0217  -0.0335 432 LYS A CA  
338  C C   . LYS A 45  ? 0.3225 0.3024 0.2172 -0.0138 0.0135  -0.0196 432 LYS A C   
339  O O   . LYS A 45  ? 0.3242 0.3071 0.2175 -0.0142 0.0165  -0.0130 432 LYS A O   
340  C CB  . LYS A 45  ? 0.3902 0.3519 0.2551 -0.0217 0.0202  -0.0399 432 LYS A CB  
341  C CG  . LYS A 45  ? 0.5178 0.4806 0.3591 -0.0286 0.0244  -0.0374 432 LYS A CG  
342  C CD  . LYS A 45  ? 0.5909 0.5442 0.4021 -0.0384 0.0219  -0.0455 432 LYS A CD  
343  C CE  . LYS A 45  ? 0.7066 0.6628 0.4901 -0.0463 0.0255  -0.0414 432 LYS A CE  
344  N NZ  . LYS A 45  ? 0.7727 0.7199 0.5219 -0.0575 0.0220  -0.0503 432 LYS A NZ  
345  N N   . GLY A 46  ? 0.2425 0.2271 0.1440 -0.0138 0.0037  -0.0147 433 GLY A N   
346  C CA  . GLY A 46  ? 0.2713 0.2663 0.1812 -0.0121 -0.0032 -0.0022 433 GLY A CA  
347  C C   . GLY A 46  ? 0.3345 0.3324 0.2632 -0.0034 0.0015  -0.0003 433 GLY A C   
348  O O   . GLY A 46  ? 0.2794 0.2790 0.2112 -0.0016 0.0013  0.0076  433 GLY A O   
349  N N   . ILE A 47  ? 0.2489 0.2460 0.1896 0.0015  0.0049  -0.0075 434 ILE A N   
350  C CA  . ILE A 47  ? 0.1831 0.1823 0.1394 0.0082  0.0084  -0.0084 434 ILE A CA  
351  C C   . ILE A 47  ? 0.2466 0.2408 0.2025 0.0072  0.0155  -0.0094 434 ILE A C   
352  O O   . ILE A 47  ? 0.2742 0.2676 0.2382 0.0097  0.0164  -0.0056 434 ILE A O   
353  C CB  . ILE A 47  ? 0.1709 0.1710 0.1365 0.0118  0.0092  -0.0154 434 ILE A CB  
354  C CG1 . ILE A 47  ? 0.2036 0.2105 0.1724 0.0127  0.0030  -0.0118 434 ILE A CG1 
355  C CG2 . ILE A 47  ? 0.1596 0.1606 0.1375 0.0162  0.0128  -0.0188 434 ILE A CG2 
356  C CD1 . ILE A 47  ? 0.1536 0.1620 0.1298 0.0157  0.0026  -0.0158 434 ILE A CD1 
357  N N   . GLY A 48  ? 0.3090 0.2994 0.2557 0.0033  0.0213  -0.0149 435 GLY A N   
358  C CA  . GLY A 48  ? 0.2805 0.2692 0.2267 0.0008  0.0298  -0.0153 435 GLY A CA  
359  C C   . GLY A 48  ? 0.3277 0.3143 0.2642 -0.0034 0.0290  -0.0043 435 GLY A C   
360  O O   . GLY A 48  ? 0.3560 0.3408 0.3001 -0.0041 0.0331  -0.0004 435 GLY A O   
361  N N   . GLU A 49  ? 0.3044 0.2911 0.2248 -0.0071 0.0228  0.0016  436 GLU A N   
362  C CA  . GLU A 49  ? 0.3024 0.2880 0.2127 -0.0112 0.0199  0.0147  436 GLU A CA  
363  C C   . GLU A 49  ? 0.2587 0.2440 0.1871 -0.0047 0.0145  0.0236  436 GLU A C   
364  O O   . GLU A 49  ? 0.3346 0.3144 0.2661 -0.0054 0.0164  0.0320  436 GLU A O   
365  C CB  . GLU A 49  ? 0.3138 0.3018 0.2027 -0.0173 0.0120  0.0192  436 GLU A CB  
366  C CG  . GLU A 49  ? 0.5862 0.5750 0.4651 -0.0212 0.0060  0.0357  436 GLU A CG  
367  C CD  . GLU A 49  ? 0.7400 0.7329 0.5947 -0.0296 -0.0032 0.0400  436 GLU A CD  
368  O OE1 . GLU A 49  ? 0.8406 0.8334 0.6858 -0.0330 -0.0042 0.0286  436 GLU A OE1 
369  O OE2 . GLU A 49  ? 0.7304 0.7257 0.5756 -0.0333 -0.0105 0.0553  436 GLU A OE2 
370  N N   . THR A 50  ? 0.2415 0.2319 0.1820 0.0015  0.0086  0.0217  437 THR A N   
371  C CA  . THR A 50  ? 0.2925 0.2831 0.2507 0.0094  0.0052  0.0274  437 THR A CA  
372  C C   . THR A 50  ? 0.2645 0.2467 0.2359 0.0126  0.0118  0.0218  437 THR A C   
373  O O   . THR A 50  ? 0.2154 0.1898 0.1960 0.0159  0.0114  0.0281  437 THR A O   
374  C CB  . THR A 50  ? 0.1974 0.1982 0.1655 0.0151  0.0003  0.0247  437 THR A CB  
375  O OG1 . THR A 50  ? 0.3005 0.3098 0.2589 0.0104  -0.0073 0.0310  437 THR A OG1 
376  C CG2 . THR A 50  ? 0.1945 0.1962 0.1810 0.0247  -0.0006 0.0283  437 THR A CG2 
377  N N   . PHE A 51  ? 0.2662 0.2492 0.2394 0.0114  0.0169  0.0102  438 PHE A N   
378  C CA  . PHE A 51  ? 0.2832 0.2608 0.2687 0.0120  0.0218  0.0039  438 PHE A CA  
379  C C   . PHE A 51  ? 0.2876 0.2570 0.2716 0.0059  0.0264  0.0109  438 PHE A C   
380  O O   . PHE A 51  ? 0.2957 0.2557 0.2907 0.0067  0.0268  0.0128  438 PHE A O   
381  C CB  . PHE A 51  ? 0.1915 0.1749 0.1798 0.0110  0.0250  -0.0073 438 PHE A CB  
382  C CG  . PHE A 51  ? 0.2153 0.1966 0.2164 0.0087  0.0293  -0.0126 438 PHE A CG  
383  C CD1 . PHE A 51  ? 0.2240 0.2019 0.2364 0.0119  0.0264  -0.0175 438 PHE A CD1 
384  C CD2 . PHE A 51  ? 0.2189 0.2028 0.2207 0.0027  0.0363  -0.0135 438 PHE A CD2 
385  C CE1 . PHE A 51  ? 0.2518 0.2282 0.2761 0.0078  0.0284  -0.0228 438 PHE A CE1 
386  C CE2 . PHE A 51  ? 0.2831 0.2683 0.3002 -0.0007 0.0395  -0.0174 438 PHE A CE2 
387  C CZ  . PHE A 51  ? 0.2143 0.1953 0.2427 0.0012  0.0344  -0.0219 438 PHE A CZ  
388  N N   . CYS A 52  ? 0.2612 0.2332 0.2306 -0.0009 0.0303  0.0144  439 CYS A N   
389  C CA  . CYS A 52  ? 0.2585 0.2250 0.2236 -0.0084 0.0359  0.0230  439 CYS A CA  
390  C C   . CYS A 52  ? 0.2701 0.2269 0.2341 -0.0078 0.0303  0.0382  439 CYS A C   
391  O O   . CYS A 52  ? 0.3810 0.3278 0.3519 -0.0115 0.0330  0.0452  439 CYS A O   
392  C CB  . CYS A 52  ? 0.2995 0.2723 0.2447 -0.0155 0.0424  0.0228  439 CYS A CB  
393  S SG  . CYS A 52  ? 0.4396 0.4219 0.3931 -0.0161 0.0530  0.0071  439 CYS A SG  
394  N N   . GLN A 53  ? 0.2636 0.2234 0.2213 -0.0034 0.0219  0.0443  440 GLN A N   
395  C CA  . GLN A 53  ? 0.2698 0.2224 0.2299 -0.0008 0.0150  0.0603  440 GLN A CA  
396  C C   . GLN A 53  ? 0.2687 0.2088 0.2517 0.0072  0.0145  0.0591  440 GLN A C   
397  O O   . GLN A 53  ? 0.3345 0.2609 0.3232 0.0064  0.0138  0.0704  440 GLN A O   
398  C CB  . GLN A 53  ? 0.4876 0.4505 0.4419 0.0031  0.0053  0.0661  440 GLN A CB  
399  C CG  . GLN A 53  ? 0.4108 0.3823 0.3390 -0.0061 0.0033  0.0692  440 GLN A CG  
400  C CD  . GLN A 53  ? 0.4928 0.4759 0.4185 -0.0038 -0.0080 0.0735  440 GLN A CD  
401  O OE1 . GLN A 53  ? 0.5691 0.5580 0.5128 0.0047  -0.0112 0.0691  440 GLN A OE1 
402  N NE2 . GLN A 53  ? 0.5678 0.5560 0.4709 -0.0122 -0.0142 0.0823  440 GLN A NE2 
403  N N   . HIS A 54  ? 0.2803 0.2241 0.2751 0.0143  0.0148  0.0451  441 HIS A N   
404  C CA  . HIS A 54  ? 0.3148 0.2464 0.3280 0.0218  0.0151  0.0398  441 HIS A CA  
405  C C   . HIS A 54  ? 0.2594 0.1788 0.2786 0.0148  0.0208  0.0337  441 HIS A C   
406  O O   . HIS A 54  ? 0.2873 0.1889 0.3181 0.0164  0.0207  0.0356  441 HIS A O   
407  C CB  . HIS A 54  ? 0.3115 0.2531 0.3310 0.0302  0.0144  0.0266  441 HIS A CB  
408  C CG  . HIS A 54  ? 0.3333 0.2848 0.3564 0.0388  0.0090  0.0335  441 HIS A CG  
409  N ND1 . HIS A 54  ? 0.3352 0.2806 0.3740 0.0499  0.0079  0.0356  441 HIS A ND1 
410  C CD2 . HIS A 54  ? 0.2514 0.2193 0.2663 0.0376  0.0045  0.0385  441 HIS A CD2 
411  C CE1 . HIS A 54  ? 0.3359 0.2970 0.3785 0.0557  0.0033  0.0427  441 HIS A CE1 
412  N NE2 . HIS A 54  ? 0.2409 0.2157 0.2687 0.0473  0.0004  0.0449  441 HIS A NE2 
413  N N   . TYR A 55  ? 0.2490 0.1779 0.2623 0.0071  0.0256  0.0265  442 TYR A N   
414  C CA  . TYR A 55  ? 0.2533 0.1766 0.2754 -0.0008 0.0306  0.0209  442 TYR A CA  
415  C C   . TYR A 55  ? 0.3280 0.2378 0.3506 -0.0090 0.0331  0.0352  442 TYR A C   
416  O O   . TYR A 55  ? 0.2989 0.1940 0.3344 -0.0129 0.0339  0.0341  442 TYR A O   
417  C CB  . TYR A 55  ? 0.2576 0.1979 0.2757 -0.0061 0.0355  0.0129  442 TYR A CB  
418  C CG  . TYR A 55  ? 0.3468 0.2883 0.3783 -0.0138 0.0400  0.0063  442 TYR A CG  
419  C CD1 . TYR A 55  ? 0.2279 0.1743 0.2704 -0.0116 0.0371  -0.0073 442 TYR A CD1 
420  C CD2 . TYR A 55  ? 0.3519 0.2922 0.3851 -0.0244 0.0467  0.0148  442 TYR A CD2 
421  C CE1 . TYR A 55  ? 0.3021 0.2528 0.3591 -0.0197 0.0393  -0.0126 442 TYR A CE1 
422  C CE2 . TYR A 55  ? 0.3237 0.2690 0.3729 -0.0326 0.0506  0.0096  442 TYR A CE2 
423  C CZ  . TYR A 55  ? 0.3114 0.2621 0.3736 -0.0302 0.0462  -0.0042 442 TYR A CZ  
424  O OH  . TYR A 55  ? 0.3331 0.2914 0.4135 -0.0392 0.0483  -0.0085 442 TYR A OH  
425  N N   . THR A 56  ? 0.2866 0.2005 0.2939 -0.0125 0.0337  0.0491  443 THR A N   
426  C CA  . THR A 56  ? 0.3979 0.3017 0.4011 -0.0221 0.0367  0.0653  443 THR A CA  
427  C C   . THR A 56  ? 0.4177 0.3024 0.4255 -0.0172 0.0296  0.0807  443 THR A C   
428  O O   . THR A 56  ? 0.5231 0.3967 0.5277 -0.0250 0.0306  0.0973  443 THR A O   
429  C CB  . THR A 56  ? 0.3522 0.2704 0.3323 -0.0298 0.0416  0.0731  443 THR A CB  
430  O OG1 . THR A 56  ? 0.3791 0.3047 0.3448 -0.0232 0.0344  0.0757  443 THR A OG1 
431  C CG2 . THR A 56  ? 0.3032 0.2378 0.2829 -0.0345 0.0510  0.0589  443 THR A CG2 
432  N N   . GLN A 57  ? 0.5089 0.3902 0.5254 -0.0040 0.0228  0.0763  444 GLN A N   
433  C CA  . GLN A 57  ? 0.5532 0.4173 0.5788 0.0040  0.0160  0.0903  444 GLN A CA  
434  C C   . GLN A 57  ? 0.5578 0.4026 0.6051 0.0127  0.0157  0.0787  444 GLN A C   
435  O O   . GLN A 57  ? 0.5486 0.4002 0.6006 0.0178  0.0175  0.0596  444 GLN A O   
436  C CB  . GLN A 57  ? 0.5826 0.4611 0.6018 0.0131  0.0084  0.0979  444 GLN A CB  
437  C CG  . GLN A 57  ? 0.7193 0.6114 0.7143 0.0037  0.0064  0.1120  444 GLN A CG  
438  C CD  . GLN A 57  ? 0.8053 0.7142 0.7939 0.0102  -0.0027 0.1176  444 GLN A CD  
439  O OE1 . GLN A 57  ? 0.8957 0.8032 0.9012 0.0225  -0.0094 0.1219  444 GLN A OE1 
440  N NE2 . GLN A 57  ? 0.7455 0.6708 0.7107 0.0019  -0.0028 0.1169  444 GLN A NE2 
441  N N   . SER A 58  ? 0.6945 0.5137 0.7536 0.0142  0.0134  0.0902  445 SER A N   
442  C CA  . SER A 58  ? 0.7408 0.5356 0.8191 0.0210  0.0140  0.0779  445 SER A CA  
443  C C   . SER A 58  ? 0.7524 0.5413 0.8440 0.0403  0.0099  0.0775  445 SER A C   
444  O O   . SER A 58  ? 0.7733 0.5598 0.8686 0.0469  0.0043  0.0969  445 SER A O   
445  C CB  . SER A 58  ? 0.7690 0.5346 0.8554 0.0109  0.0146  0.0888  445 SER A CB  
446  O OG  . SER A 58  ? 0.8190 0.5797 0.9003 0.0088  0.0105  0.1157  445 SER A OG  
447  N N   . THR A 59  ? 0.7739 0.5625 0.8728 0.0491  0.0129  0.0555  446 THR A N   
448  C CA  . THR A 59  ? 0.9179 0.7062 1.0302 0.0683  0.0123  0.0508  446 THR A CA  
449  C C   . THR A 59  ? 1.0367 0.7905 1.1680 0.0782  0.0140  0.0441  446 THR A C   
450  O O   . THR A 59  ? 1.1472 0.9009 1.2912 0.0954  0.0159  0.0368  446 THR A O   
451  C CB  . THR A 59  ? 0.9120 0.7239 1.0183 0.0732  0.0161  0.0303  446 THR A CB  
452  O OG1 . THR A 59  ? 0.9750 0.7803 1.0750 0.0636  0.0199  0.0110  446 THR A OG1 
453  C CG2 . THR A 59  ? 0.7919 0.6364 0.8842 0.0688  0.0135  0.0381  446 THR A CG2 
454  N N   . ASP A 60  ? 0.9608 0.6860 1.0944 0.0669  0.0140  0.0459  447 ASP A N   
455  C CA  . ASP A 60  ? 0.9933 0.6854 1.1357 0.0701  0.0148  0.0348  447 ASP A CA  
456  C C   . ASP A 60  ? 0.9769 0.6649 1.1140 0.0680  0.0194  0.0046  447 ASP A C   
457  O O   . ASP A 60  ? 1.0500 0.7119 1.1867 0.0633  0.0192  -0.0061 447 ASP A O   
458  C CB  . ASP A 60  ? 1.0155 0.7029 1.1675 0.0894  0.0128  0.0392  447 ASP A CB  
459  C CG  . ASP A 60  ? 1.0556 0.7232 1.2131 0.0883  0.0067  0.0626  447 ASP A CG  
460  O OD1 . ASP A 60  ? 1.0789 0.7403 1.2304 0.0720  0.0043  0.0783  447 ASP A OD1 
461  O OD2 . ASP A 60  ? 1.0829 0.7424 1.2506 0.1037  0.0049  0.0658  447 ASP A OD2 
462  N N   . GLU A 61  ? 0.8800 0.5934 1.0111 0.0705  0.0229  -0.0087 448 GLU A N   
463  C CA  . GLU A 61  ? 0.8467 0.5605 0.9682 0.0644  0.0255  -0.0349 448 GLU A CA  
464  C C   . GLU A 61  ? 0.7870 0.5171 0.8983 0.0454  0.0237  -0.0355 448 GLU A C   
465  O O   . GLU A 61  ? 0.7643 0.4923 0.8703 0.0362  0.0233  -0.0537 448 GLU A O   
466  C CB  . GLU A 61  ? 0.8152 0.5513 0.9302 0.0784  0.0297  -0.0498 448 GLU A CB  
467  C CG  . GLU A 61  ? 0.9068 0.6400 1.0293 0.0974  0.0316  -0.0461 448 GLU A CG  
468  C CD  . GLU A 61  ? 0.9976 0.7560 1.1144 0.1098  0.0373  -0.0593 448 GLU A CD  
469  O OE1 . GLU A 61  ? 1.0000 0.7796 1.1060 0.1038  0.0388  -0.0681 448 GLU A OE1 
470  O OE2 . GLU A 61  ? 1.0043 0.7620 1.1276 0.1254  0.0403  -0.0603 448 GLU A OE2 
471  N N   . GLN A 62  ? 0.7552 0.5044 0.8623 0.0395  0.0220  -0.0153 449 GLN A N   
472  C CA  . GLN A 62  ? 0.7742 0.5466 0.8710 0.0245  0.0218  -0.0145 449 GLN A CA  
473  C C   . GLN A 62  ? 0.8161 0.5893 0.9123 0.0133  0.0216  0.0080  449 GLN A C   
474  O O   . GLN A 62  ? 0.8985 0.6889 0.9871 0.0167  0.0211  0.0227  449 GLN A O   
475  C CB  . GLN A 62  ? 0.7848 0.5908 0.8699 0.0304  0.0224  -0.0192 449 GLN A CB  
476  C CG  . GLN A 62  ? 0.7893 0.6179 0.8663 0.0176  0.0226  -0.0210 449 GLN A CG  
477  C CD  . GLN A 62  ? 0.7755 0.5953 0.8576 0.0053  0.0216  -0.0341 449 GLN A CD  
478  O OE1 . GLN A 62  ? 0.8181 0.6300 0.9001 0.0078  0.0201  -0.0518 449 GLN A OE1 
479  N NE2 . GLN A 62  ? 0.7274 0.5500 0.8137 -0.0089 0.0226  -0.0254 449 GLN A NE2 
480  N N   . PRO A 63  ? 0.8049 0.5592 0.9083 -0.0008 0.0218  0.0111  450 PRO A N   
481  C CA  . PRO A 63  ? 0.7492 0.5066 0.8504 -0.0133 0.0234  0.0329  450 PRO A CA  
482  C C   . PRO A 63  ? 0.7208 0.5139 0.8079 -0.0174 0.0265  0.0363  450 PRO A C   
483  O O   . PRO A 63  ? 0.7165 0.5286 0.8015 -0.0196 0.0277  0.0209  450 PRO A O   
484  C CB  . PRO A 63  ? 0.7192 0.4598 0.8316 -0.0303 0.0242  0.0287  450 PRO A CB  
485  C CG  . PRO A 63  ? 0.8008 0.5155 0.9222 -0.0241 0.0210  0.0090  450 PRO A CG  
486  C CD  . PRO A 63  ? 0.8140 0.5468 0.9265 -0.0081 0.0207  -0.0062 450 PRO A CD  
487  N N   . GLY A 64  ? 0.6880 0.4889 0.7647 -0.0183 0.0272  0.0562  451 GLY A N   
488  C CA  . GLY A 64  ? 0.6822 0.5131 0.7433 -0.0219 0.0308  0.0587  451 GLY A CA  
489  C C   . GLY A 64  ? 0.7244 0.5668 0.7870 -0.0377 0.0378  0.0570  451 GLY A C   
490  O O   . GLY A 64  ? 0.7494 0.5768 0.8235 -0.0488 0.0396  0.0613  451 GLY A O   
491  N N   . SER A 65  ? 0.6616 0.5307 0.7146 -0.0388 0.0421  0.0510  452 SER A N   
492  C CA  . SER A 65  ? 0.5156 0.4005 0.5745 -0.0511 0.0497  0.0470  452 SER A CA  
493  C C   . SER A 65  ? 0.4925 0.3985 0.5344 -0.0548 0.0576  0.0543  452 SER A C   
494  O O   . SER A 65  ? 0.4981 0.4094 0.5224 -0.0472 0.0554  0.0572  452 SER A O   
495  C CB  . SER A 65  ? 0.5448 0.4414 0.6152 -0.0480 0.0474  0.0265  452 SER A CB  
496  O OG  . SER A 65  ? 0.6317 0.5097 0.7094 -0.0414 0.0397  0.0170  452 SER A OG  
497  N N   . HIS A 66  ? 0.4871 0.4059 0.5348 -0.0669 0.0673  0.0564  453 HIS A N   
498  C CA  . HIS A 66  ? 0.5084 0.4450 0.5387 -0.0719 0.0777  0.0635  453 HIS A CA  
499  C C   . HIS A 66  ? 0.5065 0.4611 0.5259 -0.0622 0.0787  0.0503  453 HIS A C   
500  O O   . HIS A 66  ? 0.4659 0.4276 0.4984 -0.0555 0.0752  0.0352  453 HIS A O   
501  C CB  . HIS A 66  ? 0.5159 0.4659 0.5599 -0.0861 0.0898  0.0664  453 HIS A CB  
502  C CG  . HIS A 66  ? 0.6494 0.6130 0.6731 -0.0936 0.1027  0.0774  453 HIS A CG  
503  N ND1 . HIS A 66  ? 0.5527 0.5399 0.5684 -0.0909 0.1130  0.0674  453 HIS A ND1 
504  C CD2 . HIS A 66  ? 0.6869 0.6430 0.6949 -0.1039 0.1073  0.0975  453 HIS A CD2 
505  C CE1 . HIS A 66  ? 0.5865 0.5807 0.5808 -0.0992 0.1244  0.0790  453 HIS A CE1 
506  N NE2 . HIS A 66  ? 0.6941 0.6707 0.6823 -0.1078 0.1208  0.0983  453 HIS A NE2 
507  N N   . ILE A 67  ? 0.3893 0.3802 0.3742 -0.0440 0.0856  0.0169  454 ILE A N   
508  C CA  . ILE A 67  ? 0.4664 0.4628 0.4466 -0.0399 0.0829  0.0106  454 ILE A CA  
509  C C   . ILE A 67  ? 0.4140 0.4199 0.4100 -0.0400 0.0868  0.0038  454 ILE A C   
510  O O   . ILE A 67  ? 0.3818 0.3911 0.3815 -0.0364 0.0825  -0.0019 454 ILE A O   
511  C CB  . ILE A 67  ? 0.3950 0.3909 0.3544 -0.0392 0.0865  0.0128  454 ILE A CB  
512  C CG1 . ILE A 67  ? 0.4454 0.4450 0.3994 -0.0356 0.0828  0.0057  454 ILE A CG1 
513  C CG2 . ILE A 67  ? 0.3751 0.3746 0.3321 -0.0431 0.0980  0.0149  454 ILE A CG2 
514  C CD1 . ILE A 67  ? 0.3904 0.3874 0.3473 -0.0321 0.0724  0.0038  454 ILE A CD1 
515  N N   . ASP A 68  ? 0.3848 0.3953 0.3914 -0.0441 0.0949  0.0049  455 ASP A N   
516  C CA  . ASP A 68  ? 0.3748 0.3959 0.3984 -0.0437 0.0991  -0.0009 455 ASP A CA  
517  C C   . ASP A 68  ? 0.3685 0.3936 0.4094 -0.0418 0.0907  -0.0047 455 ASP A C   
518  O O   . ASP A 68  ? 0.3826 0.4150 0.4336 -0.0384 0.0903  -0.0098 455 ASP A O   
519  C CB  . ASP A 68  ? 0.4453 0.4718 0.4786 -0.0489 0.1096  0.0017  455 ASP A CB  
520  C CG  . ASP A 68  ? 0.5162 0.5416 0.5327 -0.0502 0.1196  0.0044  455 ASP A CG  
521  O OD1 . ASP A 68  ? 0.4954 0.5177 0.4941 -0.0470 0.1182  0.0028  455 ASP A OD1 
522  O OD2 . ASP A 68  ? 0.6203 0.6487 0.6414 -0.0549 0.1290  0.0082  455 ASP A OD2 
523  N N   . PHE A 69  ? 0.3501 0.3699 0.3936 -0.0436 0.0841  -0.0022 456 PHE A N   
524  C CA  . PHE A 69  ? 0.3862 0.4098 0.4432 -0.0420 0.0755  -0.0059 456 PHE A CA  
525  C C   . PHE A 69  ? 0.3097 0.3300 0.3571 -0.0362 0.0677  -0.0082 456 PHE A C   
526  O O   . PHE A 69  ? 0.3659 0.3923 0.4228 -0.0329 0.0634  -0.0120 456 PHE A O   
527  C CB  . PHE A 69  ? 0.3713 0.3899 0.4337 -0.0464 0.0715  -0.0037 456 PHE A CB  
528  C CG  . PHE A 69  ? 0.3837 0.4083 0.4622 -0.0528 0.0776  -0.0030 456 PHE A CG  
529  C CD1 . PHE A 69  ? 0.3676 0.4058 0.4664 -0.0535 0.0769  -0.0071 456 PHE A CD1 
530  C CD2 . PHE A 69  ? 0.4241 0.4414 0.4984 -0.0581 0.0840  0.0024  456 PHE A CD2 
531  C CE1 . PHE A 69  ? 0.3595 0.4050 0.4749 -0.0600 0.0825  -0.0066 456 PHE A CE1 
532  C CE2 . PHE A 69  ? 0.4523 0.4752 0.5425 -0.0648 0.0902  0.0032  456 PHE A CE2 
533  C CZ  . PHE A 69  ? 0.4019 0.4395 0.5131 -0.0660 0.0893  -0.0017 456 PHE A CZ  
534  N N   . ALA A 70  ? 0.2212 0.2325 0.2505 -0.0349 0.0661  -0.0054 457 ALA A N   
535  C CA  . ALA A 70  ? 0.2795 0.2881 0.2994 -0.0301 0.0597  -0.0073 457 ALA A CA  
536  C C   . ALA A 70  ? 0.3176 0.3320 0.3402 -0.0270 0.0621  -0.0120 457 ALA A C   
537  O O   . ALA A 70  ? 0.1704 0.1868 0.1981 -0.0234 0.0568  -0.0149 457 ALA A O   
538  C CB  . ALA A 70  ? 0.2673 0.2681 0.2682 -0.0297 0.0592  -0.0032 457 ALA A CB  
539  N N   . VAL A 71  ? 0.2364 0.2529 0.2554 -0.0283 0.0708  -0.0127 458 VAL A N   
540  C CA  . VAL A 71  ? 0.3155 0.3360 0.3362 -0.0255 0.0750  -0.0179 458 VAL A CA  
541  C C   . VAL A 71  ? 0.3440 0.3727 0.3859 -0.0232 0.0748  -0.0208 458 VAL A C   
542  O O   . VAL A 71  ? 0.3499 0.3798 0.3960 -0.0189 0.0731  -0.0243 458 VAL A O   
543  C CB  . VAL A 71  ? 0.3502 0.3716 0.3624 -0.0278 0.0856  -0.0183 458 VAL A CB  
544  C CG1 . VAL A 71  ? 0.2928 0.3184 0.3102 -0.0249 0.0916  -0.0248 458 VAL A CG1 
545  C CG2 . VAL A 71  ? 0.2948 0.3094 0.2843 -0.0292 0.0846  -0.0155 458 VAL A CG2 
546  N N   . ASN A 72  ? 0.3572 0.3920 0.4132 -0.0261 0.0764  -0.0189 459 ASN A N   
547  C CA  . ASN A 72  ? 0.3107 0.3556 0.3880 -0.0242 0.0748  -0.0208 459 ASN A CA  
548  C C   . ASN A 72  ? 0.3480 0.3923 0.4284 -0.0209 0.0638  -0.0210 459 ASN A C   
549  O O   . ASN A 72  ? 0.2752 0.3250 0.3662 -0.0164 0.0616  -0.0229 459 ASN A O   
550  C CB  . ASN A 72  ? 0.3474 0.3998 0.4393 -0.0292 0.0779  -0.0189 459 ASN A CB  
551  C CG  . ASN A 72  ? 0.4814 0.5454 0.5950 -0.0277 0.0729  -0.0203 459 ASN A CG  
552  O OD1 . ASN A 72  ? 0.5479 0.6132 0.6669 -0.0303 0.0655  -0.0194 459 ASN A OD1 
553  N ND2 . ASN A 72  ? 0.4435 0.5162 0.5696 -0.0232 0.0766  -0.0227 459 ASN A ND2 
554  N N   . ARG A 73  ? 0.1593 0.1969 0.2306 -0.0230 0.0573  -0.0187 460 ARG A N   
555  C CA  . ARG A 73  ? 0.3585 0.3946 0.4291 -0.0199 0.0475  -0.0189 460 ARG A CA  
556  C C   . ARG A 73  ? 0.2544 0.2871 0.3176 -0.0148 0.0467  -0.0205 460 ARG A C   
557  O O   . ARG A 73  ? 0.2110 0.2473 0.2818 -0.0108 0.0425  -0.0213 460 ARG A O   
558  C CB  . ARG A 73  ? 0.3014 0.3291 0.3606 -0.0223 0.0424  -0.0167 460 ARG A CB  
559  C CG  . ARG A 73  ? 0.2588 0.2869 0.3245 -0.0278 0.0430  -0.0154 460 ARG A CG  
560  C CD  . ARG A 73  ? 0.2591 0.2971 0.3420 -0.0287 0.0381  -0.0176 460 ARG A CD  
561  N NE  . ARG A 73  ? 0.2423 0.2793 0.3306 -0.0349 0.0376  -0.0174 460 ARG A NE  
562  C CZ  . ARG A 73  ? 0.3507 0.3932 0.4509 -0.0400 0.0435  -0.0171 460 ARG A CZ  
563  N NH1 . ARG A 73  ? 0.3531 0.4033 0.4606 -0.0390 0.0505  -0.0170 460 ARG A NH1 
564  N NH2 . ARG A 73  ? 0.3084 0.3484 0.4136 -0.0462 0.0428  -0.0173 460 ARG A NH2 
565  N N   . LEU A 74  ? 0.1996 0.2253 0.2479 -0.0155 0.0507  -0.0208 461 LEU A N   
566  C CA  . LEU A 74  ? 0.2011 0.2222 0.2407 -0.0122 0.0499  -0.0229 461 LEU A CA  
567  C C   . LEU A 74  ? 0.2524 0.2777 0.3033 -0.0086 0.0542  -0.0262 461 LEU A C   
568  O O   . LEU A 74  ? 0.3661 0.3904 0.4204 -0.0046 0.0505  -0.0269 461 LEU A O   
569  C CB  . LEU A 74  ? 0.2894 0.3043 0.3113 -0.0145 0.0537  -0.0230 461 LEU A CB  
570  C CG  . LEU A 74  ? 0.4085 0.4189 0.4211 -0.0124 0.0527  -0.0261 461 LEU A CG  
571  C CD1 . LEU A 74  ? 0.3118 0.3198 0.3235 -0.0103 0.0439  -0.0244 461 LEU A CD1 
572  C CD2 . LEU A 74  ? 0.5379 0.5445 0.5330 -0.0153 0.0560  -0.0266 461 LEU A CD2 
573  N N   . LYS A 75  ? 0.1623 0.1920 0.2193 -0.0097 0.0627  -0.0279 462 LYS A N   
574  C CA  . LYS A 75  ? 0.2819 0.3161 0.3516 -0.0057 0.0684  -0.0312 462 LYS A CA  
575  C C   . LYS A 75  ? 0.2662 0.3070 0.3534 -0.0013 0.0625  -0.0295 462 LYS A C   
576  O O   . LYS A 75  ? 0.2671 0.3065 0.3596 0.0037  0.0627  -0.0309 462 LYS A O   
577  C CB  . LYS A 75  ? 0.2648 0.3054 0.3415 -0.0080 0.0783  -0.0323 462 LYS A CB  
578  C CG  . LYS A 75  ? 0.4997 0.5440 0.5881 -0.0035 0.0863  -0.0365 462 LYS A CG  
579  C CD  . LYS A 75  ? 0.6503 0.6930 0.7293 -0.0060 0.0978  -0.0402 462 LYS A CD  
580  C CE  . LYS A 75  ? 0.6526 0.6962 0.7408 -0.0010 0.1064  -0.0459 462 LYS A CE  
581  N NZ  . LYS A 75  ? 0.6527 0.7085 0.7668 0.0028  0.1084  -0.0444 462 LYS A NZ  
582  N N   . LEU A 76  ? 0.2365 0.2843 0.3322 -0.0033 0.0573  -0.0264 463 LEU A N   
583  C CA  . LEU A 76  ? 0.2907 0.3467 0.4017 0.0003  0.0506  -0.0244 463 LEU A CA  
584  C C   . LEU A 76  ? 0.2193 0.2691 0.3225 0.0037  0.0428  -0.0230 463 LEU A C   
585  O O   . LEU A 76  ? 0.1669 0.2200 0.2796 0.0089  0.0402  -0.0216 463 LEU A O   
586  C CB  . LEU A 76  ? 0.3152 0.3794 0.4341 -0.0041 0.0460  -0.0225 463 LEU A CB  
587  C CG  . LEU A 76  ? 0.4347 0.5140 0.5764 -0.0024 0.0450  -0.0218 463 LEU A CG  
588  C CD1 . LEU A 76  ? 0.4867 0.5713 0.6395 -0.0007 0.0557  -0.0236 463 LEU A CD1 
589  C CD2 . LEU A 76  ? 0.4794 0.5654 0.6268 -0.0086 0.0408  -0.0212 463 LEU A CD2 
590  N N   . ALA A 77  ? 0.2116 0.2527 0.2979 0.0008  0.0395  -0.0226 464 ALA A N   
591  C CA  . ALA A 77  ? 0.2283 0.2639 0.3069 0.0034  0.0330  -0.0211 464 ALA A CA  
592  C C   . ALA A 77  ? 0.1917 0.2209 0.2680 0.0070  0.0368  -0.0229 464 ALA A C   
593  O O   . ALA A 77  ? 0.2392 0.2670 0.3179 0.0108  0.0329  -0.0210 464 ALA A O   
594  C CB  . ALA A 77  ? 0.1381 0.1668 0.2006 -0.0003 0.0294  -0.0204 464 ALA A CB  
595  N N   . GLU A 78  ? 0.1812 0.2064 0.2525 0.0054  0.0448  -0.0267 465 GLU A N   
596  C CA  . GLU A 78  ? 0.1528 0.1710 0.2218 0.0079  0.0494  -0.0300 465 GLU A CA  
597  C C   . GLU A 78  ? 0.1541 0.1762 0.2409 0.0138  0.0521  -0.0297 465 GLU A C   
598  O O   . GLU A 78  ? 0.2236 0.2397 0.3121 0.0175  0.0521  -0.0299 465 GLU A O   
599  C CB  . GLU A 78  ? 0.3621 0.3760 0.4205 0.0044  0.0575  -0.0349 465 GLU A CB  
600  C CG  . GLU A 78  ? 0.3983 0.4072 0.4379 -0.0003 0.0545  -0.0347 465 GLU A CG  
601  C CD  . GLU A 78  ? 0.4675 0.4730 0.4947 -0.0037 0.0618  -0.0393 465 GLU A CD  
602  O OE1 . GLU A 78  ? 0.4115 0.4206 0.4440 -0.0037 0.0697  -0.0417 465 GLU A OE1 
603  O OE2 . GLU A 78  ? 0.6403 0.6408 0.6525 -0.0064 0.0596  -0.0404 465 GLU A OE2 
604  N N   . ILE A 79  ? 0.2882 0.3206 0.3894 0.0149  0.0545  -0.0289 466 ILE A N   
605  C CA  . ILE A 79  ? 0.2962 0.3348 0.4167 0.0213  0.0563  -0.0275 466 ILE A CA  
606  C C   . ILE A 79  ? 0.2879 0.3285 0.4131 0.0251  0.0468  -0.0218 466 ILE A C   
607  O O   . ILE A 79  ? 0.3272 0.3647 0.4597 0.0309  0.0474  -0.0201 466 ILE A O   
608  C CB  . ILE A 79  ? 0.2733 0.3254 0.4099 0.0212  0.0597  -0.0271 466 ILE A CB  
609  C CG1 . ILE A 79  ? 0.2671 0.3174 0.3991 0.0178  0.0705  -0.0323 466 ILE A CG1 
610  C CG2 . ILE A 79  ? 0.2667 0.3269 0.4250 0.0288  0.0605  -0.0247 466 ILE A CG2 
611  C CD1 . ILE A 79  ? 0.2628 0.3270 0.4120 0.0173  0.0755  -0.0320 466 ILE A CD1 
612  N N   . LEU A 80  ? 0.2302 0.2754 0.3505 0.0219  0.0386  -0.0188 467 LEU A N   
613  C CA  . LEU A 80  ? 0.1627 0.2103 0.2842 0.0249  0.0294  -0.0136 467 LEU A CA  
614  C C   . LEU A 80  ? 0.2030 0.2384 0.3134 0.0264  0.0285  -0.0128 467 LEU A C   
615  O O   . LEU A 80  ? 0.1818 0.2172 0.2973 0.0313  0.0250  -0.0083 467 LEU A O   
616  C CB  . LEU A 80  ? 0.2155 0.2682 0.3308 0.0202  0.0219  -0.0124 467 LEU A CB  
617  C CG  . LEU A 80  ? 0.3125 0.3801 0.4416 0.0204  0.0164  -0.0102 467 LEU A CG  
618  C CD1 . LEU A 80  ? 0.2997 0.3676 0.4185 0.0147  0.0102  -0.0109 467 LEU A CD1 
619  C CD2 . LEU A 80  ? 0.3276 0.4017 0.4667 0.0271  0.0110  -0.0049 467 LEU A CD2 
620  N N   . TYR A 81  ? 0.1414 0.1672 0.2366 0.0220  0.0314  -0.0167 468 TYR A N   
621  C CA  . TYR A 81  ? 0.1440 0.1591 0.2288 0.0220  0.0306  -0.0166 468 TYR A CA  
622  C C   . TYR A 81  ? 0.2133 0.2221 0.3066 0.0270  0.0355  -0.0167 468 TYR A C   
623  O O   . TYR A 81  ? 0.1942 0.1997 0.2891 0.0301  0.0321  -0.0123 468 TYR A O   
624  C CB  . TYR A 81  ? 0.1773 0.1854 0.2462 0.0163  0.0332  -0.0212 468 TYR A CB  
625  C CG  . TYR A 81  ? 0.2428 0.2406 0.3030 0.0155  0.0338  -0.0226 468 TYR A CG  
626  C CD1 . TYR A 81  ? 0.2361 0.2321 0.2884 0.0144  0.0276  -0.0193 468 TYR A CD1 
627  C CD2 . TYR A 81  ? 0.1594 0.1495 0.2199 0.0156  0.0409  -0.0277 468 TYR A CD2 
628  C CE1 . TYR A 81  ? 0.1949 0.1827 0.2409 0.0131  0.0283  -0.0204 468 TYR A CE1 
629  C CE2 . TYR A 81  ? 0.2661 0.2471 0.3199 0.0139  0.0413  -0.0295 468 TYR A CE2 
630  C CZ  . TYR A 81  ? 0.2371 0.2173 0.2841 0.0124  0.0349  -0.0257 468 TYR A CZ  
631  O OH  . TYR A 81  ? 0.2515 0.2234 0.2933 0.0101  0.0356  -0.0276 468 TYR A OH  
632  N N   . TYR A 82  ? 0.1580 0.1646 0.2566 0.0276  0.0439  -0.0218 469 TYR A N   
633  C CA  . TYR A 82  ? 0.2508 0.2496 0.3578 0.0323  0.0499  -0.0231 469 TYR A CA  
634  C C   . TYR A 82  ? 0.2847 0.2899 0.4097 0.0401  0.0475  -0.0163 469 TYR A C   
635  O O   . TYR A 82  ? 0.3077 0.3052 0.4388 0.0448  0.0494  -0.0140 469 TYR A O   
636  C CB  . TYR A 82  ? 0.2520 0.2478 0.3603 0.0314  0.0603  -0.0309 469 TYR A CB  
637  C CG  . TYR A 82  ? 0.1806 0.1675 0.2706 0.0247  0.0633  -0.0378 469 TYR A CG  
638  C CD1 . TYR A 82  ? 0.2257 0.2005 0.3083 0.0233  0.0638  -0.0403 469 TYR A CD1 
639  C CD2 . TYR A 82  ? 0.1797 0.1709 0.2600 0.0196  0.0653  -0.0413 469 TYR A CD2 
640  C CE1 . TYR A 82  ? 0.1926 0.1613 0.2589 0.0168  0.0656  -0.0467 469 TYR A CE1 
641  C CE2 . TYR A 82  ? 0.2145 0.1991 0.2775 0.0137  0.0672  -0.0467 469 TYR A CE2 
642  C CZ  . TYR A 82  ? 0.2383 0.2124 0.2944 0.0123  0.0670  -0.0497 469 TYR A CZ  
643  O OH  . TYR A 82  ? 0.3583 0.3279 0.3976 0.0062  0.0680  -0.0554 469 TYR A OH  
644  N N   . LYS A 83  ? 0.2348 0.2542 0.3687 0.0413  0.0433  -0.0128 470 LYS A N   
645  C CA  . LYS A 83  ? 0.2260 0.2546 0.3766 0.0485  0.0392  -0.0056 470 LYS A CA  
646  C C   . LYS A 83  ? 0.2778 0.3042 0.4226 0.0501  0.0309  0.0015  470 LYS A C   
647  O O   . LYS A 83  ? 0.2787 0.3020 0.4319 0.0565  0.0307  0.0071  470 LYS A O   
648  C CB  . LYS A 83  ? 0.1798 0.2258 0.3405 0.0478  0.0355  -0.0042 470 LYS A CB  
649  C CG  . LYS A 83  ? 0.1924 0.2509 0.3727 0.0555  0.0313  0.0030  470 LYS A CG  
650  C CD  . LYS A 83  ? 0.2512 0.3282 0.4403 0.0531  0.0258  0.0039  470 LYS A CD  
651  C CE  . LYS A 83  ? 0.3146 0.4068 0.5266 0.0610  0.0231  0.0100  470 LYS A CE  
652  N NZ  . LYS A 83  ? 0.2168 0.3105 0.4284 0.0663  0.0144  0.0186  470 LYS A NZ  
653  N N   . ILE A 84  ? 0.2106 0.2382 0.3409 0.0445  0.0246  0.0016  471 ILE A N   
654  C CA  . ILE A 84  ? 0.2237 0.2507 0.3471 0.0455  0.0170  0.0080  471 ILE A CA  
655  C C   . ILE A 84  ? 0.2432 0.2550 0.3598 0.0458  0.0206  0.0084  471 ILE A C   
656  O O   . ILE A 84  ? 0.1833 0.1926 0.3021 0.0500  0.0180  0.0154  471 ILE A O   
657  C CB  . ILE A 84  ? 0.1936 0.2252 0.3034 0.0395  0.0105  0.0069  471 ILE A CB  
658  C CG1 . ILE A 84  ? 0.2166 0.2629 0.3344 0.0387  0.0065  0.0066  471 ILE A CG1 
659  C CG2 . ILE A 84  ? 0.1609 0.1911 0.2618 0.0404  0.0041  0.0127  471 ILE A CG2 
660  C CD1 . ILE A 84  ? 0.1746 0.2235 0.2802 0.0324  0.0017  0.0039  471 ILE A CD1 
661  N N   . LEU A 85  ? 0.2297 0.2316 0.3378 0.0409  0.0266  0.0010  472 LEU A N   
662  C CA  . LEU A 85  ? 0.1667 0.1543 0.2691 0.0398  0.0304  -0.0002 472 LEU A CA  
663  C C   . LEU A 85  ? 0.1915 0.1722 0.3081 0.0466  0.0356  0.0026  472 LEU A C   
664  O O   . LEU A 85  ? 0.2635 0.2353 0.3798 0.0482  0.0356  0.0070  472 LEU A O   
665  C CB  . LEU A 85  ? 0.1864 0.1669 0.2784 0.0333  0.0358  -0.0096 472 LEU A CB  
666  C CG  . LEU A 85  ? 0.3133 0.2794 0.4003 0.0309  0.0403  -0.0130 472 LEU A CG  
667  C CD1 . LEU A 85  ? 0.2500 0.2136 0.3296 0.0292  0.0347  -0.0075 472 LEU A CD1 
668  C CD2 . LEU A 85  ? 0.2067 0.1682 0.2832 0.0244  0.0451  -0.0228 472 LEU A CD2 
669  N N   . GLU A 86  ? 0.2462 0.2309 0.3760 0.0507  0.0404  0.0005  473 GLU A N   
670  C CA  . GLU A 86  ? 0.2570 0.2352 0.4020 0.0583  0.0458  0.0034  473 GLU A CA  
671  C C   . GLU A 86  ? 0.2639 0.2479 0.4171 0.0650  0.0390  0.0154  473 GLU A C   
672  O O   . GLU A 86  ? 0.2555 0.2290 0.4132 0.0692  0.0411  0.0206  473 GLU A O   
673  C CB  . GLU A 86  ? 0.3057 0.2893 0.4647 0.0620  0.0525  -0.0010 473 GLU A CB  
674  C CG  . GLU A 86  ? 0.3855 0.3621 0.5622 0.0711  0.0588  0.0021  473 GLU A CG  
675  C CD  . GLU A 86  ? 0.4297 0.4119 0.6211 0.0752  0.0668  -0.0029 473 GLU A CD  
676  O OE1 . GLU A 86  ? 0.4998 0.4877 0.6851 0.0697  0.0693  -0.0104 473 GLU A OE1 
677  O OE2 . GLU A 86  ? 0.5025 0.4836 0.7120 0.0842  0.0709  0.0012  473 GLU A OE2 
678  N N   . THR A 87  ? 0.2259 0.2263 0.3801 0.0656  0.0308  0.0200  474 THR A N   
679  C CA  . THR A 87  ? 0.2414 0.2499 0.4007 0.0714  0.0231  0.0313  474 THR A CA  
680  C C   . THR A 87  ? 0.2029 0.2020 0.3488 0.0692  0.0201  0.0362  474 THR A C   
681  O O   . THR A 87  ? 0.2373 0.2327 0.3884 0.0749  0.0191  0.0453  474 THR A O   
682  C CB  . THR A 87  ? 0.2875 0.3156 0.4471 0.0702  0.0142  0.0331  474 THR A CB  
683  O OG1 . THR A 87  ? 0.2636 0.3019 0.4382 0.0724  0.0171  0.0297  474 THR A OG1 
684  C CG2 . THR A 87  ? 0.2537 0.2910 0.4160 0.0758  0.0055  0.0446  474 THR A CG2 
685  N N   . VAL A 88  ? 0.2635 0.2592 0.3931 0.0611  0.0190  0.0305  475 VAL A N   
686  C CA  . VAL A 88  ? 0.2650 0.2531 0.3824 0.0583  0.0169  0.0343  475 VAL A CA  
687  C C   . VAL A 88  ? 0.2225 0.1933 0.3436 0.0595  0.0242  0.0351  475 VAL A C   
688  O O   . VAL A 88  ? 0.2538 0.2195 0.3748 0.0621  0.0230  0.0436  475 VAL A O   
689  C CB  . VAL A 88  ? 0.2687 0.2569 0.3697 0.0497  0.0151  0.0274  475 VAL A CB  
690  C CG1 . VAL A 88  ? 0.1768 0.1571 0.2674 0.0467  0.0145  0.0307  475 VAL A CG1 
691  C CG2 . VAL A 88  ? 0.2050 0.2083 0.3018 0.0484  0.0078  0.0275  475 VAL A CG2 
692  N N   . MET A 89  ? 0.3165 0.2778 0.4407 0.0573  0.0321  0.0260  476 MET A N   
693  C CA  . MET A 89  ? 0.3885 0.3317 0.5154 0.0569  0.0396  0.0243  476 MET A CA  
694  C C   . MET A 89  ? 0.3954 0.3331 0.5385 0.0662  0.0426  0.0328  476 MET A C   
695  O O   . MET A 89  ? 0.4428 0.3675 0.5873 0.0671  0.0453  0.0377  476 MET A O   
696  C CB  . MET A 89  ? 0.4601 0.3956 0.5855 0.0521  0.0473  0.0113  476 MET A CB  
697  C CG  . MET A 89  ? 0.4571 0.3939 0.5657 0.0426  0.0453  0.0036  476 MET A CG  
698  S SD  . MET A 89  ? 0.5890 0.5188 0.6870 0.0370  0.0422  0.0075  476 MET A SD  
699  C CE  . MET A 89  ? 0.3854 0.3320 0.4736 0.0363  0.0321  0.0135  476 MET A CE  
700  N N   . VAL A 90  ? 0.3315 0.2794 0.4877 0.0733  0.0421  0.0351  477 VAL A N   
701  C CA  . VAL A 90  ? 0.3654 0.3101 0.5389 0.0836  0.0446  0.0439  477 VAL A CA  
702  C C   . VAL A 90  ? 0.3777 0.3254 0.5500 0.0878  0.0377  0.0584  477 VAL A C   
703  O O   . VAL A 90  ? 0.3427 0.2781 0.5226 0.0930  0.0413  0.0661  477 VAL A O   
704  C CB  . VAL A 90  ? 0.3923 0.3517 0.5809 0.0901  0.0442  0.0438  477 VAL A CB  
705  C CG1 . VAL A 90  ? 0.4418 0.4034 0.6463 0.1006  0.0435  0.0552  477 VAL A CG1 
706  C CG2 . VAL A 90  ? 0.4357 0.3891 0.6280 0.0877  0.0538  0.0307  477 VAL A CG2 
707  N N   . GLN A 91  ? 0.2893 0.2525 0.4513 0.0853  0.0281  0.0620  478 GLN A N   
708  C CA  . GLN A 91  ? 0.3419 0.3111 0.5007 0.0893  0.0209  0.0755  478 GLN A CA  
709  C C   . GLN A 91  ? 0.3605 0.3182 0.5051 0.0835  0.0216  0.0778  478 GLN A C   
710  O O   . GLN A 91  ? 0.4923 0.4533 0.6321 0.0860  0.0169  0.0891  478 GLN A O   
711  C CB  . GLN A 91  ? 0.3363 0.3275 0.4898 0.0888  0.0106  0.0771  478 GLN A CB  
712  C CG  . GLN A 91  ? 0.5078 0.5130 0.6767 0.0939  0.0091  0.0755  478 GLN A CG  
713  C CD  . GLN A 91  ? 0.6247 0.6510 0.7886 0.0917  -0.0010 0.0755  478 GLN A CD  
714  O OE1 . GLN A 91  ? 0.6982 0.7272 0.8454 0.0853  -0.0058 0.0735  478 GLN A OE1 
715  N NE2 . GLN A 91  ? 0.6334 0.6750 0.8126 0.0970  -0.0040 0.0773  478 GLN A NE2 
716  N N   . GLU A 92  ? 0.2945 0.2399 0.4326 0.0756  0.0276  0.0674  479 GLU A N   
717  C CA  . GLU A 92  ? 0.4126 0.3484 0.5388 0.0692  0.0287  0.0685  479 GLU A CA  
718  C C   . GLU A 92  ? 0.4809 0.4022 0.6142 0.0735  0.0332  0.0789  479 GLU A C   
719  O O   . GLU A 92  ? 0.4359 0.3466 0.5834 0.0791  0.0392  0.0801  479 GLU A O   
720  C CB  . GLU A 92  ? 0.4765 0.4033 0.5961 0.0600  0.0339  0.0546  479 GLU A CB  
721  C CG  . GLU A 92  ? 0.5627 0.4848 0.6698 0.0522  0.0335  0.0545  479 GLU A CG  
722  C CD  . GLU A 92  ? 0.6265 0.5639 0.7216 0.0510  0.0252  0.0592  479 GLU A CD  
723  O OE1 . GLU A 92  ? 0.5075 0.4554 0.5956 0.0478  0.0214  0.0521  479 GLU A OE1 
724  O OE2 . GLU A 92  ? 0.6931 0.6313 0.7855 0.0534  0.0229  0.0701  479 GLU A OE2 
725  N N   . THR A 93  ? 0.4339 0.3544 0.5574 0.0709  0.0307  0.0867  480 THR A N   
726  C CA  . THR A 93  ? 0.4343 0.3414 0.5629 0.0742  0.0348  0.0983  480 THR A CA  
727  C C   . THR A 93  ? 0.3866 0.2717 0.5227 0.0702  0.0450  0.0915  480 THR A C   
728  O O   . THR A 93  ? 0.4433 0.3173 0.5896 0.0746  0.0498  0.0961  480 THR A O   
729  C CB  . THR A 93  ? 0.5324 0.4436 0.6473 0.0703  0.0312  0.1065  480 THR A CB  
730  O OG1 . THR A 93  ? 0.6165 0.5458 0.7258 0.0759  0.0224  0.1153  480 THR A OG1 
731  C CG2 . THR A 93  ? 0.5746 0.4689 0.6941 0.0712  0.0374  0.1170  480 THR A CG2 
732  N N   . ARG A 94  ? 0.3719 0.2534 0.5002 0.0602  0.0473  0.0785  481 ARG A N   
733  C CA  . ARG A 94  ? 0.4417 0.3035 0.5753 0.0547  0.0563  0.0701  481 ARG A CA  
734  C C   . ARG A 94  ? 0.3827 0.2359 0.5299 0.0602  0.0623  0.0639  481 ARG A C   
735  O O   . ARG A 94  ? 0.3805 0.2182 0.5345 0.0593  0.0693  0.0614  481 ARG A O   
736  C CB  . ARG A 94  ? 0.4974 0.3611 0.6193 0.0430  0.0560  0.0571  481 ARG A CB  
737  C CG  . ARG A 94  ? 0.5400 0.4062 0.6521 0.0365  0.0536  0.0622  481 ARG A CG  
738  C CD  . ARG A 94  ? 0.6738 0.5424 0.7766 0.0255  0.0533  0.0494  481 ARG A CD  
739  N NE  . ARG A 94  ? 0.6810 0.5325 0.7893 0.0189  0.0608  0.0401  481 ARG A NE  
740  C CZ  . ARG A 94  ? 0.6159 0.4573 0.7253 0.0118  0.0645  0.0410  481 ARG A CZ  
741  N NH1 . ARG A 94  ? 0.6337 0.4808 0.7390 0.0107  0.0620  0.0516  481 ARG A NH1 
742  N NH2 . ARG A 94  ? 0.5009 0.3269 0.6154 0.0053  0.0710  0.0310  481 ARG A NH2 
743  N N   . ARG A 95  ? 0.3702 0.2375 0.5186 0.0643  0.0587  0.0598  482 ARG A N   
744  C CA  . ARG A 95  ? 0.3877 0.2504 0.5490 0.0699  0.0644  0.0538  482 ARG A CA  
745  C C   . ARG A 95  ? 0.3355 0.1969 0.5067 0.0779  0.0650  0.0643  482 ARG A C   
746  O O   . ARG A 95  ? 0.3758 0.2255 0.5547 0.0789  0.0720  0.0599  482 ARG A O   
747  C CB  . ARG A 95  ? 0.3695 0.2509 0.5296 0.0719  0.0596  0.0486  482 ARG A CB  
748  C CG  . ARG A 95  ? 0.3052 0.1823 0.4735 0.0730  0.0670  0.0365  482 ARG A CG  
749  C CD  . ARG A 95  ? 0.3414 0.2179 0.5235 0.0814  0.0701  0.0410  482 ARG A CD  
750  N NE  . ARG A 95  ? 0.3762 0.2706 0.5645 0.0896  0.0623  0.0525  482 ARG A NE  
751  C CZ  . ARG A 95  ? 0.3860 0.2830 0.5853 0.0975  0.0623  0.0603  482 ARG A CZ  
752  N NH1 . ARG A 95  ? 0.4071 0.2888 0.6129 0.0987  0.0701  0.0583  482 ARG A NH1 
753  N NH2 . ARG A 95  ? 0.3460 0.2611 0.5497 0.1039  0.0542  0.0700  482 ARG A NH2 
754  N N   . LEU A 96  ? 0.3799 0.2534 0.5499 0.0834  0.0575  0.0781  483 LEU A N   
755  C CA  . LEU A 96  ? 0.3660 0.2404 0.5444 0.0914  0.0568  0.0894  483 LEU A CA  
756  C C   . LEU A 96  ? 0.4130 0.2690 0.5922 0.0891  0.0627  0.0935  483 LEU A C   
757  O O   . LEU A 96  ? 0.3575 0.2075 0.5463 0.0948  0.0659  0.0985  483 LEU A O   
758  C CB  . LEU A 96  ? 0.4334 0.3266 0.6073 0.0965  0.0465  0.1023  483 LEU A CB  
759  C CG  . LEU A 96  ? 0.4719 0.3849 0.6486 0.1002  0.0402  0.0994  483 LEU A CG  
760  C CD1 . LEU A 96  ? 0.4956 0.4268 0.6625 0.1011  0.0296  0.1081  483 LEU A CD1 
761  C CD2 . LEU A 96  ? 0.4427 0.3602 0.6341 0.1083  0.0414  0.1010  483 LEU A CD2 
762  N N   . HIS A 97  ? 0.4086 0.2559 0.5786 0.0805  0.0644  0.0914  484 HIS A N   
763  C CA  . HIS A 97  ? 0.4326 0.2624 0.6036 0.0766  0.0704  0.0940  484 HIS A CA  
764  C C   . HIS A 97  ? 0.3660 0.1790 0.5405 0.0698  0.0792  0.0789  484 HIS A C   
765  O O   . HIS A 97  ? 0.3822 0.1800 0.5581 0.0651  0.0847  0.0784  484 HIS A O   
766  C CB  . HIS A 97  ? 0.4530 0.2835 0.6129 0.0705  0.0676  0.1008  484 HIS A CB  
767  C CG  . HIS A 97  ? 0.4654 0.3075 0.6212 0.0767  0.0611  0.1172  484 HIS A CG  
768  N ND1 . HIS A 97  ? 0.5281 0.3886 0.6745 0.0784  0.0526  0.1221  484 HIS A ND1 
769  C CD2 . HIS A 97  ? 0.4701 0.3084 0.6289 0.0814  0.0618  0.1295  484 HIS A CD2 
770  C CE1 . HIS A 97  ? 0.5501 0.4181 0.6930 0.0834  0.0481  0.1359  484 HIS A CE1 
771  N NE2 . HIS A 97  ? 0.5392 0.3940 0.6897 0.0855  0.0536  0.1410  484 HIS A NE2 
772  N N   . GLY A 98  ? 0.3605 0.1772 0.5357 0.0688  0.0803  0.0663  485 GLY A N   
773  C CA  . GLY A 98  ? 0.4081 0.2112 0.5849 0.0625  0.0882  0.0508  485 GLY A CA  
774  C C   . GLY A 98  ? 0.4484 0.2436 0.6156 0.0503  0.0897  0.0424  485 GLY A C   
775  O O   . GLY A 98  ? 0.4922 0.2732 0.6602 0.0438  0.0960  0.0331  485 GLY A O   
776  N N   . MET A 99  ? 0.4044 0.2095 0.5626 0.0470  0.0837  0.0456  486 MET A N   
777  C CA  . MET A 99  ? 0.4239 0.2238 0.5734 0.0352  0.0843  0.0387  486 MET A CA  
778  C C   . MET A 99  ? 0.3767 0.1825 0.5190 0.0298  0.0831  0.0249  486 MET A C   
779  O O   . MET A 99  ? 0.3809 0.2002 0.5213 0.0349  0.0789  0.0248  486 MET A O   
780  C CB  . MET A 99  ? 0.3356 0.1415 0.4796 0.0341  0.0793  0.0519  486 MET A CB  
781  C CG  . MET A 99  ? 0.3533 0.1520 0.5023 0.0372  0.0813  0.0645  486 MET A CG  
782  S SD  . MET A 99  ? 0.6870 0.4968 0.8279 0.0380  0.0752  0.0815  486 MET A SD  
783  C CE  . MET A 99  ? 0.7789 0.5876 0.9115 0.0240  0.0759  0.0723  486 MET A CE  
784  N N   . ASP A 100 ? 0.4465 0.2447 0.5834 0.0186  0.0861  0.0130  487 ASP A N   
785  C CA  . ASP A 100 ? 0.4466 0.2525 0.5735 0.0118  0.0843  -0.0013 487 ASP A CA  
786  C C   . ASP A 100 ? 0.3938 0.2225 0.5091 0.0115  0.0745  0.0030  487 ASP A C   
787  O O   . ASP A 100 ? 0.4182 0.2530 0.5290 0.0091  0.0701  0.0112  487 ASP A O   
788  C CB  . ASP A 100 ? 0.4452 0.2408 0.5682 -0.0009 0.0877  -0.0130 487 ASP A CB  
789  C CG  . ASP A 100 ? 0.4942 0.2973 0.6064 -0.0075 0.0864  -0.0286 487 ASP A CG  
790  O OD1 . ASP A 100 ? 0.4837 0.2802 0.5977 -0.0061 0.0918  -0.0386 487 ASP A OD1 
791  O OD2 . ASP A 100 ? 0.5226 0.3402 0.6237 -0.0138 0.0797  -0.0303 487 ASP A OD2 
792  N N   . MET A 101 ? 0.3538 0.1942 0.4648 0.0144  0.0718  -0.0025 488 MET A N   
793  C CA  . MET A 101 ? 0.3868 0.2474 0.4879 0.0149  0.0632  0.0009  488 MET A CA  
794  C C   . MET A 101 ? 0.3658 0.2348 0.4539 0.0058  0.0601  -0.0097 488 MET A C   
795  O O   . MET A 101 ? 0.3314 0.2156 0.4117 0.0066  0.0540  -0.0088 488 MET A O   
796  C CB  . MET A 101 ? 0.4040 0.2738 0.5097 0.0242  0.0616  0.0038  488 MET A CB  
797  C CG  . MET A 101 ? 0.5516 0.4255 0.6644 0.0331  0.0583  0.0190  488 MET A CG  
798  S SD  . MET A 101 ? 0.5790 0.4650 0.7003 0.0439  0.0559  0.0229  488 MET A SD  
799  C CE  . MET A 101 ? 0.2889 0.1600 0.4208 0.0452  0.0666  0.0115  488 MET A CE  
800  N N   . SER A 102 ? 0.3723 0.2314 0.4585 -0.0026 0.0642  -0.0198 489 SER A N   
801  C CA  . SER A 102 ? 0.3932 0.2603 0.4673 -0.0112 0.0612  -0.0301 489 SER A CA  
802  C C   . SER A 102 ? 0.3874 0.2707 0.4529 -0.0132 0.0531  -0.0242 489 SER A C   
803  O O   . SER A 102 ? 0.3782 0.2737 0.4350 -0.0137 0.0488  -0.0274 489 SER A O   
804  C CB  . SER A 102 ? 0.4210 0.2761 0.4951 -0.0210 0.0655  -0.0397 489 SER A CB  
805  O OG  . SER A 102 ? 0.3742 0.2137 0.4543 -0.0201 0.0736  -0.0481 489 SER A OG  
806  N N   . VAL A 103 ? 0.4185 0.3015 0.4867 -0.0141 0.0515  -0.0154 490 VAL A N   
807  C CA  . VAL A 103 ? 0.4565 0.3540 0.5173 -0.0159 0.0449  -0.0102 490 VAL A CA  
808  C C   . VAL A 103 ? 0.4891 0.3986 0.5464 -0.0080 0.0400  -0.0039 490 VAL A C   
809  O O   . VAL A 103 ? 0.4122 0.3344 0.4611 -0.0092 0.0348  -0.0046 490 VAL A O   
810  C CB  . VAL A 103 ? 0.3423 0.2366 0.4073 -0.0181 0.0456  -0.0015 490 VAL A CB  
811  C CG1 . VAL A 103 ? 0.4071 0.3171 0.4647 -0.0193 0.0396  0.0035  490 VAL A CG1 
812  C CG2 . VAL A 103 ? 0.2517 0.1344 0.3211 -0.0274 0.0503  -0.0085 490 VAL A CG2 
813  N N   . LEU A 104 ? 0.4196 0.3251 0.4840 0.0000  0.0417  0.0021  491 LEU A N   
814  C CA  . LEU A 104 ? 0.3606 0.2776 0.4232 0.0070  0.0370  0.0074  491 LEU A CA  
815  C C   . LEU A 104 ? 0.2916 0.2155 0.3488 0.0060  0.0357  -0.0013 491 LEU A C   
816  O O   . LEU A 104 ? 0.2439 0.1798 0.2939 0.0063  0.0305  -0.0006 491 LEU A O   
817  C CB  . LEU A 104 ? 0.3337 0.2457 0.4067 0.0156  0.0391  0.0148  491 LEU A CB  
818  C CG  . LEU A 104 ? 0.4827 0.4073 0.5547 0.0224  0.0331  0.0237  491 LEU A CG  
819  C CD1 . LEU A 104 ? 0.5750 0.5013 0.6442 0.0231  0.0306  0.0344  491 LEU A CD1 
820  C CD2 . LEU A 104 ? 0.4734 0.3967 0.5562 0.0306  0.0346  0.0269  491 LEU A CD2 
821  N N   . LEU A 105 ? 0.3221 0.2378 0.3825 0.0047  0.0410  -0.0098 492 LEU A N   
822  C CA  . LEU A 105 ? 0.3344 0.2557 0.3905 0.0045  0.0413  -0.0173 492 LEU A CA  
823  C C   . LEU A 105 ? 0.3411 0.2680 0.3853 -0.0030 0.0389  -0.0246 492 LEU A C   
824  O O   . LEU A 105 ? 0.3160 0.2490 0.3547 -0.0034 0.0384  -0.0292 492 LEU A O   
825  C CB  . LEU A 105 ? 0.3492 0.2599 0.4129 0.0065  0.0489  -0.0237 492 LEU A CB  
826  C CG  . LEU A 105 ? 0.4415 0.3532 0.5169 0.0159  0.0504  -0.0178 492 LEU A CG  
827  C CD1 . LEU A 105 ? 0.3083 0.2062 0.3941 0.0185  0.0591  -0.0226 492 LEU A CD1 
828  C CD2 . LEU A 105 ? 0.3765 0.3016 0.4490 0.0180  0.0474  -0.0188 492 LEU A CD2 
829  N N   . GLU A 106 ? 0.3008 0.2261 0.3415 -0.0091 0.0376  -0.0251 493 GLU A N   
830  C CA  . GLU A 106 ? 0.2991 0.2306 0.3296 -0.0161 0.0348  -0.0315 493 GLU A CA  
831  C C   . GLU A 106 ? 0.3922 0.3366 0.4165 -0.0159 0.0281  -0.0258 493 GLU A C   
832  O O   . GLU A 106 ? 0.4297 0.3804 0.4470 -0.0212 0.0252  -0.0292 493 GLU A O   
833  C CB  . GLU A 106 ? 0.3150 0.2387 0.3463 -0.0239 0.0374  -0.0373 493 GLU A CB  
834  C CG  . GLU A 106 ? 0.4575 0.3797 0.4937 -0.0257 0.0363  -0.0304 493 GLU A CG  
835  C CD  . GLU A 106 ? 0.5339 0.4464 0.5735 -0.0339 0.0399  -0.0368 493 GLU A CD  
836  O OE1 . GLU A 106 ? 0.4241 0.3296 0.4620 -0.0377 0.0435  -0.0471 493 GLU A OE1 
837  O OE2 . GLU A 106 ? 0.6344 0.5462 0.6782 -0.0369 0.0394  -0.0317 493 GLU A OE2 
838  N N   . GLN A 107 ? 0.3487 0.2974 0.3757 -0.0099 0.0256  -0.0173 494 GLN A N   
839  C CA  . GLN A 107 ? 0.3606 0.3204 0.3815 -0.0095 0.0200  -0.0128 494 GLN A CA  
840  C C   . GLN A 107 ? 0.2599 0.2266 0.2750 -0.0076 0.0177  -0.0151 494 GLN A C   
841  O O   . GLN A 107 ? 0.2172 0.1851 0.2352 -0.0027 0.0177  -0.0130 494 GLN A O   
842  C CB  . GLN A 107 ? 0.3601 0.3218 0.3845 -0.0045 0.0183  -0.0034 494 GLN A CB  
843  C CG  . GLN A 107 ? 0.4435 0.3975 0.4741 -0.0056 0.0212  0.0009  494 GLN A CG  
844  C CD  . GLN A 107 ? 0.5368 0.4911 0.5659 -0.0129 0.0216  -0.0017 494 GLN A CD  
845  O OE1 . GLN A 107 ? 0.5530 0.5170 0.5765 -0.0151 0.0181  -0.0022 494 GLN A OE1 
846  N NE2 . GLN A 107 ? 0.4798 0.4236 0.5151 -0.0168 0.0261  -0.0036 494 GLN A NE2 
847  N N   . ASP A 108 ? 0.2745 0.2467 0.2820 -0.0117 0.0155  -0.0189 495 ASP A N   
848  C CA  . ASP A 108 ? 0.3326 0.3100 0.3341 -0.0108 0.0141  -0.0210 495 ASP A CA  
849  C C   . ASP A 108 ? 0.2734 0.2564 0.2749 -0.0059 0.0109  -0.0155 495 ASP A C   
850  O O   . ASP A 108 ? 0.2186 0.2030 0.2195 -0.0039 0.0112  -0.0163 495 ASP A O   
851  C CB  . ASP A 108 ? 0.3271 0.3098 0.3202 -0.0156 0.0117  -0.0243 495 ASP A CB  
852  C CG  . ASP A 108 ? 0.4418 0.4203 0.4331 -0.0213 0.0144  -0.0316 495 ASP A CG  
853  O OD1 . ASP A 108 ? 0.6243 0.5945 0.6196 -0.0211 0.0192  -0.0354 495 ASP A OD1 
854  O OD2 . ASP A 108 ? 0.4904 0.4742 0.4763 -0.0259 0.0117  -0.0338 495 ASP A OD2 
855  N N   . ILE A 109 ? 0.1923 0.1784 0.1943 -0.0045 0.0081  -0.0102 496 ILE A N   
856  C CA  . ILE A 109 ? 0.2162 0.2076 0.2164 -0.0006 0.0049  -0.0062 496 ILE A CA  
857  C C   . ILE A 109 ? 0.2058 0.1959 0.2117 0.0035  0.0054  -0.0043 496 ILE A C   
858  O O   . ILE A 109 ? 0.2914 0.2855 0.2964 0.0056  0.0033  -0.0038 496 ILE A O   
859  C CB  . ILE A 109 ? 0.2987 0.2940 0.2975 0.0001  0.0026  -0.0015 496 ILE A CB  
860  C CG1 . ILE A 109 ? 0.2882 0.2888 0.2831 0.0033  -0.0005 0.0006  496 ILE A CG1 
861  C CG2 . ILE A 109 ? 0.2782 0.2700 0.2824 0.0015  0.0042  0.0029  496 ILE A CG2 
862  C CD1 . ILE A 109 ? 0.2218 0.2252 0.2115 0.0022  -0.0018 -0.0022 496 ILE A CD1 
863  N N   . PHE A 110 ? 0.2493 0.2340 0.2620 0.0047  0.0082  -0.0032 497 PHE A N   
864  C CA  . PHE A 110 ? 0.1832 0.1682 0.2030 0.0094  0.0083  -0.0006 497 PHE A CA  
865  C C   . PHE A 110 ? 0.2548 0.2406 0.2766 0.0094  0.0102  -0.0052 497 PHE A C   
866  O O   . PHE A 110 ? 0.3301 0.3214 0.3543 0.0118  0.0081  -0.0040 497 PHE A O   
867  C CB  . PHE A 110 ? 0.2185 0.1966 0.2463 0.0114  0.0114  0.0024  497 PHE A CB  
868  C CG  . PHE A 110 ? 0.2509 0.2304 0.2876 0.0169  0.0116  0.0054  497 PHE A CG  
869  C CD1 . PHE A 110 ? 0.1967 0.1722 0.2405 0.0180  0.0160  0.0014  497 PHE A CD1 
870  C CD2 . PHE A 110 ? 0.2644 0.2504 0.3022 0.0211  0.0071  0.0120  497 PHE A CD2 
871  C CE1 . PHE A 110 ? 0.2830 0.2617 0.3370 0.0235  0.0161  0.0045  497 PHE A CE1 
872  C CE2 . PHE A 110 ? 0.2604 0.2500 0.3072 0.0261  0.0063  0.0151  497 PHE A CE2 
873  C CZ  . PHE A 110 ? 0.1744 0.1607 0.2303 0.0276  0.0107  0.0116  497 PHE A CZ  
874  N N   . HIS A 111 ? 0.2801 0.2610 0.3010 0.0063  0.0144  -0.0108 498 HIS A N   
875  C CA  . HIS A 111 ? 0.2383 0.2197 0.2605 0.0061  0.0176  -0.0154 498 HIS A CA  
876  C C   . HIS A 111 ? 0.2399 0.2276 0.2556 0.0046  0.0149  -0.0158 498 HIS A C   
877  O O   . HIS A 111 ? 0.2354 0.2266 0.2550 0.0060  0.0156  -0.0161 498 HIS A O   
878  C CB  . HIS A 111 ? 0.1855 0.1603 0.2053 0.0024  0.0228  -0.0220 498 HIS A CB  
879  C CG  . HIS A 111 ? 0.2469 0.2133 0.2744 0.0038  0.0267  -0.0225 498 HIS A CG  
880  N ND1 . HIS A 111 ? 0.2280 0.1922 0.2666 0.0087  0.0301  -0.0213 498 HIS A ND1 
881  C CD2 . HIS A 111 ? 0.2707 0.2301 0.2976 0.0008  0.0281  -0.0238 498 HIS A CD2 
882  C CE1 . HIS A 111 ? 0.2532 0.2081 0.2973 0.0093  0.0336  -0.0216 498 HIS A CE1 
883  N NE2 . HIS A 111 ? 0.3137 0.2652 0.3507 0.0041  0.0326  -0.0234 498 HIS A NE2 
884  N N   . ARG A 112 ? 0.2542 0.2432 0.2610 0.0018  0.0121  -0.0156 499 ARG A N   
885  C CA  . ARG A 112 ? 0.2146 0.2078 0.2154 0.0009  0.0098  -0.0153 499 ARG A CA  
886  C C   . ARG A 112 ? 0.1354 0.1328 0.1401 0.0040  0.0065  -0.0118 499 ARG A C   
887  O O   . ARG A 112 ? 0.1889 0.1887 0.1944 0.0038  0.0065  -0.0124 499 ARG A O   
888  C CB  . ARG A 112 ? 0.1732 0.1677 0.1656 -0.0014 0.0071  -0.0147 499 ARG A CB  
889  C CG  . ARG A 112 ? 0.1426 0.1352 0.1300 -0.0054 0.0092  -0.0187 499 ARG A CG  
890  C CD  . ARG A 112 ? 0.2067 0.2028 0.1886 -0.0072 0.0056  -0.0171 499 ARG A CD  
891  N NE  . ARG A 112 ? 0.2063 0.2063 0.1830 -0.0062 0.0031  -0.0147 499 ARG A NE  
892  C CZ  . ARG A 112 ? 0.2805 0.2842 0.2561 -0.0046 -0.0002 -0.0113 499 ARG A CZ  
893  N NH1 . ARG A 112 ? 0.3082 0.3132 0.2869 -0.0043 -0.0013 -0.0097 499 ARG A NH1 
894  N NH2 . ARG A 112 ? 0.3019 0.3073 0.2734 -0.0033 -0.0017 -0.0092 499 ARG A NH2 
895  N N   . SER A 113 ? 0.1674 0.1657 0.1742 0.0063  0.0038  -0.0082 500 SER A N   
896  C CA  . SER A 113 ? 0.1255 0.1285 0.1344 0.0089  0.0000  -0.0054 500 SER A CA  
897  C C   . SER A 113 ? 0.1658 0.1716 0.1839 0.0108  0.0007  -0.0056 500 SER A C   
898  O O   . SER A 113 ? 0.1894 0.1999 0.2092 0.0109  -0.0017 -0.0058 500 SER A O   
899  C CB  . SER A 113 ? 0.1717 0.1756 0.1796 0.0110  -0.0026 -0.0012 500 SER A CB  
900  O OG  . SER A 113 ? 0.1697 0.1733 0.1703 0.0095  -0.0034 -0.0009 500 SER A OG  
901  N N   . LEU A 114 ? 0.1602 0.1633 0.1852 0.0122  0.0041  -0.0058 501 LEU A N   
902  C CA  . LEU A 114 ? 0.1818 0.1887 0.2179 0.0149  0.0052  -0.0054 501 LEU A CA  
903  C C   . LEU A 114 ? 0.1427 0.1518 0.1802 0.0124  0.0081  -0.0094 501 LEU A C   
904  O O   . LEU A 114 ? 0.1737 0.1893 0.2180 0.0130  0.0066  -0.0090 501 LEU A O   
905  C CB  . LEU A 114 ? 0.1353 0.1374 0.1791 0.0175  0.0094  -0.0049 501 LEU A CB  
906  C CG  . LEU A 114 ? 0.2635 0.2701 0.3210 0.0216  0.0111  -0.0039 501 LEU A CG  
907  C CD1 . LEU A 114 ? 0.1653 0.1813 0.2277 0.0247  0.0046  0.0014  501 LEU A CD1 
908  C CD2 . LEU A 114 ? 0.1856 0.1851 0.2507 0.0248  0.0162  -0.0035 501 LEU A CD2 
909  N N   . MET A 115 ? 0.1313 0.1353 0.1620 0.0092  0.0120  -0.0131 502 MET A N   
910  C CA  . MET A 115 ? 0.2739 0.2794 0.3038 0.0065  0.0154  -0.0161 502 MET A CA  
911  C C   . MET A 115 ? 0.2187 0.2275 0.2449 0.0046  0.0116  -0.0149 502 MET A C   
912  O O   . MET A 115 ? 0.2570 0.2694 0.2881 0.0033  0.0131  -0.0156 502 MET A O   
913  C CB  . MET A 115 ? 0.3356 0.3356 0.3563 0.0034  0.0197  -0.0197 502 MET A CB  
914  C CG  . MET A 115 ? 0.3816 0.3828 0.4000 0.0007  0.0241  -0.0221 502 MET A CG  
915  S SD  . MET A 115 ? 0.3990 0.4048 0.4323 0.0028  0.0295  -0.0236 502 MET A SD  
916  C CE  . MET A 115 ? 0.3311 0.3399 0.3607 -0.0012 0.0326  -0.0240 502 MET A CE  
917  N N   . ALA A 116 ? 0.2446 0.2519 0.2630 0.0044  0.0074  -0.0131 503 ALA A N   
918  C CA  . ALA A 116 ? 0.3122 0.3211 0.3273 0.0030  0.0042  -0.0125 503 ALA A CA  
919  C C   . ALA A 116 ? 0.2297 0.2446 0.2530 0.0043  0.0007  -0.0118 503 ALA A C   
920  O O   . ALA A 116 ? 0.1662 0.1832 0.1920 0.0021  0.0001  -0.0129 503 ALA A O   
921  C CB  . ALA A 116 ? 0.1240 0.1302 0.1299 0.0033  0.0011  -0.0111 503 ALA A CB  
922  N N   . CYS A 117 ? 0.2136 0.2315 0.2412 0.0075  -0.0019 -0.0097 504 CYS A N   
923  C CA  . CYS A 117 ? 0.2622 0.2877 0.2974 0.0090  -0.0062 -0.0086 504 CYS A CA  
924  C C   . CYS A 117 ? 0.2059 0.2368 0.2532 0.0083  -0.0036 -0.0100 504 CYS A C   
925  O O   . CYS A 117 ? 0.2693 0.3070 0.3225 0.0068  -0.0065 -0.0108 504 CYS A O   
926  C CB  . CYS A 117 ? 0.2414 0.2693 0.2784 0.0132  -0.0092 -0.0046 504 CYS A CB  
927  S SG  . CYS A 117 ? 0.3344 0.3727 0.3746 0.0146  -0.0168 -0.0029 504 CYS A SG  
928  N N   . CYS A 118 ? 0.2187 0.2470 0.2699 0.0091  0.0021  -0.0107 505 CYS A N   
929  C CA  . CYS A 118 ? 0.2797 0.3136 0.3429 0.0087  0.0060  -0.0122 505 CYS A CA  
930  C C   . CYS A 118 ? 0.2553 0.2891 0.3162 0.0036  0.0079  -0.0146 505 CYS A C   
931  O O   . CYS A 118 ? 0.2399 0.2812 0.3112 0.0019  0.0078  -0.0153 505 CYS A O   
932  C CB  . CYS A 118 ? 0.3521 0.3819 0.4183 0.0106  0.0129  -0.0134 505 CYS A CB  
933  S SG  . CYS A 118 ? 0.3133 0.3430 0.3878 0.0171  0.0122  -0.0100 505 CYS A SG  
934  N N   . LEU A 119 ? 0.2407 0.2665 0.2889 0.0011  0.0096  -0.0154 506 LEU A N   
935  C CA  . LEU A 119 ? 0.2855 0.3094 0.3305 -0.0034 0.0117  -0.0164 506 LEU A CA  
936  C C   . LEU A 119 ? 0.2561 0.2830 0.3035 -0.0053 0.0062  -0.0165 506 LEU A C   
937  O O   . LEU A 119 ? 0.2011 0.2306 0.2545 -0.0090 0.0076  -0.0176 506 LEU A O   
938  C CB  . LEU A 119 ? 0.2788 0.2941 0.3094 -0.0047 0.0135  -0.0160 506 LEU A CB  
939  C CG  . LEU A 119 ? 0.2882 0.3008 0.3151 -0.0053 0.0200  -0.0171 506 LEU A CG  
940  C CD1 . LEU A 119 ? 0.1370 0.1433 0.1496 -0.0058 0.0196  -0.0165 506 LEU A CD1 
941  C CD2 . LEU A 119 ? 0.2053 0.2200 0.2364 -0.0084 0.0258  -0.0177 506 LEU A CD2 
942  N N   . GLU A 120 ? 0.2557 0.2824 0.2984 -0.0030 0.0004  -0.0158 507 GLU A N   
943  C CA  . GLU A 120 ? 0.2373 0.2667 0.2805 -0.0047 -0.0050 -0.0171 507 GLU A CA  
944  C C   . GLU A 120 ? 0.2391 0.2797 0.2964 -0.0055 -0.0076 -0.0180 507 GLU A C   
945  O O   . GLU A 120 ? 0.2672 0.3105 0.3285 -0.0096 -0.0096 -0.0205 507 GLU A O   
946  C CB  . GLU A 120 ? 0.2578 0.2856 0.2923 -0.0017 -0.0099 -0.0161 507 GLU A CB  
947  C CG  . GLU A 120 ? 0.2576 0.2887 0.2912 -0.0031 -0.0156 -0.0183 507 GLU A CG  
948  C CD  . GLU A 120 ? 0.3501 0.3747 0.3803 -0.0074 -0.0143 -0.0214 507 GLU A CD  
949  O OE1 . GLU A 120 ? 0.4055 0.4219 0.4305 -0.0081 -0.0097 -0.0204 507 GLU A OE1 
950  O OE2 . GLU A 120 ? 0.4608 0.4884 0.4934 -0.0102 -0.0180 -0.0248 507 GLU A OE2 
951  N N   . ILE A 121 ? 0.2017 0.2489 0.2672 -0.0016 -0.0077 -0.0159 508 ILE A N   
952  C CA  . ILE A 121 ? 0.2337 0.2937 0.3148 -0.0015 -0.0101 -0.0159 508 ILE A CA  
953  C C   . ILE A 121 ? 0.2533 0.3162 0.3439 -0.0063 -0.0053 -0.0182 508 ILE A C   
954  O O   . ILE A 121 ? 0.1923 0.2635 0.2920 -0.0100 -0.0084 -0.0200 508 ILE A O   
955  C CB  . ILE A 121 ? 0.2443 0.3093 0.3338 0.0045  -0.0092 -0.0125 508 ILE A CB  
956  C CG1 . ILE A 121 ? 0.3020 0.3664 0.3846 0.0089  -0.0148 -0.0091 508 ILE A CG1 
957  C CG2 . ILE A 121 ? 0.1974 0.2766 0.3055 0.0050  -0.0103 -0.0121 508 ILE A CG2 
958  C CD1 . ILE A 121 ? 0.4215 0.4944 0.5037 0.0077  -0.0231 -0.0095 508 ILE A CD1 
959  N N   . VAL A 122 ? 0.1253 0.1817 0.2134 -0.0066 0.0025  -0.0181 509 VAL A N   
960  C CA  . VAL A 122 ? 0.1859 0.2447 0.2821 -0.0109 0.0087  -0.0194 509 VAL A CA  
961  C C   . VAL A 122 ? 0.2422 0.2966 0.3344 -0.0172 0.0080  -0.0211 509 VAL A C   
962  O O   . VAL A 122 ? 0.1925 0.2538 0.2962 -0.0218 0.0082  -0.0226 509 VAL A O   
963  C CB  . VAL A 122 ? 0.2643 0.3162 0.3550 -0.0098 0.0173  -0.0190 509 VAL A CB  
964  C CG1 . VAL A 122 ? 0.2781 0.3315 0.3742 -0.0147 0.0246  -0.0198 509 VAL A CG1 
965  C CG2 . VAL A 122 ? 0.1923 0.2479 0.2896 -0.0040 0.0192  -0.0183 509 VAL A CG2 
966  N N   . LEU A 123 ? 0.2359 0.2785 0.3125 -0.0174 0.0072  -0.0208 510 LEU A N   
967  C CA  . LEU A 123 ? 0.1986 0.2343 0.2704 -0.0224 0.0067  -0.0221 510 LEU A CA  
968  C C   . LEU A 123 ? 0.2301 0.2724 0.3093 -0.0254 0.0001  -0.0253 510 LEU A C   
969  O O   . LEU A 123 ? 0.2168 0.2587 0.3018 -0.0313 0.0011  -0.0274 510 LEU A O   
970  C CB  . LEU A 123 ? 0.1394 0.1631 0.1945 -0.0203 0.0059  -0.0209 510 LEU A CB  
971  C CG  . LEU A 123 ? 0.2261 0.2428 0.2722 -0.0192 0.0121  -0.0181 510 LEU A CG  
972  C CD1 . LEU A 123 ? 0.1415 0.1491 0.1731 -0.0165 0.0100  -0.0166 510 LEU A CD1 
973  C CD2 . LEU A 123 ? 0.1474 0.1611 0.1959 -0.0240 0.0185  -0.0170 510 LEU A CD2 
974  N N   . PHE A 124 ? 0.2788 0.3271 0.3573 -0.0216 -0.0067 -0.0257 511 PHE A N   
975  C CA  . PHE A 124 ? 0.2652 0.3213 0.3491 -0.0244 -0.0139 -0.0292 511 PHE A CA  
976  C C   . PHE A 124 ? 0.2586 0.3284 0.3612 -0.0281 -0.0140 -0.0303 511 PHE A C   
977  O O   . PHE A 124 ? 0.1970 0.2699 0.3058 -0.0344 -0.0164 -0.0343 511 PHE A O   
978  C CB  . PHE A 124 ? 0.2860 0.3475 0.3650 -0.0191 -0.0209 -0.0281 511 PHE A CB  
979  C CG  . PHE A 124 ? 0.3174 0.3898 0.4016 -0.0217 -0.0289 -0.0316 511 PHE A CG  
980  C CD1 . PHE A 124 ? 0.3420 0.4091 0.4197 -0.0267 -0.0317 -0.0369 511 PHE A CD1 
981  C CD2 . PHE A 124 ? 0.3389 0.4270 0.4344 -0.0192 -0.0338 -0.0296 511 PHE A CD2 
982  C CE1 . PHE A 124 ? 0.3246 0.4022 0.4059 -0.0299 -0.0395 -0.0412 511 PHE A CE1 
983  C CE2 . PHE A 124 ? 0.3721 0.4719 0.4716 -0.0218 -0.0422 -0.0327 511 PHE A CE2 
984  C CZ  . PHE A 124 ? 0.3823 0.4770 0.4741 -0.0276 -0.0451 -0.0390 511 PHE A CZ  
985  N N   . ALA A 125 ? 0.1938 0.2715 0.3061 -0.0244 -0.0109 -0.0272 512 ALA A N   
986  C CA  . ALA A 125 ? 0.1860 0.2790 0.3183 -0.0267 -0.0106 -0.0277 512 ALA A CA  
987  C C   . ALA A 125 ? 0.1924 0.2835 0.3316 -0.0346 -0.0049 -0.0299 512 ALA A C   
988  O O   . ALA A 125 ? 0.2669 0.3705 0.4224 -0.0393 -0.0065 -0.0319 512 ALA A O   
989  C CB  . ALA A 125 ? 0.1293 0.2282 0.2698 -0.0203 -0.0061 -0.0239 512 ALA A CB  
990  N N   . TYR A 126 ? 0.2074 0.2833 0.3348 -0.0361 0.0018  -0.0290 513 TYR A N   
991  C CA  . TYR A 126 ? 0.2507 0.3222 0.3826 -0.0433 0.0084  -0.0296 513 TYR A CA  
992  C C   . TYR A 126 ? 0.2192 0.2806 0.3445 -0.0491 0.0055  -0.0328 513 TYR A C   
993  O O   . TYR A 126 ? 0.3002 0.3549 0.4278 -0.0553 0.0110  -0.0328 513 TYR A O   
994  C CB  . TYR A 126 ? 0.1687 0.2301 0.2916 -0.0415 0.0179  -0.0259 513 TYR A CB  
995  C CG  . TYR A 126 ? 0.2610 0.3326 0.3948 -0.0387 0.0240  -0.0242 513 TYR A CG  
996  C CD1 . TYR A 126 ? 0.2843 0.3632 0.4323 -0.0438 0.0308  -0.0240 513 TYR A CD1 
997  C CD2 . TYR A 126 ? 0.1900 0.2636 0.3207 -0.0312 0.0235  -0.0230 513 TYR A CD2 
998  C CE1 . TYR A 126 ? 0.2762 0.3646 0.4346 -0.0407 0.0373  -0.0230 513 TYR A CE1 
999  C CE2 . TYR A 126 ? 0.2495 0.3313 0.3907 -0.0282 0.0297  -0.0222 513 TYR A CE2 
1000 C CZ  . TYR A 126 ? 0.3132 0.4027 0.4681 -0.0327 0.0367  -0.0223 513 TYR A CZ  
1001 O OH  . TYR A 126 ? 0.2754 0.3731 0.4409 -0.0292 0.0438  -0.0220 513 TYR A OH  
1002 N N   . SER A 127 ? 0.2036 0.2634 0.3208 -0.0471 -0.0026 -0.0355 514 SER A N   
1003 C CA  . SER A 127 ? 0.2305 0.2790 0.3395 -0.0515 -0.0051 -0.0395 514 SER A CA  
1004 C C   . SER A 127 ? 0.2496 0.2801 0.3462 -0.0512 0.0019  -0.0364 514 SER A C   
1005 O O   . SER A 127 ? 0.2562 0.2771 0.3537 -0.0570 0.0052  -0.0376 514 SER A O   
1006 C CB  . SER A 127 ? 0.1707 0.2250 0.2938 -0.0607 -0.0067 -0.0445 514 SER A CB  
1007 O OG  . SER A 127 ? 0.4067 0.4786 0.5399 -0.0612 -0.0152 -0.0479 514 SER A OG  
1008 N N   . SER A 128 ? 0.2613 0.2874 0.3470 -0.0444 0.0041  -0.0320 515 SER A N   
1009 C CA  . SER A 128 ? 0.2223 0.2337 0.2957 -0.0431 0.0098  -0.0282 515 SER A CA  
1010 C C   . SER A 128 ? 0.2810 0.2796 0.3450 -0.0437 0.0073  -0.0304 515 SER A C   
1011 O O   . SER A 128 ? 0.2587 0.2593 0.3194 -0.0420 0.0009  -0.0344 515 SER A O   
1012 C CB  . SER A 128 ? 0.2024 0.2135 0.2661 -0.0360 0.0109  -0.0243 515 SER A CB  
1013 O OG  . SER A 128 ? 0.2688 0.2675 0.3203 -0.0347 0.0152  -0.0204 515 SER A OG  
1014 N N   . PRO A 129 ? 0.2195 0.2050 0.2794 -0.0460 0.0129  -0.0277 516 PRO A N   
1015 C CA  . PRO A 129 ? 0.2274 0.1985 0.2779 -0.0451 0.0123  -0.0286 516 PRO A CA  
1016 C C   . PRO A 129 ? 0.3280 0.2961 0.3651 -0.0371 0.0104  -0.0258 516 PRO A C   
1017 O O   . PRO A 129 ? 0.2525 0.2111 0.2821 -0.0348 0.0091  -0.0270 516 PRO A O   
1018 C CB  . PRO A 129 ? 0.2325 0.1917 0.2836 -0.0489 0.0198  -0.0240 516 PRO A CB  
1019 C CG  . PRO A 129 ? 0.1967 0.1635 0.2502 -0.0487 0.0247  -0.0188 516 PRO A CG  
1020 C CD  . PRO A 129 ? 0.1937 0.1773 0.2576 -0.0493 0.0208  -0.0229 516 PRO A CD  
1021 N N   . ARG A 130 ? 0.3352 0.3110 0.3698 -0.0331 0.0107  -0.0224 517 ARG A N   
1022 C CA  . ARG A 130 ? 0.2441 0.2175 0.2671 -0.0266 0.0093  -0.0197 517 ARG A CA  
1023 C C   . ARG A 130 ? 0.3267 0.3075 0.3490 -0.0237 0.0028  -0.0236 517 ARG A C   
1024 O O   . ARG A 130 ? 0.3976 0.3883 0.4229 -0.0219 0.0010  -0.0234 517 ARG A O   
1025 C CB  . ARG A 130 ? 0.1979 0.1748 0.2175 -0.0244 0.0129  -0.0148 517 ARG A CB  
1026 C CG  . ARG A 130 ? 0.2458 0.2160 0.2640 -0.0272 0.0195  -0.0101 517 ARG A CG  
1027 C CD  . ARG A 130 ? 0.1975 0.1730 0.2135 -0.0266 0.0237  -0.0069 517 ARG A CD  
1028 N NE  . ARG A 130 ? 0.2457 0.2139 0.2565 -0.0285 0.0297  -0.0013 517 ARG A NE  
1029 C CZ  . ARG A 130 ? 0.3126 0.2794 0.3303 -0.0339 0.0350  0.0000  517 ARG A CZ  
1030 N NH1 . ARG A 130 ? 0.2968 0.2700 0.3280 -0.0380 0.0348  -0.0045 517 ARG A NH1 
1031 N NH2 . ARG A 130 ? 0.2435 0.2030 0.2549 -0.0351 0.0405  0.0062  517 ARG A NH2 
1032 N N   . THR A 131 ? 0.3163 0.2911 0.3335 -0.0226 0.0001  -0.0266 518 THR A N   
1033 C CA  . THR A 131 ? 0.2861 0.2674 0.3023 -0.0212 -0.0058 -0.0311 518 THR A CA  
1034 C C   . THR A 131 ? 0.2649 0.2476 0.2721 -0.0149 -0.0073 -0.0283 518 THR A C   
1035 O O   . THR A 131 ? 0.2535 0.2289 0.2541 -0.0119 -0.0046 -0.0251 518 THR A O   
1036 C CB  . THR A 131 ? 0.3576 0.3316 0.3721 -0.0238 -0.0074 -0.0372 518 THR A CB  
1037 O OG1 . THR A 131 ? 0.4406 0.4097 0.4633 -0.0303 -0.0046 -0.0390 518 THR A OG1 
1038 C CG2 . THR A 131 ? 0.3048 0.2880 0.3189 -0.0240 -0.0139 -0.0426 518 THR A CG2 
1039 N N   . PHE A 132 ? 0.2837 0.2763 0.2917 -0.0129 -0.0113 -0.0288 519 PHE A N   
1040 C CA  . PHE A 132 ? 0.3593 0.3536 0.3597 -0.0076 -0.0128 -0.0265 519 PHE A CA  
1041 C C   . PHE A 132 ? 0.3628 0.3496 0.3549 -0.0056 -0.0128 -0.0286 519 PHE A C   
1042 O O   . PHE A 132 ? 0.3963 0.3801 0.3883 -0.0081 -0.0142 -0.0337 519 PHE A O   
1043 C CB  . PHE A 132 ? 0.3319 0.3370 0.3345 -0.0063 -0.0175 -0.0270 519 PHE A CB  
1044 C CG  . PHE A 132 ? 0.3169 0.3238 0.3131 -0.0014 -0.0182 -0.0236 519 PHE A CG  
1045 C CD1 . PHE A 132 ? 0.2510 0.2600 0.2494 0.0004  -0.0162 -0.0194 519 PHE A CD1 
1046 C CD2 . PHE A 132 ? 0.2768 0.2829 0.2648 0.0009  -0.0201 -0.0249 519 PHE A CD2 
1047 C CE1 . PHE A 132 ? 0.2072 0.2172 0.2006 0.0039  -0.0165 -0.0164 519 PHE A CE1 
1048 C CE2 . PHE A 132 ? 0.2110 0.2192 0.1939 0.0048  -0.0201 -0.0214 519 PHE A CE2 
1049 C CZ  . PHE A 132 ? 0.2005 0.2105 0.1866 0.0060  -0.0184 -0.0170 519 PHE A CZ  
1050 N N   . PRO A 133 ? 0.2793 0.2633 0.2650 -0.0013 -0.0111 -0.0250 520 PRO A N   
1051 C CA  . PRO A 133 ? 0.2955 0.2832 0.2808 0.0008  -0.0100 -0.0200 520 PRO A CA  
1052 C C   . PRO A 133 ? 0.3295 0.3129 0.3153 0.0000  -0.0061 -0.0164 520 PRO A C   
1053 O O   . PRO A 133 ? 0.3019 0.2859 0.2838 0.0025  -0.0052 -0.0130 520 PRO A O   
1054 C CB  . PRO A 133 ? 0.2740 0.2619 0.2525 0.0052  -0.0105 -0.0187 520 PRO A CB  
1055 C CG  . PRO A 133 ? 0.2198 0.1994 0.1952 0.0059  -0.0090 -0.0210 520 PRO A CG  
1056 C CD  . PRO A 133 ? 0.2043 0.1818 0.1834 0.0017  -0.0102 -0.0263 520 PRO A CD  
1057 N N   . TRP A 134 ? 0.2680 0.2486 0.2587 -0.0038 -0.0039 -0.0170 521 TRP A N   
1058 C CA  . TRP A 134 ? 0.2667 0.2432 0.2561 -0.0047 0.0002  -0.0130 521 TRP A CA  
1059 C C   . TRP A 134 ? 0.3156 0.2981 0.3040 -0.0037 0.0009  -0.0106 521 TRP A C   
1060 O O   . TRP A 134 ? 0.2176 0.1987 0.2001 -0.0021 0.0021  -0.0073 521 TRP A O   
1061 C CB  . TRP A 134 ? 0.2323 0.2061 0.2281 -0.0096 0.0030  -0.0138 521 TRP A CB  
1062 C CG  . TRP A 134 ? 0.1846 0.1543 0.1782 -0.0108 0.0078  -0.0091 521 TRP A CG  
1063 C CD1 . TRP A 134 ? 0.2242 0.1846 0.2140 -0.0106 0.0105  -0.0056 521 TRP A CD1 
1064 C CD2 . TRP A 134 ? 0.2302 0.2049 0.2247 -0.0123 0.0108  -0.0073 521 TRP A CD2 
1065 N NE1 . TRP A 134 ? 0.1978 0.1579 0.1850 -0.0120 0.0146  -0.0009 521 TRP A NE1 
1066 C CE2 . TRP A 134 ? 0.1764 0.1451 0.1660 -0.0132 0.0150  -0.0025 521 TRP A CE2 
1067 C CE3 . TRP A 134 ? 0.2160 0.1991 0.2149 -0.0125 0.0107  -0.0091 521 TRP A CE3 
1068 C CZ2 . TRP A 134 ? 0.2660 0.2377 0.2536 -0.0148 0.0192  -0.0002 521 TRP A CZ2 
1069 C CZ3 . TRP A 134 ? 0.1539 0.1390 0.1519 -0.0138 0.0153  -0.0073 521 TRP A CZ3 
1070 C CH2 . TRP A 134 ? 0.2825 0.2623 0.2742 -0.0152 0.0195  -0.0032 521 TRP A CH2 
1071 N N   . ILE A 135 ? 0.2522 0.2414 0.2463 -0.0046 -0.0001 -0.0125 522 ILE A N   
1072 C CA  . ILE A 135 ? 0.2221 0.2153 0.2164 -0.0041 0.0016  -0.0113 522 ILE A CA  
1073 C C   . ILE A 135 ? 0.1966 0.1904 0.1846 -0.0010 0.0000  -0.0098 522 ILE A C   
1074 O O   . ILE A 135 ? 0.1836 0.1774 0.1678 -0.0012 0.0020  -0.0084 522 ILE A O   
1075 C CB  . ILE A 135 ? 0.2129 0.2130 0.2166 -0.0046 0.0011  -0.0132 522 ILE A CB  
1076 C CG1 . ILE A 135 ? 0.2267 0.2289 0.2313 -0.0041 0.0043  -0.0127 522 ILE A CG1 
1077 C CG2 . ILE A 135 ? 0.2564 0.2606 0.2619 -0.0024 -0.0039 -0.0143 522 ILE A CG2 
1078 C CD1 . ILE A 135 ? 0.3098 0.3094 0.3120 -0.0067 0.0096  -0.0121 522 ILE A CD1 
1079 N N   . ILE A 136 ? 0.1891 0.1840 0.1756 0.0013  -0.0034 -0.0102 523 ILE A N   
1080 C CA  . ILE A 136 ? 0.1903 0.1868 0.1725 0.0037  -0.0044 -0.0085 523 ILE A CA  
1081 C C   . ILE A 136 ? 0.2481 0.2417 0.2242 0.0050  -0.0041 -0.0063 523 ILE A C   
1082 O O   . ILE A 136 ? 0.2960 0.2922 0.2694 0.0061  -0.0046 -0.0048 523 ILE A O   
1083 C CB  . ILE A 136 ? 0.1623 0.1621 0.1451 0.0059  -0.0074 -0.0090 523 ILE A CB  
1084 C CG1 . ILE A 136 ? 0.1462 0.1440 0.1271 0.0066  -0.0091 -0.0108 523 ILE A CG1 
1085 C CG2 . ILE A 136 ? 0.1864 0.1902 0.1754 0.0056  -0.0081 -0.0095 523 ILE A CG2 
1086 C CD1 . ILE A 136 ? 0.2584 0.2593 0.2361 0.0093  -0.0112 -0.0107 523 ILE A CD1 
1087 N N   . GLU A 137 ? 0.2693 0.2580 0.2444 0.0049  -0.0033 -0.0060 524 GLU A N   
1088 C CA  . GLU A 137 ? 0.3071 0.2932 0.2776 0.0069  -0.0027 -0.0028 524 GLU A CA  
1089 C C   . GLU A 137 ? 0.2713 0.2577 0.2389 0.0051  -0.0008 -0.0001 524 GLU A C   
1090 O O   . GLU A 137 ? 0.2990 0.2879 0.2624 0.0063  -0.0015 0.0028  524 GLU A O   
1091 C CB  . GLU A 137 ? 0.3567 0.3357 0.3273 0.0080  -0.0019 -0.0029 524 GLU A CB  
1092 C CG  . GLU A 137 ? 0.4730 0.4519 0.4439 0.0105  -0.0036 -0.0059 524 GLU A CG  
1093 C CD  . GLU A 137 ? 0.6092 0.5795 0.5803 0.0112  -0.0023 -0.0076 524 GLU A CD  
1094 O OE1 . GLU A 137 ? 0.6458 0.6100 0.6185 0.0088  -0.0002 -0.0066 524 GLU A OE1 
1095 O OE2 . GLU A 137 ? 0.6740 0.6433 0.6437 0.0140  -0.0028 -0.0099 524 GLU A OE2 
1096 N N   . VAL A 138 ? 0.2506 0.2354 0.2203 0.0019  0.0016  -0.0012 525 VAL A N   
1097 C CA  . VAL A 138 ? 0.2276 0.2129 0.1937 -0.0003 0.0044  0.0007  525 VAL A CA  
1098 C C   . VAL A 138 ? 0.2240 0.2148 0.1877 -0.0009 0.0038  -0.0007 525 VAL A C   
1099 O O   . VAL A 138 ? 0.1887 0.1813 0.1460 -0.0018 0.0044  0.0010  525 VAL A O   
1100 C CB  . VAL A 138 ? 0.2887 0.2721 0.2594 -0.0037 0.0080  -0.0008 525 VAL A CB  
1101 C CG1 . VAL A 138 ? 0.2511 0.2373 0.2189 -0.0061 0.0114  -0.0009 525 VAL A CG1 
1102 C CG2 . VAL A 138 ? 0.2090 0.1855 0.1801 -0.0044 0.0098  0.0018  525 VAL A CG2 
1103 N N   . LEU A 139 ? 0.1874 0.1808 0.1560 -0.0006 0.0026  -0.0038 526 LEU A N   
1104 C CA  . LEU A 139 ? 0.2675 0.2643 0.2355 -0.0016 0.0028  -0.0057 526 LEU A CA  
1105 C C   . LEU A 139 ? 0.2454 0.2452 0.2119 0.0000  -0.0004 -0.0049 526 LEU A C   
1106 O O   . LEU A 139 ? 0.2372 0.2390 0.2040 -0.0013 -0.0004 -0.0066 526 LEU A O   
1107 C CB  . LEU A 139 ? 0.2911 0.2885 0.2665 -0.0020 0.0041  -0.0087 526 LEU A CB  
1108 C CG  . LEU A 139 ? 0.3387 0.3354 0.3179 -0.0038 0.0080  -0.0101 526 LEU A CG  
1109 C CD1 . LEU A 139 ? 0.2995 0.2983 0.2878 -0.0030 0.0086  -0.0123 526 LEU A CD1 
1110 C CD2 . LEU A 139 ? 0.3511 0.3474 0.3238 -0.0062 0.0117  -0.0108 526 LEU A CD2 
1111 N N   . ASN A 140 ? 0.2273 0.2270 0.1930 0.0026  -0.0025 -0.0024 527 ASN A N   
1112 C CA  . ASN A 140 ? 0.2947 0.2983 0.2601 0.0044  -0.0050 -0.0012 527 ASN A CA  
1113 C C   . ASN A 140 ? 0.3464 0.3517 0.3160 0.0044  -0.0054 -0.0028 527 ASN A C   
1114 O O   . ASN A 140 ? 0.3098 0.3186 0.2798 0.0034  -0.0061 -0.0028 527 ASN A O   
1115 C CB  . ASN A 140 ? 0.3070 0.3150 0.2682 0.0030  -0.0060 0.0001  527 ASN A CB  
1116 C CG  . ASN A 140 ? 0.3966 0.4053 0.3543 0.0054  -0.0071 0.0043  527 ASN A CG  
1117 O OD1 . ASN A 140 ? 0.4232 0.4335 0.3828 0.0088  -0.0085 0.0065  527 ASN A OD1 
1118 N ND2 . ASN A 140 ? 0.2961 0.3033 0.2486 0.0039  -0.0060 0.0058  527 ASN A ND2 
1119 N N   . LEU A 141 ? 0.2520 0.2553 0.2251 0.0053  -0.0052 -0.0040 528 LEU A N   
1120 C CA  . LEU A 141 ? 0.2782 0.2831 0.2546 0.0060  -0.0059 -0.0042 528 LEU A CA  
1121 C C   . LEU A 141 ? 0.2491 0.2556 0.2245 0.0088  -0.0075 -0.0030 528 LEU A C   
1122 O O   . LEU A 141 ? 0.2518 0.2565 0.2265 0.0100  -0.0082 -0.0040 528 LEU A O   
1123 C CB  . LEU A 141 ? 0.3248 0.3284 0.3059 0.0055  -0.0051 -0.0057 528 LEU A CB  
1124 C CG  . LEU A 141 ? 0.3180 0.3204 0.3013 0.0032  -0.0024 -0.0073 528 LEU A CG  
1125 C CD1 . LEU A 141 ? 0.2583 0.2601 0.2471 0.0032  -0.0010 -0.0087 528 LEU A CD1 
1126 C CD2 . LEU A 141 ? 0.2194 0.2220 0.2047 0.0030  -0.0021 -0.0068 528 LEU A CD2 
1127 N N   . GLN A 142 ? 0.2067 0.2165 0.1821 0.0095  -0.0078 -0.0013 529 GLN A N   
1128 C CA  . GLN A 142 ? 0.2303 0.2424 0.2041 0.0122  -0.0084 -0.0002 529 GLN A CA  
1129 C C   . GLN A 142 ? 0.2552 0.2668 0.2292 0.0132  -0.0094 -0.0008 529 GLN A C   
1130 O O   . GLN A 142 ? 0.3467 0.3586 0.3237 0.0124  -0.0095 0.0001  529 GLN A O   
1131 C CB  . GLN A 142 ? 0.2893 0.3059 0.2643 0.0120  -0.0077 0.0022  529 GLN A CB  
1132 C CG  . GLN A 142 ? 0.3225 0.3427 0.2978 0.0116  -0.0076 0.0030  529 GLN A CG  
1133 C CD  . GLN A 142 ? 0.5124 0.5342 0.4859 0.0154  -0.0075 0.0036  529 GLN A CD  
1134 O OE1 . GLN A 142 ? 0.4679 0.4897 0.4397 0.0179  -0.0068 0.0033  529 GLN A OE1 
1135 N NE2 . GLN A 142 ? 0.6650 0.6883 0.6386 0.0161  -0.0080 0.0045  529 GLN A NE2 
1136 N N   . PRO A 143 ? 0.2996 0.3106 0.2705 0.0150  -0.0103 -0.0026 530 PRO A N   
1137 C CA  . PRO A 143 ? 0.2559 0.2683 0.2256 0.0157  -0.0122 -0.0037 530 PRO A CA  
1138 C C   . PRO A 143 ? 0.1908 0.2073 0.1597 0.0168  -0.0124 -0.0002 530 PRO A C   
1139 O O   . PRO A 143 ? 0.1591 0.1773 0.1295 0.0170  -0.0142 0.0010  530 PRO A O   
1140 C CB  . PRO A 143 ? 0.2086 0.2194 0.1733 0.0173  -0.0122 -0.0067 530 PRO A CB  
1141 C CG  . PRO A 143 ? 0.2441 0.2506 0.2099 0.0172  -0.0106 -0.0073 530 PRO A CG  
1142 C CD  . PRO A 143 ? 0.2266 0.2354 0.1950 0.0164  -0.0095 -0.0039 530 PRO A CD  
1143 N N   . PHE A 144 ? 0.2581 0.2766 0.2253 0.0177  -0.0105 0.0021  531 PHE A N   
1144 C CA  . PHE A 144 ? 0.1929 0.2148 0.1590 0.0185  -0.0097 0.0062  531 PHE A CA  
1145 C C   . PHE A 144 ? 0.2243 0.2448 0.1961 0.0170  -0.0096 0.0092  531 PHE A C   
1146 O O   . PHE A 144 ? 0.2979 0.3198 0.2695 0.0181  -0.0100 0.0130  531 PHE A O   
1147 C CB  . PHE A 144 ? 0.2114 0.2364 0.1769 0.0190  -0.0069 0.0079  531 PHE A CB  
1148 C CG  . PHE A 144 ? 0.2015 0.2300 0.1663 0.0193  -0.0051 0.0128  531 PHE A CG  
1149 C CD1 . PHE A 144 ? 0.1800 0.2113 0.1381 0.0215  -0.0053 0.0142  531 PHE A CD1 
1150 C CD2 . PHE A 144 ? 0.1762 0.2052 0.1465 0.0168  -0.0031 0.0159  531 PHE A CD2 
1151 C CE1 . PHE A 144 ? 0.2942 0.3285 0.2509 0.0218  -0.0031 0.0198  531 PHE A CE1 
1152 C CE2 . PHE A 144 ? 0.2675 0.2987 0.2378 0.0166  -0.0007 0.0210  531 PHE A CE2 
1153 C CZ  . PHE A 144 ? 0.3783 0.4122 0.3417 0.0193  -0.0006 0.0235  531 PHE A CZ  
1154 N N   . TYR A 145 ? 0.1722 0.1896 0.1487 0.0147  -0.0088 0.0076  532 TYR A N   
1155 C CA  . TYR A 145 ? 0.1838 0.1982 0.1660 0.0133  -0.0078 0.0090  532 TYR A CA  
1156 C C   . TYR A 145 ? 0.2462 0.2595 0.2315 0.0142  -0.0094 0.0078  532 TYR A C   
1157 O O   . TYR A 145 ? 0.3188 0.3318 0.3081 0.0155  -0.0096 0.0107  532 TYR A O   
1158 C CB  . TYR A 145 ? 0.3080 0.3201 0.2928 0.0101  -0.0059 0.0069  532 TYR A CB  
1159 C CG  . TYR A 145 ? 0.3530 0.3680 0.3371 0.0086  -0.0047 0.0083  532 TYR A CG  
1160 C CD1 . TYR A 145 ? 0.3996 0.4167 0.3840 0.0092  -0.0034 0.0124  532 TYR A CD1 
1161 C CD2 . TYR A 145 ? 0.3739 0.3907 0.3575 0.0067  -0.0048 0.0060  532 TYR A CD2 
1162 C CE1 . TYR A 145 ? 0.4174 0.4386 0.4029 0.0074  -0.0019 0.0138  532 TYR A CE1 
1163 C CE2 . TYR A 145 ? 0.3855 0.4071 0.3702 0.0053  -0.0041 0.0074  532 TYR A CE2 
1164 C CZ  . TYR A 145 ? 0.3963 0.4203 0.3827 0.0055  -0.0025 0.0110  532 TYR A CZ  
1165 O OH  . TYR A 145 ? 0.5692 0.5993 0.5584 0.0037  -0.0014 0.0124  532 TYR A OH  
1166 N N   . PHE A 146 ? 0.2826 0.2957 0.2669 0.0136  -0.0105 0.0040  533 PHE A N   
1167 C CA  . PHE A 146 ? 0.2532 0.2661 0.2423 0.0135  -0.0114 0.0022  533 PHE A CA  
1168 C C   . PHE A 146 ? 0.1853 0.2025 0.1762 0.0158  -0.0145 0.0042  533 PHE A C   
1169 O O   . PHE A 146 ? 0.2407 0.2588 0.2385 0.0167  -0.0146 0.0054  533 PHE A O   
1170 C CB  . PHE A 146 ? 0.2512 0.2629 0.2385 0.0120  -0.0116 -0.0017 533 PHE A CB  
1171 C CG  . PHE A 146 ? 0.2624 0.2755 0.2553 0.0113  -0.0125 -0.0036 533 PHE A CG  
1172 C CD1 . PHE A 146 ? 0.2875 0.2992 0.2864 0.0102  -0.0099 -0.0044 533 PHE A CD1 
1173 C CD2 . PHE A 146 ? 0.1994 0.2156 0.1918 0.0115  -0.0157 -0.0052 533 PHE A CD2 
1174 C CE1 . PHE A 146 ? 0.2143 0.2286 0.2199 0.0096  -0.0102 -0.0059 533 PHE A CE1 
1175 C CE2 . PHE A 146 ? 0.2867 0.3057 0.2859 0.0103  -0.0167 -0.0070 533 PHE A CE2 
1176 C CZ  . PHE A 146 ? 0.2249 0.2433 0.2312 0.0095  -0.0138 -0.0070 533 PHE A CZ  
1177 N N   . TYR A 147 ? 0.1983 0.2189 0.1829 0.0170  -0.0170 0.0044  534 TYR A N   
1178 C CA  . TYR A 147 ? 0.2316 0.2579 0.2160 0.0186  -0.0210 0.0055  534 TYR A CA  
1179 C C   . TYR A 147 ? 0.2702 0.2987 0.2597 0.0212  -0.0216 0.0115  534 TYR A C   
1180 O O   . TYR A 147 ? 0.2848 0.3189 0.2781 0.0228  -0.0252 0.0130  534 TYR A O   
1181 C CB  . TYR A 147 ? 0.2196 0.2488 0.1941 0.0195  -0.0228 0.0048  534 TYR A CB  
1182 C CG  . TYR A 147 ? 0.2687 0.2996 0.2388 0.0217  -0.0219 0.0106  534 TYR A CG  
1183 C CD1 . TYR A 147 ? 0.2405 0.2771 0.2090 0.0240  -0.0251 0.0151  534 TYR A CD1 
1184 C CD2 . TYR A 147 ? 0.2301 0.2579 0.1984 0.0213  -0.0179 0.0122  534 TYR A CD2 
1185 C CE1 . TYR A 147 ? 0.2873 0.3250 0.2516 0.0259  -0.0236 0.0216  534 TYR A CE1 
1186 C CE2 . TYR A 147 ? 0.2354 0.2647 0.2007 0.0227  -0.0163 0.0179  534 TYR A CE2 
1187 C CZ  . TYR A 147 ? 0.2150 0.2486 0.1779 0.0250  -0.0188 0.0228  534 TYR A CZ  
1188 O OH  . TYR A 147 ? 0.3063 0.3410 0.2659 0.0263  -0.0167 0.0294  534 TYR A OH  
1189 N N   . LYS A 148 ? 0.3105 0.3347 0.3007 0.0215  -0.0181 0.0151  535 LYS A N   
1190 C CA  . LYS A 148 ? 0.3490 0.3730 0.3441 0.0242  -0.0177 0.0216  535 LYS A CA  
1191 C C   . LYS A 148 ? 0.2812 0.3048 0.2874 0.0255  -0.0176 0.0216  535 LYS A C   
1192 O O   . LYS A 148 ? 0.2908 0.3162 0.3021 0.0289  -0.0186 0.0272  535 LYS A O   
1193 C CB  . LYS A 148 ? 0.4209 0.4387 0.4157 0.0230  -0.0132 0.0243  535 LYS A CB  
1194 C CG  . LYS A 148 ? 0.4699 0.4898 0.4558 0.0227  -0.0127 0.0265  535 LYS A CG  
1195 C CD  . LYS A 148 ? 0.4901 0.5061 0.4779 0.0223  -0.0089 0.0322  535 LYS A CD  
1196 C CE  . LYS A 148 ? 0.4323 0.4427 0.4243 0.0183  -0.0051 0.0287  535 LYS A CE  
1197 N NZ  . LYS A 148 ? 0.3735 0.3773 0.3743 0.0178  -0.0032 0.0277  535 LYS A NZ  
1198 N N   . VAL A 149 ? 0.2092 0.2307 0.2192 0.0231  -0.0158 0.0159  536 VAL A N   
1199 C CA  . VAL A 149 ? 0.1488 0.1701 0.1698 0.0242  -0.0144 0.0153  536 VAL A CA  
1200 C C   . VAL A 149 ? 0.1864 0.2170 0.2125 0.0260  -0.0191 0.0156  536 VAL A C   
1201 O O   . VAL A 149 ? 0.1940 0.2274 0.2308 0.0287  -0.0189 0.0177  536 VAL A O   
1202 C CB  . VAL A 149 ? 0.2767 0.2929 0.2990 0.0207  -0.0102 0.0092  536 VAL A CB  
1203 C CG1 . VAL A 149 ? 0.1485 0.1685 0.1682 0.0182  -0.0121 0.0047  536 VAL A CG1 
1204 C CG2 . VAL A 149 ? 0.2245 0.2381 0.2574 0.0221  -0.0063 0.0087  536 VAL A CG2 
1205 N N   . ILE A 150 ? 0.1757 0.2114 0.1949 0.0243  -0.0232 0.0132  537 ILE A N   
1206 C CA  . ILE A 150 ? 0.2113 0.2567 0.2353 0.0245  -0.0283 0.0120  537 ILE A CA  
1207 C C   . ILE A 150 ? 0.2371 0.2901 0.2668 0.0292  -0.0322 0.0188  537 ILE A C   
1208 O O   . ILE A 150 ? 0.2906 0.3507 0.3319 0.0308  -0.0340 0.0195  537 ILE A O   
1209 C CB  . ILE A 150 ? 0.2314 0.2795 0.2453 0.0217  -0.0320 0.0079  537 ILE A CB  
1210 C CG1 . ILE A 150 ? 0.1748 0.2154 0.1850 0.0177  -0.0282 0.0020  537 ILE A CG1 
1211 C CG2 . ILE A 150 ? 0.2236 0.2826 0.2423 0.0210  -0.0380 0.0062  537 ILE A CG2 
1212 C CD1 . ILE A 150 ? 0.2179 0.2577 0.2175 0.0157  -0.0301 -0.0018 537 ILE A CD1 
1213 N N   . GLU A 151 ? 0.2315 0.2837 0.2536 0.0317  -0.0332 0.0245  538 GLU A N   
1214 C CA  . GLU A 151 ? 0.2704 0.3292 0.2963 0.0368  -0.0369 0.0327  538 GLU A CA  
1215 C C   . GLU A 151 ? 0.2733 0.3278 0.3129 0.0405  -0.0328 0.0369  538 GLU A C   
1216 O O   . GLU A 151 ? 0.2595 0.3212 0.3083 0.0452  -0.0358 0.0427  538 GLU A O   
1217 C CB  . GLU A 151 ? 0.3528 0.4102 0.3664 0.0382  -0.0374 0.0383  538 GLU A CB  
1218 C CG  . GLU A 151 ? 0.5134 0.5789 0.5277 0.0434  -0.0422 0.0478  538 GLU A CG  
1219 C CD  . GLU A 151 ? 0.6494 0.7152 0.6488 0.0440  -0.0429 0.0527  538 GLU A CD  
1220 O OE1 . GLU A 151 ? 0.6455 0.7017 0.6404 0.0427  -0.0371 0.0537  538 GLU A OE1 
1221 O OE2 . GLU A 151 ? 0.6516 0.7281 0.6437 0.0455  -0.0492 0.0554  538 GLU A OE2 
1222 N N   . VAL A 152 ? 0.2068 0.2500 0.2480 0.0386  -0.0259 0.0338  539 VAL A N   
1223 C CA  . VAL A 152 ? 0.2731 0.3106 0.3270 0.0417  -0.0210 0.0360  539 VAL A CA  
1224 C C   . VAL A 152 ? 0.2856 0.3298 0.3518 0.0422  -0.0212 0.0321  539 VAL A C   
1225 O O   . VAL A 152 ? 0.2413 0.2887 0.3203 0.0472  -0.0208 0.0363  539 VAL A O   
1226 C CB  . VAL A 152 ? 0.3148 0.3388 0.3663 0.0386  -0.0137 0.0323  539 VAL A CB  
1227 C CG1 . VAL A 152 ? 0.3310 0.3483 0.3953 0.0418  -0.0082 0.0333  539 VAL A CG1 
1228 C CG2 . VAL A 152 ? 0.2689 0.2874 0.3101 0.0376  -0.0131 0.0362  539 VAL A CG2 
1229 N N   . VAL A 153 ? 0.2688 0.3149 0.3318 0.0372  -0.0213 0.0246  540 VAL A N   
1230 C CA  . VAL A 153 ? 0.2333 0.2866 0.3076 0.0365  -0.0211 0.0206  540 VAL A CA  
1231 C C   . VAL A 153 ? 0.2179 0.2861 0.3008 0.0397  -0.0282 0.0248  540 VAL A C   
1232 O O   . VAL A 153 ? 0.2662 0.3408 0.3642 0.0432  -0.0275 0.0265  540 VAL A O   
1233 C CB  . VAL A 153 ? 0.2122 0.2648 0.2800 0.0300  -0.0206 0.0130  540 VAL A CB  
1234 C CG1 . VAL A 153 ? 0.1473 0.2100 0.2270 0.0287  -0.0217 0.0100  540 VAL A CG1 
1235 C CG2 . VAL A 153 ? 0.1511 0.1916 0.2133 0.0271  -0.0136 0.0089  540 VAL A CG2 
1236 N N   . ILE A 154 ? 0.2368 0.3112 0.3098 0.0386  -0.0351 0.0261  541 ILE A N   
1237 C CA  . ILE A 154 ? 0.3323 0.4223 0.4109 0.0409  -0.0432 0.0295  541 ILE A CA  
1238 C C   . ILE A 154 ? 0.2854 0.3793 0.3744 0.0487  -0.0441 0.0392  541 ILE A C   
1239 O O   . ILE A 154 ? 0.3301 0.4368 0.4331 0.0519  -0.0479 0.0419  541 ILE A O   
1240 C CB  . ILE A 154 ? 0.1795 0.2738 0.2423 0.0383  -0.0498 0.0288  541 ILE A CB  
1241 C CG1 . ILE A 154 ? 0.2094 0.3005 0.2651 0.0311  -0.0491 0.0192  541 ILE A CG1 
1242 C CG2 . ILE A 154 ? 0.1957 0.3071 0.2626 0.0408  -0.0590 0.0331  541 ILE A CG2 
1243 C CD1 . ILE A 154 ? 0.1508 0.2450 0.1914 0.0282  -0.0544 0.0165  541 ILE A CD1 
1244 N N   . ARG A 155 ? 0.2180 0.3007 0.3015 0.0518  -0.0403 0.0446  542 ARG A N   
1245 C CA  . ARG A 155 ? 0.3027 0.3853 0.3960 0.0595  -0.0397 0.0544  542 ARG A CA  
1246 C C   . ARG A 155 ? 0.3608 0.4405 0.4723 0.0628  -0.0334 0.0533  542 ARG A C   
1247 O O   . ARG A 155 ? 0.3843 0.4720 0.5103 0.0694  -0.0352 0.0597  542 ARG A O   
1248 C CB  . ARG A 155 ? 0.3870 0.4560 0.4701 0.0608  -0.0358 0.0597  542 ARG A CB  
1249 C CG  . ARG A 155 ? 0.4901 0.5636 0.5580 0.0608  -0.0416 0.0652  542 ARG A CG  
1250 C CD  . ARG A 155 ? 0.6024 0.6616 0.6620 0.0608  -0.0359 0.0695  542 ARG A CD  
1251 N NE  . ARG A 155 ? 0.6758 0.7236 0.7480 0.0646  -0.0290 0.0730  542 ARG A NE  
1252 C CZ  . ARG A 155 ? 0.7432 0.7758 0.8140 0.0615  -0.0212 0.0696  542 ARG A CZ  
1253 N NH1 . ARG A 155 ? 0.6491 0.6771 0.7072 0.0552  -0.0197 0.0637  542 ARG A NH1 
1254 N NH2 . ARG A 155 ? 0.8397 0.8618 0.9224 0.0649  -0.0150 0.0719  542 ARG A NH2 
1255 N N   . SER A 156 ? 0.3273 0.3958 0.4378 0.0585  -0.0258 0.0453  543 SER A N   
1256 C CA  . SER A 156 ? 0.2857 0.3478 0.4103 0.0615  -0.0178 0.0436  543 SER A CA  
1257 C C   . SER A 156 ? 0.3472 0.4201 0.4860 0.0611  -0.0169 0.0387  543 SER A C   
1258 O O   . SER A 156 ? 0.4699 0.5402 0.6224 0.0649  -0.0104 0.0380  543 SER A O   
1259 C CB  . SER A 156 ? 0.2418 0.2868 0.3576 0.0570  -0.0098 0.0374  543 SER A CB  
1260 O OG  . SER A 156 ? 0.3730 0.4089 0.4776 0.0570  -0.0101 0.0420  543 SER A OG  
1261 N N   . GLU A 157 ? 0.2220 0.3067 0.3580 0.0564  -0.0228 0.0350  544 GLU A N   
1262 C CA  . GLU A 157 ? 0.3342 0.4309 0.4851 0.0555  -0.0224 0.0312  544 GLU A CA  
1263 C C   . GLU A 157 ? 0.4280 0.5441 0.5841 0.0559  -0.0328 0.0345  544 GLU A C   
1264 O O   . GLU A 157 ? 0.4960 0.6159 0.6405 0.0501  -0.0387 0.0312  544 GLU A O   
1265 C CB  . GLU A 157 ? 0.3888 0.4802 0.5329 0.0474  -0.0176 0.0216  544 GLU A CB  
1266 C CG  . GLU A 157 ? 0.4090 0.5121 0.5685 0.0455  -0.0157 0.0176  544 GLU A CG  
1267 C CD  . GLU A 157 ? 0.3807 0.4877 0.5600 0.0525  -0.0101 0.0203  544 GLU A CD  
1268 O OE1 . GLU A 157 ? 0.3280 0.4225 0.5072 0.0537  -0.0007 0.0175  544 GLU A OE1 
1269 O OE2 . GLU A 157 ? 0.3765 0.4995 0.5717 0.0569  -0.0151 0.0250  544 GLU A OE2 
1270 N N   . GLU A 158 ? 0.2971 0.4255 0.4713 0.0627  -0.0351 0.0406  545 GLU A N   
1271 C CA  . GLU A 158 ? 0.4157 0.5646 0.5962 0.0640  -0.0461 0.0447  545 GLU A CA  
1272 C C   . GLU A 158 ? 0.2217 0.3852 0.4153 0.0588  -0.0473 0.0382  545 GLU A C   
1273 O O   . GLU A 158 ? 0.3053 0.4867 0.5035 0.0570  -0.0566 0.0389  545 GLU A O   
1274 C CB  . GLU A 158 ? 0.5122 0.6691 0.7067 0.0746  -0.0489 0.0560  545 GLU A CB  
1275 C CG  . GLU A 158 ? 0.6309 0.7791 0.8116 0.0790  -0.0516 0.0647  545 GLU A CG  
1276 C CD  . GLU A 158 ? 0.7552 0.9180 0.9257 0.0779  -0.0640 0.0689  545 GLU A CD  
1277 O OE1 . GLU A 158 ? 0.8081 0.9906 0.9915 0.0822  -0.0718 0.0746  545 GLU A OE1 
1278 O OE2 . GLU A 158 ? 0.7434 0.8988 0.8929 0.0729  -0.0659 0.0665  545 GLU A OE2 
1279 N N   . GLY A 159 ? 0.1780 0.3339 0.3772 0.0561  -0.0375 0.0319  546 GLY A N   
1280 C CA  . GLY A 159 ? 0.2227 0.3903 0.4344 0.0506  -0.0364 0.0258  546 GLY A CA  
1281 C C   . GLY A 159 ? 0.2770 0.4424 0.4744 0.0402  -0.0395 0.0184  546 GLY A C   
1282 O O   . GLY A 159 ? 0.2643 0.4399 0.4710 0.0344  -0.0400 0.0135  546 GLY A O   
1283 N N   . LEU A 160 ? 0.2500 0.4019 0.4257 0.0380  -0.0410 0.0176  547 LEU A N   
1284 C CA  . LEU A 160 ? 0.2622 0.4113 0.4240 0.0292  -0.0442 0.0110  547 LEU A CA  
1285 C C   . LEU A 160 ? 0.2492 0.4165 0.4151 0.0265  -0.0553 0.0107  547 LEU A C   
1286 O O   . LEU A 160 ? 0.3465 0.5241 0.5141 0.0318  -0.0628 0.0170  547 LEU A O   
1287 C CB  . LEU A 160 ? 0.2095 0.3420 0.3485 0.0286  -0.0437 0.0109  547 LEU A CB  
1288 C CG  . LEU A 160 ? 0.2648 0.3791 0.3967 0.0296  -0.0338 0.0100  547 LEU A CG  
1289 C CD1 . LEU A 160 ? 0.2960 0.3974 0.4070 0.0280  -0.0345 0.0095  547 LEU A CD1 
1290 C CD2 . LEU A 160 ? 0.2361 0.3467 0.3729 0.0245  -0.0263 0.0038  547 LEU A CD2 
1291 N N   . SER A 161 ? 0.2699 0.4410 0.4373 0.0180  -0.0563 0.0034  548 SER A N   
1292 C CA  . SER A 161 ? 0.2934 0.4813 0.4643 0.0135  -0.0667 0.0009  548 SER A CA  
1293 C C   . SER A 161 ? 0.2618 0.4450 0.4112 0.0119  -0.0736 -0.0002 548 SER A C   
1294 O O   . SER A 161 ? 0.1735 0.3395 0.3056 0.0131  -0.0694 0.0000  548 SER A O   
1295 C CB  . SER A 161 ? 0.2592 0.4503 0.4385 0.0039  -0.0645 -0.0071 548 SER A CB  
1296 O OG  . SER A 161 ? 0.2843 0.4562 0.4470 -0.0015 -0.0591 -0.0126 548 SER A OG  
1297 N N   . ARG A 162 ? 0.2570 0.4567 0.4077 0.0095  -0.0843 -0.0013 549 ARG A N   
1298 C CA  . ARG A 162 ? 0.3211 0.5181 0.4511 0.0067  -0.0909 -0.0043 549 ARG A CA  
1299 C C   . ARG A 162 ? 0.3172 0.4965 0.4333 -0.0008 -0.0856 -0.0133 549 ARG A C   
1300 O O   . ARG A 162 ? 0.2802 0.4473 0.3768 -0.0001 -0.0849 -0.0141 549 ARG A O   
1301 C CB  . ARG A 162 ? 0.3959 0.6151 0.5312 0.0033  -0.1031 -0.0063 549 ARG A CB  
1302 C CG  . ARG A 162 ? 0.5118 0.7495 0.6580 0.0118  -0.1102 0.0040  549 ARG A CG  
1303 C CD  . ARG A 162 ? 0.5915 0.8549 0.7514 0.0076  -0.1213 0.0016  549 ARG A CD  
1304 N NE  . ARG A 162 ? 0.6872 0.9567 0.8688 0.0018  -0.1174 -0.0037 549 ARG A NE  
1305 C CZ  . ARG A 162 ? 0.7386 1.0251 0.9354 -0.0032 -0.1240 -0.0063 549 ARG A CZ  
1306 N NH1 . ARG A 162 ? 0.7681 1.0625 0.9587 -0.0031 -0.1344 -0.0045 549 ARG A NH1 
1307 N NH2 . ARG A 162 ? 0.7525 1.0451 0.9698 -0.0086 -0.1191 -0.0106 549 ARG A NH2 
1308 N N   . ASP A 163 ? 0.2458 0.4238 0.3727 -0.0076 -0.0814 -0.0194 550 ASP A N   
1309 C CA  . ASP A 163 ? 0.2603 0.4214 0.3761 -0.0144 -0.0760 -0.0271 550 ASP A CA  
1310 C C   . ASP A 163 ? 0.2708 0.4121 0.3763 -0.0104 -0.0664 -0.0242 550 ASP A C   
1311 O O   . ASP A 163 ? 0.4137 0.5408 0.5032 -0.0123 -0.0641 -0.0276 550 ASP A O   
1312 C CB  . ASP A 163 ? 0.3094 0.4742 0.4406 -0.0227 -0.0733 -0.0329 550 ASP A CB  
1313 C CG  . ASP A 163 ? 0.5245 0.7035 0.6602 -0.0303 -0.0827 -0.0398 550 ASP A CG  
1314 O OD1 . ASP A 163 ? 0.5968 0.7792 0.7191 -0.0299 -0.0905 -0.0415 550 ASP A OD1 
1315 O OD2 . ASP A 163 ? 0.5916 0.7785 0.7438 -0.0371 -0.0820 -0.0437 550 ASP A OD2 
1316 N N   . MET A 164 ? 0.2371 0.3780 0.3523 -0.0050 -0.0608 -0.0183 551 MET A N   
1317 C CA  . MET A 164 ? 0.2648 0.3889 0.3706 -0.0012 -0.0525 -0.0156 551 MET A CA  
1318 C C   . MET A 164 ? 0.2156 0.3339 0.3051 0.0037  -0.0552 -0.0119 551 MET A C   
1319 O O   . MET A 164 ? 0.2562 0.3602 0.3316 0.0032  -0.0513 -0.0133 551 MET A O   
1320 C CB  . MET A 164 ? 0.3237 0.4496 0.4434 0.0036  -0.0463 -0.0109 551 MET A CB  
1321 C CG  . MET A 164 ? 0.4287 0.5575 0.5629 -0.0011 -0.0405 -0.0142 551 MET A CG  
1322 S SD  . MET A 164 ? 0.5622 0.6952 0.7135 0.0054  -0.0330 -0.0094 551 MET A SD  
1323 C CE  . MET A 164 ? 0.4576 0.6002 0.6269 -0.0017 -0.0289 -0.0138 551 MET A CE  
1324 N N   . VAL A 165 ? 0.2156 0.3457 0.3074 0.0086  -0.0619 -0.0066 552 VAL A N   
1325 C CA  . VAL A 165 ? 0.2345 0.3605 0.3112 0.0132  -0.0644 -0.0020 552 VAL A CA  
1326 C C   . VAL A 165 ? 0.1798 0.3016 0.2393 0.0086  -0.0677 -0.0080 552 VAL A C   
1327 O O   . VAL A 165 ? 0.2290 0.3397 0.2740 0.0101  -0.0649 -0.0072 552 VAL A O   
1328 C CB  . VAL A 165 ? 0.2482 0.3892 0.3311 0.0193  -0.0715 0.0058  552 VAL A CB  
1329 C CG1 . VAL A 165 ? 0.2435 0.3823 0.3089 0.0225  -0.0751 0.0101  552 VAL A CG1 
1330 C CG2 . VAL A 165 ? 0.1978 0.3386 0.2956 0.0257  -0.0665 0.0127  552 VAL A CG2 
1331 N N   . LYS A 166 ? 0.2267 0.3573 0.2888 0.0027  -0.0732 -0.0144 553 LYS A N   
1332 C CA  . LYS A 166 ? 0.2685 0.3941 0.3154 -0.0022 -0.0756 -0.0219 553 LYS A CA  
1333 C C   . LYS A 166 ? 0.2661 0.3727 0.3051 -0.0043 -0.0671 -0.0257 553 LYS A C   
1334 O O   . LYS A 166 ? 0.3071 0.4048 0.3304 -0.0036 -0.0659 -0.0273 553 LYS A O   
1335 C CB  . LYS A 166 ? 0.4066 0.5435 0.4609 -0.0095 -0.0818 -0.0295 553 LYS A CB  
1336 C CG  . LYS A 166 ? 0.5426 0.6817 0.5815 -0.0132 -0.0882 -0.0361 553 LYS A CG  
1337 C CD  . LYS A 166 ? 0.6246 0.7767 0.6730 -0.0211 -0.0950 -0.0439 553 LYS A CD  
1338 C CE  . LYS A 166 ? 0.6600 0.8321 0.7276 -0.0191 -0.1005 -0.0381 553 LYS A CE  
1339 N NZ  . LYS A 166 ? 0.6615 0.8449 0.7246 -0.0110 -0.1064 -0.0286 553 LYS A NZ  
1340 N N   . HIS A 167 ? 0.2024 0.3037 0.2523 -0.0066 -0.0611 -0.0266 554 HIS A N   
1341 C CA  . HIS A 167 ? 0.1682 0.2528 0.2115 -0.0082 -0.0534 -0.0289 554 HIS A CA  
1342 C C   . HIS A 167 ? 0.1733 0.2489 0.2065 -0.0023 -0.0494 -0.0235 554 HIS A C   
1343 O O   . HIS A 167 ? 0.2167 0.2814 0.2381 -0.0024 -0.0465 -0.0255 554 HIS A O   
1344 C CB  . HIS A 167 ? 0.2610 0.3433 0.3176 -0.0111 -0.0476 -0.0294 554 HIS A CB  
1345 C CG  . HIS A 167 ? 0.3168 0.3830 0.3666 -0.0125 -0.0402 -0.0306 554 HIS A CG  
1346 N ND1 . HIS A 167 ? 0.2979 0.3545 0.3388 -0.0163 -0.0395 -0.0360 554 HIS A ND1 
1347 C CD2 . HIS A 167 ? 0.3179 0.3763 0.3679 -0.0103 -0.0333 -0.0271 554 HIS A CD2 
1348 C CE1 . HIS A 167 ? 0.2792 0.3234 0.3161 -0.0160 -0.0328 -0.0347 554 HIS A CE1 
1349 N NE2 . HIS A 167 ? 0.2649 0.3105 0.3065 -0.0127 -0.0292 -0.0295 554 HIS A NE2 
1350 N N   . LEU A 168 ? 0.1730 0.2534 0.2121 0.0029  -0.0491 -0.0167 555 LEU A N   
1351 C CA  . LEU A 168 ? 0.2109 0.2832 0.2423 0.0077  -0.0452 -0.0116 555 LEU A CA  
1352 C C   . LEU A 168 ? 0.1996 0.2718 0.2167 0.0096  -0.0486 -0.0107 555 LEU A C   
1353 O O   . LEU A 168 ? 0.1985 0.2615 0.2057 0.0108  -0.0449 -0.0100 555 LEU A O   
1354 C CB  . LEU A 168 ? 0.2430 0.3198 0.2849 0.0126  -0.0440 -0.0050 555 LEU A CB  
1355 C CG  . LEU A 168 ? 0.3653 0.4397 0.4194 0.0115  -0.0382 -0.0058 555 LEU A CG  
1356 C CD1 . LEU A 168 ? 0.3960 0.4763 0.4623 0.0168  -0.0375 -0.0001 555 LEU A CD1 
1357 C CD2 . LEU A 168 ? 0.3236 0.3842 0.3701 0.0103  -0.0313 -0.0073 555 LEU A CD2 
1358 N N   . ASN A 169 ? 0.2347 0.3183 0.2505 0.0098  -0.0558 -0.0106 556 ASN A N   
1359 C CA  . ASN A 169 ? 0.2291 0.3134 0.2294 0.0110  -0.0589 -0.0106 556 ASN A CA  
1360 C C   . ASN A 169 ? 0.2971 0.3729 0.2869 0.0068  -0.0570 -0.0188 556 ASN A C   
1361 O O   . ASN A 169 ? 0.3492 0.4202 0.3262 0.0086  -0.0553 -0.0188 556 ASN A O   
1362 C CB  . ASN A 169 ? 0.2006 0.3004 0.2010 0.0118  -0.0676 -0.0089 556 ASN A CB  
1363 C CG  . ASN A 169 ? 0.3077 0.4146 0.3152 0.0180  -0.0692 0.0015  556 ASN A CG  
1364 O OD1 . ASN A 169 ? 0.3438 0.4426 0.3494 0.0219  -0.0641 0.0075  556 ASN A OD1 
1365 N ND2 . ASN A 169 ? 0.2733 0.3951 0.2896 0.0188  -0.0762 0.0038  556 ASN A ND2 
1366 N N   . SER A 170 ? 0.2356 0.3093 0.2318 0.0016  -0.0565 -0.0256 557 SER A N   
1367 C CA  . SER A 170 ? 0.2650 0.3289 0.2527 -0.0021 -0.0542 -0.0334 557 SER A CA  
1368 C C   . SER A 170 ? 0.2466 0.2972 0.2297 0.0002  -0.0468 -0.0315 557 SER A C   
1369 O O   . SER A 170 ? 0.2049 0.2490 0.1771 0.0010  -0.0447 -0.0343 557 SER A O   
1370 C CB  . SER A 170 ? 0.2289 0.2923 0.2260 -0.0086 -0.0548 -0.0402 557 SER A CB  
1371 O OG  . SER A 170 ? 0.4377 0.5150 0.4399 -0.0116 -0.0623 -0.0428 557 SER A OG  
1372 N N   . ILE A 171 ? 0.2021 0.2495 0.1937 0.0014  -0.0426 -0.0270 558 ILE A N   
1373 C CA  . ILE A 171 ? 0.2949 0.3312 0.2826 0.0030  -0.0364 -0.0255 558 ILE A CA  
1374 C C   . ILE A 171 ? 0.2711 0.3075 0.2514 0.0077  -0.0354 -0.0201 558 ILE A C   
1375 O O   . ILE A 171 ? 0.3204 0.3497 0.2951 0.0091  -0.0314 -0.0196 558 ILE A O   
1376 C CB  . ILE A 171 ? 0.3112 0.3441 0.3088 0.0019  -0.0322 -0.0233 558 ILE A CB  
1377 C CG1 . ILE A 171 ? 0.3252 0.3645 0.3302 0.0048  -0.0326 -0.0177 558 ILE A CG1 
1378 C CG2 . ILE A 171 ? 0.1856 0.2181 0.1910 -0.0032 -0.0322 -0.0279 558 ILE A CG2 
1379 C CD1 . ILE A 171 ? 0.3532 0.3889 0.3663 0.0039  -0.0276 -0.0164 558 ILE A CD1 
1380 N N   . GLU A 172 ? 0.2686 0.3135 0.2494 0.0102  -0.0389 -0.0157 559 GLU A N   
1381 C CA  . GLU A 172 ? 0.2700 0.3152 0.2432 0.0141  -0.0379 -0.0104 559 GLU A CA  
1382 C C   . GLU A 172 ? 0.2356 0.2805 0.1959 0.0142  -0.0387 -0.0141 559 GLU A C   
1383 O O   . GLU A 172 ? 0.1626 0.2030 0.1161 0.0161  -0.0349 -0.0129 559 GLU A O   
1384 C CB  . GLU A 172 ? 0.2933 0.3469 0.2703 0.0171  -0.0414 -0.0037 559 GLU A CB  
1385 C CG  . GLU A 172 ? 0.3546 0.4080 0.3239 0.0207  -0.0399 0.0026  559 GLU A CG  
1386 C CD  . GLU A 172 ? 0.5049 0.5664 0.4765 0.0240  -0.0437 0.0100  559 GLU A CD  
1387 O OE1 . GLU A 172 ? 0.4913 0.5616 0.4566 0.0244  -0.0492 0.0100  559 GLU A OE1 
1388 O OE2 . GLU A 172 ? 0.4797 0.5389 0.4595 0.0263  -0.0413 0.0159  559 GLU A OE2 
1389 N N   . GLU A 173 ? 0.2099 0.2602 0.1671 0.0119  -0.0436 -0.0193 560 GLU A N   
1390 C CA  . GLU A 173 ? 0.2704 0.3200 0.2148 0.0113  -0.0441 -0.0249 560 GLU A CA  
1391 C C   . GLU A 173 ? 0.2158 0.2538 0.1580 0.0105  -0.0385 -0.0301 560 GLU A C   
1392 O O   . GLU A 173 ? 0.2348 0.2699 0.1673 0.0125  -0.0356 -0.0316 560 GLU A O   
1393 C CB  . GLU A 173 ? 0.2658 0.3230 0.2088 0.0077  -0.0507 -0.0312 560 GLU A CB  
1394 C CG  . GLU A 173 ? 0.3802 0.4510 0.3233 0.0094  -0.0572 -0.0255 560 GLU A CG  
1395 C CD  . GLU A 173 ? 0.4519 0.5322 0.3901 0.0058  -0.0645 -0.0321 560 GLU A CD  
1396 O OE1 . GLU A 173 ? 0.4908 0.5656 0.4239 0.0017  -0.0638 -0.0420 560 GLU A OE1 
1397 O OE2 . GLU A 173 ? 0.4800 0.5733 0.4196 0.0070  -0.0711 -0.0276 560 GLU A OE2 
1398 N N   . GLN A 174 ? 0.2339 0.2657 0.1854 0.0079  -0.0367 -0.0321 561 GLN A N   
1399 C CA  . GLN A 174 ? 0.2670 0.2876 0.2176 0.0077  -0.0315 -0.0354 561 GLN A CA  
1400 C C   . GLN A 174 ? 0.2090 0.2266 0.1572 0.0119  -0.0268 -0.0299 561 GLN A C   
1401 O O   . GLN A 174 ? 0.2646 0.2763 0.2079 0.0137  -0.0231 -0.0320 561 GLN A O   
1402 C CB  . GLN A 174 ? 0.2822 0.2974 0.2432 0.0043  -0.0301 -0.0365 561 GLN A CB  
1403 C CG  . GLN A 174 ? 0.4201 0.4362 0.3849 -0.0010 -0.0334 -0.0433 561 GLN A CG  
1404 C CD  . GLN A 174 ? 0.4776 0.4881 0.4527 -0.0044 -0.0308 -0.0432 561 GLN A CD  
1405 O OE1 . GLN A 174 ? 0.4492 0.4516 0.4251 -0.0028 -0.0259 -0.0402 561 GLN A OE1 
1406 N NE2 . GLN A 174 ? 0.4525 0.4683 0.4358 -0.0092 -0.0340 -0.0462 561 GLN A NE2 
1407 N N   . ILE A 175 ? 0.2323 0.2540 0.1850 0.0133  -0.0269 -0.0231 562 ILE A N   
1408 C CA  . ILE A 175 ? 0.2422 0.2622 0.1940 0.0162  -0.0230 -0.0179 562 ILE A CA  
1409 C C   . ILE A 175 ? 0.1987 0.2226 0.1412 0.0190  -0.0223 -0.0167 562 ILE A C   
1410 O O   . ILE A 175 ? 0.3118 0.3332 0.2510 0.0210  -0.0184 -0.0166 562 ILE A O   
1411 C CB  . ILE A 175 ? 0.1801 0.2025 0.1394 0.0163  -0.0230 -0.0120 562 ILE A CB  
1412 C CG1 . ILE A 175 ? 0.2729 0.2914 0.2404 0.0137  -0.0222 -0.0134 562 ILE A CG1 
1413 C CG2 . ILE A 175 ? 0.1579 0.1797 0.1160 0.0183  -0.0195 -0.0071 562 ILE A CG2 
1414 C CD1 . ILE A 175 ? 0.2645 0.2852 0.2397 0.0136  -0.0221 -0.0093 562 ILE A CD1 
1415 N N   . LEU A 176 ? 0.1976 0.2286 0.1362 0.0192  -0.0261 -0.0154 563 LEU A N   
1416 C CA  . LEU A 176 ? 0.2371 0.2728 0.1654 0.0216  -0.0255 -0.0135 563 LEU A CA  
1417 C C   . LEU A 176 ? 0.2552 0.2884 0.1740 0.0220  -0.0234 -0.0206 563 LEU A C   
1418 O O   . LEU A 176 ? 0.2300 0.2643 0.1421 0.0246  -0.0196 -0.0193 563 LEU A O   
1419 C CB  . LEU A 176 ? 0.2270 0.2713 0.1522 0.0217  -0.0309 -0.0105 563 LEU A CB  
1420 C CG  . LEU A 176 ? 0.2860 0.3327 0.2205 0.0225  -0.0321 -0.0025 563 LEU A CG  
1421 C CD1 . LEU A 176 ? 0.2217 0.2777 0.1536 0.0235  -0.0379 0.0013  563 LEU A CD1 
1422 C CD2 . LEU A 176 ? 0.1863 0.2304 0.1216 0.0245  -0.0270 0.0040  563 LEU A CD2 
1423 N N   . GLU A 177 ? 0.2634 0.2929 0.1822 0.0194  -0.0255 -0.0284 564 GLU A N   
1424 C CA  . GLU A 177 ? 0.2988 0.3245 0.2086 0.0196  -0.0235 -0.0367 564 GLU A CA  
1425 C C   . GLU A 177 ? 0.3059 0.3220 0.2185 0.0215  -0.0174 -0.0389 564 GLU A C   
1426 O O   . GLU A 177 ? 0.3159 0.3296 0.2211 0.0238  -0.0136 -0.0433 564 GLU A O   
1427 C CB  . GLU A 177 ? 0.2101 0.2355 0.1189 0.0151  -0.0283 -0.0449 564 GLU A CB  
1428 C CG  . GLU A 177 ? 0.2998 0.3167 0.2192 0.0120  -0.0279 -0.0481 564 GLU A CG  
1429 C CD  . GLU A 177 ? 0.3468 0.3658 0.2682 0.0065  -0.0334 -0.0548 564 GLU A CD  
1430 O OE1 . GLU A 177 ? 0.3609 0.3889 0.2750 0.0053  -0.0384 -0.0572 564 GLU A OE1 
1431 O OE2 . GLU A 177 ? 0.3671 0.3795 0.2976 0.0032  -0.0327 -0.0574 564 GLU A OE2 
1432 N N   . SER A 178 ? 0.1908 0.2017 0.1139 0.0208  -0.0164 -0.0363 565 SER A N   
1433 C CA  . SER A 178 ? 0.3382 0.3407 0.2648 0.0230  -0.0114 -0.0373 565 SER A CA  
1434 C C   . SER A 178 ? 0.2826 0.2854 0.2174 0.0243  -0.0098 -0.0297 565 SER A C   
1435 O O   . SER A 178 ? 0.2465 0.2501 0.1817 0.0277  -0.0061 -0.0268 565 SER A O   
1436 C CB  . SER A 178 ? 0.1968 0.1895 0.1261 0.0202  -0.0116 -0.0441 565 SER A CB  
1437 O OG  . SER A 178 ? 0.4159 0.4082 0.3532 0.0163  -0.0146 -0.0422 565 SER A OG  
1438 N N   . LEU A 179 ? 0.1703 0.1728 0.1119 0.0213  -0.0124 -0.0272 566 LEU A N   
1439 C CA  . LEU A 179 ? 0.3168 0.3178 0.2653 0.0215  -0.0108 -0.0220 566 LEU A CA  
1440 C C   . LEU A 179 ? 0.2727 0.2797 0.2220 0.0237  -0.0093 -0.0161 566 LEU A C   
1441 O O   . LEU A 179 ? 0.2605 0.2667 0.2132 0.0251  -0.0071 -0.0134 566 LEU A O   
1442 C CB  . LEU A 179 ? 0.1696 0.1707 0.1242 0.0179  -0.0134 -0.0209 566 LEU A CB  
1443 C CG  . LEU A 179 ? 0.3250 0.3207 0.2817 0.0146  -0.0146 -0.0260 566 LEU A CG  
1444 C CD1 . LEU A 179 ? 0.1869 0.1845 0.1508 0.0113  -0.0162 -0.0240 566 LEU A CD1 
1445 C CD2 . LEU A 179 ? 0.2270 0.2132 0.1839 0.0156  -0.0111 -0.0279 566 LEU A CD2 
1446 N N   . ALA A 180 ? 0.2993 0.3127 0.2456 0.0238  -0.0105 -0.0139 567 ALA A N   
1447 C CA  . ALA A 180 ? 0.3100 0.3284 0.2578 0.0249  -0.0087 -0.0083 567 ALA A CA  
1448 C C   . ALA A 180 ? 0.2702 0.2908 0.2149 0.0282  -0.0048 -0.0083 567 ALA A C   
1449 O O   . ALA A 180 ? 0.2162 0.2415 0.1633 0.0288  -0.0027 -0.0040 567 ALA A O   
1450 C CB  . ALA A 180 ? 0.3031 0.3265 0.2493 0.0241  -0.0106 -0.0048 567 ALA A CB  
1451 N N   . TRP A 181 ? 0.2105 0.2276 0.1503 0.0301  -0.0036 -0.0137 568 TRP A N   
1452 C CA  . TRP A 181 ? 0.2110 0.2300 0.1480 0.0340  0.0010  -0.0147 568 TRP A CA  
1453 C C   . TRP A 181 ? 0.2290 0.2438 0.1717 0.0367  0.0036  -0.0153 568 TRP A C   
1454 O O   . TRP A 181 ? 0.1963 0.2127 0.1386 0.0408  0.0078  -0.0161 568 TRP A O   
1455 C CB  . TRP A 181 ? 0.2430 0.2610 0.1700 0.0350  0.0016  -0.0209 568 TRP A CB  
1456 C CG  . TRP A 181 ? 0.2974 0.3211 0.2177 0.0330  -0.0013 -0.0193 568 TRP A CG  
1457 C CD1 . TRP A 181 ? 0.2878 0.3110 0.2056 0.0299  -0.0065 -0.0214 568 TRP A CD1 
1458 C CD2 . TRP A 181 ? 0.2499 0.2815 0.1655 0.0342  0.0007  -0.0145 568 TRP A CD2 
1459 N NE1 . TRP A 181 ? 0.3001 0.3306 0.2118 0.0297  -0.0082 -0.0178 568 TRP A NE1 
1460 C CE2 . TRP A 181 ? 0.2484 0.2834 0.1580 0.0322  -0.0036 -0.0134 568 TRP A CE2 
1461 C CE3 . TRP A 181 ? 0.2894 0.3261 0.2060 0.0367  0.0060  -0.0107 568 TRP A CE3 
1462 C CZ2 . TRP A 181 ? 0.2502 0.2923 0.1537 0.0329  -0.0027 -0.0078 568 TRP A CZ2 
1463 C CZ3 . TRP A 181 ? 0.2534 0.2971 0.1644 0.0367  0.0074  -0.0057 568 TRP A CZ3 
1464 C CH2 . TRP A 181 ? 0.2003 0.2461 0.1042 0.0349  0.0031  -0.0039 568 TRP A CH2 
1465 N N   . SER A 182 ? 0.1900 0.1996 0.1379 0.0350  0.0015  -0.0146 569 SER A N   
1466 C CA  . SER A 182 ? 0.2687 0.2745 0.2219 0.0379  0.0034  -0.0135 569 SER A CA  
1467 C C   . SER A 182 ? 0.3374 0.3519 0.2958 0.0403  0.0052  -0.0082 569 SER A C   
1468 O O   . SER A 182 ? 0.3381 0.3599 0.2976 0.0380  0.0043  -0.0048 569 SER A O   
1469 C CB  . SER A 182 ? 0.3037 0.3039 0.2606 0.0350  0.0008  -0.0122 569 SER A CB  
1470 O OG  . SER A 182 ? 0.3483 0.3545 0.3087 0.0324  -0.0012 -0.0074 569 SER A OG  
1471 N N   . HIS A 183 ? 0.2581 0.2721 0.2206 0.0450  0.0080  -0.0074 570 HIS A N   
1472 C CA  . HIS A 183 ? 0.3192 0.3436 0.2882 0.0477  0.0097  -0.0027 570 HIS A CA  
1473 C C   . HIS A 183 ? 0.2742 0.3052 0.2482 0.0438  0.0062  0.0024  570 HIS A C   
1474 O O   . HIS A 183 ? 0.2833 0.3246 0.2622 0.0436  0.0068  0.0057  570 HIS A O   
1475 C CB  . HIS A 183 ? 0.3416 0.3641 0.3158 0.0541  0.0126  -0.0021 570 HIS A CB  
1476 C CG  . HIS A 183 ? 0.4358 0.4520 0.4130 0.0542  0.0100  0.0005  570 HIS A CG  
1477 N ND1 . HIS A 183 ? 0.4514 0.4544 0.4256 0.0547  0.0105  -0.0028 570 HIS A ND1 
1478 C CD2 . HIS A 183 ? 0.4721 0.4938 0.4545 0.0534  0.0069  0.0063  570 HIS A CD2 
1479 C CE1 . HIS A 183 ? 0.4968 0.4969 0.4741 0.0546  0.0084  0.0017  570 HIS A CE1 
1480 N NE2 . HIS A 183 ? 0.5309 0.5427 0.5126 0.0540  0.0059  0.0071  570 HIS A NE2 
1481 N N   . ASP A 184 ? 0.1821 0.2075 0.1552 0.0404  0.0028  0.0026  571 ASP A N   
1482 C CA  . ASP A 184 ? 0.3395 0.3701 0.3160 0.0364  -0.0003 0.0062  571 ASP A CA  
1483 C C   . ASP A 184 ? 0.2578 0.2880 0.2316 0.0310  -0.0019 0.0052  571 ASP A C   
1484 O O   . ASP A 184 ? 0.3299 0.3618 0.3055 0.0272  -0.0040 0.0067  571 ASP A O   
1485 C CB  . ASP A 184 ? 0.3577 0.3836 0.3348 0.0363  -0.0024 0.0078  571 ASP A CB  
1486 C CG  . ASP A 184 ? 0.4809 0.4965 0.4533 0.0336  -0.0032 0.0048  571 ASP A CG  
1487 O OD1 . ASP A 184 ? 0.5144 0.5252 0.4834 0.0335  -0.0021 0.0009  571 ASP A OD1 
1488 O OD2 . ASP A 184 ? 0.6305 0.6437 0.6026 0.0312  -0.0049 0.0065  571 ASP A OD2 
1489 N N   . SER A 185 ? 0.2269 0.2545 0.1961 0.0310  -0.0009 0.0027  572 SER A N   
1490 C CA  . SER A 185 ? 0.1865 0.2138 0.1539 0.0271  -0.0023 0.0027  572 SER A CA  
1491 C C   . SER A 185 ? 0.2009 0.2354 0.1720 0.0249  -0.0016 0.0063  572 SER A C   
1492 O O   . SER A 185 ? 0.1518 0.1930 0.1253 0.0266  0.0008  0.0082  572 SER A O   
1493 C CB  . SER A 185 ? 0.2510 0.2758 0.2122 0.0281  -0.0019 -0.0001 572 SER A CB  
1494 O OG  . SER A 185 ? 0.2590 0.2852 0.2193 0.0255  -0.0032 0.0016  572 SER A OG  
1495 N N   . ALA A 186 ? 0.1660 0.1989 0.1383 0.0210  -0.0031 0.0071  573 ALA A N   
1496 C CA  . ALA A 186 ? 0.2061 0.2435 0.1824 0.0180  -0.0021 0.0102  573 ALA A CA  
1497 C C   . ALA A 186 ? 0.2160 0.2563 0.1899 0.0193  0.0004  0.0125  573 ALA A C   
1498 O O   . ALA A 186 ? 0.1750 0.2196 0.1526 0.0172  0.0024  0.0158  573 ALA A O   
1499 C CB  . ALA A 186 ? 0.1636 0.1965 0.1417 0.0141  -0.0036 0.0098  573 ALA A CB  
1500 N N   . LEU A 187 ? 0.1787 0.2167 0.1460 0.0222  0.0004  0.0109  574 LEU A N   
1501 C CA  . LEU A 187 ? 0.1685 0.2100 0.1310 0.0239  0.0028  0.0130  574 LEU A CA  
1502 C C   . LEU A 187 ? 0.2043 0.2535 0.1699 0.0250  0.0069  0.0152  574 LEU A C   
1503 O O   . LEU A 187 ? 0.2600 0.3134 0.2264 0.0237  0.0096  0.0195  574 LEU A O   
1504 C CB  . LEU A 187 ? 0.1723 0.2114 0.1264 0.0268  0.0020  0.0091  574 LEU A CB  
1505 C CG  . LEU A 187 ? 0.1880 0.2318 0.1349 0.0291  0.0052  0.0104  574 LEU A CG  
1506 C CD1 . LEU A 187 ? 0.1577 0.2033 0.1026 0.0274  0.0049  0.0160  574 LEU A CD1 
1507 C CD2 . LEU A 187 ? 0.2356 0.2767 0.1738 0.0316  0.0043  0.0046  574 LEU A CD2 
1508 N N   . TRP A 188 ? 0.1484 0.1997 0.1167 0.0275  0.0076  0.0129  575 TRP A N   
1509 C CA  . TRP A 188 ? 0.1798 0.2398 0.1527 0.0295  0.0116  0.0147  575 TRP A CA  
1510 C C   . TRP A 188 ? 0.1778 0.2444 0.1599 0.0251  0.0120  0.0189  575 TRP A C   
1511 O O   . TRP A 188 ? 0.2092 0.2837 0.1950 0.0248  0.0160  0.0220  575 TRP A O   
1512 C CB  . TRP A 188 ? 0.1772 0.2375 0.1527 0.0338  0.0119  0.0120  575 TRP A CB  
1513 C CG  . TRP A 188 ? 0.1725 0.2251 0.1395 0.0373  0.0121  0.0071  575 TRP A CG  
1514 C CD1 . TRP A 188 ? 0.1740 0.2179 0.1390 0.0377  0.0091  0.0037  575 TRP A CD1 
1515 C CD2 . TRP A 188 ? 0.2500 0.3028 0.2089 0.0401  0.0156  0.0047  575 TRP A CD2 
1516 N NE1 . TRP A 188 ? 0.2025 0.2408 0.1596 0.0401  0.0103  -0.0012 575 TRP A NE1 
1517 C CE2 . TRP A 188 ? 0.3353 0.3790 0.2879 0.0417  0.0142  -0.0010 575 TRP A CE2 
1518 C CE3 . TRP A 188 ? 0.1838 0.2436 0.1398 0.0410  0.0202  0.0067  575 TRP A CE3 
1519 C CZ2 . TRP A 188 ? 0.3263 0.3679 0.2693 0.0441  0.0166  -0.0058 575 TRP A CZ2 
1520 C CZ3 . TRP A 188 ? 0.1965 0.2545 0.1419 0.0438  0.0230  0.0026  575 TRP A CZ3 
1521 C CH2 . TRP A 188 ? 0.3480 0.3970 0.2867 0.0452  0.0209  -0.0040 575 TRP A CH2 
1522 N N   . GLU A 189 ? 0.2164 0.2798 0.2023 0.0213  0.0083  0.0185  576 GLU A N   
1523 C CA  . GLU A 189 ? 0.2297 0.2976 0.2235 0.0159  0.0081  0.0209  576 GLU A CA  
1524 C C   . GLU A 189 ? 0.2513 0.3180 0.2446 0.0130  0.0109  0.0245  576 GLU A C   
1525 O O   . GLU A 189 ? 0.2024 0.2757 0.2023 0.0099  0.0138  0.0277  576 GLU A O   
1526 C CB  . GLU A 189 ? 0.2318 0.2945 0.2269 0.0123  0.0039  0.0186  576 GLU A CB  
1527 C CG  . GLU A 189 ? 0.2630 0.3272 0.2586 0.0146  0.0010  0.0164  576 GLU A CG  
1528 C CD  . GLU A 189 ? 0.4223 0.4823 0.4178 0.0107  -0.0025 0.0143  576 GLU A CD  
1529 O OE1 . GLU A 189 ? 0.4407 0.5038 0.4409 0.0053  -0.0032 0.0143  576 GLU A OE1 
1530 O OE2 . GLU A 189 ? 0.5062 0.5598 0.4968 0.0126  -0.0043 0.0123  576 GLU A OE2 
1531 N N   . ALA A 190 ? 0.1371 0.1956 0.1231 0.0139  0.0100  0.0245  577 ALA A N   
1532 C CA  . ALA A 190 ? 0.2191 0.2751 0.2035 0.0121  0.0122  0.0290  577 ALA A CA  
1533 C C   . ALA A 190 ? 0.2563 0.3190 0.2377 0.0142  0.0170  0.0328  577 ALA A C   
1534 O O   . ALA A 190 ? 0.2440 0.3088 0.2287 0.0114  0.0205  0.0379  577 ALA A O   
1535 C CB  . ALA A 190 ? 0.2289 0.2766 0.2065 0.0138  0.0094  0.0284  577 ALA A CB  
1536 N N   . LEU A 191 ? 0.1503 0.2159 0.1255 0.0191  0.0178  0.0300  578 LEU A N   
1537 C CA  . LEU A 191 ? 0.3005 0.3731 0.2718 0.0216  0.0231  0.0325  578 LEU A CA  
1538 C C   . LEU A 191 ? 0.2347 0.3170 0.2170 0.0196  0.0270  0.0348  578 LEU A C   
1539 O O   . LEU A 191 ? 0.1890 0.2773 0.1724 0.0186  0.0323  0.0395  578 LEU A O   
1540 C CB  . LEU A 191 ? 0.1823 0.2548 0.1447 0.0272  0.0234  0.0275  578 LEU A CB  
1541 C CG  . LEU A 191 ? 0.2872 0.3539 0.2367 0.0290  0.0212  0.0261  578 LEU A CG  
1542 C CD1 . LEU A 191 ? 0.2329 0.2985 0.1743 0.0335  0.0215  0.0193  578 LEU A CD1 
1543 C CD2 . LEU A 191 ? 0.3292 0.3989 0.2725 0.0283  0.0244  0.0324  578 LEU A CD2 
1544 N N   . GLN A 192 ? 0.1562 0.2410 0.1470 0.0189  0.0243  0.0318  579 GLN A N   
1545 C CA  . GLN A 192 ? 0.1463 0.2425 0.1492 0.0171  0.0266  0.0334  579 GLN A CA  
1546 C C   . GLN A 192 ? 0.1476 0.2464 0.1583 0.0101  0.0286  0.0380  579 GLN A C   
1547 O O   . GLN A 192 ? 0.1725 0.2810 0.1898 0.0087  0.0337  0.0415  579 GLN A O   
1548 C CB  . GLN A 192 ? 0.1508 0.2487 0.1599 0.0175  0.0218  0.0298  579 GLN A CB  
1549 C CG  . GLN A 192 ? 0.1879 0.3000 0.2103 0.0165  0.0228  0.0312  579 GLN A CG  
1550 C CD  . GLN A 192 ? 0.2033 0.3170 0.2300 0.0171  0.0171  0.0287  579 GLN A CD  
1551 O OE1 . GLN A 192 ? 0.3250 0.4351 0.3473 0.0230  0.0157  0.0264  579 GLN A OE1 
1552 N NE2 . GLN A 192 ? 0.1287 0.2472 0.1634 0.0108  0.0138  0.0289  579 GLN A NE2 
1553 N N   . VAL A 193 ? 0.2064 0.2961 0.2171 0.0055  0.0252  0.0378  580 VAL A N   
1554 C CA  . VAL A 193 ? 0.1988 0.2888 0.2177 -0.0016 0.0274  0.0415  580 VAL A CA  
1555 C C   . VAL A 193 ? 0.2391 0.3266 0.2529 -0.0014 0.0329  0.0479  580 VAL A C   
1556 O O   . VAL A 193 ? 0.2744 0.3629 0.2952 -0.0067 0.0366  0.0525  580 VAL A O   
1557 C CB  . VAL A 193 ? 0.2471 0.3269 0.2677 -0.0063 0.0230  0.0388  580 VAL A CB  
1558 C CG1 . VAL A 193 ? 0.1481 0.2302 0.1706 -0.0060 0.0175  0.0329  580 VAL A CG1 
1559 C CG2 . VAL A 193 ? 0.3015 0.3686 0.3123 -0.0038 0.0220  0.0399  580 VAL A CG2 
1560 N N   . SER A 194 ? 0.4486 0.3267 0.1675 -0.0375 0.0450  0.0597  581 SER A N   
1561 C CA  . SER A 194 ? 0.4497 0.3309 0.1726 -0.0422 0.0435  0.0682  581 SER A CA  
1562 C C   . SER A 194 ? 0.4312 0.3277 0.1616 -0.0618 0.0363  0.0600  581 SER A C   
1563 O O   . SER A 194 ? 0.4270 0.3394 0.1623 -0.0678 0.0342  0.0669  581 SER A O   
1564 C CB  . SER A 194 ? 0.5147 0.4199 0.2518 -0.0313 0.0445  0.0834  581 SER A CB  
1565 O OG  . SER A 194 ? 0.6184 0.5090 0.3488 -0.0127 0.0511  0.0890  581 SER A OG  
1566 N N   . ALA A 195 ? 0.4724 0.3686 0.2049 -0.0706 0.0314  0.0442  582 ALA A N   
1567 C CA  . ALA A 195 ? 0.4035 0.3177 0.1465 -0.0876 0.0234  0.0300  582 ALA A CA  
1568 C C   . ALA A 195 ? 0.3763 0.3292 0.1424 -0.0890 0.0148  0.0317  582 ALA A C   
1569 O O   . ALA A 195 ? 0.4538 0.4304 0.2282 -0.0993 0.0104  0.0242  582 ALA A O   
1570 C CB  . ALA A 195 ? 0.4208 0.3265 0.1526 -0.0995 0.0278  0.0298  582 ALA A CB  
1571 N N   . ASN A 196 ? 0.3876 0.3492 0.1647 -0.0785 0.0123  0.0415  583 ASN A N   
1572 C CA  . ASN A 196 ? 0.4278 0.4233 0.2312 -0.0782 0.0012  0.0441  583 ASN A CA  
1573 C C   . ASN A 196 ? 0.5069 0.5224 0.3134 -0.0783 0.0024  0.0505  583 ASN A C   
1574 O O   . ASN A 196 ? 0.5681 0.6148 0.3953 -0.0817 -0.0092 0.0435  583 ASN A O   
1575 C CB  . ASN A 196 ? 0.3727 0.3827 0.1959 -0.0884 -0.0159 0.0242  583 ASN A CB  
1576 C CG  . ASN A 196 ? 0.3876 0.3807 0.2105 -0.0880 -0.0218 0.0229  583 ASN A CG  
1577 O OD1 . ASN A 196 ? 0.4711 0.4565 0.2872 -0.0797 -0.0149 0.0396  583 ASN A OD1 
1578 N ND2 . ASN A 196 ? 0.3433 0.3328 0.1730 -0.0971 -0.0349 0.0027  583 ASN A ND2 
1579 N N   . LYS A 197 ? 0.4529 0.4496 0.2390 -0.0735 0.0142  0.0634  584 LYS A N   
1580 C CA  . LYS A 197 ? 0.3876 0.3989 0.1721 -0.0730 0.0146  0.0740  584 LYS A CA  
1581 C C   . LYS A 197 ? 0.4237 0.4431 0.2205 -0.0573 0.0143  0.0899  584 LYS A C   
1582 O O   . LYS A 197 ? 0.5310 0.5295 0.3197 -0.0453 0.0224  0.1004  584 LYS A O   
1583 C CB  . LYS A 197 ? 0.4483 0.4322 0.2062 -0.0776 0.0232  0.0821  584 LYS A CB  
1584 C CG  . LYS A 197 ? 0.5830 0.5818 0.3364 -0.0806 0.0215  0.0939  584 LYS A CG  
1585 C CD  . LYS A 197 ? 0.7579 0.7243 0.4919 -0.0835 0.0266  0.1052  584 LYS A CD  
1586 C CE  . LYS A 197 ? 0.8949 0.8243 0.6172 -0.0682 0.0295  0.1195  584 LYS A CE  
1587 N NZ  . LYS A 197 ? 0.9416 0.8851 0.6758 -0.0519 0.0262  0.1313  584 LYS A NZ  
1588 N N   . VAL A 198 ? 0.4100 0.4627 0.2295 -0.0566 0.0039  0.0892  585 VAL A N   
1589 C CA  . VAL A 198 ? 0.3768 0.4424 0.2138 -0.0430 0.0017  0.1033  585 VAL A CA  
1590 C C   . VAL A 198 ? 0.4382 0.5024 0.2640 -0.0370 0.0040  0.1164  585 VAL A C   
1591 O O   . VAL A 198 ? 0.4110 0.4890 0.2298 -0.0452 -0.0008 0.1133  585 VAL A O   
1592 C CB  . VAL A 198 ? 0.3210 0.4210 0.1916 -0.0447 -0.0144 0.0964  585 VAL A CB  
1593 C CG1 . VAL A 198 ? 0.3040 0.4189 0.1961 -0.0320 -0.0171 0.1117  585 VAL A CG1 
1594 C CG2 . VAL A 198 ? 0.2962 0.3935 0.1783 -0.0519 -0.0210 0.0854  585 VAL A CG2 
1595 N N   . PRO A 199 ? 0.5018 0.5510 0.3255 -0.0225 0.0103  0.1304  586 PRO A N   
1596 C CA  . PRO A 199 ? 0.4107 0.4538 0.2244 -0.0159 0.0087  0.1435  586 PRO A CA  
1597 C C   . PRO A 199 ? 0.4338 0.5114 0.2669 -0.0136 -0.0030 0.1461  586 PRO A C   
1598 O O   . PRO A 199 ? 0.3544 0.4554 0.2166 -0.0077 -0.0084 0.1443  586 PRO A O   
1599 C CB  . PRO A 199 ? 0.4727 0.4968 0.2882 0.0020  0.0156  0.1524  586 PRO A CB  
1600 C CG  . PRO A 199 ? 0.4396 0.4781 0.2739 0.0054  0.0200  0.1469  586 PRO A CG  
1601 C CD  . PRO A 199 ? 0.5044 0.5447 0.3346 -0.0112 0.0182  0.1338  586 PRO A CD  
1602 N N   . THR A 200 ? 0.4673 0.5490 0.2842 -0.0195 -0.0079 0.1506  587 THR A N   
1603 C CA  . THR A 200 ? 0.4326 0.5469 0.2639 -0.0157 -0.0200 0.1522  587 THR A CA  
1604 C C   . THR A 200 ? 0.3943 0.5020 0.2369 0.0028  -0.0228 0.1673  587 THR A C   
1605 O O   . THR A 200 ? 0.4603 0.5374 0.2932 0.0113  -0.0157 0.1763  587 THR A O   
1606 C CB  . THR A 200 ? 0.4429 0.5662 0.2507 -0.0282 -0.0235 0.1515  587 THR A CB  
1607 O OG1 . THR A 200 ? 0.4744 0.5644 0.2611 -0.0247 -0.0215 0.1671  587 THR A OG1 
1608 C CG2 . THR A 200 ? 0.4296 0.5527 0.2255 -0.0459 -0.0171 0.1358  587 THR A CG2 
1609 N N   . CYS A 201 ? 0.3798 0.5174 0.2459 0.0103  -0.0346 0.1675  588 CYS A N   
1610 C CA  . CYS A 201 ? 0.4733 0.6096 0.3556 0.0284  -0.0387 0.1797  588 CYS A CA  
1611 C C   . CYS A 201 ? 0.4697 0.5753 0.3234 0.0332  -0.0393 0.1945  588 CYS A C   
1612 O O   . CYS A 201 ? 0.4815 0.5661 0.3400 0.0476  -0.0365 0.2020  588 CYS A O   
1613 C CB  . CYS A 201 ? 0.3682 0.5418 0.2794 0.0340  -0.0543 0.1763  588 CYS A CB  
1614 S SG  . CYS A 201 ? 0.5111 0.6880 0.4486 0.0564  -0.0611 0.1892  588 CYS A SG  
1615 N N   . GLU A 202 ? 0.4653 0.5690 0.2911 0.0205  -0.0439 0.1968  589 GLU A N   
1616 C CA  . GLU A 202 ? 0.5364 0.6059 0.3355 0.0203  -0.0474 0.2096  589 GLU A CA  
1617 C C   . GLU A 202 ? 0.5319 0.5580 0.3159 0.0216  -0.0391 0.2163  589 GLU A C   
1618 O O   . GLU A 202 ? 0.5781 0.5740 0.3553 0.0328  -0.0455 0.2296  589 GLU A O   
1619 C CB  . GLU A 202 ? 0.6587 0.7350 0.4325 0.0017  -0.0495 0.2057  589 GLU A CB  
1620 C CG  . GLU A 202 ? 0.8763 0.9273 0.6261 0.0017  -0.0585 0.2213  589 GLU A CG  
1621 C CD  . GLU A 202 ? 1.0493 1.1184 0.7775 -0.0162 -0.0587 0.2182  589 GLU A CD  
1622 O OE1 . GLU A 202 ? 1.1244 1.1750 0.8314 -0.0317 -0.0510 0.2207  589 GLU A OE1 
1623 O OE2 . GLU A 202 ? 1.0429 1.1481 0.7777 -0.0142 -0.0668 0.2129  589 GLU A OE2 
1624 N N   . GLU A 203 ? 0.5000 0.5231 0.2806 0.0115  -0.0273 0.2060  590 GLU A N   
1625 C CA  . GLU A 203 ? 0.6411 0.6252 0.4079 0.0130  -0.0200 0.2097  590 GLU A CA  
1626 C C   . GLU A 203 ? 0.7263 0.6994 0.5151 0.0366  -0.0177 0.2075  590 GLU A C   
1627 O O   . GLU A 203 ? 0.7492 0.6863 0.5295 0.0463  -0.0206 0.2128  590 GLU A O   
1628 C CB  . GLU A 203 ? 0.5785 0.5652 0.3401 -0.0022 -0.0086 0.1951  590 GLU A CB  
1629 C CG  . GLU A 203 ? 0.7093 0.6961 0.4519 -0.0239 -0.0080 0.1883  590 GLU A CG  
1630 C CD  . GLU A 203 ? 0.7235 0.7215 0.4689 -0.0368 0.0007  0.1703  590 GLU A CD  
1631 O OE1 . GLU A 203 ? 0.7392 0.7578 0.5036 -0.0322 0.0024  0.1610  590 GLU A OE1 
1632 O OE2 . GLU A 203 ? 0.7860 0.7739 0.5171 -0.0517 0.0046  0.1663  590 GLU A OE2 
1633 N N   . VAL A 204 ? 0.4872 0.4931 0.3060 0.0456  -0.0135 0.1991  591 VAL A N   
1634 C CA  . VAL A 204 ? 0.4870 0.4929 0.3277 0.0663  -0.0084 0.1958  591 VAL A CA  
1635 C C   . VAL A 204 ? 0.4933 0.5117 0.3569 0.0853  -0.0181 0.2027  591 VAL A C   
1636 O O   . VAL A 204 ? 0.6163 0.6337 0.4966 0.1038  -0.0144 0.1990  591 VAL A O   
1637 C CB  . VAL A 204 ? 0.4507 0.4862 0.3127 0.0642  0.0029  0.1853  591 VAL A CB  
1638 C CG1 . VAL A 204 ? 0.4479 0.4674 0.2891 0.0492  0.0115  0.1765  591 VAL A CG1 
1639 C CG2 . VAL A 204 ? 0.4180 0.4928 0.3041 0.0583  -0.0043 0.1858  591 VAL A CG2 
1640 N N   . ILE A 205 ? 0.5587 0.5909 0.4237 0.0822  -0.0308 0.2108  592 ILE A N   
1641 C CA  . ILE A 205 ? 0.5543 0.5978 0.4430 0.1012  -0.0416 0.2162  592 ILE A CA  
1642 C C   . ILE A 205 ? 0.6296 0.6345 0.4983 0.1093  -0.0552 0.2275  592 ILE A C   
1643 O O   . ILE A 205 ? 0.6480 0.6555 0.5324 0.1252  -0.0681 0.2326  592 ILE A O   
1644 C CB  . ILE A 205 ? 0.5428 0.6237 0.4494 0.0979  -0.0519 0.2179  592 ILE A CB  
1645 C CG1 . ILE A 205 ? 0.6064 0.6806 0.4808 0.0832  -0.0626 0.2253  592 ILE A CG1 
1646 C CG2 . ILE A 205 ? 0.5613 0.6777 0.4937 0.0903  -0.0439 0.2077  592 ILE A CG2 
1647 C CD1 . ILE A 205 ? 0.5244 0.6346 0.4144 0.0842  -0.0762 0.2249  592 ILE A CD1 
1648 N N   . PHE A 206 ? 0.7285 0.6960 0.5642 0.0975  -0.0547 0.2320  593 PHE A N   
1649 C CA  . PHE A 206 ? 0.7992 0.7224 0.6171 0.1038  -0.0700 0.2442  593 PHE A CA  
1650 C C   . PHE A 206 ? 0.8320 0.7187 0.6427 0.1081  -0.0642 0.2367  593 PHE A C   
1651 O O   . PHE A 206 ? 0.8106 0.6979 0.6113 0.0952  -0.0497 0.2283  593 PHE A O   
1652 C CB  . PHE A 206 ? 0.8266 0.7374 0.6094 0.0823  -0.0811 0.2622  593 PHE A CB  
1653 C CG  . PHE A 206 ? 0.7625 0.7086 0.5511 0.0798  -0.0888 0.2639  593 PHE A CG  
1654 C CD1 . PHE A 206 ? 0.7122 0.6590 0.5174 0.0985  -0.1050 0.2691  593 PHE A CD1 
1655 C CD2 . PHE A 206 ? 0.7180 0.6962 0.4992 0.0602  -0.0810 0.2544  593 PHE A CD2 
1656 C CE1 . PHE A 206 ? 0.6374 0.6149 0.4492 0.0967  -0.1126 0.2660  593 PHE A CE1 
1657 C CE2 . PHE A 206 ? 0.6769 0.6875 0.4660 0.0602  -0.0892 0.2511  593 PHE A CE2 
1658 C CZ  . PHE A 206 ? 0.6109 0.6205 0.4142 0.0780  -0.1048 0.2574  593 PHE A CZ  
1659 N N   . PRO A 207 ? 0.8966 0.7521 0.7148 0.1280  -0.0777 0.2373  594 PRO A N   
1660 C CA  . PRO A 207 ? 0.9321 0.7531 0.7487 0.1377  -0.0764 0.2263  594 PRO A CA  
1661 C C   . PRO A 207 ? 0.9478 0.7281 0.7299 0.1146  -0.0799 0.2364  594 PRO A C   
1662 O O   . PRO A 207 ? 0.9767 0.7535 0.7517 0.1067  -0.0658 0.2252  594 PRO A O   
1666 N N   . ASN A 215 ? 1.1210 0.6193 0.8046 0.0538  -0.0430 0.0824  780 ASN A N   
1667 C CA  . ASN A 215 ? 1.0033 0.5320 0.6808 0.0569  -0.0241 0.0612  780 ASN A CA  
1668 C C   . ASN A 215 ? 0.9849 0.5664 0.6582 0.0425  -0.0040 0.0686  780 ASN A C   
1669 O O   . ASN A 215 ? 0.9746 0.5647 0.6405 0.0193  0.0028  0.0693  780 ASN A O   
1670 C CB  . ASN A 215 ? 0.9551 0.4520 0.6255 0.0412  -0.0293 0.0516  780 ASN A CB  
1671 C CG  . ASN A 215 ? 0.9191 0.4339 0.5828 0.0508  -0.0168 0.0256  780 ASN A CG  
1672 O OD1 . ASN A 215 ? 0.9013 0.4498 0.5647 0.0707  -0.0052 0.0145  780 ASN A OD1 
1673 N ND2 . ASN A 215 ? 0.9705 0.4636 0.6287 0.0358  -0.0199 0.0165  780 ASN A ND2 
1674 N N   . ARG A 216 ? 0.9963 0.6130 0.6777 0.0571  0.0035  0.0725  781 ARG A N   
1675 C CA  . ARG A 216 ? 0.9032 0.5691 0.5861 0.0459  0.0184  0.0801  781 ARG A CA  
1676 C C   . ARG A 216 ? 0.7920 0.4838 0.4704 0.0462  0.0319  0.0637  781 ARG A C   
1677 O O   . ARG A 216 ? 0.8184 0.5033 0.4933 0.0639  0.0337  0.0456  781 ARG A O   
1678 C CB  . ARG A 216 ? 0.8510 0.5458 0.5479 0.0632  0.0204  0.0882  781 ARG A CB  
1679 C CG  . ARG A 216 ? 0.9694 0.6355 0.6748 0.0841  0.0054  0.0898  781 ARG A CG  
1680 C CD  . ARG A 216 ? 1.0583 0.6902 0.7590 0.0671  -0.0113 0.1118  781 ARG A CD  
1681 N NE  . ARG A 216 ? 1.1721 0.7658 0.8815 0.0869  -0.0313 0.1119  781 ARG A NE  
1682 C CZ  . ARG A 216 ? 1.2440 0.7893 0.9484 0.0755  -0.0516 0.1257  781 ARG A CZ  
1683 N NH1 . ARG A 216 ? 1.2507 0.7855 0.9402 0.0432  -0.0512 0.1414  781 ARG A NH1 
1684 N NH2 . ARG A 216 ? 1.3082 0.8168 1.0242 0.0957  -0.0739 0.1242  781 ARG A NH2 
1685 N N   . PRO A 217 ? 0.7258 0.4489 0.4049 0.0276  0.0397  0.0692  782 PRO A N   
1686 C CA  . PRO A 217 ? 0.5987 0.3497 0.2765 0.0288  0.0496  0.0579  782 PRO A CA  
1687 C C   . PRO A 217 ? 0.6815 0.4608 0.3671 0.0516  0.0571  0.0564  782 PRO A C   
1688 O O   . PRO A 217 ? 0.6867 0.4789 0.3850 0.0599  0.0561  0.0676  782 PRO A O   
1689 C CB  . PRO A 217 ? 0.5617 0.3416 0.2462 0.0071  0.0511  0.0667  782 PRO A CB  
1690 C CG  . PRO A 217 ? 0.6645 0.4280 0.3471 -0.0094 0.0440  0.0770  782 PRO A CG  
1691 C CD  . PRO A 217 ? 0.6941 0.4300 0.3758 0.0052  0.0375  0.0852  782 PRO A CD  
1692 N N   . LYS A 218 ? 0.5969 0.3885 0.2753 0.0612  0.0644  0.0431  783 LYS A N   
1693 C CA  . LYS A 218 ? 0.7651 0.5934 0.4520 0.0800  0.0737  0.0432  783 LYS A CA  
1694 C C   . LYS A 218 ? 0.6856 0.5544 0.3880 0.0678  0.0780  0.0603  783 LYS A C   
1695 O O   . LYS A 218 ? 0.5340 0.4048 0.2366 0.0469  0.0745  0.0657  783 LYS A O   
1696 C CB  . LYS A 218 ? 0.7638 0.6028 0.4362 0.0915  0.0814  0.0266  783 LYS A CB  
1697 C CG  . LYS A 218 ? 0.8538 0.7401 0.5357 0.1089  0.0932  0.0276  783 LYS A CG  
1698 C CD  . LYS A 218 ? 0.8646 0.7696 0.5301 0.1229  0.1023  0.0108  783 LYS A CD  
1699 C CE  . LYS A 218 ? 0.9662 0.9057 0.6442 0.1496  0.1104  0.0029  783 LYS A CE  
1700 N NZ  . LYS A 218 ? 0.9705 0.9604 0.6383 0.1566  0.1257  -0.0029 783 LYS A NZ  
1701 N N   . ARG A 219 ? 0.6819 0.5826 0.4005 0.0820  0.0837  0.0668  784 ARG A N   
1702 C CA  . ARG A 219 ? 0.7305 0.6714 0.4694 0.0740  0.0863  0.0831  784 ARG A CA  
1703 C C   . ARG A 219 ? 0.7268 0.6593 0.4781 0.0664  0.0767  0.0954  784 ARG A C   
1704 O O   . ARG A 219 ? 0.7019 0.6642 0.4724 0.0604  0.0756  0.1076  784 ARG A O   
1705 C CB  . ARG A 219 ? 0.7241 0.6832 0.4608 0.0548  0.0875  0.0873  784 ARG A CB  
1706 C CG  . ARG A 219 ? 0.7583 0.7296 0.4794 0.0601  0.0964  0.0787  784 ARG A CG  
1707 C CD  . ARG A 219 ? 0.8022 0.8133 0.5332 0.0785  0.1086  0.0803  784 ARG A CD  
1708 N NE  . ARG A 219 ? 0.8446 0.8648 0.5547 0.0892  0.1180  0.0666  784 ARG A NE  
1709 C CZ  . ARG A 219 ? 0.9609 1.0241 0.6751 0.1042  0.1311  0.0643  784 ARG A CZ  
1710 N NH1 . ARG A 219 ? 1.0331 1.1319 0.7745 0.1099  0.1358  0.0751  784 ARG A NH1 
1711 N NH2 . ARG A 219 ? 0.9896 1.0635 0.6812 0.1138  0.1394  0.0499  784 ARG A NH2 
1712 N N   . THR A 220 ? 0.4953 0.4799 0.5535 -0.0314 0.0676  0.0276  785 THR A N   
1713 C CA  . THR A 220 ? 0.5455 0.5239 0.5905 -0.0304 0.0709  0.0373  785 THR A CA  
1714 C C   . THR A 220 ? 0.5192 0.4868 0.5560 -0.0182 0.0646  0.0451  785 THR A C   
1715 O O   . THR A 220 ? 0.4542 0.4301 0.4844 -0.0120 0.0601  0.0483  785 THR A O   
1716 C CB  . THR A 220 ? 0.5689 0.5292 0.6064 -0.0413 0.0813  0.0425  785 THR A CB  
1717 O OG1 . THR A 220 ? 0.5990 0.5756 0.6464 -0.0538 0.0877  0.0347  785 THR A OG1 
1718 C CG2 . THR A 220 ? 0.5643 0.5118 0.5820 -0.0386 0.0842  0.0551  785 THR A CG2 
1719 N N   . GLY A 221 ? 0.4958 0.4462 0.5341 -0.0146 0.0640  0.0468  786 GLY A N   
1720 C CA  . GLY A 221 ? 0.5035 0.4477 0.5397 -0.0019 0.0573  0.0521  786 GLY A CA  
1721 C C   . GLY A 221 ? 0.4172 0.3824 0.4629 0.0043  0.0495  0.0464  786 GLY A C   
1722 O O   . GLY A 221 ? 0.4304 0.4010 0.4733 0.0124  0.0431  0.0502  786 GLY A O   
1723 N N   . SER A 222 ? 0.3941 0.3700 0.4499 0.0001  0.0497  0.0373  787 SER A N   
1724 C CA  . SER A 222 ? 0.3493 0.3412 0.4117 0.0039  0.0437  0.0323  787 SER A CA  
1725 C C   . SER A 222 ? 0.2929 0.2975 0.3504 0.0044  0.0402  0.0328  787 SER A C   
1726 O O   . SER A 222 ? 0.3672 0.3796 0.4259 0.0096  0.0342  0.0324  787 SER A O   
1727 C CB  . SER A 222 ? 0.3840 0.3808 0.4529 -0.0008 0.0447  0.0239  787 SER A CB  
1728 O OG  . SER A 222 ? 0.4472 0.4356 0.5203 0.0010  0.0465  0.0217  787 SER A OG  
1729 N N   . LEU A 223 ? 0.2960 0.3035 0.3488 -0.0016 0.0445  0.0324  788 LEU A N   
1730 C CA  . LEU A 223 ? 0.2779 0.2969 0.3247 -0.0008 0.0429  0.0317  788 LEU A CA  
1731 C C   . LEU A 223 ? 0.3008 0.3150 0.3354 0.0048  0.0398  0.0394  788 LEU A C   
1732 O O   . LEU A 223 ? 0.3021 0.3253 0.3340 0.0093  0.0336  0.0375  788 LEU A O   
1733 C CB  . LEU A 223 ? 0.3261 0.3509 0.3717 -0.0086 0.0504  0.0294  788 LEU A CB  
1734 C CG  . LEU A 223 ? 0.3614 0.4012 0.4186 -0.0111 0.0498  0.0194  788 LEU A CG  
1735 C CD1 . LEU A 223 ? 0.3704 0.4207 0.4291 -0.0183 0.0577  0.0167  788 LEU A CD1 
1736 C CD2 . LEU A 223 ? 0.3280 0.3766 0.3860 -0.0040 0.0422  0.0148  788 LEU A CD2 
1737 N N   . ALA A 224 ? 0.2533 0.2518 0.2793 0.0047  0.0434  0.0479  789 ALA A N   
1738 C CA  . ALA A 224 ? 0.3302 0.3214 0.3410 0.0113  0.0393  0.0569  789 ALA A CA  
1739 C C   . ALA A 224 ? 0.3108 0.3081 0.3285 0.0212  0.0285  0.0561  789 ALA A C   
1740 O O   . ALA A 224 ? 0.3852 0.3897 0.3948 0.0261  0.0215  0.0572  789 ALA A O   
1741 C CB  . ALA A 224 ? 0.2371 0.2049 0.2366 0.0103  0.0448  0.0670  789 ALA A CB  
1742 N N   . LEU A 225 ? 0.2461 0.2418 0.2789 0.0235  0.0276  0.0532  790 LEU A N   
1743 C CA  . LEU A 225 ? 0.2945 0.2994 0.3383 0.0314  0.0190  0.0510  790 LEU A CA  
1744 C C   . LEU A 225 ? 0.2147 0.2374 0.2649 0.0292  0.0143  0.0429  790 LEU A C   
1745 O O   . LEU A 225 ? 0.2726 0.3051 0.3238 0.0340  0.0060  0.0421  790 LEU A O   
1746 C CB  . LEU A 225 ? 0.3084 0.3090 0.3674 0.0333  0.0218  0.0483  790 LEU A CB  
1747 C CG  . LEU A 225 ? 0.4011 0.4163 0.4763 0.0396  0.0153  0.0440  790 LEU A CG  
1748 C CD1 . LEU A 225 ? 0.2804 0.2991 0.3532 0.0503  0.0057  0.0495  790 LEU A CD1 
1749 C CD2 . LEU A 225 ? 0.3947 0.4071 0.4841 0.0407  0.0205  0.0398  790 LEU A CD2 
1750 N N   . PHE A 226 ? 0.2067 0.2325 0.2610 0.0223  0.0189  0.0367  791 PHE A N   
1751 C CA  . PHE A 226 ? 0.1430 0.1800 0.2016 0.0203  0.0150  0.0294  791 PHE A CA  
1752 C C   . PHE A 226 ? 0.1510 0.1938 0.1978 0.0220  0.0101  0.0291  791 PHE A C   
1753 O O   . PHE A 226 ? 0.1502 0.2010 0.1996 0.0239  0.0028  0.0255  791 PHE A O   
1754 C CB  . PHE A 226 ? 0.1328 0.1691 0.1939 0.0147  0.0198  0.0240  791 PHE A CB  
1755 C CG  . PHE A 226 ? 0.2442 0.2866 0.3061 0.0136  0.0159  0.0175  791 PHE A CG  
1756 C CD1 . PHE A 226 ? 0.1986 0.2422 0.2683 0.0127  0.0131  0.0142  791 PHE A CD1 
1757 C CD2 . PHE A 226 ? 0.1706 0.2163 0.2251 0.0133  0.0161  0.0142  791 PHE A CD2 
1758 C CE1 . PHE A 226 ? 0.1634 0.2076 0.2317 0.0110  0.0099  0.0087  791 PHE A CE1 
1759 C CE2 . PHE A 226 ? 0.1355 0.1831 0.1897 0.0136  0.0123  0.0078  791 PHE A CE2 
1760 C CZ  . PHE A 226 ? 0.1538 0.1986 0.2140 0.0122  0.0089  0.0055  791 PHE A CZ  
1761 N N   . TYR A 227 ? 0.1611 0.2002 0.1947 0.0204  0.0148  0.0322  792 TYR A N   
1762 C CA  . TYR A 227 ? 0.3264 0.3706 0.3455 0.0217  0.0120  0.0311  792 TYR A CA  
1763 C C   . TYR A 227 ? 0.3161 0.3597 0.3251 0.0280  0.0041  0.0369  792 TYR A C   
1764 O O   . TYR A 227 ? 0.3222 0.3728 0.3223 0.0301  -0.0024 0.0333  792 TYR A O   
1765 C CB  . TYR A 227 ? 0.2825 0.3247 0.2906 0.0174  0.0213  0.0326  792 TYR A CB  
1766 C CG  . TYR A 227 ? 0.3152 0.3658 0.3307 0.0142  0.0248  0.0232  792 TYR A CG  
1767 C CD1 . TYR A 227 ? 0.2972 0.3555 0.3074 0.0163  0.0217  0.0158  792 TYR A CD1 
1768 C CD2 . TYR A 227 ? 0.2576 0.3082 0.2851 0.0101  0.0301  0.0210  792 TYR A CD2 
1769 C CE1 . TYR A 227 ? 0.2793 0.3440 0.2967 0.0159  0.0239  0.0070  792 TYR A CE1 
1770 C CE2 . TYR A 227 ? 0.2381 0.2974 0.2728 0.0094  0.0312  0.0124  792 TYR A CE2 
1771 C CZ  . TYR A 227 ? 0.2761 0.3419 0.3059 0.0131  0.0282  0.0058  792 TYR A CZ  
1772 O OH  . TYR A 227 ? 0.2450 0.3178 0.2820 0.0148  0.0285  -0.0028 792 TYR A OH  
1773 N N   . ARG A 228 ? 0.2749 0.3096 0.2845 0.0319  0.0038  0.0453  793 ARG A N   
1774 C CA  . ARG A 228 ? 0.3883 0.4236 0.3914 0.0405  -0.0063 0.0506  793 ARG A CA  
1775 C C   . ARG A 228 ? 0.2005 0.2522 0.2200 0.0428  -0.0164 0.0423  793 ARG A C   
1776 O O   . ARG A 228 ? 0.2700 0.3302 0.2825 0.0469  -0.0266 0.0408  793 ARG A O   
1777 C CB  . ARG A 228 ? 0.4330 0.4543 0.4375 0.0461  -0.0053 0.0600  793 ARG A CB  
1778 C CG  . ARG A 228 ? 0.5132 0.5338 0.5088 0.0576  -0.0170 0.0669  793 ARG A CG  
1779 C CD  . ARG A 228 ? 0.5743 0.5797 0.5741 0.0656  -0.0167 0.0750  793 ARG A CD  
1780 N NE  . ARG A 228 ? 0.6928 0.7088 0.7215 0.0676  -0.0172 0.0677  793 ARG A NE  
1781 C CZ  . ARG A 228 ? 0.7649 0.7985 0.8107 0.0757  -0.0278 0.0635  793 ARG A CZ  
1782 N NH1 . ARG A 228 ? 0.8317 0.8746 0.8688 0.0832  -0.0408 0.0655  793 ARG A NH1 
1783 N NH2 . ARG A 228 ? 0.7316 0.7752 0.8034 0.0759  -0.0252 0.0565  793 ARG A NH2 
1784 N N   . LYS A 229 ? 0.1983 0.2543 0.2387 0.0391  -0.0134 0.0365  794 LYS A N   
1785 C CA  . LYS A 229 ? 0.2602 0.3311 0.3178 0.0382  -0.0203 0.0283  794 LYS A CA  
1786 C C   . LYS A 229 ? 0.1868 0.2632 0.2381 0.0330  -0.0233 0.0200  794 LYS A C   
1787 O O   . LYS A 229 ? 0.2521 0.3401 0.3083 0.0332  -0.0325 0.0142  794 LYS A O   
1788 C CB  . LYS A 229 ? 0.2661 0.3373 0.3432 0.0341  -0.0137 0.0248  794 LYS A CB  
1789 C CG  . LYS A 229 ? 0.3585 0.4248 0.4439 0.0398  -0.0106 0.0304  794 LYS A CG  
1790 C CD  . LYS A 229 ? 0.4801 0.5589 0.5765 0.0488  -0.0203 0.0310  794 LYS A CD  
1791 C CE  . LYS A 229 ? 0.5821 0.6753 0.7045 0.0469  -0.0187 0.0239  794 LYS A CE  
1792 N NZ  . LYS A 229 ? 0.6720 0.7544 0.7998 0.0456  -0.0074 0.0247  794 LYS A NZ  
1793 N N   . VAL A 230 ? 0.1652 0.2338 0.2069 0.0287  -0.0159 0.0186  795 VAL A N   
1794 C CA  . VAL A 230 ? 0.1666 0.2373 0.2013 0.0253  -0.0176 0.0102  795 VAL A CA  
1795 C C   . VAL A 230 ? 0.2902 0.3650 0.3068 0.0290  -0.0244 0.0096  795 VAL A C   
1796 O O   . VAL A 230 ? 0.2345 0.3157 0.2504 0.0279  -0.0322 0.0015  795 VAL A O   
1797 C CB  . VAL A 230 ? 0.2003 0.2639 0.2303 0.0224  -0.0083 0.0086  795 VAL A CB  
1798 C CG1 . VAL A 230 ? 0.1682 0.2331 0.1882 0.0219  -0.0099 -0.0001 795 VAL A CG1 
1799 C CG2 . VAL A 230 ? 0.1942 0.2536 0.2389 0.0188  -0.0039 0.0073  795 VAL A CG2 
1800 N N   . TYR A 231 ? 0.1993 0.2688 0.1992 0.0325  -0.0213 0.0182  796 TYR A N   
1801 C CA  . TYR A 231 ? 0.3253 0.3965 0.3022 0.0364  -0.0271 0.0195  796 TYR A CA  
1802 C C   . TYR A 231 ? 0.3329 0.4136 0.3137 0.0416  -0.0416 0.0191  796 TYR A C   
1803 O O   . TYR A 231 ? 0.3992 0.4867 0.3681 0.0427  -0.0505 0.0130  796 TYR A O   
1804 C CB  . TYR A 231 ? 0.2987 0.3591 0.2557 0.0382  -0.0196 0.0312  796 TYR A CB  
1805 C CG  . TYR A 231 ? 0.2854 0.3425 0.2350 0.0325  -0.0063 0.0290  796 TYR A CG  
1806 C CD1 . TYR A 231 ? 0.3696 0.4333 0.3124 0.0309  -0.0052 0.0184  796 TYR A CD1 
1807 C CD2 . TYR A 231 ? 0.2375 0.2859 0.1884 0.0289  0.0051  0.0364  796 TYR A CD2 
1808 C CE1 . TYR A 231 ? 0.3727 0.4373 0.3121 0.0271  0.0070  0.0152  796 TYR A CE1 
1809 C CE2 . TYR A 231 ? 0.2363 0.2867 0.1846 0.0233  0.0170  0.0330  796 TYR A CE2 
1810 C CZ  . TYR A 231 ? 0.3460 0.4059 0.2895 0.0231  0.0179  0.0224  796 TYR A CZ  
1811 O OH  . TYR A 231 ? 0.3931 0.4586 0.3370 0.0189  0.0296  0.0178  796 TYR A OH  
1812 N N   . HIS A 232 ? 0.2632 0.3459 0.2615 0.0451  -0.0442 0.0242  797 HIS A N   
1813 C CA  . HIS A 232 ? 0.2803 0.3765 0.2882 0.0510  -0.0584 0.0227  797 HIS A CA  
1814 C C   . HIS A 232 ? 0.2943 0.4055 0.3193 0.0447  -0.0648 0.0089  797 HIS A C   
1815 O O   . HIS A 232 ? 0.3020 0.4260 0.3251 0.0468  -0.0778 0.0034  797 HIS A O   
1816 C CB  . HIS A 232 ? 0.3501 0.4466 0.3772 0.0567  -0.0579 0.0294  797 HIS A CB  
1817 C CG  . HIS A 232 ? 0.4894 0.6048 0.5328 0.0638  -0.0723 0.0264  797 HIS A CG  
1818 N ND1 . HIS A 232 ? 0.5846 0.7027 0.6132 0.0750  -0.0853 0.0322  797 HIS A ND1 
1819 C CD2 . HIS A 232 ? 0.5381 0.6721 0.6121 0.0612  -0.0757 0.0177  797 HIS A CD2 
1820 C CE1 . HIS A 232 ? 0.5127 0.6529 0.5647 0.0800  -0.0975 0.0265  797 HIS A CE1 
1821 N NE2 . HIS A 232 ? 0.5192 0.6702 0.6000 0.0710  -0.0910 0.0172  797 HIS A NE2 
1822 N N   . LEU A 233 ? 0.2503 0.3586 0.2908 0.0364  -0.0560 0.0035  798 LEU A N   
1823 C CA  . LEU A 233 ? 0.2685 0.3856 0.3244 0.0283  -0.0597 -0.0087 798 LEU A CA  
1824 C C   . LEU A 233 ? 0.3133 0.4283 0.3512 0.0254  -0.0643 -0.0175 798 LEU A C   
1825 O O   . LEU A 233 ? 0.2800 0.4058 0.3230 0.0221  -0.0745 -0.0272 798 LEU A O   
1826 C CB  . LEU A 233 ? 0.2921 0.4007 0.3619 0.0208  -0.0484 -0.0103 798 LEU A CB  
1827 C CG  . LEU A 233 ? 0.2355 0.3467 0.3184 0.0107  -0.0497 -0.0213 798 LEU A CG  
1828 C CD1 . LEU A 233 ? 0.2325 0.3642 0.3383 0.0086  -0.0576 -0.0257 798 LEU A CD1 
1829 C CD2 . LEU A 233 ? 0.2317 0.3291 0.3201 0.0047  -0.0383 -0.0204 798 LEU A CD2 
1830 N N   . ALA A 234 ? 0.2438 0.3458 0.2617 0.0263  -0.0565 -0.0155 799 ALA A N   
1831 C CA  . ALA A 234 ? 0.3020 0.4005 0.3021 0.0246  -0.0584 -0.0249 799 ALA A CA  
1832 C C   . ALA A 234 ? 0.2490 0.3561 0.2302 0.0295  -0.0701 -0.0262 799 ALA A C   
1833 O O   . ALA A 234 ? 0.3232 0.4327 0.2953 0.0270  -0.0769 -0.0378 799 ALA A O   
1834 C CB  . ALA A 234 ? 0.2773 0.3640 0.2635 0.0256  -0.0460 -0.0227 799 ALA A CB  
1835 N N   . SER A 235 ? 0.2569 0.3665 0.2301 0.0370  -0.0730 -0.0145 800 SER A N   
1836 C CA  . SER A 235 ? 0.3739 0.4899 0.3249 0.0433  -0.0854 -0.0135 800 SER A CA  
1837 C C   . SER A 235 ? 0.3314 0.4658 0.2993 0.0426  -0.1019 -0.0228 800 SER A C   
1838 O O   . SER A 235 ? 0.3505 0.4920 0.3028 0.0435  -0.1136 -0.0307 800 SER A O   
1839 C CB  . SER A 235 ? 0.3610 0.4706 0.2977 0.0523  -0.0845 0.0031  800 SER A CB  
1840 O OG  . SER A 235 ? 0.4680 0.5829 0.4302 0.0558  -0.0872 0.0091  800 SER A OG  
1841 N N   . VAL A 236 ? 0.3303 0.4738 0.3305 0.0403  -0.1023 -0.0228 801 VAL A N   
1842 C CA  . VAL A 236 ? 0.2662 0.4313 0.2896 0.0377  -0.1162 -0.0326 801 VAL A CA  
1843 C C   . VAL A 236 ? 0.2752 0.4408 0.3014 0.0259  -0.1178 -0.0491 801 VAL A C   
1844 O O   . VAL A 236 ? 0.3115 0.4913 0.3378 0.0238  -0.1321 -0.0600 801 VAL A O   
1845 C CB  . VAL A 236 ? 0.3533 0.5284 0.4121 0.0366  -0.1123 -0.0297 801 VAL A CB  
1846 C CG1 . VAL A 236 ? 0.3705 0.5709 0.4580 0.0305  -0.1238 -0.0425 801 VAL A CG1 
1847 C CG2 . VAL A 236 ? 0.3505 0.5249 0.4071 0.0500  -0.1133 -0.0151 801 VAL A CG2 
1848 N N   . ARG A 237 ? 0.2656 0.4141 0.2928 0.0186  -0.1040 -0.0512 802 ARG A N   
1849 C CA  . ARG A 237 ? 0.3698 0.5115 0.3968 0.0083  -0.1040 -0.0659 802 ARG A CA  
1850 C C   . ARG A 237 ? 0.4010 0.5376 0.3966 0.0112  -0.1097 -0.0734 802 ARG A C   
1851 O O   . ARG A 237 ? 0.3749 0.5152 0.3692 0.0049  -0.1188 -0.0879 802 ARG A O   
1852 C CB  . ARG A 237 ? 0.2988 0.4209 0.3317 0.0028  -0.0886 -0.0644 802 ARG A CB  
1853 C CG  . ARG A 237 ? 0.2363 0.3630 0.2982 -0.0025 -0.0831 -0.0599 802 ARG A CG  
1854 C CD  . ARG A 237 ? 0.2373 0.3437 0.3014 -0.0069 -0.0694 -0.0573 802 ARG A CD  
1855 N NE  . ARG A 237 ? 0.2854 0.3967 0.3740 -0.0126 -0.0639 -0.0535 802 ARG A NE  
1856 C CZ  . ARG A 237 ? 0.2881 0.3837 0.3804 -0.0169 -0.0528 -0.0500 802 ARG A CZ  
1857 N NH1 . ARG A 237 ? 0.2289 0.3039 0.3044 -0.0150 -0.0472 -0.0499 802 ARG A NH1 
1858 N NH2 . ARG A 237 ? 0.1796 0.2811 0.2919 -0.0223 -0.0475 -0.0471 802 ARG A NH2 
1859 N N   . LEU A 238 ? 0.3654 0.4935 0.3354 0.0198  -0.1036 -0.0642 803 LEU A N   
1860 C CA  . LEU A 238 ? 0.3456 0.4693 0.2830 0.0229  -0.1066 -0.0710 803 LEU A CA  
1861 C C   . LEU A 238 ? 0.4430 0.5828 0.3687 0.0265  -0.1250 -0.0748 803 LEU A C   
1862 O O   . LEU A 238 ? 0.4713 0.6118 0.3791 0.0244  -0.1328 -0.0882 803 LEU A O   
1863 C CB  . LEU A 238 ? 0.3260 0.4389 0.2396 0.0299  -0.0940 -0.0596 803 LEU A CB  
1864 C CG  . LEU A 238 ? 0.3898 0.4990 0.2672 0.0331  -0.0943 -0.0661 803 LEU A CG  
1865 C CD1 . LEU A 238 ? 0.3818 0.4848 0.2586 0.0273  -0.0945 -0.0853 803 LEU A CD1 
1866 C CD2 . LEU A 238 ? 0.3601 0.4603 0.2179 0.0375  -0.0787 -0.0553 803 LEU A CD2 
1867 N N   . ARG A 239 ? 0.4667 0.6194 0.4023 0.0328  -0.1327 -0.0638 804 ARG A N   
1868 C CA  . ARG A 239 ? 0.5136 0.6840 0.4406 0.0384  -0.1527 -0.0665 804 ARG A CA  
1869 C C   . ARG A 239 ? 0.4800 0.6666 0.4287 0.0285  -0.1656 -0.0854 804 ARG A C   
1870 O O   . ARG A 239 ? 0.4236 0.6197 0.3556 0.0290  -0.1808 -0.0961 804 ARG A O   
1871 C CB  . ARG A 239 ? 0.5944 0.7749 0.5330 0.0487  -0.1586 -0.0513 804 ARG A CB  
1872 C CG  . ARG A 239 ? 0.7636 0.9373 0.6641 0.0616  -0.1638 -0.0379 804 ARG A CG  
1873 C CD  . ARG A 239 ? 0.8513 1.0278 0.7621 0.0732  -0.1675 -0.0213 804 ARG A CD  
1874 N NE  . ARG A 239 ? 0.9241 1.0835 0.7944 0.0839  -0.1665 -0.0051 804 ARG A NE  
1875 C CZ  . ARG A 239 ? 1.0097 1.1733 0.8547 0.0949  -0.1839 -0.0002 804 ARG A CZ  
1876 N NH1 . ARG A 239 ? 1.0115 1.1943 0.8744 0.0934  -0.1998 -0.0102 804 ARG A NH1 
1877 N NH2 . ARG A 239 ? 1.0708 1.2125 0.8770 0.1021  -0.1791 0.0163  804 ARG A NH2 
1878 N N   . ASP A 240 ? 0.4533 0.6424 0.4376 0.0186  -0.1594 -0.0897 805 ASP A N   
1879 C CA  . ASP A 240 ? 0.4987 0.7020 0.5065 0.0062  -0.1693 -0.1074 805 ASP A CA  
1880 C C   . ASP A 240 ? 0.4686 0.6559 0.4561 -0.0020 -0.1685 -0.1234 805 ASP A C   
1881 O O   . ASP A 240 ? 0.4714 0.6690 0.4565 -0.0076 -0.1823 -0.1382 805 ASP A O   
1882 C CB  . ASP A 240 ? 0.5230 0.7290 0.5702 -0.0039 -0.1595 -0.1071 805 ASP A CB  
1883 C CG  . ASP A 240 ? 0.6217 0.8406 0.6939 -0.0198 -0.1673 -0.1254 805 ASP A CG  
1884 O OD1 . ASP A 240 ? 0.7018 0.9008 0.7746 -0.0320 -0.1582 -0.1340 805 ASP A OD1 
1885 O OD2 . ASP A 240 ? 0.5533 0.7971 0.6426 -0.0201 -0.1797 -0.1285 805 ASP A OD2 
1886 N N   . LEU A 241 ? 0.3793 0.5409 0.3533 -0.0023 -0.1518 -0.1204 806 LEU A N   
1887 C CA  . LEU A 241 ? 0.4302 0.5733 0.3844 -0.0074 -0.1489 -0.1351 806 LEU A CA  
1888 C C   . LEU A 241 ? 0.4314 0.5791 0.3501 -0.0010 -0.1601 -0.1425 806 LEU A C   
1889 O O   . LEU A 241 ? 0.4817 0.6288 0.3929 -0.0078 -0.1693 -0.1605 806 LEU A O   
1890 C CB  . LEU A 241 ? 0.4781 0.5967 0.4234 -0.0043 -0.1297 -0.1285 806 LEU A CB  
1891 C CG  . LEU A 241 ? 0.4787 0.5816 0.4481 -0.0139 -0.1196 -0.1309 806 LEU A CG  
1892 C CD1 . LEU A 241 ? 0.4920 0.5754 0.4516 -0.0073 -0.1034 -0.1228 806 LEU A CD1 
1893 C CD2 . LEU A 241 ? 0.5405 0.6329 0.5110 -0.0253 -0.1255 -0.1507 806 LEU A CD2 
1894 N N   . CYS A 242 ? 0.4176 0.5680 0.3129 0.0114  -0.1588 -0.1281 807 CYS A N   
1895 C CA  . CYS A 242 ? 0.4530 0.6063 0.3090 0.0185  -0.1680 -0.1319 807 CYS A CA  
1896 C C   . CYS A 242 ? 0.6388 0.8080 0.5012 0.0149  -0.1861 -0.1374 807 CYS A C   
1897 O O   . CYS A 242 ? 0.7398 0.9051 0.5773 0.0136  -0.1920 -0.1457 807 CYS A O   
1898 C CB  . CYS A 242 ? 0.4562 0.6070 0.2884 0.0308  -0.1618 -0.1114 807 CYS A CB  
1899 S SG  . CYS A 242 ? 0.5488 0.6770 0.3679 0.0329  -0.1353 -0.1029 807 CYS A SG  
1900 N N   . LEU A 243 ? 0.5604 0.7477 0.4574 0.0130  -0.1938 -0.1325 808 LEU A N   
1901 C CA  . LEU A 243 ? 0.5572 0.7629 0.4673 0.0093  -0.2100 -0.1372 808 LEU A CA  
1902 C C   . LEU A 243 ? 0.6116 0.8142 0.5342 -0.0066 -0.2123 -0.1573 808 LEU A C   
1903 O O   . LEU A 243 ? 0.6422 0.8470 0.5493 -0.0097 -0.2228 -0.1667 808 LEU A O   
1904 C CB  . LEU A 243 ? 0.5270 0.7537 0.4743 0.0120  -0.2147 -0.1272 808 LEU A CB  
1905 C CG  . LEU A 243 ? 0.6744 0.9244 0.6346 0.0139  -0.2319 -0.1272 808 LEU A CG  
1906 C CD1 . LEU A 243 ? 0.6689 0.9314 0.6441 0.0269  -0.2342 -0.1097 808 LEU A CD1 
1907 C CD2 . LEU A 243 ? 0.7220 0.9861 0.7183 -0.0024 -0.2358 -0.1429 808 LEU A CD2 
1908 N N   . LYS A 244 ? 0.6142 0.8094 0.5633 -0.0171 -0.2023 -0.1633 809 LYS A N   
1909 C CA  . LYS A 244 ? 0.6771 0.8646 0.6394 -0.0336 -0.2027 -0.1806 809 LYS A CA  
1910 C C   . LYS A 244 ? 0.6758 0.8384 0.6036 -0.0348 -0.1988 -0.1926 809 LYS A C   
1911 O O   . LYS A 244 ? 0.6990 0.8546 0.6264 -0.0461 -0.2032 -0.2074 809 LYS A O   
1912 C CB  . LYS A 244 ? 0.7041 0.8851 0.6999 -0.0445 -0.1912 -0.1815 809 LYS A CB  
1913 C CG  . LYS A 244 ? 0.7983 1.0055 0.8326 -0.0469 -0.1942 -0.1735 809 LYS A CG  
1914 C CD  . LYS A 244 ? 0.8623 1.0619 0.9281 -0.0615 -0.1822 -0.1761 809 LYS A CD  
1915 C CE  . LYS A 244 ? 0.8656 1.0938 0.9701 -0.0656 -0.1845 -0.1708 809 LYS A CE  
1916 N NZ  . LYS A 244 ? 0.8654 1.0856 0.9981 -0.0816 -0.1712 -0.1727 809 LYS A NZ  
1917 N N   . LEU A 245 ? 0.6782 0.8277 0.5774 -0.0231 -0.1897 -0.1863 810 LEU A N   
1918 C CA  . LEU A 245 ? 0.7054 0.8335 0.5707 -0.0216 -0.1842 -0.1969 810 LEU A CA  
1919 C C   . LEU A 245 ? 0.7391 0.8743 0.5687 -0.0130 -0.1926 -0.1941 810 LEU A C   
1920 O O   . LEU A 245 ? 0.6940 0.8143 0.4926 -0.0114 -0.1883 -0.2027 810 LEU A O   
1921 C CB  . LEU A 245 ? 0.6373 0.7467 0.4934 -0.0149 -0.1669 -0.1935 810 LEU A CB  
1922 C CG  . LEU A 245 ? 0.4933 0.5850 0.3751 -0.0243 -0.1582 -0.2008 810 LEU A CG  
1923 C CD1 . LEU A 245 ? 0.4668 0.5477 0.3491 -0.0161 -0.1433 -0.1919 810 LEU A CD1 
1924 C CD2 . LEU A 245 ? 0.5254 0.5938 0.3965 -0.0322 -0.1566 -0.2185 810 LEU A CD2 
1925 N N   . ASP A 246 ? 0.7409 0.8978 0.5752 -0.0075 -0.2041 -0.1820 811 ASP A N   
1926 C CA  . ASP A 246 ? 0.7977 0.9611 0.5985 0.0011  -0.2139 -0.1761 811 ASP A CA  
1927 C C   . ASP A 246 ? 0.7471 0.8925 0.5060 0.0095  -0.2008 -0.1725 811 ASP A C   
1928 O O   . ASP A 246 ? 0.7102 0.8444 0.4408 0.0074  -0.1997 -0.1839 811 ASP A O   
1929 C CB  . ASP A 246 ? 0.9159 1.0860 0.7125 -0.0073 -0.2293 -0.1908 811 ASP A CB  
1930 C CG  . ASP A 246 ? 1.0264 1.1984 0.7813 0.0009  -0.2385 -0.1866 811 ASP A CG  
1931 O OD1 . ASP A 246 ? 1.0577 1.2426 0.8086 0.0106  -0.2465 -0.1707 811 ASP A OD1 
1932 O OD2 . ASP A 246 ? 1.0552 1.2144 0.7806 -0.0024 -0.2378 -0.1992 811 ASP A OD2 
1933 N N   . VAL A 247 ? 0.7098 0.8528 0.4662 0.0182  -0.1897 -0.1570 812 VAL A N   
1934 C CA  . VAL A 247 ? 0.7421 0.8705 0.4631 0.0253  -0.1744 -0.1520 812 VAL A CA  
1935 C C   . VAL A 247 ? 0.7003 0.8327 0.3942 0.0352  -0.1774 -0.1324 812 VAL A C   
1936 O O   . VAL A 247 ? 0.6496 0.7943 0.3597 0.0392  -0.1878 -0.1199 812 VAL A O   
1937 C CB  . VAL A 247 ? 0.7775 0.8975 0.5141 0.0265  -0.1568 -0.1497 812 VAL A CB  
1938 C CG1 . VAL A 247 ? 0.8620 0.9689 0.5660 0.0320  -0.1392 -0.1485 812 VAL A CG1 
1939 C CG2 . VAL A 247 ? 0.7892 0.9026 0.5556 0.0166  -0.1558 -0.1665 812 VAL A CG2 
1940 N N   . SER A 248 ? 0.7130 0.8337 0.3658 0.0389  -0.1678 -0.1298 813 SER A N   
1941 C CA  . SER A 248 ? 0.7234 0.8417 0.3456 0.0469  -0.1672 -0.1099 813 SER A CA  
1942 C C   . SER A 248 ? 0.7360 0.8534 0.3723 0.0525  -0.1569 -0.0920 813 SER A C   
1943 O O   . SER A 248 ? 0.6967 0.8124 0.3541 0.0506  -0.1444 -0.0960 813 SER A O   
1944 C CB  . SER A 248 ? 0.7078 0.8122 0.2841 0.0472  -0.1543 -0.1117 813 SER A CB  
1945 O OG  . SER A 248 ? 0.6888 0.7848 0.2664 0.0468  -0.1319 -0.1140 813 SER A OG  
1946 N N   . ASN A 249 ? 0.8139 0.9308 0.4378 0.0596  -0.1624 -0.0721 814 ASN A N   
1947 C CA  . ASN A 249 ? 0.9097 1.0226 0.5434 0.0651  -0.1528 -0.0535 814 ASN A CA  
1948 C C   . ASN A 249 ? 0.8825 0.9811 0.4921 0.0643  -0.1285 -0.0478 814 ASN A C   
1949 O O   . ASN A 249 ? 0.9287 1.0245 0.5510 0.0661  -0.1165 -0.0371 814 ASN A O   
1950 C CB  . ASN A 249 ? 0.9766 1.0881 0.6005 0.0733  -0.1648 -0.0338 814 ASN A CB  
1951 C CG  . ASN A 249 ? 0.9885 1.1186 0.6479 0.0753  -0.1862 -0.0377 814 ASN A CG  
1952 O OD1 . ASN A 249 ? 0.9324 1.0760 0.6212 0.0685  -0.1922 -0.0553 814 ASN A OD1 
1953 N ND2 . ASN A 249 ? 1.0342 1.1644 0.6919 0.0841  -0.1970 -0.0213 814 ASN A ND2 
1954 N N   . GLU A 250 ? 0.8400 0.9312 0.4164 0.0609  -0.1206 -0.0556 815 GLU A N   
1955 C CA  . GLU A 250 ? 0.8393 0.9201 0.3950 0.0588  -0.0959 -0.0523 815 GLU A CA  
1956 C C   . GLU A 250 ? 0.7332 0.8191 0.3165 0.0557  -0.0827 -0.0676 815 GLU A C   
1957 O O   . GLU A 250 ? 0.6880 0.7719 0.2757 0.0554  -0.0637 -0.0614 815 GLU A O   
1958 C CB  . GLU A 250 ? 0.9801 1.0523 0.4920 0.0559  -0.0910 -0.0566 815 GLU A CB  
1959 C CG  . GLU A 250 ? 1.0890 1.1547 0.5850 0.0519  -0.0641 -0.0600 815 GLU A CG  
1960 C CD  . GLU A 250 ? 1.2011 1.2577 0.6840 0.0511  -0.0466 -0.0382 815 GLU A CD  
1961 O OE1 . GLU A 250 ? 1.2362 1.2918 0.7354 0.0545  -0.0515 -0.0223 815 GLU A OE1 
1962 O OE2 . GLU A 250 ? 1.2384 1.2883 0.6955 0.0461  -0.0270 -0.0374 815 GLU A OE2 
1963 N N   . LEU A 251 ? 0.7000 0.7916 0.3024 0.0529  -0.0926 -0.0877 816 LEU A N   
1964 C CA  . LEU A 251 ? 0.6627 0.7560 0.2933 0.0505  -0.0827 -0.1020 816 LEU A CA  
1965 C C   . LEU A 251 ? 0.6193 0.7161 0.2909 0.0498  -0.0838 -0.0916 816 LEU A C   
1966 O O   . LEU A 251 ? 0.6177 0.7106 0.3134 0.0476  -0.0685 -0.0907 816 LEU A O   
1967 C CB  . LEU A 251 ? 0.6418 0.7337 0.2817 0.0460  -0.0922 -0.1247 816 LEU A CB  
1968 C CG  . LEU A 251 ? 0.6278 0.7160 0.2968 0.0440  -0.0837 -0.1395 816 LEU A CG  
1969 C CD1 . LEU A 251 ? 0.5740 0.6590 0.2366 0.0474  -0.0602 -0.1383 816 LEU A CD1 
1970 C CD2 . LEU A 251 ? 0.6858 0.7664 0.3574 0.0390  -0.0913 -0.1607 816 LEU A CD2 
1971 N N   . ARG A 252 ? 0.6396 0.7430 0.3223 0.0513  -0.1013 -0.0832 817 ARG A N   
1972 C CA  . ARG A 252 ? 0.6137 0.7190 0.3360 0.0501  -0.1012 -0.0712 817 ARG A CA  
1973 C C   . ARG A 252 ? 0.5727 0.6694 0.2939 0.0514  -0.0823 -0.0533 817 ARG A C   
1974 O O   . ARG A 252 ? 0.5113 0.6055 0.2626 0.0481  -0.0711 -0.0513 817 ARG A O   
1975 C CB  . ARG A 252 ? 0.5780 0.6940 0.3071 0.0541  -0.1222 -0.0640 817 ARG A CB  
1976 C CG  . ARG A 252 ? 0.5254 0.6454 0.2972 0.0531  -0.1225 -0.0545 817 ARG A CG  
1977 C CD  . ARG A 252 ? 0.5399 0.6742 0.3206 0.0586  -0.1437 -0.0497 817 ARG A CD  
1978 N NE  . ARG A 252 ? 0.6346 0.7635 0.3819 0.0690  -0.1480 -0.0327 817 ARG A NE  
1979 C CZ  . ARG A 252 ? 0.7072 0.8457 0.4540 0.0772  -0.1668 -0.0260 817 ARG A CZ  
1980 N NH1 . ARG A 252 ? 0.7167 0.8740 0.4992 0.0746  -0.1812 -0.0359 817 ARG A NH1 
1981 N NH2 . ARG A 252 ? 0.7497 0.8751 0.4662 0.0849  -0.1673 -0.0085 817 ARG A NH2 
1982 N N   . ARG A 253 ? 0.6291 0.7204 0.3136 0.0557  -0.0787 -0.0405 818 ARG A N   
1983 C CA  . ARG A 253 ? 0.6127 0.6944 0.2919 0.0549  -0.0600 -0.0239 818 ARG A CA  
1984 C C   . ARG A 253 ? 0.5827 0.6640 0.2682 0.0498  -0.0388 -0.0332 818 ARG A C   
1985 O O   . ARG A 253 ? 0.4970 0.5756 0.2012 0.0467  -0.0243 -0.0251 818 ARG A O   
1986 C CB  . ARG A 253 ? 0.6808 0.7535 0.3131 0.0592  -0.0600 -0.0092 818 ARG A CB  
1987 C CG  . ARG A 253 ? 0.8510 0.9105 0.4776 0.0573  -0.0429 0.0108  818 ARG A CG  
1988 C CD  . ARG A 253 ? 1.0288 1.0752 0.6023 0.0604  -0.0411 0.0249  818 ARG A CD  
1989 N NE  . ARG A 253 ? 1.1136 1.1440 0.6798 0.0565  -0.0237 0.0443  818 ARG A NE  
1990 C CZ  . ARG A 253 ? 1.1575 1.1720 0.7146 0.0614  -0.0302 0.0643  818 ARG A CZ  
1991 N NH1 . ARG A 253 ? 1.1452 1.1609 0.7025 0.0714  -0.0544 0.0674  818 ARG A NH1 
1992 N NH2 . ARG A 253 ? 1.1979 1.1951 0.7481 0.0559  -0.0126 0.0804  818 ARG A NH2 
1993 N N   . LYS A 254 ? 0.5739 0.6588 0.2446 0.0495  -0.0378 -0.0513 819 LYS A N   
1994 C CA  . LYS A 254 ? 0.5800 0.6666 0.2585 0.0471  -0.0193 -0.0629 819 LYS A CA  
1995 C C   . LYS A 254 ? 0.5065 0.5944 0.2299 0.0454  -0.0197 -0.0709 819 LYS A C   
1996 O O   . LYS A 254 ? 0.5241 0.6134 0.2663 0.0442  -0.0048 -0.0708 819 LYS A O   
1997 C CB  . LYS A 254 ? 0.5444 0.6328 0.1926 0.0489  -0.0186 -0.0813 819 LYS A CB  
1998 C CG  . LYS A 254 ? 0.5891 0.6756 0.1887 0.0498  -0.0107 -0.0741 819 LYS A CG  
1999 C CD  . LYS A 254 ? 0.6816 0.7638 0.2578 0.0490  -0.0132 -0.0908 819 LYS A CD  
2000 C CE  . LYS A 254 ? 0.7812 0.8546 0.3137 0.0463  -0.0056 -0.0804 819 LYS A CE  
2001 N NZ  . LYS A 254 ? 0.8672 0.9355 0.3730 0.0453  -0.0109 -0.0957 819 LYS A NZ  
2002 N N   . ILE A 255 ? 0.5139 0.6018 0.2536 0.0450  -0.0370 -0.0781 820 ILE A N   
2003 C CA  . ILE A 255 ? 0.5044 0.5902 0.2830 0.0425  -0.0383 -0.0838 820 ILE A CA  
2004 C C   . ILE A 255 ? 0.4703 0.5559 0.2734 0.0411  -0.0326 -0.0667 820 ILE A C   
2005 O O   . ILE A 255 ? 0.4063 0.4900 0.2324 0.0400  -0.0230 -0.0675 820 ILE A O   
2006 C CB  . ILE A 255 ? 0.4965 0.5826 0.2868 0.0398  -0.0573 -0.0936 820 ILE A CB  
2007 C CG1 . ILE A 255 ? 0.5256 0.6088 0.2958 0.0399  -0.0621 -0.1143 820 ILE A CG1 
2008 C CG2 . ILE A 255 ? 0.4786 0.5605 0.3073 0.0357  -0.0577 -0.0941 820 ILE A CG2 
2009 C CD1 . ILE A 255 ? 0.4659 0.5514 0.2418 0.0355  -0.0818 -0.1250 820 ILE A CD1 
2010 N N   . TRP A 256 ? 0.5141 0.6010 0.3105 0.0420  -0.0391 -0.0516 821 TRP A N   
2011 C CA  . TRP A 256 ? 0.4139 0.4986 0.2292 0.0411  -0.0338 -0.0354 821 TRP A CA  
2012 C C   . TRP A 256 ? 0.4801 0.5625 0.2924 0.0394  -0.0141 -0.0295 821 TRP A C   
2013 O O   . TRP A 256 ? 0.4518 0.5334 0.2894 0.0370  -0.0069 -0.0251 821 TRP A O   
2014 C CB  . TRP A 256 ? 0.3930 0.4769 0.1953 0.0447  -0.0441 -0.0208 821 TRP A CB  
2015 C CG  . TRP A 256 ? 0.4051 0.4837 0.2240 0.0445  -0.0383 -0.0049 821 TRP A CG  
2016 C CD1 . TRP A 256 ? 0.4214 0.4909 0.2232 0.0450  -0.0288 0.0105  821 TRP A CD1 
2017 C CD2 . TRP A 256 ? 0.3679 0.4481 0.2225 0.0429  -0.0408 -0.0034 821 TRP A CD2 
2018 N NE1 . TRP A 256 ? 0.4579 0.5227 0.2832 0.0444  -0.0261 0.0205  821 TRP A NE1 
2019 C CE2 . TRP A 256 ? 0.4204 0.4927 0.2779 0.0435  -0.0332 0.0120  821 TRP A CE2 
2020 C CE3 . TRP A 256 ? 0.4133 0.4994 0.2959 0.0403  -0.0478 -0.0137 821 TRP A CE3 
2021 C CZ2 . TRP A 256 ? 0.3916 0.4631 0.2786 0.0425  -0.0329 0.0162  821 TRP A CZ2 
2022 C CZ3 . TRP A 256 ? 0.3672 0.4528 0.2782 0.0388  -0.0466 -0.0083 821 TRP A CZ3 
2023 C CH2 . TRP A 256 ? 0.3222 0.4013 0.2351 0.0404  -0.0394 0.0060  821 TRP A CH2 
2024 N N   . THR A 257 ? 0.4840 0.5667 0.2653 0.0399  -0.0053 -0.0303 822 THR A N   
2025 C CA  . THR A 257 ? 0.4846 0.5688 0.2626 0.0366  0.0149  -0.0264 822 THR A CA  
2026 C C   . THR A 257 ? 0.4299 0.5213 0.2347 0.0364  0.0233  -0.0402 822 THR A C   
2027 O O   . THR A 257 ? 0.3865 0.4816 0.2098 0.0334  0.0352  -0.0362 822 THR A O   
2028 C CB  . THR A 257 ? 0.5425 0.6270 0.2795 0.0365  0.0238  -0.0265 822 THR A CB  
2029 O OG1 . THR A 257 ? 0.5671 0.6418 0.2762 0.0377  0.0165  -0.0106 822 THR A OG1 
2030 C CG2 . THR A 257 ? 0.4447 0.5347 0.1826 0.0315  0.0465  -0.0250 822 THR A CG2 
2031 N N   . CYS A 258 ? 0.4045 0.4969 0.2113 0.0398  0.0162  -0.0568 823 CYS A N   
2032 C CA  . CYS A 258 ? 0.3641 0.4595 0.1940 0.0420  0.0217  -0.0701 823 CYS A CA  
2033 C C   . CYS A 258 ? 0.3623 0.4536 0.2256 0.0407  0.0164  -0.0651 823 CYS A C   
2034 O O   . CYS A 258 ? 0.3123 0.4074 0.1962 0.0415  0.0244  -0.0668 823 CYS A O   
2035 C CB  . CYS A 258 ? 0.3810 0.4729 0.2018 0.0461  0.0144  -0.0888 823 CYS A CB  
2036 S SG  . CYS A 258 ? 0.5097 0.6006 0.3546 0.0519  0.0203  -0.1057 823 CYS A SG  
2037 N N   . PHE A 259 ? 0.3226 0.4078 0.1910 0.0389  0.0026  -0.0597 824 PHE A N   
2038 C CA  . PHE A 259 ? 0.3446 0.4255 0.2414 0.0369  -0.0017 -0.0546 824 PHE A CA  
2039 C C   . PHE A 259 ? 0.3487 0.4324 0.2564 0.0346  0.0079  -0.0411 824 PHE A C   
2040 O O   . PHE A 259 ? 0.2571 0.3403 0.1863 0.0341  0.0115  -0.0412 824 PHE A O   
2041 C CB  . PHE A 259 ? 0.2920 0.3699 0.1922 0.0348  -0.0166 -0.0514 824 PHE A CB  
2042 C CG  . PHE A 259 ? 0.3576 0.4324 0.2846 0.0320  -0.0190 -0.0449 824 PHE A CG  
2043 C CD1 . PHE A 259 ? 0.3286 0.3966 0.2731 0.0307  -0.0200 -0.0526 824 PHE A CD1 
2044 C CD2 . PHE A 259 ? 0.3126 0.3891 0.2450 0.0311  -0.0197 -0.0309 824 PHE A CD2 
2045 C CE1 . PHE A 259 ? 0.3006 0.3651 0.2661 0.0276  -0.0210 -0.0463 824 PHE A CE1 
2046 C CE2 . PHE A 259 ? 0.3226 0.3967 0.2782 0.0287  -0.0207 -0.0262 824 PHE A CE2 
2047 C CZ  . PHE A 259 ? 0.2821 0.3510 0.2535 0.0264  -0.0210 -0.0338 824 PHE A CZ  
2048 N N   . GLU A 260 ? 0.4205 0.5050 0.3114 0.0330  0.0114  -0.0296 825 GLU A N   
2049 C CA  . GLU A 260 ? 0.3984 0.4825 0.2969 0.0294  0.0213  -0.0174 825 GLU A CA  
2050 C C   . GLU A 260 ? 0.4165 0.5096 0.3235 0.0279  0.0357  -0.0236 825 GLU A C   
2051 O O   . GLU A 260 ? 0.3600 0.4552 0.2876 0.0252  0.0408  -0.0205 825 GLU A O   
2052 C CB  . GLU A 260 ? 0.3743 0.4531 0.2478 0.0281  0.0233  -0.0039 825 GLU A CB  
2053 C CG  . GLU A 260 ? 0.4726 0.5479 0.3501 0.0226  0.0357  0.0079  825 GLU A CG  
2054 C CD  . GLU A 260 ? 0.6425 0.7059 0.4933 0.0220  0.0363  0.0231  825 GLU A CD  
2055 O OE1 . GLU A 260 ? 0.8189 0.8767 0.6591 0.0275  0.0224  0.0273  825 GLU A OE1 
2056 O OE2 . GLU A 260 ? 0.6506 0.7100 0.4910 0.0159  0.0504  0.0307  825 GLU A OE2 
2057 N N   . PHE A 261 ? 0.3690 0.4690 0.2610 0.0301  0.0418  -0.0337 826 PHE A N   
2058 C CA  . PHE A 261 ? 0.3487 0.4618 0.2512 0.0303  0.0554  -0.0422 826 PHE A CA  
2059 C C   . PHE A 261 ? 0.3341 0.4494 0.2663 0.0343  0.0512  -0.0502 826 PHE A C   
2060 O O   . PHE A 261 ? 0.3013 0.4271 0.2521 0.0332  0.0593  -0.0514 826 PHE A O   
2061 C CB  . PHE A 261 ? 0.3182 0.4385 0.2006 0.0340  0.0615  -0.0548 826 PHE A CB  
2062 C CG  . PHE A 261 ? 0.3327 0.4696 0.2313 0.0368  0.0739  -0.0671 826 PHE A CG  
2063 C CD1 . PHE A 261 ? 0.4052 0.5566 0.3065 0.0306  0.0909  -0.0636 826 PHE A CD1 
2064 C CD2 . PHE A 261 ? 0.3373 0.4753 0.2498 0.0457  0.0687  -0.0825 826 PHE A CD2 
2065 C CE1 . PHE A 261 ? 0.3779 0.5497 0.2986 0.0337  0.1020  -0.0763 826 PHE A CE1 
2066 C CE2 . PHE A 261 ? 0.3910 0.5459 0.3207 0.0509  0.0788  -0.0944 826 PHE A CE2 
2067 C CZ  . PHE A 261 ? 0.4106 0.5850 0.3461 0.0451  0.0953  -0.0919 826 PHE A CZ  
2068 N N   . THR A 262 ? 0.3309 0.4358 0.2665 0.0386  0.0383  -0.0560 827 THR A N   
2069 C CA  . THR A 262 ? 0.2929 0.3948 0.2513 0.0428  0.0338  -0.0622 827 THR A CA  
2070 C C   . THR A 262 ? 0.2948 0.3935 0.2705 0.0383  0.0316  -0.0508 827 THR A C   
2071 O O   . THR A 262 ? 0.2971 0.3995 0.2908 0.0404  0.0332  -0.0530 827 THR A O   
2072 C CB  . THR A 262 ? 0.3422 0.4300 0.2976 0.0467  0.0218  -0.0712 827 THR A CB  
2073 O OG1 . THR A 262 ? 0.4366 0.5160 0.3851 0.0416  0.0123  -0.0638 827 THR A OG1 
2074 C CG2 . THR A 262 ? 0.3061 0.3960 0.2455 0.0521  0.0243  -0.0855 827 THR A CG2 
2075 N N   . LEU A 263 ? 0.2204 0.3126 0.1902 0.0332  0.0276  -0.0392 828 LEU A N   
2076 C CA  . LEU A 263 ? 0.2733 0.3621 0.2577 0.0291  0.0271  -0.0291 828 LEU A CA  
2077 C C   . LEU A 263 ? 0.1989 0.2973 0.1895 0.0251  0.0388  -0.0249 828 LEU A C   
2078 O O   . LEU A 263 ? 0.3996 0.4998 0.4075 0.0237  0.0397  -0.0241 828 LEU A O   
2079 C CB  . LEU A 263 ? 0.2486 0.3293 0.2258 0.0263  0.0208  -0.0186 828 LEU A CB  
2080 C CG  . LEU A 263 ? 0.3280 0.4016 0.3078 0.0275  0.0086  -0.0215 828 LEU A CG  
2081 C CD1 . LEU A 263 ? 0.3845 0.4550 0.3655 0.0256  0.0034  -0.0111 828 LEU A CD1 
2082 C CD2 . LEU A 263 ? 0.3474 0.4157 0.3438 0.0282  0.0060  -0.0273 828 LEU A CD2 
2083 N N   . VAL A 264 ? 0.3480 0.4518 0.3231 0.0221  0.0477  -0.0221 829 VAL A N   
2084 C CA  . VAL A 264 ? 0.2736 0.3854 0.2528 0.0152  0.0605  -0.0174 829 VAL A CA  
2085 C C   . VAL A 264 ? 0.3454 0.4765 0.3396 0.0163  0.0692  -0.0291 829 VAL A C   
2086 O O   . VAL A 264 ? 0.3691 0.5091 0.3820 0.0121  0.0741  -0.0292 829 VAL A O   
2087 C CB  . VAL A 264 ? 0.3333 0.4407 0.2866 0.0102  0.0682  -0.0084 829 VAL A CB  
2088 C CG1 . VAL A 264 ? 0.3245 0.4387 0.2814 0.0006  0.0836  -0.0040 829 VAL A CG1 
2089 C CG2 . VAL A 264 ? 0.3123 0.4021 0.2537 0.0108  0.0585  0.0038  829 VAL A CG2 
2090 N N   . HIS A 265 ? 0.3644 0.5035 0.3507 0.0221  0.0714  -0.0398 830 HIS A N   
2091 C CA  . HIS A 265 ? 0.3789 0.5393 0.3809 0.0251  0.0803  -0.0522 830 HIS A CA  
2092 C C   . HIS A 265 ? 0.3616 0.5243 0.3796 0.0369  0.0712  -0.0648 830 HIS A C   
2093 O O   . HIS A 265 ? 0.3660 0.5478 0.4005 0.0418  0.0768  -0.0757 830 HIS A O   
2094 C CB  . HIS A 265 ? 0.4196 0.5904 0.4028 0.0236  0.0932  -0.0569 830 HIS A CB  
2095 C CG  . HIS A 265 ? 0.5026 0.6737 0.4727 0.0111  0.1060  -0.0449 830 HIS A CG  
2096 N ND1 . HIS A 265 ? 0.4828 0.6658 0.4713 0.0018  0.1162  -0.0421 830 HIS A ND1 
2097 C CD2 . HIS A 265 ? 0.5160 0.6742 0.4550 0.0062  0.1095  -0.0346 830 HIS A CD2 
2098 C CE1 . HIS A 265 ? 0.4910 0.6662 0.4600 -0.0093 0.1269  -0.0302 830 HIS A CE1 
2099 N NE2 . HIS A 265 ? 0.5022 0.6617 0.4397 -0.0060 0.1228  -0.0248 830 HIS A NE2 
2100 N N   . CYS A 266 ? 0.3223 0.4657 0.3360 0.0415  0.0576  -0.0636 831 CYS A N   
2101 C CA  . CYS A 266 ? 0.2764 0.4153 0.3039 0.0515  0.0485  -0.0724 831 CYS A CA  
2102 C C   . CYS A 266 ? 0.3098 0.4302 0.3416 0.0497  0.0371  -0.0640 831 CYS A C   
2103 O O   . CYS A 266 ? 0.2890 0.3926 0.3158 0.0541  0.0279  -0.0668 831 CYS A O   
2104 C CB  . CYS A 266 ? 0.2716 0.4027 0.2869 0.0601  0.0449  -0.0841 831 CYS A CB  
2105 S SG  . CYS A 266 ? 0.4359 0.5851 0.4381 0.0622  0.0587  -0.0951 831 CYS A SG  
2106 N N   . PRO A 267 ? 0.2731 0.3960 0.3140 0.0427  0.0386  -0.0545 832 PRO A N   
2107 C CA  . PRO A 267 ? 0.2242 0.3297 0.2658 0.0400  0.0297  -0.0462 832 PRO A CA  
2108 C C   . PRO A 267 ? 0.2782 0.3741 0.3281 0.0473  0.0210  -0.0507 832 PRO A C   
2109 O O   . PRO A 267 ? 0.2709 0.3495 0.3170 0.0456  0.0140  -0.0460 832 PRO A O   
2110 C CB  . PRO A 267 ? 0.1643 0.2753 0.2131 0.0316  0.0350  -0.0373 832 PRO A CB  
2111 C CG  . PRO A 267 ? 0.2413 0.3741 0.3012 0.0312  0.0442  -0.0436 832 PRO A CG  
2112 C CD  . PRO A 267 ? 0.2587 0.3992 0.3095 0.0360  0.0490  -0.0518 832 PRO A CD  
2113 N N   . ASP A 268 ? 0.2934 0.4006 0.3543 0.0554  0.0215  -0.0596 833 ASP A N   
2114 C CA  . ASP A 268 ? 0.2949 0.3906 0.3606 0.0647  0.0122  -0.0634 833 ASP A CA  
2115 C C   . ASP A 268 ? 0.3721 0.4441 0.4244 0.0689  0.0057  -0.0665 833 ASP A C   
2116 O O   . ASP A 268 ? 0.3682 0.4206 0.4181 0.0723  -0.0022 -0.0648 833 ASP A O   
2117 C CB  . ASP A 268 ? 0.2999 0.4149 0.3806 0.0753  0.0132  -0.0739 833 ASP A CB  
2118 C CG  . ASP A 268 ? 0.4317 0.5552 0.5098 0.0826  0.0183  -0.0855 833 ASP A CG  
2119 O OD1 . ASP A 268 ? 0.4964 0.6072 0.5718 0.0945  0.0120  -0.0933 833 ASP A OD1 
2120 O OD2 . ASP A 268 ? 0.4573 0.5981 0.5341 0.0766  0.0292  -0.0869 833 ASP A OD2 
2121 N N   . LEU A 269 ? 0.2995 0.3723 0.3414 0.0678  0.0091  -0.0711 834 LEU A N   
2122 C CA  . LEU A 269 ? 0.3254 0.3765 0.3547 0.0695  0.0031  -0.0757 834 LEU A CA  
2123 C C   . LEU A 269 ? 0.3253 0.3578 0.3501 0.0606  -0.0027 -0.0665 834 LEU A C   
2124 O O   . LEU A 269 ? 0.3624 0.3733 0.3810 0.0611  -0.0087 -0.0693 834 LEU A O   
2125 C CB  . LEU A 269 ? 0.2210 0.2788 0.2382 0.0681  0.0074  -0.0823 834 LEU A CB  
2126 C CG  . LEU A 269 ? 0.3514 0.4225 0.3692 0.0782  0.0135  -0.0955 834 LEU A CG  
2127 C CD1 . LEU A 269 ? 0.3308 0.4065 0.3313 0.0753  0.0180  -0.1011 834 LEU A CD1 
2128 C CD2 . LEU A 269 ? 0.3359 0.3906 0.3566 0.0905  0.0070  -0.1054 834 LEU A CD2 
2129 N N   . MET A 270 ? 0.2124 0.2531 0.2410 0.0522  -0.0001 -0.0562 835 MET A N   
2130 C CA  . MET A 270 ? 0.2368 0.2648 0.2641 0.0440  -0.0039 -0.0482 835 MET A CA  
2131 C C   . MET A 270 ? 0.2547 0.2694 0.2863 0.0447  -0.0071 -0.0439 835 MET A C   
2132 O O   . MET A 270 ? 0.2929 0.2936 0.3223 0.0385  -0.0097 -0.0394 835 MET A O   
2133 C CB  . MET A 270 ? 0.3054 0.3456 0.3347 0.0366  0.0000  -0.0395 835 MET A CB  
2134 C CG  . MET A 270 ? 0.3837 0.4268 0.4044 0.0328  -0.0015 -0.0398 835 MET A CG  
2135 S SD  . MET A 270 ? 0.3306 0.3574 0.3480 0.0289  -0.0098 -0.0444 835 MET A SD  
2136 C CE  . MET A 270 ? 0.2567 0.2759 0.2850 0.0224  -0.0102 -0.0353 835 MET A CE  
2137 N N   . LYS A 271 ? 0.2284 0.2489 0.2658 0.0520  -0.0070 -0.0455 836 LYS A N   
2138 C CA  . LYS A 271 ? 0.2462 0.2548 0.2843 0.0533  -0.0109 -0.0406 836 LYS A CA  
2139 C C   . LYS A 271 ? 0.3020 0.2820 0.3294 0.0548  -0.0166 -0.0413 836 LYS A C   
2140 O O   . LYS A 271 ? 0.2224 0.1925 0.2453 0.0629  -0.0197 -0.0489 836 LYS A O   
2141 C CB  . LYS A 271 ? 0.2168 0.2384 0.2635 0.0627  -0.0122 -0.0443 836 LYS A CB  
2142 C CG  . LYS A 271 ? 0.2948 0.3048 0.3391 0.0648  -0.0178 -0.0390 836 LYS A CG  
2143 C CD  . LYS A 271 ? 0.2460 0.2756 0.3020 0.0726  -0.0202 -0.0429 836 LYS A CD  
2144 C CE  . LYS A 271 ? 0.2583 0.2919 0.3189 0.0873  -0.0243 -0.0529 836 LYS A CE  
2145 N NZ  . LYS A 271 ? 0.2422 0.2978 0.3174 0.0955  -0.0283 -0.0576 836 LYS A NZ  
2146 N N   . ASP A 272 ? 0.2636 0.2296 0.2864 0.0465  -0.0168 -0.0335 837 ASP A N   
2147 C CA  . ASP A 272 ? 0.3376 0.2742 0.3489 0.0440  -0.0201 -0.0322 837 ASP A CA  
2148 C C   . ASP A 272 ? 0.3071 0.2351 0.3152 0.0400  -0.0206 -0.0389 837 ASP A C   
2149 O O   . ASP A 272 ? 0.2875 0.1891 0.2859 0.0396  -0.0236 -0.0409 837 ASP A O   
2150 C CB  . ASP A 272 ? 0.2604 0.1790 0.2635 0.0560  -0.0261 -0.0332 837 ASP A CB  
2151 C CG  . ASP A 272 ? 0.3028 0.2247 0.3051 0.0582  -0.0275 -0.0262 837 ASP A CG  
2152 O OD1 . ASP A 272 ? 0.3643 0.2854 0.3648 0.0477  -0.0235 -0.0190 837 ASP A OD1 
2153 O OD2 . ASP A 272 ? 0.3372 0.2642 0.3414 0.0707  -0.0329 -0.0291 837 ASP A OD2 
2154 N N   . ARG A 273 ? 0.2514 0.1999 0.2659 0.0364  -0.0181 -0.0421 838 ARG A N   
2155 C CA  . ARG A 273 ? 0.2910 0.2344 0.3019 0.0322  -0.0199 -0.0495 838 ARG A CA  
2156 C C   . ARG A 273 ? 0.3081 0.2647 0.3252 0.0207  -0.0185 -0.0459 838 ARG A C   
2157 O O   . ARG A 273 ? 0.2776 0.2424 0.3013 0.0162  -0.0154 -0.0375 838 ARG A O   
2158 C CB  . ARG A 273 ? 0.2372 0.1917 0.2459 0.0413  -0.0201 -0.0594 838 ARG A CB  
2159 C CG  . ARG A 273 ? 0.3329 0.2746 0.3378 0.0545  -0.0223 -0.0656 838 ARG A CG  
2160 C CD  . ARG A 273 ? 0.3415 0.2888 0.3425 0.0623  -0.0219 -0.0786 838 ARG A CD  
2161 N NE  . ARG A 273 ? 0.3950 0.3308 0.3950 0.0770  -0.0243 -0.0854 838 ARG A NE  
2162 C CZ  . ARG A 273 ? 0.2754 0.2310 0.2845 0.0881  -0.0220 -0.0878 838 ARG A CZ  
2163 N NH1 . ARG A 273 ? 0.3265 0.3118 0.3447 0.0842  -0.0161 -0.0836 838 ARG A NH1 
2164 N NH2 . ARG A 273 ? 0.2969 0.2427 0.3068 0.1032  -0.0256 -0.0947 838 ARG A NH2 
2165 N N   . HIS A 274 ? 0.2962 0.2544 0.3112 0.0167  -0.0214 -0.0532 839 HIS A N   
2166 C CA  . HIS A 274 ? 0.3209 0.2920 0.3430 0.0069  -0.0226 -0.0516 839 HIS A CA  
2167 C C   . HIS A 274 ? 0.2544 0.2463 0.2740 0.0106  -0.0242 -0.0546 839 HIS A C   
2168 O O   . HIS A 274 ? 0.3129 0.3036 0.3227 0.0164  -0.0255 -0.0630 839 HIS A O   
2169 C CB  . HIS A 274 ? 0.2402 0.1955 0.2618 -0.0030 -0.0262 -0.0581 839 HIS A CB  
2170 C CG  . HIS A 274 ? 0.2967 0.2669 0.3306 -0.0140 -0.0276 -0.0569 839 HIS A CG  
2171 N ND1 . HIS A 274 ? 0.3401 0.3319 0.3771 -0.0140 -0.0326 -0.0605 839 HIS A ND1 
2172 C CD2 . HIS A 274 ? 0.2617 0.2294 0.3060 -0.0249 -0.0249 -0.0531 839 HIS A CD2 
2173 C CE1 . HIS A 274 ? 0.3228 0.3266 0.3742 -0.0232 -0.0341 -0.0594 839 HIS A CE1 
2174 N NE2 . HIS A 274 ? 0.2984 0.2891 0.3557 -0.0306 -0.0285 -0.0554 839 HIS A NE2 
2175 N N   . LEU A 275 ? 0.2007 0.2102 0.2273 0.0080  -0.0236 -0.0476 840 LEU A N   
2176 C CA  . LEU A 275 ? 0.2576 0.2842 0.2787 0.0114  -0.0252 -0.0475 840 LEU A CA  
2177 C C   . LEU A 275 ? 0.3097 0.3370 0.3212 0.0103  -0.0321 -0.0583 840 LEU A C   
2178 O O   . LEU A 275 ? 0.3087 0.3427 0.3070 0.0157  -0.0321 -0.0616 840 LEU A O   
2179 C CB  . LEU A 275 ? 0.2463 0.2867 0.2772 0.0086  -0.0258 -0.0386 840 LEU A CB  
2180 C CG  . LEU A 275 ? 0.2577 0.3105 0.2814 0.0141  -0.0242 -0.0322 840 LEU A CG  
2181 C CD1 . LEU A 275 ? 0.2201 0.2705 0.2425 0.0178  -0.0155 -0.0272 840 LEU A CD1 
2182 C CD2 . LEU A 275 ? 0.3615 0.4249 0.3946 0.0128  -0.0273 -0.0250 840 LEU A CD2 
2183 N N   . ASP A 276 ? 0.2269 0.2474 0.2442 0.0023  -0.0375 -0.0643 841 ASP A N   
2184 C CA  . ASP A 276 ? 0.3099 0.3319 0.3193 -0.0005 -0.0454 -0.0760 841 ASP A CA  
2185 C C   . ASP A 276 ? 0.3560 0.3622 0.3504 0.0047  -0.0443 -0.0868 841 ASP A C   
2186 O O   . ASP A 276 ? 0.3409 0.3500 0.3224 0.0061  -0.0491 -0.0968 841 ASP A O   
2187 C CB  . ASP A 276 ? 0.2873 0.3072 0.3099 -0.0127 -0.0508 -0.0809 841 ASP A CB  
2188 C CG  . ASP A 276 ? 0.3104 0.3513 0.3503 -0.0165 -0.0528 -0.0730 841 ASP A CG  
2189 O OD1 . ASP A 276 ? 0.3679 0.4111 0.4235 -0.0271 -0.0548 -0.0759 841 ASP A OD1 
2190 O OD2 . ASP A 276 ? 0.2580 0.3126 0.2962 -0.0089 -0.0518 -0.0641 841 ASP A OD2 
2191 N N   . GLN A 277 ? 0.3930 0.3825 0.3882 0.0087  -0.0385 -0.0854 842 GLN A N   
2192 C CA  . GLN A 277 ? 0.3989 0.3734 0.3822 0.0164  -0.0374 -0.0959 842 GLN A CA  
2193 C C   . GLN A 277 ? 0.4158 0.4068 0.3883 0.0258  -0.0336 -0.0981 842 GLN A C   
2194 O O   . GLN A 277 ? 0.3967 0.3842 0.3560 0.0302  -0.0345 -0.1104 842 GLN A O   
2195 C CB  . GLN A 277 ? 0.3426 0.2973 0.3297 0.0209  -0.0334 -0.0924 842 GLN A CB  
2196 C CG  . GLN A 277 ? 0.3409 0.2708 0.3314 0.0112  -0.0360 -0.0926 842 GLN A CG  
2197 C CD  . GLN A 277 ? 0.2936 0.2080 0.2873 0.0138  -0.0322 -0.0830 842 GLN A CD  
2198 O OE1 . GLN A 277 ? 0.3283 0.2540 0.3248 0.0220  -0.0287 -0.0761 842 GLN A OE1 
2199 N NE2 . GLN A 277 ? 0.3117 0.1995 0.3036 0.0058  -0.0330 -0.0824 842 GLN A NE2 
2200 N N   . LEU A 278 ? 0.3028 0.3107 0.2799 0.0282  -0.0284 -0.0866 843 LEU A N   
2201 C CA  . LEU A 278 ? 0.3220 0.3456 0.2885 0.0346  -0.0227 -0.0869 843 LEU A CA  
2202 C C   . LEU A 278 ? 0.3494 0.3836 0.3017 0.0317  -0.0277 -0.0890 843 LEU A C   
2203 O O   . LEU A 278 ? 0.3699 0.4107 0.3055 0.0362  -0.0246 -0.0949 843 LEU A O   
2204 C CB  . LEU A 278 ? 0.3623 0.3979 0.3377 0.0360  -0.0154 -0.0739 843 LEU A CB  
2205 C CG  . LEU A 278 ? 0.3690 0.4047 0.3509 0.0435  -0.0082 -0.0758 843 LEU A CG  
2206 C CD1 . LEU A 278 ? 0.3806 0.3968 0.3702 0.0455  -0.0122 -0.0792 843 LEU A CD1 
2207 C CD2 . LEU A 278 ? 0.4395 0.4882 0.4305 0.0423  -0.0016 -0.0642 843 LEU A CD2 
2208 N N   . LEU A 279 ? 0.3470 0.3839 0.3055 0.0245  -0.0356 -0.0846 844 LEU A N   
2209 C CA  . LEU A 279 ? 0.4165 0.4651 0.3624 0.0229  -0.0431 -0.0857 844 LEU A CA  
2210 C C   . LEU A 279 ? 0.4098 0.4519 0.3422 0.0216  -0.0501 -0.1025 844 LEU A C   
2211 O O   . LEU A 279 ? 0.4610 0.5109 0.3729 0.0242  -0.0531 -0.1072 844 LEU A O   
2212 C CB  . LEU A 279 ? 0.4092 0.4661 0.3701 0.0170  -0.0505 -0.0775 844 LEU A CB  
2213 C CG  . LEU A 279 ? 0.4952 0.5668 0.4450 0.0178  -0.0601 -0.0758 844 LEU A CG  
2214 C CD1 . LEU A 279 ? 0.5084 0.5859 0.4401 0.0248  -0.0541 -0.0654 844 LEU A CD1 
2215 C CD2 . LEU A 279 ? 0.3649 0.4468 0.3352 0.0131  -0.0682 -0.0706 844 LEU A CD2 
2216 N N   . LEU A 280 ? 0.4038 0.4293 0.3451 0.0174  -0.0523 -0.1117 845 LEU A N   
2217 C CA  . LEU A 280 ? 0.4422 0.4574 0.3717 0.0150  -0.0589 -0.1291 845 LEU A CA  
2218 C C   . LEU A 280 ? 0.4239 0.4331 0.3352 0.0248  -0.0518 -0.1390 845 LEU A C   
2219 O O   . LEU A 280 ? 0.4239 0.4337 0.3159 0.0259  -0.0556 -0.1518 845 LEU A O   
2220 C CB  . LEU A 280 ? 0.3491 0.3437 0.2927 0.0064  -0.0621 -0.1352 845 LEU A CB  
2221 C CG  . LEU A 280 ? 0.5114 0.5136 0.4748 -0.0054 -0.0682 -0.1290 845 LEU A CG  
2222 C CD1 . LEU A 280 ? 0.5062 0.4845 0.4809 -0.0152 -0.0679 -0.1342 845 LEU A CD1 
2223 C CD2 . LEU A 280 ? 0.5054 0.5270 0.4650 -0.0102 -0.0800 -0.1351 845 LEU A CD2 
2224 N N   . CYS A 281 ? 0.4180 0.4230 0.3359 0.0321  -0.0416 -0.1340 846 CYS A N   
2225 C CA  . CYS A 281 ? 0.3692 0.3741 0.2747 0.0426  -0.0332 -0.1431 846 CYS A CA  
2226 C C   . CYS A 281 ? 0.4229 0.4487 0.3103 0.0452  -0.0285 -0.1401 846 CYS A C   
2227 O O   . CYS A 281 ? 0.4665 0.4939 0.3345 0.0502  -0.0252 -0.1525 846 CYS A O   
2228 C CB  . CYS A 281 ? 0.3478 0.3490 0.2684 0.0501  -0.0246 -0.1377 846 CYS A CB  
2229 S SG  . CYS A 281 ? 0.4016 0.3713 0.3341 0.0505  -0.0292 -0.1429 846 CYS A SG  
2230 N N   . ALA A 282 ? 0.3983 0.4381 0.2901 0.0420  -0.0276 -0.1237 847 ALA A N   
2231 C CA  . ALA A 282 ? 0.3932 0.4484 0.2647 0.0432  -0.0235 -0.1181 847 ALA A CA  
2232 C C   . ALA A 282 ? 0.4467 0.5024 0.2948 0.0412  -0.0338 -0.1277 847 ALA A C   
2233 O O   . ALA A 282 ? 0.4478 0.5095 0.2701 0.0446  -0.0293 -0.1327 847 ALA A O   
2234 C CB  . ALA A 282 ? 0.3369 0.4011 0.2171 0.0399  -0.0230 -0.0986 847 ALA A CB  
2235 N N   . PHE A 283 ? 0.4701 0.5205 0.3270 0.0348  -0.0474 -0.1313 848 PHE A N   
2236 C CA  . PHE A 283 ? 0.4645 0.5179 0.3027 0.0317  -0.0602 -0.1414 848 PHE A CA  
2237 C C   . PHE A 283 ? 0.5040 0.5488 0.3202 0.0352  -0.0583 -0.1615 848 PHE A C   
2238 O O   . PHE A 283 ? 0.5478 0.5995 0.3348 0.0374  -0.0604 -0.1670 848 PHE A O   
2239 C CB  . PHE A 283 ? 0.4058 0.4563 0.2650 0.0226  -0.0737 -0.1441 848 PHE A CB  
2240 C CG  . PHE A 283 ? 0.4245 0.4872 0.2720 0.0188  -0.0895 -0.1486 848 PHE A CG  
2241 C CD1 . PHE A 283 ? 0.4101 0.4879 0.2704 0.0165  -0.0984 -0.1362 848 PHE A CD1 
2242 C CD2 . PHE A 283 ? 0.6042 0.6638 0.4278 0.0184  -0.0964 -0.1665 848 PHE A CD2 
2243 C CE1 . PHE A 283 ? 0.4288 0.5205 0.2800 0.0146  -0.1150 -0.1410 848 PHE A CE1 
2244 C CE2 . PHE A 283 ? 0.4784 0.5510 0.2906 0.0152  -0.1129 -0.1717 848 PHE A CE2 
2245 C CZ  . PHE A 283 ? 0.4630 0.5526 0.2897 0.0137  -0.1227 -0.1586 848 PHE A CZ  
2246 N N   . TYR A 284 ? 0.4684 0.4962 0.2972 0.0364  -0.0543 -0.1723 849 TYR A N   
2247 C CA  . TYR A 284 ? 0.5153 0.5299 0.3277 0.0402  -0.0532 -0.1938 849 TYR A CA  
2248 C C   . TYR A 284 ? 0.5698 0.5929 0.3627 0.0504  -0.0388 -0.1972 849 TYR A C   
2249 O O   . TYR A 284 ? 0.5227 0.5473 0.2887 0.0521  -0.0386 -0.2089 849 TYR A O   
2250 C CB  . TYR A 284 ? 0.4764 0.4666 0.3084 0.0400  -0.0528 -0.2022 849 TYR A CB  
2251 C CG  . TYR A 284 ? 0.6033 0.5754 0.4202 0.0461  -0.0504 -0.2244 849 TYR A CG  
2252 C CD1 . TYR A 284 ? 0.6474 0.6068 0.4540 0.0378  -0.0594 -0.2361 849 TYR A CD1 
2253 C CD2 . TYR A 284 ? 0.5451 0.5132 0.3640 0.0580  -0.0369 -0.2267 849 TYR A CD2 
2254 C CE1 . TYR A 284 ? 0.6635 0.6040 0.4590 0.0417  -0.0545 -0.2499 849 TYR A CE1 
2255 C CE2 . TYR A 284 ? 0.5963 0.5480 0.4067 0.0628  -0.0325 -0.2399 849 TYR A CE2 
2256 C CZ  . TYR A 284 ? 0.6563 0.5928 0.4537 0.0547  -0.0410 -0.2516 849 TYR A CZ  
2257 O OH  . TYR A 284 ? 0.6985 0.6173 0.4861 0.0599  -0.0359 -0.2652 849 TYR A OH  
2258 N N   . ILE A 285 ? 0.5070 0.5370 0.3144 0.0556  -0.0260 -0.1857 850 ILE A N   
2259 C CA  . ILE A 285 ? 0.6398 0.6802 0.4349 0.0644  -0.0103 -0.1904 850 ILE A CA  
2260 C C   . ILE A 285 ? 0.6387 0.6952 0.4038 0.0623  -0.0071 -0.1845 850 ILE A C   
2261 O O   . ILE A 285 ? 0.6413 0.7015 0.3863 0.0657  0.0029  -0.1919 850 ILE A O   
2262 C CB  . ILE A 285 ? 0.5168 0.5649 0.3376 0.0691  0.0019  -0.1795 850 ILE A CB  
2263 C CG1 . ILE A 285 ? 0.5742 0.6318 0.3899 0.0793  0.0176  -0.1914 850 ILE A CG1 
2264 C CG2 . ILE A 285 ? 0.4496 0.5121 0.2758 0.0632  0.0044  -0.1573 850 ILE A CG2 
2265 C CD1 . ILE A 285 ? 0.5549 0.6225 0.3986 0.0847  0.0278  -0.1846 850 ILE A CD1 
2266 N N   . MET A 286 ? 0.5773 0.6394 0.3412 0.0556  -0.0156 -0.1679 851 MET A N   
2267 C CA  . MET A 286 ? 0.5922 0.6650 0.3248 0.0542  -0.0152 -0.1597 851 MET A CA  
2268 C C   . MET A 286 ? 0.5397 0.6082 0.2442 0.0527  -0.0282 -0.1732 851 MET A C   
2269 O O   . MET A 286 ? 0.6342 0.7042 0.3095 0.0528  -0.0226 -0.1726 851 MET A O   
2270 C CB  . MET A 286 ? 0.5128 0.5909 0.2547 0.0497  -0.0208 -0.1371 851 MET A CB  
2271 C CG  . MET A 286 ? 0.4564 0.5404 0.2148 0.0501  -0.0056 -0.1220 851 MET A CG  
2272 S SD  . MET A 286 ? 0.7427 0.8369 0.4750 0.0529  0.0164  -0.1233 851 MET A SD  
2273 C CE  . MET A 286 ? 0.5222 0.6198 0.2892 0.0576  0.0294  -0.1335 851 MET A CE  
2274 N N   . ALA A 287 ? 0.5686 0.6286 0.2864 0.0484  -0.0444 -0.1818 852 ALA A N   
2275 C CA  . ALA A 287 ? 0.6643 0.7175 0.3646 0.0438  -0.0564 -0.1929 852 ALA A CA  
2276 C C   . ALA A 287 ? 0.6987 0.7404 0.3860 0.0469  -0.0454 -0.2084 852 ALA A C   
2277 O O   . ALA A 287 ? 0.7201 0.7597 0.3793 0.0455  -0.0471 -0.2146 852 ALA A O   
2278 C CB  . ALA A 287 ? 0.5616 0.6084 0.2844 0.0364  -0.0735 -0.1998 852 ALA A CB  
2279 N N   . LYS A 288 ? 0.6487 0.6825 0.3567 0.0518  -0.0345 -0.2146 853 LYS A N   
2280 C CA  . LYS A 288 ? 0.6300 0.6538 0.3306 0.0572  -0.0227 -0.2287 853 LYS A CA  
2281 C C   . LYS A 288 ? 0.6703 0.7061 0.3449 0.0606  -0.0077 -0.2248 853 LYS A C   
2282 O O   . LYS A 288 ? 0.6764 0.7075 0.3234 0.0593  -0.0074 -0.2335 853 LYS A O   
2283 C CB  . LYS A 288 ? 0.6487 0.6642 0.3790 0.0639  -0.0144 -0.2323 853 LYS A CB  
2284 C CG  . LYS A 288 ? 0.7211 0.7168 0.4513 0.0684  -0.0109 -0.2499 853 LYS A CG  
2285 C CD  . LYS A 288 ? 0.7752 0.7593 0.5358 0.0753  -0.0072 -0.2508 853 LYS A CD  
2286 C CE  . LYS A 288 ? 0.8527 0.8124 0.6130 0.0799  -0.0062 -0.2672 853 LYS A CE  
2287 N NZ  . LYS A 288 ? 0.8737 0.8126 0.6248 0.0696  -0.0205 -0.2762 853 LYS A NZ  
2288 N N   . VAL A 289 ? 0.6412 0.6915 0.3240 0.0636  0.0052  -0.2117 854 VAL A N   
2289 C CA  . VAL A 289 ? 0.7113 0.7721 0.3737 0.0653  0.0230  -0.2075 854 VAL A CA  
2290 C C   . VAL A 289 ? 0.7876 0.8496 0.4102 0.0599  0.0189  -0.2008 854 VAL A C   
2291 O O   . VAL A 289 ? 0.9111 0.9745 0.5084 0.0601  0.0321  -0.2024 854 VAL A O   
2292 C CB  . VAL A 289 ? 0.6766 0.7532 0.3574 0.0666  0.0369  -0.1928 854 VAL A CB  
2293 C CG1 . VAL A 289 ? 0.6280 0.7047 0.3459 0.0734  0.0426  -0.1998 854 VAL A CG1 
2294 C CG2 . VAL A 289 ? 0.5944 0.6767 0.2767 0.0619  0.0270  -0.1752 854 VAL A CG2 
2295 N N   . THR A 290 ? 0.7308 0.7919 0.3478 0.0553  0.0005  -0.1931 855 THR A N   
2296 C CA  . THR A 290 ? 0.7888 0.8501 0.3684 0.0514  -0.0064 -0.1851 855 THR A CA  
2297 C C   . THR A 290 ? 0.7474 0.7983 0.3085 0.0487  -0.0205 -0.2006 855 THR A C   
2298 O O   . THR A 290 ? 0.7708 0.8210 0.3003 0.0456  -0.0291 -0.1961 855 THR A O   
2299 C CB  . THR A 290 ? 0.7131 0.7810 0.2960 0.0492  -0.0196 -0.1661 855 THR A CB  
2300 O OG1 . THR A 290 ? 0.7426 0.8093 0.3526 0.0477  -0.0378 -0.1719 855 THR A OG1 
2301 C CG2 . THR A 290 ? 0.6409 0.7176 0.2378 0.0507  -0.0050 -0.1498 855 THR A CG2 
2302 N N   . LYS A 291 ? 0.7250 0.7664 0.3055 0.0496  -0.0231 -0.2185 856 LYS A N   
2303 C CA  . LYS A 291 ? 0.9000 0.9291 0.4656 0.0461  -0.0343 -0.2359 856 LYS A CA  
2304 C C   . LYS A 291 ? 0.8574 0.8891 0.4215 0.0392  -0.0580 -0.2325 856 LYS A C   
2305 O O   . LYS A 291 ? 0.8600 0.8864 0.4028 0.0349  -0.0690 -0.2424 856 LYS A O   
2306 C CB  . LYS A 291 ? 0.8113 0.8367 0.3370 0.0471  -0.0236 -0.2425 856 LYS A CB  
2307 C CG  . LYS A 291 ? 0.8428 0.8611 0.3731 0.0533  -0.0047 -0.2570 856 LYS A CG  
2308 C CD  . LYS A 291 ? 0.8188 0.8473 0.3767 0.0592  0.0122  -0.2479 856 LYS A CD  
2309 C CE  . LYS A 291 ? 0.8743 0.8969 0.4459 0.0668  0.0273  -0.2633 856 LYS A CE  
2310 N NZ  . LYS A 291 ? 0.8444 0.8787 0.4491 0.0726  0.0403  -0.2551 856 LYS A NZ  
2311 N N   . GLU A 292 ? 0.8668 0.9080 0.4551 0.0384  -0.0657 -0.2187 857 GLU A N   
2312 C CA  . GLU A 292 ? 0.9226 0.9691 0.5224 0.0325  -0.0877 -0.2160 857 GLU A CA  
2313 C C   . GLU A 292 ? 0.9740 1.0121 0.6102 0.0278  -0.0935 -0.2274 857 GLU A C   
2314 O O   . GLU A 292 ? 1.0611 1.1050 0.7185 0.0219  -0.1086 -0.2247 857 GLU A O   
2315 C CB  . GLU A 292 ? 0.9097 0.9707 0.5138 0.0346  -0.0924 -0.1939 857 GLU A CB  
2316 C CG  . GLU A 292 ? 0.9216 0.9920 0.5277 0.0304  -0.1153 -0.1893 857 GLU A CG  
2317 C CD  . GLU A 292 ? 0.9092 0.9900 0.5037 0.0350  -0.1189 -0.1668 857 GLU A CD  
2318 O OE1 . GLU A 292 ? 0.8655 0.9567 0.4734 0.0339  -0.1367 -0.1602 857 GLU A OE1 
2319 O OE2 . GLU A 292 ? 0.9203 0.9983 0.4931 0.0396  -0.1034 -0.1556 857 GLU A OE2 
2320 N N   . GLU A 293 ? 0.9172 0.9407 0.5607 0.0306  -0.0807 -0.2395 858 GLU A N   
2321 C CA  . GLU A 293 ? 0.8461 0.8579 0.5237 0.0292  -0.0796 -0.2450 858 GLU A CA  
2322 C C   . GLU A 293 ? 0.7981 0.8049 0.4967 0.0183  -0.0967 -0.2503 858 GLU A C   
2323 O O   . GLU A 293 ? 0.8563 0.8601 0.5436 0.0110  -0.1082 -0.2603 858 GLU A O   
2324 C CB  . GLU A 293 ? 0.8916 0.8839 0.5662 0.0338  -0.0672 -0.2607 858 GLU A CB  
2325 C CG  . GLU A 293 ? 1.0010 0.9986 0.6556 0.0433  -0.0491 -0.2596 858 GLU A CG  
2326 C CD  . GLU A 293 ? 1.1451 1.1354 0.7668 0.0428  -0.0475 -0.2733 858 GLU A CD  
2327 O OE1 . GLU A 293 ? 1.2026 1.1899 0.8143 0.0502  -0.0312 -0.2796 858 GLU A OE1 
2328 O OE2 . GLU A 293 ? 1.1955 1.1843 0.8022 0.0350  -0.0624 -0.2783 858 GLU A OE2 
2329 N N   . ARG A 294 ? 0.7055 0.7120 0.4353 0.0165  -0.0973 -0.2434 859 ARG A N   
2330 C CA  . ARG A 294 ? 0.6698 0.6681 0.4249 0.0049  -0.1086 -0.2486 859 ARG A CA  
2331 C C   . ARG A 294 ? 0.6068 0.5814 0.3814 0.0062  -0.0989 -0.2531 859 ARG A C   
2332 O O   . ARG A 294 ? 0.5856 0.5603 0.3651 0.0160  -0.0870 -0.2460 859 ARG A O   
2333 C CB  . ARG A 294 ? 0.6897 0.7093 0.4645 0.0004  -0.1192 -0.2348 859 ARG A CB  
2334 C CG  . ARG A 294 ? 0.7116 0.7538 0.4669 0.0025  -0.1289 -0.2265 859 ARG A CG  
2335 C CD  . ARG A 294 ? 0.8199 0.8595 0.5569 -0.0040 -0.1399 -0.2398 859 ARG A CD  
2336 N NE  . ARG A 294 ? 0.8018 0.8582 0.5119 0.0004  -0.1475 -0.2320 859 ARG A NE  
2337 C CZ  . ARG A 294 ? 0.8303 0.9067 0.5490 -0.0011 -0.1618 -0.2218 859 ARG A CZ  
2338 N NH1 . ARG A 294 ? 0.8399 0.9250 0.5953 -0.0078 -0.1689 -0.2190 859 ARG A NH1 
2339 N NH2 . ARG A 294 ? 0.8067 0.8939 0.4973 0.0042  -0.1687 -0.2139 859 ARG A NH2 
2340 N N   . THR A 295 ? 0.6242 0.5775 0.4087 -0.0037 -0.1036 -0.2643 860 THR A N   
2341 C CA  . THR A 295 ? 0.6892 0.6150 0.4894 -0.0025 -0.0953 -0.2668 860 THR A CA  
2342 C C   . THR A 295 ? 0.6597 0.5907 0.4873 -0.0046 -0.0952 -0.2531 860 THR A C   
2343 O O   . THR A 295 ? 0.5925 0.5434 0.4326 -0.0129 -0.1045 -0.2459 860 THR A O   
2344 C CB  . THR A 295 ? 0.7307 0.6283 0.5320 -0.0145 -0.1001 -0.2808 860 THR A CB  
2345 O OG1 . THR A 295 ? 0.7566 0.6608 0.5771 -0.0307 -0.1114 -0.2780 860 THR A OG1 
2346 C CG2 . THR A 295 ? 0.6974 0.5915 0.4710 -0.0146 -0.1025 -0.2956 860 THR A CG2 
2347 N N   . PHE A 296 ? 0.7094 0.6235 0.5465 0.0035  -0.0850 -0.2493 861 PHE A N   
2348 C CA  . PHE A 296 ? 0.7322 0.6454 0.5935 0.0008  -0.0846 -0.2374 861 PHE A CA  
2349 C C   . PHE A 296 ? 0.7350 0.6371 0.6132 -0.0174 -0.0928 -0.2389 861 PHE A C   
2350 O O   . PHE A 296 ? 0.7476 0.6616 0.6460 -0.0247 -0.0959 -0.2290 861 PHE A O   
2351 C CB  . PHE A 296 ? 0.7954 0.6862 0.6626 0.0121  -0.0737 -0.2341 861 PHE A CB  
2352 C CG  . PHE A 296 ? 0.7192 0.6303 0.5922 0.0235  -0.0649 -0.2183 861 PHE A CG  
2353 C CD1 . PHE A 296 ? 0.6685 0.5942 0.5601 0.0179  -0.0646 -0.1987 861 PHE A CD1 
2354 C CD2 . PHE A 296 ? 0.6695 0.5833 0.5324 0.0391  -0.0552 -0.2223 861 PHE A CD2 
2355 C CE1 . PHE A 296 ? 0.5512 0.4935 0.4487 0.0269  -0.0559 -0.1836 861 PHE A CE1 
2356 C CE2 . PHE A 296 ? 0.6676 0.6006 0.5389 0.0473  -0.0460 -0.2072 861 PHE A CE2 
2357 C CZ  . PHE A 296 ? 0.6279 0.5741 0.5159 0.0407  -0.0468 -0.1875 861 PHE A CZ  
2358 N N   . GLN A 297 ? 0.8038 0.6831 0.6739 -0.0253 -0.0949 -0.2512 862 GLN A N   
2359 C CA  . GLN A 297 ? 0.7473 0.6142 0.6318 -0.0445 -0.1008 -0.2536 862 GLN A CA  
2360 C C   . GLN A 297 ? 0.6701 0.5721 0.5661 -0.0553 -0.1121 -0.2510 862 GLN A C   
2361 O O   . GLN A 297 ? 0.6760 0.5856 0.5959 -0.0666 -0.1141 -0.2435 862 GLN A O   
2362 C CB  . GLN A 297 ? 0.7096 0.5453 0.5791 -0.0509 -0.1010 -0.2685 862 GLN A CB  
2363 C CG  . GLN A 297 ? 0.8023 0.5971 0.6675 -0.0440 -0.0905 -0.2691 862 GLN A CG  
2364 C CD  . GLN A 297 ? 0.9680 0.7277 0.8201 -0.0532 -0.0906 -0.2831 862 GLN A CD  
2365 O OE1 . GLN A 297 ? 1.0549 0.8212 0.8948 -0.0599 -0.0974 -0.2954 862 GLN A OE1 
2366 N NE2 . GLN A 297 ? 0.9926 0.7130 0.8455 -0.0535 -0.0830 -0.2809 862 GLN A NE2 
2367 N N   . GLU A 298 ? 0.6428 0.5670 0.5221 -0.0510 -0.1190 -0.2561 863 GLU A N   
2368 C CA  . GLU A 298 ? 0.6512 0.6098 0.5405 -0.0582 -0.1312 -0.2523 863 GLU A CA  
2369 C C   . GLU A 298 ? 0.5585 0.5438 0.4603 -0.0502 -0.1304 -0.2365 863 GLU A C   
2370 O O   . GLU A 298 ? 0.5156 0.5254 0.4375 -0.0572 -0.1381 -0.2300 863 GLU A O   
2371 C CB  . GLU A 298 ? 0.7003 0.6715 0.5645 -0.0555 -0.1398 -0.2613 863 GLU A CB  
2372 C CG  . GLU A 298 ? 0.7949 0.7726 0.6315 -0.0382 -0.1342 -0.2587 863 GLU A CG  
2373 C CD  . GLU A 298 ? 0.8977 0.8818 0.7066 -0.0379 -0.1420 -0.2687 863 GLU A CD  
2374 O OE1 . GLU A 298 ? 0.9912 0.9835 0.8056 -0.0497 -0.1548 -0.2748 863 GLU A OE1 
2375 O OE2 . GLU A 298 ? 0.8791 0.8602 0.6610 -0.0263 -0.1349 -0.2708 863 GLU A OE2 
2376 N N   . ILE A 299 ? 0.5662 0.5472 0.4572 -0.0355 -0.1207 -0.2305 864 ILE A N   
2377 C CA  . ILE A 299 ? 0.5179 0.5180 0.4204 -0.0285 -0.1168 -0.2126 864 ILE A CA  
2378 C C   . ILE A 299 ? 0.5092 0.5044 0.4430 -0.0388 -0.1133 -0.2025 864 ILE A C   
2379 O O   . ILE A 299 ? 0.5199 0.5382 0.4718 -0.0415 -0.1161 -0.1902 864 ILE A O   
2380 C CB  . ILE A 299 ? 0.4681 0.4600 0.3563 -0.0129 -0.1026 -0.2044 864 ILE A CB  
2381 C CG1 . ILE A 299 ? 0.4875 0.4941 0.3459 -0.0031 -0.1039 -0.2082 864 ILE A CG1 
2382 C CG2 . ILE A 299 ? 0.4971 0.4982 0.4034 -0.0091 -0.0941 -0.1823 864 ILE A CG2 
2383 C CD1 . ILE A 299 ? 0.4798 0.4824 0.3254 0.0105  -0.0889 -0.2028 864 ILE A CD1 
2384 N N   . MET A 300 ? 0.4969 0.4607 0.4354 -0.0445 -0.1073 -0.2084 865 MET A N   
2385 C CA  . MET A 300 ? 0.5337 0.4874 0.4965 -0.0545 -0.1018 -0.1985 865 MET A CA  
2386 C C   . MET A 300 ? 0.4819 0.4456 0.4660 -0.0743 -0.1103 -0.2056 865 MET A C   
2387 O O   . MET A 300 ? 0.4442 0.4176 0.4514 -0.0819 -0.1067 -0.1942 865 MET A O   
2388 C CB  . MET A 300 ? 0.5738 0.4866 0.5301 -0.0524 -0.0926 -0.2007 865 MET A CB  
2389 C CG  . MET A 300 ? 0.5048 0.4131 0.4538 -0.0347 -0.0821 -0.1878 865 MET A CG  
2390 S SD  . MET A 300 ? 0.9576 0.8213 0.8914 -0.0251 -0.0756 -0.1968 865 MET A SD  
2391 C CE  . MET A 300 ? 0.9272 0.7568 0.8677 -0.0457 -0.0793 -0.2064 865 MET A CE  
2392 N N   . LYS A 301 ? 0.5214 0.4835 0.4978 -0.0826 -0.1191 -0.2209 866 LYS A N   
2393 C CA  . LYS A 301 ? 0.5954 0.5717 0.5929 -0.1007 -0.1255 -0.2231 866 LYS A CA  
2394 C C   . LYS A 301 ? 0.6254 0.6470 0.6389 -0.0975 -0.1341 -0.2156 866 LYS A C   
2395 O O   . LYS A 301 ? 0.6434 0.6835 0.6845 -0.1086 -0.1352 -0.2110 866 LYS A O   
2396 C CB  . LYS A 301 ? 0.6647 0.6291 0.6487 -0.1098 -0.1326 -0.2382 866 LYS A CB  
2397 C CG  . LYS A 301 ? 0.7983 0.7152 0.7639 -0.1120 -0.1251 -0.2463 866 LYS A CG  
2398 C CD  . LYS A 301 ? 0.9173 0.8245 0.8633 -0.1167 -0.1330 -0.2625 866 LYS A CD  
2399 C CE  . LYS A 301 ? 0.9422 0.8520 0.8596 -0.0986 -0.1338 -0.2680 866 LYS A CE  
2400 N NZ  . LYS A 301 ? 0.9419 0.8267 0.8344 -0.1002 -0.1355 -0.2841 866 LYS A NZ  
2401 N N   . SER A 302 ? 0.6180 0.6562 0.6130 -0.0815 -0.1393 -0.2134 867 SER A N   
2402 C CA  . SER A 302 ? 0.6034 0.6794 0.6085 -0.0747 -0.1473 -0.2036 867 SER A CA  
2403 C C   . SER A 302 ? 0.5093 0.5912 0.5339 -0.0710 -0.1377 -0.1873 867 SER A C   
2404 O O   . SER A 302 ? 0.5424 0.6516 0.5902 -0.0725 -0.1416 -0.1797 867 SER A O   
2405 C CB  . SER A 302 ? 0.6263 0.7114 0.6000 -0.0586 -0.1530 -0.2027 867 SER A CB  
2406 O OG  . SER A 302 ? 0.7019 0.7814 0.6561 -0.0620 -0.1605 -0.2155 867 SER A OG  
2407 N N   . TYR A 303 ? 0.4394 0.4938 0.4533 -0.0648 -0.1233 -0.1790 868 TYR A N   
2408 C CA  . TYR A 303 ? 0.3639 0.4180 0.3910 -0.0602 -0.1114 -0.1602 868 TYR A CA  
2409 C C   . TYR A 303 ? 0.4651 0.5189 0.5214 -0.0757 -0.1070 -0.1583 868 TYR A C   
2410 O O   . TYR A 303 ? 0.4613 0.5330 0.5363 -0.0747 -0.1033 -0.1461 868 TYR A O   
2411 C CB  . TYR A 303 ? 0.3625 0.3881 0.3718 -0.0503 -0.0988 -0.1541 868 TYR A CB  
2412 C CG  . TYR A 303 ? 0.3624 0.3831 0.3849 -0.0483 -0.0870 -0.1373 868 TYR A CG  
2413 C CD1 . TYR A 303 ? 0.3107 0.3519 0.3382 -0.0394 -0.0846 -0.1226 868 TYR A CD1 
2414 C CD2 . TYR A 303 ? 0.4086 0.4018 0.4362 -0.0554 -0.0785 -0.1362 868 TYR A CD2 
2415 C CE1 . TYR A 303 ? 0.4165 0.4530 0.4548 -0.0379 -0.0743 -0.1089 868 TYR A CE1 
2416 C CE2 . TYR A 303 ? 0.3544 0.3429 0.3907 -0.0534 -0.0686 -0.1214 868 TYR A CE2 
2417 C CZ  . TYR A 303 ? 0.4352 0.4466 0.4775 -0.0449 -0.0665 -0.1086 868 TYR A CZ  
2418 O OH  . TYR A 303 ? 0.4954 0.5021 0.5453 -0.0434 -0.0570 -0.0955 868 TYR A OH  
2419 N N   . ARG A 304 ? 0.5681 0.6006 0.6274 -0.0906 -0.1065 -0.1709 869 ARG A N   
2420 C CA  . ARG A 304 ? 0.6269 0.6515 0.7092 -0.1072 -0.0987 -0.1687 869 ARG A CA  
2421 C C   . ARG A 304 ? 0.5910 0.6540 0.7056 -0.1180 -0.1045 -0.1703 869 ARG A C   
2422 O O   . ARG A 304 ? 0.6396 0.7036 0.7756 -0.1301 -0.0955 -0.1654 869 ARG A O   
2423 C CB  . ARG A 304 ? 0.7261 0.7154 0.8013 -0.1217 -0.0973 -0.1826 869 ARG A CB  
2424 C CG  . ARG A 304 ? 0.7986 0.7640 0.8856 -0.1363 -0.0844 -0.1760 869 ARG A CG  
2425 C CD  . ARG A 304 ? 0.9028 0.8273 0.9756 -0.1481 -0.0819 -0.1831 869 ARG A CD  
2426 N NE  . ARG A 304 ? 0.9619 0.8887 1.0232 -0.1490 -0.0936 -0.1978 869 ARG A NE  
2427 C CZ  . ARG A 304 ? 1.0365 0.9385 1.0711 -0.1387 -0.0964 -0.2064 869 ARG A CZ  
2428 N NH1 . ARG A 304 ? 1.1010 0.9757 1.1198 -0.1253 -0.0891 -0.2020 869 ARG A NH1 
2429 N NH2 . ARG A 304 ? 0.9845 0.8898 1.0083 -0.1410 -0.1063 -0.2198 869 ARG A NH2 
2430 N N   . ASN A 305 ? 0.5584 0.6531 0.6753 -0.1128 -0.1190 -0.1764 870 ASN A N   
2431 C CA  . ASN A 305 ? 0.5262 0.6574 0.6711 -0.1176 -0.1241 -0.1737 870 ASN A CA  
2432 C C   . ASN A 305 ? 0.5465 0.7032 0.7062 -0.1055 -0.1221 -0.1605 870 ASN A C   
2433 O O   . ASN A 305 ? 0.6314 0.8186 0.8154 -0.1059 -0.1251 -0.1569 870 ASN A O   
2434 C CB  . ASN A 305 ? 0.6111 0.7623 0.7494 -0.1151 -0.1406 -0.1828 870 ASN A CB  
2435 C CG  . ASN A 305 ? 0.7119 0.8455 0.8464 -0.1315 -0.1428 -0.1962 870 ASN A CG  
2436 O OD1 . ASN A 305 ? 0.6834 0.8033 0.8327 -0.1479 -0.1335 -0.1971 870 ASN A OD1 
2437 N ND2 . ASN A 305 ? 0.7862 0.9182 0.8986 -0.1275 -0.1546 -0.2062 870 ASN A ND2 
2438 N N   . GLN A 306 ? 0.4341 0.5721 0.5736 -0.0916 -0.1137 -0.1478 871 GLN A N   
2439 C CA  . GLN A 306 ? 0.4562 0.6079 0.6035 -0.0793 -0.1078 -0.1311 871 GLN A CA  
2440 C C   . GLN A 306 ? 0.5189 0.6627 0.6856 -0.0893 -0.0923 -0.1240 871 GLN A C   
2441 O O   . GLN A 306 ? 0.4874 0.6014 0.6470 -0.0996 -0.0829 -0.1257 871 GLN A O   
2442 C CB  . GLN A 306 ? 0.3488 0.4835 0.4659 -0.0618 -0.1040 -0.1199 871 GLN A CB  
2443 C CG  . GLN A 306 ? 0.4144 0.5577 0.5088 -0.0512 -0.1172 -0.1245 871 GLN A CG  
2444 C CD  . GLN A 306 ? 0.4800 0.6144 0.5501 -0.0346 -0.1117 -0.1111 871 GLN A CD  
2445 O OE1 . GLN A 306 ? 0.4253 0.5492 0.4978 -0.0308 -0.0994 -0.0989 871 GLN A OE1 
2446 N NE2 . GLN A 306 ? 0.5140 0.6528 0.5597 -0.0257 -0.1207 -0.1137 871 GLN A NE2 
2447 N N   . PRO A 307 ? 0.5386 0.7077 0.7280 -0.0854 -0.0897 -0.1161 872 PRO A N   
2448 C CA  . PRO A 307 ? 0.4983 0.6662 0.7081 -0.0958 -0.0750 -0.1111 872 PRO A CA  
2449 C C   . PRO A 307 ? 0.4543 0.5842 0.6434 -0.0956 -0.0600 -0.1008 872 PRO A C   
2450 O O   . PRO A 307 ? 0.5027 0.6167 0.6973 -0.1101 -0.0491 -0.1013 872 PRO A O   
2451 C CB  . PRO A 307 ? 0.4795 0.6785 0.7086 -0.0838 -0.0760 -0.1031 872 PRO A CB  
2452 C CG  . PRO A 307 ? 0.5239 0.7482 0.7534 -0.0736 -0.0947 -0.1087 872 PRO A CG  
2453 C CD  . PRO A 307 ? 0.5604 0.7598 0.7557 -0.0701 -0.1006 -0.1117 872 PRO A CD  
2454 N N   . GLN A 308 ? 0.4210 0.5367 0.5862 -0.0796 -0.0596 -0.0917 873 GLN A N   
2455 C CA  . GLN A 308 ? 0.3693 0.4537 0.5168 -0.0770 -0.0475 -0.0822 873 GLN A CA  
2456 C C   . GLN A 308 ? 0.3718 0.4231 0.4994 -0.0826 -0.0471 -0.0886 873 GLN A C   
2457 O O   . GLN A 308 ? 0.3311 0.3538 0.4459 -0.0833 -0.0381 -0.0827 873 GLN A O   
2458 C CB  . GLN A 308 ? 0.3020 0.3864 0.4346 -0.0589 -0.0469 -0.0713 873 GLN A CB  
2459 C CG  . GLN A 308 ? 0.2884 0.3664 0.3984 -0.0489 -0.0550 -0.0747 873 GLN A CG  
2460 C CD  . GLN A 308 ? 0.2635 0.3666 0.3773 -0.0460 -0.0687 -0.0816 873 GLN A CD  
2461 O OE1 . GLN A 308 ? 0.2826 0.4099 0.4190 -0.0510 -0.0737 -0.0848 873 GLN A OE1 
2462 N NE2 . GLN A 308 ? 0.2636 0.3624 0.3551 -0.0374 -0.0748 -0.0842 873 GLN A NE2 
2463 N N   . ALA A 309 ? 0.4495 0.5036 0.5737 -0.0861 -0.0577 -0.1013 874 ALA A N   
2464 C CA  . ALA A 309 ? 0.5347 0.5563 0.6376 -0.0880 -0.0584 -0.1088 874 ALA A CA  
2465 C C   . ALA A 309 ? 0.6037 0.5992 0.7105 -0.1056 -0.0509 -0.1121 874 ALA A C   
2466 O O   . ALA A 309 ? 0.6479 0.6548 0.7739 -0.1222 -0.0523 -0.1203 874 ALA A O   
2467 C CB  . ALA A 309 ? 0.5130 0.5445 0.6091 -0.0869 -0.0718 -0.1229 874 ALA A CB  
2468 N N   . ASN A 310 ? 0.5993 0.5594 0.6874 -0.1017 -0.0430 -0.1055 875 ASN A N   
2469 C CA  . ASN A 310 ? 0.5536 0.4785 0.6365 -0.1162 -0.0360 -0.1069 875 ASN A CA  
2470 C C   . ASN A 310 ? 0.6536 0.5422 0.7111 -0.1084 -0.0393 -0.1128 875 ASN A C   
2471 O O   . ASN A 310 ? 0.7014 0.5938 0.7465 -0.0907 -0.0435 -0.1125 875 ASN A O   
2472 C CB  . ASN A 310 ? 0.4877 0.4003 0.5697 -0.1179 -0.0234 -0.0919 875 ASN A CB  
2473 C CG  . ASN A 310 ? 0.5322 0.4785 0.6406 -0.1273 -0.0181 -0.0883 875 ASN A CG  
2474 O OD1 . ASN A 310 ? 0.4827 0.4542 0.5984 -0.1159 -0.0176 -0.0808 875 ASN A OD1 
2475 N ND2 . ASN A 310 ? 0.5743 0.5213 0.6981 -0.1485 -0.0135 -0.0944 875 ASN A ND2 
2476 N N   . SER A 311 ? 0.6347 0.4878 0.6848 -0.1216 -0.0367 -0.1186 876 SER A N   
2477 C CA  . SER A 311 ? 0.6474 0.4640 0.6747 -0.1145 -0.0405 -0.1270 876 SER A CA  
2478 C C   . SER A 311 ? 0.5658 0.3656 0.5744 -0.0927 -0.0382 -0.1170 876 SER A C   
2479 O O   . SER A 311 ? 0.5294 0.3224 0.5248 -0.0782 -0.0433 -0.1245 876 SER A O   
2480 C CB  . SER A 311 ? 0.6868 0.4610 0.7078 -0.1330 -0.0362 -0.1319 876 SER A CB  
2481 O OG  . SER A 311 ? 0.6505 0.4005 0.6656 -0.1376 -0.0253 -0.1167 876 SER A OG  
2482 N N   . HIS A 312 ? 0.4789 0.2749 0.4872 -0.0903 -0.0304 -0.1014 877 HIS A N   
2483 C CA  . HIS A 312 ? 0.5529 0.3314 0.5447 -0.0712 -0.0289 -0.0923 877 HIS A CA  
2484 C C   . HIS A 312 ? 0.6152 0.4244 0.6086 -0.0527 -0.0332 -0.0933 877 HIS A C   
2485 O O   . HIS A 312 ? 0.5950 0.3931 0.5766 -0.0359 -0.0339 -0.0915 877 HIS A O   
2486 C CB  . HIS A 312 ? 0.5790 0.3506 0.5696 -0.0739 -0.0204 -0.0760 877 HIS A CB  
2487 C CG  . HIS A 312 ? 0.6588 0.4720 0.6669 -0.0734 -0.0175 -0.0686 877 HIS A CG  
2488 N ND1 . HIS A 312 ? 0.7190 0.5534 0.7273 -0.0565 -0.0193 -0.0635 877 HIS A ND1 
2489 C CD2 . HIS A 312 ? 0.6797 0.5163 0.7062 -0.0877 -0.0126 -0.0660 877 HIS A CD2 
2490 C CE1 . HIS A 312 ? 0.6805 0.5459 0.7045 -0.0600 -0.0159 -0.0577 877 HIS A CE1 
2491 N NE2 . HIS A 312 ? 0.6959 0.5642 0.7318 -0.0778 -0.0120 -0.0594 877 HIS A NE2 
2492 N N   . VAL A 313 ? 0.5204 0.3681 0.5287 -0.0556 -0.0361 -0.0961 878 VAL A N   
2493 C CA  . VAL A 313 ? 0.4724 0.3480 0.4806 -0.0403 -0.0386 -0.0950 878 VAL A CA  
2494 C C   . VAL A 313 ? 0.4657 0.3316 0.4591 -0.0286 -0.0431 -0.1069 878 VAL A C   
2495 O O   . VAL A 313 ? 0.4231 0.2932 0.4102 -0.0131 -0.0414 -0.1042 878 VAL A O   
2496 C CB  . VAL A 313 ? 0.3988 0.3131 0.4225 -0.0455 -0.0420 -0.0954 878 VAL A CB  
2497 C CG1 . VAL A 313 ? 0.3275 0.2650 0.3461 -0.0309 -0.0442 -0.0943 878 VAL A CG1 
2498 C CG2 . VAL A 313 ? 0.3689 0.2960 0.4086 -0.0535 -0.0361 -0.0838 878 VAL A CG2 
2499 N N   . TYR A 314 ? 0.4661 0.3219 0.4552 -0.0360 -0.0484 -0.1212 879 TYR A N   
2500 C CA  . TYR A 314 ? 0.5002 0.3425 0.4734 -0.0248 -0.0516 -0.1343 879 TYR A CA  
2501 C C   . TYR A 314 ? 0.5572 0.3536 0.5180 -0.0233 -0.0507 -0.1399 879 TYR A C   
2502 O O   . TYR A 314 ? 0.6059 0.3885 0.5540 -0.0101 -0.0520 -0.1498 879 TYR A O   
2503 C CB  . TYR A 314 ? 0.4832 0.3419 0.4549 -0.0311 -0.0590 -0.1489 879 TYR A CB  
2504 C CG  . TYR A 314 ? 0.5956 0.4507 0.5782 -0.0519 -0.0629 -0.1542 879 TYR A CG  
2505 C CD1 . TYR A 314 ? 0.6078 0.4272 0.5837 -0.0617 -0.0641 -0.1655 879 TYR A CD1 
2506 C CD2 . TYR A 314 ? 0.6317 0.5192 0.6328 -0.0618 -0.0650 -0.1485 879 TYR A CD2 
2507 C CE1 . TYR A 314 ? 0.6375 0.4549 0.6255 -0.0831 -0.0666 -0.1713 879 TYR A CE1 
2508 C CE2 . TYR A 314 ? 0.6597 0.5488 0.6750 -0.0814 -0.0680 -0.1548 879 TYR A CE2 
2509 C CZ  . TYR A 314 ? 0.6654 0.5201 0.6746 -0.0931 -0.0684 -0.1663 879 TYR A CZ  
2510 O OH  . TYR A 314 ? 0.6592 0.5164 0.6844 -0.1149 -0.0705 -0.1735 879 TYR A OH  
2511 N N   . ARG A 315 ? 0.5524 0.3240 0.5157 -0.0366 -0.0481 -0.1339 880 ARG A N   
2512 C CA  . ARG A 315 ? 0.6427 0.3648 0.5912 -0.0352 -0.0471 -0.1363 880 ARG A CA  
2513 C C   . ARG A 315 ? 0.6342 0.3401 0.5752 -0.0196 -0.0436 -0.1228 880 ARG A C   
2514 O O   . ARG A 315 ? 0.5826 0.2570 0.5095 -0.0061 -0.0453 -0.1268 880 ARG A O   
2515 C CB  . ARG A 315 ? 0.7135 0.4114 0.6647 -0.0588 -0.0452 -0.1368 880 ARG A CB  
2516 C CG  . ARG A 315 ? 0.7097 0.4150 0.6661 -0.0733 -0.0509 -0.1549 880 ARG A CG  
2517 C CD  . ARG A 315 ? 0.8256 0.5018 0.7833 -0.0970 -0.0476 -0.1580 880 ARG A CD  
2518 N NE  . ARG A 315 ? 0.9728 0.6537 0.9277 -0.1079 -0.0537 -0.1739 880 ARG A NE  
2519 C CZ  . ARG A 315 ? 1.0168 0.7283 0.9901 -0.1246 -0.0591 -0.1780 880 ARG A CZ  
2520 N NH1 . ARG A 315 ? 1.0329 0.7739 1.0288 -0.1340 -0.0553 -0.1681 880 ARG A NH1 
2521 N NH2 . ARG A 315 ? 1.0080 0.7222 0.9771 -0.1320 -0.0668 -0.1922 880 ARG A NH2 
2522 N N   . SER A 316 ? 0.6249 0.3512 0.5749 -0.0210 -0.0394 -0.1075 881 SER A N   
2523 C CA  . SER A 316 ? 0.5823 0.2972 0.5252 -0.0066 -0.0376 -0.0952 881 SER A CA  
2524 C C   . SER A 316 ? 0.5652 0.3212 0.5183 0.0062  -0.0370 -0.0902 881 SER A C   
2525 O O   . SER A 316 ? 0.5921 0.3749 0.5567 -0.0008 -0.0337 -0.0813 881 SER A O   
2526 C CB  . SER A 316 ? 0.5245 0.2200 0.4642 -0.0195 -0.0324 -0.0810 881 SER A CB  
2527 O OG  . SER A 316 ? 0.5584 0.2401 0.4876 -0.0052 -0.0323 -0.0695 881 SER A OG  
2528 N N   . VAL A 317 ? 0.5079 0.2673 0.4572 0.0252  -0.0394 -0.0961 882 VAL A N   
2529 C CA  . VAL A 317 ? 0.4752 0.2736 0.4345 0.0357  -0.0378 -0.0937 882 VAL A CA  
2530 C C   . VAL A 317 ? 0.4664 0.2587 0.4230 0.0543  -0.0390 -0.0900 882 VAL A C   
2531 O O   . VAL A 317 ? 0.4680 0.2314 0.4146 0.0655  -0.0425 -0.0959 882 VAL A O   
2532 C CB  . VAL A 317 ? 0.4964 0.3179 0.4574 0.0394  -0.0384 -0.1071 882 VAL A CB  
2533 C CG1 . VAL A 317 ? 0.4014 0.2618 0.3716 0.0471  -0.0349 -0.1029 882 VAL A CG1 
2534 C CG2 . VAL A 317 ? 0.5422 0.3691 0.5049 0.0223  -0.0401 -0.1124 882 VAL A CG2 
2535 N N   . LEU A 318 ? 0.4536 0.2729 0.4197 0.0580  -0.0367 -0.0810 883 LEU A N   
2536 C CA  . LEU A 318 ? 0.3662 0.1857 0.3328 0.0750  -0.0390 -0.0781 883 LEU A CA  
2537 C C   . LEU A 318 ? 0.4366 0.2705 0.4077 0.0913  -0.0395 -0.0913 883 LEU A C   
2538 O O   . LEU A 318 ? 0.3748 0.2397 0.3539 0.0896  -0.0351 -0.0967 883 LEU A O   
2539 C CB  . LEU A 318 ? 0.3558 0.2025 0.3325 0.0726  -0.0363 -0.0670 883 LEU A CB  
2540 C CG  . LEU A 318 ? 0.4392 0.2927 0.4194 0.0887  -0.0399 -0.0647 883 LEU A CG  
2541 C CD1 . LEU A 318 ? 0.4475 0.2623 0.4121 0.0945  -0.0461 -0.0582 883 LEU A CD1 
2542 C CD2 . LEU A 318 ? 0.3378 0.2231 0.3299 0.0840  -0.0363 -0.0571 883 LEU A CD2 
2543 N N   . LEU A 319 ? 0.4952 0.3059 0.4602 0.1075  -0.0445 -0.0964 884 LEU A N   
2544 C CA  . LEU A 319 ? 0.5348 0.3593 0.5059 0.1252  -0.0445 -0.1103 884 LEU A CA  
2545 C C   . LEU A 319 ? 0.7130 0.5625 0.6977 0.1400  -0.0459 -0.1075 884 LEU A C   
2546 O O   . LEU A 319 ? 0.7437 0.6320 0.7431 0.1425  -0.0405 -0.1122 884 LEU A O   
2547 C CB  . LEU A 319 ? 0.5217 0.3118 0.4809 0.1318  -0.0476 -0.1171 884 LEU A CB  
2548 C CG  . LEU A 319 ? 0.5504 0.3166 0.4976 0.1182  -0.0466 -0.1247 884 LEU A CG  
2549 C CD1 . LEU A 319 ? 0.5064 0.2447 0.4444 0.1249  -0.0477 -0.1318 884 LEU A CD1 
2550 C CD2 . LEU A 319 ? 0.4425 0.2395 0.3947 0.1116  -0.0421 -0.1351 884 LEU A CD2 
2551 N N   . LYS A 320 ? 0.8128 0.6432 0.7924 0.1463  -0.0523 -0.0981 885 LYS A N   
2552 C CA  . LYS A 320 ? 0.8547 0.7108 0.8473 0.1577  -0.0554 -0.0946 885 LYS A CA  
2553 C C   . LYS A 320 ? 0.8896 0.7213 0.8705 0.1589  -0.0632 -0.0808 885 LYS A C   
2554 O O   . LYS A 320 ? 0.9472 0.7680 0.9242 0.1709  -0.0698 -0.0792 885 LYS A O   
2556 N N   . GLU A 325 ? 0.7891 0.4724 0.7000 0.1305  -0.0661 -0.0569 926 GLU A N   
2557 C CA  . GLU A 325 ? 0.8461 0.5189 0.7578 0.1287  -0.0631 -0.0694 926 GLU A CA  
2558 C C   . GLU A 325 ? 0.7916 0.4791 0.7107 0.1134  -0.0572 -0.0770 926 GLU A C   
2559 O O   . GLU A 325 ? 0.5640 0.2867 0.4970 0.1143  -0.0556 -0.0800 926 GLU A O   
2560 C CB  . GLU A 325 ? 0.8884 0.5814 0.8120 0.1483  -0.0657 -0.0810 926 GLU A CB  
2561 C CG  . GLU A 325 ? 1.0294 0.6913 0.9417 0.1605  -0.0709 -0.0797 926 GLU A CG  
2562 C CD  . GLU A 325 ? 1.0519 0.7393 0.9784 0.1820  -0.0750 -0.0882 926 GLU A CD  
2563 O OE1 . GLU A 325 ? 1.0635 0.7942 1.0088 0.1859  -0.0731 -0.0936 926 GLU A OE1 
2564 O OE2 . GLU A 325 ? 1.0540 0.7183 0.9735 0.1943  -0.0795 -0.0896 926 GLU A OE2 
2565 N N   . ARG A 326 ? 0.7647 0.4254 0.6747 0.0990  -0.0542 -0.0805 927 ARG A N   
2566 C CA  . ARG A 326 ? 0.6723 0.3448 0.5879 0.0831  -0.0506 -0.0884 927 ARG A CA  
2567 C C   . ARG A 326 ? 0.6796 0.3379 0.5915 0.0790  -0.0496 -0.1023 927 ARG A C   
2568 O O   . ARG A 326 ? 0.7808 0.4082 0.6829 0.0818  -0.0500 -0.1025 927 ARG A O   
2569 C CB  . ARG A 326 ? 0.5407 0.2011 0.4516 0.0620  -0.0476 -0.0773 927 ARG A CB  
2570 C CG  . ARG A 326 ? 0.5157 0.1898 0.4281 0.0636  -0.0467 -0.0617 927 ARG A CG  
2571 C CD  . ARG A 326 ? 0.5139 0.1879 0.4261 0.0409  -0.0402 -0.0511 927 ARG A CD  
2572 N NE  . ARG A 326 ? 0.5213 0.2361 0.4526 0.0287  -0.0356 -0.0553 927 ARG A NE  
2573 C CZ  . ARG A 326 ? 0.5980 0.3518 0.5430 0.0302  -0.0334 -0.0508 927 ARG A CZ  
2574 N NH1 . ARG A 326 ? 0.6030 0.3630 0.5464 0.0419  -0.0351 -0.0432 927 ARG A NH1 
2575 N NH2 . ARG A 326 ? 0.5237 0.3093 0.4835 0.0202  -0.0302 -0.0541 927 ARG A NH2 
2576 N N   . GLY A 327 ? 0.5892 0.2700 0.5082 0.0725  -0.0485 -0.1143 928 GLY A N   
2577 C CA  . GLY A 327 ? 0.5999 0.2717 0.5146 0.0676  -0.0480 -0.1291 928 GLY A CA  
2578 C C   . GLY A 327 ? 0.6128 0.3054 0.5330 0.0512  -0.0484 -0.1362 928 GLY A C   
2579 O O   . GLY A 327 ? 0.6121 0.3353 0.5435 0.0434  -0.0456 -0.1250 928 GLY A O   
2580 N N   . ASP A 328 ? 0.6449 0.3330 0.5609 0.0437  -0.0490 -0.1504 929 ASP A N   
2581 C CA  . ASP A 328 ? 0.6635 0.3787 0.5863 0.0276  -0.0501 -0.1556 929 ASP A CA  
2582 C C   . ASP A 328 ? 0.5895 0.3503 0.5185 0.0374  -0.0483 -0.1579 929 ASP A C   
2583 O O   . ASP A 328 ? 0.5029 0.2726 0.4323 0.0555  -0.0459 -0.1578 929 ASP A O   
2584 C CB  . ASP A 328 ? 0.6880 0.3833 0.6029 0.0151  -0.0529 -0.1710 929 ASP A CB  
2585 C CG  . ASP A 328 ? 0.7464 0.4356 0.6510 0.0288  -0.0513 -0.1840 929 ASP A CG  
2586 O OD1 . ASP A 328 ? 0.7255 0.4423 0.6306 0.0431  -0.0502 -0.1892 929 ASP A OD1 
2587 O OD2 . ASP A 328 ? 0.9186 0.5755 0.8150 0.0242  -0.0499 -0.1896 929 ASP A OD2 
2588 N N   . LEU A 329 ? 0.4668 0.2564 0.4006 0.0255  -0.0495 -0.1599 930 LEU A N   
2589 C CA  . LEU A 329 ? 0.4841 0.3150 0.4215 0.0323  -0.0471 -0.1581 930 LEU A CA  
2590 C C   . LEU A 329 ? 0.5137 0.3483 0.4397 0.0470  -0.0455 -0.1733 930 LEU A C   
2591 O O   . LEU A 329 ? 0.5194 0.3801 0.4475 0.0579  -0.0402 -0.1708 930 LEU A O   
2592 C CB  . LEU A 329 ? 0.4221 0.2787 0.3642 0.0175  -0.0505 -0.1568 930 LEU A CB  
2593 C CG  . LEU A 329 ? 0.3971 0.2927 0.3417 0.0225  -0.0478 -0.1498 930 LEU A CG  
2594 C CD1 . LEU A 329 ? 0.3825 0.2880 0.3385 0.0280  -0.0418 -0.1332 930 LEU A CD1 
2595 C CD2 . LEU A 329 ? 0.4954 0.4123 0.4436 0.0097  -0.0535 -0.1486 930 LEU A CD2 
2596 N N   . ILE A 330 ? 0.5221 0.3301 0.4362 0.0464  -0.0491 -0.1899 931 ILE A N   
2597 C CA  . ILE A 330 ? 0.5789 0.3891 0.4808 0.0591  -0.0465 -0.2057 931 ILE A CA  
2598 C C   . ILE A 330 ? 0.5915 0.3996 0.4981 0.0782  -0.0400 -0.2021 931 ILE A C   
2599 O O   . ILE A 330 ? 0.5495 0.3818 0.4554 0.0896  -0.0338 -0.2068 931 ILE A O   
2600 C CB  . ILE A 330 ? 0.6395 0.4218 0.5298 0.0509  -0.0491 -0.2179 931 ILE A CB  
2601 C CG1 . ILE A 330 ? 0.6832 0.4724 0.5721 0.0309  -0.0566 -0.2220 931 ILE A CG1 
2602 C CG2 . ILE A 330 ? 0.5953 0.3823 0.4737 0.0629  -0.0439 -0.2308 931 ILE A CG2 
2603 C CD1 . ILE A 330 ? 0.7398 0.5018 0.6187 0.0196  -0.0593 -0.2340 931 ILE A CD1 
2604 N N   . LYS A 331 ? 0.5973 0.3782 0.5090 0.0810  -0.0413 -0.1932 932 LYS A N   
2605 C CA  . LYS A 331 ? 0.5667 0.3471 0.4849 0.0993  -0.0377 -0.1887 932 LYS A CA  
2606 C C   . LYS A 331 ? 0.5938 0.4106 0.5250 0.1064  -0.0344 -0.1805 932 LYS A C   
2607 O O   . LYS A 331 ? 0.6039 0.4409 0.5423 0.1205  -0.0294 -0.1822 932 LYS A O   
2608 C CB  . LYS A 331 ? 0.5628 0.3050 0.4802 0.0997  -0.0410 -0.1791 932 LYS A CB  
2609 C CG  . LYS A 331 ? 0.6316 0.3720 0.5548 0.1195  -0.0398 -0.1756 932 LYS A CG  
2610 C CD  . LYS A 331 ? 0.7510 0.4483 0.6673 0.1203  -0.0434 -0.1681 932 LYS A CD  
2611 C CE  . LYS A 331 ? 0.8322 0.5305 0.7547 0.1414  -0.0444 -0.1649 932 LYS A CE  
2612 N NZ  . LYS A 331 ? 0.9256 0.5804 0.8386 0.1437  -0.0484 -0.1572 932 LYS A NZ  
2613 N N   . PHE A 332 ? 0.5386 0.3661 0.4745 0.0945  -0.0363 -0.1703 933 PHE A N   
2614 C CA  . PHE A 332 ? 0.5022 0.3669 0.4509 0.0959  -0.0312 -0.1582 933 PHE A CA  
2615 C C   . PHE A 332 ? 0.4756 0.3739 0.4224 0.0995  -0.0246 -0.1666 933 PHE A C   
2616 O O   . PHE A 332 ? 0.4413 0.3645 0.3973 0.1095  -0.0183 -0.1657 933 PHE A O   
2617 C CB  . PHE A 332 ? 0.3918 0.2642 0.3461 0.0787  -0.0325 -0.1423 933 PHE A CB  
2618 C CG  . PHE A 332 ? 0.4236 0.3335 0.3879 0.0774  -0.0271 -0.1321 933 PHE A CG  
2619 C CD1 . PHE A 332 ? 0.4429 0.3640 0.4186 0.0856  -0.0245 -0.1237 933 PHE A CD1 
2620 C CD2 . PHE A 332 ? 0.4232 0.3557 0.3844 0.0679  -0.0254 -0.1311 933 PHE A CD2 
2621 C CE1 . PHE A 332 ? 0.4377 0.3905 0.4224 0.0828  -0.0190 -0.1152 933 PHE A CE1 
2622 C CE2 . PHE A 332 ? 0.4277 0.3895 0.3959 0.0665  -0.0201 -0.1211 933 PHE A CE2 
2623 C CZ  . PHE A 332 ? 0.3726 0.3438 0.3529 0.0731  -0.0162 -0.1134 933 PHE A CZ  
2624 N N   . TYR A 333 ? 0.4702 0.3695 0.4044 0.0903  -0.0259 -0.1748 934 TYR A N   
2625 C CA  . TYR A 333 ? 0.4199 0.3469 0.3455 0.0923  -0.0197 -0.1826 934 TYR A CA  
2626 C C   . TYR A 333 ? 0.4564 0.3880 0.3811 0.1094  -0.0127 -0.1963 934 TYR A C   
2627 O O   . TYR A 333 ? 0.4703 0.4318 0.4001 0.1147  -0.0035 -0.1949 934 TYR A O   
2628 C CB  . TYR A 333 ? 0.5164 0.4376 0.4251 0.0810  -0.0252 -0.1914 934 TYR A CB  
2629 C CG  . TYR A 333 ? 0.4831 0.4277 0.3762 0.0836  -0.0195 -0.2006 934 TYR A CG  
2630 C CD1 . TYR A 333 ? 0.5051 0.4786 0.3960 0.0779  -0.0156 -0.1888 934 TYR A CD1 
2631 C CD2 . TYR A 333 ? 0.4800 0.4158 0.3595 0.0902  -0.0169 -0.2173 934 TYR A CD2 
2632 C CE1 . TYR A 333 ? 0.4711 0.4631 0.3431 0.0797  -0.0097 -0.1957 934 TYR A CE1 
2633 C CE2 . TYR A 333 ? 0.4913 0.4477 0.3546 0.0908  -0.0104 -0.2226 934 TYR A CE2 
2634 C CZ  . TYR A 333 ? 0.4719 0.4560 0.3290 0.0867  -0.0070 -0.2142 934 TYR A CZ  
2635 O OH  . TYR A 333 ? 0.6568 0.6581 0.4940 0.0864  0.0002  -0.2175 934 TYR A OH  
2636 N N   . ASN A 334 ? 0.5269 0.4304 0.4480 0.1140  -0.0156 -0.2035 935 ASN A N   
2637 C CA  . ASN A 334 ? 0.4903 0.3979 0.4129 0.1271  -0.0088 -0.2121 935 ASN A CA  
2638 C C   . ASN A 334 ? 0.5118 0.4360 0.4548 0.1399  -0.0047 -0.2051 935 ASN A C   
2639 O O   . ASN A 334 ? 0.5237 0.4764 0.4732 0.1464  0.0045  -0.2086 935 ASN A O   
2640 C CB  . ASN A 334 ? 0.5305 0.4003 0.4444 0.1292  -0.0135 -0.2211 935 ASN A CB  
2641 C CG  . ASN A 334 ? 0.5956 0.4557 0.4895 0.1185  -0.0152 -0.2328 935 ASN A CG  
2642 O OD1 . ASN A 334 ? 0.5893 0.4725 0.4733 0.1175  -0.0096 -0.2395 935 ASN A OD1 
2643 N ND2 . ASN A 334 ? 0.6652 0.4910 0.5522 0.1094  -0.0229 -0.2351 935 ASN A ND2 
2644 N N   . THR A 335 ? 0.5199 0.4269 0.4725 0.1423  -0.0116 -0.1951 936 THR A N   
2645 C CA  . THR A 335 ? 0.4572 0.3763 0.4280 0.1551  -0.0107 -0.1893 936 THR A CA  
2646 C C   . THR A 335 ? 0.5441 0.4981 0.5297 0.1526  -0.0067 -0.1796 936 THR A C   
2647 O O   . THR A 335 ? 0.5631 0.5367 0.5655 0.1614  -0.0047 -0.1769 936 THR A O   
2648 C CB  . THR A 335 ? 0.4723 0.3560 0.4436 0.1596  -0.0203 -0.1817 936 THR A CB  
2649 O OG1 . THR A 335 ? 0.5386 0.4073 0.5051 0.1473  -0.0257 -0.1711 936 THR A OG1 
2650 C CG2 . THR A 335 ? 0.5153 0.3631 0.4735 0.1630  -0.0230 -0.1910 936 THR A CG2 
2651 N N   . ILE A 336 ? 0.5461 0.5080 0.5260 0.1402  -0.0059 -0.1750 937 ILE A N   
2652 C CA  . ILE A 336 ? 0.5043 0.4950 0.4972 0.1367  -0.0019 -0.1652 937 ILE A CA  
2653 C C   . ILE A 336 ? 0.4749 0.4923 0.4608 0.1267  0.0071  -0.1654 937 ILE A C   
2654 O O   . ILE A 336 ? 0.4797 0.5281 0.4742 0.1284  0.0171  -0.1661 937 ILE A O   
2655 C CB  . ILE A 336 ? 0.4950 0.4685 0.4898 0.1282  -0.0099 -0.1503 937 ILE A CB  
2656 C CG1 . ILE A 336 ? 0.5727 0.5171 0.5702 0.1394  -0.0186 -0.1492 937 ILE A CG1 
2657 C CG2 . ILE A 336 ? 0.4705 0.4730 0.4783 0.1210  -0.0053 -0.1371 937 ILE A CG2 
2658 C CD1 . ILE A 336 ? 0.6223 0.5461 0.6172 0.1290  -0.0252 -0.1337 937 ILE A CD1 
2659 N N   . TYR A 337 ? 0.3950 0.3998 0.3652 0.1134  0.0031  -0.1615 938 TYR A N   
2660 C CA  . TYR A 337 ? 0.3969 0.4222 0.3574 0.1018  0.0086  -0.1558 938 TYR A CA  
2661 C C   . TYR A 337 ? 0.3583 0.4040 0.3083 0.1067  0.0195  -0.1680 938 TYR A C   
2662 O O   . TYR A 337 ? 0.3709 0.4416 0.3207 0.1019  0.0289  -0.1616 938 TYR A O   
2663 C CB  . TYR A 337 ? 0.4678 0.4756 0.4142 0.0894  -0.0002 -0.1527 938 TYR A CB  
2664 C CG  . TYR A 337 ? 0.4449 0.4711 0.3814 0.0787  0.0023  -0.1437 938 TYR A CG  
2665 C CD1 . TYR A 337 ? 0.3560 0.3894 0.3018 0.0702  0.0011  -0.1266 938 TYR A CD1 
2666 C CD2 . TYR A 337 ? 0.4733 0.5078 0.3891 0.0780  0.0055  -0.1524 938 TYR A CD2 
2667 C CE1 . TYR A 337 ? 0.4019 0.4488 0.3377 0.0623  0.0025  -0.1179 938 TYR A CE1 
2668 C CE2 . TYR A 337 ? 0.4523 0.5006 0.3557 0.0696  0.0065  -0.1429 938 TYR A CE2 
2669 C CZ  . TYR A 337 ? 0.3786 0.4323 0.2925 0.0623  0.0047  -0.1254 938 TYR A CZ  
2670 O OH  . TYR A 337 ? 0.3465 0.4107 0.2471 0.0559  0.0047  -0.1155 938 TYR A OH  
2671 N N   . VAL A 338 ? 0.3873 0.4205 0.3270 0.1154  0.0190  -0.1854 939 VAL A N   
2672 C CA  . VAL A 338 ? 0.4746 0.5239 0.4027 0.1165  0.0296  -0.1931 939 VAL A CA  
2673 C C   . VAL A 338 ? 0.4888 0.5669 0.4350 0.1210  0.0421  -0.1899 939 VAL A C   
2674 O O   . VAL A 338 ? 0.5781 0.6788 0.5172 0.1150  0.0533  -0.1868 939 VAL A O   
2675 C CB  . VAL A 338 ? 0.6011 0.6290 0.5199 0.1229  0.0270  -0.2073 939 VAL A CB  
2676 C CG1 . VAL A 338 ? 0.6758 0.7216 0.5839 0.1250  0.0397  -0.2155 939 VAL A CG1 
2677 C CG2 . VAL A 338 ? 0.6168 0.6184 0.5171 0.1151  0.0156  -0.2117 939 VAL A CG2 
2678 N N   . GLY A 339 ? 0.4571 0.5334 0.4258 0.1306  0.0396  -0.1898 940 GLY A N   
2679 C CA  . GLY A 339 ? 0.5090 0.6136 0.4987 0.1346  0.0492  -0.1882 940 GLY A CA  
2680 C C   . GLY A 339 ? 0.4854 0.6155 0.4811 0.1238  0.0571  -0.1766 940 GLY A C   
2681 O O   . GLY A 339 ? 0.5215 0.6767 0.5224 0.1206  0.0699  -0.1766 940 GLY A O   
2682 N N   . ARG A 340 ? 0.4922 0.6145 0.4865 0.1176  0.0501  -0.1668 941 ARG A N   
2683 C CA  . ARG A 340 ? 0.4271 0.5701 0.4276 0.1074  0.0570  -0.1549 941 ARG A CA  
2684 C C   . ARG A 340 ? 0.4986 0.6495 0.4745 0.0966  0.0660  -0.1516 941 ARG A C   
2685 O O   . ARG A 340 ? 0.6274 0.7989 0.6056 0.0888  0.0782  -0.1450 941 ARG A O   
2686 C CB  . ARG A 340 ? 0.3679 0.4957 0.3758 0.1028  0.0455  -0.1419 941 ARG A CB  
2687 C CG  . ARG A 340 ? 0.3007 0.4225 0.3298 0.1140  0.0371  -0.1441 941 ARG A CG  
2688 C CD  . ARG A 340 ? 0.3146 0.4647 0.3677 0.1147  0.0436  -0.1420 941 ARG A CD  
2689 N NE  . ARG A 340 ? 0.3211 0.4877 0.3784 0.1019  0.0501  -0.1309 941 ARG A NE  
2690 C CZ  . ARG A 340 ? 0.3835 0.5407 0.4468 0.0956  0.0425  -0.1180 941 ARG A CZ  
2691 N NH1 . ARG A 340 ? 0.3783 0.5135 0.4438 0.1022  0.0295  -0.1163 941 ARG A NH1 
2692 N NH2 . ARG A 340 ? 0.3539 0.5218 0.4192 0.0823  0.0486  -0.1068 941 ARG A NH2 
2693 N N   . VAL A 341 ? 0.4749 0.6051 0.4268 0.0937  0.0583  -0.1525 942 VAL A N   
2694 C CA  . VAL A 341 ? 0.4612 0.5932 0.3868 0.0830  0.0619  -0.1449 942 VAL A CA  
2695 C C   . VAL A 341 ? 0.5404 0.6792 0.4408 0.0859  0.0712  -0.1586 942 VAL A C   
2696 O O   . VAL A 341 ? 0.5531 0.6944 0.4279 0.0780  0.0753  -0.1521 942 VAL A O   
2697 C CB  . VAL A 341 ? 0.4463 0.5553 0.3610 0.0764  0.0462  -0.1362 942 VAL A CB  
2698 C CG1 . VAL A 341 ? 0.5147 0.6273 0.4100 0.0658  0.0474  -0.1220 942 VAL A CG1 
2699 C CG2 . VAL A 341 ? 0.4112 0.5094 0.3496 0.0759  0.0368  -0.1276 942 VAL A CG2 
2700 N N   . LYS A 342 ? 0.5448 0.6802 0.4531 0.0948  0.0729  -0.1713 943 LYS A N   
2701 C CA  . LYS A 342 ? 0.7096 0.8425 0.5941 0.0955  0.0788  -0.1812 943 LYS A CA  
2702 C C   . LYS A 342 ? 0.7805 0.9338 0.6549 0.0886  0.0964  -0.1756 943 LYS A C   
2703 O O   . LYS A 342 ? 0.8204 0.9707 0.6647 0.0847  0.1010  -0.1777 943 LYS A O   
2704 C CB  . LYS A 342 ? 0.7002 0.8243 0.5962 0.1074  0.0777  -0.1963 943 LYS A CB  
2705 C CG  . LYS A 342 ? 0.7205 0.8659 0.6349 0.1126  0.0918  -0.2002 943 LYS A CG  
2706 C CD  . LYS A 342 ? 0.7716 0.9071 0.7042 0.1267  0.0866  -0.2122 943 LYS A CD  
2707 C CE  . LYS A 342 ? 0.8115 0.9663 0.7530 0.1330  0.1008  -0.2213 943 LYS A CE  
2708 N NZ  . LYS A 342 ? 0.8256 0.9826 0.7373 0.1280  0.1123  -0.2272 943 LYS A NZ  
2709 N N   . SER A 343 ? 0.8052 0.9777 0.7036 0.0861  0.1057  -0.1682 944 SER A N   
2710 C CA  . SER A 343 ? 0.7602 0.9501 0.6511 0.0773  0.1234  -0.1617 944 SER A CA  
2711 C C   . SER A 343 ? 0.6582 0.8414 0.5178 0.0659  0.1239  -0.1478 944 SER A C   
2712 O O   . SER A 343 ? 0.6656 0.8479 0.4964 0.0607  0.1336  -0.1457 944 SER A O   
2713 C CB  . SER A 343 ? 0.8029 1.0134 0.7285 0.0751  0.1310  -0.1564 944 SER A CB  
2714 O OG  . SER A 343 ? 0.8910 1.1172 0.8117 0.0669  0.1493  -0.1527 944 SER A OG  
2715 N N   . PHE A 344 ? 0.6338 0.8110 0.4975 0.0630  0.1129  -0.1380 945 PHE A N   
2716 C CA  . PHE A 344 ? 0.5482 0.7173 0.3820 0.0546  0.1097  -0.1243 945 PHE A CA  
2717 C C   . PHE A 344 ? 0.5699 0.7237 0.3701 0.0574  0.0996  -0.1310 945 PHE A C   
2718 O O   . PHE A 344 ? 0.6401 0.7892 0.4069 0.0517  0.1028  -0.1236 945 PHE A O   
2719 C CB  . PHE A 344 ? 0.5182 0.6789 0.3688 0.0516  0.0969  -0.1111 945 PHE A CB  
2720 C CG  . PHE A 344 ? 0.4881 0.6356 0.3145 0.0433  0.0909  -0.0929 945 PHE A CG  
2721 C CD1 . PHE A 344 ? 0.5320 0.6833 0.3534 0.0339  0.1022  -0.0772 945 PHE A CD1 
2722 C CD2 . PHE A 344 ? 0.4911 0.6222 0.3002 0.0452  0.0737  -0.0920 945 PHE A CD2 
2723 C CE1 . PHE A 344 ? 0.5819 0.7181 0.3799 0.0285  0.0958  -0.0601 945 PHE A CE1 
2724 C CE2 . PHE A 344 ? 0.5447 0.6657 0.3332 0.0400  0.0667  -0.0759 945 PHE A CE2 
2725 C CZ  . PHE A 344 ? 0.5318 0.6540 0.3138 0.0327  0.0775  -0.0594 945 PHE A CZ  
2726 N N   . ALA A 345 ? 0.5656 0.7092 0.3742 0.0658  0.0869  -0.1448 946 ALA A N   
2727 C CA  . ALA A 345 ? 0.6215 0.7492 0.4033 0.0674  0.0743  -0.1530 946 ALA A CA  
2728 C C   . ALA A 345 ? 0.6515 0.7781 0.4060 0.0670  0.0839  -0.1604 946 ALA A C   
2729 O O   . ALA A 345 ? 0.6843 0.8028 0.4052 0.0633  0.0783  -0.1580 946 ALA A O   
2730 C CB  . ALA A 345 ? 0.6083 0.7224 0.4084 0.0749  0.0611  -0.1667 946 ALA A CB  
2731 N N   . LEU A 346 ? 0.6825 0.8177 0.4514 0.0715  0.0978  -0.1694 947 LEU A N   
2732 C CA  . LEU A 346 ? 0.7749 0.9093 0.5196 0.0723  0.1087  -0.1785 947 LEU A CA  
2733 C C   . LEU A 346 ? 0.8126 0.9515 0.5269 0.0629  0.1213  -0.1652 947 LEU A C   
2734 O O   . LEU A 346 ? 0.8589 0.9947 0.5456 0.0623  0.1303  -0.1707 947 LEU A O   
2735 C CB  . LEU A 346 ? 0.7734 0.9187 0.5446 0.0803  0.1210  -0.1905 947 LEU A CB  
2736 C CG  . LEU A 346 ? 0.7583 0.8919 0.5487 0.0914  0.1099  -0.2061 947 LEU A CG  
2737 C CD1 . LEU A 346 ? 0.7779 0.9240 0.5940 0.1006  0.1217  -0.2161 947 LEU A CD1 
2738 C CD2 . LEU A 346 ? 0.7192 0.8321 0.4795 0.0922  0.1001  -0.2174 947 LEU A CD2 
2739 N N   . LYS A 347 ? 0.7847 0.9284 0.5024 0.0556  0.1223  -0.1474 948 LYS A N   
2740 C CA  . LYS A 347 ? 0.7813 0.9244 0.4699 0.0463  0.1345  -0.1322 948 LYS A CA  
2741 C C   . LYS A 347 ? 0.9139 1.0403 0.5622 0.0431  0.1205  -0.1232 948 LYS A C   
2742 O O   . LYS A 347 ? 1.0087 1.1286 0.6276 0.0360  0.1272  -0.1081 948 LYS A O   
2744 N N   . TYR A 348 ? 0.9214 1.0397 0.5688 0.0483  0.1004  -0.1321 949 TYR A N   
2745 C CA  . TYR A 348 ? 0.9199 1.0254 0.5347 0.0463  0.0832  -0.1247 949 TYR A CA  
2746 C C   . TYR A 348 ? 0.9538 1.0497 0.5526 0.0504  0.0707  -0.1424 949 TYR A C   
2747 O O   . TYR A 348 ? 0.9463 1.0422 0.5470 0.0539  0.0797  -0.1584 949 TYR A O   
2756 N N   . PRO A 361 ? 1.0383 1.1118 0.6312 0.0016  0.1296  0.0075  962 PRO A N   
2757 C CA  . PRO A 361 ? 1.0451 1.1013 0.6241 0.0045  0.1129  0.0265  962 PRO A CA  
2758 C C   . PRO A 361 ? 0.9825 1.0441 0.5900 0.0151  0.0891  0.0199  962 PRO A C   
2759 O O   . PRO A 361 ? 0.9932 1.0696 0.6411 0.0161  0.0889  0.0059  962 PRO A O   
2760 C CB  . PRO A 361 ? 1.0325 1.0814 0.6266 -0.0057 0.1272  0.0421  962 PRO A CB  
2761 C CG  . PRO A 361 ? 0.9730 1.0460 0.6076 -0.0108 0.1431  0.0269  962 PRO A CG  
2762 C CD  . PRO A 361 ? 0.9958 1.0793 0.6207 -0.0070 0.1495  0.0087  962 PRO A CD  
2763 N N   . LEU A 362 ? 0.9124 0.9600 0.5015 0.0222  0.0686  0.0294  963 LEU A N   
2764 C CA  . LEU A 362 ? 0.8404 0.8918 0.4589 0.0298  0.0460  0.0229  963 LEU A CA  
2765 C C   . LEU A 362 ? 0.8574 0.8971 0.4971 0.0304  0.0386  0.0392  963 LEU A C   
2766 O O   . LEU A 362 ? 0.9280 0.9501 0.5454 0.0287  0.0426  0.0578  963 LEU A O   
2767 C CB  . LEU A 362 ? 0.8428 0.8933 0.4327 0.0381  0.0259  0.0175  963 LEU A CB  
2768 C CG  . LEU A 362 ? 0.9202 0.9821 0.4928 0.0389  0.0294  -0.0029 963 LEU A CG  
2769 C CD1 . LEU A 362 ? 0.9428 1.0033 0.4912 0.0457  0.0067  -0.0091 963 LEU A CD1 
2770 C CD2 . LEU A 362 ? 0.8948 0.9711 0.5098 0.0378  0.0345  -0.0219 963 LEU A CD2 
2771 N N   . SER A 363 ? 0.7979 0.8455 0.4792 0.0327  0.0286  0.0318  964 SER A N   
2772 C CA  . SER A 363 ? 0.7440 0.7831 0.4499 0.0336  0.0226  0.0438  964 SER A CA  
2773 C C   . SER A 363 ? 0.8239 0.8560 0.5196 0.0430  0.0007  0.0516  964 SER A C   
2774 O O   . SER A 363 ? 0.8365 0.8764 0.5208 0.0484  -0.0137 0.0425  964 SER A O   
2775 C CB  . SER A 363 ? 0.6408 0.6915 0.3932 0.0318  0.0222  0.0324  964 SER A CB  
2776 O OG  . SER A 363 ? 0.6688 0.7280 0.4333 0.0249  0.0405  0.0251  964 SER A OG  
2777 N N   . PRO A 364 ? 0.8990 0.9170 0.5998 0.0454  -0.0022 0.0675  965 PRO A N   
2778 C CA  . PRO A 364 ? 0.9876 1.0019 0.6851 0.0564  -0.0237 0.0743  965 PRO A CA  
2779 C C   . PRO A 364 ? 0.9177 0.9504 0.6545 0.0595  -0.0382 0.0607  965 PRO A C   
2780 O O   . PRO A 364 ? 0.7935 0.8316 0.5658 0.0546  -0.0317 0.0552  965 PRO A O   
2781 C CB  . PRO A 364 ? 1.0309 1.0240 0.7289 0.0577  -0.0191 0.0932  965 PRO A CB  
2782 C CG  . PRO A 364 ? 0.9999 0.9928 0.7214 0.0461  0.0011  0.0906  965 PRO A CG  
2783 C CD  . PRO A 364 ? 0.9597 0.9642 0.6692 0.0384  0.0140  0.0792  965 PRO A CD  
2784 N N   . PHE A 365 ? 0.9374 0.9795 0.6668 0.0670  -0.0579 0.0554  966 PHE A N   
2785 C CA  . PHE A 365 ? 0.7940 0.8541 0.5595 0.0685  -0.0717 0.0426  966 PHE A CA  
2786 C C   . PHE A 365 ? 0.7546 0.8146 0.5384 0.0771  -0.0843 0.0525  966 PHE A C   
2787 O O   . PHE A 365 ? 0.8347 0.8907 0.5966 0.0872  -0.0977 0.0617  966 PHE A O   
2788 C CB  . PHE A 365 ? 0.7341 0.8080 0.4864 0.0699  -0.0860 0.0279  966 PHE A CB  
2789 C CG  . PHE A 365 ? 0.6947 0.7860 0.4844 0.0667  -0.0957 0.0118  966 PHE A CG  
2790 C CD1 . PHE A 365 ? 0.7402 0.8464 0.5375 0.0717  -0.1170 0.0060  966 PHE A CD1 
2791 C CD2 . PHE A 365 ? 0.5799 0.6725 0.3972 0.0583  -0.0837 0.0027  966 PHE A CD2 
2792 C CE1 . PHE A 365 ? 0.6873 0.8092 0.5197 0.0662  -0.1241 -0.0088 966 PHE A CE1 
2793 C CE2 . PHE A 365 ? 0.5041 0.6086 0.3526 0.0541  -0.0912 -0.0107 966 PHE A CE2 
2794 C CZ  . PHE A 365 ? 0.5589 0.6778 0.4152 0.0570  -0.1104 -0.0165 966 PHE A CZ  
2795 N N   . PRO A 366 ? 0.7283 0.7925 0.5513 0.0742  -0.0800 0.0503  967 PRO A N   
2796 C CA  . PRO A 366 ? 0.7568 0.8217 0.6024 0.0821  -0.0882 0.0579  967 PRO A CA  
2797 C C   . PRO A 366 ? 0.7662 0.8482 0.6162 0.0922  -0.1112 0.0541  967 PRO A C   
2798 O O   . PRO A 366 ? 0.7629 0.8611 0.6127 0.0892  -0.1205 0.0405  967 PRO A O   
2799 C CB  . PRO A 366 ? 0.6859 0.7587 0.5720 0.0742  -0.0796 0.0491  967 PRO A CB  
2800 C CG  . PRO A 366 ? 0.6663 0.7325 0.5449 0.0638  -0.0628 0.0446  967 PRO A CG  
2801 C CD  . PRO A 366 ? 0.6602 0.7282 0.5068 0.0636  -0.0662 0.0397  967 PRO A CD  
2802 N N   . ASP B 1   ? 0.5585 0.8820 0.7631 0.0675  -0.0057 -0.3889 21  ASP B N   
2803 C CA  . ASP B 1   ? 0.6326 0.9183 0.7868 0.0740  0.0013  -0.3728 21  ASP B CA  
2804 C C   . ASP B 1   ? 0.6229 0.8775 0.7613 0.0762  -0.0148 -0.3685 21  ASP B C   
2805 O O   . ASP B 1   ? 0.6186 0.8588 0.7286 0.0923  -0.0280 -0.3666 21  ASP B O   
2806 C CB  . ASP B 1   ? 0.7514 1.0233 0.8922 0.0607  0.0332  -0.3593 21  ASP B CB  
2807 C CG  . ASP B 1   ? 0.8442 1.1509 0.9921 0.0654  0.0543  -0.3631 21  ASP B CG  
2808 O OD1 . ASP B 1   ? 0.8889 1.1773 0.9854 0.0839  0.0620  -0.3558 21  ASP B OD1 
2809 O OD2 . ASP B 1   ? 0.8399 1.1926 1.0433 0.0549  0.0607  -0.3763 21  ASP B OD2 
2810 N N   . LEU B 2   ? 0.6246 0.8714 0.7847 0.0623  -0.0163 -0.3702 22  LEU B N   
2811 C CA  . LEU B 2   ? 0.6557 0.8737 0.7984 0.0693  -0.0330 -0.3694 22  LEU B CA  
2812 C C   . LEU B 2   ? 0.5641 0.8058 0.7230 0.0812  -0.0518 -0.3810 22  LEU B C   
2813 O O   . LEU B 2   ? 0.5597 0.7882 0.7066 0.0917  -0.0639 -0.3829 22  LEU B O   
2814 C CB  . LEU B 2   ? 0.7026 0.8918 0.8545 0.0522  -0.0313 -0.3675 22  LEU B CB  
2815 C CG  . LEU B 2   ? 0.7721 0.9065 0.8799 0.0463  -0.0201 -0.3504 22  LEU B CG  
2816 C CD1 . LEU B 2   ? 0.7804 0.8780 0.8993 0.0271  -0.0249 -0.3493 22  LEU B CD1 
2817 C CD2 . LEU B 2   ? 0.8123 0.9197 0.8689 0.0736  -0.0352 -0.3479 22  LEU B CD2 
2818 N N   . TYR B 3   ? 0.5204 0.7938 0.7010 0.0815  -0.0530 -0.3885 23  TYR B N   
2819 C CA  . TYR B 3   ? 0.4687 0.7557 0.6548 0.0910  -0.0668 -0.3954 23  TYR B CA  
2820 C C   . TYR B 3   ? 0.4955 0.7864 0.6660 0.1009  -0.0704 -0.3882 23  TYR B C   
2821 O O   . TYR B 3   ? 0.5165 0.8047 0.6756 0.1036  -0.0680 -0.3848 23  TYR B O   
2822 C CB  . TYR B 3   ? 0.4430 0.7508 0.6509 0.0888  -0.0705 -0.4021 23  TYR B CB  
2823 C CG  . TYR B 3   ? 0.4819 0.7966 0.7197 0.0810  -0.0724 -0.4181 23  TYR B CG  
2824 C CD1 . TYR B 3   ? 0.5063 0.8068 0.7484 0.0839  -0.0853 -0.4207 23  TYR B CD1 
2825 C CD2 . TYR B 3   ? 0.4916 0.8295 0.7579 0.0716  -0.0614 -0.4243 23  TYR B CD2 
2826 C CE1 . TYR B 3   ? 0.4468 0.7535 0.7247 0.0766  -0.0933 -0.4382 23  TYR B CE1 
2827 C CE2 . TYR B 3   ? 0.4335 0.7870 0.7432 0.0614  -0.0637 -0.4387 23  TYR B CE2 
2828 C CZ  . TYR B 3   ? 0.4976 0.8341 0.8154 0.0630  -0.0826 -0.4484 23  TYR B CZ  
2829 O OH  . TYR B 3   ? 0.5309 0.8830 0.8999 0.0529  -0.0911 -0.4668 23  TYR B OH  
2830 N N   . CYS B 4   ? 0.5043 0.8017 0.6758 0.1067  -0.0759 -0.3851 24  CYS B N   
2831 C CA  . CYS B 4   ? 0.4535 0.7646 0.6248 0.1126  -0.0776 -0.3842 24  CYS B CA  
2832 C C   . CYS B 4   ? 0.4796 0.8017 0.6597 0.1069  -0.0802 -0.3839 24  CYS B C   
2833 O O   . CYS B 4   ? 0.5214 0.8405 0.6968 0.1066  -0.0798 -0.3841 24  CYS B O   
2834 C CB  . CYS B 4   ? 0.4285 0.7454 0.5957 0.1238  -0.0766 -0.3856 24  CYS B CB  
2835 S SG  . CYS B 4   ? 0.4220 0.7721 0.6098 0.1272  -0.0749 -0.3827 24  CYS B SG  
2836 N N   . TYR B 5   ? 0.4351 0.7612 0.6212 0.1043  -0.0860 -0.3829 25  TYR B N   
2837 C CA  . TYR B 5   ? 0.4240 0.7486 0.6147 0.0975  -0.0935 -0.3820 25  TYR B CA  
2838 C C   . TYR B 5   ? 0.4473 0.7850 0.6562 0.0897  -0.0933 -0.3749 25  TYR B C   
2839 O O   . TYR B 5   ? 0.5524 0.8822 0.7665 0.0798  -0.1010 -0.3717 25  TYR B O   
2840 C CB  . TYR B 5   ? 0.4452 0.7620 0.6308 0.1011  -0.1033 -0.3861 25  TYR B CB  
2841 C CG  . TYR B 5   ? 0.4854 0.7983 0.6637 0.1041  -0.0949 -0.3836 25  TYR B CG  
2842 C CD1 . TYR B 5   ? 0.5012 0.8127 0.6821 0.1042  -0.0978 -0.3841 25  TYR B CD1 
2843 C CD2 . TYR B 5   ? 0.4745 0.7854 0.6447 0.1066  -0.0846 -0.3843 25  TYR B CD2 
2844 C CE1 . TYR B 5   ? 0.4129 0.7345 0.6013 0.1054  -0.0904 -0.3894 25  TYR B CE1 
2845 C CE2 . TYR B 5   ? 0.4554 0.7690 0.6269 0.1042  -0.0734 -0.3885 25  TYR B CE2 
2846 C CZ  . TYR B 5   ? 0.4175 0.7432 0.6046 0.1028  -0.0762 -0.3931 25  TYR B CZ  
2847 O OH  . TYR B 5   ? 0.4434 0.7846 0.6455 0.0996  -0.0642 -0.4046 25  TYR B OH  
2848 N N   . GLU B 6   ? 0.4410 0.7990 0.6621 0.0938  -0.0849 -0.3734 26  GLU B N   
2849 C CA  . GLU B 6   ? 0.4142 0.7989 0.6645 0.0852  -0.0780 -0.3675 26  GLU B CA  
2850 C C   . GLU B 6   ? 0.4729 0.8531 0.7100 0.0783  -0.0611 -0.3562 26  GLU B C   
2851 O O   . GLU B 6   ? 0.5058 0.8646 0.7100 0.0874  -0.0584 -0.3572 26  GLU B O   
2852 C CB  . GLU B 6   ? 0.4288 0.8425 0.6964 0.0984  -0.0748 -0.3737 26  GLU B CB  
2853 C CG  . GLU B 6   ? 0.4777 0.8797 0.7370 0.1122  -0.0919 -0.3842 26  GLU B CG  
2854 C CD  . GLU B 6   ? 0.5428 0.9601 0.8044 0.1315  -0.0933 -0.3924 26  GLU B CD  
2855 O OE1 . GLU B 6   ? 0.4145 0.8731 0.7116 0.1331  -0.0872 -0.3953 26  GLU B OE1 
2856 O OE2 . GLU B 6   ? 0.5884 0.9755 0.8158 0.1454  -0.0997 -0.3961 26  GLU B OE2 
2857 N N   . GLN B 7   ? 0.5477 0.9458 0.8100 0.0622  -0.0503 -0.3458 27  GLN B N   
2858 C CA  . GLN B 7   ? 0.6131 1.0050 0.8556 0.0560  -0.0275 -0.3307 27  GLN B CA  
2859 C C   . GLN B 7   ? 0.6812 1.1257 0.9653 0.0497  -0.0032 -0.3243 27  GLN B C   
2860 O O   . GLN B 7   ? 0.6073 1.0918 0.9364 0.0535  -0.0102 -0.3359 27  GLN B O   
2861 C CB  . GLN B 7   ? 0.6711 1.0220 0.8955 0.0372  -0.0335 -0.3193 27  GLN B CB  
2862 C CG  . GLN B 7   ? 0.7501 1.0740 0.9708 0.0381  -0.0643 -0.3311 27  GLN B CG  
2863 C CD  . GLN B 7   ? 0.8529 1.1370 1.0632 0.0200  -0.0766 -0.3224 27  GLN B CD  
2864 O OE1 . GLN B 7   ? 0.9658 1.2300 1.1602 0.0052  -0.0609 -0.3045 27  GLN B OE1 
2865 N NE2 . GLN B 7   ? 0.8492 1.1164 1.0627 0.0226  -0.1048 -0.3345 27  GLN B NE2 
2866 N N   . LEU B 8   ? 0.7923 1.2375 1.0603 0.0426  0.0257  -0.3071 28  LEU B N   
2867 C CA  . LEU B 8   ? 0.8397 1.3449 1.1490 0.0386  0.0567  -0.3010 28  LEU B CA  
2868 C C   . LEU B 8   ? 0.9761 1.4817 1.3019 0.0039  0.0842  -0.2759 28  LEU B C   
2869 O O   . LEU B 8   ? 1.0347 1.4798 1.3207 -0.0108 0.0764  -0.2630 28  LEU B O   
2870 C CB  . LEU B 8   ? 0.8727 1.3870 1.1404 0.0722  0.0739  -0.3053 28  LEU B CB  
2871 C CG  . LEU B 8   ? 0.9293 1.4081 1.1232 0.0897  0.0953  -0.2934 28  LEU B CG  
2872 C CD1 . LEU B 8   ? 0.9696 1.4710 1.1649 0.0747  0.1403  -0.2694 28  LEU B CD1 
2873 C CD2 . LEU B 8   ? 0.9023 1.3933 1.0733 0.1288  0.0900  -0.3116 28  LEU B CD2 
2874 N N   . ASN B 9   ? 1.0031 1.5741 1.3886 -0.0109 0.1155  -0.2688 29  ASN B N   
2875 C CA  . ASN B 9   ? 0.9925 1.6413 1.4248 0.0109  0.1280  -0.2853 29  ASN B CA  
2876 C C   . ASN B 9   ? 0.9608 1.6414 1.4487 0.0211  0.0902  -0.3136 29  ASN B C   
2877 O O   . ASN B 9   ? 0.9716 1.6523 1.5074 -0.0020 0.0668  -0.3182 29  ASN B O   
2878 C CB  . ASN B 9   ? 1.0286 1.7460 1.5210 -0.0124 0.1747  -0.2699 29  ASN B CB  
2879 C CG  . ASN B 9   ? 1.1159 1.7950 1.5423 -0.0223 0.2180  -0.2375 29  ASN B CG  
2880 O OD1 . ASN B 9   ? 1.1701 1.7691 1.5059 -0.0089 0.2067  -0.2299 29  ASN B OD1 
2881 N ND2 . ASN B 9   ? 1.1290 1.8663 1.5989 -0.0431 0.2685  -0.2194 29  ASN B ND2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   388 ?   ?   ?   A . n 
A 1 2   GLU 2   389 389 GLU GLU A . n 
A 1 3   PHE 3   390 390 PHE PHE A . n 
A 1 4   THR 4   391 391 THR THR A . n 
A 1 5   GLN 5   392 392 GLN GLN A . n 
A 1 6   SER 6   393 393 SER SER A . n 
A 1 7   VAL 7   394 394 VAL VAL A . n 
A 1 8   SER 8   395 395 SER SER A . n 
A 1 9   ARG 9   396 396 ARG ARG A . n 
A 1 10  LEU 10  397 397 LEU LEU A . n 
A 1 11  GLN 11  398 398 GLN GLN A . n 
A 1 12  SER 12  399 399 SER SER A . n 
A 1 13  ILE 13  400 400 ILE ILE A . n 
A 1 14  VAL 14  401 401 VAL VAL A . n 
A 1 15  ALA 15  402 402 ALA ALA A . n 
A 1 16  GLY 16  403 403 GLY GLY A . n 
A 1 17  LEU 17  404 404 LEU LEU A . n 
A 1 18  LYS 18  405 405 LYS LYS A . n 
A 1 19  ASN 19  406 406 ASN ASN A . n 
A 1 20  ALA 20  407 407 ALA ALA A . n 
A 1 21  PRO 21  408 408 PRO PRO A . n 
A 1 22  SER 22  409 409 SER SER A . n 
A 1 23  ASP 23  410 410 ASP ASP A . n 
A 1 24  GLN 24  411 411 GLN GLN A . n 
A 1 25  LEU 25  412 412 LEU LEU A . n 
A 1 26  ILE 26  413 413 ILE ILE A . n 
A 1 27  ASN 27  414 414 ASN ASN A . n 
A 1 28  ILE 28  415 415 ILE ILE A . n 
A 1 29  PHE 29  416 416 PHE PHE A . n 
A 1 30  GLU 30  417 417 GLU GLU A . n 
A 1 31  SER 31  418 418 SER SER A . n 
A 1 32  CYS 32  419 419 CYS CYS A . n 
A 1 33  VAL 33  420 420 VAL VAL A . n 
A 1 34  ARG 34  421 421 ARG ARG A . n 
A 1 35  ASN 35  422 422 ASN ASN A . n 
A 1 36  PRO 36  423 423 PRO PRO A . n 
A 1 37  VAL 37  424 424 VAL VAL A . n 
A 1 38  GLU 38  425 425 GLU GLU A . n 
A 1 39  ASN 39  426 426 ASN ASN A . n 
A 1 40  ILE 40  427 427 ILE ILE A . n 
A 1 41  MET 41  428 428 MET MET A . n 
A 1 42  LYS 42  429 429 LYS LYS A . n 
A 1 43  ILE 43  430 430 ILE ILE A . n 
A 1 44  LEU 44  431 431 LEU LEU A . n 
A 1 45  LYS 45  432 432 LYS LYS A . n 
A 1 46  GLY 46  433 433 GLY GLY A . n 
A 1 47  ILE 47  434 434 ILE ILE A . n 
A 1 48  GLY 48  435 435 GLY GLY A . n 
A 1 49  GLU 49  436 436 GLU GLU A . n 
A 1 50  THR 50  437 437 THR THR A . n 
A 1 51  PHE 51  438 438 PHE PHE A . n 
A 1 52  CYS 52  439 439 CYS CYS A . n 
A 1 53  GLN 53  440 440 GLN GLN A . n 
A 1 54  HIS 54  441 441 HIS HIS A . n 
A 1 55  TYR 55  442 442 TYR TYR A . n 
A 1 56  THR 56  443 443 THR THR A . n 
A 1 57  GLN 57  444 444 GLN GLN A . n 
A 1 58  SER 58  445 445 SER SER A . n 
A 1 59  THR 59  446 446 THR THR A . n 
A 1 60  ASP 60  447 447 ASP ASP A . n 
A 1 61  GLU 61  448 448 GLU GLU A . n 
A 1 62  GLN 62  449 449 GLN GLN A . n 
A 1 63  PRO 63  450 450 PRO PRO A . n 
A 1 64  GLY 64  451 451 GLY GLY A . n 
A 1 65  SER 65  452 452 SER SER A . n 
A 1 66  HIS 66  453 453 HIS HIS A . n 
A 1 67  ILE 67  454 454 ILE ILE A . n 
A 1 68  ASP 68  455 455 ASP ASP A . n 
A 1 69  PHE 69  456 456 PHE PHE A . n 
A 1 70  ALA 70  457 457 ALA ALA A . n 
A 1 71  VAL 71  458 458 VAL VAL A . n 
A 1 72  ASN 72  459 459 ASN ASN A . n 
A 1 73  ARG 73  460 460 ARG ARG A . n 
A 1 74  LEU 74  461 461 LEU LEU A . n 
A 1 75  LYS 75  462 462 LYS LYS A . n 
A 1 76  LEU 76  463 463 LEU LEU A . n 
A 1 77  ALA 77  464 464 ALA ALA A . n 
A 1 78  GLU 78  465 465 GLU GLU A . n 
A 1 79  ILE 79  466 466 ILE ILE A . n 
A 1 80  LEU 80  467 467 LEU LEU A . n 
A 1 81  TYR 81  468 468 TYR TYR A . n 
A 1 82  TYR 82  469 469 TYR TYR A . n 
A 1 83  LYS 83  470 470 LYS LYS A . n 
A 1 84  ILE 84  471 471 ILE ILE A . n 
A 1 85  LEU 85  472 472 LEU LEU A . n 
A 1 86  GLU 86  473 473 GLU GLU A . n 
A 1 87  THR 87  474 474 THR THR A . n 
A 1 88  VAL 88  475 475 VAL VAL A . n 
A 1 89  MET 89  476 476 MET MET A . n 
A 1 90  VAL 90  477 477 VAL VAL A . n 
A 1 91  GLN 91  478 478 GLN GLN A . n 
A 1 92  GLU 92  479 479 GLU GLU A . n 
A 1 93  THR 93  480 480 THR THR A . n 
A 1 94  ARG 94  481 481 ARG ARG A . n 
A 1 95  ARG 95  482 482 ARG ARG A . n 
A 1 96  LEU 96  483 483 LEU LEU A . n 
A 1 97  HIS 97  484 484 HIS HIS A . n 
A 1 98  GLY 98  485 485 GLY GLY A . n 
A 1 99  MET 99  486 486 MET MET A . n 
A 1 100 ASP 100 487 487 ASP ASP A . n 
A 1 101 MET 101 488 488 MET MET A . n 
A 1 102 SER 102 489 489 SER SER A . n 
A 1 103 VAL 103 490 490 VAL VAL A . n 
A 1 104 LEU 104 491 491 LEU LEU A . n 
A 1 105 LEU 105 492 492 LEU LEU A . n 
A 1 106 GLU 106 493 493 GLU GLU A . n 
A 1 107 GLN 107 494 494 GLN GLN A . n 
A 1 108 ASP 108 495 495 ASP ASP A . n 
A 1 109 ILE 109 496 496 ILE ILE A . n 
A 1 110 PHE 110 497 497 PHE PHE A . n 
A 1 111 HIS 111 498 498 HIS HIS A . n 
A 1 112 ARG 112 499 499 ARG ARG A . n 
A 1 113 SER 113 500 500 SER SER A . n 
A 1 114 LEU 114 501 501 LEU LEU A . n 
A 1 115 MET 115 502 502 MET MET A . n 
A 1 116 ALA 116 503 503 ALA ALA A . n 
A 1 117 CYS 117 504 504 CYS CYS A . n 
A 1 118 CYS 118 505 505 CYS CYS A . n 
A 1 119 LEU 119 506 506 LEU LEU A . n 
A 1 120 GLU 120 507 507 GLU GLU A . n 
A 1 121 ILE 121 508 508 ILE ILE A . n 
A 1 122 VAL 122 509 509 VAL VAL A . n 
A 1 123 LEU 123 510 510 LEU LEU A . n 
A 1 124 PHE 124 511 511 PHE PHE A . n 
A 1 125 ALA 125 512 512 ALA ALA A . n 
A 1 126 TYR 126 513 513 TYR TYR A . n 
A 1 127 SER 127 514 514 SER SER A . n 
A 1 128 SER 128 515 515 SER SER A . n 
A 1 129 PRO 129 516 516 PRO PRO A . n 
A 1 130 ARG 130 517 517 ARG ARG A . n 
A 1 131 THR 131 518 518 THR THR A . n 
A 1 132 PHE 132 519 519 PHE PHE A . n 
A 1 133 PRO 133 520 520 PRO PRO A . n 
A 1 134 TRP 134 521 521 TRP TRP A . n 
A 1 135 ILE 135 522 522 ILE ILE A . n 
A 1 136 ILE 136 523 523 ILE ILE A . n 
A 1 137 GLU 137 524 524 GLU GLU A . n 
A 1 138 VAL 138 525 525 VAL VAL A . n 
A 1 139 LEU 139 526 526 LEU LEU A . n 
A 1 140 ASN 140 527 527 ASN ASN A . n 
A 1 141 LEU 141 528 528 LEU LEU A . n 
A 1 142 GLN 142 529 529 GLN GLN A . n 
A 1 143 PRO 143 530 530 PRO PRO A . n 
A 1 144 PHE 144 531 531 PHE PHE A . n 
A 1 145 TYR 145 532 532 TYR TYR A . n 
A 1 146 PHE 146 533 533 PHE PHE A . n 
A 1 147 TYR 147 534 534 TYR TYR A . n 
A 1 148 LYS 148 535 535 LYS LYS A . n 
A 1 149 VAL 149 536 536 VAL VAL A . n 
A 1 150 ILE 150 537 537 ILE ILE A . n 
A 1 151 GLU 151 538 538 GLU GLU A . n 
A 1 152 VAL 152 539 539 VAL VAL A . n 
A 1 153 VAL 153 540 540 VAL VAL A . n 
A 1 154 ILE 154 541 541 ILE ILE A . n 
A 1 155 ARG 155 542 542 ARG ARG A . n 
A 1 156 SER 156 543 543 SER SER A . n 
A 1 157 GLU 157 544 544 GLU GLU A . n 
A 1 158 GLU 158 545 545 GLU GLU A . n 
A 1 159 GLY 159 546 546 GLY GLY A . n 
A 1 160 LEU 160 547 547 LEU LEU A . n 
A 1 161 SER 161 548 548 SER SER A . n 
A 1 162 ARG 162 549 549 ARG ARG A . n 
A 1 163 ASP 163 550 550 ASP ASP A . n 
A 1 164 MET 164 551 551 MET MET A . n 
A 1 165 VAL 165 552 552 VAL VAL A . n 
A 1 166 LYS 166 553 553 LYS LYS A . n 
A 1 167 HIS 167 554 554 HIS HIS A . n 
A 1 168 LEU 168 555 555 LEU LEU A . n 
A 1 169 ASN 169 556 556 ASN ASN A . n 
A 1 170 SER 170 557 557 SER SER A . n 
A 1 171 ILE 171 558 558 ILE ILE A . n 
A 1 172 GLU 172 559 559 GLU GLU A . n 
A 1 173 GLU 173 560 560 GLU GLU A . n 
A 1 174 GLN 174 561 561 GLN GLN A . n 
A 1 175 ILE 175 562 562 ILE ILE A . n 
A 1 176 LEU 176 563 563 LEU LEU A . n 
A 1 177 GLU 177 564 564 GLU GLU A . n 
A 1 178 SER 178 565 565 SER SER A . n 
A 1 179 LEU 179 566 566 LEU LEU A . n 
A 1 180 ALA 180 567 567 ALA ALA A . n 
A 1 181 TRP 181 568 568 TRP TRP A . n 
A 1 182 SER 182 569 569 SER SER A . n 
A 1 183 HIS 183 570 570 HIS HIS A . n 
A 1 184 ASP 184 571 571 ASP ASP A . n 
A 1 185 SER 185 572 572 SER SER A . n 
A 1 186 ALA 186 573 573 ALA ALA A . n 
A 1 187 LEU 187 574 574 LEU LEU A . n 
A 1 188 TRP 188 575 575 TRP TRP A . n 
A 1 189 GLU 189 576 576 GLU GLU A . n 
A 1 190 ALA 190 577 577 ALA ALA A . n 
A 1 191 LEU 191 578 578 LEU LEU A . n 
A 1 192 GLN 192 579 579 GLN GLN A . n 
A 1 193 VAL 193 580 580 VAL VAL A . n 
A 1 194 SER 194 581 581 SER SER A . n 
A 1 195 ALA 195 582 582 ALA ALA A . n 
A 1 196 ASN 196 583 583 ASN ASN A . n 
A 1 197 LYS 197 584 584 LYS LYS A . n 
A 1 198 VAL 198 585 585 VAL VAL A . n 
A 1 199 PRO 199 586 586 PRO PRO A . n 
A 1 200 THR 200 587 587 THR THR A . n 
A 1 201 CYS 201 588 588 CYS CYS A . n 
A 1 202 GLU 202 589 589 GLU GLU A . n 
A 1 203 GLU 203 590 590 GLU GLU A . n 
A 1 204 VAL 204 591 591 VAL VAL A . n 
A 1 205 ILE 205 592 592 ILE ILE A . n 
A 1 206 PHE 206 593 593 PHE PHE A . n 
A 1 207 PRO 207 594 594 PRO PRO A . n 
A 1 208 ASN 208 773 ?   ?   ?   A . n 
A 1 209 ASN 209 774 ?   ?   ?   A . n 
A 1 210 PHE 210 775 ?   ?   ?   A . n 
A 1 211 GLU 211 776 ?   ?   ?   A . n 
A 1 212 THR 212 777 ?   ?   ?   A . n 
A 1 213 GLY 213 778 ?   ?   ?   A . n 
A 1 214 ASN 214 779 ?   ?   ?   A . n 
A 1 215 ASN 215 780 780 ASN ASN A . n 
A 1 216 ARG 216 781 781 ARG ARG A . n 
A 1 217 PRO 217 782 782 PRO PRO A . n 
A 1 218 LYS 218 783 783 LYS LYS A . n 
A 1 219 ARG 219 784 784 ARG ARG A . n 
A 1 220 THR 220 785 785 THR THR A . n 
A 1 221 GLY 221 786 786 GLY GLY A . n 
A 1 222 SER 222 787 787 SER SER A . n 
A 1 223 LEU 223 788 788 LEU LEU A . n 
A 1 224 ALA 224 789 789 ALA ALA A . n 
A 1 225 LEU 225 790 790 LEU LEU A . n 
A 1 226 PHE 226 791 791 PHE PHE A . n 
A 1 227 TYR 227 792 792 TYR TYR A . n 
A 1 228 ARG 228 793 793 ARG ARG A . n 
A 1 229 LYS 229 794 794 LYS LYS A . n 
A 1 230 VAL 230 795 795 VAL VAL A . n 
A 1 231 TYR 231 796 796 TYR TYR A . n 
A 1 232 HIS 232 797 797 HIS HIS A . n 
A 1 233 LEU 233 798 798 LEU LEU A . n 
A 1 234 ALA 234 799 799 ALA ALA A . n 
A 1 235 SER 235 800 800 SER SER A . n 
A 1 236 VAL 236 801 801 VAL VAL A . n 
A 1 237 ARG 237 802 802 ARG ARG A . n 
A 1 238 LEU 238 803 803 LEU LEU A . n 
A 1 239 ARG 239 804 804 ARG ARG A . n 
A 1 240 ASP 240 805 805 ASP ASP A . n 
A 1 241 LEU 241 806 806 LEU LEU A . n 
A 1 242 CYS 242 807 807 CYS CYS A . n 
A 1 243 LEU 243 808 808 LEU LEU A . n 
A 1 244 LYS 244 809 809 LYS LYS A . n 
A 1 245 LEU 245 810 810 LEU LEU A . n 
A 1 246 ASP 246 811 811 ASP ASP A . n 
A 1 247 VAL 247 812 812 VAL VAL A . n 
A 1 248 SER 248 813 813 SER SER A . n 
A 1 249 ASN 249 814 814 ASN ASN A . n 
A 1 250 GLU 250 815 815 GLU GLU A . n 
A 1 251 LEU 251 816 816 LEU LEU A . n 
A 1 252 ARG 252 817 817 ARG ARG A . n 
A 1 253 ARG 253 818 818 ARG ARG A . n 
A 1 254 LYS 254 819 819 LYS LYS A . n 
A 1 255 ILE 255 820 820 ILE ILE A . n 
A 1 256 TRP 256 821 821 TRP TRP A . n 
A 1 257 THR 257 822 822 THR THR A . n 
A 1 258 CYS 258 823 823 CYS CYS A . n 
A 1 259 PHE 259 824 824 PHE PHE A . n 
A 1 260 GLU 260 825 825 GLU GLU A . n 
A 1 261 PHE 261 826 826 PHE PHE A . n 
A 1 262 THR 262 827 827 THR THR A . n 
A 1 263 LEU 263 828 828 LEU LEU A . n 
A 1 264 VAL 264 829 829 VAL VAL A . n 
A 1 265 HIS 265 830 830 HIS HIS A . n 
A 1 266 CYS 266 831 831 CYS CYS A . n 
A 1 267 PRO 267 832 832 PRO PRO A . n 
A 1 268 ASP 268 833 833 ASP ASP A . n 
A 1 269 LEU 269 834 834 LEU LEU A . n 
A 1 270 MET 270 835 835 MET MET A . n 
A 1 271 LYS 271 836 836 LYS LYS A . n 
A 1 272 ASP 272 837 837 ASP ASP A . n 
A 1 273 ARG 273 838 838 ARG ARG A . n 
A 1 274 HIS 274 839 839 HIS HIS A . n 
A 1 275 LEU 275 840 840 LEU LEU A . n 
A 1 276 ASP 276 841 841 ASP ASP A . n 
A 1 277 GLN 277 842 842 GLN GLN A . n 
A 1 278 LEU 278 843 843 LEU LEU A . n 
A 1 279 LEU 279 844 844 LEU LEU A . n 
A 1 280 LEU 280 845 845 LEU LEU A . n 
A 1 281 CYS 281 846 846 CYS CYS A . n 
A 1 282 ALA 282 847 847 ALA ALA A . n 
A 1 283 PHE 283 848 848 PHE PHE A . n 
A 1 284 TYR 284 849 849 TYR TYR A . n 
A 1 285 ILE 285 850 850 ILE ILE A . n 
A 1 286 MET 286 851 851 MET MET A . n 
A 1 287 ALA 287 852 852 ALA ALA A . n 
A 1 288 LYS 288 853 853 LYS LYS A . n 
A 1 289 VAL 289 854 854 VAL VAL A . n 
A 1 290 THR 290 855 855 THR THR A . n 
A 1 291 LYS 291 856 856 LYS LYS A . n 
A 1 292 GLU 292 857 857 GLU GLU A . n 
A 1 293 GLU 293 858 858 GLU GLU A . n 
A 1 294 ARG 294 859 859 ARG ARG A . n 
A 1 295 THR 295 860 860 THR THR A . n 
A 1 296 PHE 296 861 861 PHE PHE A . n 
A 1 297 GLN 297 862 862 GLN GLN A . n 
A 1 298 GLU 298 863 863 GLU GLU A . n 
A 1 299 ILE 299 864 864 ILE ILE A . n 
A 1 300 MET 300 865 865 MET MET A . n 
A 1 301 LYS 301 866 866 LYS LYS A . n 
A 1 302 SER 302 867 867 SER SER A . n 
A 1 303 TYR 303 868 868 TYR TYR A . n 
A 1 304 ARG 304 869 869 ARG ARG A . n 
A 1 305 ASN 305 870 870 ASN ASN A . n 
A 1 306 GLN 306 871 871 GLN GLN A . n 
A 1 307 PRO 307 872 872 PRO PRO A . n 
A 1 308 GLN 308 873 873 GLN GLN A . n 
A 1 309 ALA 309 874 874 ALA ALA A . n 
A 1 310 ASN 310 875 875 ASN ASN A . n 
A 1 311 SER 311 876 876 SER SER A . n 
A 1 312 HIS 312 877 877 HIS HIS A . n 
A 1 313 VAL 313 878 878 VAL VAL A . n 
A 1 314 TYR 314 879 879 TYR TYR A . n 
A 1 315 ARG 315 880 880 ARG ARG A . n 
A 1 316 SER 316 881 881 SER SER A . n 
A 1 317 VAL 317 882 882 VAL VAL A . n 
A 1 318 LEU 318 883 883 LEU LEU A . n 
A 1 319 LEU 319 884 884 LEU LEU A . n 
A 1 320 LYS 320 885 885 LYS LYS A . n 
A 1 321 SER 321 922 ?   ?   ?   A . n 
A 1 322 ILE 322 923 ?   ?   ?   A . n 
A 1 323 LYS 323 924 ?   ?   ?   A . n 
A 1 324 GLU 324 925 ?   ?   ?   A . n 
A 1 325 GLU 325 926 926 GLU GLU A . n 
A 1 326 ARG 326 927 927 ARG ARG A . n 
A 1 327 GLY 327 928 928 GLY GLY A . n 
A 1 328 ASP 328 929 929 ASP ASP A . n 
A 1 329 LEU 329 930 930 LEU LEU A . n 
A 1 330 ILE 330 931 931 ILE ILE A . n 
A 1 331 LYS 331 932 932 LYS LYS A . n 
A 1 332 PHE 332 933 933 PHE PHE A . n 
A 1 333 TYR 333 934 934 TYR TYR A . n 
A 1 334 ASN 334 935 935 ASN ASN A . n 
A 1 335 THR 335 936 936 THR THR A . n 
A 1 336 ILE 336 937 937 ILE ILE A . n 
A 1 337 TYR 337 938 938 TYR TYR A . n 
A 1 338 VAL 338 939 939 VAL VAL A . n 
A 1 339 GLY 339 940 940 GLY GLY A . n 
A 1 340 ARG 340 941 941 ARG ARG A . n 
A 1 341 VAL 341 942 942 VAL VAL A . n 
A 1 342 LYS 342 943 943 LYS LYS A . n 
A 1 343 SER 343 944 944 SER SER A . n 
A 1 344 PHE 344 945 945 PHE PHE A . n 
A 1 345 ALA 345 946 946 ALA ALA A . n 
A 1 346 LEU 346 947 947 LEU LEU A . n 
A 1 347 LYS 347 948 948 LYS LYS A . n 
A 1 348 TYR 348 949 949 TYR TYR A . n 
A 1 349 ASP 349 950 ?   ?   ?   A . n 
A 1 350 LEU 350 951 ?   ?   ?   A . n 
A 1 351 ALA 351 952 ?   ?   ?   A . n 
A 1 352 ASN 352 953 ?   ?   ?   A . n 
A 1 353 GLN 353 954 ?   ?   ?   A . n 
A 1 354 ASP 354 955 ?   ?   ?   A . n 
A 1 355 HIS 355 956 ?   ?   ?   A . n 
A 1 356 MET 356 957 ?   ?   ?   A . n 
A 1 357 MET 357 958 ?   ?   ?   A . n 
A 1 358 ASP 358 959 ?   ?   ?   A . n 
A 1 359 ALA 359 960 ?   ?   ?   A . n 
A 1 360 PRO 360 961 ?   ?   ?   A . n 
A 1 361 PRO 361 962 962 PRO PRO A . n 
A 1 362 LEU 362 963 963 LEU LEU A . n 
A 1 363 SER 363 964 964 SER SER A . n 
A 1 364 PRO 364 965 965 PRO PRO A . n 
A 1 365 PHE 365 966 966 PHE PHE A . n 
A 1 366 PRO 366 967 967 PRO PRO A . n 
A 1 367 HIS 367 968 ?   ?   ?   A . n 
A 1 368 ILE 368 969 ?   ?   ?   A . n 
A 1 369 LYS 369 970 ?   ?   ?   A . n 
A 1 370 GLN 370 971 ?   ?   ?   A . n 
A 1 371 GLN 371 972 ?   ?   ?   A . n 
B 2 1   ASP 1   21  21  ASP ASP B . n 
B 2 2   LEU 2   22  22  LEU LEU B . n 
B 2 3   TYR 3   23  23  TYR TYR B . n 
B 2 4   CYS 4   24  24  CYS CYS B . n 
B 2 5   TYR 5   25  25  TYR TYR B . n 
B 2 6   GLU 6   26  26  GLU GLU B . n 
B 2 7   GLN 7   27  27  GLN GLN B . n 
B 2 8   LEU 8   28  28  LEU LEU B . n 
B 2 9   ASN 9   29  29  ASN ASN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1   1001 1   SO4 SO4 A . 
D 3 SO4 1   1002 3   SO4 SO4 A . 
E 3 SO4 1   1003 4   SO4 SO4 A . 
F 3 SO4 1   1004 5   SO4 SO4 A . 
G 4 HOH 1   1101 111 HOH HOH A . 
G 4 HOH 2   1102 118 HOH HOH A . 
G 4 HOH 3   1103 78  HOH HOH A . 
G 4 HOH 4   1104 29  HOH HOH A . 
G 4 HOH 5   1105 41  HOH HOH A . 
G 4 HOH 6   1106 16  HOH HOH A . 
G 4 HOH 7   1107 34  HOH HOH A . 
G 4 HOH 8   1108 40  HOH HOH A . 
G 4 HOH 9   1109 1   HOH HOH A . 
G 4 HOH 10  1110 14  HOH HOH A . 
G 4 HOH 11  1111 17  HOH HOH A . 
G 4 HOH 12  1112 28  HOH HOH A . 
G 4 HOH 13  1113 3   HOH HOH A . 
G 4 HOH 14  1114 122 HOH HOH A . 
G 4 HOH 15  1115 5   HOH HOH A . 
G 4 HOH 16  1116 23  HOH HOH A . 
G 4 HOH 17  1117 42  HOH HOH A . 
G 4 HOH 18  1118 73  HOH HOH A . 
G 4 HOH 19  1119 7   HOH HOH A . 
G 4 HOH 20  1120 121 HOH HOH A . 
G 4 HOH 21  1121 108 HOH HOH A . 
G 4 HOH 22  1122 71  HOH HOH A . 
G 4 HOH 23  1123 38  HOH HOH A . 
G 4 HOH 24  1124 10  HOH HOH A . 
G 4 HOH 25  1125 6   HOH HOH A . 
G 4 HOH 26  1126 36  HOH HOH A . 
G 4 HOH 27  1127 11  HOH HOH A . 
G 4 HOH 28  1128 27  HOH HOH A . 
G 4 HOH 29  1129 120 HOH HOH A . 
G 4 HOH 30  1130 94  HOH HOH A . 
G 4 HOH 31  1131 22  HOH HOH A . 
G 4 HOH 32  1132 90  HOH HOH A . 
G 4 HOH 33  1133 33  HOH HOH A . 
G 4 HOH 34  1134 51  HOH HOH A . 
G 4 HOH 35  1135 20  HOH HOH A . 
G 4 HOH 36  1136 65  HOH HOH A . 
G 4 HOH 37  1137 19  HOH HOH A . 
G 4 HOH 38  1138 72  HOH HOH A . 
G 4 HOH 39  1139 57  HOH HOH A . 
G 4 HOH 40  1140 88  HOH HOH A . 
G 4 HOH 41  1141 24  HOH HOH A . 
G 4 HOH 42  1142 93  HOH HOH A . 
G 4 HOH 43  1143 50  HOH HOH A . 
G 4 HOH 44  1144 63  HOH HOH A . 
G 4 HOH 45  1145 46  HOH HOH A . 
G 4 HOH 46  1146 4   HOH HOH A . 
G 4 HOH 47  1147 9   HOH HOH A . 
G 4 HOH 48  1148 58  HOH HOH A . 
G 4 HOH 49  1149 79  HOH HOH A . 
G 4 HOH 50  1150 2   HOH HOH A . 
G 4 HOH 51  1151 56  HOH HOH A . 
G 4 HOH 52  1152 31  HOH HOH A . 
G 4 HOH 53  1153 112 HOH HOH A . 
G 4 HOH 54  1154 25  HOH HOH A . 
G 4 HOH 55  1155 12  HOH HOH A . 
G 4 HOH 56  1156 49  HOH HOH A . 
G 4 HOH 57  1157 53  HOH HOH A . 
G 4 HOH 58  1158 62  HOH HOH A . 
G 4 HOH 59  1159 109 HOH HOH A . 
G 4 HOH 60  1160 26  HOH HOH A . 
G 4 HOH 61  1161 21  HOH HOH A . 
G 4 HOH 62  1162 39  HOH HOH A . 
G 4 HOH 63  1163 18  HOH HOH A . 
G 4 HOH 64  1164 83  HOH HOH A . 
G 4 HOH 65  1165 45  HOH HOH A . 
G 4 HOH 66  1166 81  HOH HOH A . 
G 4 HOH 67  1167 96  HOH HOH A . 
G 4 HOH 68  1168 52  HOH HOH A . 
G 4 HOH 69  1169 82  HOH HOH A . 
G 4 HOH 70  1170 55  HOH HOH A . 
G 4 HOH 71  1171 35  HOH HOH A . 
G 4 HOH 72  1172 67  HOH HOH A . 
G 4 HOH 73  1173 74  HOH HOH A . 
G 4 HOH 74  1174 44  HOH HOH A . 
G 4 HOH 75  1175 43  HOH HOH A . 
G 4 HOH 76  1176 110 HOH HOH A . 
G 4 HOH 77  1177 132 HOH HOH A . 
G 4 HOH 78  1178 76  HOH HOH A . 
G 4 HOH 79  1179 61  HOH HOH A . 
G 4 HOH 80  1180 32  HOH HOH A . 
G 4 HOH 81  1181 128 HOH HOH A . 
G 4 HOH 82  1182 125 HOH HOH A . 
G 4 HOH 83  1183 15  HOH HOH A . 
G 4 HOH 84  1184 114 HOH HOH A . 
G 4 HOH 85  1185 47  HOH HOH A . 
G 4 HOH 86  1186 135 HOH HOH A . 
G 4 HOH 87  1187 138 HOH HOH A . 
G 4 HOH 88  1188 130 HOH HOH A . 
G 4 HOH 89  1189 124 HOH HOH A . 
G 4 HOH 90  1190 126 HOH HOH A . 
G 4 HOH 91  1191 60  HOH HOH A . 
G 4 HOH 92  1192 136 HOH HOH A . 
G 4 HOH 93  1193 70  HOH HOH A . 
G 4 HOH 94  1194 75  HOH HOH A . 
G 4 HOH 95  1195 137 HOH HOH A . 
G 4 HOH 96  1196 2   HOH HOH A . 
G 4 HOH 97  1197 4   HOH HOH A . 
G 4 HOH 98  1198 140 HOH HOH A . 
G 4 HOH 99  1199 139 HOH HOH A . 
G 4 HOH 100 1200 68  HOH HOH A . 
G 4 HOH 101 1201 131 HOH HOH A . 
G 4 HOH 102 1202 3   HOH HOH A . 
G 4 HOH 103 1203 30  HOH HOH A . 
G 4 HOH 104 1204 69  HOH HOH A . 
G 4 HOH 105 1205 64  HOH HOH A . 
G 4 HOH 106 1206 129 HOH HOH A . 
G 4 HOH 107 1207 37  HOH HOH A . 
G 4 HOH 108 1208 133 HOH HOH A . 
G 4 HOH 109 1209 127 HOH HOH A . 
G 4 HOH 110 1210 1   HOH HOH A . 
H 4 HOH 1   101  134 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1800  ? 
1 MORE         -60   ? 
1 'SSA (A^2)'  17490 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1186 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   G 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-06-24 
2 'Structure model' 1 1 2015-09-09 
3 'Structure model' 1 2 2017-09-20 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2019-12-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Other                        
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Derived calculations'       
4 3 'Structure model' 'Refinement description'     
5 4 'Structure model' 'Data collection'            
6 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_audit_support    
2 3 'Structure model' pdbx_struct_oper_list 
3 3 'Structure model' software              
4 4 'Structure model' diffrn_detector       
5 5 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_audit_support.funding_organization'  
2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 3 'Structure model' '_software.classification'                  
4 4 'Structure model' '_diffrn_detector.detector'                 
5 5 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 21.2829 11.1822 -7.4632 0.1667 ? 0.0247 ? 0.0350  ? 0.1722 ? -0.0480 ? 0.1881 ? 2.6840 ? 0.5565  ? 
0.1479  ? 2.2978 ? -0.4642 ? 2.1273 ? -0.0333 ? 0.1380  ? -0.1063 ? -0.2403 ? 0.0993  ? -0.3699 ? 0.1134  ? 0.1656 ? -0.0635 ? 
2 'X-RAY DIFFRACTION' ? refined 15.9673 11.9036 2.9397  0.1237 ? 0.0146 ? -0.0085 ? 0.1428 ? -0.0015 ? 0.1481 ? 1.3504 ? 0.0657  ? 
-0.3262 ? 0.9784 ? -0.0882 ? 0.9824 ? -0.0590 ? -0.1137 ? -0.1344 ? 0.0172  ? 0.0371  ? -0.2003 ? 0.0396  ? 0.1074 ? 0.0229  ? 
3 'X-RAY DIFFRACTION' ? refined -1.0090 5.9654  18.7161 0.4941 ? 0.0107 ? 0.0291  ? 0.4125 ? 0.1503  ? 0.2530 ? 3.9279 ? 0.0752  ? 
2.4625  ? 1.8547 ? 0.9051  ? 1.9792 ? 0.1523  ? -0.1986 ? -0.4561 ? 0.0468  ? -0.2101 ? -0.3450 ? 0.7875  ? 0.2527 ? 0.0621  ? 
4 'X-RAY DIFFRACTION' ? refined 5.0701  25.7846 25.9786 0.3001 ? 0.0282 ? -0.0387 ? 0.3472 ? -0.0937 ? 0.2295 ? 1.6811 ? -0.0157 ? 
-0.0842 ? 2.1558 ? 0.7572  ? 2.4673 ? -0.0751 ? -0.6001 ? 0.2780  ? 0.4616  ? 0.0188  ? -0.1134 ? -0.2789 ? 0.0376 ? 0.0482  ? 
5 'X-RAY DIFFRACTION' ? refined 0.8287  40.7124 30.0641 0.4110 ? 0.1062 ? -0.0785 ? 0.7452 ? -0.3794 ? 0.5983 ? 3.0469 ? -3.0063 ? 
2.2309  ? 6.9373 ? 1.9532  ? 5.9791 ? -0.0332 ? 0.1296  ? 0.0971  ? -0.1143 ? -0.0737 ? -0.2589 ? 0.0474  ? 0.3753 ? 0.0841  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 389 through 453 )
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 454 through 580 )
;
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 581 through 784 )
;
4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 785 through 967 )
;
5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 21 through 29 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.8.4_1496 1 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot    ? ? ? .          2 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice ? ? ? .          3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? .          4 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA   ? ? ? .          5 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .          6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    1170 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1172 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A PRO 594 ? ? N  A PRO 594 ? ? CD A PRO 594 ? ? 99.44  111.70 -12.26 1.40 N 
2 1 CA B LEU 28  ? ? CB B LEU 28  ? ? CG B LEU 28  ? ? 131.63 115.30 16.33  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 447 ? ? 79.21   -21.01 
2 1 PRO A 520 ? ? -89.54  44.31  
3 1 SER A 565 ? ? -136.05 -60.18 
4 1 ARG A 784 ? ? 80.42   -1.17  
5 1 ASP A 811 ? ? 44.09   72.27  
6 1 LEU A 884 ? ? -100.15 -63.59 
7 1 ILE A 937 ? ? -128.88 -63.32 
8 1 LEU A 947 ? ? -45.35  -8.61  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 885 ? CG ? A LYS 320 CG 
2 1 Y 1 A LYS 885 ? CD ? A LYS 320 CD 
3 1 Y 1 A LYS 885 ? CE ? A LYS 320 CE 
4 1 Y 1 A LYS 885 ? NZ ? A LYS 320 NZ 
5 1 Y 1 A LYS 948 ? CG ? A LYS 347 CG 
6 1 Y 1 A LYS 948 ? CD ? A LYS 347 CD 
7 1 Y 1 A LYS 948 ? CE ? A LYS 347 CE 
8 1 Y 1 A LYS 948 ? NZ ? A LYS 347 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 388 ? A GLY 1   
2  1 Y 1 A ASN 773 ? A ASN 208 
3  1 Y 1 A ASN 774 ? A ASN 209 
4  1 Y 1 A PHE 775 ? A PHE 210 
5  1 Y 1 A GLU 776 ? A GLU 211 
6  1 Y 1 A THR 777 ? A THR 212 
7  1 Y 1 A GLY 778 ? A GLY 213 
8  1 Y 1 A ASN 779 ? A ASN 214 
9  1 Y 1 A SER 922 ? A SER 321 
10 1 Y 1 A ILE 923 ? A ILE 322 
11 1 Y 1 A LYS 924 ? A LYS 323 
12 1 Y 1 A GLU 925 ? A GLU 324 
13 1 Y 1 A ASP 950 ? A ASP 349 
14 1 Y 1 A LEU 951 ? A LEU 350 
15 1 Y 1 A ALA 952 ? A ALA 351 
16 1 Y 1 A ASN 953 ? A ASN 352 
17 1 Y 1 A GLN 954 ? A GLN 353 
18 1 Y 1 A ASP 955 ? A ASP 354 
19 1 Y 1 A HIS 956 ? A HIS 355 
20 1 Y 1 A MET 957 ? A MET 356 
21 1 Y 1 A MET 958 ? A MET 357 
22 1 Y 1 A ASP 959 ? A ASP 358 
23 1 Y 1 A ALA 960 ? A ALA 359 
24 1 Y 1 A PRO 961 ? A PRO 360 
25 1 Y 1 A HIS 968 ? A HIS 367 
26 1 Y 1 A ILE 969 ? A ILE 368 
27 1 Y 1 A LYS 970 ? A LYS 369 
28 1 Y 1 A GLN 971 ? A GLN 370 
29 1 Y 1 A GLN 972 ? A GLN 371 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health/National Cancer Institute (NIH/NCI)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01CA132685 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#