data_5A0Q
# 
_entry.id   5A0Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5A0Q         
PDBE  EBI-63660    
WWPDB D_1290063660 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.db_id          EMD-2981 
_pdbx_database_related.content_type   'associated EM volume' 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5A0Q 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'daFonseca, P.C.A.' 1 
'Morris, E.P.'      2 
# 
_citation.id                        primary 
_citation.title                     'Cryo-Em Reveals the Conformation of a Substrate Analogue in the Human 20S Proteasome Core.' 
_citation.journal_abbrev            Nat.Commun. 
_citation.journal_volume            6 
_citation.page_first                7573 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26133119 
_citation.pdbx_database_id_DOI      10.1038/NCOMMS8573 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Da Fonseca, P.C.A.' 1 
primary 'Morris, E.P.'       2 
# 
_cell.entry_id           5A0Q 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5A0Q 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'PROTEASOME SUBUNIT ALPHA TYPE-6' 27432.459 2 3.4.25.1 ? ? ? 
2  polymer     nat 'PROTEASOME SUBUNIT ALPHA TYPE-2' 25927.535 2 3.4.25.1 ? ? ? 
3  polymer     nat 'PROTEASOME SUBUNIT ALPHA TYPE-4' 29525.842 2 3.4.25.1 ? ? ? 
4  polymer     nat 'PROTEASOME SUBUNIT ALPHA TYPE-7' 27929.891 2 3.4.25.1 ? ? ? 
5  polymer     nat 'PROTEASOME SUBUNIT ALPHA TYPE-5' 26435.977 2 3.4.25.1 ? ? ? 
6  polymer     nat 'PROTEASOME SUBUNIT ALPHA TYPE-1' 29595.627 2 3.4.25.1 ? ? ? 
7  polymer     nat 'PROTEASOME SUBUNIT ALPHA TYPE-3' 28469.252 2 3.4.25.1 ? ? ? 
8  polymer     nat 'PROTEASOME SUBUNIT BETA TYPE-6'  21921.836 2 3.4.25.1 ? ? 
'SUBUNIT PARTIALLY BOUND TO THE INHIBITOR ADAMANTANE-ACETYL-(6-AMINOHEXANOYL)3-(LEUCINYL)3-VINYL-(METHYL)-SULFONE (ADAAHX3L3VS)' 
9  polymer     nat 'PROTEASOME SUBUNIT BETA TYPE-7'  25321.980 2 3.4.25.1 ? ? 
'SUBUNIT PARTIALLY BOUND TO THE INHIBITOR ADAMANTANE-ACETYL-(6-AMINOHEXANOYL)3-(LEUCINYL)3-VINYL-(METHYL)-SULFONE (ADAAHX3L3VS)' 
10 polymer     nat 'PROTEASOME SUBUNIT BETA TYPE-3'  22841.701 2 3.4.25.1 ? ? ? 
11 polymer     nat 'PROTEASOME SUBUNIT BETA TYPE-2'  22864.277 2 3.4.25.1 ? ? ? 
12 polymer     nat 'PROTEASOME SUBUNIT BETA TYPE-5'  22484.369 2 3.4.25.1 ? ? 
'SUBUNIT BOUND TO THE INHIBITOR ADAMANTANE-ACETYL-(6-AMINOHEXANOYL)3-(LEUCINYL)3-VINYL-(METHYL)-SULFONE (ADAAHX3L3VS)'           
13 polymer     nat 'PROTEASOME SUBUNIT BETA TYPE-1'  23578.986 2 3.4.25.1 ? ? ? 
14 polymer     nat 'PROTEASOME SUBUNIT BETA TYPE-4'  24414.740 2 3.4.25.1 ? ? ? 
15 non-polymer syn 'ADA-(AHX)3-(LEU)3-VINYL SULFONE' 949.377   6 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  '27 KDA PROSOMAL PROTEIN, P27K, MACROPAIN IOTA CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX IOTA CHAIN, PROTEASOME IOTA CHAIN' 
2  'MACROPAIN SUBUNIT C3, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C3, PROTEASOME COMPONENT C3' 
3  'MACROPAIN SUBUNIT C9, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C9, PROTEASOME COMPONENT C9, PROTEASOME SUBUNIT L' 
4  'PROTEASOME SUBUNIT RC6-1, PROTEASOME SUBUNIT XAPC7' 
5  'MACROPAIN ZETA CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX ZETA CHAIN, PROTEASOME ZETA CHAIN' 
6  
;30 KDA PROSOMAL PROTEIN, PROS-30, MACROPAIN SUBUNIT C2, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C2, PROTEASOME COMPONENT C2, PROTEASOME NU CHAIN
;
7  'MACROPAIN SUBUNIT C8, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C8, PROTEASOME COMPONENT C8' 
8  'MACROPAIN DELTA CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX DELTA CHAIN, PROTEASOME DELTA CHAIN, PROTEASOME SUBUNIT Y' 
9  'MACROPAIN CHAIN Z, MULTICATALYTIC ENDOPEPTIDASE COMPLEX CHAIN Z, PROTEASOME SUBUNIT Z' 
10 'PROTEASOME CHAIN 13, PROTEASOME COMPONENT C10-II, PROTEASOME THETA CHAIN' 
11 'MACROPAIN SUBUNIT C7-I, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C7-I, PROTEASOME COMPONENT C7-I' 
12 
;MACROPAIN EPSILON CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX EPSILON CHAIN, PROTEASOME CHAIN 6, PROTEASOME EPSILON CHAIN, PROTEASOME SUBUNIT MB1, PROTEASOME SUBUNIT X
;
13 'MACROPAIN SUBUNIT C5, MULTICATALYTIC ENDOPEPTIDASE COMPLEX SUBUNIT C5, PROTEASOME COMPONENT C5, PROTEASOME GAMMA CHAIN' 
14 
;26 KDA PROSOMAL PROTEIN, PROS-26, MACROPAIN BETA CHAIN, MULTICATALYTIC ENDOPEPTIDASE COMPLEX BETA CHAIN, PROTEASOME BETA CHAIN, PROTEASOME CHAIN 3, HSN3
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVM
TGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYY
CGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
;
;MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVM
TGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYY
CGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
;
A,O ? 
2  'polypeptide(L)' no no 
;MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG
PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKA
TAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
;
;MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG
PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKA
TAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
;
B,P ? 
3  'polypeptide(L)' no no 
;MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGIT
SDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWK
ATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
;
;MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGIT
SDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWK
ATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK
;
C,Q ? 
4  'polypeptide(L)' no no 
;MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADA
RIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANA
IGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
;
;MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADA
RIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANA
IGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
;
D,R ? 
5  'polypeptide(L)' no no 
;MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG
LIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG
TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
;
;MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSG
LIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG
TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
;
E,S ? 
6  'polypeptide(L)' no no 
;MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTAD
ARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
IGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
;
;MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTAD
ARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
IGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
;
F,T ? 
7  'polypeptide(L)' no no 
;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG
LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYG
YWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
;
;MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG
LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYG
YWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
;
G,U ? 
8  'polypeptide(L)' no no 
;TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAA
SLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANAL
ALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA
;
;TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAA
SLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANAL
ALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA
;
H,V ? 
9  'polypeptide(L)' no no 
;TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTAN
RMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIA
AGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
;
;TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTAN
RMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIA
AGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
;
I,W ? 
10 'polypeptide(L)' no no 
;SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQ
IKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPD
HLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
;
;SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQ
IKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPD
HLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
;
J,X ? 
11 'polypeptide(L)' no no 
;MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA
ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL
RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
;
;MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA
ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL
RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
;
K,Y ? 
12 'polypeptide(L)' no no 
;TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAAS
KLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAI
YQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP
;
;TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAAS
KLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAI
YQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP
;
L,Z ? 
13 'polypeptide(L)' no no 
;RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNN
KAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQN
VEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
;
;RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNN
KAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQN
VEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
;
M,a ? 
14 'polypeptide(L)' no no 
;TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDG
HSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVL
SQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
;
;TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDG
HSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVL
SQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
;
N,b ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   SER n 
1  3   ARG n 
1  4   GLY n 
1  5   SER n 
1  6   SER n 
1  7   ALA n 
1  8   GLY n 
1  9   PHE n 
1  10  ASP n 
1  11  ARG n 
1  12  HIS n 
1  13  ILE n 
1  14  THR n 
1  15  ILE n 
1  16  PHE n 
1  17  SER n 
1  18  PRO n 
1  19  GLU n 
1  20  GLY n 
1  21  ARG n 
1  22  LEU n 
1  23  TYR n 
1  24  GLN n 
1  25  VAL n 
1  26  GLU n 
1  27  TYR n 
1  28  ALA n 
1  29  PHE n 
1  30  LYS n 
1  31  ALA n 
1  32  ILE n 
1  33  ASN n 
1  34  GLN n 
1  35  GLY n 
1  36  GLY n 
1  37  LEU n 
1  38  THR n 
1  39  SER n 
1  40  VAL n 
1  41  ALA n 
1  42  VAL n 
1  43  ARG n 
1  44  GLY n 
1  45  LYS n 
1  46  ASP n 
1  47  CYS n 
1  48  ALA n 
1  49  VAL n 
1  50  ILE n 
1  51  VAL n 
1  52  THR n 
1  53  GLN n 
1  54  LYS n 
1  55  LYS n 
1  56  VAL n 
1  57  PRO n 
1  58  ASP n 
1  59  LYS n 
1  60  LEU n 
1  61  LEU n 
1  62  ASP n 
1  63  SER n 
1  64  SER n 
1  65  THR n 
1  66  VAL n 
1  67  THR n 
1  68  HIS n 
1  69  LEU n 
1  70  PHE n 
1  71  LYS n 
1  72  ILE n 
1  73  THR n 
1  74  GLU n 
1  75  ASN n 
1  76  ILE n 
1  77  GLY n 
1  78  CYS n 
1  79  VAL n 
1  80  MET n 
1  81  THR n 
1  82  GLY n 
1  83  MET n 
1  84  THR n 
1  85  ALA n 
1  86  ASP n 
1  87  SER n 
1  88  ARG n 
1  89  SER n 
1  90  GLN n 
1  91  VAL n 
1  92  GLN n 
1  93  ARG n 
1  94  ALA n 
1  95  ARG n 
1  96  TYR n 
1  97  GLU n 
1  98  ALA n 
1  99  ALA n 
1  100 ASN n 
1  101 TRP n 
1  102 LYS n 
1  103 TYR n 
1  104 LYS n 
1  105 TYR n 
1  106 GLY n 
1  107 TYR n 
1  108 GLU n 
1  109 ILE n 
1  110 PRO n 
1  111 VAL n 
1  112 ASP n 
1  113 MET n 
1  114 LEU n 
1  115 CYS n 
1  116 LYS n 
1  117 ARG n 
1  118 ILE n 
1  119 ALA n 
1  120 ASP n 
1  121 ILE n 
1  122 SER n 
1  123 GLN n 
1  124 VAL n 
1  125 TYR n 
1  126 THR n 
1  127 GLN n 
1  128 ASN n 
1  129 ALA n 
1  130 GLU n 
1  131 MET n 
1  132 ARG n 
1  133 PRO n 
1  134 LEU n 
1  135 GLY n 
1  136 CYS n 
1  137 CYS n 
1  138 MET n 
1  139 ILE n 
1  140 LEU n 
1  141 ILE n 
1  142 GLY n 
1  143 ILE n 
1  144 ASP n 
1  145 GLU n 
1  146 GLU n 
1  147 GLN n 
1  148 GLY n 
1  149 PRO n 
1  150 GLN n 
1  151 VAL n 
1  152 TYR n 
1  153 LYS n 
1  154 CYS n 
1  155 ASP n 
1  156 PRO n 
1  157 ALA n 
1  158 GLY n 
1  159 TYR n 
1  160 TYR n 
1  161 CYS n 
1  162 GLY n 
1  163 PHE n 
1  164 LYS n 
1  165 ALA n 
1  166 THR n 
1  167 ALA n 
1  168 ALA n 
1  169 GLY n 
1  170 VAL n 
1  171 LYS n 
1  172 GLN n 
1  173 THR n 
1  174 GLU n 
1  175 SER n 
1  176 THR n 
1  177 SER n 
1  178 PHE n 
1  179 LEU n 
1  180 GLU n 
1  181 LYS n 
1  182 LYS n 
1  183 VAL n 
1  184 LYS n 
1  185 LYS n 
1  186 LYS n 
1  187 PHE n 
1  188 ASP n 
1  189 TRP n 
1  190 THR n 
1  191 PHE n 
1  192 GLU n 
1  193 GLN n 
1  194 THR n 
1  195 VAL n 
1  196 GLU n 
1  197 THR n 
1  198 ALA n 
1  199 ILE n 
1  200 THR n 
1  201 CYS n 
1  202 LEU n 
1  203 SER n 
1  204 THR n 
1  205 VAL n 
1  206 LEU n 
1  207 SER n 
1  208 ILE n 
1  209 ASP n 
1  210 PHE n 
1  211 LYS n 
1  212 PRO n 
1  213 SER n 
1  214 GLU n 
1  215 ILE n 
1  216 GLU n 
1  217 VAL n 
1  218 GLY n 
1  219 VAL n 
1  220 VAL n 
1  221 THR n 
1  222 VAL n 
1  223 GLU n 
1  224 ASN n 
1  225 PRO n 
1  226 LYS n 
1  227 PHE n 
1  228 ARG n 
1  229 ILE n 
1  230 LEU n 
1  231 THR n 
1  232 GLU n 
1  233 ALA n 
1  234 GLU n 
1  235 ILE n 
1  236 ASP n 
1  237 ALA n 
1  238 HIS n 
1  239 LEU n 
1  240 VAL n 
1  241 ALA n 
1  242 LEU n 
1  243 ALA n 
1  244 GLU n 
1  245 ARG n 
1  246 ASP n 
2  1   MET n 
2  2   ALA n 
2  3   GLU n 
2  4   ARG n 
2  5   GLY n 
2  6   TYR n 
2  7   SER n 
2  8   PHE n 
2  9   SER n 
2  10  LEU n 
2  11  THR n 
2  12  THR n 
2  13  PHE n 
2  14  SER n 
2  15  PRO n 
2  16  SER n 
2  17  GLY n 
2  18  LYS n 
2  19  LEU n 
2  20  VAL n 
2  21  GLN n 
2  22  ILE n 
2  23  GLU n 
2  24  TYR n 
2  25  ALA n 
2  26  LEU n 
2  27  ALA n 
2  28  ALA n 
2  29  VAL n 
2  30  ALA n 
2  31  GLY n 
2  32  GLY n 
2  33  ALA n 
2  34  PRO n 
2  35  SER n 
2  36  VAL n 
2  37  GLY n 
2  38  ILE n 
2  39  LYS n 
2  40  ALA n 
2  41  ALA n 
2  42  ASN n 
2  43  GLY n 
2  44  VAL n 
2  45  VAL n 
2  46  LEU n 
2  47  ALA n 
2  48  THR n 
2  49  GLU n 
2  50  LYS n 
2  51  LYS n 
2  52  GLN n 
2  53  LYS n 
2  54  SER n 
2  55  ILE n 
2  56  LEU n 
2  57  TYR n 
2  58  ASP n 
2  59  GLU n 
2  60  ARG n 
2  61  SER n 
2  62  VAL n 
2  63  HIS n 
2  64  LYS n 
2  65  VAL n 
2  66  GLU n 
2  67  PRO n 
2  68  ILE n 
2  69  THR n 
2  70  LYS n 
2  71  HIS n 
2  72  ILE n 
2  73  GLY n 
2  74  LEU n 
2  75  VAL n 
2  76  TYR n 
2  77  SER n 
2  78  GLY n 
2  79  MET n 
2  80  GLY n 
2  81  PRO n 
2  82  ASP n 
2  83  TYR n 
2  84  ARG n 
2  85  VAL n 
2  86  LEU n 
2  87  VAL n 
2  88  HIS n 
2  89  ARG n 
2  90  ALA n 
2  91  ARG n 
2  92  LYS n 
2  93  LEU n 
2  94  ALA n 
2  95  GLN n 
2  96  GLN n 
2  97  TYR n 
2  98  TYR n 
2  99  LEU n 
2  100 VAL n 
2  101 TYR n 
2  102 GLN n 
2  103 GLU n 
2  104 PRO n 
2  105 ILE n 
2  106 PRO n 
2  107 THR n 
2  108 ALA n 
2  109 GLN n 
2  110 LEU n 
2  111 VAL n 
2  112 GLN n 
2  113 ARG n 
2  114 VAL n 
2  115 ALA n 
2  116 SER n 
2  117 VAL n 
2  118 MET n 
2  119 GLN n 
2  120 GLU n 
2  121 TYR n 
2  122 THR n 
2  123 GLN n 
2  124 SER n 
2  125 GLY n 
2  126 GLY n 
2  127 VAL n 
2  128 ARG n 
2  129 PRO n 
2  130 PHE n 
2  131 GLY n 
2  132 VAL n 
2  133 SER n 
2  134 LEU n 
2  135 LEU n 
2  136 ILE n 
2  137 CYS n 
2  138 GLY n 
2  139 TRP n 
2  140 ASN n 
2  141 GLU n 
2  142 GLY n 
2  143 ARG n 
2  144 PRO n 
2  145 TYR n 
2  146 LEU n 
2  147 PHE n 
2  148 GLN n 
2  149 SER n 
2  150 ASP n 
2  151 PRO n 
2  152 SER n 
2  153 GLY n 
2  154 ALA n 
2  155 TYR n 
2  156 PHE n 
2  157 ALA n 
2  158 TRP n 
2  159 LYS n 
2  160 ALA n 
2  161 THR n 
2  162 ALA n 
2  163 MET n 
2  164 GLY n 
2  165 LYS n 
2  166 ASN n 
2  167 TYR n 
2  168 VAL n 
2  169 ASN n 
2  170 GLY n 
2  171 LYS n 
2  172 THR n 
2  173 PHE n 
2  174 LEU n 
2  175 GLU n 
2  176 LYS n 
2  177 ARG n 
2  178 TYR n 
2  179 ASN n 
2  180 GLU n 
2  181 ASP n 
2  182 LEU n 
2  183 GLU n 
2  184 LEU n 
2  185 GLU n 
2  186 ASP n 
2  187 ALA n 
2  188 ILE n 
2  189 HIS n 
2  190 THR n 
2  191 ALA n 
2  192 ILE n 
2  193 LEU n 
2  194 THR n 
2  195 LEU n 
2  196 LYS n 
2  197 GLU n 
2  198 SER n 
2  199 PHE n 
2  200 GLU n 
2  201 GLY n 
2  202 GLN n 
2  203 MET n 
2  204 THR n 
2  205 GLU n 
2  206 ASP n 
2  207 ASN n 
2  208 ILE n 
2  209 GLU n 
2  210 VAL n 
2  211 GLY n 
2  212 ILE n 
2  213 CYS n 
2  214 ASN n 
2  215 GLU n 
2  216 ALA n 
2  217 GLY n 
2  218 PHE n 
2  219 ARG n 
2  220 ARG n 
2  221 LEU n 
2  222 THR n 
2  223 PRO n 
2  224 THR n 
2  225 GLU n 
2  226 VAL n 
2  227 LYS n 
2  228 ASP n 
2  229 TYR n 
2  230 LEU n 
2  231 ALA n 
2  232 ALA n 
2  233 ILE n 
2  234 ALA n 
3  1   MET n 
3  2   SER n 
3  3   ARG n 
3  4   ARG n 
3  5   TYR n 
3  6   ASP n 
3  7   SER n 
3  8   ARG n 
3  9   THR n 
3  10  THR n 
3  11  ILE n 
3  12  PHE n 
3  13  SER n 
3  14  PRO n 
3  15  GLU n 
3  16  GLY n 
3  17  ARG n 
3  18  LEU n 
3  19  TYR n 
3  20  GLN n 
3  21  VAL n 
3  22  GLU n 
3  23  TYR n 
3  24  ALA n 
3  25  MET n 
3  26  GLU n 
3  27  ALA n 
3  28  ILE n 
3  29  GLY n 
3  30  HIS n 
3  31  ALA n 
3  32  GLY n 
3  33  THR n 
3  34  CYS n 
3  35  LEU n 
3  36  GLY n 
3  37  ILE n 
3  38  LEU n 
3  39  ALA n 
3  40  ASN n 
3  41  ASP n 
3  42  GLY n 
3  43  VAL n 
3  44  LEU n 
3  45  LEU n 
3  46  ALA n 
3  47  ALA n 
3  48  GLU n 
3  49  ARG n 
3  50  ARG n 
3  51  ASN n 
3  52  ILE n 
3  53  HIS n 
3  54  LYS n 
3  55  LEU n 
3  56  LEU n 
3  57  ASP n 
3  58  GLU n 
3  59  VAL n 
3  60  PHE n 
3  61  PHE n 
3  62  SER n 
3  63  GLU n 
3  64  LYS n 
3  65  ILE n 
3  66  TYR n 
3  67  LYS n 
3  68  LEU n 
3  69  ASN n 
3  70  GLU n 
3  71  ASP n 
3  72  MET n 
3  73  ALA n 
3  74  CYS n 
3  75  SER n 
3  76  VAL n 
3  77  ALA n 
3  78  GLY n 
3  79  ILE n 
3  80  THR n 
3  81  SER n 
3  82  ASP n 
3  83  ALA n 
3  84  ASN n 
3  85  VAL n 
3  86  LEU n 
3  87  THR n 
3  88  ASN n 
3  89  GLU n 
3  90  LEU n 
3  91  ARG n 
3  92  LEU n 
3  93  ILE n 
3  94  ALA n 
3  95  GLN n 
3  96  ARG n 
3  97  TYR n 
3  98  LEU n 
3  99  LEU n 
3  100 GLN n 
3  101 TYR n 
3  102 GLN n 
3  103 GLU n 
3  104 PRO n 
3  105 ILE n 
3  106 PRO n 
3  107 CYS n 
3  108 GLU n 
3  109 GLN n 
3  110 LEU n 
3  111 VAL n 
3  112 THR n 
3  113 ALA n 
3  114 LEU n 
3  115 CYS n 
3  116 ASP n 
3  117 ILE n 
3  118 LYS n 
3  119 GLN n 
3  120 ALA n 
3  121 TYR n 
3  122 THR n 
3  123 GLN n 
3  124 PHE n 
3  125 GLY n 
3  126 GLY n 
3  127 LYS n 
3  128 ARG n 
3  129 PRO n 
3  130 PHE n 
3  131 GLY n 
3  132 VAL n 
3  133 SER n 
3  134 LEU n 
3  135 LEU n 
3  136 TYR n 
3  137 ILE n 
3  138 GLY n 
3  139 TRP n 
3  140 ASP n 
3  141 LYS n 
3  142 HIS n 
3  143 TYR n 
3  144 GLY n 
3  145 PHE n 
3  146 GLN n 
3  147 LEU n 
3  148 TYR n 
3  149 GLN n 
3  150 SER n 
3  151 ASP n 
3  152 PRO n 
3  153 SER n 
3  154 GLY n 
3  155 ASN n 
3  156 TYR n 
3  157 GLY n 
3  158 GLY n 
3  159 TRP n 
3  160 LYS n 
3  161 ALA n 
3  162 THR n 
3  163 CYS n 
3  164 ILE n 
3  165 GLY n 
3  166 ASN n 
3  167 ASN n 
3  168 SER n 
3  169 ALA n 
3  170 ALA n 
3  171 ALA n 
3  172 VAL n 
3  173 SER n 
3  174 MET n 
3  175 LEU n 
3  176 LYS n 
3  177 GLN n 
3  178 ASP n 
3  179 TYR n 
3  180 LYS n 
3  181 GLU n 
3  182 GLY n 
3  183 GLU n 
3  184 MET n 
3  185 THR n 
3  186 LEU n 
3  187 LYS n 
3  188 SER n 
3  189 ALA n 
3  190 LEU n 
3  191 ALA n 
3  192 LEU n 
3  193 ALA n 
3  194 ILE n 
3  195 LYS n 
3  196 VAL n 
3  197 LEU n 
3  198 ASN n 
3  199 LYS n 
3  200 THR n 
3  201 MET n 
3  202 ASP n 
3  203 VAL n 
3  204 SER n 
3  205 LYS n 
3  206 LEU n 
3  207 SER n 
3  208 ALA n 
3  209 GLU n 
3  210 LYS n 
3  211 VAL n 
3  212 GLU n 
3  213 ILE n 
3  214 ALA n 
3  215 THR n 
3  216 LEU n 
3  217 THR n 
3  218 ARG n 
3  219 GLU n 
3  220 ASN n 
3  221 GLY n 
3  222 LYS n 
3  223 THR n 
3  224 VAL n 
3  225 ILE n 
3  226 ARG n 
3  227 VAL n 
3  228 LEU n 
3  229 LYS n 
3  230 GLN n 
3  231 LYS n 
3  232 GLU n 
3  233 VAL n 
3  234 GLU n 
3  235 GLN n 
3  236 LEU n 
3  237 ILE n 
3  238 LYS n 
3  239 LYS n 
3  240 HIS n 
3  241 GLU n 
3  242 GLU n 
3  243 GLU n 
3  244 GLU n 
3  245 ALA n 
3  246 LYS n 
3  247 ALA n 
3  248 GLU n 
3  249 ARG n 
3  250 GLU n 
3  251 LYS n 
3  252 LYS n 
3  253 GLU n 
3  254 LYS n 
3  255 GLU n 
3  256 GLN n 
3  257 LYS n 
3  258 GLU n 
3  259 LYS n 
3  260 ASP n 
3  261 LYS n 
4  1   MET n 
4  2   SER n 
4  3   TYR n 
4  4   ASP n 
4  5   ARG n 
4  6   ALA n 
4  7   ILE n 
4  8   THR n 
4  9   VAL n 
4  10  PHE n 
4  11  SER n 
4  12  PRO n 
4  13  ASP n 
4  14  GLY n 
4  15  HIS n 
4  16  LEU n 
4  17  PHE n 
4  18  GLN n 
4  19  VAL n 
4  20  GLU n 
4  21  TYR n 
4  22  ALA n 
4  23  GLN n 
4  24  GLU n 
4  25  ALA n 
4  26  VAL n 
4  27  LYS n 
4  28  LYS n 
4  29  GLY n 
4  30  SER n 
4  31  THR n 
4  32  ALA n 
4  33  VAL n 
4  34  GLY n 
4  35  VAL n 
4  36  ARG n 
4  37  GLY n 
4  38  ARG n 
4  39  ASP n 
4  40  ILE n 
4  41  VAL n 
4  42  VAL n 
4  43  LEU n 
4  44  GLY n 
4  45  VAL n 
4  46  GLU n 
4  47  LYS n 
4  48  LYS n 
4  49  SER n 
4  50  VAL n 
4  51  ALA n 
4  52  LYS n 
4  53  LEU n 
4  54  GLN n 
4  55  ASP n 
4  56  GLU n 
4  57  ARG n 
4  58  THR n 
4  59  VAL n 
4  60  ARG n 
4  61  LYS n 
4  62  ILE n 
4  63  CYS n 
4  64  ALA n 
4  65  LEU n 
4  66  ASP n 
4  67  ASP n 
4  68  ASN n 
4  69  VAL n 
4  70  CYS n 
4  71  MET n 
4  72  ALA n 
4  73  PHE n 
4  74  ALA n 
4  75  GLY n 
4  76  LEU n 
4  77  THR n 
4  78  ALA n 
4  79  ASP n 
4  80  ALA n 
4  81  ARG n 
4  82  ILE n 
4  83  VAL n 
4  84  ILE n 
4  85  ASN n 
4  86  ARG n 
4  87  ALA n 
4  88  ARG n 
4  89  VAL n 
4  90  GLU n 
4  91  CYS n 
4  92  GLN n 
4  93  SER n 
4  94  HIS n 
4  95  ARG n 
4  96  LEU n 
4  97  THR n 
4  98  VAL n 
4  99  GLU n 
4  100 ASP n 
4  101 PRO n 
4  102 VAL n 
4  103 THR n 
4  104 VAL n 
4  105 GLU n 
4  106 TYR n 
4  107 ILE n 
4  108 THR n 
4  109 ARG n 
4  110 TYR n 
4  111 ILE n 
4  112 ALA n 
4  113 SER n 
4  114 LEU n 
4  115 LYS n 
4  116 GLN n 
4  117 ARG n 
4  118 TYR n 
4  119 THR n 
4  120 GLN n 
4  121 SER n 
4  122 ASN n 
4  123 GLY n 
4  124 ARG n 
4  125 ARG n 
4  126 PRO n 
4  127 PHE n 
4  128 GLY n 
4  129 ILE n 
4  130 SER n 
4  131 ALA n 
4  132 LEU n 
4  133 ILE n 
4  134 VAL n 
4  135 GLY n 
4  136 PHE n 
4  137 ASP n 
4  138 PHE n 
4  139 ASP n 
4  140 GLY n 
4  141 THR n 
4  142 PRO n 
4  143 ARG n 
4  144 LEU n 
4  145 TYR n 
4  146 GLN n 
4  147 THR n 
4  148 ASP n 
4  149 PRO n 
4  150 SER n 
4  151 GLY n 
4  152 THR n 
4  153 TYR n 
4  154 HIS n 
4  155 ALA n 
4  156 TRP n 
4  157 LYS n 
4  158 ALA n 
4  159 ASN n 
4  160 ALA n 
4  161 ILE n 
4  162 GLY n 
4  163 ARG n 
4  164 GLY n 
4  165 ALA n 
4  166 LYS n 
4  167 SER n 
4  168 VAL n 
4  169 ARG n 
4  170 GLU n 
4  171 PHE n 
4  172 LEU n 
4  173 GLU n 
4  174 LYS n 
4  175 ASN n 
4  176 TYR n 
4  177 THR n 
4  178 ASP n 
4  179 GLU n 
4  180 ALA n 
4  181 ILE n 
4  182 GLU n 
4  183 THR n 
4  184 ASP n 
4  185 ASP n 
4  186 LEU n 
4  187 THR n 
4  188 ILE n 
4  189 LYS n 
4  190 LEU n 
4  191 VAL n 
4  192 ILE n 
4  193 LYS n 
4  194 ALA n 
4  195 LEU n 
4  196 LEU n 
4  197 GLU n 
4  198 VAL n 
4  199 VAL n 
4  200 GLN n 
4  201 SER n 
4  202 GLY n 
4  203 GLY n 
4  204 LYS n 
4  205 ASN n 
4  206 ILE n 
4  207 GLU n 
4  208 LEU n 
4  209 ALA n 
4  210 VAL n 
4  211 MET n 
4  212 ARG n 
4  213 ARG n 
4  214 ASP n 
4  215 GLN n 
4  216 SER n 
4  217 LEU n 
4  218 LYS n 
4  219 ILE n 
4  220 LEU n 
4  221 ASN n 
4  222 PRO n 
4  223 GLU n 
4  224 GLU n 
4  225 ILE n 
4  226 GLU n 
4  227 LYS n 
4  228 TYR n 
4  229 VAL n 
4  230 ALA n 
4  231 GLU n 
4  232 ILE n 
4  233 GLU n 
4  234 LYS n 
4  235 GLU n 
4  236 LYS n 
4  237 GLU n 
4  238 GLU n 
4  239 ASN n 
4  240 GLU n 
4  241 LYS n 
4  242 LYS n 
4  243 LYS n 
4  244 GLN n 
4  245 LYS n 
4  246 LYS n 
4  247 ALA n 
4  248 SER n 
5  1   MET n 
5  2   PHE n 
5  3   LEU n 
5  4   THR n 
5  5   ARG n 
5  6   SER n 
5  7   GLU n 
5  8   TYR n 
5  9   ASP n 
5  10  ARG n 
5  11  GLY n 
5  12  VAL n 
5  13  ASN n 
5  14  THR n 
5  15  PHE n 
5  16  SER n 
5  17  PRO n 
5  18  GLU n 
5  19  GLY n 
5  20  ARG n 
5  21  LEU n 
5  22  PHE n 
5  23  GLN n 
5  24  VAL n 
5  25  GLU n 
5  26  TYR n 
5  27  ALA n 
5  28  ILE n 
5  29  GLU n 
5  30  ALA n 
5  31  ILE n 
5  32  LYS n 
5  33  LEU n 
5  34  GLY n 
5  35  SER n 
5  36  THR n 
5  37  ALA n 
5  38  ILE n 
5  39  GLY n 
5  40  ILE n 
5  41  GLN n 
5  42  THR n 
5  43  SER n 
5  44  GLU n 
5  45  GLY n 
5  46  VAL n 
5  47  CYS n 
5  48  LEU n 
5  49  ALA n 
5  50  VAL n 
5  51  GLU n 
5  52  LYS n 
5  53  ARG n 
5  54  ILE n 
5  55  THR n 
5  56  SER n 
5  57  PRO n 
5  58  LEU n 
5  59  MET n 
5  60  GLU n 
5  61  PRO n 
5  62  SER n 
5  63  SER n 
5  64  ILE n 
5  65  GLU n 
5  66  LYS n 
5  67  ILE n 
5  68  VAL n 
5  69  GLU n 
5  70  ILE n 
5  71  ASP n 
5  72  ALA n 
5  73  HIS n 
5  74  ILE n 
5  75  GLY n 
5  76  CYS n 
5  77  ALA n 
5  78  MET n 
5  79  SER n 
5  80  GLY n 
5  81  LEU n 
5  82  ILE n 
5  83  ALA n 
5  84  ASP n 
5  85  ALA n 
5  86  LYS n 
5  87  THR n 
5  88  LEU n 
5  89  ILE n 
5  90  ASP n 
5  91  LYS n 
5  92  ALA n 
5  93  ARG n 
5  94  VAL n 
5  95  GLU n 
5  96  THR n 
5  97  GLN n 
5  98  ASN n 
5  99  HIS n 
5  100 TRP n 
5  101 PHE n 
5  102 THR n 
5  103 TYR n 
5  104 ASN n 
5  105 GLU n 
5  106 THR n 
5  107 MET n 
5  108 THR n 
5  109 VAL n 
5  110 GLU n 
5  111 SER n 
5  112 VAL n 
5  113 THR n 
5  114 GLN n 
5  115 ALA n 
5  116 VAL n 
5  117 SER n 
5  118 ASN n 
5  119 LEU n 
5  120 ALA n 
5  121 LEU n 
5  122 GLN n 
5  123 PHE n 
5  124 GLY n 
5  125 GLU n 
5  126 GLU n 
5  127 ASP n 
5  128 ALA n 
5  129 ASP n 
5  130 PRO n 
5  131 GLY n 
5  132 ALA n 
5  133 MET n 
5  134 SER n 
5  135 ARG n 
5  136 PRO n 
5  137 PHE n 
5  138 GLY n 
5  139 VAL n 
5  140 ALA n 
5  141 LEU n 
5  142 LEU n 
5  143 PHE n 
5  144 GLY n 
5  145 GLY n 
5  146 VAL n 
5  147 ASP n 
5  148 GLU n 
5  149 LYS n 
5  150 GLY n 
5  151 PRO n 
5  152 GLN n 
5  153 LEU n 
5  154 PHE n 
5  155 HIS n 
5  156 MET n 
5  157 ASP n 
5  158 PRO n 
5  159 SER n 
5  160 GLY n 
5  161 THR n 
5  162 PHE n 
5  163 VAL n 
5  164 GLN n 
5  165 CYS n 
5  166 ASP n 
5  167 ALA n 
5  168 ARG n 
5  169 ALA n 
5  170 ILE n 
5  171 GLY n 
5  172 SER n 
5  173 ALA n 
5  174 SER n 
5  175 GLU n 
5  176 GLY n 
5  177 ALA n 
5  178 GLN n 
5  179 SER n 
5  180 SER n 
5  181 LEU n 
5  182 GLN n 
5  183 GLU n 
5  184 VAL n 
5  185 TYR n 
5  186 HIS n 
5  187 LYS n 
5  188 SER n 
5  189 MET n 
5  190 THR n 
5  191 LEU n 
5  192 LYS n 
5  193 GLU n 
5  194 ALA n 
5  195 ILE n 
5  196 LYS n 
5  197 SER n 
5  198 SER n 
5  199 LEU n 
5  200 ILE n 
5  201 ILE n 
5  202 LEU n 
5  203 LYS n 
5  204 GLN n 
5  205 VAL n 
5  206 MET n 
5  207 GLU n 
5  208 GLU n 
5  209 LYS n 
5  210 LEU n 
5  211 ASN n 
5  212 ALA n 
5  213 THR n 
5  214 ASN n 
5  215 ILE n 
5  216 GLU n 
5  217 LEU n 
5  218 ALA n 
5  219 THR n 
5  220 VAL n 
5  221 GLN n 
5  222 PRO n 
5  223 GLY n 
5  224 GLN n 
5  225 ASN n 
5  226 PHE n 
5  227 HIS n 
5  228 MET n 
5  229 PHE n 
5  230 THR n 
5  231 LYS n 
5  232 GLU n 
5  233 GLU n 
5  234 LEU n 
5  235 GLU n 
5  236 GLU n 
5  237 VAL n 
5  238 ILE n 
5  239 LYS n 
5  240 ASP n 
5  241 ILE n 
6  1   MET n 
6  2   PHE n 
6  3   ARG n 
6  4   ASN n 
6  5   GLN n 
6  6   TYR n 
6  7   ASP n 
6  8   ASN n 
6  9   ASP n 
6  10  VAL n 
6  11  THR n 
6  12  VAL n 
6  13  TRP n 
6  14  SER n 
6  15  PRO n 
6  16  GLN n 
6  17  GLY n 
6  18  ARG n 
6  19  ILE n 
6  20  HIS n 
6  21  GLN n 
6  22  ILE n 
6  23  GLU n 
6  24  TYR n 
6  25  ALA n 
6  26  MET n 
6  27  GLU n 
6  28  ALA n 
6  29  VAL n 
6  30  LYS n 
6  31  GLN n 
6  32  GLY n 
6  33  SER n 
6  34  ALA n 
6  35  THR n 
6  36  VAL n 
6  37  GLY n 
6  38  LEU n 
6  39  LYS n 
6  40  SER n 
6  41  LYS n 
6  42  THR n 
6  43  HIS n 
6  44  ALA n 
6  45  VAL n 
6  46  LEU n 
6  47  VAL n 
6  48  ALA n 
6  49  LEU n 
6  50  LYS n 
6  51  ARG n 
6  52  ALA n 
6  53  GLN n 
6  54  SER n 
6  55  GLU n 
6  56  LEU n 
6  57  ALA n 
6  58  ALA n 
6  59  HIS n 
6  60  GLN n 
6  61  LYS n 
6  62  LYS n 
6  63  ILE n 
6  64  LEU n 
6  65  HIS n 
6  66  VAL n 
6  67  ASP n 
6  68  ASN n 
6  69  HIS n 
6  70  ILE n 
6  71  GLY n 
6  72  ILE n 
6  73  SER n 
6  74  ILE n 
6  75  ALA n 
6  76  GLY n 
6  77  LEU n 
6  78  THR n 
6  79  ALA n 
6  80  ASP n 
6  81  ALA n 
6  82  ARG n 
6  83  LEU n 
6  84  LEU n 
6  85  CYS n 
6  86  ASN n 
6  87  PHE n 
6  88  MET n 
6  89  ARG n 
6  90  GLN n 
6  91  GLU n 
6  92  CYS n 
6  93  LEU n 
6  94  ASP n 
6  95  SER n 
6  96  ARG n 
6  97  PHE n 
6  98  VAL n 
6  99  PHE n 
6  100 ASP n 
6  101 ARG n 
6  102 PRO n 
6  103 LEU n 
6  104 PRO n 
6  105 VAL n 
6  106 SER n 
6  107 ARG n 
6  108 LEU n 
6  109 VAL n 
6  110 SER n 
6  111 LEU n 
6  112 ILE n 
6  113 GLY n 
6  114 SER n 
6  115 LYS n 
6  116 THR n 
6  117 GLN n 
6  118 ILE n 
6  119 PRO n 
6  120 THR n 
6  121 GLN n 
6  122 ARG n 
6  123 TYR n 
6  124 GLY n 
6  125 ARG n 
6  126 ARG n 
6  127 PRO n 
6  128 TYR n 
6  129 GLY n 
6  130 VAL n 
6  131 GLY n 
6  132 LEU n 
6  133 LEU n 
6  134 ILE n 
6  135 ALA n 
6  136 GLY n 
6  137 TYR n 
6  138 ASP n 
6  139 ASP n 
6  140 MET n 
6  141 GLY n 
6  142 PRO n 
6  143 HIS n 
6  144 ILE n 
6  145 PHE n 
6  146 GLN n 
6  147 THR n 
6  148 CYS n 
6  149 PRO n 
6  150 SER n 
6  151 ALA n 
6  152 ASN n 
6  153 TYR n 
6  154 PHE n 
6  155 ASP n 
6  156 CYS n 
6  157 ARG n 
6  158 ALA n 
6  159 MET n 
6  160 SER n 
6  161 ILE n 
6  162 GLY n 
6  163 ALA n 
6  164 ARG n 
6  165 SER n 
6  166 GLN n 
6  167 SER n 
6  168 ALA n 
6  169 ARG n 
6  170 THR n 
6  171 TYR n 
6  172 LEU n 
6  173 GLU n 
6  174 ARG n 
6  175 HIS n 
6  176 MET n 
6  177 SER n 
6  178 GLU n 
6  179 PHE n 
6  180 MET n 
6  181 GLU n 
6  182 CYS n 
6  183 ASN n 
6  184 LEU n 
6  185 ASN n 
6  186 GLU n 
6  187 LEU n 
6  188 VAL n 
6  189 LYS n 
6  190 HIS n 
6  191 GLY n 
6  192 LEU n 
6  193 ARG n 
6  194 ALA n 
6  195 LEU n 
6  196 ARG n 
6  197 GLU n 
6  198 THR n 
6  199 LEU n 
6  200 PRO n 
6  201 ALA n 
6  202 GLU n 
6  203 GLN n 
6  204 ASP n 
6  205 LEU n 
6  206 THR n 
6  207 THR n 
6  208 LYS n 
6  209 ASN n 
6  210 VAL n 
6  211 SER n 
6  212 ILE n 
6  213 GLY n 
6  214 ILE n 
6  215 VAL n 
6  216 GLY n 
6  217 LYS n 
6  218 ASP n 
6  219 LEU n 
6  220 GLU n 
6  221 PHE n 
6  222 THR n 
6  223 ILE n 
6  224 TYR n 
6  225 ASP n 
6  226 ASP n 
6  227 ASP n 
6  228 ASP n 
6  229 VAL n 
6  230 SER n 
6  231 PRO n 
6  232 PHE n 
6  233 LEU n 
6  234 GLU n 
6  235 GLY n 
6  236 LEU n 
6  237 GLU n 
6  238 GLU n 
6  239 ARG n 
6  240 PRO n 
6  241 GLN n 
6  242 ARG n 
6  243 LYS n 
6  244 ALA n 
6  245 GLN n 
6  246 PRO n 
6  247 ALA n 
6  248 GLN n 
6  249 PRO n 
6  250 ALA n 
6  251 ASP n 
6  252 GLU n 
6  253 PRO n 
6  254 ALA n 
6  255 GLU n 
6  256 LYS n 
6  257 ALA n 
6  258 ASP n 
6  259 GLU n 
6  260 PRO n 
6  261 MET n 
6  262 GLU n 
6  263 HIS n 
7  1   MET n 
7  2   SER n 
7  3   SER n 
7  4   ILE n 
7  5   GLY n 
7  6   THR n 
7  7   GLY n 
7  8   TYR n 
7  9   ASP n 
7  10  LEU n 
7  11  SER n 
7  12  ALA n 
7  13  SER n 
7  14  THR n 
7  15  PHE n 
7  16  SER n 
7  17  PRO n 
7  18  ASP n 
7  19  GLY n 
7  20  ARG n 
7  21  VAL n 
7  22  PHE n 
7  23  GLN n 
7  24  VAL n 
7  25  GLU n 
7  26  TYR n 
7  27  ALA n 
7  28  MET n 
7  29  LYS n 
7  30  ALA n 
7  31  VAL n 
7  32  GLU n 
7  33  ASN n 
7  34  SER n 
7  35  SER n 
7  36  THR n 
7  37  ALA n 
7  38  ILE n 
7  39  GLY n 
7  40  ILE n 
7  41  ARG n 
7  42  CYS n 
7  43  LYS n 
7  44  ASP n 
7  45  GLY n 
7  46  VAL n 
7  47  VAL n 
7  48  PHE n 
7  49  GLY n 
7  50  VAL n 
7  51  GLU n 
7  52  LYS n 
7  53  LEU n 
7  54  VAL n 
7  55  LEU n 
7  56  SER n 
7  57  LYS n 
7  58  LEU n 
7  59  TYR n 
7  60  GLU n 
7  61  GLU n 
7  62  GLY n 
7  63  SER n 
7  64  ASN n 
7  65  LYS n 
7  66  ARG n 
7  67  LEU n 
7  68  PHE n 
7  69  ASN n 
7  70  VAL n 
7  71  ASP n 
7  72  ARG n 
7  73  HIS n 
7  74  VAL n 
7  75  GLY n 
7  76  MET n 
7  77  ALA n 
7  78  VAL n 
7  79  ALA n 
7  80  GLY n 
7  81  LEU n 
7  82  LEU n 
7  83  ALA n 
7  84  ASP n 
7  85  ALA n 
7  86  ARG n 
7  87  SER n 
7  88  LEU n 
7  89  ALA n 
7  90  ASP n 
7  91  ILE n 
7  92  ALA n 
7  93  ARG n 
7  94  GLU n 
7  95  GLU n 
7  96  ALA n 
7  97  SER n 
7  98  ASN n 
7  99  PHE n 
7  100 ARG n 
7  101 SER n 
7  102 ASN n 
7  103 PHE n 
7  104 GLY n 
7  105 TYR n 
7  106 ASN n 
7  107 ILE n 
7  108 PRO n 
7  109 LEU n 
7  110 LYS n 
7  111 HIS n 
7  112 LEU n 
7  113 ALA n 
7  114 ASP n 
7  115 ARG n 
7  116 VAL n 
7  117 ALA n 
7  118 MET n 
7  119 TYR n 
7  120 VAL n 
7  121 HIS n 
7  122 ALA n 
7  123 TYR n 
7  124 THR n 
7  125 LEU n 
7  126 TYR n 
7  127 SER n 
7  128 ALA n 
7  129 VAL n 
7  130 ARG n 
7  131 PRO n 
7  132 PHE n 
7  133 GLY n 
7  134 CYS n 
7  135 SER n 
7  136 PHE n 
7  137 MET n 
7  138 LEU n 
7  139 GLY n 
7  140 SER n 
7  141 TYR n 
7  142 SER n 
7  143 VAL n 
7  144 ASN n 
7  145 ASP n 
7  146 GLY n 
7  147 ALA n 
7  148 GLN n 
7  149 LEU n 
7  150 TYR n 
7  151 MET n 
7  152 ILE n 
7  153 ASP n 
7  154 PRO n 
7  155 SER n 
7  156 GLY n 
7  157 VAL n 
7  158 SER n 
7  159 TYR n 
7  160 GLY n 
7  161 TYR n 
7  162 TRP n 
7  163 GLY n 
7  164 CYS n 
7  165 ALA n 
7  166 ILE n 
7  167 GLY n 
7  168 LYS n 
7  169 ALA n 
7  170 ARG n 
7  171 GLN n 
7  172 ALA n 
7  173 ALA n 
7  174 LYS n 
7  175 THR n 
7  176 GLU n 
7  177 ILE n 
7  178 GLU n 
7  179 LYS n 
7  180 LEU n 
7  181 GLN n 
7  182 MET n 
7  183 LYS n 
7  184 GLU n 
7  185 MET n 
7  186 THR n 
7  187 CYS n 
7  188 ARG n 
7  189 ASP n 
7  190 ILE n 
7  191 VAL n 
7  192 LYS n 
7  193 GLU n 
7  194 VAL n 
7  195 ALA n 
7  196 LYS n 
7  197 ILE n 
7  198 ILE n 
7  199 TYR n 
7  200 ILE n 
7  201 VAL n 
7  202 HIS n 
7  203 ASP n 
7  204 GLU n 
7  205 VAL n 
7  206 LYS n 
7  207 ASP n 
7  208 LYS n 
7  209 ALA n 
7  210 PHE n 
7  211 GLU n 
7  212 LEU n 
7  213 GLU n 
7  214 LEU n 
7  215 SER n 
7  216 TRP n 
7  217 VAL n 
7  218 GLY n 
7  219 GLU n 
7  220 LEU n 
7  221 THR n 
7  222 ASN n 
7  223 GLY n 
7  224 ARG n 
7  225 HIS n 
7  226 GLU n 
7  227 ILE n 
7  228 VAL n 
7  229 PRO n 
7  230 LYS n 
7  231 ASP n 
7  232 ILE n 
7  233 ARG n 
7  234 GLU n 
7  235 GLU n 
7  236 ALA n 
7  237 GLU n 
7  238 LYS n 
7  239 TYR n 
7  240 ALA n 
7  241 LYS n 
7  242 GLU n 
7  243 SER n 
7  244 LEU n 
7  245 LYS n 
7  246 GLU n 
7  247 GLU n 
7  248 ASP n 
7  249 GLU n 
7  250 SER n 
7  251 ASP n 
7  252 ASP n 
7  253 ASP n 
7  254 ASN n 
7  255 MET n 
8  1   THR n 
8  2   THR n 
8  3   ILE n 
8  4   MET n 
8  5   ALA n 
8  6   VAL n 
8  7   GLN n 
8  8   PHE n 
8  9   ASP n 
8  10  GLY n 
8  11  GLY n 
8  12  VAL n 
8  13  VAL n 
8  14  LEU n 
8  15  GLY n 
8  16  ALA n 
8  17  ASP n 
8  18  SER n 
8  19  ARG n 
8  20  THR n 
8  21  THR n 
8  22  THR n 
8  23  GLY n 
8  24  SER n 
8  25  TYR n 
8  26  ILE n 
8  27  ALA n 
8  28  ASN n 
8  29  ARG n 
8  30  VAL n 
8  31  THR n 
8  32  ASP n 
8  33  LYS n 
8  34  LEU n 
8  35  THR n 
8  36  PRO n 
8  37  ILE n 
8  38  HIS n 
8  39  ASP n 
8  40  ARG n 
8  41  ILE n 
8  42  PHE n 
8  43  CYS n 
8  44  CYS n 
8  45  ARG n 
8  46  SER n 
8  47  GLY n 
8  48  SER n 
8  49  ALA n 
8  50  ALA n 
8  51  ASP n 
8  52  THR n 
8  53  GLN n 
8  54  ALA n 
8  55  VAL n 
8  56  ALA n 
8  57  ASP n 
8  58  ALA n 
8  59  VAL n 
8  60  THR n 
8  61  TYR n 
8  62  GLN n 
8  63  LEU n 
8  64  GLY n 
8  65  PHE n 
8  66  HIS n 
8  67  SER n 
8  68  ILE n 
8  69  GLU n 
8  70  LEU n 
8  71  ASN n 
8  72  GLU n 
8  73  PRO n 
8  74  PRO n 
8  75  LEU n 
8  76  VAL n 
8  77  HIS n 
8  78  THR n 
8  79  ALA n 
8  80  ALA n 
8  81  SER n 
8  82  LEU n 
8  83  PHE n 
8  84  LYS n 
8  85  GLU n 
8  86  MET n 
8  87  CYS n 
8  88  TYR n 
8  89  ARG n 
8  90  TYR n 
8  91  ARG n 
8  92  GLU n 
8  93  ASP n 
8  94  LEU n 
8  95  MET n 
8  96  ALA n 
8  97  GLY n 
8  98  ILE n 
8  99  ILE n 
8  100 ILE n 
8  101 ALA n 
8  102 GLY n 
8  103 TRP n 
8  104 ASP n 
8  105 PRO n 
8  106 GLN n 
8  107 GLU n 
8  108 GLY n 
8  109 GLY n 
8  110 GLN n 
8  111 VAL n 
8  112 TYR n 
8  113 SER n 
8  114 VAL n 
8  115 PRO n 
8  116 MET n 
8  117 GLY n 
8  118 GLY n 
8  119 MET n 
8  120 MET n 
8  121 VAL n 
8  122 ARG n 
8  123 GLN n 
8  124 SER n 
8  125 PHE n 
8  126 ALA n 
8  127 ILE n 
8  128 GLY n 
8  129 GLY n 
8  130 SER n 
8  131 GLY n 
8  132 SER n 
8  133 SER n 
8  134 TYR n 
8  135 ILE n 
8  136 TYR n 
8  137 GLY n 
8  138 TYR n 
8  139 VAL n 
8  140 ASP n 
8  141 ALA n 
8  142 THR n 
8  143 TYR n 
8  144 ARG n 
8  145 GLU n 
8  146 GLY n 
8  147 MET n 
8  148 THR n 
8  149 LYS n 
8  150 GLU n 
8  151 GLU n 
8  152 CYS n 
8  153 LEU n 
8  154 GLN n 
8  155 PHE n 
8  156 THR n 
8  157 ALA n 
8  158 ASN n 
8  159 ALA n 
8  160 LEU n 
8  161 ALA n 
8  162 LEU n 
8  163 ALA n 
8  164 MET n 
8  165 GLU n 
8  166 ARG n 
8  167 ASP n 
8  168 GLY n 
8  169 SER n 
8  170 SER n 
8  171 GLY n 
8  172 GLY n 
8  173 VAL n 
8  174 ILE n 
8  175 ARG n 
8  176 LEU n 
8  177 ALA n 
8  178 ALA n 
8  179 ILE n 
8  180 ALA n 
8  181 GLU n 
8  182 SER n 
8  183 GLY n 
8  184 VAL n 
8  185 GLU n 
8  186 ARG n 
8  187 GLN n 
8  188 VAL n 
8  189 LEU n 
8  190 LEU n 
8  191 GLY n 
8  192 ASP n 
8  193 GLN n 
8  194 ILE n 
8  195 PRO n 
8  196 LYS n 
8  197 PHE n 
8  198 ALA n 
8  199 VAL n 
8  200 ALA n 
8  201 THR n 
8  202 LEU n 
8  203 PRO n 
8  204 PRO n 
8  205 ALA n 
9  1   THR n 
9  2   THR n 
9  3   ILE n 
9  4   ALA n 
9  5   GLY n 
9  6   VAL n 
9  7   VAL n 
9  8   TYR n 
9  9   LYS n 
9  10  ASP n 
9  11  GLY n 
9  12  ILE n 
9  13  VAL n 
9  14  LEU n 
9  15  GLY n 
9  16  ALA n 
9  17  ASP n 
9  18  THR n 
9  19  ARG n 
9  20  ALA n 
9  21  THR n 
9  22  GLU n 
9  23  GLY n 
9  24  MET n 
9  25  VAL n 
9  26  VAL n 
9  27  ALA n 
9  28  ASP n 
9  29  LYS n 
9  30  ASN n 
9  31  CYS n 
9  32  SER n 
9  33  LYS n 
9  34  ILE n 
9  35  HIS n 
9  36  PHE n 
9  37  ILE n 
9  38  SER n 
9  39  PRO n 
9  40  ASN n 
9  41  ILE n 
9  42  TYR n 
9  43  CYS n 
9  44  CYS n 
9  45  GLY n 
9  46  ALA n 
9  47  GLY n 
9  48  THR n 
9  49  ALA n 
9  50  ALA n 
9  51  ASP n 
9  52  THR n 
9  53  ASP n 
9  54  MET n 
9  55  THR n 
9  56  THR n 
9  57  GLN n 
9  58  LEU n 
9  59  ILE n 
9  60  SER n 
9  61  SER n 
9  62  ASN n 
9  63  LEU n 
9  64  GLU n 
9  65  LEU n 
9  66  HIS n 
9  67  SER n 
9  68  LEU n 
9  69  SER n 
9  70  THR n 
9  71  GLY n 
9  72  ARG n 
9  73  LEU n 
9  74  PRO n 
9  75  ARG n 
9  76  VAL n 
9  77  VAL n 
9  78  THR n 
9  79  ALA n 
9  80  ASN n 
9  81  ARG n 
9  82  MET n 
9  83  LEU n 
9  84  LYS n 
9  85  GLN n 
9  86  MET n 
9  87  LEU n 
9  88  PHE n 
9  89  ARG n 
9  90  TYR n 
9  91  GLN n 
9  92  GLY n 
9  93  TYR n 
9  94  ILE n 
9  95  GLY n 
9  96  ALA n 
9  97  ALA n 
9  98  LEU n 
9  99  VAL n 
9  100 LEU n 
9  101 GLY n 
9  102 GLY n 
9  103 VAL n 
9  104 ASP n 
9  105 VAL n 
9  106 THR n 
9  107 GLY n 
9  108 PRO n 
9  109 HIS n 
9  110 LEU n 
9  111 TYR n 
9  112 SER n 
9  113 ILE n 
9  114 TYR n 
9  115 PRO n 
9  116 HIS n 
9  117 GLY n 
9  118 SER n 
9  119 THR n 
9  120 ASP n 
9  121 LYS n 
9  122 LEU n 
9  123 PRO n 
9  124 TYR n 
9  125 VAL n 
9  126 THR n 
9  127 MET n 
9  128 GLY n 
9  129 SER n 
9  130 GLY n 
9  131 SER n 
9  132 LEU n 
9  133 ALA n 
9  134 ALA n 
9  135 MET n 
9  136 ALA n 
9  137 VAL n 
9  138 PHE n 
9  139 GLU n 
9  140 ASP n 
9  141 LYS n 
9  142 PHE n 
9  143 ARG n 
9  144 PRO n 
9  145 ASP n 
9  146 MET n 
9  147 GLU n 
9  148 GLU n 
9  149 GLU n 
9  150 GLU n 
9  151 ALA n 
9  152 LYS n 
9  153 ASN n 
9  154 LEU n 
9  155 VAL n 
9  156 SER n 
9  157 GLU n 
9  158 ALA n 
9  159 ILE n 
9  160 ALA n 
9  161 ALA n 
9  162 GLY n 
9  163 ILE n 
9  164 PHE n 
9  165 ASN n 
9  166 ASP n 
9  167 LEU n 
9  168 GLY n 
9  169 SER n 
9  170 GLY n 
9  171 SER n 
9  172 ASN n 
9  173 ILE n 
9  174 ASP n 
9  175 LEU n 
9  176 CYS n 
9  177 VAL n 
9  178 ILE n 
9  179 SER n 
9  180 LYS n 
9  181 ASN n 
9  182 LYS n 
9  183 LEU n 
9  184 ASP n 
9  185 PHE n 
9  186 LEU n 
9  187 ARG n 
9  188 PRO n 
9  189 TYR n 
9  190 THR n 
9  191 VAL n 
9  192 PRO n 
9  193 ASN n 
9  194 LYS n 
9  195 LYS n 
9  196 GLY n 
9  197 THR n 
9  198 ARG n 
9  199 LEU n 
9  200 GLY n 
9  201 ARG n 
9  202 TYR n 
9  203 ARG n 
9  204 CYS n 
9  205 GLU n 
9  206 LYS n 
9  207 GLY n 
9  208 THR n 
9  209 THR n 
9  210 ALA n 
9  211 VAL n 
9  212 LEU n 
9  213 THR n 
9  214 GLU n 
9  215 LYS n 
9  216 ILE n 
9  217 THR n 
9  218 PRO n 
9  219 LEU n 
9  220 GLU n 
9  221 ILE n 
9  222 GLU n 
9  223 VAL n 
9  224 LEU n 
9  225 GLU n 
9  226 GLU n 
9  227 THR n 
9  228 VAL n 
9  229 GLN n 
9  230 THR n 
9  231 MET n 
9  232 ASP n 
9  233 THR n 
9  234 SER n 
10 1   SER n 
10 2   ILE n 
10 3   MET n 
10 4   SER n 
10 5   TYR n 
10 6   ASN n 
10 7   GLY n 
10 8   GLY n 
10 9   ALA n 
10 10  VAL n 
10 11  MET n 
10 12  ALA n 
10 13  MET n 
10 14  LYS n 
10 15  GLY n 
10 16  LYS n 
10 17  ASN n 
10 18  CYS n 
10 19  VAL n 
10 20  ALA n 
10 21  ILE n 
10 22  ALA n 
10 23  ALA n 
10 24  ASP n 
10 25  ARG n 
10 26  ARG n 
10 27  PHE n 
10 28  GLY n 
10 29  ILE n 
10 30  GLN n 
10 31  ALA n 
10 32  GLN n 
10 33  MET n 
10 34  VAL n 
10 35  THR n 
10 36  THR n 
10 37  ASP n 
10 38  PHE n 
10 39  GLN n 
10 40  LYS n 
10 41  ILE n 
10 42  PHE n 
10 43  PRO n 
10 44  MET n 
10 45  GLY n 
10 46  ASP n 
10 47  ARG n 
10 48  LEU n 
10 49  TYR n 
10 50  ILE n 
10 51  GLY n 
10 52  LEU n 
10 53  ALA n 
10 54  GLY n 
10 55  LEU n 
10 56  ALA n 
10 57  THR n 
10 58  ASP n 
10 59  VAL n 
10 60  GLN n 
10 61  THR n 
10 62  VAL n 
10 63  ALA n 
10 64  GLN n 
10 65  ARG n 
10 66  LEU n 
10 67  LYS n 
10 68  PHE n 
10 69  ARG n 
10 70  LEU n 
10 71  ASN n 
10 72  LEU n 
10 73  TYR n 
10 74  GLU n 
10 75  LEU n 
10 76  LYS n 
10 77  GLU n 
10 78  GLY n 
10 79  ARG n 
10 80  GLN n 
10 81  ILE n 
10 82  LYS n 
10 83  PRO n 
10 84  TYR n 
10 85  THR n 
10 86  LEU n 
10 87  MET n 
10 88  SER n 
10 89  MET n 
10 90  VAL n 
10 91  ALA n 
10 92  ASN n 
10 93  LEU n 
10 94  LEU n 
10 95  TYR n 
10 96  GLU n 
10 97  LYS n 
10 98  ARG n 
10 99  PHE n 
10 100 GLY n 
10 101 PRO n 
10 102 TYR n 
10 103 TYR n 
10 104 THR n 
10 105 GLU n 
10 106 PRO n 
10 107 VAL n 
10 108 ILE n 
10 109 ALA n 
10 110 GLY n 
10 111 LEU n 
10 112 ASP n 
10 113 PRO n 
10 114 LYS n 
10 115 THR n 
10 116 PHE n 
10 117 LYS n 
10 118 PRO n 
10 119 PHE n 
10 120 ILE n 
10 121 CYS n 
10 122 SER n 
10 123 LEU n 
10 124 ASP n 
10 125 LEU n 
10 126 ILE n 
10 127 GLY n 
10 128 CYS n 
10 129 PRO n 
10 130 MET n 
10 131 VAL n 
10 132 THR n 
10 133 ASP n 
10 134 ASP n 
10 135 PHE n 
10 136 VAL n 
10 137 VAL n 
10 138 SER n 
10 139 GLY n 
10 140 THR n 
10 141 CYS n 
10 142 ALA n 
10 143 GLU n 
10 144 GLN n 
10 145 MET n 
10 146 TYR n 
10 147 GLY n 
10 148 MET n 
10 149 CYS n 
10 150 GLU n 
10 151 SER n 
10 152 LEU n 
10 153 TRP n 
10 154 GLU n 
10 155 PRO n 
10 156 ASN n 
10 157 MET n 
10 158 ASP n 
10 159 PRO n 
10 160 ASP n 
10 161 HIS n 
10 162 LEU n 
10 163 PHE n 
10 164 GLU n 
10 165 THR n 
10 166 ILE n 
10 167 SER n 
10 168 GLN n 
10 169 ALA n 
10 170 MET n 
10 171 LEU n 
10 172 ASN n 
10 173 ALA n 
10 174 VAL n 
10 175 ASP n 
10 176 ARG n 
10 177 ASP n 
10 178 ALA n 
10 179 VAL n 
10 180 SER n 
10 181 GLY n 
10 182 MET n 
10 183 GLY n 
10 184 VAL n 
10 185 ILE n 
10 186 VAL n 
10 187 HIS n 
10 188 ILE n 
10 189 ILE n 
10 190 GLU n 
10 191 LYS n 
10 192 ASP n 
10 193 LYS n 
10 194 ILE n 
10 195 THR n 
10 196 THR n 
10 197 ARG n 
10 198 THR n 
10 199 LEU n 
10 200 LYS n 
10 201 ALA n 
10 202 ARG n 
10 203 MET n 
10 204 ASP n 
11 1   MET n 
11 2   GLU n 
11 3   TYR n 
11 4   LEU n 
11 5   ILE n 
11 6   GLY n 
11 7   ILE n 
11 8   GLN n 
11 9   GLY n 
11 10  PRO n 
11 11  ASP n 
11 12  TYR n 
11 13  VAL n 
11 14  LEU n 
11 15  VAL n 
11 16  ALA n 
11 17  SER n 
11 18  ASP n 
11 19  ARG n 
11 20  VAL n 
11 21  ALA n 
11 22  ALA n 
11 23  SER n 
11 24  ASN n 
11 25  ILE n 
11 26  VAL n 
11 27  GLN n 
11 28  MET n 
11 29  LYS n 
11 30  ASP n 
11 31  ASP n 
11 32  HIS n 
11 33  ASP n 
11 34  LYS n 
11 35  MET n 
11 36  PHE n 
11 37  LYS n 
11 38  MET n 
11 39  SER n 
11 40  GLU n 
11 41  LYS n 
11 42  ILE n 
11 43  LEU n 
11 44  LEU n 
11 45  LEU n 
11 46  CYS n 
11 47  VAL n 
11 48  GLY n 
11 49  GLU n 
11 50  ALA n 
11 51  GLY n 
11 52  ASP n 
11 53  THR n 
11 54  VAL n 
11 55  GLN n 
11 56  PHE n 
11 57  ALA n 
11 58  GLU n 
11 59  TYR n 
11 60  ILE n 
11 61  GLN n 
11 62  LYS n 
11 63  ASN n 
11 64  VAL n 
11 65  GLN n 
11 66  LEU n 
11 67  TYR n 
11 68  LYS n 
11 69  MET n 
11 70  ARG n 
11 71  ASN n 
11 72  GLY n 
11 73  TYR n 
11 74  GLU n 
11 75  LEU n 
11 76  SER n 
11 77  PRO n 
11 78  THR n 
11 79  ALA n 
11 80  ALA n 
11 81  ALA n 
11 82  ASN n 
11 83  PHE n 
11 84  THR n 
11 85  ARG n 
11 86  ARG n 
11 87  ASN n 
11 88  LEU n 
11 89  ALA n 
11 90  ASP n 
11 91  CYS n 
11 92  LEU n 
11 93  ARG n 
11 94  SER n 
11 95  ARG n 
11 96  THR n 
11 97  PRO n 
11 98  TYR n 
11 99  HIS n 
11 100 VAL n 
11 101 ASN n 
11 102 LEU n 
11 103 LEU n 
11 104 LEU n 
11 105 ALA n 
11 106 GLY n 
11 107 TYR n 
11 108 ASP n 
11 109 GLU n 
11 110 HIS n 
11 111 GLU n 
11 112 GLY n 
11 113 PRO n 
11 114 ALA n 
11 115 LEU n 
11 116 TYR n 
11 117 TYR n 
11 118 MET n 
11 119 ASP n 
11 120 TYR n 
11 121 LEU n 
11 122 ALA n 
11 123 ALA n 
11 124 LEU n 
11 125 ALA n 
11 126 LYS n 
11 127 ALA n 
11 128 PRO n 
11 129 PHE n 
11 130 ALA n 
11 131 ALA n 
11 132 HIS n 
11 133 GLY n 
11 134 TYR n 
11 135 GLY n 
11 136 ALA n 
11 137 PHE n 
11 138 LEU n 
11 139 THR n 
11 140 LEU n 
11 141 SER n 
11 142 ILE n 
11 143 LEU n 
11 144 ASP n 
11 145 ARG n 
11 146 TYR n 
11 147 TYR n 
11 148 THR n 
11 149 PRO n 
11 150 THR n 
11 151 ILE n 
11 152 SER n 
11 153 ARG n 
11 154 GLU n 
11 155 ARG n 
11 156 ALA n 
11 157 VAL n 
11 158 GLU n 
11 159 LEU n 
11 160 LEU n 
11 161 ARG n 
11 162 LYS n 
11 163 CYS n 
11 164 LEU n 
11 165 GLU n 
11 166 GLU n 
11 167 LEU n 
11 168 GLN n 
11 169 LYS n 
11 170 ARG n 
11 171 PHE n 
11 172 ILE n 
11 173 LEU n 
11 174 ASN n 
11 175 LEU n 
11 176 PRO n 
11 177 THR n 
11 178 PHE n 
11 179 SER n 
11 180 VAL n 
11 181 ARG n 
11 182 ILE n 
11 183 ILE n 
11 184 ASP n 
11 185 LYS n 
11 186 ASN n 
11 187 GLY n 
11 188 ILE n 
11 189 HIS n 
11 190 ASP n 
11 191 LEU n 
11 192 ASP n 
11 193 ASN n 
11 194 ILE n 
11 195 SER n 
11 196 PHE n 
11 197 PRO n 
11 198 LYS n 
11 199 GLN n 
11 200 GLY n 
11 201 SER n 
12 1   THR n 
12 2   THR n 
12 3   THR n 
12 4   LEU n 
12 5   ALA n 
12 6   PHE n 
12 7   LYS n 
12 8   PHE n 
12 9   ARG n 
12 10  HIS n 
12 11  GLY n 
12 12  VAL n 
12 13  ILE n 
12 14  VAL n 
12 15  ALA n 
12 16  ALA n 
12 17  ASP n 
12 18  SER n 
12 19  ARG n 
12 20  ALA n 
12 21  THR n 
12 22  ALA n 
12 23  GLY n 
12 24  ALA n 
12 25  TYR n 
12 26  ILE n 
12 27  ALA n 
12 28  SER n 
12 29  GLN n 
12 30  THR n 
12 31  VAL n 
12 32  LYS n 
12 33  LYS n 
12 34  VAL n 
12 35  ILE n 
12 36  GLU n 
12 37  ILE n 
12 38  ASN n 
12 39  PRO n 
12 40  TYR n 
12 41  LEU n 
12 42  LEU n 
12 43  GLY n 
12 44  THR n 
12 45  MET n 
12 46  ALA n 
12 47  GLY n 
12 48  GLY n 
12 49  ALA n 
12 50  ALA n 
12 51  ASP n 
12 52  CYS n 
12 53  SER n 
12 54  PHE n 
12 55  TRP n 
12 56  GLU n 
12 57  ARG n 
12 58  LEU n 
12 59  LEU n 
12 60  ALA n 
12 61  ARG n 
12 62  GLN n 
12 63  CYS n 
12 64  ARG n 
12 65  ILE n 
12 66  TYR n 
12 67  GLU n 
12 68  LEU n 
12 69  ARG n 
12 70  ASN n 
12 71  LYS n 
12 72  GLU n 
12 73  ARG n 
12 74  ILE n 
12 75  SER n 
12 76  VAL n 
12 77  ALA n 
12 78  ALA n 
12 79  ALA n 
12 80  SER n 
12 81  LYS n 
12 82  LEU n 
12 83  LEU n 
12 84  ALA n 
12 85  ASN n 
12 86  MET n 
12 87  VAL n 
12 88  TYR n 
12 89  GLN n 
12 90  TYR n 
12 91  LYS n 
12 92  GLY n 
12 93  MET n 
12 94  GLY n 
12 95  LEU n 
12 96  SER n 
12 97  MET n 
12 98  GLY n 
12 99  THR n 
12 100 MET n 
12 101 ILE n 
12 102 CYS n 
12 103 GLY n 
12 104 TRP n 
12 105 ASP n 
12 106 LYS n 
12 107 ARG n 
12 108 GLY n 
12 109 PRO n 
12 110 GLY n 
12 111 LEU n 
12 112 TYR n 
12 113 TYR n 
12 114 VAL n 
12 115 ASP n 
12 116 SER n 
12 117 GLU n 
12 118 GLY n 
12 119 ASN n 
12 120 ARG n 
12 121 ILE n 
12 122 SER n 
12 123 GLY n 
12 124 ALA n 
12 125 THR n 
12 126 PHE n 
12 127 SER n 
12 128 VAL n 
12 129 GLY n 
12 130 SER n 
12 131 GLY n 
12 132 SER n 
12 133 VAL n 
12 134 TYR n 
12 135 ALA n 
12 136 TYR n 
12 137 GLY n 
12 138 VAL n 
12 139 MET n 
12 140 ASP n 
12 141 ARG n 
12 142 GLY n 
12 143 TYR n 
12 144 SER n 
12 145 TYR n 
12 146 ASP n 
12 147 LEU n 
12 148 GLU n 
12 149 VAL n 
12 150 GLU n 
12 151 GLN n 
12 152 ALA n 
12 153 TYR n 
12 154 ASP n 
12 155 LEU n 
12 156 ALA n 
12 157 ARG n 
12 158 ARG n 
12 159 ALA n 
12 160 ILE n 
12 161 TYR n 
12 162 GLN n 
12 163 ALA n 
12 164 THR n 
12 165 TYR n 
12 166 ARG n 
12 167 ASP n 
12 168 ALA n 
12 169 TYR n 
12 170 SER n 
12 171 GLY n 
12 172 GLY n 
12 173 ALA n 
12 174 VAL n 
12 175 ASN n 
12 176 LEU n 
12 177 TYR n 
12 178 HIS n 
12 179 VAL n 
12 180 ARG n 
12 181 GLU n 
12 182 ASP n 
12 183 GLY n 
12 184 TRP n 
12 185 ILE n 
12 186 ARG n 
12 187 VAL n 
12 188 SER n 
12 189 SER n 
12 190 ASP n 
12 191 ASN n 
12 192 VAL n 
12 193 ALA n 
12 194 ASP n 
12 195 LEU n 
12 196 HIS n 
12 197 GLU n 
12 198 LYS n 
12 199 TYR n 
12 200 SER n 
12 201 GLY n 
12 202 SER n 
12 203 THR n 
12 204 PRO n 
13 1   ARG n 
13 2   PHE n 
13 3   SER n 
13 4   PRO n 
13 5   TYR n 
13 6   VAL n 
13 7   PHE n 
13 8   ASN n 
13 9   GLY n 
13 10  GLY n 
13 11  THR n 
13 12  ILE n 
13 13  LEU n 
13 14  ALA n 
13 15  ILE n 
13 16  ALA n 
13 17  GLY n 
13 18  GLU n 
13 19  ASP n 
13 20  PHE n 
13 21  ALA n 
13 22  ILE n 
13 23  VAL n 
13 24  ALA n 
13 25  SER n 
13 26  ASP n 
13 27  THR n 
13 28  ARG n 
13 29  LEU n 
13 30  SER n 
13 31  GLU n 
13 32  GLY n 
13 33  PHE n 
13 34  SER n 
13 35  ILE n 
13 36  HIS n 
13 37  THR n 
13 38  ARG n 
13 39  ASP n 
13 40  SER n 
13 41  PRO n 
13 42  LYS n 
13 43  CYS n 
13 44  TYR n 
13 45  LYS n 
13 46  LEU n 
13 47  THR n 
13 48  ASP n 
13 49  LYS n 
13 50  THR n 
13 51  VAL n 
13 52  ILE n 
13 53  GLY n 
13 54  CYS n 
13 55  SER n 
13 56  GLY n 
13 57  PHE n 
13 58  HIS n 
13 59  GLY n 
13 60  ASP n 
13 61  CYS n 
13 62  LEU n 
13 63  THR n 
13 64  LEU n 
13 65  THR n 
13 66  LYS n 
13 67  ILE n 
13 68  ILE n 
13 69  GLU n 
13 70  ALA n 
13 71  ARG n 
13 72  LEU n 
13 73  LYS n 
13 74  MET n 
13 75  TYR n 
13 76  LYS n 
13 77  HIS n 
13 78  SER n 
13 79  ASN n 
13 80  ASN n 
13 81  LYS n 
13 82  ALA n 
13 83  MET n 
13 84  THR n 
13 85  THR n 
13 86  GLY n 
13 87  ALA n 
13 88  ILE n 
13 89  ALA n 
13 90  ALA n 
13 91  MET n 
13 92  LEU n 
13 93  SER n 
13 94  THR n 
13 95  ILE n 
13 96  LEU n 
13 97  TYR n 
13 98  SER n 
13 99  ARG n 
13 100 ARG n 
13 101 PHE n 
13 102 PHE n 
13 103 PRO n 
13 104 TYR n 
13 105 TYR n 
13 106 VAL n 
13 107 TYR n 
13 108 ASN n 
13 109 ILE n 
13 110 ILE n 
13 111 GLY n 
13 112 GLY n 
13 113 LEU n 
13 114 ASP n 
13 115 GLU n 
13 116 GLU n 
13 117 GLY n 
13 118 LYS n 
13 119 GLY n 
13 120 ALA n 
13 121 VAL n 
13 122 TYR n 
13 123 SER n 
13 124 PHE n 
13 125 ASP n 
13 126 PRO n 
13 127 VAL n 
13 128 GLY n 
13 129 SER n 
13 130 TYR n 
13 131 GLN n 
13 132 ARG n 
13 133 ASP n 
13 134 SER n 
13 135 PHE n 
13 136 LYS n 
13 137 ALA n 
13 138 GLY n 
13 139 GLY n 
13 140 SER n 
13 141 ALA n 
13 142 SER n 
13 143 ALA n 
13 144 MET n 
13 145 LEU n 
13 146 GLN n 
13 147 PRO n 
13 148 LEU n 
13 149 LEU n 
13 150 ASP n 
13 151 ASN n 
13 152 GLN n 
13 153 VAL n 
13 154 GLY n 
13 155 PHE n 
13 156 LYS n 
13 157 ASN n 
13 158 MET n 
13 159 GLN n 
13 160 ASN n 
13 161 VAL n 
13 162 GLU n 
13 163 HIS n 
13 164 VAL n 
13 165 PRO n 
13 166 LEU n 
13 167 SER n 
13 168 LEU n 
13 169 ASP n 
13 170 ARG n 
13 171 ALA n 
13 172 MET n 
13 173 ARG n 
13 174 LEU n 
13 175 VAL n 
13 176 LYS n 
13 177 ASP n 
13 178 VAL n 
13 179 PHE n 
13 180 ILE n 
13 181 SER n 
13 182 ALA n 
13 183 ALA n 
13 184 GLU n 
13 185 ARG n 
13 186 ASP n 
13 187 VAL n 
13 188 TYR n 
13 189 THR n 
13 190 GLY n 
13 191 ASP n 
13 192 ALA n 
13 193 LEU n 
13 194 ARG n 
13 195 ILE n 
13 196 CYS n 
13 197 ILE n 
13 198 VAL n 
13 199 THR n 
13 200 LYS n 
13 201 GLU n 
13 202 GLY n 
13 203 ILE n 
13 204 ARG n 
13 205 GLU n 
13 206 GLU n 
13 207 THR n 
13 208 VAL n 
13 209 SER n 
13 210 LEU n 
13 211 ARG n 
13 212 LYS n 
13 213 ASP n 
14 1   THR n 
14 2   GLN n 
14 3   ASN n 
14 4   PRO n 
14 5   MET n 
14 6   VAL n 
14 7   THR n 
14 8   GLY n 
14 9   THR n 
14 10  SER n 
14 11  VAL n 
14 12  LEU n 
14 13  GLY n 
14 14  VAL n 
14 15  LYS n 
14 16  PHE n 
14 17  GLU n 
14 18  GLY n 
14 19  GLY n 
14 20  VAL n 
14 21  VAL n 
14 22  ILE n 
14 23  ALA n 
14 24  ALA n 
14 25  ASP n 
14 26  MET n 
14 27  LEU n 
14 28  GLY n 
14 29  SER n 
14 30  TYR n 
14 31  GLY n 
14 32  SER n 
14 33  LEU n 
14 34  ALA n 
14 35  ARG n 
14 36  PHE n 
14 37  ARG n 
14 38  ASN n 
14 39  ILE n 
14 40  SER n 
14 41  ARG n 
14 42  ILE n 
14 43  MET n 
14 44  ARG n 
14 45  VAL n 
14 46  ASN n 
14 47  ASN n 
14 48  SER n 
14 49  THR n 
14 50  MET n 
14 51  LEU n 
14 52  GLY n 
14 53  ALA n 
14 54  SER n 
14 55  GLY n 
14 56  ASP n 
14 57  TYR n 
14 58  ALA n 
14 59  ASP n 
14 60  PHE n 
14 61  GLN n 
14 62  TYR n 
14 63  LEU n 
14 64  LYS n 
14 65  GLN n 
14 66  VAL n 
14 67  LEU n 
14 68  GLY n 
14 69  GLN n 
14 70  MET n 
14 71  VAL n 
14 72  ILE n 
14 73  ASP n 
14 74  GLU n 
14 75  GLU n 
14 76  LEU n 
14 77  LEU n 
14 78  GLY n 
14 79  ASP n 
14 80  GLY n 
14 81  HIS n 
14 82  SER n 
14 83  TYR n 
14 84  SER n 
14 85  PRO n 
14 86  ARG n 
14 87  ALA n 
14 88  ILE n 
14 89  HIS n 
14 90  SER n 
14 91  TRP n 
14 92  LEU n 
14 93  THR n 
14 94  ARG n 
14 95  ALA n 
14 96  MET n 
14 97  TYR n 
14 98  SER n 
14 99  ARG n 
14 100 ARG n 
14 101 SER n 
14 102 LYS n 
14 103 MET n 
14 104 ASN n 
14 105 PRO n 
14 106 LEU n 
14 107 TRP n 
14 108 ASN n 
14 109 THR n 
14 110 MET n 
14 111 VAL n 
14 112 ILE n 
14 113 GLY n 
14 114 GLY n 
14 115 TYR n 
14 116 ALA n 
14 117 ASP n 
14 118 GLY n 
14 119 GLU n 
14 120 SER n 
14 121 PHE n 
14 122 LEU n 
14 123 GLY n 
14 124 TYR n 
14 125 VAL n 
14 126 ASP n 
14 127 MET n 
14 128 LEU n 
14 129 GLY n 
14 130 VAL n 
14 131 ALA n 
14 132 TYR n 
14 133 GLU n 
14 134 ALA n 
14 135 PRO n 
14 136 SER n 
14 137 LEU n 
14 138 ALA n 
14 139 THR n 
14 140 GLY n 
14 141 TYR n 
14 142 GLY n 
14 143 ALA n 
14 144 TYR n 
14 145 LEU n 
14 146 ALA n 
14 147 GLN n 
14 148 PRO n 
14 149 LEU n 
14 150 LEU n 
14 151 ARG n 
14 152 GLU n 
14 153 VAL n 
14 154 LEU n 
14 155 GLU n 
14 156 LYS n 
14 157 GLN n 
14 158 PRO n 
14 159 VAL n 
14 160 LEU n 
14 161 SER n 
14 162 GLN n 
14 163 THR n 
14 164 GLU n 
14 165 ALA n 
14 166 ARG n 
14 167 ASP n 
14 168 LEU n 
14 169 VAL n 
14 170 GLU n 
14 171 ARG n 
14 172 CYS n 
14 173 MET n 
14 174 ARG n 
14 175 VAL n 
14 176 LEU n 
14 177 TYR n 
14 178 TYR n 
14 179 ARG n 
14 180 ASP n 
14 181 ALA n 
14 182 ARG n 
14 183 SER n 
14 184 TYR n 
14 185 ASN n 
14 186 ARG n 
14 187 PHE n 
14 188 GLN n 
14 189 ILE n 
14 190 ALA n 
14 191 THR n 
14 192 VAL n 
14 193 THR n 
14 194 GLU n 
14 195 LYS n 
14 196 GLY n 
14 197 VAL n 
14 198 GLU n 
14 199 ILE n 
14 200 GLU n 
14 201 GLY n 
14 202 PRO n 
14 203 LEU n 
14 204 SER n 
14 205 THR n 
14 206 GLU n 
14 207 THR n 
14 208 ASN n 
14 209 TRP n 
14 210 ASP n 
14 211 ILE n 
14 212 ALA n 
14 213 HIS n 
14 214 MET n 
14 215 ILE n 
14 216 SER n 
14 217 GLY n 
14 218 PHE n 
14 219 GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
2  1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
3  1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
4  1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
5  1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
6  1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
7  1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
8  1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
9  1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
10 1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
11 1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
12 1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
13 1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
14 1 sample ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTES ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP PSA6_HUMAN 1  ? ? P60900 ? 
2  UNP PSA2_HUMAN 2  ? ? P25787 ? 
3  UNP PSA4_HUMAN 3  ? ? P25789 ? 
4  UNP PSA7_HUMAN 4  ? ? O14818 ? 
5  UNP PSA5_HUMAN 5  ? ? P28066 ? 
6  UNP PSA1_HUMAN 6  ? ? P25786 ? 
7  UNP PSA3_HUMAN 7  ? ? P25788 ? 
8  UNP PSB6_HUMAN 8  ? ? P28072 ? 
9  UNP PSB7_HUMAN 9  ? ? Q99436 ? 
10 UNP PSB3_HUMAN 10 ? ? P49720 ? 
11 UNP PSB2_HUMAN 11 ? ? P49721 ? 
12 UNP PSB5_HUMAN 12 ? ? P28074 ? 
13 UNP PSB1_HUMAN 13 ? ? P20618 ? 
14 UNP PSB4_HUMAN 14 ? ? P28070 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5A0Q A 1 ? 246 ? P60900 1  ? 246 ? 1 246 
2  2  5A0Q B 1 ? 234 ? P25787 1  ? 234 ? 0 233 
3  3  5A0Q C 1 ? 261 ? P25789 1  ? 261 ? 1 261 
4  4  5A0Q D 1 ? 248 ? O14818 1  ? 248 ? 1 248 
5  5  5A0Q E 1 ? 241 ? P28066 1  ? 241 ? 1 241 
6  6  5A0Q F 1 ? 263 ? P25786 1  ? 263 ? 1 263 
7  7  5A0Q G 1 ? 255 ? P25788 1  ? 255 ? 0 254 
8  8  5A0Q H 1 ? 205 ? P28072 35 ? 239 ? 1 205 
9  9  5A0Q I 1 ? 234 ? Q99436 44 ? 277 ? 1 234 
10 10 5A0Q J 1 ? 204 ? P49720 2  ? 205 ? 1 204 
11 11 5A0Q K 1 ? 201 ? P49721 1  ? 201 ? 1 201 
12 12 5A0Q L 1 ? 204 ? P28074 60 ? 263 ? 1 204 
13 13 5A0Q M 1 ? 213 ? P20618 29 ? 241 ? 1 213 
14 14 5A0Q N 1 ? 219 ? P28070 46 ? 264 ? 1 219 
15 1  5A0Q O 1 ? 246 ? P60900 1  ? 246 ? 1 246 
16 2  5A0Q P 1 ? 234 ? P25787 1  ? 234 ? 0 233 
17 3  5A0Q Q 1 ? 261 ? P25789 1  ? 261 ? 1 261 
18 4  5A0Q R 1 ? 248 ? O14818 1  ? 248 ? 1 248 
19 5  5A0Q S 1 ? 241 ? P28066 1  ? 241 ? 1 241 
20 6  5A0Q T 1 ? 263 ? P25786 1  ? 263 ? 1 263 
21 7  5A0Q U 1 ? 255 ? P25788 1  ? 255 ? 0 254 
22 8  5A0Q V 1 ? 205 ? P28072 35 ? 239 ? 1 205 
23 9  5A0Q W 1 ? 234 ? Q99436 44 ? 277 ? 1 234 
24 10 5A0Q X 1 ? 204 ? P49720 2  ? 205 ? 1 204 
25 11 5A0Q Y 1 ? 201 ? P49721 1  ? 201 ? 1 201 
26 12 5A0Q Z 1 ? 204 ? P28074 60 ? 263 ? 1 204 
27 13 5A0Q a 1 ? 213 ? P20618 29 ? 241 ? 1 213 
28 14 5A0Q b 1 ? 219 ? P28070 46 ? 264 ? 1 219 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'     131.173 
KNM non-polymer         . 'ADA-(AHX)3-(LEU)3-VINYL SULFONE' ? 'C51 H92 N6 O8 S' 949.377 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          5A0Q 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 5A0Q 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            3.50 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        43264 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         184 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               43448 
_refine_hist.d_res_high                       3.50 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  5A0Q 
_struct.title                     'Cryo-EM reveals the conformation of a substrate analogue in the human 20S proteasome core' 
_struct.pdbx_descriptor           
;PROTEASOME SUBUNIT ALPHA TYPE-6 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-2 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-4 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-7 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-5 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-1 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-3 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-6 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-7 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-3 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-2 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-5 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-1 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-4 (E.C.3.4.25.1)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5A0Q 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, PROTEASOME, 20S, ADAAHX3L3VS, LIGAND, INHIBITOR, DRUG DESIGN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 1  ? 
P  N N 2  ? 
Q  N N 3  ? 
R  N N 4  ? 
S  N N 5  ? 
T  N N 6  ? 
U  N N 7  ? 
V  N N 8  ? 
W  N N 9  ? 
X  N N 10 ? 
Y  N N 11 ? 
Z  N N 12 ? 
AA N N 13 ? 
BA N N 14 ? 
CA N N 15 ? 
DA N N 15 ? 
EA N N 15 ? 
FA N N 15 ? 
GA N N 15 ? 
HA N N 15 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   TYR A  23  ? GLY A  35  ? TYR A 23  GLY A 35  1 ? 13 
HELX_P HELX_P2   2   THR A  84  ? TYR A  105 ? THR A 84  TYR A 105 1 ? 22 
HELX_P HELX_P3   3   VAL A  111 ? GLN A  127 ? VAL A 111 GLN A 127 1 ? 17 
HELX_P HELX_P4   4   GLN A  172 ? LYS A  181 ? GLN A 172 LYS A 181 1 ? 10 
HELX_P HELX_P5   5   THR A  194 ? LEU A  206 ? THR A 194 LEU A 206 1 ? 13 
HELX_P HELX_P6   6   PRO A  212 ? GLU A  214 ? PRO A 212 GLU A 214 1 ? 3  
HELX_P HELX_P7   7   VAL B  20  ? ALA B  30  ? VAL B 19  ALA B 29  1 ? 11 
HELX_P HELX_P8   8   GLY B  80  ? TYR B  101 ? GLY B 79  TYR B 100 1 ? 22 
HELX_P HELX_P9   9   THR B  107 ? GLN B  123 ? THR B 106 GLN B 122 1 ? 17 
HELX_P HELX_P10  10  TYR B  167 ? ARG B  177 ? TYR B 166 ARG B 176 1 ? 11 
HELX_P HELX_P11  11  LEU B  184 ? GLU B  197 ? LEU B 183 GLU B 196 1 ? 14 
HELX_P HELX_P12  12  ARG C  3   ? TYR C  5   ? ARG C 3   TYR C 5   1 ? 3  
HELX_P HELX_P13  13  TYR C  19  ? HIS C  30  ? TYR C 19  HIS C 30  1 ? 12 
HELX_P HELX_P14  14  ASP C  82  ? TYR C  101 ? ASP C 82  TYR C 101 1 ? 20 
HELX_P HELX_P15  15  CYS C  107 ? GLN C  123 ? CYS C 107 GLN C 123 1 ? 17 
HELX_P HELX_P16  16  SER C  168 ? ASP C  178 ? SER C 168 ASP C 178 1 ? 11 
HELX_P HELX_P17  17  LEU C  186 ? THR C  200 ? LEU C 186 THR C 200 1 ? 15 
HELX_P HELX_P18  18  GLN C  230 ? GLU C  243 ? GLN C 230 GLU C 243 1 ? 14 
HELX_P HELX_P19  19  PHE D  17  ? LYS D  28  ? PHE D 17  LYS D 28  1 ? 12 
HELX_P HELX_P20  20  THR D  77  ? THR D  97  ? THR D 77  THR D 97  1 ? 21 
HELX_P HELX_P21  21  VAL D  104 ? THR D  119 ? VAL D 104 THR D 119 1 ? 16 
HELX_P HELX_P22  22  ALA D  165 ? LYS D  174 ? ALA D 165 LYS D 174 1 ? 10 
HELX_P HELX_P23  23  ASP D  185 ? VAL D  198 ? ASP D 185 VAL D 198 1 ? 14 
HELX_P HELX_P24  24  GLU D  223 ? LYS D  234 ? GLU D 223 LYS D 234 1 ? 12 
HELX_P HELX_P25  25  PHE E  22  ? LEU E  33  ? PHE E 22  LEU E 33  1 ? 12 
HELX_P HELX_P26  26  ILE E  82  ? TYR E  103 ? ILE E 82  TYR E 103 1 ? 22 
HELX_P HELX_P27  27  VAL E  109 ? ALA E  120 ? VAL E 109 ALA E 120 1 ? 12 
HELX_P HELX_P28  28  SER E  174 ? VAL E  184 ? SER E 174 VAL E 184 1 ? 11 
HELX_P HELX_P29  29  LEU E  191 ? VAL E  205 ? LEU E 191 VAL E 205 1 ? 15 
HELX_P HELX_P30  30  LYS E  231 ? GLU E  235 ? LYS E 231 GLU E 235 1 ? 5  
HELX_P HELX_P31  31  HIS F  20  ? GLN F  31  ? HIS F 20  GLN F 31  1 ? 12 
HELX_P HELX_P32  32  THR F  78  ? VAL F  98  ? THR F 78  VAL F 98  1 ? 21 
HELX_P HELX_P33  33  VAL F  105 ? GLN F  121 ? VAL F 105 GLN F 121 1 ? 17 
HELX_P HELX_P34  34  SER F  165 ? ARG F  174 ? SER F 165 ARG F 174 1 ? 10 
HELX_P HELX_P35  35  LEU F  184 ? ARG F  196 ? LEU F 184 ARG F 196 1 ? 13 
HELX_P HELX_P36  36  PHE G  22  ? ASN G  33  ? PHE G 21  ASN G 32  1 ? 12 
HELX_P HELX_P37  37  LEU G  82  ? PHE G  103 ? LEU G 81  PHE G 102 1 ? 22 
HELX_P HELX_P38  38  LEU G  109 ? LEU G  125 ? LEU G 108 LEU G 124 1 ? 17 
HELX_P HELX_P39  39  ALA G  173 ? LYS G  179 ? ALA G 172 LYS G 178 1 ? 7  
HELX_P HELX_P40  40  CYS G  187 ? VAL G  201 ? CYS G 186 VAL G 200 1 ? 15 
HELX_P HELX_P41  41  LYS G  230 ? GLU G  237 ? LYS G 229 GLU G 236 1 ? 8  
HELX_P HELX_P42  42  ALA H  49  ? ALA H  54  ? ALA H 49  ALA H 54  1 ? 6  
HELX_P HELX_P43  43  ASP H  57  ? LEU H  70  ? ASP H 57  LEU H 70  1 ? 14 
HELX_P HELX_P44  44  VAL H  76  ? ARG H  89  ? VAL H 76  ARG H 89  1 ? 14 
HELX_P HELX_P45  45  SER H  132 ? ASP H  140 ? SER H 132 ASP H 140 1 ? 9  
HELX_P HELX_P46  46  LYS H  149 ? ARG H  166 ? LYS H 149 ARG H 166 1 ? 18 
HELX_P HELX_P47  47  ALA I  49  ? THR I  70  ? ALA I 49  THR I 70  1 ? 22 
HELX_P HELX_P48  48  VAL I  76  ? ARG I  89  ? VAL I 76  ARG I 89  1 ? 14 
HELX_P HELX_P49  49  GLY I  130 ? LYS I  141 ? GLY I 130 LYS I 141 1 ? 12 
HELX_P HELX_P50  50  GLU I  148 ? ASN I  165 ? GLU I 148 ASN I 165 1 ? 18 
HELX_P HELX_P51  51  ALA J  56  ? LYS J  76  ? ALA J 56  LYS J 76  1 ? 21 
HELX_P HELX_P52  52  PRO J  83  ? GLU J  96  ? PRO J 83  GLU J 96  1 ? 14 
HELX_P HELX_P53  53  PRO J  159 ? ARG J  176 ? PRO J 159 ARG J 176 1 ? 18 
HELX_P HELX_P54  54  GLY K  51  ? ASN K  71  ? GLY K 51  ASN K 71  1 ? 21 
HELX_P HELX_P55  55  PRO K  77  ? ARG K  93  ? PRO K 77  ARG K 93  1 ? 17 
HELX_P HELX_P56  56  GLY K  135 ? TYR K  146 ? GLY K 135 TYR K 146 1 ? 12 
HELX_P HELX_P57  57  ARG K  153 ? ARG K  170 ? ARG K 153 ARG K 170 1 ? 18 
HELX_P HELX_P58  58  ALA L  49  ? ASN L  70  ? ALA L 49  ASN L 70  1 ? 22 
HELX_P HELX_P59  59  VAL L  76  ? TYR L  90  ? VAL L 76  TYR L 90  1 ? 15 
HELX_P HELX_P60  60  SER L  132 ? GLY L  142 ? SER L 132 GLY L 142 1 ? 11 
HELX_P HELX_P61  61  VAL L  149 ? ARG L  166 ? VAL L 149 ARG L 166 1 ? 18 
HELX_P HELX_P62  62  HIS M  58  ? ASN M  79  ? HIS M 58  ASN M 79  1 ? 22 
HELX_P HELX_P63  63  THR M  85  ? SER M  98  ? THR M 85  SER M 98  1 ? 14 
HELX_P HELX_P64  64  SER M  142 ? VAL M  153 ? SER M 142 VAL M 153 1 ? 12 
HELX_P HELX_P65  65  LEU M  168 ? ARG M  185 ? LEU M 168 ARG M 185 1 ? 18 
HELX_P HELX_P66  66  TYR N  57  ? LEU N  76  ? TYR N 57  LEU N 76  1 ? 20 
HELX_P HELX_P67  67  PRO N  85  ? LYS N  102 ? PRO N 85  LYS N 102 1 ? 18 
HELX_P HELX_P68  68  ALA N  146 ? LYS N  156 ? ALA N 146 LYS N 156 1 ? 11 
HELX_P HELX_P69  69  THR N  163 ? ARG N  174 ? THR N 163 ARG N 174 1 ? 12 
HELX_P HELX_P70  70  TYR O  23  ? GLY O  35  ? TYR O 23  GLY O 35  1 ? 13 
HELX_P HELX_P71  71  THR O  84  ? TYR O  105 ? THR O 84  TYR O 105 1 ? 22 
HELX_P HELX_P72  72  VAL O  111 ? GLN O  127 ? VAL O 111 GLN O 127 1 ? 17 
HELX_P HELX_P73  73  GLN O  172 ? LYS O  181 ? GLN O 172 LYS O 181 1 ? 10 
HELX_P HELX_P74  74  THR O  194 ? LEU O  206 ? THR O 194 LEU O 206 1 ? 13 
HELX_P HELX_P75  75  PRO O  212 ? GLU O  214 ? PRO O 212 GLU O 214 1 ? 3  
HELX_P HELX_P76  76  VAL P  20  ? ALA P  30  ? VAL P 19  ALA P 29  1 ? 11 
HELX_P HELX_P77  77  GLY P  80  ? TYR P  101 ? GLY P 79  TYR P 100 1 ? 22 
HELX_P HELX_P78  78  THR P  107 ? GLN P  123 ? THR P 106 GLN P 122 1 ? 17 
HELX_P HELX_P79  79  TYR P  167 ? ARG P  177 ? TYR P 166 ARG P 176 1 ? 11 
HELX_P HELX_P80  80  LEU P  184 ? GLU P  197 ? LEU P 183 GLU P 196 1 ? 14 
HELX_P HELX_P81  81  ARG Q  3   ? TYR Q  5   ? ARG Q 3   TYR Q 5   1 ? 3  
HELX_P HELX_P82  82  TYR Q  19  ? HIS Q  30  ? TYR Q 19  HIS Q 30  1 ? 12 
HELX_P HELX_P83  83  ASP Q  82  ? TYR Q  101 ? ASP Q 82  TYR Q 101 1 ? 20 
HELX_P HELX_P84  84  CYS Q  107 ? GLN Q  123 ? CYS Q 107 GLN Q 123 1 ? 17 
HELX_P HELX_P85  85  SER Q  168 ? ASP Q  178 ? SER Q 168 ASP Q 178 1 ? 11 
HELX_P HELX_P86  86  LEU Q  186 ? THR Q  200 ? LEU Q 186 THR Q 200 1 ? 15 
HELX_P HELX_P87  87  GLN Q  230 ? GLU Q  243 ? GLN Q 230 GLU Q 243 1 ? 14 
HELX_P HELX_P88  88  PHE R  17  ? LYS R  28  ? PHE R 17  LYS R 28  1 ? 12 
HELX_P HELX_P89  89  THR R  77  ? THR R  97  ? THR R 77  THR R 97  1 ? 21 
HELX_P HELX_P90  90  VAL R  104 ? THR R  119 ? VAL R 104 THR R 119 1 ? 16 
HELX_P HELX_P91  91  ALA R  165 ? LYS R  174 ? ALA R 165 LYS R 174 1 ? 10 
HELX_P HELX_P92  92  ASP R  185 ? VAL R  198 ? ASP R 185 VAL R 198 1 ? 14 
HELX_P HELX_P93  93  GLU R  223 ? LYS R  234 ? GLU R 223 LYS R 234 1 ? 12 
HELX_P HELX_P94  94  PHE S  22  ? LEU S  33  ? PHE S 22  LEU S 33  1 ? 12 
HELX_P HELX_P95  95  ILE S  82  ? TYR S  103 ? ILE S 82  TYR S 103 1 ? 22 
HELX_P HELX_P96  96  VAL S  109 ? ALA S  120 ? VAL S 109 ALA S 120 1 ? 12 
HELX_P HELX_P97  97  SER S  174 ? VAL S  184 ? SER S 174 VAL S 184 1 ? 11 
HELX_P HELX_P98  98  LEU S  191 ? VAL S  205 ? LEU S 191 VAL S 205 1 ? 15 
HELX_P HELX_P99  99  LYS S  231 ? GLU S  235 ? LYS S 231 GLU S 235 1 ? 5  
HELX_P HELX_P100 100 HIS T  20  ? GLN T  31  ? HIS T 20  GLN T 31  1 ? 12 
HELX_P HELX_P101 101 THR T  78  ? VAL T  98  ? THR T 78  VAL T 98  1 ? 21 
HELX_P HELX_P102 102 VAL T  105 ? GLN T  121 ? VAL T 105 GLN T 121 1 ? 17 
HELX_P HELX_P103 103 SER T  165 ? ARG T  174 ? SER T 165 ARG T 174 1 ? 10 
HELX_P HELX_P104 104 LEU T  184 ? ARG T  196 ? LEU T 184 ARG T 196 1 ? 13 
HELX_P HELX_P105 105 PHE U  22  ? ASN U  33  ? PHE U 21  ASN U 32  1 ? 12 
HELX_P HELX_P106 106 LEU U  82  ? PHE U  103 ? LEU U 81  PHE U 102 1 ? 22 
HELX_P HELX_P107 107 LEU U  109 ? LEU U  125 ? LEU U 108 LEU U 124 1 ? 17 
HELX_P HELX_P108 108 ALA U  173 ? LYS U  179 ? ALA U 172 LYS U 178 1 ? 7  
HELX_P HELX_P109 109 CYS U  187 ? VAL U  201 ? CYS U 186 VAL U 200 1 ? 15 
HELX_P HELX_P110 110 LYS U  230 ? GLU U  237 ? LYS U 229 GLU U 236 1 ? 8  
HELX_P HELX_P111 111 ALA V  49  ? ALA V  54  ? ALA V 49  ALA V 54  1 ? 6  
HELX_P HELX_P112 112 ASP V  57  ? LEU V  70  ? ASP V 57  LEU V 70  1 ? 14 
HELX_P HELX_P113 113 VAL V  76  ? ARG V  89  ? VAL V 76  ARG V 89  1 ? 14 
HELX_P HELX_P114 114 SER V  132 ? ASP V  140 ? SER V 132 ASP V 140 1 ? 9  
HELX_P HELX_P115 115 LYS V  149 ? ARG V  166 ? LYS V 149 ARG V 166 1 ? 18 
HELX_P HELX_P116 116 ALA W  49  ? THR W  70  ? ALA W 49  THR W 70  1 ? 22 
HELX_P HELX_P117 117 VAL W  76  ? ARG W  89  ? VAL W 76  ARG W 89  1 ? 14 
HELX_P HELX_P118 118 GLY W  130 ? LYS W  141 ? GLY W 130 LYS W 141 1 ? 12 
HELX_P HELX_P119 119 GLU W  148 ? ASN W  165 ? GLU W 148 ASN W 165 1 ? 18 
HELX_P HELX_P120 120 ALA X  56  ? LYS X  76  ? ALA X 56  LYS X 76  1 ? 21 
HELX_P HELX_P121 121 PRO X  83  ? GLU X  96  ? PRO X 83  GLU X 96  1 ? 14 
HELX_P HELX_P122 122 PRO X  159 ? ARG X  176 ? PRO X 159 ARG X 176 1 ? 18 
HELX_P HELX_P123 123 GLY Y  51  ? ASN Y  71  ? GLY Y 51  ASN Y 71  1 ? 21 
HELX_P HELX_P124 124 PRO Y  77  ? ARG Y  93  ? PRO Y 77  ARG Y 93  1 ? 17 
HELX_P HELX_P125 125 GLY Y  135 ? TYR Y  146 ? GLY Y 135 TYR Y 146 1 ? 12 
HELX_P HELX_P126 126 ARG Y  153 ? ARG Y  170 ? ARG Y 153 ARG Y 170 1 ? 18 
HELX_P HELX_P127 127 ALA Z  49  ? ASN Z  70  ? ALA Z 49  ASN Z 70  1 ? 22 
HELX_P HELX_P128 128 VAL Z  76  ? TYR Z  90  ? VAL Z 76  TYR Z 90  1 ? 15 
HELX_P HELX_P129 129 SER Z  132 ? GLY Z  142 ? SER Z 132 GLY Z 142 1 ? 11 
HELX_P HELX_P130 130 VAL Z  149 ? ARG Z  166 ? VAL Z 149 ARG Z 166 1 ? 18 
HELX_P HELX_P131 131 HIS AA 58  ? ASN AA 79  ? HIS a 58  ASN a 79  1 ? 22 
HELX_P HELX_P132 132 THR AA 85  ? SER AA 98  ? THR a 85  SER a 98  1 ? 14 
HELX_P HELX_P133 133 SER AA 142 ? VAL AA 153 ? SER a 142 VAL a 153 1 ? 12 
HELX_P HELX_P134 134 LEU AA 168 ? ARG AA 185 ? LEU a 168 ARG a 185 1 ? 18 
HELX_P HELX_P135 135 TYR BA 57  ? LEU BA 76  ? TYR b 57  LEU b 76  1 ? 20 
HELX_P HELX_P136 136 PRO BA 85  ? LYS BA 102 ? PRO b 85  LYS b 102 1 ? 18 
HELX_P HELX_P137 137 ALA BA 146 ? LYS BA 156 ? ALA b 146 LYS b 156 1 ? 11 
HELX_P HELX_P138 138 THR BA 163 ? ARG BA 174 ? THR b 163 ARG b 174 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? M  CYS 54 SG  ? ? ? 1_555 M  CYS 61 SG  ? ? M CYS 54 M CYS 61  1_555 ? ? ? ? ? ? ? 2.007 ? 
disulf2 disulf ? ? AA CYS 54 SG  ? ? ? 1_555 AA CYS 61 SG  ? ? a CYS 54 a CYS 61  1_555 ? ? ? ? ? ? ? 2.007 ? 
covale1 covale ? ? H  THR 1  OG1 ? ? ? 1_555 CA KNM .  C21 ? ? H THR 1  H KNM 300 1_555 ? ? ? ? ? ? ? 1.428 ? 
covale2 covale ? ? I  THR 1  OG1 ? ? ? 1_555 DA KNM .  C21 ? ? I THR 1  I KNM 300 1_555 ? ? ? ? ? ? ? 1.426 ? 
covale3 covale ? ? L  THR 1  OG1 ? ? ? 1_555 EA KNM .  C21 ? ? L THR 1  L KNM 300 1_555 ? ? ? ? ? ? ? 1.423 ? 
covale4 covale ? ? V  THR 1  OG1 ? ? ? 1_555 FA KNM .  C21 ? ? V THR 1  V KNM 300 1_555 ? ? ? ? ? ? ? 1.428 ? 
covale5 covale ? ? W  THR 1  OG1 ? ? ? 1_555 GA KNM .  C21 ? ? W THR 1  W KNM 300 1_555 ? ? ? ? ? ? ? 1.426 ? 
covale6 covale ? ? Z  THR 1  OG1 ? ? ? 1_555 HA KNM .  C21 ? ? Z THR 1  Z KNM 300 1_555 ? ? ? ? ? ? ? 1.423 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1   ? 1 ? 
2   ? 1 ? 
3   ? 1 ? 
4   ? 1 ? 
5   ? 1 ? 
6   ? 1 ? 
7   ? 1 ? 
8   ? 1 ? 
9   ? 1 ? 
10  ? 1 ? 
11  ? 1 ? 
12  ? 1 ? 
13  ? 1 ? 
14  ? 1 ? 
15  ? 1 ? 
16  ? 1 ? 
17  ? 1 ? 
18  ? 1 ? 
19  ? 1 ? 
20  ? 1 ? 
21  ? 1 ? 
22  ? 1 ? 
23  ? 1 ? 
24  ? 1 ? 
25  ? 1 ? 
26  ? 1 ? 
27  ? 1 ? 
28  ? 1 ? 
29  ? 1 ? 
30  ? 1 ? 
31  ? 1 ? 
32  ? 1 ? 
33  ? 1 ? 
34  ? 1 ? 
35  ? 1 ? 
36  ? 1 ? 
37  ? 1 ? 
38  ? 1 ? 
39  ? 1 ? 
40  ? 1 ? 
41  ? 1 ? 
42  ? 1 ? 
43  ? 1 ? 
44  ? 1 ? 
45  ? 1 ? 
46  ? 1 ? 
47  ? 1 ? 
48  ? 1 ? 
49  ? 1 ? 
50  ? 1 ? 
51  ? 1 ? 
52  ? 1 ? 
53  ? 1 ? 
54  ? 1 ? 
55  ? 1 ? 
56  ? 1 ? 
57  ? 1 ? 
58  ? 1 ? 
59  ? 1 ? 
60  ? 1 ? 
61  ? 1 ? 
62  ? 1 ? 
63  ? 1 ? 
64  ? 1 ? 
65  ? 1 ? 
66  ? 1 ? 
67  ? 1 ? 
68  ? 1 ? 
69  ? 1 ? 
70  ? 1 ? 
71  ? 1 ? 
72  ? 1 ? 
73  ? 1 ? 
74  ? 1 ? 
75  ? 1 ? 
76  ? 1 ? 
77  ? 1 ? 
78  ? 1 ? 
79  ? 1 ? 
80  ? 1 ? 
81  ? 1 ? 
82  ? 1 ? 
83  ? 1 ? 
84  ? 1 ? 
85  ? 1 ? 
86  ? 1 ? 
87  ? 1 ? 
88  ? 1 ? 
89  ? 1 ? 
90  ? 1 ? 
91  ? 1 ? 
92  ? 1 ? 
93  ? 1 ? 
94  ? 1 ? 
95  ? 1 ? 
96  ? 1 ? 
97  ? 1 ? 
98  ? 1 ? 
99  ? 1 ? 
100 ? 1 ? 
101 ? 1 ? 
102 ? 1 ? 
103 ? 1 ? 
104 ? 1 ? 
105 ? 1 ? 
106 ? 1 ? 
107 ? 1 ? 
108 ? 1 ? 
109 ? 1 ? 
110 ? 1 ? 
111 ? 1 ? 
112 ? 1 ? 
113 ? 1 ? 
114 ? 1 ? 
115 ? 1 ? 
116 ? 1 ? 
117 ? 1 ? 
118 ? 1 ? 
119 ? 1 ? 
120 ? 1 ? 
121 ? 1 ? 
122 ? 1 ? 
123 ? 1 ? 
124 ? 1 ? 
125 ? 1 ? 
126 ? 1 ? 
127 ? 1 ? 
128 ? 1 ? 
129 ? 1 ? 
130 ? 1 ? 
131 ? 1 ? 
132 ? 1 ? 
133 ? 1 ? 
134 ? 1 ? 
135 ? 1 ? 
136 ? 1 ? 
137 ? 1 ? 
138 ? 1 ? 
139 ? 1 ? 
140 ? 1 ? 
141 ? 1 ? 
142 ? 1 ? 
143 ? 1 ? 
144 ? 1 ? 
145 ? 1 ? 
146 ? 1 ? 
147 ? 1 ? 
148 ? 1 ? 
149 ? 1 ? 
150 ? 1 ? 
151 ? 1 ? 
152 ? 1 ? 
153 ? 1 ? 
154 ? 1 ? 
155 ? 1 ? 
156 ? 1 ? 
157 ? 1 ? 
158 ? 1 ? 
159 ? 1 ? 
160 ? 1 ? 
161 ? 1 ? 
162 ? 1 ? 
163 ? 1 ? 
164 ? 1 ? 
165 ? 1 ? 
166 ? 1 ? 
167 ? 1 ? 
168 ? 1 ? 
169 ? 1 ? 
170 ? 1 ? 
171 ? 1 ? 
172 ? 1 ? 
173 ? 1 ? 
174 ? 1 ? 
175 ? 1 ? 
176 ? 1 ? 
177 ? 1 ? 
178 ? 1 ? 
179 ? 1 ? 
180 ? 1 ? 
181 ? 1 ? 
182 ? 1 ? 
183 ? 1 ? 
184 ? 1 ? 
185 ? 1 ? 
186 ? 1 ? 
187 ? 1 ? 
188 ? 1 ? 
189 ? 1 ? 
190 ? 1 ? 
191 ? 1 ? 
192 ? 1 ? 
193 ? 1 ? 
194 ? 1 ? 
195 ? 1 ? 
196 ? 1 ? 
197 ? 1 ? 
198 ? 1 ? 
199 ? 1 ? 
200 ? 1 ? 
201 ? 1 ? 
202 ? 1 ? 
203 ? 1 ? 
204 ? 1 ? 
205 ? 1 ? 
206 ? 1 ? 
207 ? 1 ? 
208 ? 1 ? 
209 ? 1 ? 
210 ? 1 ? 
211 ? 1 ? 
212 ? 1 ? 
213 ? 1 ? 
214 ? 1 ? 
215 ? 1 ? 
216 ? 1 ? 
217 ? 1 ? 
218 ? 1 ? 
219 ? 1 ? 
220 ? 1 ? 
221 ? 1 ? 
222 ? 1 ? 
223 ? 1 ? 
224 ? 1 ? 
225 ? 1 ? 
226 ? 1 ? 
227 ? 1 ? 
228 ? 1 ? 
229 ? 1 ? 
230 ? 1 ? 
231 ? 1 ? 
232 ? 1 ? 
233 ? 1 ? 
234 ? 1 ? 
235 ? 1 ? 
236 ? 1 ? 
237 ? 1 ? 
238 ? 1 ? 
239 ? 1 ? 
240 ? 1 ? 
241 ? 1 ? 
242 ? 1 ? 
243 ? 1 ? 
244 ? 1 ? 
245 ? 1 ? 
246 ? 1 ? 
247 ? 1 ? 
248 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1   1 VAL A  40  ? ARG A  43  ? VAL A 40  ARG A 43  
2   1 ALA A  48  ? THR A  52  ? ALA A 48  THR A 52  
3   1 PHE A  70  ? THR A  73  ? PHE A 70  THR A 73  
4   1 ILE A  76  ? THR A  81  ? ILE A 76  THR A 81  
5   1 CYS A  136 ? ASP A  144 ? CYS A 136 ASP A 144 
6   1 GLY A  148 ? ASP A  155 ? GLY A 148 ASP A 155 
7   1 GLY A  158 ? GLY A  162 ? GLY A 158 GLY A 162 
8   1 GLU A  216 ? GLY A  218 ? GLU A 216 GLY A 218 
9   1 SER B  35  ? ILE B  38  ? SER B 34  ILE B 37  
10  1 VAL B  45  ? THR B  48  ? VAL B 44  THR B 47  
11  1 GLU B  66  ? THR B  69  ? GLU B 65  THR B 68  
12  1 ILE B  72  ? SER B  77  ? ILE B 71  SER B 76  
13  1 SER B  133 ? ASN B  140 ? SER B 132 ASN B 139 
14  1 ARG B  143 ? ASP B  150 ? ARG B 142 ASP B 149 
15  1 GLY B  153 ? ALA B  157 ? GLY B 152 ALA B 156 
16  1 ALA B  160 ? MET B  163 ? ALA B 159 MET B 162 
17  1 GLU B  209 ? ILE B  212 ? GLU B 208 ILE B 211 
18  1 CYS C  34  ? LEU C  38  ? CYS C 34  LEU C 38  
19  1 VAL C  43  ? GLU C  48  ? VAL C 43  GLU C 48  
20  1 ILE C  65  ? LYS C  67  ? ILE C 65  LYS C 67  
21  1 MET C  72  ? VAL C  76  ? MET C 72  VAL C 76  
22  1 LEU C  134 ? ASP C  140 ? LEU C 134 ASP C 140 
23  1 TYR C  143 ? SER C  150 ? TYR C 143 SER C 150 
24  1 ALA C  161 ? ILE C  164 ? ALA C 161 ILE C 164 
25  1 VAL C  211 ? GLU C  219 ? VAL C 211 GLU C 219 
26  1 LYS C  222 ? VAL C  227 ? LYS C 222 VAL C 227 
27  1 ALA D  32  ? ARG D  36  ? ALA D 32  ARG D 36  
28  1 VAL D  41  ? GLY D  44  ? VAL D 41  GLY D 44  
29  1 VAL D  69  ? ALA D  74  ? VAL D 69  ALA D 74  
30  1 SER D  130 ? ASP D  137 ? SER D 130 ASP D 137 
31  1 GLY D  140 ? ASP D  148 ? GLY D 140 ASP D 148 
32  1 GLY D  151 ? ALA D  155 ? GLY D 151 ALA D 155 
33  1 ALA D  158 ? ILE D  161 ? ALA D 158 ILE D 161 
34  1 ALA E  37  ? GLN E  41  ? ALA E 37  GLN E 41  
35  1 VAL E  46  ? GLU E  51  ? VAL E 46  GLU E 51  
36  1 ILE E  67  ? GLU E  69  ? ILE E 67  GLU E 69  
37  1 ILE E  74  ? SER E  79  ? ILE E 74  SER E 79  
38  1 ALA E  140 ? VAL E  146 ? ALA E 140 VAL E 146 
39  1 PRO E  151 ? ASP E  157 ? PRO E 151 ASP E 157 
40  1 GLY E  160 ? GLN E  164 ? GLY E 160 GLN E 164 
41  1 ALA E  167 ? ILE E  170 ? ALA E 167 ILE E 170 
42  1 ILE E  215 ? VAL E  220 ? ILE E 215 VAL E 220 
43  1 THR F  35  ? SER F  40  ? THR F 35  SER F 40  
44  1 HIS F  43  ? LEU F  49  ? HIS F 43  LEU F 49  
45  1 ILE F  63  ? HIS F  65  ? ILE F 63  HIS F 65  
46  1 ILE F  70  ? ALA F  75  ? ILE F 70  ALA F 75  
47  1 GLY F  131 ? GLY F  136 ? GLY F 131 GLY F 136 
48  1 HIS F  143 ? THR F  147 ? HIS F 143 THR F 147 
49  1 MET F  159 ? ILE F  161 ? MET F 159 ILE F 161 
50  1 VAL F  210 ? GLY F  216 ? VAL F 210 GLY F 216 
51  1 THR F  222 ? TYR F  224 ? THR F 222 TYR F 224 
52  1 ALA G  37  ? ARG G  41  ? ALA G 36  ARG G 40  
53  1 VAL G  46  ? VAL G  50  ? VAL G 45  VAL G 49  
54  1 GLY G  75  ? ALA G  79  ? GLY G 74  ALA G 78  
55  1 SER G  135 ? TYR G  141 ? SER G 134 TYR G 140 
56  1 ALA G  147 ? ASP G  153 ? ALA G 146 ASP G 152 
57  1 GLY G  156 ? GLY G  160 ? GLY G 155 GLY G 159 
58  1 GLY G  163 ? ILE G  166 ? GLY G 162 ILE G 165 
59  1 GLU G  213 ? SER G  215 ? GLU G 212 SER G 214 
60  1 THR H  2   ? VAL H  6   ? THR H 2   VAL H 6   
61  1 VAL H  13  ? ALA H  16  ? VAL H 13  ALA H 16  
62  1 PHE H  42  ? SER H  46  ? PHE H 42  SER H 46  
63  1 ALA H  96  ? ALA H  101 ? ALA H 96  ALA H 101 
64  1 TYR H  112 ? VAL H  114 ? TYR H 112 VAL H 114 
65  1 ALA H  126 ? GLY H  128 ? ALA H 126 GLY H 128 
66  1 ARG H  175 ? ALA H  180 ? ARG H 175 ALA H 180 
67  1 GLY H  183 ? GLN H  187 ? GLY H 183 GLN H 187 
68  1 THR I  2   ? TYR I  8   ? THR I 2   TYR I 8   
69  1 GLY I  11  ? ASP I  17  ? GLY I 11  ASP I 17  
70  1 ALA I  20  ? GLU I  22  ? ALA I 20  GLU I 22  
71  1 VAL I  25  ? ASP I  28  ? VAL I 25  ASP I 28  
72  1 ILE I  34  ? PHE I  36  ? ILE I 34  PHE I 36  
73  1 TYR I  42  ? ALA I  46  ? TYR I 42  ALA I 46  
74  1 ALA I  97  ? VAL I  103 ? ALA I 97  VAL I 103 
75  1 PRO I  108 ? TYR I  114 ? PRO I 108 TYR I 114 
76  1 GLY I  117 ? LYS I  121 ? GLY I 117 LYS I 121 
77  1 TYR I  124 ? MET I  127 ? TYR I 124 MET I 127 
78  1 ILE I  173 ? SER I  179 ? ILE I 173 SER I 179 
79  1 LYS I  182 ? PHE I  185 ? LYS I 182 PHE I 185 
80  1 ALA J  9   ? LYS J  14  ? ALA J 9   LYS J 14  
81  1 VAL J  19  ? ILE J  29  ? VAL J 19  ILE J 29  
82  1 GLN J  32  ? THR J  35  ? GLN J 32  THR J 35  
83  1 TYR J  49  ? ALA J  53  ? TYR J 49  ALA J 53  
84  1 THR J  104 ? ASP J  112 ? THR J 104 ASP J 112 
85  1 PHE J  116 ? SER J  122 ? PHE J 116 SER J 122 
86  1 PHE J  135 ? SER J  138 ? PHE J 135 SER J 138 
87  1 VAL J  184 ? ILE J  189 ? VAL J 184 ILE J 189 
88  1 LEU K  4   ? GLY K  9   ? LEU K 4   GLY K 9   
89  1 TYR K  12  ? ASP K  18  ? TYR K 12  ASP K 18  
90  1 MET K  35  ? LYS K  37  ? MET K 35  LYS K 37  
91  1 ILE K  42  ? VAL K  47  ? ILE K 42  VAL K 47  
92  1 ASN K  101 ? TYR K  107 ? ASN K 101 TYR K 107 
93  1 PRO K  113 ? ASP K  119 ? PRO K 113 ASP K 119 
94  1 ALA K  122 ? LYS K  126 ? ALA K 122 LYS K 126 
95  1 PHE K  129 ? HIS K  132 ? PHE K 129 HIS K 132 
96  1 PHE K  178 ? ILE K  183 ? PHE K 178 ILE K 183 
97  1 THR L  3   ? PHE L  8   ? THR L 3   PHE L 8   
98  1 GLY L  11  ? ALA L  16  ? GLY L 11  ALA L 16  
99  1 ALA L  20  ? ALA L  22  ? ALA L 20  ALA L 22  
100 1 TYR L  25  ? SER L  28  ? TYR L 25  SER L 28  
101 1 MET L  100 ? TRP L  104 ? MET L 100 TRP L 104 
102 1 PRO L  109 ? ASP L  115 ? PRO L 109 ASP L 115 
103 1 GLY L  118 ? ILE L  121 ? GLY L 118 ILE L 121 
104 1 LEU L  176 ? ARG L  180 ? LEU L 176 ARG L 180 
105 1 GLY L  183 ? SER L  188 ? GLY L 183 SER L 188 
106 1 THR M  11  ? ILE M  15  ? THR M 11  ILE M 15  
107 1 ALA M  21  ? ASP M  26  ? ALA M 21  ASP M 26  
108 1 LEU M  29  ? GLU M  31  ? LEU M 29  GLU M 31  
109 1 SER M  34  ? THR M  37  ? SER M 34  THR M 37  
110 1 CYS M  43  ? LYS M  45  ? CYS M 43  LYS M 45  
111 1 VAL M  51  ? SER M  55  ? VAL M 51  SER M 55  
112 1 TYR M  107 ? GLY M  111 ? TYR M 107 GLY M 111 
113 1 PHE M  135 ? GLY M  138 ? PHE M 135 GLY M 138 
114 1 LEU M  193 ? THR M  199 ? LEU M 193 THR M 199 
115 1 GLY M  202 ? ARG M  204 ? GLY M 202 ARG M 204 
116 1 LEU N  12  ? PHE N  16  ? LEU N 12  PHE N 16  
117 1 GLY N  19  ? ALA N  24  ? GLY N 19  ALA N 24  
118 1 ILE N  42  ? ASN N  46  ? ILE N 42  ASN N 46  
119 1 THR N  49  ? SER N  54  ? THR N 49  SER N 54  
120 1 THR N  109 ? ALA N  116 ? THR N 109 ALA N 116 
121 1 GLU N  119 ? ASP N  126 ? GLU N 119 ASP N 126 
122 1 GLY N  129 ? GLU N  133 ? GLY N 129 GLU N 133 
123 1 SER N  136 ? ALA N  138 ? SER N 136 ALA N 138 
124 1 GLN N  188 ? VAL N  192 ? GLN N 188 VAL N 192 
125 1 VAL O  40  ? ARG O  43  ? VAL O 40  ARG O 43  
126 1 ALA O  48  ? THR O  52  ? ALA O 48  THR O 52  
127 1 PHE O  70  ? THR O  73  ? PHE O 70  THR O 73  
128 1 ILE O  76  ? THR O  81  ? ILE O 76  THR O 81  
129 1 CYS O  136 ? ASP O  144 ? CYS O 136 ASP O 144 
130 1 GLY O  148 ? ASP O  155 ? GLY O 148 ASP O 155 
131 1 GLY O  158 ? GLY O  162 ? GLY O 158 GLY O 162 
132 1 GLU O  216 ? GLY O  218 ? GLU O 216 GLY O 218 
133 1 SER P  35  ? ILE P  38  ? SER P 34  ILE P 37  
134 1 VAL P  45  ? THR P  48  ? VAL P 44  THR P 47  
135 1 GLU P  66  ? THR P  69  ? GLU P 65  THR P 68  
136 1 ILE P  72  ? SER P  77  ? ILE P 71  SER P 76  
137 1 SER P  133 ? ASN P  140 ? SER P 132 ASN P 139 
138 1 ARG P  143 ? ASP P  150 ? ARG P 142 ASP P 149 
139 1 GLY P  153 ? ALA P  157 ? GLY P 152 ALA P 156 
140 1 ALA P  160 ? MET P  163 ? ALA P 159 MET P 162 
141 1 GLU P  209 ? ILE P  212 ? GLU P 208 ILE P 211 
142 1 CYS Q  34  ? LEU Q  38  ? CYS Q 34  LEU Q 38  
143 1 VAL Q  43  ? GLU Q  48  ? VAL Q 43  GLU Q 48  
144 1 ILE Q  65  ? LYS Q  67  ? ILE Q 65  LYS Q 67  
145 1 MET Q  72  ? VAL Q  76  ? MET Q 72  VAL Q 76  
146 1 LEU Q  134 ? ASP Q  140 ? LEU Q 134 ASP Q 140 
147 1 TYR Q  143 ? SER Q  150 ? TYR Q 143 SER Q 150 
148 1 ALA Q  161 ? ILE Q  164 ? ALA Q 161 ILE Q 164 
149 1 VAL Q  211 ? GLU Q  219 ? VAL Q 211 GLU Q 219 
150 1 LYS Q  222 ? VAL Q  227 ? LYS Q 222 VAL Q 227 
151 1 ALA R  32  ? ARG R  36  ? ALA R 32  ARG R 36  
152 1 VAL R  41  ? GLY R  44  ? VAL R 41  GLY R 44  
153 1 VAL R  69  ? ALA R  74  ? VAL R 69  ALA R 74  
154 1 SER R  130 ? ASP R  137 ? SER R 130 ASP R 137 
155 1 GLY R  140 ? ASP R  148 ? GLY R 140 ASP R 148 
156 1 GLY R  151 ? ALA R  155 ? GLY R 151 ALA R 155 
157 1 ALA R  158 ? ILE R  161 ? ALA R 158 ILE R 161 
158 1 ALA S  37  ? GLN S  41  ? ALA S 37  GLN S 41  
159 1 VAL S  46  ? GLU S  51  ? VAL S 46  GLU S 51  
160 1 ILE S  67  ? GLU S  69  ? ILE S 67  GLU S 69  
161 1 ILE S  74  ? SER S  79  ? ILE S 74  SER S 79  
162 1 ALA S  140 ? VAL S  146 ? ALA S 140 VAL S 146 
163 1 PRO S  151 ? ASP S  157 ? PRO S 151 ASP S 157 
164 1 GLY S  160 ? GLN S  164 ? GLY S 160 GLN S 164 
165 1 ALA S  167 ? ILE S  170 ? ALA S 167 ILE S 170 
166 1 ILE S  215 ? VAL S  220 ? ILE S 215 VAL S 220 
167 1 THR T  35  ? SER T  40  ? THR T 35  SER T 40  
168 1 HIS T  43  ? LEU T  49  ? HIS T 43  LEU T 49  
169 1 ILE T  63  ? HIS T  65  ? ILE T 63  HIS T 65  
170 1 ILE T  70  ? ALA T  75  ? ILE T 70  ALA T 75  
171 1 GLY T  131 ? GLY T  136 ? GLY T 131 GLY T 136 
172 1 HIS T  143 ? THR T  147 ? HIS T 143 THR T 147 
173 1 MET T  159 ? ILE T  161 ? MET T 159 ILE T 161 
174 1 VAL T  210 ? GLY T  216 ? VAL T 210 GLY T 216 
175 1 THR T  222 ? TYR T  224 ? THR T 222 TYR T 224 
176 1 ALA U  37  ? ARG U  41  ? ALA U 36  ARG U 40  
177 1 VAL U  46  ? VAL U  50  ? VAL U 45  VAL U 49  
178 1 GLY U  75  ? ALA U  79  ? GLY U 74  ALA U 78  
179 1 SER U  135 ? TYR U  141 ? SER U 134 TYR U 140 
180 1 ALA U  147 ? ASP U  153 ? ALA U 146 ASP U 152 
181 1 GLY U  156 ? GLY U  160 ? GLY U 155 GLY U 159 
182 1 GLY U  163 ? ILE U  166 ? GLY U 162 ILE U 165 
183 1 GLU U  213 ? SER U  215 ? GLU U 212 SER U 214 
184 1 THR V  2   ? VAL V  6   ? THR V 2   VAL V 6   
185 1 VAL V  13  ? ALA V  16  ? VAL V 13  ALA V 16  
186 1 PHE V  42  ? SER V  46  ? PHE V 42  SER V 46  
187 1 ALA V  96  ? ALA V  101 ? ALA V 96  ALA V 101 
188 1 TYR V  112 ? VAL V  114 ? TYR V 112 VAL V 114 
189 1 ALA V  126 ? GLY V  128 ? ALA V 126 GLY V 128 
190 1 ARG V  175 ? ALA V  180 ? ARG V 175 ALA V 180 
191 1 GLY V  183 ? GLN V  187 ? GLY V 183 GLN V 187 
192 1 THR W  2   ? TYR W  8   ? THR W 2   TYR W 8   
193 1 GLY W  11  ? ASP W  17  ? GLY W 11  ASP W 17  
194 1 ALA W  20  ? GLU W  22  ? ALA W 20  GLU W 22  
195 1 VAL W  25  ? ASP W  28  ? VAL W 25  ASP W 28  
196 1 ILE W  34  ? PHE W  36  ? ILE W 34  PHE W 36  
197 1 TYR W  42  ? ALA W  46  ? TYR W 42  ALA W 46  
198 1 ALA W  97  ? VAL W  103 ? ALA W 97  VAL W 103 
199 1 PRO W  108 ? TYR W  114 ? PRO W 108 TYR W 114 
200 1 GLY W  117 ? LYS W  121 ? GLY W 117 LYS W 121 
201 1 TYR W  124 ? MET W  127 ? TYR W 124 MET W 127 
202 1 ILE W  173 ? SER W  179 ? ILE W 173 SER W 179 
203 1 LYS W  182 ? PHE W  185 ? LYS W 182 PHE W 185 
204 1 ALA X  9   ? LYS X  14  ? ALA X 9   LYS X 14  
205 1 VAL X  19  ? ILE X  29  ? VAL X 19  ILE X 29  
206 1 GLN X  32  ? THR X  35  ? GLN X 32  THR X 35  
207 1 TYR X  49  ? ALA X  53  ? TYR X 49  ALA X 53  
208 1 THR X  104 ? ASP X  112 ? THR X 104 ASP X 112 
209 1 PHE X  116 ? SER X  122 ? PHE X 116 SER X 122 
210 1 PHE X  135 ? SER X  138 ? PHE X 135 SER X 138 
211 1 VAL X  184 ? ILE X  189 ? VAL X 184 ILE X 189 
212 1 LEU Y  4   ? GLY Y  9   ? LEU Y 4   GLY Y 9   
213 1 TYR Y  12  ? ASP Y  18  ? TYR Y 12  ASP Y 18  
214 1 MET Y  35  ? LYS Y  37  ? MET Y 35  LYS Y 37  
215 1 ILE Y  42  ? VAL Y  47  ? ILE Y 42  VAL Y 47  
216 1 ASN Y  101 ? TYR Y  107 ? ASN Y 101 TYR Y 107 
217 1 PRO Y  113 ? ASP Y  119 ? PRO Y 113 ASP Y 119 
218 1 ALA Y  122 ? LYS Y  126 ? ALA Y 122 LYS Y 126 
219 1 PHE Y  129 ? HIS Y  132 ? PHE Y 129 HIS Y 132 
220 1 PHE Y  178 ? ILE Y  183 ? PHE Y 178 ILE Y 183 
221 1 THR Z  3   ? PHE Z  8   ? THR Z 3   PHE Z 8   
222 1 GLY Z  11  ? ALA Z  16  ? GLY Z 11  ALA Z 16  
223 1 ALA Z  20  ? ALA Z  22  ? ALA Z 20  ALA Z 22  
224 1 TYR Z  25  ? SER Z  28  ? TYR Z 25  SER Z 28  
225 1 MET Z  100 ? TRP Z  104 ? MET Z 100 TRP Z 104 
226 1 PRO Z  109 ? ASP Z  115 ? PRO Z 109 ASP Z 115 
227 1 GLY Z  118 ? ILE Z  121 ? GLY Z 118 ILE Z 121 
228 1 LEU Z  176 ? ARG Z  180 ? LEU Z 176 ARG Z 180 
229 1 GLY Z  183 ? SER Z  188 ? GLY Z 183 SER Z 188 
230 1 THR AA 11  ? ILE AA 15  ? THR a 11  ILE a 15  
231 1 ALA AA 21  ? ASP AA 26  ? ALA a 21  ASP a 26  
232 1 LEU AA 29  ? GLU AA 31  ? LEU a 29  GLU a 31  
233 1 SER AA 34  ? THR AA 37  ? SER a 34  THR a 37  
234 1 CYS AA 43  ? LYS AA 45  ? CYS a 43  LYS a 45  
235 1 VAL AA 51  ? SER AA 55  ? VAL a 51  SER a 55  
236 1 TYR AA 107 ? GLY AA 111 ? TYR a 107 GLY a 111 
237 1 PHE AA 135 ? GLY AA 138 ? PHE a 135 GLY a 138 
238 1 LEU AA 193 ? THR AA 199 ? LEU a 193 THR a 199 
239 1 GLY AA 202 ? ARG AA 204 ? GLY a 202 ARG a 204 
240 1 LEU BA 12  ? PHE BA 16  ? LEU b 12  PHE b 16  
241 1 GLY BA 19  ? ALA BA 24  ? GLY b 19  ALA b 24  
242 1 ILE BA 42  ? ASN BA 46  ? ILE b 42  ASN b 46  
243 1 THR BA 49  ? SER BA 54  ? THR b 49  SER b 54  
244 1 THR BA 109 ? ALA BA 116 ? THR b 109 ALA b 116 
245 1 GLU BA 119 ? ASP BA 126 ? GLU b 119 ASP b 126 
246 1 GLY BA 129 ? GLU BA 133 ? GLY b 129 GLU b 133 
247 1 SER BA 136 ? ALA BA 138 ? SER b 136 ALA b 138 
248 1 GLN BA 188 ? VAL BA 192 ? GLN b 188 VAL b 192 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'Binding site for Ligand KNM H 300 bound to THR H 1' 
AC2 Software ? ? ? ? 11 'Binding site for Ligand KNM I 300 bound to THR I 1' 
AC3 Software ? ? ? ? 9  'Binding site for Ligand KNM L 300 bound to THR L 1' 
AC4 Software ? ? ? ? 11 'Binding site for Ligand KNM V 300 bound to THR V 1' 
AC5 Software ? ? ? ? 11 'Binding site for Ligand KNM W 300 bound to THR W 1' 
AC6 Software ? ? ? ? 9  'Binding site for Ligand KNM Z 300 bound to THR Z 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 THR H  1   ? THR H 1   . ? 1_555 ? 
2  AC1 11 THR H  20  ? THR H 20  . ? 1_555 ? 
3  AC1 11 THR H  21  ? THR H 21  . ? 1_555 ? 
4  AC1 11 THR H  22  ? THR H 22  . ? 1_555 ? 
5  AC1 11 LYS H  33  ? LYS H 33  . ? 1_555 ? 
6  AC1 11 ARG H  45  ? ARG H 45  . ? 1_555 ? 
7  AC1 11 GLY H  47  ? GLY H 47  . ? 1_555 ? 
8  AC1 11 SER H  48  ? SER H 48  . ? 1_555 ? 
9  AC1 11 SER H  130 ? SER H 130 . ? 1_555 ? 
10 AC1 11 HIS I  116 ? HIS I 116 . ? 1_555 ? 
11 AC1 11 SER I  118 ? SER I 118 . ? 1_555 ? 
12 AC2 11 THR I  1   ? THR I 1   . ? 1_555 ? 
13 AC2 11 ALA I  20  ? ALA I 20  . ? 1_555 ? 
14 AC2 11 THR I  21  ? THR I 21  . ? 1_555 ? 
15 AC2 11 GLU I  22  ? GLU I 22  . ? 1_555 ? 
16 AC2 11 ALA I  46  ? ALA I 46  . ? 1_555 ? 
17 AC2 11 GLY I  47  ? GLY I 47  . ? 1_555 ? 
18 AC2 11 ALA I  49  ? ALA I 49  . ? 1_555 ? 
19 AC2 11 THR I  52  ? THR I 52  . ? 1_555 ? 
20 AC2 11 GLY I  128 ? GLY I 128 . ? 1_555 ? 
21 AC2 11 SER I  129 ? SER I 129 . ? 1_555 ? 
22 AC2 11 ASP J  124 ? ASP J 124 . ? 1_555 ? 
23 AC3 9  THR L  1   ? THR L 1   . ? 1_555 ? 
24 AC3 9  ALA L  20  ? ALA L 20  . ? 1_555 ? 
25 AC3 9  THR L  21  ? THR L 21  . ? 1_555 ? 
26 AC3 9  ALA L  22  ? ALA L 22  . ? 1_555 ? 
27 AC3 9  LYS L  33  ? LYS L 33  . ? 1_555 ? 
28 AC3 9  MET L  45  ? MET L 45  . ? 1_555 ? 
29 AC3 9  GLY L  47  ? GLY L 47  . ? 1_555 ? 
30 AC3 9  ALA L  49  ? ALA L 49  . ? 1_555 ? 
31 AC3 9  ASP M  125 ? ASP M 125 . ? 1_555 ? 
32 AC4 11 THR V  1   ? THR V 1   . ? 1_555 ? 
33 AC4 11 THR V  20  ? THR V 20  . ? 1_555 ? 
34 AC4 11 THR V  21  ? THR V 21  . ? 1_555 ? 
35 AC4 11 THR V  22  ? THR V 22  . ? 1_555 ? 
36 AC4 11 LYS V  33  ? LYS V 33  . ? 1_555 ? 
37 AC4 11 ARG V  45  ? ARG V 45  . ? 1_555 ? 
38 AC4 11 GLY V  47  ? GLY V 47  . ? 1_555 ? 
39 AC4 11 SER V  48  ? SER V 48  . ? 1_555 ? 
40 AC4 11 SER V  130 ? SER V 130 . ? 1_555 ? 
41 AC4 11 HIS W  116 ? HIS W 116 . ? 1_555 ? 
42 AC4 11 SER W  118 ? SER W 118 . ? 1_555 ? 
43 AC5 11 THR W  1   ? THR W 1   . ? 1_555 ? 
44 AC5 11 ALA W  20  ? ALA W 20  . ? 1_555 ? 
45 AC5 11 THR W  21  ? THR W 21  . ? 1_555 ? 
46 AC5 11 GLU W  22  ? GLU W 22  . ? 1_555 ? 
47 AC5 11 ALA W  46  ? ALA W 46  . ? 1_555 ? 
48 AC5 11 GLY W  47  ? GLY W 47  . ? 1_555 ? 
49 AC5 11 ALA W  49  ? ALA W 49  . ? 1_555 ? 
50 AC5 11 THR W  52  ? THR W 52  . ? 1_555 ? 
51 AC5 11 GLY W  128 ? GLY W 128 . ? 1_555 ? 
52 AC5 11 SER W  129 ? SER W 129 . ? 1_555 ? 
53 AC5 11 ASP X  124 ? ASP X 124 . ? 1_555 ? 
54 AC6 9  THR Z  1   ? THR Z 1   . ? 1_555 ? 
55 AC6 9  ALA Z  20  ? ALA Z 20  . ? 1_555 ? 
56 AC6 9  THR Z  21  ? THR Z 21  . ? 1_555 ? 
57 AC6 9  ALA Z  22  ? ALA Z 22  . ? 1_555 ? 
58 AC6 9  LYS Z  33  ? LYS Z 33  . ? 1_555 ? 
59 AC6 9  MET Z  45  ? MET Z 45  . ? 1_555 ? 
60 AC6 9  GLY Z  47  ? GLY Z 47  . ? 1_555 ? 
61 AC6 9  ALA Z  49  ? ALA Z 49  . ? 1_555 ? 
62 AC6 9  ASP AA 125 ? ASP a 125 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5A0Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5A0Q 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ASP A  1  10  ? 5.661   -73.427 -10.542 1.00 0.00 ? 10  ASP A N   1 
ATOM   2     C CA  . ASP A  1  10  ? 6.785   -74.382 -10.779 1.00 0.00 ? 10  ASP A CA  1 
ATOM   3     C C   . ASP A  1  10  ? 7.330   -74.159 -12.153 1.00 0.00 ? 10  ASP A C   1 
ATOM   4     O O   . ASP A  1  10  ? 8.401   -73.585 -12.340 1.00 0.00 ? 10  ASP A O   1 
ATOM   5     C CB  . ASP A  1  10  ? 6.336   -75.859 -10.645 1.00 0.00 ? 10  ASP A CB  1 
ATOM   6     C CG  . ASP A  1  10  ? 5.763   -76.130 -9.257  1.00 0.00 ? 10  ASP A CG  1 
ATOM   7     O OD1 . ASP A  1  10  ? 6.381   -75.690 -8.257  1.00 0.00 ? 10  ASP A OD1 1 
ATOM   8     O OD2 . ASP A  1  10  ? 4.686   -76.780 -9.188  1.00 0.00 ? 10  ASP A OD2 1 
ATOM   9     N N   . ARG A  1  11  ? 6.537   -74.605 -13.143 1.00 0.00 ? 11  ARG A N   1 
ATOM   10    C CA  . ARG A  1  11  ? 6.727   -74.447 -14.556 1.00 0.00 ? 11  ARG A CA  1 
ATOM   11    C C   . ARG A  1  11  ? 5.663   -73.505 -15.024 1.00 0.00 ? 11  ARG A C   1 
ATOM   12    O O   . ARG A  1  11  ? 5.262   -73.539 -16.184 1.00 0.00 ? 11  ARG A O   1 
ATOM   13    C CB  . ARG A  1  11  ? 6.493   -75.779 -15.284 1.00 0.00 ? 11  ARG A CB  1 
ATOM   14    C CG  . ARG A  1  11  ? 7.441   -76.895 -14.832 1.00 0.00 ? 11  ARG A CG  1 
ATOM   15    C CD  . ARG A  1  11  ? 7.198   -78.192 -15.604 1.00 0.00 ? 11  ARG A CD  1 
ATOM   16    N NE  . ARG A  1  11  ? 8.434   -79.031 -15.522 1.00 0.00 ? 11  ARG A NE  1 
ATOM   17    C CZ  . ARG A  1  11  ? 8.414   -80.393 -15.598 1.00 0.00 ? 11  ARG A CZ  1 
ATOM   18    N NH1 . ARG A  1  11  ? 7.243   -81.089 -15.589 1.00 0.00 ? 11  ARG A NH1 1 
ATOM   19    N NH2 . ARG A  1  11  ? 9.597   -81.067 -15.681 1.00 0.00 ? 11  ARG A NH2 1 
ATOM   20    N N   . HIS A  1  12  ? 5.091   -72.755 -14.082 1.00 0.00 ? 12  HIS A N   1 
ATOM   21    C CA  . HIS A  1  12  ? 3.980   -71.850 -14.386 1.00 0.00 ? 12  HIS A CA  1 
ATOM   22    C C   . HIS A  1  12  ? 4.201   -70.365 -14.066 1.00 0.00 ? 12  HIS A C   1 
ATOM   23    O O   . HIS A  1  12  ? 3.574   -69.499 -14.677 1.00 0.00 ? 12  HIS A O   1 
ATOM   24    C CB  . HIS A  1  12  ? 2.701   -72.337 -13.698 1.00 0.00 ? 12  HIS A CB  1 
ATOM   25    C CG  . HIS A  1  12  ? 2.557   -73.827 -13.676 1.00 0.00 ? 12  HIS A CG  1 
ATOM   26    N ND1 . HIS A  1  12  ? 2.242   -74.561 -14.799 1.00 0.00 ? 12  HIS A ND1 1 
ATOM   27    C CD2 . HIS A  1  12  ? 2.686   -74.721 -12.667 1.00 0.00 ? 12  HIS A CD2 1 
ATOM   28    C CE1 . HIS A  1  12  ? 2.183   -75.842 -14.483 1.00 0.00 ? 12  HIS A CE1 1 
ATOM   29    N NE2 . HIS A  1  12  ? 2.449   -75.966 -13.195 1.00 0.00 ? 12  HIS A NE2 1 
ATOM   30    N N   . ILE A  1  13  ? 5.020   -70.121 -13.047 1.00 0.00 ? 13  ILE A N   1 
ATOM   31    C CA  . ILE A  1  13  ? 5.364   -68.785 -12.590 1.00 0.00 ? 13  ILE A CA  1 
ATOM   32    C C   . ILE A  1  13  ? 6.867   -68.653 -12.743 1.00 0.00 ? 13  ILE A C   1 
ATOM   33    O O   . ILE A  1  13  ? 7.617   -69.546 -12.349 1.00 0.00 ? 13  ILE A O   1 
ATOM   34    C CB  . ILE A  1  13  ? 4.976   -68.568 -11.117 1.00 0.00 ? 13  ILE A CB  1 
ATOM   35    C CG1 . ILE A  1  13  ? 5.828   -69.453 -10.205 1.00 0.00 ? 13  ILE A CG1 1 
ATOM   36    C CG2 . ILE A  1  13  ? 3.496   -68.850 -10.909 1.00 0.00 ? 13  ILE A CG2 1 
ATOM   37    C CD1 . ILE A  1  13  ? 6.443   -68.714 -9.037  1.00 0.00 ? 13  ILE A CD1 1 
ATOM   38    N N   . THR A  1  14  ? 7.308   -67.552 -13.334 1.00 0.00 ? 14  THR A N   1 
ATOM   39    C CA  . THR A  1  14  ? 8.664   -67.456 -13.779 1.00 0.00 ? 14  THR A CA  1 
ATOM   40    C C   . THR A  1  14  ? 9.457   -67.451 -12.526 1.00 0.00 ? 14  THR A C   1 
ATOM   41    O O   . THR A  1  14  ? 9.344   -66.575 -11.677 1.00 0.00 ? 14  THR A O   1 
ATOM   42    C CB  . THR A  1  14  ? 8.978   -66.226 -14.589 1.00 0.00 ? 14  THR A CB  1 
ATOM   43    O OG1 . THR A  1  14  ? 8.362   -65.079 -14.044 1.00 0.00 ? 14  THR A OG1 1 
ATOM   44    C CG2 . THR A  1  14  ? 8.466   -66.445 -16.012 1.00 0.00 ? 14  THR A CG2 1 
ATOM   45    N N   . ILE A  1  15  ? 10.233  -68.521 -12.402 1.00 0.00 ? 15  ILE A N   1 
ATOM   46    C CA  . ILE A  1  15  ? 11.068  -68.813 -11.306 1.00 0.00 ? 15  ILE A CA  1 
ATOM   47    C C   . ILE A  1  15  ? 12.005  -69.798 -11.931 1.00 0.00 ? 15  ILE A C   1 
ATOM   48    O O   . ILE A  1  15  ? 11.775  -70.295 -13.030 1.00 0.00 ? 15  ILE A O   1 
ATOM   49    C CB  . ILE A  1  15  ? 10.346  -69.457 -10.129 1.00 0.00 ? 15  ILE A CB  1 
ATOM   50    C CG1 . ILE A  1  15  ? 9.331   -70.545 -10.534 1.00 0.00 ? 15  ILE A CG1 1 
ATOM   51    C CG2 . ILE A  1  15  ? 9.671   -68.372 -9.278  1.00 0.00 ? 15  ILE A CG2 1 
ATOM   52    C CD1 . ILE A  1  15  ? 8.772   -71.309 -9.336  1.00 0.00 ? 15  ILE A CD1 1 
ATOM   53    N N   . PHE A  1  16  ? 13.106  -70.112 -11.237 1.00 0.00 ? 16  PHE A N   1 
ATOM   54    C CA  . PHE A  1  16  ? 14.126  -70.967 -11.750 1.00 0.00 ? 16  PHE A CA  1 
ATOM   55    C C   . PHE A  1  16  ? 13.767  -72.341 -11.376 1.00 0.00 ? 16  PHE A C   1 
ATOM   56    O O   . PHE A  1  16  ? 13.347  -72.567 -10.248 1.00 0.00 ? 16  PHE A O   1 
ATOM   57    C CB  . PHE A  1  16  ? 15.493  -70.747 -11.106 1.00 0.00 ? 16  PHE A CB  1 
ATOM   58    C CG  . PHE A  1  16  ? 15.989  -69.392 -11.432 1.00 0.00 ? 16  PHE A CG  1 
ATOM   59    C CD1 . PHE A  1  16  ? 16.327  -69.070 -12.752 1.00 0.00 ? 16  PHE A CD1 1 
ATOM   60    C CD2 . PHE A  1  16  ? 16.162  -68.441 -10.413 1.00 0.00 ? 16  PHE A CD2 1 
ATOM   61    C CE1 . PHE A  1  16  ? 16.833  -67.809 -13.049 1.00 0.00 ? 16  PHE A CE1 1 
ATOM   62    C CE2 . PHE A  1  16  ? 16.695  -67.189 -10.704 1.00 0.00 ? 16  PHE A CE2 1 
ATOM   63    C CZ  . PHE A  1  16  ? 17.032  -66.879 -12.020 1.00 0.00 ? 16  PHE A CZ  1 
ATOM   64    N N   . SER A  1  17  ? 13.992  -73.285 -12.321 1.00 0.00 ? 17  SER A N   1 
ATOM   65    C CA  . SER A  1  17  ? 13.926  -74.715 -12.147 1.00 0.00 ? 17  SER A CA  1 
ATOM   66    C C   . SER A  1  17  ? 15.113  -75.155 -11.348 1.00 0.00 ? 17  SER A C   1 
ATOM   67    O O   . SER A  1  17  ? 15.989  -74.328 -11.136 1.00 0.00 ? 17  SER A O   1 
ATOM   68    C CB  . SER A  1  17  ? 13.935  -75.435 -13.501 1.00 0.00 ? 17  SER A CB  1 
ATOM   69    O OG  . SER A  1  17  ? 15.126  -75.187 -14.224 1.00 0.00 ? 17  SER A OG  1 
ATOM   70    N N   . PRO A  1  18  ? 15.219  -76.355 -10.827 1.00 0.00 ? 18  PRO A N   1 
ATOM   71    C CA  . PRO A  1  18  ? 16.419  -76.834 -10.164 1.00 0.00 ? 18  PRO A CA  1 
ATOM   72    C C   . PRO A  1  18  ? 17.616  -76.958 -11.062 1.00 0.00 ? 18  PRO A C   1 
ATOM   73    O O   . PRO A  1  18  ? 18.683  -77.293 -10.557 1.00 0.00 ? 18  PRO A O   1 
ATOM   74    C CB  . PRO A  1  18  ? 16.038  -78.195 -9.581  1.00 0.00 ? 18  PRO A CB  1 
ATOM   75    C CG  . PRO A  1  18  ? 14.512  -78.162 -9.496  1.00 0.00 ? 18  PRO A CG  1 
ATOM   76    C CD  . PRO A  1  18  ? 14.108  -77.275 -10.671 1.00 0.00 ? 18  PRO A CD  1 
ATOM   77    N N   . GLU A  1  19  ? 17.462  -76.710 -12.376 1.00 0.00 ? 19  GLU A N   1 
ATOM   78    C CA  . GLU A  1  19  ? 18.545  -76.704 -13.313 1.00 0.00 ? 19  GLU A CA  1 
ATOM   79    C C   . GLU A  1  19  ? 18.958  -75.302 -13.627 1.00 0.00 ? 19  GLU A C   1 
ATOM   80    O O   . GLU A  1  19  ? 19.853  -75.101 -14.442 1.00 0.00 ? 19  GLU A O   1 
ATOM   81    C CB  . GLU A  1  19  ? 18.147  -77.382 -14.628 1.00 0.00 ? 19  GLU A CB  1 
ATOM   82    C CG  . GLU A  1  19  ? 17.644  -78.807 -14.375 1.00 0.00 ? 19  GLU A CG  1 
ATOM   83    C CD  . GLU A  1  19  ? 17.493  -79.567 -15.684 1.00 0.00 ? 19  GLU A CD  1 
ATOM   84    O OE1 . GLU A  1  19  ? 17.756  -78.975 -16.762 1.00 0.00 ? 19  GLU A OE1 1 
ATOM   85    O OE2 . GLU A  1  19  ? 17.116  -80.766 -15.618 1.00 0.00 ? 19  GLU A OE2 1 
ATOM   86    N N   . GLY A  1  20  ? 18.339  -74.286 -12.981 1.00 0.00 ? 20  GLY A N   1 
ATOM   87    C CA  . GLY A  1  20  ? 18.661  -72.901 -13.211 1.00 0.00 ? 20  GLY A CA  1 
ATOM   88    C C   . GLY A  1  20  ? 18.176  -72.484 -14.554 1.00 0.00 ? 20  GLY A C   1 
ATOM   89    O O   . GLY A  1  20  ? 18.935  -71.947 -15.354 1.00 0.00 ? 20  GLY A O   1 
ATOM   90    N N   . ARG A  1  21  ? 16.927  -72.854 -14.872 1.00 0.00 ? 21  ARG A N   1 
ATOM   91    C CA  . ARG A  1  21  ? 16.405  -72.668 -16.189 1.00 0.00 ? 21  ARG A CA  1 
ATOM   92    C C   . ARG A  1  21  ? 14.986  -72.228 -16.064 1.00 0.00 ? 21  ARG A C   1 
ATOM   93    O O   . ARG A  1  21  ? 14.201  -72.848 -15.363 1.00 0.00 ? 21  ARG A O   1 
ATOM   94    C CB  . ARG A  1  21  ? 16.497  -73.999 -16.967 1.00 0.00 ? 21  ARG A CB  1 
ATOM   95    C CG  . ARG A  1  21  ? 16.328  -73.892 -18.486 1.00 0.00 ? 21  ARG A CG  1 
ATOM   96    C CD  . ARG A  1  21  ? 16.696  -75.198 -19.197 1.00 0.00 ? 21  ARG A CD  1 
ATOM   97    N NE  . ARG A  1  21  ? 15.888  -76.328 -18.622 1.00 0.00 ? 21  ARG A NE  1 
ATOM   98    C CZ  . ARG A  1  21  ? 16.003  -77.614 -19.069 1.00 0.00 ? 21  ARG A CZ  1 
ATOM   99    N NH1 . ARG A  1  21  ? 16.898  -77.947 -20.037 1.00 0.00 ? 21  ARG A NH1 1 
ATOM   100   N NH2 . ARG A  1  21  ? 15.216  -78.588 -18.533 1.00 0.00 ? 21  ARG A NH2 1 
ATOM   101   N N   . LEU A  1  22  ? 14.622  -71.127 -16.757 1.00 0.00 ? 22  LEU A N   1 
ATOM   102   C CA  . LEU A  1  22  ? 13.278  -70.639 -16.798 1.00 0.00 ? 22  LEU A CA  1 
ATOM   103   C C   . LEU A  1  22  ? 12.533  -71.433 -17.802 1.00 0.00 ? 22  LEU A C   1 
ATOM   104   O O   . LEU A  1  22  ? 12.988  -71.629 -18.922 1.00 0.00 ? 22  LEU A O   1 
ATOM   105   C CB  . LEU A  1  22  ? 13.163  -69.178 -17.221 1.00 0.00 ? 22  LEU A CB  1 
ATOM   106   C CG  . LEU A  1  22  ? 13.869  -68.209 -16.261 1.00 0.00 ? 22  LEU A CG  1 
ATOM   107   C CD1 . LEU A  1  22  ? 13.771  -66.781 -16.787 1.00 0.00 ? 22  LEU A CD1 1 
ATOM   108   C CD2 . LEU A  1  22  ? 13.327  -68.279 -14.826 1.00 0.00 ? 22  LEU A CD2 1 
ATOM   109   N N   . TYR A  1  23  ? 11.373  -71.962 -17.386 1.00 0.00 ? 23  TYR A N   1 
ATOM   110   C CA  . TYR A  1  23  ? 10.592  -72.857 -18.176 1.00 0.00 ? 23  TYR A CA  1 
ATOM   111   C C   . TYR A  1  23  ? 9.713   -72.067 -19.062 1.00 0.00 ? 23  TYR A C   1 
ATOM   112   O O   . TYR A  1  23  ? 9.574   -72.359 -20.241 1.00 0.00 ? 23  TYR A O   1 
ATOM   113   C CB  . TYR A  1  23  ? 9.755   -73.796 -17.286 1.00 0.00 ? 23  TYR A CB  1 
ATOM   114   C CG  . TYR A  1  23  ? 10.579  -75.002 -16.935 1.00 0.00 ? 23  TYR A CG  1 
ATOM   115   C CD1 . TYR A  1  23  ? 11.235  -75.751 -17.937 1.00 0.00 ? 23  TYR A CD1 1 
ATOM   116   C CD2 . TYR A  1  23  ? 10.657  -75.452 -15.614 1.00 0.00 ? 23  TYR A CD2 1 
ATOM   117   C CE1 . TYR A  1  23  ? 12.001  -76.873 -17.623 1.00 0.00 ? 23  TYR A CE1 1 
ATOM   118   C CE2 . TYR A  1  23  ? 11.353  -76.627 -15.303 1.00 0.00 ? 23  TYR A CE2 1 
ATOM   119   C CZ  . TYR A  1  23  ? 12.063  -77.310 -16.299 1.00 0.00 ? 23  TYR A CZ  1 
ATOM   120   O OH  . TYR A  1  23  ? 12.832  -78.443 -15.969 1.00 0.00 ? 23  TYR A OH  1 
ATOM   121   N N   . GLN A  1  24  ? 9.126   -70.994 -18.541 1.00 0.00 ? 24  GLN A N   1 
ATOM   122   C CA  . GLN A  1  24  ? 8.236   -70.169 -19.287 1.00 0.00 ? 24  GLN A CA  1 
ATOM   123   C C   . GLN A  1  24  ? 8.888   -69.489 -20.441 1.00 0.00 ? 24  GLN A C   1 
ATOM   124   O O   . GLN A  1  24  ? 8.228   -69.264 -21.445 1.00 0.00 ? 24  GLN A O   1 
ATOM   125   C CB  . GLN A  1  24  ? 7.675   -69.122 -18.355 1.00 0.00 ? 24  GLN A CB  1 
ATOM   126   C CG  . GLN A  1  24  ? 6.636   -69.687 -17.401 1.00 0.00 ? 24  GLN A CG  1 
ATOM   127   C CD  . GLN A  1  24  ? 5.403   -69.947 -18.254 1.00 0.00 ? 24  GLN A CD  1 
ATOM   128   O OE1 . GLN A  1  24  ? 4.850   -69.003 -18.827 1.00 0.00 ? 24  GLN A OE1 1 
ATOM   129   N NE2 . GLN A  1  24  ? 4.974   -71.236 -18.354 1.00 0.00 ? 24  GLN A NE2 1 
ATOM   130   N N   . VAL A  1  25  ? 10.199  -69.175 -20.348 1.00 0.00 ? 25  VAL A N   1 
ATOM   131   C CA  . VAL A  1  25  ? 10.965  -68.544 -21.401 1.00 0.00 ? 25  VAL A CA  1 
ATOM   132   C C   . VAL A  1  25  ? 11.135  -69.455 -22.568 1.00 0.00 ? 25  VAL A C   1 
ATOM   133   O O   . VAL A  1  25  ? 10.931  -69.045 -23.706 1.00 0.00 ? 25  VAL A O   1 
ATOM   134   C CB  . VAL A  1  25  ? 12.300  -68.024 -20.930 1.00 0.00 ? 25  VAL A CB  1 
ATOM   135   C CG1 . VAL A  1  25  ? 13.159  -67.523 -22.102 1.00 0.00 ? 25  VAL A CG1 1 
ATOM   136   C CG2 . VAL A  1  25  ? 12.005  -66.860 -19.969 1.00 0.00 ? 25  VAL A CG2 1 
ATOM   137   N N   . GLU A  1  26  ? 11.542  -70.718 -22.333 1.00 0.00 ? 26  GLU A N   1 
ATOM   138   C CA  . GLU A  1  26  ? 11.730  -71.670 -23.394 1.00 0.00 ? 26  GLU A CA  1 
ATOM   139   C C   . GLU A  1  26  ? 10.433  -72.057 -23.997 1.00 0.00 ? 26  GLU A C   1 
ATOM   140   O O   . GLU A  1  26  ? 10.393  -72.410 -25.170 1.00 0.00 ? 26  GLU A O   1 
ATOM   141   C CB  . GLU A  1  26  ? 12.507  -72.924 -22.973 1.00 0.00 ? 26  GLU A CB  1 
ATOM   142   C CG  . GLU A  1  26  ? 11.895  -73.702 -21.802 1.00 0.00 ? 26  GLU A CG  1 
ATOM   143   C CD  . GLU A  1  26  ? 12.903  -74.713 -21.260 1.00 0.00 ? 26  GLU A CD  1 
ATOM   144   O OE1 . GLU A  1  26  ? 13.344  -75.604 -22.034 1.00 0.00 ? 26  GLU A OE1 1 
ATOM   145   O OE2 . GLU A  1  26  ? 13.254  -74.592 -20.055 1.00 0.00 ? 26  GLU A OE2 1 
ATOM   146   N N   . TYR A  1  27  ? 9.328   -71.997 -23.216 1.00 0.00 ? 27  TYR A N   1 
ATOM   147   C CA  . TYR A  1  27  ? 7.990   -72.211 -23.719 1.00 0.00 ? 27  TYR A CA  1 
ATOM   148   C C   . TYR A  1  27  ? 7.629   -71.159 -24.679 1.00 0.00 ? 27  TYR A C   1 
ATOM   149   O O   . TYR A  1  27  ? 6.927   -71.447 -25.635 1.00 0.00 ? 27  TYR A O   1 
ATOM   150   C CB  . TYR A  1  27  ? 6.884   -72.278 -22.661 1.00 0.00 ? 27  TYR A CB  1 
ATOM   151   C CG  . TYR A  1  27  ? 7.065   -73.395 -21.668 1.00 0.00 ? 27  TYR A CG  1 
ATOM   152   C CD1 . TYR A  1  27  ? 8.016   -74.423 -21.762 1.00 0.00 ? 27  TYR A CD1 1 
ATOM   153   C CD2 . TYR A  1  27  ? 6.222   -73.378 -20.552 1.00 0.00 ? 27  TYR A CD2 1 
ATOM   154   C CE1 . TYR A  1  27  ? 8.134   -75.377 -20.747 1.00 0.00 ? 27  TYR A CE1 1 
ATOM   155   C CE2 . TYR A  1  27  ? 6.336   -74.319 -19.529 1.00 0.00 ? 27  TYR A CE2 1 
ATOM   156   C CZ  . TYR A  1  27  ? 7.290   -75.331 -19.631 1.00 0.00 ? 27  TYR A CZ  1 
ATOM   157   O OH  . TYR A  1  27  ? 7.387   -76.318 -18.632 1.00 0.00 ? 27  TYR A OH  1 
ATOM   158   N N   . ALA A  1  28  ? 8.122   -69.926 -24.463 1.00 0.00 ? 28  ALA A N   1 
ATOM   159   C CA  . ALA A  1  28  ? 7.929   -68.811 -25.351 1.00 0.00 ? 28  ALA A CA  1 
ATOM   160   C C   . ALA A  1  28  ? 8.696   -68.993 -26.618 1.00 0.00 ? 28  ALA A C   1 
ATOM   161   O O   . ALA A  1  28  ? 8.170   -68.665 -27.667 1.00 0.00 ? 28  ALA A O   1 
ATOM   162   C CB  . ALA A  1  28  ? 8.296   -67.464 -24.727 1.00 0.00 ? 28  ALA A CB  1 
ATOM   163   N N   . PHE A  1  29  ? 9.921   -69.571 -26.583 1.00 0.00 ? 29  PHE A N   1 
ATOM   164   C CA  . PHE A  1  29  ? 10.673  -69.932 -27.783 1.00 0.00 ? 29  PHE A CA  1 
ATOM   165   C C   . PHE A  1  29  ? 9.950   -70.976 -28.573 1.00 0.00 ? 29  PHE A C   1 
ATOM   166   O O   . PHE A  1  29  ? 9.931   -70.943 -29.800 1.00 0.00 ? 29  PHE A O   1 
ATOM   167   C CB  . PHE A  1  29  ? 12.078  -70.540 -27.607 1.00 0.00 ? 29  PHE A CB  1 
ATOM   168   C CG  . PHE A  1  29  ? 13.061  -69.696 -26.857 1.00 0.00 ? 29  PHE A CG  1 
ATOM   169   C CD1 . PHE A  1  29  ? 12.892  -68.330 -26.608 1.00 0.00 ? 29  PHE A CD1 1 
ATOM   170   C CD2 . PHE A  1  29  ? 14.204  -70.340 -26.356 1.00 0.00 ? 29  PHE A CD2 1 
ATOM   171   C CE1 . PHE A  1  29  ? 13.814  -67.637 -25.825 1.00 0.00 ? 29  PHE A CE1 1 
ATOM   172   C CE2 . PHE A  1  29  ? 15.140  -69.647 -25.592 1.00 0.00 ? 29  PHE A CE2 1 
ATOM   173   C CZ  . PHE A  1  29  ? 14.940  -68.294 -25.318 1.00 0.00 ? 29  PHE A CZ  1 
ATOM   174   N N   . LYS A  1  30  ? 9.344   -71.970 -27.887 1.00 0.00 ? 30  LYS A N   1 
ATOM   175   C CA  . LYS A  1  30  ? 8.592   -72.997 -28.567 1.00 0.00 ? 30  LYS A CA  1 
ATOM   176   C C   . LYS A  1  30  ? 7.327   -72.458 -29.175 1.00 0.00 ? 30  LYS A C   1 
ATOM   177   O O   . LYS A  1  30  ? 6.922   -72.931 -30.224 1.00 0.00 ? 30  LYS A O   1 
ATOM   178   C CB  . LYS A  1  30  ? 8.232   -74.150 -27.612 1.00 0.00 ? 30  LYS A CB  1 
ATOM   179   C CG  . LYS A  1  30  ? 9.463   -75.005 -27.262 1.00 0.00 ? 30  LYS A CG  1 
ATOM   180   C CD  . LYS A  1  30  ? 9.143   -76.221 -26.386 1.00 0.00 ? 30  LYS A CD  1 
ATOM   181   C CE  . LYS A  1  30  ? 8.805   -75.833 -24.951 1.00 0.00 ? 30  LYS A CE  1 
ATOM   182   N NZ  . LYS A  1  30  ? 8.485   -77.024 -24.135 1.00 0.00 ? 30  LYS A NZ  1 
ATOM   183   N N   . ALA A  1  31  ? 6.722   -71.417 -28.565 1.00 0.00 ? 31  ALA A N   1 
ATOM   184   C CA  . ALA A  1  31  ? 5.625   -70.642 -29.083 1.00 0.00 ? 31  ALA A CA  1 
ATOM   185   C C   . ALA A  1  31  ? 5.991   -69.838 -30.309 1.00 0.00 ? 31  ALA A C   1 
ATOM   186   O O   . ALA A  1  31  ? 5.171   -69.688 -31.203 1.00 0.00 ? 31  ALA A O   1 
ATOM   187   C CB  . ALA A  1  31  ? 5.019   -69.727 -28.013 1.00 0.00 ? 31  ALA A CB  1 
ATOM   188   N N   . ILE A  1  32  ? 7.240   -69.341 -30.423 1.00 0.00 ? 32  ILE A N   1 
ATOM   189   C CA  . ILE A  1  32  ? 7.749   -68.667 -31.600 1.00 0.00 ? 32  ILE A CA  1 
ATOM   190   C C   . ILE A  1  32  ? 7.845   -69.637 -32.744 1.00 0.00 ? 32  ILE A C   1 
ATOM   191   O O   . ILE A  1  32  ? 7.492   -69.293 -33.872 1.00 0.00 ? 32  ILE A O   1 
ATOM   192   C CB  . ILE A  1  32  ? 9.124   -68.055 -31.365 1.00 0.00 ? 32  ILE A CB  1 
ATOM   193   C CG1 . ILE A  1  32  ? 8.959   -66.774 -30.534 1.00 0.00 ? 32  ILE A CG1 1 
ATOM   194   C CG2 . ILE A  1  32  ? 9.873   -67.765 -32.692 1.00 0.00 ? 32  ILE A CG2 1 
ATOM   195   C CD1 . ILE A  1  32  ? 10.269  -66.172 -30.045 1.00 0.00 ? 32  ILE A CD1 1 
ATOM   196   N N   . ASN A  1  33  ? 8.322   -70.879 -32.473 1.00 0.00 ? 33  ASN A N   1 
ATOM   197   C CA  . ASN A  1  33  ? 8.443   -71.928 -33.474 1.00 0.00 ? 33  ASN A CA  1 
ATOM   198   C C   . ASN A  1  33  ? 7.110   -72.402 -33.983 1.00 0.00 ? 33  ASN A C   1 
ATOM   199   O O   . ASN A  1  33  ? 7.018   -72.854 -35.117 1.00 0.00 ? 33  ASN A O   1 
ATOM   200   C CB  . ASN A  1  33  ? 9.157   -73.190 -32.941 1.00 0.00 ? 33  ASN A CB  1 
ATOM   201   C CG  . ASN A  1  33  ? 10.648  -72.918 -32.769 1.00 0.00 ? 33  ASN A CG  1 
ATOM   202   O OD1 . ASN A  1  33  ? 11.042  -71.903 -32.186 1.00 0.00 ? 33  ASN A OD1 1 
ATOM   203   N ND2 . ASN A  1  33  ? 11.490  -73.856 -33.300 1.00 0.00 ? 33  ASN A ND2 1 
ATOM   204   N N   . GLN A  1  34  ? 6.067   -72.321 -33.129 1.00 0.00 ? 34  GLN A N   1 
ATOM   205   C CA  . GLN A  1  34  ? 4.724   -72.768 -33.395 1.00 0.00 ? 34  GLN A CA  1 
ATOM   206   C C   . GLN A  1  34  ? 3.901   -71.627 -33.926 1.00 0.00 ? 34  GLN A C   1 
ATOM   207   O O   . GLN A  1  34  ? 2.738   -71.828 -34.272 1.00 0.00 ? 34  GLN A O   1 
ATOM   208   C CB  . GLN A  1  34  ? 4.004   -73.354 -32.159 1.00 0.00 ? 34  GLN A CB  1 
ATOM   209   C CG  . GLN A  1  34  ? 4.587   -74.694 -31.650 1.00 0.00 ? 34  GLN A CG  1 
ATOM   210   C CD  . GLN A  1  34  ? 4.531   -75.822 -32.692 1.00 0.00 ? 34  GLN A CD  1 
ATOM   211   O OE1 . GLN A  1  34  ? 5.576   -76.369 -33.070 1.00 0.00 ? 34  GLN A OE1 1 
ATOM   212   N NE2 . GLN A  1  34  ? 3.291   -76.184 -33.139 1.00 0.00 ? 34  GLN A NE2 1 
ATOM   213   N N   . GLY A  1  35  ? 4.518   -70.428 -34.119 1.00 0.00 ? 35  GLY A N   1 
ATOM   214   C CA  . GLY A  1  35  ? 3.895   -69.319 -34.797 1.00 0.00 ? 35  GLY A CA  1 
ATOM   215   C C   . GLY A  1  35  ? 3.824   -69.612 -36.278 1.00 0.00 ? 35  GLY A C   1 
ATOM   216   O O   . GLY A  1  35  ? 2.972   -69.089 -36.992 1.00 0.00 ? 35  GLY A O   1 
ATOM   217   N N   . GLY A  1  36  ? 4.649   -70.574 -36.737 1.00 0.00 ? 36  GLY A N   1 
ATOM   218   C CA  . GLY A  1  36  ? 4.541   -71.198 -38.026 1.00 0.00 ? 36  GLY A CA  1 
ATOM   219   C C   . GLY A  1  36  ? 5.160   -70.431 -39.150 1.00 0.00 ? 36  GLY A C   1 
ATOM   220   O O   . GLY A  1  36  ? 5.078   -70.872 -40.292 1.00 0.00 ? 36  GLY A O   1 
ATOM   221   N N   . LEU A  1  37  ? 5.731   -69.241 -38.882 1.00 0.00 ? 37  LEU A N   1 
ATOM   222   C CA  . LEU A  1  37  ? 6.341   -68.403 -39.890 1.00 0.00 ? 37  LEU A CA  1 
ATOM   223   C C   . LEU A  1  37  ? 7.819   -68.632 -39.840 1.00 0.00 ? 37  LEU A C   1 
ATOM   224   O O   . LEU A  1  37  ? 8.300   -69.102 -38.820 1.00 0.00 ? 37  LEU A O   1 
ATOM   225   C CB  . LEU A  1  37  ? 6.027   -66.911 -39.625 1.00 0.00 ? 37  LEU A CB  1 
ATOM   226   C CG  . LEU A  1  37  ? 4.521   -66.567 -39.603 1.00 0.00 ? 37  LEU A CG  1 
ATOM   227   C CD1 . LEU A  1  37  ? 4.278   -65.237 -38.876 1.00 0.00 ? 37  LEU A CD1 1 
ATOM   228   C CD2 . LEU A  1  37  ? 3.906   -66.545 -41.008 1.00 0.00 ? 37  LEU A CD2 1 
ATOM   229   N N   . THR A  1  38  ? 8.495   -68.363 -40.965 1.00 0.00 ? 38  THR A N   1 
ATOM   230   C CA  . THR A  1  38  ? 9.935   -68.596 -41.160 1.00 0.00 ? 38  THR A CA  1 
ATOM   231   C C   . THR A  1  38  ? 10.705  -67.418 -41.800 1.00 0.00 ? 38  THR A C   1 
ATOM   232   O O   . THR A  1  38  ? 11.038  -67.447 -42.985 1.00 0.00 ? 38  THR A O   1 
ATOM   233   C CB  . THR A  1  38  ? 10.189  -69.866 -41.994 1.00 0.00 ? 38  THR A CB  1 
ATOM   234   O OG1 . THR A  1  38  ? 9.427   -70.954 -41.457 1.00 0.00 ? 38  THR A OG1 1 
ATOM   235   C CG2 . THR A  1  38  ? 11.665  -70.229 -41.975 1.00 0.00 ? 38  THR A CG2 1 
ATOM   236   N N   . SER A  1  39  ? 10.974  -66.397 -40.995 1.00 0.00 ? 39  SER A N   1 
ATOM   237   C CA  . SER A  1  39  ? 11.699  -65.199 -41.348 1.00 0.00 ? 39  SER A CA  1 
ATOM   238   C C   . SER A  1  39  ? 13.182  -65.426 -41.548 1.00 0.00 ? 39  SER A C   1 
ATOM   239   O O   . SER A  1  39  ? 13.773  -66.275 -40.883 1.00 0.00 ? 39  SER A O   1 
ATOM   240   C CB  . SER A  1  39  ? 11.548  -64.123 -40.278 1.00 0.00 ? 39  SER A CB  1 
ATOM   241   O OG  . SER A  1  39  ? 10.180  -63.984 -39.960 1.00 0.00 ? 39  SER A OG  1 
ATOM   242   N N   . VAL A  1  40  ? 13.815  -64.683 -42.495 1.00 0.00 ? 40  VAL A N   1 
ATOM   243   C CA  . VAL A  1  40  ? 15.245  -64.768 -42.769 1.00 0.00 ? 40  VAL A CA  1 
ATOM   244   C C   . VAL A  1  40  ? 15.636  -63.374 -43.115 1.00 0.00 ? 40  VAL A C   1 
ATOM   245   O O   . VAL A  1  40  ? 14.851  -62.689 -43.753 1.00 0.00 ? 40  VAL A O   1 
ATOM   246   C CB  . VAL A  1  40  ? 15.619  -65.654 -43.956 1.00 0.00 ? 40  VAL A CB  1 
ATOM   247   C CG1 . VAL A  1  40  ? 17.127  -65.613 -44.313 1.00 0.00 ? 40  VAL A CG1 1 
ATOM   248   C CG2 . VAL A  1  40  ? 15.176  -67.103 -43.664 1.00 0.00 ? 40  VAL A CG2 1 
ATOM   249   N N   . ALA A  1  41  ? 16.871  -62.931 -42.757 1.00 0.00 ? 41  ALA A N   1 
ATOM   250   C CA  . ALA A  1  41  ? 17.375  -61.646 -43.159 1.00 0.00 ? 41  ALA A CA  1 
ATOM   251   C C   . ALA A  1  41  ? 18.804  -61.857 -43.419 1.00 0.00 ? 41  ALA A C   1 
ATOM   252   O O   . ALA A  1  41  ? 19.412  -62.753 -42.866 1.00 0.00 ? 41  ALA A O   1 
ATOM   253   C CB  . ALA A  1  41  ? 17.296  -60.558 -42.086 1.00 0.00 ? 41  ALA A CB  1 
ATOM   254   N N   . VAL A  1  42  ? 19.350  -61.060 -44.336 1.00 0.00 ? 42  VAL A N   1 
ATOM   255   C CA  . VAL A  1  42  ? 20.691  -61.148 -44.833 1.00 0.00 ? 42  VAL A CA  1 
ATOM   256   C C   . VAL A  1  42  ? 21.221  -59.768 -44.728 1.00 0.00 ? 42  VAL A C   1 
ATOM   257   O O   . VAL A  1  42  ? 20.550  -58.828 -45.135 1.00 0.00 ? 42  VAL A O   1 
ATOM   258   C CB  . VAL A  1  42  ? 20.728  -61.593 -46.284 1.00 0.00 ? 42  VAL A CB  1 
ATOM   259   C CG1 . VAL A  1  42  ? 22.139  -61.489 -46.891 1.00 0.00 ? 42  VAL A CG1 1 
ATOM   260   C CG2 . VAL A  1  42  ? 20.198  -63.034 -46.358 1.00 0.00 ? 42  VAL A CG2 1 
ATOM   261   N N   . ARG A  1  43  ? 22.460  -59.597 -44.241 1.00 0.00 ? 43  ARG A N   1 
ATOM   262   C CA  . ARG A  1  43  ? 23.081  -58.307 -44.225 1.00 0.00 ? 43  ARG A CA  1 
ATOM   263   C C   . ARG A  1  43  ? 24.086  -58.299 -45.330 1.00 0.00 ? 43  ARG A C   1 
ATOM   264   O O   . ARG A  1  43  ? 25.190  -58.814 -45.185 1.00 0.00 ? 43  ARG A O   1 
ATOM   265   C CB  . ARG A  1  43  ? 23.819  -58.046 -42.916 1.00 0.00 ? 43  ARG A CB  1 
ATOM   266   C CG  . ARG A  1  43  ? 24.462  -56.667 -42.839 1.00 0.00 ? 43  ARG A CG  1 
ATOM   267   C CD  . ARG A  1  43  ? 24.744  -56.250 -41.400 1.00 0.00 ? 43  ARG A CD  1 
ATOM   268   N NE  . ARG A  1  43  ? 25.527  -57.303 -40.695 1.00 0.00 ? 43  ARG A NE  1 
ATOM   269   C CZ  . ARG A  1  43  ? 25.564  -57.406 -39.334 1.00 0.00 ? 43  ARG A CZ  1 
ATOM   270   N NH1 . ARG A  1  43  ? 24.692  -56.745 -38.533 1.00 0.00 ? 43  ARG A NH1 1 
ATOM   271   N NH2 . ARG A  1  43  ? 26.511  -58.200 -38.764 1.00 0.00 ? 43  ARG A NH2 1 
ATOM   272   N N   . GLY A  1  44  ? 23.738  -57.656 -46.467 1.00 0.00 ? 44  GLY A N   1 
ATOM   273   C CA  . GLY A  1  44  ? 24.643  -57.378 -47.553 1.00 0.00 ? 44  GLY A CA  1 
ATOM   274   C C   . GLY A  1  44  ? 25.505  -56.262 -47.118 1.00 0.00 ? 44  GLY A C   1 
ATOM   275   O O   . GLY A  1  44  ? 25.282  -55.694 -46.056 1.00 0.00 ? 44  GLY A O   1 
ATOM   276   N N   . LYS A  1  45  ? 26.508  -55.861 -47.914 1.00 0.00 ? 45  LYS A N   1 
ATOM   277   C CA  . LYS A  1  45  ? 27.278  -54.703 -47.533 1.00 0.00 ? 45  LYS A CA  1 
ATOM   278   C C   . LYS A  1  45  ? 26.430  -53.459 -47.650 1.00 0.00 ? 45  LYS A C   1 
ATOM   279   O O   . LYS A  1  45  ? 26.488  -52.551 -46.819 1.00 0.00 ? 45  LYS A O   1 
ATOM   280   C CB  . LYS A  1  45  ? 28.526  -54.506 -48.416 1.00 0.00 ? 45  LYS A CB  1 
ATOM   281   C CG  . LYS A  1  45  ? 29.650  -55.486 -48.076 1.00 0.00 ? 45  LYS A CG  1 
ATOM   282   C CD  . LYS A  1  45  ? 30.929  -55.294 -48.907 1.00 0.00 ? 45  LYS A CD  1 
ATOM   283   C CE  . LYS A  1  45  ? 31.702  -53.987 -48.680 1.00 0.00 ? 45  LYS A CE  1 
ATOM   284   N NZ  . LYS A  1  45  ? 32.200  -53.891 -47.290 1.00 0.00 ? 45  LYS A NZ  1 
ATOM   285   N N   . ASP A  1  46  ? 25.697  -53.389 -48.774 1.00 0.00 ? 46  ASP A N   1 
ATOM   286   C CA  . ASP A  1  46  ? 24.973  -52.233 -49.196 1.00 0.00 ? 46  ASP A CA  1 
ATOM   287   C C   . ASP A  1  46  ? 23.508  -52.362 -48.974 1.00 0.00 ? 46  ASP A C   1 
ATOM   288   O O   . ASP A  1  46  ? 22.800  -51.418 -49.275 1.00 0.00 ? 46  ASP A O   1 
ATOM   289   C CB  . ASP A  1  46  ? 25.170  -52.038 -50.707 1.00 0.00 ? 46  ASP A CB  1 
ATOM   290   C CG  . ASP A  1  46  ? 26.660  -52.016 -51.025 1.00 0.00 ? 46  ASP A CG  1 
ATOM   291   O OD1 . ASP A  1  46  ? 27.313  -50.987 -50.714 1.00 0.00 ? 46  ASP A OD1 1 
ATOM   292   O OD2 . ASP A  1  46  ? 27.169  -53.033 -51.566 1.00 0.00 ? 46  ASP A OD2 1 
ATOM   293   N N   . CYS A  1  47  ? 22.986  -53.509 -48.495 1.00 0.00 ? 47  CYS A N   1 
ATOM   294   C CA  . CYS A  1  47  ? 21.556  -53.683 -48.375 1.00 0.00 ? 47  CYS A CA  1 
ATOM   295   C C   . CYS A  1  47  ? 21.292  -54.707 -47.318 1.00 0.00 ? 47  CYS A C   1 
ATOM   296   O O   . CYS A  1  47  ? 22.211  -55.363 -46.864 1.00 0.00 ? 47  CYS A O   1 
ATOM   297   C CB  . CYS A  1  47  ? 20.888  -54.081 -49.712 1.00 0.00 ? 47  CYS A CB  1 
ATOM   298   S SG  . CYS A  1  47  ? 21.818  -55.355 -50.598 1.00 0.00 ? 47  CYS A SG  1 
ATOM   299   N N   . ALA A  1  48  ? 20.066  -54.692 -46.759 1.00 0.00 ? 48  ALA A N   1 
ATOM   300   C CA  . ALA A  1  48  ? 19.693  -55.470 -45.618 1.00 0.00 ? 48  ALA A CA  1 
ATOM   301   C C   . ALA A  1  48  ? 18.375  -56.115 -45.817 1.00 0.00 ? 48  ALA A C   1 
ATOM   302   O O   . ALA A  1  48  ? 17.388  -55.673 -45.246 1.00 0.00 ? 48  ALA A O   1 
ATOM   303   C CB  . ALA A  1  48  ? 19.627  -54.649 -44.329 1.00 0.00 ? 48  ALA A CB  1 
ATOM   304   N N   . VAL A  1  49  ? 18.303  -57.186 -46.624 1.00 0.00 ? 49  VAL A N   1 
ATOM   305   C CA  . VAL A  1  49  ? 17.083  -57.893 -46.959 1.00 0.00 ? 49  VAL A CA  1 
ATOM   306   C C   . VAL A  1  49  ? 16.460  -58.560 -45.756 1.00 0.00 ? 49  VAL A C   1 
ATOM   307   O O   . VAL A  1  49  ? 17.190  -59.063 -44.916 1.00 0.00 ? 49  VAL A O   1 
ATOM   308   C CB  . VAL A  1  49  ? 17.338  -58.951 -48.002 1.00 0.00 ? 49  VAL A CB  1 
ATOM   309   C CG1 . VAL A  1  49  ? 16.005  -59.469 -48.584 1.00 0.00 ? 49  VAL A CG1 1 
ATOM   310   C CG2 . VAL A  1  49  ? 18.226  -58.324 -49.093 1.00 0.00 ? 49  VAL A CG2 1 
ATOM   311   N N   . ILE A  1  50  ? 15.109  -58.630 -45.670 1.00 0.00 ? 50  ILE A N   1 
ATOM   312   C CA  . ILE A  1  50  ? 14.401  -59.378 -44.654 1.00 0.00 ? 50  ILE A CA  1 
ATOM   313   C C   . ILE A  1  50  ? 13.251  -59.966 -45.401 1.00 0.00 ? 50  ILE A C   1 
ATOM   314   O O   . ILE A  1  50  ? 12.828  -59.410 -46.403 1.00 0.00 ? 50  ILE A O   1 
ATOM   315   C CB  . ILE A  1  50  ? 13.910  -58.500 -43.508 1.00 0.00 ? 50  ILE A CB  1 
ATOM   316   C CG1 . ILE A  1  50  ? 13.475  -59.307 -42.281 1.00 0.00 ? 50  ILE A CG1 1 
ATOM   317   C CG2 . ILE A  1  50  ? 12.767  -57.557 -43.950 1.00 0.00 ? 50  ILE A CG2 1 
ATOM   318   C CD1 . ILE A  1  50  ? 13.437  -58.439 -41.025 1.00 0.00 ? 50  ILE A CD1 1 
ATOM   319   N N   . VAL A  1  51  ? 12.760  -61.145 -45.000 1.00 0.00 ? 51  VAL A N   1 
ATOM   320   C CA  . VAL A  1  51  ? 11.757  -61.815 -45.772 1.00 0.00 ? 51  VAL A CA  1 
ATOM   321   C C   . VAL A  1  51  ? 11.016  -62.725 -44.836 1.00 0.00 ? 51  VAL A C   1 
ATOM   322   O O   . VAL A  1  51  ? 11.558  -63.109 -43.803 1.00 0.00 ? 51  VAL A O   1 
ATOM   323   C CB  . VAL A  1  51  ? 12.364  -62.501 -46.998 1.00 0.00 ? 51  VAL A CB  1 
ATOM   324   C CG1 . VAL A  1  51  ? 13.636  -63.259 -46.609 1.00 0.00 ? 51  VAL A CG1 1 
ATOM   325   C CG2 . VAL A  1  51  ? 11.369  -63.391 -47.771 1.00 0.00 ? 51  VAL A CG2 1 
ATOM   326   N N   . THR A  1  52  ? 9.718   -62.997 -45.142 1.00 0.00 ? 52  THR A N   1 
ATOM   327   C CA  . THR A  1  52  ? 8.836   -63.785 -44.327 1.00 0.00 ? 52  THR A CA  1 
ATOM   328   C C   . THR A  1  52  ? 7.870   -64.444 -45.257 1.00 0.00 ? 52  THR A C   1 
ATOM   329   O O   . THR A  1  52  ? 7.380   -63.831 -46.201 1.00 0.00 ? 52  THR A O   1 
ATOM   330   C CB  . THR A  1  52  ? 7.972   -62.930 -43.385 1.00 0.00 ? 52  THR A CB  1 
ATOM   331   O OG1 . THR A  1  52  ? 8.684   -61.788 -42.928 1.00 0.00 ? 52  THR A OG1 1 
ATOM   332   C CG2 . THR A  1  52  ? 7.505   -63.748 -42.160 1.00 0.00 ? 52  THR A CG2 1 
ATOM   333   N N   . HIS A  1  68  ? 3.685   -58.956 -42.038 1.00 0.00 ? 68  HIS A N   1 
ATOM   334   C CA  . HIS A  1  68  ? 4.504   -59.109 -40.853 1.00 0.00 ? 68  HIS A CA  1 
ATOM   335   C C   . HIS A  1  68  ? 5.693   -58.216 -40.947 1.00 0.00 ? 68  HIS A C   1 
ATOM   336   O O   . HIS A  1  68  ? 6.409   -58.061 -39.966 1.00 0.00 ? 68  HIS A O   1 
ATOM   337   C CB  . HIS A  1  68  ? 5.017   -60.547 -40.642 1.00 0.00 ? 68  HIS A CB  1 
ATOM   338   C CG  . HIS A  1  68  ? 3.889   -61.528 -40.679 1.00 0.00 ? 68  HIS A CG  1 
ATOM   339   N ND1 . HIS A  1  68  ? 2.795   -61.463 -39.851 1.00 0.00 ? 68  HIS A ND1 1 
ATOM   340   C CD2 . HIS A  1  68  ? 3.637   -62.537 -41.552 1.00 0.00 ? 68  HIS A CD2 1 
ATOM   341   C CE1 . HIS A  1  68  ? 1.938   -62.424 -40.271 1.00 0.00 ? 68  HIS A CE1 1 
ATOM   342   N NE2 . HIS A  1  68  ? 2.405   -63.098 -41.300 1.00 0.00 ? 68  HIS A NE2 1 
ATOM   343   N N   . LEU A  1  69  ? 5.915   -57.566 -42.115 1.00 0.00 ? 69  LEU A N   1 
ATOM   344   C CA  . LEU A  1  69  ? 6.836   -56.464 -42.226 1.00 0.00 ? 69  LEU A CA  1 
ATOM   345   C C   . LEU A  1  69  ? 6.234   -55.286 -41.528 1.00 0.00 ? 69  LEU A C   1 
ATOM   346   O O   . LEU A  1  69  ? 5.020   -55.124 -41.518 1.00 0.00 ? 69  LEU A O   1 
ATOM   347   C CB  . LEU A  1  69  ? 7.134   -56.037 -43.673 1.00 0.00 ? 69  LEU A CB  1 
ATOM   348   C CG  . LEU A  1  69  ? 7.493   -57.186 -44.631 1.00 0.00 ? 69  LEU A CG  1 
ATOM   349   C CD1 . LEU A  1  69  ? 7.901   -56.611 -45.993 1.00 0.00 ? 69  LEU A CD1 1 
ATOM   350   C CD2 . LEU A  1  69  ? 8.564   -58.154 -44.110 1.00 0.00 ? 69  LEU A CD2 1 
ATOM   351   N N   . PHE A  1  70  ? 7.081   -54.482 -40.865 1.00 0.00 ? 70  PHE A N   1 
ATOM   352   C CA  . PHE A  1  70  ? 6.646   -53.372 -40.070 1.00 0.00 ? 70  PHE A CA  1 
ATOM   353   C C   . PHE A  1  70  ? 7.614   -52.313 -40.318 1.00 0.00 ? 70  PHE A C   1 
ATOM   354   O O   . PHE A  1  70  ? 8.710   -52.562 -40.801 1.00 0.00 ? 70  PHE A O   1 
ATOM   355   C CB  . PHE A  1  70  ? 6.647   -53.602 -38.544 1.00 0.00 ? 70  PHE A CB  1 
ATOM   356   C CG  . PHE A  1  70  ? 5.605   -54.621 -38.234 1.00 0.00 ? 70  PHE A CG  1 
ATOM   357   C CD1 . PHE A  1  70  ? 4.247   -54.287 -38.379 1.00 0.00 ? 70  PHE A CD1 1 
ATOM   358   C CD2 . PHE A  1  70  ? 5.958   -55.921 -37.843 1.00 0.00 ? 70  PHE A CD2 1 
ATOM   359   C CE1 . PHE A  1  70  ? 3.253   -55.248 -38.160 1.00 0.00 ? 70  PHE A CE1 1 
ATOM   360   C CE2 . PHE A  1  70  ? 4.964   -56.876 -37.605 1.00 0.00 ? 70  PHE A CE2 1 
ATOM   361   C CZ  . PHE A  1  70  ? 3.613   -56.545 -37.772 1.00 0.00 ? 70  PHE A CZ  1 
ATOM   362   N N   . LYS A  1  71  ? 7.163   -51.090 -40.011 1.00 0.00 ? 71  LYS A N   1 
ATOM   363   C CA  . LYS A  1  71  ? 7.883   -49.883 -40.180 1.00 0.00 ? 71  LYS A CA  1 
ATOM   364   C C   . LYS A  1  71  ? 7.794   -49.261 -38.844 1.00 0.00 ? 71  LYS A C   1 
ATOM   365   O O   . LYS A  1  71  ? 6.884   -48.491 -38.583 1.00 0.00 ? 71  LYS A O   1 
ATOM   366   C CB  . LYS A  1  71  ? 7.269   -48.964 -41.260 1.00 0.00 ? 71  LYS A CB  1 
ATOM   367   C CG  . LYS A  1  71  ? 8.161   -47.767 -41.595 1.00 0.00 ? 71  LYS A CG  1 
ATOM   368   C CD  . LYS A  1  71  ? 7.571   -46.784 -42.616 1.00 0.00 ? 71  LYS A CD  1 
ATOM   369   C CE  . LYS A  1  71  ? 6.646   -45.741 -41.976 1.00 0.00 ? 71  LYS A CE  1 
ATOM   370   N NZ  . LYS A  1  71  ? 6.253   -44.696 -42.948 1.00 0.00 ? 71  LYS A NZ  1 
ATOM   371   N N   . ILE A  1  72  ? 8.740   -49.603 -37.950 1.00 0.00 ? 72  ILE A N   1 
ATOM   372   C CA  . ILE A  1  72  ? 8.858   -49.082 -36.605 1.00 0.00 ? 72  ILE A CA  1 
ATOM   373   C C   . ILE A  1  72  ? 9.195   -47.612 -36.590 1.00 0.00 ? 72  ILE A C   1 
ATOM   374   O O   . ILE A  1  72  ? 8.828   -46.867 -35.689 1.00 0.00 ? 72  ILE A O   1 
ATOM   375   C CB  . ILE A  1  72  ? 9.896   -49.856 -35.831 1.00 0.00 ? 72  ILE A CB  1 
ATOM   376   C CG1 . ILE A  1  72  ? 9.527   -51.344 -35.768 1.00 0.00 ? 72  ILE A CG1 1 
ATOM   377   C CG2 . ILE A  1  72  ? 10.066  -49.300 -34.414 1.00 0.00 ? 72  ILE A CG2 1 
ATOM   378   C CD1 . ILE A  1  72  ? 8.104   -51.629 -35.297 1.00 0.00 ? 72  ILE A CD1 1 
ATOM   379   N N   . THR A  1  73  ? 9.925   -47.156 -37.603 1.00 0.00 ? 73  THR A N   1 
ATOM   380   C CA  . THR A  1  73  ? 10.336  -45.791 -37.732 1.00 0.00 ? 73  THR A CA  1 
ATOM   381   C C   . THR A  1  73  ? 10.487  -45.729 -39.200 1.00 0.00 ? 73  THR A C   1 
ATOM   382   O O   . THR A  1  73  ? 10.631  -46.755 -39.847 1.00 0.00 ? 73  THR A O   1 
ATOM   383   C CB  . THR A  1  73  ? 11.670  -45.437 -37.083 1.00 0.00 ? 73  THR A CB  1 
ATOM   384   O OG1 . THR A  1  73  ? 11.768  -46.001 -35.789 1.00 0.00 ? 73  THR A OG1 1 
ATOM   385   C CG2 . THR A  1  73  ? 11.831  -43.904 -36.967 1.00 0.00 ? 73  THR A CG2 1 
ATOM   386   N N   . GLU A  1  74  ? 10.502  -44.544 -39.809 1.00 0.00 ? 74  GLU A N   1 
ATOM   387   C CA  . GLU A  1  74  ? 10.647  -44.436 -41.238 1.00 0.00 ? 74  GLU A CA  1 
ATOM   388   C C   . GLU A  1  74  ? 11.982  -44.968 -41.725 1.00 0.00 ? 74  GLU A C   1 
ATOM   389   O O   . GLU A  1  74  ? 12.135  -45.269 -42.902 1.00 0.00 ? 74  GLU A O   1 
ATOM   390   C CB  . GLU A  1  74  ? 10.483  -42.961 -41.677 1.00 0.00 ? 74  GLU A CB  1 
ATOM   391   C CG  . GLU A  1  74  ? 11.498  -42.001 -41.016 1.00 0.00 ? 74  GLU A CG  1 
ATOM   392   C CD  . GLU A  1  74  ? 11.097  -40.535 -41.154 1.00 0.00 ? 74  GLU A CD  1 
ATOM   393   O OE1 . GLU A  1  74  ? 10.072  -40.248 -41.824 1.00 0.00 ? 74  GLU A OE1 1 
ATOM   394   O OE2 . GLU A  1  74  ? 11.818  -39.680 -40.568 1.00 0.00 ? 74  GLU A OE2 1 
ATOM   395   N N   . ASN A  1  75  ? 12.990  -45.054 -40.832 1.00 0.00 ? 75  ASN A N   1 
ATOM   396   C CA  . ASN A  1  75  ? 14.296  -45.551 -41.148 1.00 0.00 ? 75  ASN A CA  1 
ATOM   397   C C   . ASN A  1  75  ? 14.542  -46.925 -40.604 1.00 0.00 ? 75  ASN A C   1 
ATOM   398   O O   . ASN A  1  75  ? 15.639  -47.446 -40.792 1.00 0.00 ? 75  ASN A O   1 
ATOM   399   C CB  . ASN A  1  75  ? 15.396  -44.681 -40.507 1.00 0.00 ? 75  ASN A CB  1 
ATOM   400   C CG  . ASN A  1  75  ? 15.153  -43.184 -40.739 1.00 0.00 ? 75  ASN A CG  1 
ATOM   401   O OD1 . ASN A  1  75  ? 15.398  -42.661 -41.830 1.00 0.00 ? 75  ASN A OD1 1 
ATOM   402   N ND2 . ASN A  1  75  ? 14.675  -42.491 -39.661 1.00 0.00 ? 75  ASN A ND2 1 
ATOM   403   N N   . ILE A  1  76  ? 13.560  -47.541 -39.901 1.00 0.00 ? 76  ILE A N   1 
ATOM   404   C CA  . ILE A  1  76  ? 13.761  -48.783 -39.185 1.00 0.00 ? 76  ILE A CA  1 
ATOM   405   C C   . ILE A  1  76  ? 12.556  -49.661 -39.384 1.00 0.00 ? 76  ILE A C   1 
ATOM   406   O O   . ILE A  1  76  ? 11.421  -49.212 -39.322 1.00 0.00 ? 76  ILE A O   1 
ATOM   407   C CB  . ILE A  1  76  ? 13.997  -48.628 -37.691 1.00 0.00 ? 76  ILE A CB  1 
ATOM   408   C CG1 . ILE A  1  76  ? 14.934  -47.449 -37.389 1.00 0.00 ? 76  ILE A CG1 1 
ATOM   409   C CG2 . ILE A  1  76  ? 14.579  -49.947 -37.142 1.00 0.00 ? 76  ILE A CG2 1 
ATOM   410   C CD1 . ILE A  1  76  ? 15.157  -47.209 -35.898 1.00 0.00 ? 76  ILE A CD1 1 
ATOM   411   N N   . GLY A  1  77  ? 12.749  -50.965 -39.573 1.00 0.00 ? 77  GLY A N   1 
ATOM   412   C CA  . GLY A  1  77  ? 11.642  -51.862 -39.680 1.00 0.00 ? 77  GLY A CA  1 
ATOM   413   C C   . GLY A  1  77  ? 12.060  -53.088 -38.972 1.00 0.00 ? 77  GLY A C   1 
ATOM   414   O O   . GLY A  1  77  ? 13.182  -53.192 -38.484 1.00 0.00 ? 77  GLY A O   1 
ATOM   415   N N   . CYS A  1  78  ? 11.121  -54.032 -38.823 1.00 0.00 ? 78  CYS A N   1 
ATOM   416   C CA  . CYS A  1  78  ? 11.429  -55.264 -38.177 1.00 0.00 ? 78  CYS A CA  1 
ATOM   417   C C   . CYS A  1  78  ? 10.362  -56.207 -38.551 1.00 0.00 ? 78  CYS A C   1 
ATOM   418   O O   . CYS A  1  78  ? 9.315   -55.789 -39.032 1.00 0.00 ? 78  CYS A O   1 
ATOM   419   C CB  . CYS A  1  78  ? 11.531  -55.201 -36.616 1.00 0.00 ? 78  CYS A CB  1 
ATOM   420   S SG  . CYS A  1  78  ? 10.015  -54.900 -35.657 1.00 0.00 ? 78  CYS A SG  1 
ATOM   421   N N   . VAL A  1  79  ? 10.610  -57.512 -38.331 1.00 0.00 ? 79  VAL A N   1 
ATOM   422   C CA  . VAL A  1  79  ? 9.608   -58.506 -38.562 1.00 0.00 ? 79  VAL A CA  1 
ATOM   423   C C   . VAL A  1  79  ? 9.568   -59.229 -37.278 1.00 0.00 ? 79  VAL A C   1 
ATOM   424   O O   . VAL A  1  79  ? 10.569  -59.781 -36.846 1.00 0.00 ? 79  VAL A O   1 
ATOM   425   C CB  . VAL A  1  79  ? 10.021  -59.461 -39.662 1.00 0.00 ? 79  VAL A CB  1 
ATOM   426   C CG1 . VAL A  1  79  ? 9.195   -60.753 -39.674 1.00 0.00 ? 79  VAL A CG1 1 
ATOM   427   C CG2 . VAL A  1  79  ? 9.846   -58.732 -41.002 1.00 0.00 ? 79  VAL A CG2 1 
ATOM   428   N N   . MET A  1  80  ? 8.355   -59.287 -36.687 1.00 0.00 ? 80  MET A N   1 
ATOM   429   C CA  . MET A  1  80  ? 8.003   -60.115 -35.584 1.00 0.00 ? 80  MET A CA  1 
ATOM   430   C C   . MET A  1  80  ? 7.708   -61.498 -36.106 1.00 0.00 ? 80  MET A C   1 
ATOM   431   O O   . MET A  1  80  ? 7.387   -61.668 -37.278 1.00 0.00 ? 80  MET A O   1 
ATOM   432   C CB  . MET A  1  80  ? 6.805   -59.543 -34.852 1.00 0.00 ? 80  MET A CB  1 
ATOM   433   C CG  . MET A  1  80  ? 7.077   -58.172 -34.213 1.00 0.00 ? 80  MET A CG  1 
ATOM   434   S SD  . MET A  1  80  ? 7.875   -58.224 -32.582 1.00 0.00 ? 80  MET A SD  1 
ATOM   435   C CE  . MET A  1  80  ? 7.927   -56.423 -32.472 1.00 0.00 ? 80  MET A CE  1 
ATOM   436   N N   . THR A  1  81  ? 7.873   -62.548 -35.284 1.00 0.00 ? 81  THR A N   1 
ATOM   437   C CA  . THR A  1  81  ? 7.686   -63.892 -35.762 1.00 0.00 ? 81  THR A CA  1 
ATOM   438   C C   . THR A  1  81  ? 7.236   -64.685 -34.595 1.00 0.00 ? 81  THR A C   1 
ATOM   439   O O   . THR A  1  81  ? 8.013   -64.933 -33.686 1.00 0.00 ? 81  THR A O   1 
ATOM   440   C CB  . THR A  1  81  ? 8.962   -64.550 -36.278 1.00 0.00 ? 81  THR A CB  1 
ATOM   441   O OG1 . THR A  1  81  ? 9.729   -63.647 -37.061 1.00 0.00 ? 81  THR A OG1 1 
ATOM   442   C CG2 . THR A  1  81  ? 8.606   -65.789 -37.127 1.00 0.00 ? 81  THR A CG2 1 
ATOM   443   N N   . GLY A  1  82  ? 5.980   -65.140 -34.580 1.00 0.00 ? 82  GLY A N   1 
ATOM   444   C CA  . GLY A  1  82  ? 5.524   -65.922 -33.479 1.00 0.00 ? 82  GLY A CA  1 
ATOM   445   C C   . GLY A  1  82  ? 4.073   -65.732 -33.418 1.00 0.00 ? 82  GLY A C   1 
ATOM   446   O O   . GLY A  1  82  ? 3.408   -65.724 -34.446 1.00 0.00 ? 82  GLY A O   1 
ATOM   447   N N   . MET A  1  83  ? 3.542   -65.582 -32.192 1.00 0.00 ? 83  MET A N   1 
ATOM   448   C CA  . MET A  1  83  ? 2.157   -65.287 -31.926 1.00 0.00 ? 83  MET A CA  1 
ATOM   449   C C   . MET A  1  83  ? 1.795   -63.981 -32.583 1.00 0.00 ? 83  MET A C   1 
ATOM   450   O O   . MET A  1  83  ? 2.602   -63.052 -32.585 1.00 0.00 ? 83  MET A O   1 
ATOM   451   C CB  . MET A  1  83  ? 1.885   -65.199 -30.419 1.00 0.00 ? 83  MET A CB  1 
ATOM   452   C CG  . MET A  1  83  ? 2.197   -66.493 -29.662 1.00 0.00 ? 83  MET A CG  1 
ATOM   453   S SD  . MET A  1  83  ? 2.070   -66.282 -27.867 1.00 0.00 ? 83  MET A SD  1 
ATOM   454   C CE  . MET A  1  83  ? 0.272   -66.471 -27.728 1.00 0.00 ? 83  MET A CE  1 
ATOM   455   N N   . THR A  1  84  ? 0.629   -63.948 -33.274 1.00 0.00 ? 84  THR A N   1 
ATOM   456   C CA  . THR A  1  84  ? 0.288   -62.864 -34.166 1.00 0.00 ? 84  THR A CA  1 
ATOM   457   C C   . THR A  1  84  ? -0.106  -61.661 -33.385 1.00 0.00 ? 84  THR A C   1 
ATOM   458   O O   . THR A  1  84  ? 0.273   -60.540 -33.698 1.00 0.00 ? 84  THR A O   1 
ATOM   459   C CB  . THR A  1  84  ? -0.884  -63.221 -35.067 1.00 0.00 ? 84  THR A CB  1 
ATOM   460   O OG1 . THR A  1  84  ? -0.679  -64.480 -35.689 1.00 0.00 ? 84  THR A OG1 1 
ATOM   461   C CG2 . THR A  1  84  ? -1.063  -62.137 -36.155 1.00 0.00 ? 84  THR A CG2 1 
ATOM   462   N N   . ALA A  1  85  ? -0.890  -61.891 -32.322 1.00 0.00 ? 85  ALA A N   1 
ATOM   463   C CA  . ALA A  1  85  ? -1.407  -60.859 -31.482 1.00 0.00 ? 85  ALA A CA  1 
ATOM   464   C C   . ALA A  1  85  ? -0.326  -60.164 -30.748 1.00 0.00 ? 85  ALA A C   1 
ATOM   465   O O   . ALA A  1  85  ? -0.371  -58.952 -30.556 1.00 0.00 ? 85  ALA A O   1 
ATOM   466   C CB  . ALA A  1  85  ? -2.346  -61.448 -30.433 1.00 0.00 ? 85  ALA A CB  1 
ATOM   467   N N   . ASP A  1  86  ? 0.668   -60.974 -30.321 1.00 0.00 ? 86  ASP A N   1 
ATOM   468   C CA  . ASP A  1  86  ? 1.770   -60.595 -29.479 1.00 0.00 ? 86  ASP A CA  1 
ATOM   469   C C   . ASP A  1  86  ? 2.699   -59.664 -30.161 1.00 0.00 ? 86  ASP A C   1 
ATOM   470   O O   . ASP A  1  86  ? 3.304   -58.821 -29.509 1.00 0.00 ? 86  ASP A O   1 
ATOM   471   C CB  . ASP A  1  86  ? 2.547   -61.825 -28.986 1.00 0.00 ? 86  ASP A CB  1 
ATOM   472   C CG  . ASP A  1  86  ? 1.697   -62.596 -27.975 1.00 0.00 ? 86  ASP A CG  1 
ATOM   473   O OD1 . ASP A  1  86  ? 0.614   -63.106 -28.364 1.00 0.00 ? 86  ASP A OD1 1 
ATOM   474   O OD2 . ASP A  1  86  ? 2.116   -62.687 -26.792 1.00 0.00 ? 86  ASP A OD2 1 
ATOM   475   N N   . SER A  1  87  ? 2.769   -59.761 -31.504 1.00 0.00 ? 87  SER A N   1 
ATOM   476   C CA  . SER A  1  87  ? 3.646   -58.985 -32.327 1.00 0.00 ? 87  SER A CA  1 
ATOM   477   C C   . SER A  1  87  ? 3.297   -57.534 -32.218 1.00 0.00 ? 87  SER A C   1 
ATOM   478   O O   . SER A  1  87  ? 4.185   -56.708 -32.053 1.00 0.00 ? 87  SER A O   1 
ATOM   479   C CB  . SER A  1  87  ? 3.455   -59.327 -33.827 1.00 0.00 ? 87  SER A CB  1 
ATOM   480   O OG  . SER A  1  87  ? 3.741   -60.690 -34.111 1.00 0.00 ? 87  SER A OG  1 
ATOM   481   N N   . ARG A  1  88  ? 1.986   -57.203 -32.235 1.00 0.00 ? 88  ARG A N   1 
ATOM   482   C CA  . ARG A  1  88  ? 1.500   -55.852 -32.307 1.00 0.00 ? 88  ARG A CA  1 
ATOM   483   C C   . ARG A  1  88  ? 1.793   -55.033 -31.096 1.00 0.00 ? 88  ARG A C   1 
ATOM   484   O O   . ARG A  1  88  ? 1.994   -53.830 -31.218 1.00 0.00 ? 88  ARG A O   1 
ATOM   485   C CB  . ARG A  1  88  ? -0.013  -55.788 -32.558 1.00 0.00 ? 88  ARG A CB  1 
ATOM   486   C CG  . ARG A  1  88  ? -0.469  -56.557 -33.813 1.00 0.00 ? 88  ARG A CG  1 
ATOM   487   C CD  . ARG A  1  88  ? 0.208   -56.099 -35.113 1.00 0.00 ? 88  ARG A CD  1 
ATOM   488   N NE  . ARG A  1  88  ? -0.517  -56.688 -36.287 1.00 0.00 ? 88  ARG A NE  1 
ATOM   489   C CZ  . ARG A  1  88  ? -0.232  -57.916 -36.819 1.00 0.00 ? 88  ARG A CZ  1 
ATOM   490   N NH1 . ARG A  1  88  ? 0.755   -58.705 -36.308 1.00 0.00 ? 88  ARG A NH1 1 
ATOM   491   N NH2 . ARG A  1  88  ? -0.955  -58.362 -37.890 1.00 0.00 ? 88  ARG A NH2 1 
ATOM   492   N N   . SER A  1  89  ? 1.861   -55.653 -29.897 1.00 0.00 ? 89  SER A N   1 
ATOM   493   C CA  . SER A  1  89  ? 2.150   -54.955 -28.661 1.00 0.00 ? 89  SER A CA  1 
ATOM   494   C C   . SER A  1  89  ? 3.554   -54.414 -28.660 1.00 0.00 ? 89  SER A C   1 
ATOM   495   O O   . SER A  1  89  ? 3.788   -53.263 -28.301 1.00 0.00 ? 89  SER A O   1 
ATOM   496   C CB  . SER A  1  89  ? 1.980   -55.864 -27.434 1.00 0.00 ? 89  SER A CB  1 
ATOM   497   O OG  . SER A  1  89  ? 2.102   -55.152 -26.209 1.00 0.00 ? 89  SER A OG  1 
ATOM   498   N N   . GLN A  1  90  ? 4.527   -55.271 -29.048 1.00 0.00 ? 90  GLN A N   1 
ATOM   499   C CA  . GLN A  1  90  ? 5.894   -54.898 -29.166 1.00 0.00 ? 90  GLN A CA  1 
ATOM   500   C C   . GLN A  1  90  ? 6.153   -54.052 -30.361 1.00 0.00 ? 90  GLN A C   1 
ATOM   501   O O   . GLN A  1  90  ? 7.154   -53.349 -30.370 1.00 0.00 ? 90  GLN A O   1 
ATOM   502   C CB  . GLN A  1  90  ? 6.844   -56.104 -29.209 1.00 0.00 ? 90  GLN A CB  1 
ATOM   503   C CG  . GLN A  1  90  ? 6.915   -56.840 -27.861 1.00 0.00 ? 90  GLN A CG  1 
ATOM   504   C CD  . GLN A  1  90  ? 8.317   -57.407 -27.620 1.00 0.00 ? 90  GLN A CD  1 
ATOM   505   O OE1 . GLN A  1  90  ? 8.798   -58.280 -28.345 1.00 0.00 ? 90  GLN A OE1 1 
ATOM   506   N NE2 . GLN A  1  90  ? 8.989   -56.896 -26.551 1.00 0.00 ? 90  GLN A NE2 1 
ATOM   507   N N   . VAL A  1  91  ? 5.297   -54.063 -31.406 1.00 0.00 ? 91  VAL A N   1 
ATOM   508   C CA  . VAL A  1  91  ? 5.437   -53.142 -32.514 1.00 0.00 ? 91  VAL A CA  1 
ATOM   509   C C   . VAL A  1  91  ? 5.140   -51.775 -32.019 1.00 0.00 ? 91  VAL A C   1 
ATOM   510   O O   . VAL A  1  91  ? 5.879   -50.840 -32.274 1.00 0.00 ? 91  VAL A O   1 
ATOM   511   C CB  . VAL A  1  91  ? 4.593   -53.472 -33.742 1.00 0.00 ? 91  VAL A CB  1 
ATOM   512   C CG1 . VAL A  1  91  ? 4.463   -52.275 -34.714 1.00 0.00 ? 91  VAL A CG1 1 
ATOM   513   C CG2 . VAL A  1  91  ? 5.220   -54.674 -34.476 1.00 0.00 ? 91  VAL A CG2 1 
ATOM   514   N N   . GLN A  1  92  ? 4.032   -51.611 -31.295 1.00 0.00 ? 92  GLN A N   1 
ATOM   515   C CA  . GLN A  1  92  ? 3.640   -50.337 -30.771 1.00 0.00 ? 92  GLN A CA  1 
ATOM   516   C C   . GLN A  1  92  ? 4.591   -49.822 -29.754 1.00 0.00 ? 92  GLN A C   1 
ATOM   517   O O   . GLN A  1  92  ? 4.821   -48.623 -29.711 1.00 0.00 ? 92  GLN A O   1 
ATOM   518   C CB  . GLN A  1  92  ? 2.235   -50.378 -30.136 1.00 0.00 ? 92  GLN A CB  1 
ATOM   519   C CG  . GLN A  1  92  ? 1.115   -50.327 -31.185 1.00 0.00 ? 92  GLN A CG  1 
ATOM   520   C CD  . GLN A  1  92  ? 1.138   -48.952 -31.869 1.00 0.00 ? 92  GLN A CD  1 
ATOM   521   O OE1 . GLN A  1  92  ? 1.602   -47.958 -31.296 1.00 0.00 ? 92  GLN A OE1 1 
ATOM   522   N NE2 . GLN A  1  92  ? 0.618   -48.908 -33.131 1.00 0.00 ? 92  GLN A NE2 1 
ATOM   523   N N   . ARG A  1  93  ? 5.188   -50.699 -28.924 1.00 0.00 ? 93  ARG A N   1 
ATOM   524   C CA  . ARG A  1  93  ? 6.190   -50.307 -27.962 1.00 0.00 ? 93  ARG A CA  1 
ATOM   525   C C   . ARG A  1  93  ? 7.450   -49.859 -28.653 1.00 0.00 ? 93  ARG A C   1 
ATOM   526   O O   . ARG A  1  93  ? 8.139   -48.950 -28.212 1.00 0.00 ? 93  ARG A O   1 
ATOM   527   C CB  . ARG A  1  93  ? 6.531   -51.448 -26.994 1.00 0.00 ? 93  ARG A CB  1 
ATOM   528   C CG  . ARG A  1  93  ? 7.542   -51.062 -25.904 1.00 0.00 ? 93  ARG A CG  1 
ATOM   529   C CD  . ARG A  1  93  ? 7.008   -50.079 -24.859 1.00 0.00 ? 93  ARG A CD  1 
ATOM   530   N NE  . ARG A  1  93  ? 6.148   -50.863 -23.911 1.00 0.00 ? 93  ARG A NE  1 
ATOM   531   C CZ  . ARG A  1  93  ? 6.319   -50.860 -22.555 1.00 0.00 ? 93  ARG A CZ  1 
ATOM   532   N NH1 . ARG A  1  93  ? 7.221   -50.038 -21.947 1.00 0.00 ? 93  ARG A NH1 1 
ATOM   533   N NH2 . ARG A  1  93  ? 5.566   -51.702 -21.788 1.00 0.00 ? 93  ARG A NH2 1 
ATOM   534   N N   . ALA A  1  94  ? 7.786   -50.471 -29.793 1.00 0.00 ? 94  ALA A N   1 
ATOM   535   C CA  . ALA A  1  94  ? 8.936   -50.109 -30.546 1.00 0.00 ? 94  ALA A CA  1 
ATOM   536   C C   . ALA A  1  94  ? 8.778   -48.755 -31.149 1.00 0.00 ? 94  ALA A C   1 
ATOM   537   O O   . ALA A  1  94  ? 9.702   -47.960 -31.110 1.00 0.00 ? 94  ALA A O   1 
ATOM   538   C CB  . ALA A  1  94  ? 9.219   -51.157 -31.622 1.00 0.00 ? 94  ALA A CB  1 
ATOM   539   N N   . ARG A  1  95  ? 7.592   -48.427 -31.678 1.00 0.00 ? 95  ARG A N   1 
ATOM   540   C CA  . ARG A  1  95  ? 7.246   -47.126 -32.184 1.00 0.00 ? 95  ARG A CA  1 
ATOM   541   C C   . ARG A  1  95  ? 7.171   -46.100 -31.108 1.00 0.00 ? 95  ARG A C   1 
ATOM   542   O O   . ARG A  1  95  ? 7.450   -44.935 -31.346 1.00 0.00 ? 95  ARG A O   1 
ATOM   543   C CB  . ARG A  1  95  ? 5.921   -47.144 -32.924 1.00 0.00 ? 95  ARG A CB  1 
ATOM   544   C CG  . ARG A  1  95  ? 5.989   -47.869 -34.265 1.00 0.00 ? 95  ARG A CG  1 
ATOM   545   C CD  . ARG A  1  95  ? 4.601   -48.351 -34.656 1.00 0.00 ? 95  ARG A CD  1 
ATOM   546   N NE  . ARG A  1  95  ? 4.577   -48.718 -36.096 1.00 0.00 ? 95  ARG A NE  1 
ATOM   547   C CZ  . ARG A  1  95  ? 3.422   -49.129 -36.696 1.00 0.00 ? 95  ARG A CZ  1 
ATOM   548   N NH1 . ARG A  1  95  ? 2.352   -49.502 -35.940 1.00 0.00 ? 95  ARG A NH1 1 
ATOM   549   N NH2 . ARG A  1  95  ? 3.344   -49.171 -38.059 1.00 0.00 ? 95  ARG A NH2 1 
ATOM   550   N N   . TYR A  1  96  ? 6.800   -46.493 -29.881 1.00 0.00 ? 96  TYR A N   1 
ATOM   551   C CA  . TYR A  1  96  ? 6.711   -45.576 -28.779 1.00 0.00 ? 96  TYR A CA  1 
ATOM   552   C C   . TYR A  1  96  ? 8.087   -45.102 -28.404 1.00 0.00 ? 96  TYR A C   1 
ATOM   553   O O   . TYR A  1  96  ? 8.330   -43.902 -28.303 1.00 0.00 ? 96  TYR A O   1 
ATOM   554   C CB  . TYR A  1  96  ? 6.074   -46.262 -27.540 1.00 0.00 ? 96  TYR A CB  1 
ATOM   555   C CG  . TYR A  1  96  ? 6.101   -45.451 -26.266 1.00 0.00 ? 96  TYR A CG  1 
ATOM   556   C CD1 . TYR A  1  96  ? 5.766   -44.088 -26.247 1.00 0.00 ? 96  TYR A CD1 1 
ATOM   557   C CD2 . TYR A  1  96  ? 6.447   -46.074 -25.061 1.00 0.00 ? 96  TYR A CD2 1 
ATOM   558   C CE1 . TYR A  1  96  ? 5.777   -43.366 -25.047 1.00 0.00 ? 96  TYR A CE1 1 
ATOM   559   C CE2 . TYR A  1  96  ? 6.447   -45.368 -23.857 1.00 0.00 ? 96  TYR A CE2 1 
ATOM   560   C CZ  . TYR A  1  96  ? 6.118   -44.007 -23.848 1.00 0.00 ? 96  TYR A CZ  1 
ATOM   561   O OH  . TYR A  1  96  ? 6.132   -43.283 -22.635 1.00 0.00 ? 96  TYR A OH  1 
ATOM   562   N N   . GLU A  1  97  ? 9.014   -46.059 -28.187 1.00 0.00 ? 97  GLU A N   1 
ATOM   563   C CA  . GLU A  1  97  ? 10.378  -45.792 -27.829 1.00 0.00 ? 97  GLU A CA  1 
ATOM   564   C C   . GLU A  1  97  ? 11.149  -45.126 -28.920 1.00 0.00 ? 97  GLU A C   1 
ATOM   565   O O   . GLU A  1  97  ? 12.027  -44.335 -28.646 1.00 0.00 ? 97  GLU A O   1 
ATOM   566   C CB  . GLU A  1  97  ? 11.123  -47.078 -27.406 1.00 0.00 ? 97  GLU A CB  1 
ATOM   567   C CG  . GLU A  1  97  ? 10.480  -47.843 -26.225 1.00 0.00 ? 97  GLU A CG  1 
ATOM   568   C CD  . GLU A  1  97  ? 10.535  -47.116 -24.878 1.00 0.00 ? 97  GLU A CD  1 
ATOM   569   O OE1 . GLU A  1  97  ? 11.101  -45.994 -24.784 1.00 0.00 ? 97  GLU A OE1 1 
ATOM   570   O OE2 . GLU A  1  97  ? 9.996   -47.709 -23.904 1.00 0.00 ? 97  GLU A OE2 1 
ATOM   571   N N   . ALA A  1  98  ? 10.902  -45.481 -30.187 1.00 0.00 ? 98  ALA A N   1 
ATOM   572   C CA  . ALA A  1  98  ? 11.626  -44.943 -31.299 1.00 0.00 ? 98  ALA A CA  1 
ATOM   573   C C   . ALA A  1  98  ? 11.364  -43.493 -31.517 1.00 0.00 ? 98  ALA A C   1 
ATOM   574   O O   . ALA A  1  98  ? 12.250  -42.752 -31.950 1.00 0.00 ? 98  ALA A O   1 
ATOM   575   C CB  . ALA A  1  98  ? 11.274  -45.667 -32.598 1.00 0.00 ? 98  ALA A CB  1 
ATOM   576   N N   . ALA A  1  99  ? 10.107  -43.090 -31.223 1.00 0.00 ? 99  ALA A N   1 
ATOM   577   C CA  . ALA A  1  99  ? 9.586   -41.764 -31.362 1.00 0.00 ? 99  ALA A CA  1 
ATOM   578   C C   . ALA A  1  99  ? 10.026  -40.976 -30.187 1.00 0.00 ? 99  ALA A C   1 
ATOM   579   O O   . ALA A  1  99  ? 10.402  -39.821 -30.330 1.00 0.00 ? 99  ALA A O   1 
ATOM   580   C CB  . ALA A  1  99  ? 8.060   -41.756 -31.489 1.00 0.00 ? 99  ALA A CB  1 
ATOM   581   N N   . ASN A  1  100 ? 10.002  -41.575 -28.985 1.00 0.00 ? 100 ASN A N   1 
ATOM   582   C CA  . ASN A  1  100 ? 10.429  -40.933 -27.765 1.00 0.00 ? 100 ASN A CA  1 
ATOM   583   C C   . ASN A  1  100 ? 11.928  -40.633 -27.775 1.00 0.00 ? 100 ASN A C   1 
ATOM   584   O O   . ASN A  1  100 ? 12.388  -39.686 -27.147 1.00 0.00 ? 100 ASN A O   1 
ATOM   585   C CB  . ASN A  1  100 ? 10.046  -41.887 -26.599 1.00 0.00 ? 100 ASN A CB  1 
ATOM   586   C CG  . ASN A  1  100 ? 10.120  -41.357 -25.159 1.00 0.00 ? 100 ASN A CG  1 
ATOM   587   O OD1 . ASN A  1  100 ? 9.909   -40.162 -24.929 1.00 0.00 ? 100 ASN A OD1 1 
ATOM   588   N ND2 . ASN A  1  100 ? 10.358  -42.278 -24.178 1.00 0.00 ? 100 ASN A ND2 1 
ATOM   589   N N   . TRP A  1  101 ? 12.741  -41.417 -28.510 1.00 0.00 ? 101 TRP A N   1 
ATOM   590   C CA  . TRP A  1  101 ? 14.142  -41.193 -28.692 1.00 0.00 ? 101 TRP A CA  1 
ATOM   591   C C   . TRP A  1  101 ? 14.404  -39.890 -29.312 1.00 0.00 ? 101 TRP A C   1 
ATOM   592   O O   . TRP A  1  101 ? 15.151  -39.093 -28.778 1.00 0.00 ? 101 TRP A O   1 
ATOM   593   C CB  . TRP A  1  101 ? 14.760  -42.217 -29.630 1.00 0.00 ? 101 TRP A CB  1 
ATOM   594   C CG  . TRP A  1  101 ? 16.267  -42.216 -29.638 1.00 0.00 ? 101 TRP A CG  1 
ATOM   595   C CD1 . TRP A  1  101 ? 17.148  -41.581 -30.458 1.00 0.00 ? 101 TRP A CD1 1 
ATOM   596   C CD2 . TRP A  1  101 ? 17.035  -42.985 -28.711 1.00 0.00 ? 101 TRP A CD2 1 
ATOM   597   N NE1 . TRP A  1  101 ? 18.420  -41.956 -30.150 1.00 0.00 ? 101 TRP A NE1 1 
ATOM   598   C CE2 . TRP A  1  101 ? 18.372  -42.838 -29.087 1.00 0.00 ? 101 TRP A CE2 1 
ATOM   599   C CE3 . TRP A  1  101 ? 16.661  -43.772 -27.629 1.00 0.00 ? 101 TRP A CE3 1 
ATOM   600   C CZ2 . TRP A  1  101 ? 19.369  -43.498 -28.386 1.00 0.00 ? 101 TRP A CZ2 1 
ATOM   601   C CZ3 . TRP A  1  101 ? 17.671  -44.393 -26.894 1.00 0.00 ? 101 TRP A CZ3 1 
ATOM   602   C CH2 . TRP A  1  101 ? 19.006  -44.262 -27.270 1.00 0.00 ? 101 TRP A CH2 1 
ATOM   603   N N   . LYS A  1  102 ? 13.785  -39.648 -30.469 1.00 0.00 ? 102 LYS A N   1 
ATOM   604   C CA  . LYS A  1  102 ? 13.927  -38.445 -31.222 1.00 0.00 ? 102 LYS A CA  1 
ATOM   605   C C   . LYS A  1  102 ? 13.377  -37.314 -30.440 1.00 0.00 ? 102 LYS A C   1 
ATOM   606   O O   . LYS A  1  102 ? 13.860  -36.195 -30.511 1.00 0.00 ? 102 LYS A O   1 
ATOM   607   C CB  . LYS A  1  102 ? 13.218  -38.544 -32.568 1.00 0.00 ? 102 LYS A CB  1 
ATOM   608   C CG  . LYS A  1  102 ? 13.323  -37.280 -33.414 1.00 0.00 ? 102 LYS A CG  1 
ATOM   609   C CD  . LYS A  1  102 ? 12.730  -37.448 -34.807 1.00 0.00 ? 102 LYS A CD  1 
ATOM   610   C CE  . LYS A  1  102 ? 13.580  -38.312 -35.736 1.00 0.00 ? 102 LYS A CE  1 
ATOM   611   N NZ  . LYS A  1  102 ? 14.878  -37.663 -35.991 1.00 0.00 ? 102 LYS A NZ  1 
ATOM   612   N N   . TYR A  1  103 ? 12.347  -37.567 -29.619 1.00 0.00 ? 103 TYR A N   1 
ATOM   613   C CA  . TYR A  1  103 ? 11.831  -36.522 -28.795 1.00 0.00 ? 103 TYR A CA  1 
ATOM   614   C C   . TYR A  1  103 ? 12.827  -36.051 -27.753 1.00 0.00 ? 103 TYR A C   1 
ATOM   615   O O   . TYR A  1  103 ? 12.812  -34.877 -27.413 1.00 0.00 ? 103 TYR A O   1 
ATOM   616   C CB  . TYR A  1  103 ? 10.512  -36.936 -28.105 1.00 0.00 ? 103 TYR A CB  1 
ATOM   617   C CG  . TYR A  1  103 ? 9.820   -35.715 -27.566 1.00 0.00 ? 103 TYR A CG  1 
ATOM   618   C CD1 . TYR A  1  103 ? 9.419   -34.691 -28.435 1.00 0.00 ? 103 TYR A CD1 1 
ATOM   619   C CD2 . TYR A  1  103 ? 9.651   -35.545 -26.184 1.00 0.00 ? 103 TYR A CD2 1 
ATOM   620   C CE1 . TYR A  1  103 ? 8.904   -33.498 -27.936 1.00 0.00 ? 103 TYR A CE1 1 
ATOM   621   C CE2 . TYR A  1  103 ? 9.145   -34.344 -25.680 1.00 0.00 ? 103 TYR A CE2 1 
ATOM   622   C CZ  . TYR A  1  103 ? 8.791   -33.311 -26.557 1.00 0.00 ? 103 TYR A CZ  1 
ATOM   623   O OH  . TYR A  1  103 ? 8.301   -32.086 -26.052 1.00 0.00 ? 103 TYR A OH  1 
ATOM   624   N N   . LYS A  1  104 ? 13.702  -36.917 -27.196 1.00 0.00 ? 104 LYS A N   1 
ATOM   625   C CA  . LYS A  1  104 ? 14.608  -36.482 -26.153 1.00 0.00 ? 104 LYS A CA  1 
ATOM   626   C C   . LYS A  1  104 ? 16.004  -36.235 -26.632 1.00 0.00 ? 104 LYS A C   1 
ATOM   627   O O   . LYS A  1  104 ? 16.800  -35.676 -25.894 1.00 0.00 ? 104 LYS A O   1 
ATOM   628   C CB  . LYS A  1  104 ? 14.703  -37.535 -25.039 1.00 0.00 ? 104 LYS A CB  1 
ATOM   629   C CG  . LYS A  1  104 ? 13.342  -37.807 -24.405 1.00 0.00 ? 104 LYS A CG  1 
ATOM   630   C CD  . LYS A  1  104 ? 13.361  -38.894 -23.335 1.00 0.00 ? 104 LYS A CD  1 
ATOM   631   C CE  . LYS A  1  104 ? 13.852  -38.407 -21.975 1.00 0.00 ? 104 LYS A CE  1 
ATOM   632   N NZ  . LYS A  1  104 ? 13.721  -39.477 -20.958 1.00 0.00 ? 104 LYS A NZ  1 
ATOM   633   N N   . TYR A  1  105 ? 16.345  -36.786 -27.799 1.00 0.00 ? 105 TYR A N   1 
ATOM   634   C CA  . TYR A  1  105 ? 17.705  -36.692 -28.337 1.00 0.00 ? 105 TYR A CA  1 
ATOM   635   C C   . TYR A  1  105 ? 17.748  -35.945 -29.667 1.00 0.00 ? 105 TYR A C   1 
ATOM   636   O O   . TYR A  1  105 ? 18.418  -34.919 -29.784 1.00 0.00 ? 105 TYR A O   1 
ATOM   637   C CB  . TYR A  1  105 ? 18.312  -38.087 -28.500 1.00 0.00 ? 105 TYR A CB  1 
ATOM   638   C CG  . TYR A  1  105 ? 18.263  -38.927 -27.244 1.00 0.00 ? 105 TYR A CG  1 
ATOM   639   C CD1 . TYR A  1  105 ? 18.696  -38.417 -26.027 1.00 0.00 ? 105 TYR A CD1 1 
ATOM   640   C CD2 . TYR A  1  105 ? 17.783  -40.230 -27.274 1.00 0.00 ? 105 TYR A CD2 1 
ATOM   641   C CE1 . TYR A  1  105 ? 18.653  -39.181 -24.876 1.00 0.00 ? 105 TYR A CE1 1 
ATOM   642   C CE2 . TYR A  1  105 ? 17.737  -41.001 -26.129 1.00 0.00 ? 105 TYR A CE2 1 
ATOM   643   C CZ  . TYR A  1  105 ? 18.172  -40.472 -24.933 1.00 0.00 ? 105 TYR A CZ  1 
ATOM   644   O OH  . TYR A  1  105 ? 18.128  -41.236 -23.789 1.00 0.00 ? 105 TYR A OH  1 
ATOM   645   N N   . GLY A  1  106 ? 17.016  -36.445 -30.660 1.00 0.00 ? 106 GLY A N   1 
ATOM   646   C CA  . GLY A  1  106 ? 16.760  -35.663 -31.855 1.00 0.00 ? 106 GLY A CA  1 
ATOM   647   C C   . GLY A  1  106 ? 17.410  -36.190 -33.086 1.00 0.00 ? 106 GLY A C   1 
ATOM   648   O O   . GLY A  1  106 ? 17.661  -35.430 -34.011 1.00 0.00 ? 106 GLY A O   1 
ATOM   649   N N   . TYR A  1  107 ? 17.704  -37.492 -33.082 1.00 0.00 ? 107 TYR A N   1 
ATOM   650   C CA  . TYR A  1  107 ? 18.279  -38.219 -34.218 1.00 0.00 ? 107 TYR A CA  1 
ATOM   651   C C   . TYR A  1  107 ? 17.741  -39.656 -34.218 1.00 0.00 ? 107 TYR A C   1 
ATOM   652   O O   . TYR A  1  107 ? 17.278  -40.134 -33.182 1.00 0.00 ? 107 TYR A O   1 
ATOM   653   C CB  . TYR A  1  107 ? 19.806  -38.222 -34.141 1.00 0.00 ? 107 TYR A CB  1 
ATOM   654   C CG  . TYR A  1  107 ? 20.361  -39.083 -33.029 1.00 0.00 ? 107 TYR A CG  1 
ATOM   655   C CD1 . TYR A  1  107 ? 20.260  -38.688 -31.702 1.00 0.00 ? 107 TYR A CD1 1 
ATOM   656   C CD2 . TYR A  1  107 ? 20.988  -40.290 -33.307 1.00 0.00 ? 107 TYR A CD2 1 
ATOM   657   C CE1 . TYR A  1  107 ? 20.766  -39.471 -30.682 1.00 0.00 ? 107 TYR A CE1 1 
ATOM   658   C CE2 . TYR A  1  107 ? 21.497  -41.080 -32.294 1.00 0.00 ? 107 TYR A CE2 1 
ATOM   659   C CZ  . TYR A  1  107 ? 21.384  -40.666 -30.984 1.00 0.00 ? 107 TYR A CZ  1 
ATOM   660   O OH  . TYR A  1  107 ? 21.890  -41.450 -29.972 1.00 0.00 ? 107 TYR A OH  1 
ATOM   661   N N   . GLU A  1  108 ? 17.786  -40.347 -35.358 1.00 0.00 ? 108 GLU A N   1 
ATOM   662   C CA  . GLU A  1  108 ? 17.207  -41.667 -35.420 1.00 0.00 ? 108 GLU A CA  1 
ATOM   663   C C   . GLU A  1  108 ? 17.862  -42.498 -34.359 1.00 0.00 ? 108 GLU A C   1 
ATOM   664   O O   . GLU A  1  108 ? 19.088  -42.549 -34.300 1.00 0.00 ? 108 GLU A O   1 
ATOM   665   C CB  . GLU A  1  108 ? 17.467  -42.386 -36.784 1.00 0.00 ? 108 GLU A CB  1 
ATOM   666   C CG  . GLU A  1  108 ? 16.805  -43.784 -36.968 1.00 0.00 ? 108 GLU A CG  1 
ATOM   667   C CD  . GLU A  1  108 ? 17.744  -44.777 -37.672 1.00 0.00 ? 108 GLU A CD  1 
ATOM   668   O OE1 . GLU A  1  108 ? 18.168  -44.501 -38.821 1.00 0.00 ? 108 GLU A OE1 1 
ATOM   669   O OE2 . GLU A  1  108 ? 18.057  -45.834 -37.073 1.00 0.00 ? 108 GLU A OE2 1 
ATOM   670   N N   . ILE A  1  109 ? 17.056  -43.246 -33.572 1.00 0.00 ? 109 ILE A N   1 
ATOM   671   C CA  . ILE A  1  109 ? 17.525  -44.231 -32.630 1.00 0.00 ? 109 ILE A CA  1 
ATOM   672   C C   . ILE A  1  109 ? 18.332  -45.255 -33.391 1.00 0.00 ? 109 ILE A C   1 
ATOM   673   O O   . ILE A  1  109 ? 17.824  -45.706 -34.408 1.00 0.00 ? 109 ILE A O   1 
ATOM   674   C CB  . ILE A  1  109 ? 16.352  -44.870 -31.897 1.00 0.00 ? 109 ILE A CB  1 
ATOM   675   C CG1 . ILE A  1  109 ? 16.779  -45.742 -30.711 1.00 0.00 ? 109 ILE A CG1 1 
ATOM   676   C CG2 . ILE A  1  109 ? 15.417  -45.643 -32.844 1.00 0.00 ? 109 ILE A CG2 1 
ATOM   677   C CD1 . ILE A  1  109 ? 15.624  -46.125 -29.790 1.00 0.00 ? 109 ILE A CD1 1 
ATOM   678   N N   . PRO A  1  110 ? 19.560  -45.660 -33.065 1.00 0.00 ? 110 PRO A N   1 
ATOM   679   C CA  . PRO A  1  110 ? 20.261  -46.689 -33.812 1.00 0.00 ? 110 PRO A CA  1 
ATOM   680   C C   . PRO A  1  110 ? 19.532  -47.987 -33.712 1.00 0.00 ? 110 PRO A C   1 
ATOM   681   O O   . PRO A  1  110 ? 18.761  -48.161 -32.776 1.00 0.00 ? 110 PRO A O   1 
ATOM   682   C CB  . PRO A  1  110 ? 21.623  -46.775 -33.149 1.00 0.00 ? 110 PRO A CB  1 
ATOM   683   C CG  . PRO A  1  110 ? 21.858  -45.354 -32.640 1.00 0.00 ? 110 PRO A CG  1 
ATOM   684   C CD  . PRO A  1  110 ? 20.468  -44.917 -32.201 1.00 0.00 ? 110 PRO A CD  1 
ATOM   685   N N   . VAL A  1  111 ? 19.716  -48.915 -34.660 1.00 0.00 ? 111 VAL A N   1 
ATOM   686   C CA  . VAL A  1  111 ? 19.012  -50.173 -34.631 1.00 0.00 ? 111 VAL A CA  1 
ATOM   687   C C   . VAL A  1  111 ? 19.371  -50.958 -33.397 1.00 0.00 ? 111 VAL A C   1 
ATOM   688   O O   . VAL A  1  111 ? 18.546  -51.671 -32.838 1.00 0.00 ? 111 VAL A O   1 
ATOM   689   C CB  . VAL A  1  111 ? 19.318  -50.986 -35.874 1.00 0.00 ? 111 VAL A CB  1 
ATOM   690   C CG1 . VAL A  1  111 ? 18.511  -52.295 -35.893 1.00 0.00 ? 111 VAL A CG1 1 
ATOM   691   C CG2 . VAL A  1  111 ? 18.970  -50.131 -37.108 1.00 0.00 ? 111 VAL A CG2 1 
ATOM   692   N N   . ASP A  1  112 ? 20.629  -50.819 -32.946 1.00 0.00 ? 112 ASP A N   1 
ATOM   693   C CA  . ASP A  1  112 ? 21.172  -51.436 -31.772 1.00 0.00 ? 112 ASP A CA  1 
ATOM   694   C C   . ASP A  1  112 ? 20.487  -50.953 -30.532 1.00 0.00 ? 112 ASP A C   1 
ATOM   695   O O   . ASP A  1  112 ? 20.214  -51.753 -29.646 1.00 0.00 ? 112 ASP A O   1 
ATOM   696   C CB  . ASP A  1  112 ? 22.680  -51.064 -31.698 1.00 0.00 ? 112 ASP A CB  1 
ATOM   697   C CG  . ASP A  1  112 ? 23.394  -51.435 -30.390 1.00 0.00 ? 112 ASP A CG  1 
ATOM   698   O OD1 . ASP A  1  112 ? 23.501  -52.652 -30.089 1.00 0.00 ? 112 ASP A OD1 1 
ATOM   699   O OD2 . ASP A  1  112 ? 23.826  -50.491 -29.675 1.00 0.00 ? 112 ASP A OD2 1 
ATOM   700   N N   . MET A  1  113 ? 20.236  -49.633 -30.432 1.00 0.00 ? 113 MET A N   1 
ATOM   701   C CA  . MET A  1  113 ? 19.629  -49.006 -29.290 1.00 0.00 ? 113 MET A CA  1 
ATOM   702   C C   . MET A  1  113 ? 18.201  -49.364 -29.159 1.00 0.00 ? 113 MET A C   1 
ATOM   703   O O   . MET A  1  113 ? 17.698  -49.510 -28.050 1.00 0.00 ? 113 MET A O   1 
ATOM   704   C CB  . MET A  1  113 ? 19.863  -47.492 -29.253 1.00 0.00 ? 113 MET A CB  1 
ATOM   705   C CG  . MET A  1  113 ? 21.371  -47.150 -29.222 1.00 0.00 ? 113 MET A CG  1 
ATOM   706   S SD  . MET A  1  113 ? 22.396  -47.891 -27.882 1.00 0.00 ? 113 MET A SD  1 
ATOM   707   C CE  . MET A  1  113 ? 21.770  -46.768 -26.612 1.00 0.00 ? 113 MET A CE  1 
ATOM   708   N N   . LEU A  1  114 ? 17.512  -49.526 -30.300 1.00 0.00 ? 114 LEU A N   1 
ATOM   709   C CA  . LEU A  1  114 ? 16.114  -49.856 -30.327 1.00 0.00 ? 114 LEU A CA  1 
ATOM   710   C C   . LEU A  1  114 ? 15.922  -51.293 -29.900 1.00 0.00 ? 114 LEU A C   1 
ATOM   711   O O   . LEU A  1  114 ? 15.070  -51.596 -29.069 1.00 0.00 ? 114 LEU A O   1 
ATOM   712   C CB  . LEU A  1  114 ? 15.544  -49.697 -31.757 1.00 0.00 ? 114 LEU A CB  1 
ATOM   713   C CG  . LEU A  1  114 ? 15.517  -48.272 -32.366 1.00 0.00 ? 114 LEU A CG  1 
ATOM   714   C CD1 . LEU A  1  114 ? 15.060  -48.367 -33.826 1.00 0.00 ? 114 LEU A CD1 1 
ATOM   715   C CD2 . LEU A  1  114 ? 14.701  -47.224 -31.596 1.00 0.00 ? 114 LEU A CD2 1 
ATOM   716   N N   . CYS A  1  115 ? 16.756  -52.221 -30.435 1.00 0.00 ? 115 CYS A N   1 
ATOM   717   C CA  . CYS A  1  115 ? 16.710  -53.609 -30.078 1.00 0.00 ? 115 CYS A CA  1 
ATOM   718   C C   . CYS A  1  115 ? 17.084  -53.821 -28.655 1.00 0.00 ? 115 CYS A C   1 
ATOM   719   O O   . CYS A  1  115 ? 16.603  -54.741 -28.011 1.00 0.00 ? 115 CYS A O   1 
ATOM   720   C CB  . CYS A  1  115 ? 17.670  -54.461 -30.907 1.00 0.00 ? 115 CYS A CB  1 
ATOM   721   S SG  . CYS A  1  115 ? 17.222  -56.225 -30.854 1.00 0.00 ? 115 CYS A SG  1 
ATOM   722   N N   . LYS A  1  116 ? 17.974  -52.970 -28.124 1.00 0.00 ? 116 LYS A N   1 
ATOM   723   C CA  . LYS A  1  116 ? 18.423  -53.068 -26.774 1.00 0.00 ? 116 LYS A CA  1 
ATOM   724   C C   . LYS A  1  116 ? 17.302  -52.732 -25.871 1.00 0.00 ? 116 LYS A C   1 
ATOM   725   O O   . LYS A  1  116 ? 17.086  -53.436 -24.896 1.00 0.00 ? 116 LYS A O   1 
ATOM   726   C CB  . LYS A  1  116 ? 19.570  -52.061 -26.506 1.00 0.00 ? 116 LYS A CB  1 
ATOM   727   C CG  . LYS A  1  116 ? 20.052  -51.975 -25.049 1.00 0.00 ? 116 LYS A CG  1 
ATOM   728   C CD  . LYS A  1  116 ? 20.843  -50.697 -24.717 1.00 0.00 ? 116 LYS A CD  1 
ATOM   729   C CE  . LYS A  1  116 ? 20.005  -49.404 -24.692 1.00 0.00 ? 116 LYS A CE  1 
ATOM   730   N NZ  . LYS A  1  116 ? 18.939  -49.453 -23.668 1.00 0.00 ? 116 LYS A NZ  1 
ATOM   731   N N   . ARG A  1  117 ? 16.585  -51.625 -26.154 1.00 0.00 ? 117 ARG A N   1 
ATOM   732   C CA  . ARG A  1  117 ? 15.515  -51.155 -25.324 1.00 0.00 ? 117 ARG A CA  1 
ATOM   733   C C   . ARG A  1  117 ? 14.343  -52.055 -25.329 1.00 0.00 ? 117 ARG A C   1 
ATOM   734   O O   . ARG A  1  117 ? 13.767  -52.306 -24.281 1.00 0.00 ? 117 ARG A O   1 
ATOM   735   C CB  . ARG A  1  117 ? 15.050  -49.748 -25.709 1.00 0.00 ? 117 ARG A CB  1 
ATOM   736   C CG  . ARG A  1  117 ? 13.851  -49.223 -24.901 1.00 0.00 ? 117 ARG A CG  1 
ATOM   737   C CD  . ARG A  1  117 ? 14.059  -49.214 -23.382 1.00 0.00 ? 117 ARG A CD  1 
ATOM   738   N NE  . ARG A  1  117 ? 12.760  -48.863 -22.737 1.00 0.00 ? 117 ARG A NE  1 
ATOM   739   C CZ  . ARG A  1  117 ? 12.635  -48.661 -21.393 1.00 0.00 ? 117 ARG A CZ  1 
ATOM   740   N NH1 . ARG A  1  117 ? 13.710  -48.762 -20.561 1.00 0.00 ? 117 ARG A NH1 1 
ATOM   741   N NH2 . ARG A  1  117 ? 11.412  -48.345 -20.875 1.00 0.00 ? 117 ARG A NH2 1 
ATOM   742   N N   . ILE A  1  118 ? 13.938  -52.597 -26.487 1.00 0.00 ? 118 ILE A N   1 
ATOM   743   C CA  . ILE A  1  118 ? 12.837  -53.535 -26.533 1.00 0.00 ? 118 ILE A CA  1 
ATOM   744   C C   . ILE A  1  118 ? 13.152  -54.828 -25.821 1.00 0.00 ? 118 ILE A C   1 
ATOM   745   O O   . ILE A  1  118 ? 12.292  -55.427 -25.190 1.00 0.00 ? 118 ILE A O   1 
ATOM   746   C CB  . ILE A  1  118 ? 12.352  -53.731 -27.955 1.00 0.00 ? 118 ILE A CB  1 
ATOM   747   C CG1 . ILE A  1  118 ? 11.849  -52.375 -28.516 1.00 0.00 ? 118 ILE A CG1 1 
ATOM   748   C CG2 . ILE A  1  118 ? 11.229  -54.779 -28.015 1.00 0.00 ? 118 ILE A CG2 1 
ATOM   749   C CD1 . ILE A  1  118 ? 10.658  -51.760 -27.767 1.00 0.00 ? 118 ILE A CD1 1 
ATOM   750   N N   . ALA A  1  119 ? 14.414  -55.271 -25.856 1.00 0.00 ? 119 ALA A N   1 
ATOM   751   C CA  . ALA A  1  119 ? 14.882  -56.414 -25.131 1.00 0.00 ? 119 ALA A CA  1 
ATOM   752   C C   . ALA A  1  119 ? 14.813  -56.166 -23.657 1.00 0.00 ? 119 ALA A C   1 
ATOM   753   O O   . ALA A  1  119 ? 14.435  -57.045 -22.896 1.00 0.00 ? 119 ALA A O   1 
ATOM   754   C CB  . ALA A  1  119 ? 16.315  -56.781 -25.499 1.00 0.00 ? 119 ALA A CB  1 
ATOM   755   N N   . ASP A  1  120 ? 15.146  -54.943 -23.215 1.00 0.00 ? 120 ASP A N   1 
ATOM   756   C CA  . ASP A  1  120 ? 15.130  -54.560 -21.828 1.00 0.00 ? 120 ASP A CA  1 
ATOM   757   C C   . ASP A  1  120 ? 13.740  -54.585 -21.263 1.00 0.00 ? 120 ASP A C   1 
ATOM   758   O O   . ASP A  1  120 ? 13.597  -54.901 -20.086 1.00 0.00 ? 120 ASP A O   1 
ATOM   759   C CB  . ASP A  1  120 ? 15.703  -53.139 -21.575 1.00 0.00 ? 120 ASP A CB  1 
ATOM   760   C CG  . ASP A  1  120 ? 17.206  -53.052 -21.856 1.00 0.00 ? 120 ASP A CG  1 
ATOM   761   O OD1 . ASP A  1  120 ? 17.869  -54.104 -22.037 1.00 0.00 ? 120 ASP A OD1 1 
ATOM   762   O OD2 . ASP A  1  120 ? 17.711  -51.901 -21.886 1.00 0.00 ? 120 ASP A OD2 1 
ATOM   763   N N   . ILE A  1  121 ? 12.686  -54.274 -22.064 1.00 0.00 ? 121 ILE A N   1 
ATOM   764   C CA  . ILE A  1  121 ? 11.323  -54.362 -21.576 1.00 0.00 ? 121 ILE A CA  1 
ATOM   765   C C   . ILE A  1  121 ? 10.757  -55.749 -21.719 1.00 0.00 ? 121 ILE A C   1 
ATOM   766   O O   . ILE A  1  121 ? 9.901   -56.116 -20.926 1.00 0.00 ? 121 ILE A O   1 
ATOM   767   C CB  . ILE A  1  121 ? 10.342  -53.318 -22.116 1.00 0.00 ? 121 ILE A CB  1 
ATOM   768   C CG1 . ILE A  1  121 ? 10.050  -53.348 -23.633 1.00 0.00 ? 121 ILE A CG1 1 
ATOM   769   C CG2 . ILE A  1  121 ? 10.872  -51.939 -21.680 1.00 0.00 ? 121 ILE A CG2 1 
ATOM   770   C CD1 . ILE A  1  121 ? 8.958   -54.326 -24.062 1.00 0.00 ? 121 ILE A CD1 1 
ATOM   771   N N   . SER A  1  122 ? 11.236  -56.593 -22.675 1.00 0.00 ? 122 SER A N   1 
ATOM   772   C CA  . SER A  1  122 ? 10.845  -57.991 -22.713 1.00 0.00 ? 122 SER A CA  1 
ATOM   773   C C   . SER A  1  122 ? 11.360  -58.765 -21.517 1.00 0.00 ? 122 SER A C   1 
ATOM   774   O O   . SER A  1  122 ? 10.736  -59.729 -21.096 1.00 0.00 ? 122 SER A O   1 
ATOM   775   C CB  . SER A  1  122 ? 11.179  -58.746 -24.027 1.00 0.00 ? 122 SER A CB  1 
ATOM   776   O OG  . SER A  1  122 ? 12.535  -59.131 -24.148 1.00 0.00 ? 122 SER A OG  1 
ATOM   777   N N   . GLN A  1  123 ? 12.487  -58.351 -20.900 1.00 0.00 ? 123 GLN A N   1 
ATOM   778   C CA  . GLN A  1  123 ? 12.972  -58.939 -19.680 1.00 0.00 ? 123 GLN A CA  1 
ATOM   779   C C   . GLN A  1  123 ? 12.018  -58.672 -18.575 1.00 0.00 ? 123 GLN A C   1 
ATOM   780   O O   . GLN A  1  123 ? 11.933  -59.463 -17.652 1.00 0.00 ? 123 GLN A O   1 
ATOM   781   C CB  . GLN A  1  123 ? 14.326  -58.376 -19.188 1.00 0.00 ? 123 GLN A CB  1 
ATOM   782   C CG  . GLN A  1  123 ? 14.780  -58.937 -17.819 1.00 0.00 ? 123 GLN A CG  1 
ATOM   783   C CD  . GLN A  1  123 ? 16.128  -58.362 -17.402 1.00 0.00 ? 123 GLN A CD  1 
ATOM   784   O OE1 . GLN A  1  123 ? 16.939  -57.982 -18.251 1.00 0.00 ? 123 GLN A OE1 1 
ATOM   785   N NE2 . GLN A  1  123 ? 16.357  -58.305 -16.054 1.00 0.00 ? 123 GLN A NE2 1 
ATOM   786   N N   . VAL A  1  124 ? 11.258  -57.560 -18.600 1.00 0.00 ? 124 VAL A N   1 
ATOM   787   C CA  . VAL A  1  124 ? 10.359  -57.224 -17.518 1.00 0.00 ? 124 VAL A CA  1 
ATOM   788   C C   . VAL A  1  124 ? 9.306   -58.281 -17.353 1.00 0.00 ? 124 VAL A C   1 
ATOM   789   O O   . VAL A  1  124 ? 8.885   -58.546 -16.235 1.00 0.00 ? 124 VAL A O   1 
ATOM   790   C CB  . VAL A  1  124 ? 9.718   -55.861 -17.701 1.00 0.00 ? 124 VAL A CB  1 
ATOM   791   C CG1 . VAL A  1  124 ? 8.720   -55.528 -16.568 1.00 0.00 ? 124 VAL A CG1 1 
ATOM   792   C CG2 . VAL A  1  124 ? 10.849  -54.814 -17.726 1.00 0.00 ? 124 VAL A CG2 1 
ATOM   793   N N   . TYR A  1  125 ? 8.898   -58.935 -18.470 1.00 0.00 ? 125 TYR A N   1 
ATOM   794   C CA  . TYR A  1  125 ? 7.946   -60.018 -18.505 1.00 0.00 ? 125 TYR A CA  1 
ATOM   795   C C   . TYR A  1  125 ? 8.452   -61.215 -17.758 1.00 0.00 ? 125 TYR A C   1 
ATOM   796   O O   . TYR A  1  125 ? 7.669   -61.978 -17.210 1.00 0.00 ? 125 TYR A O   1 
ATOM   797   C CB  . TYR A  1  125 ? 7.677   -60.565 -19.934 1.00 0.00 ? 125 TYR A CB  1 
ATOM   798   C CG  . TYR A  1  125 ? 7.337   -59.564 -21.021 1.00 0.00 ? 125 TYR A CG  1 
ATOM   799   C CD1 . TYR A  1  125 ? 6.616   -58.378 -20.802 1.00 0.00 ? 125 TYR A CD1 1 
ATOM   800   C CD2 . TYR A  1  125 ? 7.722   -59.869 -22.345 1.00 0.00 ? 125 TYR A CD2 1 
ATOM   801   C CE1 . TYR A  1  125 ? 6.295   -57.524 -21.864 1.00 0.00 ? 125 TYR A CE1 1 
ATOM   802   C CE2 . TYR A  1  125 ? 7.416   -59.021 -23.409 1.00 0.00 ? 125 TYR A CE2 1 
ATOM   803   C CZ  . TYR A  1  125 ? 6.699   -57.847 -23.168 1.00 0.00 ? 125 TYR A CZ  1 
ATOM   804   O OH  . TYR A  1  125 ? 6.368   -57.001 -24.247 1.00 0.00 ? 125 TYR A OH  1 
ATOM   805   N N   . THR A  1  126 ? 9.779   -61.405 -17.780 1.00 0.00 ? 126 THR A N   1 
ATOM   806   C CA  . THR A  1  126 ? 10.517  -62.519 -17.252 1.00 0.00 ? 126 THR A CA  1 
ATOM   807   C C   . THR A  1  126 ? 10.846  -62.325 -15.792 1.00 0.00 ? 126 THR A C   1 
ATOM   808   O O   . THR A  1  126 ? 10.705  -63.239 -14.984 1.00 0.00 ? 126 THR A O   1 
ATOM   809   C CB  . THR A  1  126 ? 11.772  -62.678 -18.067 1.00 0.00 ? 126 THR A CB  1 
ATOM   810   O OG1 . THR A  1  126 ? 11.437  -62.802 -19.437 1.00 0.00 ? 126 THR A OG1 1 
ATOM   811   C CG2 . THR A  1  126 ? 12.530  -63.927 -17.646 1.00 0.00 ? 126 THR A CG2 1 
ATOM   812   N N   . GLN A  1  127 ? 11.237  -61.099 -15.398 1.00 0.00 ? 127 GLN A N   1 
ATOM   813   C CA  . GLN A  1  127 ? 11.535  -60.755 -14.030 1.00 0.00 ? 127 GLN A CA  1 
ATOM   814   C C   . GLN A  1  127 ? 10.314  -60.810 -13.150 1.00 0.00 ? 127 GLN A C   1 
ATOM   815   O O   . GLN A  1  127 ? 10.400  -61.133 -11.970 1.00 0.00 ? 127 GLN A O   1 
ATOM   816   C CB  . GLN A  1  127 ? 12.126  -59.335 -13.905 1.00 0.00 ? 127 GLN A CB  1 
ATOM   817   C CG  . GLN A  1  127 ? 12.968  -59.112 -12.637 1.00 0.00 ? 127 GLN A CG  1 
ATOM   818   C CD  . GLN A  1  127 ? 14.219  -59.980 -12.736 1.00 0.00 ? 127 GLN A CD  1 
ATOM   819   O OE1 . GLN A  1  127 ? 14.790  -60.099 -13.824 1.00 0.00 ? 127 GLN A OE1 1 
ATOM   820   N NE2 . GLN A  1  127 ? 14.639  -60.599 -11.599 1.00 0.00 ? 127 GLN A NE2 1 
ATOM   821   N N   . ASN A  1  128 ? 9.148   -60.447 -13.744 1.00 0.00 ? 128 ASN A N   1 
ATOM   822   C CA  . ASN A  1  128 ? 7.862   -60.386 -13.102 1.00 0.00 ? 128 ASN A CA  1 
ATOM   823   C C   . ASN A  1  128 ? 7.196   -61.677 -13.419 1.00 0.00 ? 128 ASN A C   1 
ATOM   824   O O   . ASN A  1  128 ? 7.301   -62.160 -14.540 1.00 0.00 ? 128 ASN A O   1 
ATOM   825   C CB  . ASN A  1  128 ? 6.930   -59.270 -13.635 1.00 0.00 ? 128 ASN A CB  1 
ATOM   826   C CG  . ASN A  1  128 ? 7.546   -57.865 -13.522 1.00 0.00 ? 128 ASN A CG  1 
ATOM   827   O OD1 . ASN A  1  128 ? 8.717   -57.662 -13.195 1.00 0.00 ? 128 ASN A OD1 1 
ATOM   828   N ND2 . ASN A  1  128 ? 6.697   -56.844 -13.849 1.00 0.00 ? 128 ASN A ND2 1 
ATOM   829   N N   . ALA A  1  129 ? 6.543   -62.289 -12.408 1.00 0.00 ? 129 ALA A N   1 
ATOM   830   C CA  . ALA A  1  129 ? 5.816   -63.522 -12.542 1.00 0.00 ? 129 ALA A CA  1 
ATOM   831   C C   . ALA A  1  129 ? 4.365   -63.297 -12.851 1.00 0.00 ? 129 ALA A C   1 
ATOM   832   O O   . ALA A  1  129 ? 3.685   -64.230 -13.270 1.00 0.00 ? 129 ALA A O   1 
ATOM   833   C CB  . ALA A  1  129 ? 5.936   -64.313 -11.246 1.00 0.00 ? 129 ALA A CB  1 
ATOM   834   N N   . GLU A  1  130 ? 3.889   -62.034 -12.682 1.00 0.00 ? 130 GLU A N   1 
ATOM   835   C CA  . GLU A  1  130 ? 2.556   -61.531 -12.925 1.00 0.00 ? 130 GLU A CA  1 
ATOM   836   C C   . GLU A  1  130 ? 2.132   -61.686 -14.359 1.00 0.00 ? 130 GLU A C   1 
ATOM   837   O O   . GLU A  1  130 ? 1.030   -62.142 -14.640 1.00 0.00 ? 130 GLU A O   1 
ATOM   838   C CB  . GLU A  1  130 ? 2.512   -60.028 -12.540 1.00 0.00 ? 130 GLU A CB  1 
ATOM   839   C CG  . GLU A  1  130 ? 1.211   -59.237 -12.814 1.00 0.00 ? 130 GLU A CG  1 
ATOM   840   C CD  . GLU A  1  130 ? 0.038   -59.589 -11.888 1.00 0.00 ? 130 GLU A CD  1 
ATOM   841   O OE1 . GLU A  1  130 ? -0.359  -60.780 -11.829 1.00 0.00 ? 130 GLU A OE1 1 
ATOM   842   O OE2 . GLU A  1  130 ? -0.513  -58.639 -11.265 1.00 0.00 ? 130 GLU A OE2 1 
ATOM   843   N N   . MET A  1  131 ? 3.060   -61.331 -15.250 1.00 0.00 ? 131 MET A N   1 
ATOM   844   C CA  . MET A  1  131 ? 2.846   -61.210 -16.691 1.00 0.00 ? 131 MET A CA  1 
ATOM   845   C C   . MET A  1  131 ? 3.855   -62.069 -17.450 1.00 0.00 ? 131 MET A C   1 
ATOM   846   O O   . MET A  1  131 ? 4.893   -62.450 -16.907 1.00 0.00 ? 131 MET A O   1 
ATOM   847   C CB  . MET A  1  131 ? 2.958   -59.750 -17.130 1.00 0.00 ? 131 MET A CB  1 
ATOM   848   C CG  . MET A  1  131 ? 4.170   -59.024 -16.568 1.00 0.00 ? 131 MET A CG  1 
ATOM   849   S SD  . MET A  1  131 ? 4.815   -57.771 -17.693 1.00 0.00 ? 131 MET A SD  1 
ATOM   850   C CE  . MET A  1  131 ? 3.674   -56.424 -17.389 1.00 0.00 ? 131 MET A CE  1 
ATOM   851   N N   . ARG A  1  132 ? 3.530   -62.392 -18.698 1.00 0.00 ? 132 ARG A N   1 
ATOM   852   C CA  . ARG A  1  132 ? 4.101   -63.522 -19.379 1.00 0.00 ? 132 ARG A CA  1 
ATOM   853   C C   . ARG A  1  132 ? 4.910   -63.079 -20.566 1.00 0.00 ? 132 ARG A C   1 
ATOM   854   O O   . ARG A  1  132 ? 4.604   -62.046 -21.152 1.00 0.00 ? 132 ARG A O   1 
ATOM   855   C CB  . ARG A  1  132 ? 3.053   -64.533 -19.887 1.00 0.00 ? 132 ARG A CB  1 
ATOM   856   C CG  . ARG A  1  132 ? 2.181   -64.104 -21.072 1.00 0.00 ? 132 ARG A CG  1 
ATOM   857   C CD  . ARG A  1  132 ? 1.262   -65.219 -21.576 1.00 0.00 ? 132 ARG A CD  1 
ATOM   858   N NE  . ARG A  1  132 ? 0.329   -64.676 -22.597 1.00 0.00 ? 132 ARG A NE  1 
ATOM   859   C CZ  . ARG A  1  132 ? 0.688   -64.458 -23.891 1.00 0.00 ? 132 ARG A CZ  1 
ATOM   860   N NH1 . ARG A  1  132 ? 1.950   -64.710 -24.329 1.00 0.00 ? 132 ARG A NH1 1 
ATOM   861   N NH2 . ARG A  1  132 ? -0.245  -63.984 -24.764 1.00 0.00 ? 132 ARG A NH2 1 
ATOM   862   N N   . PRO A  1  133 ? 5.930   -63.815 -20.988 1.00 0.00 ? 133 PRO A N   1 
ATOM   863   C CA  . PRO A  1  133 ? 6.686   -63.535 -22.191 1.00 0.00 ? 133 PRO A CA  1 
ATOM   864   C C   . PRO A  1  133 ? 5.862   -63.463 -23.436 1.00 0.00 ? 133 PRO A C   1 
ATOM   865   O O   . PRO A  1  133 ? 5.090   -64.378 -23.681 1.00 0.00 ? 133 PRO A O   1 
ATOM   866   C CB  . PRO A  1  133 ? 7.720   -64.667 -22.290 1.00 0.00 ? 133 PRO A CB  1 
ATOM   867   C CG  . PRO A  1  133 ? 7.330   -65.703 -21.231 1.00 0.00 ? 133 PRO A CG  1 
ATOM   868   C CD  . PRO A  1  133 ? 6.567   -64.879 -20.206 1.00 0.00 ? 133 PRO A CD  1 
ATOM   869   N N   . LEU A  1  134 ? 6.019   -62.401 -24.250 1.00 0.00 ? 134 LEU A N   1 
ATOM   870   C CA  . LEU A  1  134 ? 5.360   -62.304 -25.534 1.00 0.00 ? 134 LEU A CA  1 
ATOM   871   C C   . LEU A  1  134 ? 6.198   -63.019 -26.553 1.00 0.00 ? 134 LEU A C   1 
ATOM   872   O O   . LEU A  1  134 ? 7.351   -62.665 -26.789 1.00 0.00 ? 134 LEU A O   1 
ATOM   873   C CB  . LEU A  1  134 ? 5.166   -60.857 -26.039 1.00 0.00 ? 134 LEU A CB  1 
ATOM   874   C CG  . LEU A  1  134 ? 4.411   -59.905 -25.085 1.00 0.00 ? 134 LEU A CG  1 
ATOM   875   C CD1 . LEU A  1  134 ? 3.916   -58.669 -25.854 1.00 0.00 ? 134 LEU A CD1 1 
ATOM   876   C CD2 . LEU A  1  134 ? 3.277   -60.544 -24.281 1.00 0.00 ? 134 LEU A CD2 1 
ATOM   877   N N   . GLY A  1  135 ? 5.636   -64.081 -27.152 1.00 0.00 ? 135 GLY A N   1 
ATOM   878   C CA  . GLY A  1  135 ? 6.359   -64.909 -28.052 1.00 0.00 ? 135 GLY A CA  1 
ATOM   879   C C   . GLY A  1  135 ? 6.390   -64.328 -29.408 1.00 0.00 ? 135 GLY A C   1 
ATOM   880   O O   . GLY A  1  135 ? 5.564   -64.677 -30.238 1.00 0.00 ? 135 GLY A O   1 
ATOM   881   N N   . CYS A  1  136 ? 7.407   -63.485 -29.695 1.00 0.00 ? 136 CYS A N   1 
ATOM   882   C CA  . CYS A  1  136 ? 7.647   -62.975 -31.022 1.00 0.00 ? 136 CYS A CA  1 
ATOM   883   C C   . CYS A  1  136 ? 9.111   -62.658 -31.102 1.00 0.00 ? 136 CYS A C   1 
ATOM   884   O O   . CYS A  1  136 ? 9.618   -61.822 -30.365 1.00 0.00 ? 136 CYS A O   1 
ATOM   885   C CB  . CYS A  1  136 ? 6.815   -61.713 -31.367 1.00 0.00 ? 136 CYS A CB  1 
ATOM   886   S SG  . CYS A  1  136 ? 6.794   -60.444 -30.061 1.00 0.00 ? 136 CYS A SG  1 
ATOM   887   N N   . CYS A  1  137 ? 9.849   -63.361 -31.993 1.00 0.00 ? 137 CYS A N   1 
ATOM   888   C CA  . CYS A  1  137 ? 11.206  -63.043 -32.363 1.00 0.00 ? 137 CYS A CA  1 
ATOM   889   C C   . CYS A  1  137 ? 11.194  -61.747 -33.080 1.00 0.00 ? 137 CYS A C   1 
ATOM   890   O O   . CYS A  1  137 ? 10.275  -61.540 -33.853 1.00 0.00 ? 137 CYS A O   1 
ATOM   891   C CB  . CYS A  1  137 ? 11.843  -64.118 -33.266 1.00 0.00 ? 137 CYS A CB  1 
ATOM   892   S SG  . CYS A  1  137 ? 13.655  -63.947 -33.356 1.00 0.00 ? 137 CYS A SG  1 
ATOM   893   N N   . MET A  1  138 ? 12.184  -60.863 -32.881 1.00 0.00 ? 138 MET A N   1 
ATOM   894   C CA  . MET A  1  138 ? 12.102  -59.567 -33.487 1.00 0.00 ? 138 MET A CA  1 
ATOM   895   C C   . MET A  1  138 ? 13.344  -59.335 -34.294 1.00 0.00 ? 138 MET A C   1 
ATOM   896   O O   . MET A  1  138 ? 14.385  -58.965 -33.766 1.00 0.00 ? 138 MET A O   1 
ATOM   897   C CB  . MET A  1  138 ? 11.923  -58.554 -32.357 1.00 0.00 ? 138 MET A CB  1 
ATOM   898   C CG  . MET A  1  138 ? 11.484  -57.155 -32.774 1.00 0.00 ? 138 MET A CG  1 
ATOM   899   S SD  . MET A  1  138 ? 11.348  -56.089 -31.312 1.00 0.00 ? 138 MET A SD  1 
ATOM   900   C CE  . MET A  1  138 ? 11.159  -54.507 -32.185 1.00 0.00 ? 138 MET A CE  1 
ATOM   901   N N   . ILE A  1  139 ? 13.272  -59.518 -35.626 1.00 0.00 ? 139 ILE A N   1 
ATOM   902   C CA  . ILE A  1  139 ? 14.394  -59.324 -36.518 1.00 0.00 ? 139 ILE A CA  1 
ATOM   903   C C   . ILE A  1  139 ? 14.336  -57.904 -37.004 1.00 0.00 ? 139 ILE A C   1 
ATOM   904   O O   . ILE A  1  139 ? 13.536  -57.602 -37.882 1.00 0.00 ? 139 ILE A O   1 
ATOM   905   C CB  . ILE A  1  139 ? 14.417  -60.254 -37.729 1.00 0.00 ? 139 ILE A CB  1 
ATOM   906   C CG1 . ILE A  1  139 ? 14.387  -61.745 -37.325 1.00 0.00 ? 139 ILE A CG1 1 
ATOM   907   C CG2 . ILE A  1  139 ? 15.675  -59.950 -38.570 1.00 0.00 ? 139 ILE A CG2 1 
ATOM   908   C CD1 . ILE A  1  139 ? 12.976  -62.304 -37.137 1.00 0.00 ? 139 ILE A CD1 1 
ATOM   909   N N   . LEU A  1  140 ? 15.158  -56.992 -36.440 1.00 0.00 ? 140 LEU A N   1 
ATOM   910   C CA  . LEU A  1  140 ? 15.206  -55.605 -36.844 1.00 0.00 ? 140 LEU A CA  1 
ATOM   911   C C   . LEU A  1  140 ? 16.089  -55.492 -38.024 1.00 0.00 ? 140 LEU A C   1 
ATOM   912   O O   . LEU A  1  140 ? 17.085  -56.196 -38.070 1.00 0.00 ? 140 LEU A O   1 
ATOM   913   C CB  . LEU A  1  140 ? 15.767  -54.642 -35.763 1.00 0.00 ? 140 LEU A CB  1 
ATOM   914   C CG  . LEU A  1  140 ? 14.886  -54.417 -34.497 1.00 0.00 ? 140 LEU A CG  1 
ATOM   915   C CD1 . LEU A  1  140 ? 14.767  -55.632 -33.570 1.00 0.00 ? 140 LEU A CD1 1 
ATOM   916   C CD2 . LEU A  1  140 ? 15.407  -53.210 -33.705 1.00 0.00 ? 140 LEU A CD2 1 
ATOM   917   N N   . ILE A  1  141 ? 15.798  -54.566 -38.960 1.00 0.00 ? 141 ILE A N   1 
ATOM   918   C CA  . ILE A  1  141 ? 16.718  -54.250 -40.029 1.00 0.00 ? 141 ILE A CA  1 
ATOM   919   C C   . ILE A  1  141 ? 16.607  -52.783 -40.253 1.00 0.00 ? 141 ILE A C   1 
ATOM   920   O O   . ILE A  1  141 ? 15.566  -52.164 -40.028 1.00 0.00 ? 141 ILE A O   1 
ATOM   921   C CB  . ILE A  1  141 ? 16.530  -54.895 -41.388 1.00 0.00 ? 141 ILE A CB  1 
ATOM   922   C CG1 . ILE A  1  141 ? 15.079  -54.836 -41.875 1.00 0.00 ? 141 ILE A CG1 1 
ATOM   923   C CG2 . ILE A  1  141 ? 17.090  -56.328 -41.358 1.00 0.00 ? 141 ILE A CG2 1 
ATOM   924   C CD1 . ILE A  1  141 ? 14.975  -55.017 -43.392 1.00 0.00 ? 141 ILE A CD1 1 
ATOM   925   N N   . GLY A  1  142 ? 17.751  -52.183 -40.627 1.00 0.00 ? 142 GLY A N   1 
ATOM   926   C CA  . GLY A  1  142 ? 17.844  -50.772 -40.763 1.00 0.00 ? 142 GLY A CA  1 
ATOM   927   C C   . GLY A  1  142 ? 19.291  -50.472 -40.756 1.00 0.00 ? 142 GLY A C   1 
ATOM   928   O O   . GLY A  1  142 ? 20.080  -51.235 -40.228 1.00 0.00 ? 142 GLY A O   1 
ATOM   929   N N   . ILE A  1  143 ? 19.671  -49.298 -41.277 1.00 0.00 ? 143 ILE A N   1 
ATOM   930   C CA  . ILE A  1  143 ? 21.030  -48.862 -41.324 1.00 0.00 ? 143 ILE A CA  1 
ATOM   931   C C   . ILE A  1  143 ? 21.158  -47.953 -40.150 1.00 0.00 ? 143 ILE A C   1 
ATOM   932   O O   . ILE A  1  143 ? 20.435  -46.967 -40.040 1.00 0.00 ? 143 ILE A O   1 
ATOM   933   C CB  . ILE A  1  143 ? 21.354  -48.099 -42.606 1.00 0.00 ? 143 ILE A CB  1 
ATOM   934   C CG1 . ILE A  1  143 ? 21.383  -49.103 -43.755 1.00 0.00 ? 143 ILE A CG1 1 
ATOM   935   C CG2 . ILE A  1  143 ? 22.707  -47.377 -42.507 1.00 0.00 ? 143 ILE A CG2 1 
ATOM   936   C CD1 . ILE A  1  143 ? 21.851  -48.527 -45.075 1.00 0.00 ? 143 ILE A CD1 1 
ATOM   937   N N   . ASP A  1  144 ? 22.164  -48.224 -39.295 1.00 0.00 ? 144 ASP A N   1 
ATOM   938   C CA  . ASP A  1  144 ? 22.750  -47.225 -38.447 1.00 0.00 ? 144 ASP A CA  1 
ATOM   939   C C   . ASP A  1  144 ? 23.892  -46.824 -39.332 1.00 0.00 ? 144 ASP A C   1 
ATOM   940   O O   . ASP A  1  144 ? 24.609  -47.700 -39.804 1.00 0.00 ? 144 ASP A O   1 
ATOM   941   C CB  . ASP A  1  144 ? 23.278  -47.785 -37.101 1.00 0.00 ? 144 ASP A CB  1 
ATOM   942   C CG  . ASP A  1  144 ? 24.164  -46.774 -36.357 1.00 0.00 ? 144 ASP A CG  1 
ATOM   943   O OD1 . ASP A  1  144 ? 23.654  -45.696 -35.956 1.00 0.00 ? 144 ASP A OD1 1 
ATOM   944   O OD2 . ASP A  1  144 ? 25.376  -47.067 -36.203 1.00 0.00 ? 144 ASP A OD2 1 
ATOM   945   N N   . GLY A  1  148 ? 26.820  -49.257 -40.939 1.00 0.00 ? 148 GLY A N   1 
ATOM   946   C CA  . GLY A  1  148 ? 26.228  -49.816 -42.125 1.00 0.00 ? 148 GLY A CA  1 
ATOM   947   C C   . GLY A  1  148 ? 25.016  -50.605 -41.707 1.00 0.00 ? 148 GLY A C   1 
ATOM   948   O O   . GLY A  1  148 ? 24.634  -50.493 -40.546 1.00 0.00 ? 148 GLY A O   1 
ATOM   949   N N   . PRO A  1  149 ? 24.521  -51.513 -42.542 1.00 0.00 ? 149 PRO A N   1 
ATOM   950   C CA  . PRO A  1  149 ? 23.301  -52.279 -42.233 1.00 0.00 ? 149 PRO A CA  1 
ATOM   951   C C   . PRO A  1  149 ? 23.382  -53.186 -40.987 1.00 0.00 ? 149 PRO A C   1 
ATOM   952   O O   . PRO A  1  149 ? 24.445  -53.709 -40.663 1.00 0.00 ? 149 PRO A O   1 
ATOM   953   C CB  . PRO A  1  149 ? 23.079  -53.127 -43.498 1.00 0.00 ? 149 PRO A CB  1 
ATOM   954   C CG  . PRO A  1  149 ? 24.275  -52.914 -44.369 1.00 0.00 ? 149 PRO A CG  1 
ATOM   955   C CD  . PRO A  1  149 ? 24.879  -51.607 -43.964 1.00 0.00 ? 149 PRO A CD  1 
ATOM   956   N N   . GLN A  1  150 ? 22.250  -53.333 -40.293 1.00 0.00 ? 150 GLN A N   1 
ATOM   957   C CA  . GLN A  1  150 ? 22.154  -54.038 -39.035 1.00 0.00 ? 150 GLN A CA  1 
ATOM   958   C C   . GLN A  1  150 ? 21.111  -55.108 -39.161 1.00 0.00 ? 150 GLN A C   1 
ATOM   959   O O   . GLN A  1  150 ? 20.125  -54.880 -39.841 1.00 0.00 ? 150 GLN A O   1 
ATOM   960   C CB  . GLN A  1  150 ? 21.777  -53.098 -37.876 1.00 0.00 ? 150 GLN A CB  1 
ATOM   961   C CG  . GLN A  1  150 ? 22.735  -51.907 -37.706 1.00 0.00 ? 150 GLN A CG  1 
ATOM   962   C CD  . GLN A  1  150 ? 24.001  -52.375 -37.018 1.00 0.00 ? 150 GLN A CD  1 
ATOM   963   O OE1 . GLN A  1  150 ? 24.066  -52.304 -35.788 1.00 0.00 ? 150 GLN A OE1 1 
ATOM   964   N NE2 . GLN A  1  150 ? 25.007  -52.860 -37.794 1.00 0.00 ? 150 GLN A NE2 1 
ATOM   965   N N   . VAL A  1  151 ? 21.277  -56.288 -38.520 1.00 0.00 ? 151 VAL A N   1 
ATOM   966   C CA  . VAL A  1  151 ? 20.315  -57.368 -38.543 1.00 0.00 ? 151 VAL A CA  1 
ATOM   967   C C   . VAL A  1  151 ? 20.292  -57.835 -37.127 1.00 0.00 ? 151 VAL A C   1 
ATOM   968   O O   . VAL A  1  151 ? 20.997  -58.769 -36.774 1.00 0.00 ? 151 VAL A O   1 
ATOM   969   C CB  . VAL A  1  151 ? 20.718  -58.543 -39.432 1.00 0.00 ? 151 VAL A CB  1 
ATOM   970   C CG1 . VAL A  1  151 ? 19.719  -59.698 -39.319 1.00 0.00 ? 151 VAL A CG1 1 
ATOM   971   C CG2 . VAL A  1  151 ? 20.746  -58.086 -40.890 1.00 0.00 ? 151 VAL A CG2 1 
ATOM   972   N N   . TYR A  1  152 ? 19.516  -57.198 -36.233 1.00 0.00 ? 152 TYR A N   1 
ATOM   973   C CA  . TYR A  1  152 ? 19.511  -57.624 -34.848 1.00 0.00 ? 152 TYR A CA  1 
ATOM   974   C C   . TYR A  1  152 ? 18.462  -58.665 -34.667 1.00 0.00 ? 152 TYR A C   1 
ATOM   975   O O   . TYR A  1  152 ? 17.451  -58.653 -35.358 1.00 0.00 ? 152 TYR A O   1 
ATOM   976   C CB  . TYR A  1  152 ? 19.266  -56.478 -33.846 1.00 0.00 ? 152 TYR A CB  1 
ATOM   977   C CG  . TYR A  1  152 ? 20.560  -55.798 -33.555 1.00 0.00 ? 152 TYR A CG  1 
ATOM   978   C CD1 . TYR A  1  152 ? 21.425  -55.361 -34.579 1.00 0.00 ? 152 TYR A CD1 1 
ATOM   979   C CD2 . TYR A  1  152 ? 20.970  -55.652 -32.230 1.00 0.00 ? 152 TYR A CD2 1 
ATOM   980   C CE1 . TYR A  1  152 ? 22.705  -54.892 -34.290 1.00 0.00 ? 152 TYR A CE1 1 
ATOM   981   C CE2 . TYR A  1  152 ? 22.233  -55.136 -31.932 1.00 0.00 ? 152 TYR A CE2 1 
ATOM   982   C CZ  . TYR A  1  152 ? 23.110  -54.779 -32.963 1.00 0.00 ? 152 TYR A CZ  1 
ATOM   983   O OH  . TYR A  1  152 ? 24.411  -54.315 -32.676 1.00 0.00 ? 152 TYR A OH  1 
ATOM   984   N N   . LYS A  1  153 ? 18.672  -59.587 -33.707 1.00 0.00 ? 153 LYS A N   1 
ATOM   985   C CA  . LYS A  1  153 ? 17.683  -60.529 -33.244 1.00 0.00 ? 153 LYS A CA  1 
ATOM   986   C C   . LYS A  1  153 ? 17.246  -60.120 -31.864 1.00 0.00 ? 153 LYS A C   1 
ATOM   987   O O   . LYS A  1  153 ? 18.042  -59.545 -31.133 1.00 0.00 ? 153 LYS A O   1 
ATOM   988   C CB  . LYS A  1  153 ? 18.229  -61.963 -33.243 1.00 0.00 ? 153 LYS A CB  1 
ATOM   989   C CG  . LYS A  1  153 ? 17.146  -63.043 -33.170 1.00 0.00 ? 153 LYS A CG  1 
ATOM   990   C CD  . LYS A  1  153 ? 17.700  -64.472 -33.066 1.00 0.00 ? 153 LYS A CD  1 
ATOM   991   C CE  . LYS A  1  153 ? 18.620  -64.706 -31.860 1.00 0.00 ? 153 LYS A CE  1 
ATOM   992   N NZ  . LYS A  1  153 ? 18.000  -64.246 -30.603 1.00 0.00 ? 153 LYS A NZ  1 
ATOM   993   N N   . CYS A  1  154 ? 16.007  -60.447 -31.437 1.00 0.00 ? 154 CYS A N   1 
ATOM   994   C CA  . CYS A  1  154 ? 15.619  -60.309 -30.055 1.00 0.00 ? 154 CYS A CA  1 
ATOM   995   C C   . CYS A  1  154 ? 14.775  -61.507 -29.775 1.00 0.00 ? 154 CYS A C   1 
ATOM   996   O O   . CYS A  1  154 ? 14.063  -61.978 -30.658 1.00 0.00 ? 154 CYS A O   1 
ATOM   997   C CB  . CYS A  1  154 ? 14.781  -59.052 -29.736 1.00 0.00 ? 154 CYS A CB  1 
ATOM   998   S SG  . CYS A  1  154 ? 14.561  -58.714 -27.958 1.00 0.00 ? 154 CYS A SG  1 
ATOM   999   N N   . ASP A  1  155 ? 14.826  -61.996 -28.519 1.00 0.00 ? 155 ASP A N   1 
ATOM   1000  C CA  . ASP A  1  155 ? 14.178  -63.195 -28.055 1.00 0.00 ? 155 ASP A CA  1 
ATOM   1001  C C   . ASP A  1  155 ? 13.280  -62.747 -26.948 1.00 0.00 ? 155 ASP A C   1 
ATOM   1002  O O   . ASP A  1  155 ? 13.476  -61.650 -26.444 1.00 0.00 ? 155 ASP A O   1 
ATOM   1003  C CB  . ASP A  1  155 ? 15.180  -64.202 -27.428 1.00 0.00 ? 155 ASP A CB  1 
ATOM   1004  C CG  . ASP A  1  155 ? 15.798  -65.145 -28.454 1.00 0.00 ? 155 ASP A CG  1 
ATOM   1005  O OD1 . ASP A  1  155 ? 15.256  -65.269 -29.581 1.00 0.00 ? 155 ASP A OD1 1 
ATOM   1006  O OD2 . ASP A  1  155 ? 16.821  -65.785 -28.100 1.00 0.00 ? 155 ASP A OD2 1 
ATOM   1007  N N   . PRO A  1  156 ? 12.282  -63.517 -26.518 1.00 0.00 ? 156 PRO A N   1 
ATOM   1008  C CA  . PRO A  1  156 ? 11.444  -63.236 -25.355 1.00 0.00 ? 156 PRO A CA  1 
ATOM   1009  C C   . PRO A  1  156 ? 12.210  -63.426 -24.085 1.00 0.00 ? 156 PRO A C   1 
ATOM   1010  O O   . PRO A  1  156 ? 11.650  -63.259 -23.006 1.00 0.00 ? 156 PRO A O   1 
ATOM   1011  C CB  . PRO A  1  156 ? 10.290  -64.239 -25.462 1.00 0.00 ? 156 PRO A CB  1 
ATOM   1012  C CG  . PRO A  1  156 ? 10.867  -65.399 -26.259 1.00 0.00 ? 156 PRO A CG  1 
ATOM   1013  C CD  . PRO A  1  156 ? 11.806  -64.698 -27.232 1.00 0.00 ? 156 PRO A CD  1 
ATOM   1014  N N   . ALA A  1  157 ? 13.483  -63.811 -24.217 1.00 0.00 ? 157 ALA A N   1 
ATOM   1015  C CA  . ALA A  1  157 ? 14.415  -63.982 -23.162 1.00 0.00 ? 157 ALA A CA  1 
ATOM   1016  C C   . ALA A  1  157 ? 14.844  -62.625 -22.662 1.00 0.00 ? 157 ALA A C   1 
ATOM   1017  O O   . ALA A  1  157 ? 14.963  -62.407 -21.460 1.00 0.00 ? 157 ALA A O   1 
ATOM   1018  C CB  . ALA A  1  157 ? 15.616  -64.782 -23.682 1.00 0.00 ? 157 ALA A CB  1 
ATOM   1019  N N   . GLY A  1  158 ? 15.098  -61.693 -23.607 1.00 0.00 ? 158 GLY A N   1 
ATOM   1020  C CA  . GLY A  1  158 ? 15.618  -60.377 -23.360 1.00 0.00 ? 158 GLY A CA  1 
ATOM   1021  C C   . GLY A  1  158 ? 17.027  -60.366 -23.877 1.00 0.00 ? 158 GLY A C   1 
ATOM   1022  O O   . GLY A  1  158 ? 17.828  -59.510 -23.518 1.00 0.00 ? 158 GLY A O   1 
ATOM   1023  N N   . TYR A  1  159 ? 17.354  -61.355 -24.705 1.00 0.00 ? 159 TYR A N   1 
ATOM   1024  C CA  . TYR A  1  159 ? 18.683  -61.445 -25.290 1.00 0.00 ? 159 TYR A CA  1 
ATOM   1025  C C   . TYR A  1  159 ? 18.665  -60.926 -26.713 1.00 0.00 ? 159 TYR A C   1 
ATOM   1026  O O   . TYR A  1  159 ? 17.791  -61.279 -27.498 1.00 0.00 ? 159 TYR A O   1 
ATOM   1027  C CB  . TYR A  1  159 ? 19.211  -62.880 -25.280 1.00 0.00 ? 159 TYR A CB  1 
ATOM   1028  C CG  . TYR A  1  159 ? 20.475  -63.049 -26.109 1.00 0.00 ? 159 TYR A CG  1 
ATOM   1029  C CD1 . TYR A  1  159 ? 21.641  -62.357 -25.787 1.00 0.00 ? 159 TYR A CD1 1 
ATOM   1030  C CD2 . TYR A  1  159 ? 20.494  -63.876 -27.225 1.00 0.00 ? 159 TYR A CD2 1 
ATOM   1031  C CE1 . TYR A  1  159 ? 22.790  -62.499 -26.541 1.00 0.00 ? 159 TYR A CE1 1 
ATOM   1032  C CE2 . TYR A  1  159 ? 21.640  -64.022 -27.986 1.00 0.00 ? 159 TYR A CE2 1 
ATOM   1033  C CZ  . TYR A  1  159 ? 22.784  -63.333 -27.639 1.00 0.00 ? 159 TYR A CZ  1 
ATOM   1034  O OH  . TYR A  1  159 ? 23.926  -63.477 -28.395 1.00 0.00 ? 159 TYR A OH  1 
ATOM   1035  N N   . TYR A  1  160 ? 19.650  -60.100 -27.040 1.00 0.00 ? 160 TYR A N   1 
ATOM   1036  C CA  . TYR A  1  160 ? 19.732  -59.491 -28.340 1.00 0.00 ? 160 TYR A CA  1 
ATOM   1037  C C   . TYR A  1  160 ? 21.151  -59.553 -28.780 1.00 0.00 ? 160 TYR A C   1 
ATOM   1038  O O   . TYR A  1  160 ? 22.076  -59.567 -27.978 1.00 0.00 ? 160 TYR A O   1 
ATOM   1039  C CB  . TYR A  1  160 ? 19.230  -58.034 -28.460 1.00 0.00 ? 160 TYR A CB  1 
ATOM   1040  C CG  . TYR A  1  160 ? 20.106  -57.015 -27.826 1.00 0.00 ? 160 TYR A CG  1 
ATOM   1041  C CD1 . TYR A  1  160 ? 21.135  -56.435 -28.570 1.00 0.00 ? 160 TYR A CD1 1 
ATOM   1042  C CD2 . TYR A  1  160 ? 19.938  -56.641 -26.497 1.00 0.00 ? 160 TYR A CD2 1 
ATOM   1043  C CE1 . TYR A  1  160 ? 21.987  -55.490 -28.010 1.00 0.00 ? 160 TYR A CE1 1 
ATOM   1044  C CE2 . TYR A  1  160 ? 20.803  -55.710 -25.916 1.00 0.00 ? 160 TYR A CE2 1 
ATOM   1045  C CZ  . TYR A  1  160 ? 21.825  -55.126 -26.677 1.00 0.00 ? 160 TYR A CZ  1 
ATOM   1046  O OH  . TYR A  1  160 ? 22.697  -54.177 -26.101 1.00 0.00 ? 160 TYR A OH  1 
ATOM   1047  N N   . CYS A  1  161 ? 21.348  -59.715 -30.088 1.00 0.00 ? 161 CYS A N   1 
ATOM   1048  C CA  . CYS A  1  161 ? 22.659  -59.768 -30.628 1.00 0.00 ? 161 CYS A CA  1 
ATOM   1049  C C   . CYS A  1  161 ? 22.506  -59.512 -32.052 1.00 0.00 ? 161 CYS A C   1 
ATOM   1050  O O   . CYS A  1  161 ? 21.473  -59.822 -32.642 1.00 0.00 ? 161 CYS A O   1 
ATOM   1051  C CB  . CYS A  1  161 ? 23.348  -61.129 -30.499 1.00 0.00 ? 161 CYS A CB  1 
ATOM   1052  S SG  . CYS A  1  161 ? 22.380  -62.487 -31.213 1.00 0.00 ? 161 CYS A SG  1 
ATOM   1053  N N   . GLY A  1  162 ? 23.572  -58.959 -32.628 1.00 0.00 ? 162 GLY A N   1 
ATOM   1054  C CA  . GLY A  1  162 ? 23.646  -58.672 -34.015 1.00 0.00 ? 162 GLY A CA  1 
ATOM   1055  C C   . GLY A  1  162 ? 24.080  -59.934 -34.639 1.00 0.00 ? 162 GLY A C   1 
ATOM   1056  O O   . GLY A  1  162 ? 25.079  -60.515 -34.245 1.00 0.00 ? 162 GLY A O   1 
ATOM   1057  N N   . PHE A  1  163 ? 23.319  -60.391 -35.616 1.00 0.00 ? 163 PHE A N   1 
ATOM   1058  C CA  . PHE A  1  163 ? 23.782  -61.480 -36.435 1.00 0.00 ? 163 PHE A CA  1 
ATOM   1059  C C   . PHE A  1  163 ? 24.284  -60.825 -37.693 1.00 0.00 ? 163 PHE A C   1 
ATOM   1060  O O   . PHE A  1  163 ? 24.315  -59.599 -37.807 1.00 0.00 ? 163 PHE A O   1 
ATOM   1061  C CB  . PHE A  1  163 ? 22.656  -62.452 -36.766 1.00 0.00 ? 163 PHE A CB  1 
ATOM   1062  C CG  . PHE A  1  163 ? 22.394  -63.458 -35.689 1.00 0.00 ? 163 PHE A CG  1 
ATOM   1063  C CD1 . PHE A  1  163 ? 22.689  -63.168 -34.370 1.00 0.00 ? 163 PHE A CD1 1 
ATOM   1064  C CD2 . PHE A  1  163 ? 21.852  -64.689 -35.993 1.00 0.00 ? 163 PHE A CD2 1 
ATOM   1065  C CE1 . PHE A  1  163 ? 22.447  -64.086 -33.372 1.00 0.00 ? 163 PHE A CE1 1 
ATOM   1066  C CE2 . PHE A  1  163 ? 21.607  -65.614 -35.001 1.00 0.00 ? 163 PHE A CE2 1 
ATOM   1067  C CZ  . PHE A  1  163 ? 21.907  -65.312 -33.688 1.00 0.00 ? 163 PHE A CZ  1 
ATOM   1068  N N   . LYS A  1  164 ? 24.705  -61.680 -38.623 1.00 0.00 ? 164 LYS A N   1 
ATOM   1069  C CA  . LYS A  1  164 ? 25.196  -61.281 -39.933 1.00 0.00 ? 164 LYS A CA  1 
ATOM   1070  C C   . LYS A  1  164 ? 24.202  -61.751 -40.989 1.00 0.00 ? 164 LYS A C   1 
ATOM   1071  O O   . LYS A  1  164 ? 24.060  -61.140 -42.048 1.00 0.00 ? 164 LYS A O   1 
ATOM   1072  C CB  . LYS A  1  164 ? 26.571  -61.899 -40.190 1.00 0.00 ? 164 LYS A CB  1 
ATOM   1073  C CG  . LYS A  1  164 ? 27.127  -61.646 -41.581 1.00 0.00 ? 164 LYS A CG  1 
ATOM   1074  C CD  . LYS A  1  164 ? 28.285  -62.580 -41.892 1.00 0.00 ? 164 LYS A CD  1 
ATOM   1075  C CE  . LYS A  1  164 ? 29.401  -61.855 -42.626 1.00 0.00 ? 164 LYS A CE  1 
ATOM   1076  N NZ  . LYS A  1  164 ? 29.942  -62.644 -43.769 1.00 0.00 ? 164 LYS A NZ  1 
ATOM   1077  N N   . ALA A  1  165 ? 23.581  -62.897 -40.718 1.00 0.00 ? 165 ALA A N   1 
ATOM   1078  C CA  . ALA A  1  165 ? 22.487  -63.417 -41.532 1.00 0.00 ? 165 ALA A CA  1 
ATOM   1079  C C   . ALA A  1  165 ? 21.473  -64.215 -40.705 1.00 0.00 ? 165 ALA A C   1 
ATOM   1080  O O   . ALA A  1  165 ? 21.425  -65.440 -40.821 1.00 0.00 ? 165 ALA A O   1 
ATOM   1081  C CB  . ALA A  1  165 ? 23.033  -64.267 -42.670 1.00 0.00 ? 165 ALA A CB  1 
ATOM   1082  N N   . THR A  1  166 ? 20.668  -63.555 -39.876 1.00 0.00 ? 166 THR A N   1 
ATOM   1083  C CA  . THR A  1  166 ? 19.711  -64.297 -39.065 1.00 0.00 ? 166 THR A CA  1 
ATOM   1084  C C   . THR A  1  166 ? 18.607  -65.064 -39.759 1.00 0.00 ? 166 THR A C   1 
ATOM   1085  O O   . THR A  1  166 ? 18.282  -64.817 -40.912 1.00 0.00 ? 166 THR A O   1 
ATOM   1086  C CB  . THR A  1  166 ? 19.099  -63.392 -38.012 1.00 0.00 ? 166 THR A CB  1 
ATOM   1087  O OG1 . THR A  1  166 ? 18.662  -64.109 -36.865 1.00 0.00 ? 166 THR A OG1 1 
ATOM   1088  C CG2 . THR A  1  166 ? 17.931  -62.576 -38.579 1.00 0.00 ? 166 THR A CG2 1 
ATOM   1089  N N   . ALA A  1  167 ? 17.972  -66.007 -39.032 1.00 0.00 ? 167 ALA A N   1 
ATOM   1090  C CA  . ALA A  1  167 ? 16.704  -66.552 -39.419 1.00 0.00 ? 167 ALA A CA  1 
ATOM   1091  C C   . ALA A  1  167 ? 16.034  -66.969 -38.157 1.00 0.00 ? 167 ALA A C   1 
ATOM   1092  O O   . ALA A  1  167 ? 16.698  -67.419 -37.227 1.00 0.00 ? 167 ALA A O   1 
ATOM   1093  C CB  . ALA A  1  167 ? 16.800  -67.781 -40.322 1.00 0.00 ? 167 ALA A CB  1 
ATOM   1094  N N   . ALA A  1  168 ? 14.688  -66.862 -38.110 1.00 0.00 ? 168 ALA A N   1 
ATOM   1095  C CA  . ALA A  1  168 ? 13.918  -67.243 -36.955 1.00 0.00 ? 168 ALA A CA  1 
ATOM   1096  C C   . ALA A  1  168 ? 12.606  -67.769 -37.430 1.00 0.00 ? 168 ALA A C   1 
ATOM   1097  O O   . ALA A  1  168 ? 12.078  -67.268 -38.414 1.00 0.00 ? 168 ALA A O   1 
ATOM   1098  C CB  . ALA A  1  168 ? 13.634  -66.077 -36.018 1.00 0.00 ? 168 ALA A CB  1 
ATOM   1099  N N   . GLY A  1  169 ? 12.054  -68.803 -36.741 1.00 0.00 ? 169 GLY A N   1 
ATOM   1100  C CA  . GLY A  1  169 ? 10.835  -69.439 -37.168 1.00 0.00 ? 169 GLY A CA  1 
ATOM   1101  C C   . GLY A  1  169 ? 10.852  -70.927 -37.020 1.00 0.00 ? 169 GLY A C   1 
ATOM   1102  O O   . GLY A  1  169 ? 11.367  -71.446 -36.039 1.00 0.00 ? 169 GLY A O   1 
ATOM   1103  N N   . VAL A  1  170 ? 10.185  -71.638 -37.966 1.00 0.00 ? 170 VAL A N   1 
ATOM   1104  C CA  . VAL A  1  170 ? 9.951   -73.065 -37.927 1.00 0.00 ? 170 VAL A CA  1 
ATOM   1105  C C   . VAL A  1  170 ? 11.106  -73.848 -38.448 1.00 0.00 ? 170 VAL A C   1 
ATOM   1106  O O   . VAL A  1  170 ? 11.564  -74.791 -37.804 1.00 0.00 ? 170 VAL A O   1 
ATOM   1107  C CB  . VAL A  1  170 ? 8.783   -73.505 -38.790 1.00 0.00 ? 170 VAL A CB  1 
ATOM   1108  C CG1 . VAL A  1  170 ? 8.364   -74.947 -38.424 1.00 0.00 ? 170 VAL A CG1 1 
ATOM   1109  C CG2 . VAL A  1  170 ? 7.618   -72.535 -38.601 1.00 0.00 ? 170 VAL A CG2 1 
ATOM   1110  N N   . LYS A  1  171 ? 11.596  -73.471 -39.651 1.00 0.00 ? 171 LYS A N   1 
ATOM   1111  C CA  . LYS A  1  171 ? 12.649  -74.182 -40.311 1.00 0.00 ? 171 LYS A CA  1 
ATOM   1112  C C   . LYS A  1  171 ? 13.861  -73.358 -40.122 1.00 0.00 ? 171 LYS A C   1 
ATOM   1113  O O   . LYS A  1  171 ? 14.706  -73.317 -41.003 1.00 0.00 ? 171 LYS A O   1 
ATOM   1114  C CB  . LYS A  1  171 ? 12.455  -74.320 -41.834 1.00 0.00 ? 171 LYS A CB  1 
ATOM   1115  C CG  . LYS A  1  171 ? 11.129  -74.950 -42.283 1.00 0.00 ? 171 LYS A CG  1 
ATOM   1116  C CD  . LYS A  1  171 ? 10.993  -76.463 -42.069 1.00 0.00 ? 171 LYS A CD  1 
ATOM   1117  C CE  . LYS A  1  171 ? 11.687  -77.288 -43.162 1.00 0.00 ? 171 LYS A CE  1 
ATOM   1118  N NZ  . LYS A  1  171 ? 11.505  -78.740 -42.926 1.00 0.00 ? 171 LYS A NZ  1 
ATOM   1119  N N   . GLN A  1  172 ? 13.983  -72.677 -38.961 1.00 0.00 ? 172 GLN A N   1 
ATOM   1120  C CA  . GLN A  1  172 ? 15.026  -71.736 -38.687 1.00 0.00 ? 172 GLN A CA  1 
ATOM   1121  C C   . GLN A  1  172 ? 16.390  -72.350 -38.660 1.00 0.00 ? 172 GLN A C   1 
ATOM   1122  O O   . GLN A  1  172 ? 17.355  -71.717 -39.056 1.00 0.00 ? 172 GLN A O   1 
ATOM   1123  C CB  . GLN A  1  172 ? 14.819  -71.034 -37.335 1.00 0.00 ? 172 GLN A CB  1 
ATOM   1124  C CG  . GLN A  1  172 ? 14.648  -71.976 -36.128 1.00 0.00 ? 172 GLN A CG  1 
ATOM   1125  C CD  . GLN A  1  172 ? 14.723  -71.195 -34.811 1.00 0.00 ? 172 GLN A CD  1 
ATOM   1126  O OE1 . GLN A  1  172 ? 15.160  -70.041 -34.765 1.00 0.00 ? 172 GLN A OE1 1 
ATOM   1127  N NE2 . GLN A  1  172 ? 14.311  -71.876 -33.699 1.00 0.00 ? 172 GLN A NE2 1 
ATOM   1128  N N   . THR A  1  173 ? 16.521  -73.608 -38.204 1.00 0.00 ? 173 THR A N   1 
ATOM   1129  C CA  . THR A  1  173 ? 17.786  -74.269 -38.059 1.00 0.00 ? 173 THR A CA  1 
ATOM   1130  C C   . THR A  1  173 ? 18.224  -74.771 -39.395 1.00 0.00 ? 173 THR A C   1 
ATOM   1131  O O   . THR A  1  173 ? 19.401  -74.699 -39.724 1.00 0.00 ? 173 THR A O   1 
ATOM   1132  C CB  . THR A  1  173 ? 17.763  -75.325 -36.971 1.00 0.00 ? 173 THR A CB  1 
ATOM   1133  O OG1 . THR A  1  173 ? 19.040  -75.929 -36.807 1.00 0.00 ? 173 THR A OG1 1 
ATOM   1134  C CG2 . THR A  1  173 ? 16.697  -76.405 -37.209 1.00 0.00 ? 173 THR A CG2 1 
ATOM   1135  N N   . GLU A  1  174 ? 17.277  -75.270 -40.208 1.00 0.00 ? 174 GLU A N   1 
ATOM   1136  C CA  . GLU A  1  174 ? 17.508  -75.746 -41.539 1.00 0.00 ? 174 GLU A CA  1 
ATOM   1137  C C   . GLU A  1  174 ? 17.947  -74.629 -42.449 1.00 0.00 ? 174 GLU A C   1 
ATOM   1138  O O   . GLU A  1  174 ? 18.762  -74.852 -43.338 1.00 0.00 ? 174 GLU A O   1 
ATOM   1139  C CB  . GLU A  1  174 ? 16.258  -76.440 -42.126 1.00 0.00 ? 174 GLU A CB  1 
ATOM   1140  C CG  . GLU A  1  174 ? 15.847  -77.736 -41.379 1.00 0.00 ? 174 GLU A CG  1 
ATOM   1141  C CD  . GLU A  1  174 ? 14.663  -77.543 -40.424 1.00 0.00 ? 174 GLU A CD  1 
ATOM   1142  O OE1 . GLU A  1  174 ? 14.723  -76.631 -39.564 1.00 0.00 ? 174 GLU A OE1 1 
ATOM   1143  O OE2 . GLU A  1  174 ? 13.680  -78.320 -40.535 1.00 0.00 ? 174 GLU A OE2 1 
ATOM   1144  N N   . SER A  1  175 ? 17.453  -73.387 -42.228 1.00 0.00 ? 175 SER A N   1 
ATOM   1145  C CA  . SER A  1  175 ? 17.943  -72.199 -42.897 1.00 0.00 ? 175 SER A CA  1 
ATOM   1146  C C   . SER A  1  175 ? 19.290  -71.757 -42.451 1.00 0.00 ? 175 SER A C   1 
ATOM   1147  O O   . SER A  1  175 ? 20.058  -71.300 -43.288 1.00 0.00 ? 175 SER A O   1 
ATOM   1148  C CB  . SER A  1  175 ? 17.016  -70.959 -42.829 1.00 0.00 ? 175 SER A CB  1 
ATOM   1149  O OG  . SER A  1  175 ? 16.474  -70.752 -41.541 1.00 0.00 ? 175 SER A OG  1 
ATOM   1150  N N   . THR A  1  176 ? 19.617  -71.866 -41.139 1.00 0.00 ? 176 THR A N   1 
ATOM   1151  C CA  . THR A  1  176 ? 20.852  -71.354 -40.588 1.00 0.00 ? 176 THR A CA  1 
ATOM   1152  C C   . THR A  1  176 ? 22.034  -72.038 -41.182 1.00 0.00 ? 176 THR A C   1 
ATOM   1153  O O   . THR A  1  176 ? 23.084  -71.429 -41.338 1.00 0.00 ? 176 THR A O   1 
ATOM   1154  C CB  . THR A  1  176 ? 20.913  -71.472 -39.073 1.00 0.00 ? 176 THR A CB  1 
ATOM   1155  O OG1 . THR A  1  176 ? 19.842  -70.739 -38.507 1.00 0.00 ? 176 THR A OG1 1 
ATOM   1156  C CG2 . THR A  1  176 ? 22.223  -70.888 -38.483 1.00 0.00 ? 176 THR A CG2 1 
ATOM   1157  N N   . SER A  1  177 ? 21.897  -73.319 -41.559 1.00 0.00 ? 177 SER A N   1 
ATOM   1158  C CA  . SER A  1  177 ? 22.961  -74.030 -42.204 1.00 0.00 ? 177 SER A CA  1 
ATOM   1159  C C   . SER A  1  177 ? 23.278  -73.440 -43.535 1.00 0.00 ? 177 SER A C   1 
ATOM   1160  O O   . SER A  1  177 ? 24.441  -73.235 -43.866 1.00 0.00 ? 177 SER A O   1 
ATOM   1161  C CB  . SER A  1  177 ? 22.593  -75.498 -42.439 1.00 0.00 ? 177 SER A CB  1 
ATOM   1162  O OG  . SER A  1  177 ? 22.283  -76.105 -41.198 1.00 0.00 ? 177 SER A OG  1 
ATOM   1163  N N   . PHE A  1  178 ? 22.230  -73.146 -44.328 1.00 0.00 ? 178 PHE A N   1 
ATOM   1164  C CA  . PHE A  1  178 ? 22.360  -72.571 -45.639 1.00 0.00 ? 178 PHE A CA  1 
ATOM   1165  C C   . PHE A  1  178 ? 22.922  -71.162 -45.621 1.00 0.00 ? 178 PHE A C   1 
ATOM   1166  O O   . PHE A  1  178 ? 23.647  -70.769 -46.521 1.00 0.00 ? 178 PHE A O   1 
ATOM   1167  C CB  . PHE A  1  178 ? 21.002  -72.668 -46.363 1.00 0.00 ? 178 PHE A CB  1 
ATOM   1168  C CG  . PHE A  1  178 ? 21.149  -72.498 -47.850 1.00 0.00 ? 178 PHE A CG  1 
ATOM   1169  C CD1 . PHE A  1  178 ? 22.071  -73.244 -48.604 1.00 0.00 ? 178 PHE A CD1 1 
ATOM   1170  C CD2 . PHE A  1  178 ? 20.341  -71.565 -48.513 1.00 0.00 ? 178 PHE A CD2 1 
ATOM   1171  C CE1 . PHE A  1  178 ? 22.200  -73.028 -49.982 1.00 0.00 ? 178 PHE A CE1 1 
ATOM   1172  C CE2 . PHE A  1  178 ? 20.441  -71.374 -49.893 1.00 0.00 ? 178 PHE A CE2 1 
ATOM   1173  C CZ  . PHE A  1  178 ? 21.383  -72.093 -50.628 1.00 0.00 ? 178 PHE A CZ  1 
ATOM   1174  N N   . LEU A  1  179 ? 22.644  -70.391 -44.552 1.00 0.00 ? 179 LEU A N   1 
ATOM   1175  C CA  . LEU A  1  179 ? 23.218  -69.093 -44.255 1.00 0.00 ? 179 LEU A CA  1 
ATOM   1176  C C   . LEU A  1  179 ? 24.692  -69.198 -43.944 1.00 0.00 ? 179 LEU A C   1 
ATOM   1177  O O   . LEU A  1  179 ? 25.488  -68.379 -44.392 1.00 0.00 ? 179 LEU A O   1 
ATOM   1178  C CB  . LEU A  1  179 ? 22.553  -68.451 -43.020 1.00 0.00 ? 179 LEU A CB  1 
ATOM   1179  C CG  . LEU A  1  179 ? 21.059  -68.078 -43.132 1.00 0.00 ? 179 LEU A CG  1 
ATOM   1180  C CD1 . LEU A  1  179 ? 20.391  -67.574 -41.844 1.00 0.00 ? 179 LEU A CD1 1 
ATOM   1181  C CD2 . LEU A  1  179 ? 20.826  -67.117 -44.314 1.00 0.00 ? 179 LEU A CD2 1 
ATOM   1182  N N   . GLU A  1  180 ? 25.084  -70.207 -43.136 1.00 0.00 ? 180 GLU A N   1 
ATOM   1183  C CA  . GLU A  1  180 ? 26.446  -70.468 -42.741 1.00 0.00 ? 180 GLU A CA  1 
ATOM   1184  C C   . GLU A  1  180 ? 27.277  -70.871 -43.927 1.00 0.00 ? 180 GLU A C   1 
ATOM   1185  O O   . GLU A  1  180 ? 28.448  -70.520 -44.024 1.00 0.00 ? 180 GLU A O   1 
ATOM   1186  C CB  . GLU A  1  180 ? 26.547  -71.548 -41.655 1.00 0.00 ? 180 GLU A CB  1 
ATOM   1187  C CG  . GLU A  1  180 ? 27.893  -71.548 -40.917 1.00 0.00 ? 180 GLU A CG  1 
ATOM   1188  C CD  . GLU A  1  180 ? 27.995  -72.756 -39.987 1.00 0.00 ? 180 GLU A CD  1 
ATOM   1189  O OE1 . GLU A  1  180 ? 27.178  -73.704 -40.141 1.00 0.00 ? 180 GLU A OE1 1 
ATOM   1190  O OE2 . GLU A  1  180 ? 28.905  -72.752 -39.113 1.00 0.00 ? 180 GLU A OE2 1 
ATOM   1191  N N   . LYS A  1  181 ? 26.675  -71.606 -44.897 1.00 0.00 ? 181 LYS A N   1 
ATOM   1192  C CA  . LYS A  1  181 ? 27.347  -71.994 -46.117 1.00 0.00 ? 181 LYS A CA  1 
ATOM   1193  C C   . LYS A  1  181 ? 27.716  -70.792 -46.923 1.00 0.00 ? 181 LYS A C   1 
ATOM   1194  O O   . LYS A  1  181 ? 28.796  -70.772 -47.491 1.00 0.00 ? 181 LYS A O   1 
ATOM   1195  C CB  . LYS A  1  181 ? 26.535  -72.944 -47.005 1.00 0.00 ? 181 LYS A CB  1 
ATOM   1196  C CG  . LYS A  1  181 ? 26.482  -74.359 -46.429 1.00 0.00 ? 181 LYS A CG  1 
ATOM   1197  C CD  . LYS A  1  181 ? 25.586  -75.283 -47.246 1.00 0.00 ? 181 LYS A CD  1 
ATOM   1198  C CE  . LYS A  1  181 ? 25.447  -76.666 -46.611 1.00 0.00 ? 181 LYS A CE  1 
ATOM   1199  N NZ  . LYS A  1  181 ? 24.611  -77.549 -47.453 1.00 0.00 ? 181 LYS A NZ  1 
ATOM   1200  N N   . LYS A  1  182 ? 26.868  -69.744 -46.920 1.00 0.00 ? 182 LYS A N   1 
ATOM   1201  C CA  . LYS A  1  182 ? 27.099  -68.485 -47.584 1.00 0.00 ? 182 LYS A CA  1 
ATOM   1202  C C   . LYS A  1  182 ? 27.935  -67.512 -46.783 1.00 0.00 ? 182 LYS A C   1 
ATOM   1203  O O   . LYS A  1  182 ? 28.347  -66.488 -47.324 1.00 0.00 ? 182 LYS A O   1 
ATOM   1204  C CB  . LYS A  1  182 ? 25.791  -67.808 -48.029 1.00 0.00 ? 182 LYS A CB  1 
ATOM   1205  C CG  . LYS A  1  182 ? 24.918  -68.744 -48.879 1.00 0.00 ? 182 LYS A CG  1 
ATOM   1206  C CD  . LYS A  1  182 ? 25.538  -69.179 -50.213 1.00 0.00 ? 182 LYS A CD  1 
ATOM   1207  C CE  . LYS A  1  182 ? 24.904  -70.455 -50.781 1.00 0.00 ? 182 LYS A CE  1 
ATOM   1208  N NZ  . LYS A  1  182 ? 25.274  -71.628 -49.963 1.00 0.00 ? 182 LYS A NZ  1 
ATOM   1209  N N   . GLN A  1  193 ? 22.106  -60.164 -55.307 1.00 0.00 ? 193 GLN A N   1 
ATOM   1210  C CA  . GLN A  1  193 ? 22.687  -61.320 -54.708 1.00 0.00 ? 193 GLN A CA  1 
ATOM   1211  C C   . GLN A  1  193 ? 22.304  -61.536 -53.285 1.00 0.00 ? 193 GLN A C   1 
ATOM   1212  O O   . GLN A  1  193 ? 22.224  -62.678 -52.868 1.00 0.00 ? 193 GLN A O   1 
ATOM   1213  C CB  . GLN A  1  193 ? 24.213  -61.268 -54.809 1.00 0.00 ? 193 GLN A CB  1 
ATOM   1214  C CG  . GLN A  1  193 ? 24.735  -60.998 -56.225 1.00 0.00 ? 193 GLN A CG  1 
ATOM   1215  C CD  . GLN A  1  193 ? 24.193  -62.038 -57.206 1.00 0.00 ? 193 GLN A CD  1 
ATOM   1216  O OE1 . GLN A  1  193 ? 23.318  -61.725 -58.021 1.00 0.00 ? 193 GLN A OE1 1 
ATOM   1217  N NE2 . GLN A  1  193 ? 24.736  -63.287 -57.119 1.00 0.00 ? 193 GLN A NE2 1 
ATOM   1218  N N   . THR A  1  194 ? 22.031  -60.481 -52.497 1.00 0.00 ? 194 THR A N   1 
ATOM   1219  C CA  . THR A  1  194 ? 21.605  -60.639 -51.124 1.00 0.00 ? 194 THR A CA  1 
ATOM   1220  C C   . THR A  1  194 ? 20.172  -61.108 -51.052 1.00 0.00 ? 194 THR A C   1 
ATOM   1221  O O   . THR A  1  194 ? 19.800  -61.948 -50.230 1.00 0.00 ? 194 THR A O   1 
ATOM   1222  C CB  . THR A  1  194 ? 21.786  -59.363 -50.319 1.00 0.00 ? 194 THR A CB  1 
ATOM   1223  O OG1 . THR A  1  194 ? 20.943  -58.311 -50.743 1.00 0.00 ? 194 THR A OG1 1 
ATOM   1224  C CG2 . THR A  1  194 ? 23.229  -58.900 -50.487 1.00 0.00 ? 194 THR A CG2 1 
ATOM   1225  N N   . VAL A  1  195 ? 19.314  -60.508 -51.918 1.00 0.00 ? 195 VAL A N   1 
ATOM   1226  C CA  . VAL A  1  195 ? 17.918  -60.802 -52.044 1.00 0.00 ? 195 VAL A CA  1 
ATOM   1227  C C   . VAL A  1  195 ? 17.761  -62.203 -52.494 1.00 0.00 ? 195 VAL A C   1 
ATOM   1228  O O   . VAL A  1  195 ? 16.888  -62.912 -52.023 1.00 0.00 ? 195 VAL A O   1 
ATOM   1229  C CB  . VAL A  1  195 ? 17.316  -59.871 -53.086 1.00 0.00 ? 195 VAL A CB  1 
ATOM   1230  C CG1 . VAL A  1  195 ? 15.851  -60.224 -53.409 1.00 0.00 ? 195 VAL A CG1 1 
ATOM   1231  C CG2 . VAL A  1  195 ? 17.412  -58.425 -52.577 1.00 0.00 ? 195 VAL A CG2 1 
ATOM   1232  N N   . GLU A  1  196 ? 18.659  -62.639 -53.396 1.00 0.00 ? 196 GLU A N   1 
ATOM   1233  C CA  . GLU A  1  196 ? 18.761  -63.977 -53.903 1.00 0.00 ? 196 GLU A CA  1 
ATOM   1234  C C   . GLU A  1  196 ? 19.139  -64.927 -52.839 1.00 0.00 ? 196 GLU A C   1 
ATOM   1235  O O   . GLU A  1  196 ? 18.631  -66.032 -52.838 1.00 0.00 ? 196 GLU A O   1 
ATOM   1236  C CB  . GLU A  1  196 ? 19.747  -64.020 -55.088 1.00 0.00 ? 196 GLU A CB  1 
ATOM   1237  C CG  . GLU A  1  196 ? 20.164  -65.404 -55.580 1.00 0.00 ? 196 GLU A CG  1 
ATOM   1238  C CD  . GLU A  1  196 ? 21.453  -65.787 -54.875 1.00 0.00 ? 196 GLU A CD  1 
ATOM   1239  O OE1 . GLU A  1  196 ? 22.480  -65.128 -55.177 1.00 0.00 ? 196 GLU A OE1 1 
ATOM   1240  O OE2 . GLU A  1  196 ? 21.436  -66.728 -54.037 1.00 0.00 ? 196 GLU A OE2 1 
ATOM   1241  N N   . THR A  1  197 ? 19.998  -64.518 -51.879 1.00 0.00 ? 197 THR A N   1 
ATOM   1242  C CA  . THR A  1  197 ? 20.466  -65.370 -50.805 1.00 0.00 ? 197 THR A CA  1 
ATOM   1243  C C   . THR A  1  197 ? 19.298  -65.713 -49.951 1.00 0.00 ? 197 THR A C   1 
ATOM   1244  O O   . THR A  1  197 ? 19.099  -66.873 -49.611 1.00 0.00 ? 197 THR A O   1 
ATOM   1245  C CB  . THR A  1  197 ? 21.497  -64.723 -49.884 1.00 0.00 ? 197 THR A CB  1 
ATOM   1246  O OG1 . THR A  1  197 ? 22.558  -64.158 -50.627 1.00 0.00 ? 197 THR A OG1 1 
ATOM   1247  C CG2 . THR A  1  197 ? 22.085  -65.767 -48.911 1.00 0.00 ? 197 THR A CG2 1 
ATOM   1248  N N   . ALA A  1  198 ? 18.499  -64.678 -49.613 1.00 0.00 ? 198 ALA A N   1 
ATOM   1249  C CA  . ALA A  1  198 ? 17.350  -64.819 -48.763 1.00 0.00 ? 198 ALA A CA  1 
ATOM   1250  C C   . ALA A  1  198 ? 16.231  -65.620 -49.403 1.00 0.00 ? 198 ALA A C   1 
ATOM   1251  O O   . ALA A  1  198 ? 15.730  -66.557 -48.798 1.00 0.00 ? 198 ALA A O   1 
ATOM   1252  C CB  . ALA A  1  198 ? 16.845  -63.435 -48.324 1.00 0.00 ? 198 ALA A CB  1 
ATOM   1253  N N   . ILE A  1  199 ? 15.844  -65.298 -50.657 1.00 0.00 ? 199 ILE A N   1 
ATOM   1254  C CA  . ILE A  1  199 ? 14.794  -65.966 -51.390 1.00 0.00 ? 199 ILE A CA  1 
ATOM   1255  C C   . ILE A  1  199 ? 15.101  -67.405 -51.707 1.00 0.00 ? 199 ILE A C   1 
ATOM   1256  O O   . ILE A  1  199 ? 14.233  -68.253 -51.503 1.00 0.00 ? 199 ILE A O   1 
ATOM   1257  C CB  . ILE A  1  199 ? 14.318  -65.168 -52.587 1.00 0.00 ? 199 ILE A CB  1 
ATOM   1258  C CG1 . ILE A  1  199 ? 13.599  -63.895 -52.042 1.00 0.00 ? 199 ILE A CG1 1 
ATOM   1259  C CG2 . ILE A  1  199 ? 13.368  -66.016 -53.459 1.00 0.00 ? 199 ILE A CG2 1 
ATOM   1260  C CD1 . ILE A  1  199 ? 13.204  -62.871 -53.107 1.00 0.00 ? 199 ILE A CD1 1 
ATOM   1261  N N   . THR A  1  200 ? 16.349  -67.740 -52.169 1.00 0.00 ? 200 THR A N   1 
ATOM   1262  C CA  . THR A  1  200 ? 16.764  -69.118 -52.395 1.00 0.00 ? 200 THR A CA  1 
ATOM   1263  C C   . THR A  1  200 ? 16.869  -69.830 -51.098 1.00 0.00 ? 200 THR A C   1 
ATOM   1264  O O   . THR A  1  200 ? 16.656  -71.031 -51.071 1.00 0.00 ? 200 THR A O   1 
ATOM   1265  C CB  . THR A  1  200 ? 18.070  -69.376 -53.154 1.00 0.00 ? 200 THR A CB  1 
ATOM   1266  O OG1 . THR A  1  200 ? 19.202  -68.777 -52.554 1.00 0.00 ? 200 THR A OG1 1 
ATOM   1267  C CG2 . THR A  1  200 ? 17.935  -68.873 -54.601 1.00 0.00 ? 200 THR A CG2 1 
ATOM   1268  N N   . CYS A  1  201 ? 17.180  -69.117 -49.985 1.00 0.00 ? 201 CYS A N   1 
ATOM   1269  C CA  . CYS A  1  201 ? 17.215  -69.727 -48.680 1.00 0.00 ? 201 CYS A CA  1 
ATOM   1270  C C   . CYS A  1  201 ? 15.852  -70.133 -48.280 1.00 0.00 ? 201 CYS A C   1 
ATOM   1271  O O   . CYS A  1  201 ? 15.688  -71.276 -47.891 1.00 0.00 ? 201 CYS A O   1 
ATOM   1272  C CB  . CYS A  1  201 ? 17.801  -68.854 -47.544 1.00 0.00 ? 201 CYS A CB  1 
ATOM   1273  S SG  . CYS A  1  201 ? 17.838  -69.659 -45.902 1.00 0.00 ? 201 CYS A SG  1 
ATOM   1274  N N   . LEU A  1  202 ? 14.829  -69.269 -48.387 1.00 0.00 ? 202 LEU A N   1 
ATOM   1275  C CA  . LEU A  1  202 ? 13.489  -69.669 -48.033 1.00 0.00 ? 202 LEU A CA  1 
ATOM   1276  C C   . LEU A  1  202 ? 12.964  -70.754 -48.938 1.00 0.00 ? 202 LEU A C   1 
ATOM   1277  O O   . LEU A  1  202 ? 12.187  -71.594 -48.497 1.00 0.00 ? 202 LEU A O   1 
ATOM   1278  C CB  . LEU A  1  202 ? 12.474  -68.507 -48.032 1.00 0.00 ? 202 LEU A CB  1 
ATOM   1279  C CG  . LEU A  1  202 ? 12.392  -67.717 -46.712 1.00 0.00 ? 202 LEU A CG  1 
ATOM   1280  C CD1 . LEU A  1  202 ? 13.517  -66.695 -46.588 1.00 0.00 ? 202 LEU A CD1 1 
ATOM   1281  C CD2 . LEU A  1  202 ? 11.010  -67.048 -46.571 1.00 0.00 ? 202 LEU A CD2 1 
ATOM   1282  N N   . SER A  1  203 ? 13.365  -70.752 -50.228 1.00 0.00 ? 203 SER A N   1 
ATOM   1283  C CA  . SER A  1  203 ? 12.859  -71.681 -51.207 1.00 0.00 ? 203 SER A CA  1 
ATOM   1284  C C   . SER A  1  203 ? 13.373  -73.057 -50.955 1.00 0.00 ? 203 SER A C   1 
ATOM   1285  O O   . SER A  1  203 ? 12.604  -74.011 -50.964 1.00 0.00 ? 203 SER A O   1 
ATOM   1286  C CB  . SER A  1  203 ? 13.217  -71.272 -52.662 1.00 0.00 ? 203 SER A CB  1 
ATOM   1287  O OG  . SER A  1  203 ? 12.518  -72.065 -53.618 1.00 0.00 ? 203 SER A OG  1 
ATOM   1288  N N   . THR A  1  204 ? 14.696  -73.172 -50.738 1.00 0.00 ? 204 THR A N   1 
ATOM   1289  C CA  . THR A  1  204 ? 15.400  -74.405 -50.509 1.00 0.00 ? 204 THR A CA  1 
ATOM   1290  C C   . THR A  1  204 ? 15.053  -74.988 -49.158 1.00 0.00 ? 204 THR A C   1 
ATOM   1291  O O   . THR A  1  204 ? 14.965  -76.205 -48.995 1.00 0.00 ? 204 THR A O   1 
ATOM   1292  C CB  . THR A  1  204 ? 16.895  -74.172 -50.642 1.00 0.00 ? 204 THR A CB  1 
ATOM   1293  O OG1 . THR A  1  204 ? 17.179  -73.724 -51.960 1.00 0.00 ? 204 THR A OG1 1 
ATOM   1294  C CG2 . THR A  1  204 ? 17.710  -75.459 -50.395 1.00 0.00 ? 204 THR A CG2 1 
ATOM   1295  N N   . VAL A  1  205 ? 14.885  -74.123 -48.139 1.00 0.00 ? 205 VAL A N   1 
ATOM   1296  C CA  . VAL A  1  205 ? 14.770  -74.553 -46.778 1.00 0.00 ? 205 VAL A CA  1 
ATOM   1297  C C   . VAL A  1  205 ? 13.371  -74.923 -46.416 1.00 0.00 ? 205 VAL A C   1 
ATOM   1298  O O   . VAL A  1  205 ? 13.193  -75.958 -45.778 1.00 0.00 ? 205 VAL A O   1 
ATOM   1299  C CB  . VAL A  1  205 ? 15.263  -73.461 -45.874 1.00 0.00 ? 205 VAL A CB  1 
ATOM   1300  C CG1 . VAL A  1  205 ? 14.933  -73.748 -44.399 1.00 0.00 ? 205 VAL A CG1 1 
ATOM   1301  C CG2 . VAL A  1  205 ? 16.782  -73.355 -46.128 1.00 0.00 ? 205 VAL A CG2 1 
ATOM   1302  N N   . LEU A  1  206 ? 12.334  -74.171 -46.861 1.00 0.00 ? 206 LEU A N   1 
ATOM   1303  C CA  . LEU A  1  206 ? 10.966  -74.581 -46.612 1.00 0.00 ? 206 LEU A CA  1 
ATOM   1304  C C   . LEU A  1  206 ? 10.581  -75.600 -47.652 1.00 0.00 ? 206 LEU A C   1 
ATOM   1305  O O   . LEU A  1  206 ? 9.531   -76.224 -47.527 1.00 0.00 ? 206 LEU A O   1 
ATOM   1306  C CB  . LEU A  1  206 ? 9.951   -73.416 -46.696 1.00 0.00 ? 206 LEU A CB  1 
ATOM   1307  C CG  . LEU A  1  206 ? 9.894   -72.529 -45.439 1.00 0.00 ? 206 LEU A CG  1 
ATOM   1308  C CD1 . LEU A  1  206 ? 9.482   -71.089 -45.790 1.00 0.00 ? 206 LEU A CD1 1 
ATOM   1309  C CD2 . LEU A  1  206 ? 8.945   -73.108 -44.372 1.00 0.00 ? 206 LEU A CD2 1 
ATOM   1310  N N   . SER A  1  207 ? 11.447  -75.798 -48.679 1.00 0.00 ? 207 SER A N   1 
ATOM   1311  C CA  . SER A  1  207 ? 11.353  -76.789 -49.715 1.00 0.00 ? 207 SER A CA  1 
ATOM   1312  C C   . SER A  1  207 ? 10.097  -76.586 -50.520 1.00 0.00 ? 207 SER A C   1 
ATOM   1313  O O   . SER A  1  207 ? 9.328   -77.513 -50.761 1.00 0.00 ? 207 SER A O   1 
ATOM   1314  C CB  . SER A  1  207 ? 11.458  -78.222 -49.144 1.00 0.00 ? 207 SER A CB  1 
ATOM   1315  O OG  . SER A  1  207 ? 11.704  -79.176 -50.172 1.00 0.00 ? 207 SER A OG  1 
ATOM   1316  N N   . ILE A  1  208 ? 9.820   -75.319 -50.876 1.00 0.00 ? 208 ILE A N   1 
ATOM   1317  C CA  . ILE A  1  208 ? 8.608   -74.967 -51.548 1.00 0.00 ? 208 ILE A CA  1 
ATOM   1318  C C   . ILE A  1  208 ? 8.972   -73.860 -52.478 1.00 0.00 ? 208 ILE A C   1 
ATOM   1319  O O   . ILE A  1  208 ? 9.804   -73.015 -52.148 1.00 0.00 ? 208 ILE A O   1 
ATOM   1320  C CB  . ILE A  1  208 ? 7.531   -74.540 -50.535 1.00 0.00 ? 208 ILE A CB  1 
ATOM   1321  C CG1 . ILE A  1  208 ? 6.117   -74.296 -51.129 1.00 0.00 ? 208 ILE A CG1 1 
ATOM   1322  C CG2 . ILE A  1  208 ? 7.995   -73.320 -49.708 1.00 0.00 ? 208 ILE A CG2 1 
ATOM   1323  C CD1 . ILE A  1  208 ? 5.449   -75.533 -51.744 1.00 0.00 ? 208 ILE A CD1 1 
ATOM   1324  N N   . ASP A  1  209 ? 8.315   -73.835 -53.670 1.00 0.00 ? 209 ASP A N   1 
ATOM   1325  C CA  . ASP A  1  209 ? 8.447   -72.779 -54.641 1.00 0.00 ? 209 ASP A CA  1 
ATOM   1326  C C   . ASP A  1  209 ? 7.320   -71.875 -54.299 1.00 0.00 ? 209 ASP A C   1 
ATOM   1327  O O   . ASP A  1  209 ? 6.200   -72.332 -54.088 1.00 0.00 ? 209 ASP A O   1 
ATOM   1328  C CB  . ASP A  1  209 ? 8.243   -73.180 -56.122 1.00 0.00 ? 209 ASP A CB  1 
ATOM   1329  C CG  . ASP A  1  209 ? 9.496   -73.836 -56.692 1.00 0.00 ? 209 ASP A CG  1 
ATOM   1330  O OD1 . ASP A  1  209 ? 9.757   -75.021 -56.356 1.00 0.00 ? 209 ASP A OD1 1 
ATOM   1331  O OD2 . ASP A  1  209 ? 10.200  -73.156 -57.486 1.00 0.00 ? 209 ASP A OD2 1 
ATOM   1332  N N   . PHE A  1  210 ? 7.623   -70.570 -54.197 1.00 0.00 ? 210 PHE A N   1 
ATOM   1333  C CA  . PHE A  1  210 ? 6.728   -69.583 -53.679 1.00 0.00 ? 210 PHE A CA  1 
ATOM   1334  C C   . PHE A  1  210 ? 5.914   -68.976 -54.752 1.00 0.00 ? 210 PHE A C   1 
ATOM   1335  O O   . PHE A  1  210 ? 6.214   -69.104 -55.939 1.00 0.00 ? 210 PHE A O   1 
ATOM   1336  C CB  . PHE A  1  210 ? 7.467   -68.403 -53.033 1.00 0.00 ? 210 PHE A CB  1 
ATOM   1337  C CG  . PHE A  1  210 ? 8.170   -68.883 -51.822 1.00 0.00 ? 210 PHE A CG  1 
ATOM   1338  C CD1 . PHE A  1  210 ? 7.433   -69.394 -50.742 1.00 0.00 ? 210 PHE A CD1 1 
ATOM   1339  C CD2 . PHE A  1  210 ? 9.558   -68.783 -51.727 1.00 0.00 ? 210 PHE A CD2 1 
ATOM   1340  C CE1 . PHE A  1  210 ? 8.080   -69.839 -49.595 1.00 0.00 ? 210 PHE A CE1 1 
ATOM   1341  C CE2 . PHE A  1  210 ? 10.203  -69.215 -50.574 1.00 0.00 ? 210 PHE A CE2 1 
ATOM   1342  C CZ  . PHE A  1  210 ? 9.468   -69.780 -49.528 1.00 0.00 ? 210 PHE A CZ  1 
ATOM   1343  N N   . LYS A  1  211 ? 4.867   -68.252 -54.291 1.00 0.00 ? 211 LYS A N   1 
ATOM   1344  C CA  . LYS A  1  211 ? 4.220   -67.218 -55.040 1.00 0.00 ? 211 LYS A CA  1 
ATOM   1345  C C   . LYS A  1  211 ? 4.725   -65.918 -54.453 1.00 0.00 ? 211 LYS A C   1 
ATOM   1346  O O   . LYS A  1  211 ? 5.059   -65.880 -53.271 1.00 0.00 ? 211 LYS A O   1 
ATOM   1347  C CB  . LYS A  1  211 ? 2.684   -67.246 -54.943 1.00 0.00 ? 211 LYS A CB  1 
ATOM   1348  C CG  . LYS A  1  211 ? 2.092   -68.423 -55.732 1.00 0.00 ? 211 LYS A CG  1 
ATOM   1349  C CD  . LYS A  1  211 ? 0.556   -68.399 -55.867 1.00 0.00 ? 211 LYS A CD  1 
ATOM   1350  C CE  . LYS A  1  211 ? -0.033  -67.198 -56.637 1.00 0.00 ? 211 LYS A CE  1 
ATOM   1351  N NZ  . LYS A  1  211 ? 0.477   -67.115 -58.026 1.00 0.00 ? 211 LYS A NZ  1 
ATOM   1352  N N   . PRO A  1  212 ? 4.797   -64.829 -55.205 1.00 0.00 ? 212 PRO A N   1 
ATOM   1353  C CA  . PRO A  1  212 ? 5.263   -63.551 -54.722 1.00 0.00 ? 212 PRO A CA  1 
ATOM   1354  C C   . PRO A  1  212 ? 4.501   -63.020 -53.551 1.00 0.00 ? 212 PRO A C   1 
ATOM   1355  O O   . PRO A  1  212 ? 5.116   -62.332 -52.740 1.00 0.00 ? 212 PRO A O   1 
ATOM   1356  C CB  . PRO A  1  212 ? 5.170   -62.635 -55.929 1.00 0.00 ? 212 PRO A CB  1 
ATOM   1357  C CG  . PRO A  1  212 ? 5.558   -63.562 -57.078 1.00 0.00 ? 212 PRO A CG  1 
ATOM   1358  C CD  . PRO A  1  212 ? 4.931   -64.894 -56.663 1.00 0.00 ? 212 PRO A CD  1 
ATOM   1359  N N   . SER A  1  213 ? 3.185   -63.305 -53.426 1.00 0.00 ? 213 SER A N   1 
ATOM   1360  C CA  . SER A  1  213 ? 2.406   -62.859 -52.289 1.00 0.00 ? 213 SER A CA  1 
ATOM   1361  C C   . SER A  1  213 ? 2.839   -63.535 -51.005 1.00 0.00 ? 213 SER A C   1 
ATOM   1362  O O   . SER A  1  213 ? 2.832   -62.912 -49.948 1.00 0.00 ? 213 SER A O   1 
ATOM   1363  C CB  . SER A  1  213 ? 0.895   -63.125 -52.469 1.00 0.00 ? 213 SER A CB  1 
ATOM   1364  O OG  . SER A  1  213 ? 0.382   -62.389 -53.574 1.00 0.00 ? 213 SER A OG  1 
ATOM   1365  N N   . GLU A  1  214 ? 3.284   -64.811 -51.067 1.00 0.00 ? 214 GLU A N   1 
ATOM   1366  C CA  . GLU A  1  214 ? 3.769   -65.524 -49.907 1.00 0.00 ? 214 GLU A CA  1 
ATOM   1367  C C   . GLU A  1  214 ? 5.049   -64.977 -49.343 1.00 0.00 ? 214 GLU A C   1 
ATOM   1368  O O   . GLU A  1  214 ? 5.242   -65.022 -48.134 1.00 0.00 ? 214 GLU A O   1 
ATOM   1369  C CB  . GLU A  1  214 ? 4.043   -67.015 -50.177 1.00 0.00 ? 214 GLU A CB  1 
ATOM   1370  C CG  . GLU A  1  214 ? 2.768   -67.801 -50.509 1.00 0.00 ? 214 GLU A CG  1 
ATOM   1371  C CD  . GLU A  1  214 ? 3.173   -69.237 -50.802 1.00 0.00 ? 214 GLU A CD  1 
ATOM   1372  O OE1 . GLU A  1  214 ? 3.989   -69.431 -51.740 1.00 0.00 ? 214 GLU A OE1 1 
ATOM   1373  O OE2 . GLU A  1  214 ? 2.686   -70.157 -50.093 1.00 0.00 ? 214 GLU A OE2 1 
ATOM   1374  N N   . ILE A  1  215 ? 5.954   -64.436 -50.188 1.00 0.00 ? 215 ILE A N   1 
ATOM   1375  C CA  . ILE A  1  215 ? 7.198   -63.903 -49.691 1.00 0.00 ? 215 ILE A CA  1 
ATOM   1376  C C   . ILE A  1  215 ? 7.108   -62.409 -49.725 1.00 0.00 ? 215 ILE A C   1 
ATOM   1377  O O   . ILE A  1  215 ? 7.249   -61.786 -50.773 1.00 0.00 ? 215 ILE A O   1 
ATOM   1378  C CB  . ILE A  1  215 ? 8.399   -64.408 -50.495 1.00 0.00 ? 215 ILE A CB  1 
ATOM   1379  C CG1 . ILE A  1  215 ? 8.052   -64.716 -51.975 1.00 0.00 ? 215 ILE A CG1 1 
ATOM   1380  C CG2 . ILE A  1  215 ? 8.933   -65.658 -49.763 1.00 0.00 ? 215 ILE A CG2 1 
ATOM   1381  C CD1 . ILE A  1  215 ? 9.262   -65.042 -52.857 1.00 0.00 ? 215 ILE A CD1 1 
ATOM   1382  N N   . GLU A  1  216 ? 6.896   -61.803 -48.528 1.00 0.00 ? 216 GLU A N   1 
ATOM   1383  C CA  . GLU A  1  216 ? 7.005   -60.381 -48.299 1.00 0.00 ? 216 GLU A CA  1 
ATOM   1384  C C   . GLU A  1  216 ? 8.448   -60.093 -48.037 1.00 0.00 ? 216 GLU A C   1 
ATOM   1385  O O   . GLU A  1  216 ? 9.072   -60.852 -47.314 1.00 0.00 ? 216 GLU A O   1 
ATOM   1386  C CB  . GLU A  1  216 ? 6.080   -59.908 -47.158 1.00 0.00 ? 216 GLU A CB  1 
ATOM   1387  C CG  . GLU A  1  216 ? 6.036   -60.812 -45.909 1.00 0.00 ? 216 GLU A CG  1 
ATOM   1388  C CD  . GLU A  1  216 ? 4.909   -60.407 -44.940 1.00 0.00 ? 216 GLU A CD  1 
ATOM   1389  O OE1 . GLU A  1  216 ? 4.361   -59.284 -45.071 1.00 0.00 ? 216 GLU A OE1 1 
ATOM   1390  O OE2 . GLU A  1  216 ? 4.573   -61.234 -44.056 1.00 0.00 ? 216 GLU A OE2 1 
ATOM   1391  N N   . VAL A  1  217 ? 9.040   -59.056 -48.686 1.00 0.00 ? 217 VAL A N   1 
ATOM   1392  C CA  . VAL A  1  217 ? 10.472  -58.809 -48.685 1.00 0.00 ? 217 VAL A CA  1 
ATOM   1393  C C   . VAL A  1  217 ? 10.709  -57.344 -48.413 1.00 0.00 ? 217 VAL A C   1 
ATOM   1394  O O   . VAL A  1  217 ? 10.004  -56.510 -48.959 1.00 0.00 ? 217 VAL A O   1 
ATOM   1395  C CB  . VAL A  1  217 ? 11.097  -59.159 -50.023 1.00 0.00 ? 217 VAL A CB  1 
ATOM   1396  C CG1 . VAL A  1  217 ? 12.630  -59.147 -49.916 1.00 0.00 ? 217 VAL A CG1 1 
ATOM   1397  C CG2 . VAL A  1  217 ? 10.584  -60.533 -50.490 1.00 0.00 ? 217 VAL A CG2 1 
ATOM   1398  N N   . GLY A  1  218 ? 11.651  -56.982 -47.514 1.00 0.00 ? 218 GLY A N   1 
ATOM   1399  C CA  . GLY A  1  218 ? 11.930  -55.609 -47.164 1.00 0.00 ? 218 GLY A CA  1 
ATOM   1400  C C   . GLY A  1  218 ? 13.398  -55.299 -47.239 1.00 0.00 ? 218 GLY A C   1 
ATOM   1401  O O   . GLY A  1  218 ? 14.218  -56.005 -46.665 1.00 0.00 ? 218 GLY A O   1 
ATOM   1402  N N   . VAL A  1  219 ? 13.768  -54.225 -47.977 1.00 0.00 ? 219 VAL A N   1 
ATOM   1403  C CA  . VAL A  1  219 ? 15.129  -53.827 -48.248 1.00 0.00 ? 219 VAL A CA  1 
ATOM   1404  C C   . VAL A  1  219 ? 15.415  -52.435 -47.744 1.00 0.00 ? 219 VAL A C   1 
ATOM   1405  O O   . VAL A  1  219 ? 14.543  -51.573 -47.734 1.00 0.00 ? 219 VAL A O   1 
ATOM   1406  C CB  . VAL A  1  219 ? 15.451  -53.894 -49.721 1.00 0.00 ? 219 VAL A CB  1 
ATOM   1407  C CG1 . VAL A  1  219 ? 15.529  -55.373 -50.115 1.00 0.00 ? 219 VAL A CG1 1 
ATOM   1408  C CG2 . VAL A  1  219 ? 14.391  -53.140 -50.530 1.00 0.00 ? 219 VAL A CG2 1 
ATOM   1409  N N   . VAL A  1  220 ? 16.646  -52.263 -47.254 1.00 0.00 ? 220 VAL A N   1 
ATOM   1410  C CA  . VAL A  1  220 ? 17.165  -50.995 -46.735 1.00 0.00 ? 220 VAL A CA  1 
ATOM   1411  C C   . VAL A  1  220 ? 18.568  -50.684 -47.277 1.00 0.00 ? 220 VAL A C   1 
ATOM   1412  O O   . VAL A  1  220 ? 19.564  -50.812 -46.564 1.00 0.00 ? 220 VAL A O   1 
ATOM   1413  C CB  . VAL A  1  220 ? 17.207  -50.990 -45.195 1.00 0.00 ? 220 VAL A CB  1 
ATOM   1414  C CG1 . VAL A  1  220 ? 17.564  -49.605 -44.679 1.00 0.00 ? 220 VAL A CG1 1 
ATOM   1415  C CG2 . VAL A  1  220 ? 15.874  -51.452 -44.627 1.00 0.00 ? 220 VAL A CG2 1 
ATOM   1416  N N   . THR A  1  221 ? 18.623  -50.253 -48.540 1.00 0.00 ? 221 THR A N   1 
ATOM   1417  C CA  . THR A  1  221 ? 19.870  -49.951 -49.265 1.00 0.00 ? 221 THR A CA  1 
ATOM   1418  C C   . THR A  1  221 ? 20.618  -48.710 -48.765 1.00 0.00 ? 221 THR A C   1 
ATOM   1419  O O   . THR A  1  221 ? 20.003  -47.769 -48.265 1.00 0.00 ? 221 THR A O   1 
ATOM   1420  C CB  . THR A  1  221 ? 19.611  -49.781 -50.779 1.00 0.00 ? 221 THR A CB  1 
ATOM   1421  O OG1 . THR A  1  221 ? 19.069  -50.993 -51.317 1.00 0.00 ? 221 THR A OG1 1 
ATOM   1422  C CG2 . THR A  1  221 ? 20.899  -49.445 -51.509 1.00 0.00 ? 221 THR A CG2 1 
ATOM   1423  N N   . VAL A  1  222 ? 21.943  -48.712 -48.919 1.00 0.00 ? 222 VAL A N   1 
ATOM   1424  C CA  . VAL A  1  222 ? 22.793  -47.677 -48.366 1.00 0.00 ? 222 VAL A CA  1 
ATOM   1425  C C   . VAL A  1  222 ? 22.213  -46.324 -48.701 1.00 0.00 ? 222 VAL A C   1 
ATOM   1426  O O   . VAL A  1  222 ? 22.111  -45.446 -47.844 1.00 0.00 ? 222 VAL A O   1 
ATOM   1427  C CB  . VAL A  1  222 ? 24.255  -47.805 -48.845 1.00 0.00 ? 222 VAL A CB  1 
ATOM   1428  C CG1 . VAL A  1  222 ? 24.395  -48.116 -50.347 1.00 0.00 ? 222 VAL A CG1 1 
ATOM   1429  C CG2 . VAL A  1  222 ? 25.087  -46.565 -48.466 1.00 0.00 ? 222 VAL A CG2 1 
ATOM   1430  N N   . GLU A  1  223 ? 21.822  -46.161 -49.984 1.00 0.00 ? 223 GLU A N   1 
ATOM   1431  C CA  . GLU A  1  223 ? 21.206  -44.998 -50.534 1.00 0.00 ? 223 GLU A CA  1 
ATOM   1432  C C   . GLU A  1  223 ? 19.759  -44.882 -50.140 1.00 0.00 ? 223 GLU A C   1 
ATOM   1433  O O   . GLU A  1  223 ? 19.190  -43.796 -50.230 1.00 0.00 ? 223 GLU A O   1 
ATOM   1434  C CB  . GLU A  1  223 ? 21.364  -44.992 -52.073 1.00 0.00 ? 223 GLU A CB  1 
ATOM   1435  C CG  . GLU A  1  223 ? 20.790  -46.236 -52.775 1.00 0.00 ? 223 GLU A CG  1 
ATOM   1436  C CD  . GLU A  1  223 ? 20.931  -46.179 -54.304 1.00 0.00 ? 223 GLU A CD  1 
ATOM   1437  O OE1 . GLU A  1  223 ? 21.540  -45.204 -54.819 1.00 0.00 ? 223 GLU A OE1 1 
ATOM   1438  O OE2 . GLU A  1  223 ? 20.426  -47.118 -54.978 1.00 0.00 ? 223 GLU A OE2 1 
ATOM   1439  N N   . ASN A  1  224 ? 19.134  -45.972 -49.638 1.00 0.00 ? 224 ASN A N   1 
ATOM   1440  C CA  . ASN A  1  224 ? 17.746  -45.953 -49.259 1.00 0.00 ? 224 ASN A CA  1 
ATOM   1441  C C   . ASN A  1  224 ? 17.691  -46.345 -47.827 1.00 0.00 ? 224 ASN A C   1 
ATOM   1442  O O   . ASN A  1  224 ? 17.434  -47.511 -47.558 1.00 0.00 ? 224 ASN A O   1 
ATOM   1443  C CB  . ASN A  1  224 ? 16.878  -46.964 -50.044 1.00 0.00 ? 224 ASN A CB  1 
ATOM   1444  C CG  . ASN A  1  224 ? 16.856  -46.608 -51.538 1.00 0.00 ? 224 ASN A CG  1 
ATOM   1445  O OD1 . ASN A  1  224 ? 17.353  -47.367 -52.379 1.00 0.00 ? 224 ASN A OD1 1 
ATOM   1446  N ND2 . ASN A  1  224 ? 16.254  -45.426 -51.861 1.00 0.00 ? 224 ASN A ND2 1 
ATOM   1447  N N   . PRO A  1  225 ? 17.869  -45.449 -46.861 1.00 0.00 ? 225 PRO A N   1 
ATOM   1448  C CA  . PRO A  1  225 ? 17.782  -45.760 -45.450 1.00 0.00 ? 225 PRO A CA  1 
ATOM   1449  C C   . PRO A  1  225 ? 16.334  -45.828 -45.083 1.00 0.00 ? 225 PRO A C   1 
ATOM   1450  O O   . PRO A  1  225 ? 16.014  -46.298 -43.997 1.00 0.00 ? 225 PRO A O   1 
ATOM   1451  C CB  . PRO A  1  225 ? 18.432  -44.576 -44.755 1.00 0.00 ? 225 PRO A CB  1 
ATOM   1452  C CG  . PRO A  1  225 ? 18.131  -43.403 -45.688 1.00 0.00 ? 225 PRO A CG  1 
ATOM   1453  C CD  . PRO A  1  225 ? 18.213  -44.046 -47.075 1.00 0.00 ? 225 PRO A CD  1 
ATOM   1454  N N   . LYS A  1  226 ? 15.447  -45.405 -46.002 1.00 0.00 ? 226 LYS A N   1 
ATOM   1455  C CA  . LYS A  1  226 ? 14.034  -45.522 -45.888 1.00 0.00 ? 226 LYS A CA  1 
ATOM   1456  C C   . LYS A  1  226 ? 13.707  -46.961 -46.052 1.00 0.00 ? 226 LYS A C   1 
ATOM   1457  O O   . LYS A  1  226 ? 13.954  -47.555 -47.103 1.00 0.00 ? 226 LYS A O   1 
ATOM   1458  C CB  . LYS A  1  226 ? 13.294  -44.742 -46.987 1.00 0.00 ? 226 LYS A CB  1 
ATOM   1459  C CG  . LYS A  1  226 ? 13.478  -43.225 -46.870 1.00 0.00 ? 226 LYS A CG  1 
ATOM   1460  C CD  . LYS A  1  226 ? 12.822  -42.638 -45.613 1.00 0.00 ? 226 LYS A CD  1 
ATOM   1461  C CE  . LYS A  1  226 ? 12.999  -41.125 -45.514 1.00 0.00 ? 226 LYS A CE  1 
ATOM   1462  N NZ  . LYS A  1  226 ? 12.374  -40.606 -44.278 1.00 0.00 ? 226 LYS A NZ  1 
ATOM   1463  N N   . PHE A  1  227 ? 13.105  -47.525 -44.981 1.00 0.00 ? 227 PHE A N   1 
ATOM   1464  C CA  . PHE A  1  227 ? 12.562  -48.853 -44.903 1.00 0.00 ? 227 PHE A CA  1 
ATOM   1465  C C   . PHE A  1  227 ? 11.601  -49.011 -46.038 1.00 0.00 ? 227 PHE A C   1 
ATOM   1466  O O   . PHE A  1  227 ? 10.785  -48.124 -46.269 1.00 0.00 ? 227 PHE A O   1 
ATOM   1467  C CB  . PHE A  1  227 ? 11.844  -49.024 -43.552 1.00 0.00 ? 227 PHE A CB  1 
ATOM   1468  C CG  . PHE A  1  227 ? 11.410  -50.426 -43.385 1.00 0.00 ? 227 PHE A CG  1 
ATOM   1469  C CD1 . PHE A  1  227 ? 12.342  -51.410 -43.026 1.00 0.00 ? 227 PHE A CD1 1 
ATOM   1470  C CD2 . PHE A  1  227 ? 10.093  -50.803 -43.701 1.00 0.00 ? 227 PHE A CD2 1 
ATOM   1471  C CE1 . PHE A  1  227 ? 11.967  -52.762 -43.013 1.00 0.00 ? 227 PHE A CE1 1 
ATOM   1472  C CE2 . PHE A  1  227 ? 9.722   -52.154 -43.689 1.00 0.00 ? 227 PHE A CE2 1 
ATOM   1473  C CZ  . PHE A  1  227 ? 10.659  -53.134 -43.338 1.00 0.00 ? 227 PHE A CZ  1 
ATOM   1474  N N   . ARG A  1  228 ? 11.711  -50.091 -46.822 1.00 0.00 ? 228 ARG A N   1 
ATOM   1475  C CA  . ARG A  1  228 ? 10.910  -50.135 -48.006 1.00 0.00 ? 228 ARG A CA  1 
ATOM   1476  C C   . ARG A  1  228 ? 10.745  -51.560 -48.345 1.00 0.00 ? 228 ARG A C   1 
ATOM   1477  O O   . ARG A  1  228 ? 11.702  -52.318 -48.343 1.00 0.00 ? 228 ARG A O   1 
ATOM   1478  C CB  . ARG A  1  228 ? 11.682  -49.463 -49.156 1.00 0.00 ? 228 ARG A CB  1 
ATOM   1479  C CG  . ARG A  1  228 ? 10.927  -49.235 -50.466 1.00 0.00 ? 228 ARG A CG  1 
ATOM   1480  C CD  . ARG A  1  228 ? 11.830  -48.680 -51.581 1.00 0.00 ? 228 ARG A CD  1 
ATOM   1481  N NE  . ARG A  1  228 ? 12.699  -49.765 -52.169 1.00 0.00 ? 228 ARG A NE  1 
ATOM   1482  C CZ  . ARG A  1  228 ? 14.039  -49.924 -51.935 1.00 0.00 ? 228 ARG A CZ  1 
ATOM   1483  N NH1 . ARG A  1  228 ? 14.667  -49.292 -50.910 1.00 0.00 ? 228 ARG A NH1 1 
ATOM   1484  N NH2 . ARG A  1  228 ? 14.761  -50.749 -52.748 1.00 0.00 ? 228 ARG A NH2 1 
ATOM   1485  N N   . ILE A  1  229 ? 9.517   -51.956 -48.661 1.00 0.00 ? 229 ILE A N   1 
ATOM   1486  C CA  . ILE A  1  229 ? 9.253   -53.318 -49.110 1.00 0.00 ? 229 ILE A CA  1 
ATOM   1487  C C   . ILE A  1  229 ? 9.642   -53.436 -50.577 1.00 0.00 ? 229 ILE A C   1 
ATOM   1488  O O   . ILE A  1  229 ? 9.207   -52.644 -51.410 1.00 0.00 ? 229 ILE A O   1 
ATOM   1489  C CB  . ILE A  1  229 ? 7.778   -53.713 -48.921 1.00 0.00 ? 229 ILE A CB  1 
ATOM   1490  C CG1 . ILE A  1  229 ? 7.435   -53.806 -47.432 1.00 0.00 ? 229 ILE A CG1 1 
ATOM   1491  C CG2 . ILE A  1  229 ? 7.488   -55.039 -49.605 1.00 0.00 ? 229 ILE A CG2 1 
ATOM   1492  C CD1 . ILE A  1  229 ? 7.806   -52.579 -46.628 1.00 0.00 ? 229 ILE A CD1 1 
ATOM   1493  N N   . LEU A  1  230 ? 10.519  -54.394 -50.857 1.00 0.00 ? 230 LEU A N   1 
ATOM   1494  C CA  . LEU A  1  230 ? 11.107  -54.569 -52.178 1.00 0.00 ? 230 LEU A CA  1 
ATOM   1495  C C   . LEU A  1  230 ? 10.056  -54.500 -53.267 1.00 0.00 ? 230 LEU A C   1 
ATOM   1496  O O   . LEU A  1  230 ? 10.240  -53.819 -54.273 1.00 0.00 ? 230 LEU A O   1 
ATOM   1497  C CB  . LEU A  1  230 ? 11.847  -55.905 -52.252 1.00 0.00 ? 230 LEU A CB  1 
ATOM   1498  C CG  . LEU A  1  230 ? 12.472  -56.292 -53.591 1.00 0.00 ? 230 LEU A CG  1 
ATOM   1499  C CD1 . LEU A  1  230 ? 13.551  -55.297 -53.980 1.00 0.00 ? 230 LEU A CD1 1 
ATOM   1500  C CD2 . LEU A  1  230 ? 13.041  -57.701 -53.519 1.00 0.00 ? 230 LEU A CD2 1 
ATOM   1501  N N   . THR A  1  231 ? 8.954   -55.209 -53.045 1.00 0.00 ? 231 THR A N   1 
ATOM   1502  C CA  . THR A  1  231 ? 7.843   -55.274 -53.986 1.00 0.00 ? 231 THR A CA  1 
ATOM   1503  C C   . THR A  1  231 ? 8.066   -56.331 -55.058 1.00 0.00 ? 231 THR A C   1 
ATOM   1504  O O   . THR A  1  231 ? 9.051   -57.066 -55.032 1.00 0.00 ? 231 THR A O   1 
ATOM   1505  C CB  . THR A  1  231 ? 7.566   -53.915 -54.654 1.00 0.00 ? 231 THR A CB  1 
ATOM   1506  O OG1 . THR A  1  231 ? 7.619   -52.877 -53.668 1.00 0.00 ? 231 THR A OG1 1 
ATOM   1507  C CG2 . THR A  1  231 ? 6.198   -53.921 -55.315 1.00 0.00 ? 231 THR A CG2 1 
ATOM   1508  N N   . ILE A  1  235 ? 11.609  -59.488 -57.881 1.00 0.00 ? 235 ILE A N   1 
ATOM   1509  C CA  . ILE A  1  235 ? 11.305  -60.902 -58.048 1.00 0.00 ? 235 ILE A CA  1 
ATOM   1510  C C   . ILE A  1  235 ? 11.104  -61.255 -59.519 1.00 0.00 ? 235 ILE A C   1 
ATOM   1511  C CB  . ILE A  1  235 ? 10.044  -61.296 -57.257 1.00 0.00 ? 235 ILE A CB  1 
ATOM   1512  C CG1 . ILE A  1  235 ? 10.065  -60.650 -55.868 1.00 0.00 ? 235 ILE A CG1 1 
ATOM   1513  C CG2 . ILE A  1  235 ? 9.919   -62.811 -57.167 1.00 0.00 ? 235 ILE A CG2 1 
ATOM   1514  C CD1 . ILE A  1  235 ? 9.144   -61.310 -54.865 1.00 0.00 ? 235 ILE A CD1 1 
ATOM   1515  N N   . TYR B  2  6   ? 2.466   -59.357 -8.965  1.00 0.00 ? 5   TYR B N   1 
ATOM   1516  C CA  . TYR B  2  6   ? 2.089   -59.871 -7.654  1.00 0.00 ? 5   TYR B CA  1 
ATOM   1517  C C   . TYR B  2  6   ? 2.602   -58.968 -6.538  1.00 0.00 ? 5   TYR B C   1 
ATOM   1518  O O   . TYR B  2  6   ? 3.125   -57.884 -6.795  1.00 0.00 ? 5   TYR B O   1 
ATOM   1519  C CB  . TYR B  2  6   ? 2.618   -61.295 -7.465  1.00 0.00 ? 5   TYR B CB  1 
ATOM   1520  C CG  . TYR B  2  6   ? 2.113   -62.277 -8.497  1.00 0.00 ? 5   TYR B CG  1 
ATOM   1521  C CD1 . TYR B  2  6   ? 0.802   -62.224 -8.952  1.00 0.00 ? 5   TYR B CD1 1 
ATOM   1522  C CD2 . TYR B  2  6   ? 2.947   -63.258 -9.017  1.00 0.00 ? 5   TYR B CD2 1 
ATOM   1523  C CE1 . TYR B  2  6   ? 0.336   -63.120 -9.895  1.00 0.00 ? 5   TYR B CE1 1 
ATOM   1524  C CE2 . TYR B  2  6   ? 2.489   -64.158 -9.961  1.00 0.00 ? 5   TYR B CE2 1 
ATOM   1525  C CZ  . TYR B  2  6   ? 1.183   -64.084 -10.396 1.00 0.00 ? 5   TYR B CZ  1 
ATOM   1526  O OH  . TYR B  2  6   ? 0.724   -64.978 -11.336 1.00 0.00 ? 5   TYR B OH  1 
ATOM   1527  N N   . SER B  2  7   ? 2.318   -59.358 -5.295  1.00 0.00 ? 6   SER B N   1 
ATOM   1528  C CA  . SER B  2  7   ? 2.805   -58.651 -4.106  1.00 0.00 ? 6   SER B CA  1 
ATOM   1529  C C   . SER B  2  7   ? 3.521   -59.564 -3.100  1.00 0.00 ? 6   SER B C   1 
ATOM   1530  O O   . SER B  2  7   ? 3.954   -59.117 -2.038  1.00 0.00 ? 6   SER B O   1 
ATOM   1531  C CB  . SER B  2  7   ? 1.655   -57.914 -3.415  1.00 0.00 ? 6   SER B CB  1 
ATOM   1532  O OG  . SER B  2  7   ? 1.379   -56.682 -4.059  1.00 0.00 ? 6   SER B OG  1 
ATOM   1533  N N   . PHE B  2  8   ? 3.624   -60.842 -3.445  1.00 0.00 ? 7   PHE B N   1 
ATOM   1534  C CA  . PHE B  2  8   ? 4.035   -61.883 -2.549  1.00 0.00 ? 7   PHE B CA  1 
ATOM   1535  C C   . PHE B  2  8   ? 5.301   -62.386 -3.153  1.00 0.00 ? 7   PHE B C   1 
ATOM   1536  O O   . PHE B  2  8   ? 5.353   -62.614 -4.357  1.00 0.00 ? 7   PHE B O   1 
ATOM   1537  C CB  . PHE B  2  8   ? 3.023   -63.055 -2.400  1.00 0.00 ? 7   PHE B CB  1 
ATOM   1538  C CG  . PHE B  2  8   ? 2.488   -63.582 -3.713  1.00 0.00 ? 7   PHE B CG  1 
ATOM   1539  C CD1 . PHE B  2  8   ? 3.155   -64.614 -4.390  1.00 0.00 ? 7   PHE B CD1 1 
ATOM   1540  C CD2 . PHE B  2  8   ? 1.314   -63.055 -4.281  1.00 0.00 ? 7   PHE B CD2 1 
ATOM   1541  C CE1 . PHE B  2  8   ? 2.701   -65.057 -5.636  1.00 0.00 ? 7   PHE B CE1 1 
ATOM   1542  C CE2 . PHE B  2  8   ? 0.845   -63.515 -5.516  1.00 0.00 ? 7   PHE B CE2 1 
ATOM   1543  C CZ  . PHE B  2  8   ? 1.546   -64.508 -6.198  1.00 0.00 ? 7   PHE B CZ  1 
ATOM   1544  N N   . SER B  2  9   ? 6.377   -62.534 -2.340  1.00 0.00 ? 8   SER B N   1 
ATOM   1545  C CA  . SER B  2  9   ? 7.668   -62.968 -2.818  1.00 0.00 ? 8   SER B CA  1 
ATOM   1546  C C   . SER B  2  9   ? 7.650   -64.423 -3.124  1.00 0.00 ? 8   SER B C   1 
ATOM   1547  O O   . SER B  2  9   ? 6.926   -65.186 -2.500  1.00 0.00 ? 8   SER B O   1 
ATOM   1548  C CB  . SER B  2  9   ? 8.808   -62.640 -1.837  1.00 0.00 ? 8   SER B CB  1 
ATOM   1549  O OG  . SER B  2  9   ? 8.568   -63.175 -0.547  1.00 0.00 ? 8   SER B OG  1 
ATOM   1550  N N   . LEU B  2  10  ? 8.424   -64.821 -4.147  1.00 0.00 ? 9   LEU B N   1 
ATOM   1551  C CA  . LEU B  2  10  ? 8.549   -66.184 -4.581  1.00 0.00 ? 9   LEU B CA  1 
ATOM   1552  C C   . LEU B  2  10  ? 9.751   -66.805 -3.915  1.00 0.00 ? 9   LEU B C   1 
ATOM   1553  O O   . LEU B  2  10  ? 10.204  -67.867 -4.321  1.00 0.00 ? 9   LEU B O   1 
ATOM   1554  C CB  . LEU B  2  10  ? 8.724   -66.289 -6.118  1.00 0.00 ? 9   LEU B CB  1 
ATOM   1555  C CG  . LEU B  2  10  ? 7.797   -65.365 -6.948  1.00 0.00 ? 9   LEU B CG  1 
ATOM   1556  C CD1 . LEU B  2  10  ? 8.154   -65.386 -8.439  1.00 0.00 ? 9   LEU B CD1 1 
ATOM   1557  C CD2 . LEU B  2  10  ? 6.301   -65.649 -6.759  1.00 0.00 ? 9   LEU B CD2 1 
ATOM   1558  N N   . THR B  2  11  ? 10.286  -66.161 -2.852  1.00 0.00 ? 10  THR B N   1 
ATOM   1559  C CA  . THR B  2  11  ? 11.392  -66.646 -2.062  1.00 0.00 ? 10  THR B CA  1 
ATOM   1560  C C   . THR B  2  11  ? 10.856  -66.936 -0.687  1.00 0.00 ? 10  THR B C   1 
ATOM   1561  O O   . THR B  2  11  ? 10.181  -66.125 -0.062  1.00 0.00 ? 10  THR B O   1 
ATOM   1562  C CB  . THR B  2  11  ? 12.538  -65.654 -1.975  1.00 0.00 ? 10  THR B CB  1 
ATOM   1563  O OG1 . THR B  2  11  ? 12.115  -64.384 -1.493  1.00 0.00 ? 10  THR B OG1 1 
ATOM   1564  C CG2 . THR B  2  11  ? 13.142  -65.499 -3.382  1.00 0.00 ? 10  THR B CG2 1 
ATOM   1565  N N   . THR B  2  12  ? 11.074  -68.174 -0.230  1.00 0.00 ? 11  THR B N   1 
ATOM   1566  C CA  . THR B  2  12  ? 10.549  -68.647 1.010   1.00 0.00 ? 11  THR B CA  1 
ATOM   1567  C C   . THR B  2  12  ? 11.536  -69.693 1.400   1.00 0.00 ? 11  THR B C   1 
ATOM   1568  O O   . THR B  2  12  ? 12.069  -70.399 0.552   1.00 0.00 ? 11  THR B O   1 
ATOM   1569  C CB  . THR B  2  12  ? 9.181   -69.276 0.811   1.00 0.00 ? 11  THR B CB  1 
ATOM   1570  O OG1 . THR B  2  12  ? 8.284   -68.318 0.274   1.00 0.00 ? 11  THR B OG1 1 
ATOM   1571  C CG2 . THR B  2  12  ? 8.570   -69.808 2.115   1.00 0.00 ? 11  THR B CG2 1 
ATOM   1572  N N   . PHE B  2  13  ? 11.778  -69.849 2.708   1.00 0.00 ? 12  PHE B N   1 
ATOM   1573  C CA  . PHE B  2  13  ? 12.641  -70.857 3.247   1.00 0.00 ? 12  PHE B CA  1 
ATOM   1574  C C   . PHE B  2  13  ? 12.162  -72.282 3.038   1.00 0.00 ? 12  PHE B C   1 
ATOM   1575  O O   . PHE B  2  13  ? 10.985  -72.601 3.175   1.00 0.00 ? 12  PHE B O   1 
ATOM   1576  C CB  . PHE B  2  13  ? 12.840  -70.691 4.758   1.00 0.00 ? 12  PHE B CB  1 
ATOM   1577  C CG  . PHE B  2  13  ? 13.640  -69.484 5.110   1.00 0.00 ? 12  PHE B CG  1 
ATOM   1578  C CD1 . PHE B  2  13  ? 14.886  -69.244 4.513   1.00 0.00 ? 12  PHE B CD1 1 
ATOM   1579  C CD2 . PHE B  2  13  ? 13.198  -68.626 6.131   1.00 0.00 ? 12  PHE B CD2 1 
ATOM   1580  C CE1 . PHE B  2  13  ? 15.649  -68.139 4.899   1.00 0.00 ? 12  PHE B CE1 1 
ATOM   1581  C CE2 . PHE B  2  13  ? 13.959  -67.523 6.524   1.00 0.00 ? 12  PHE B CE2 1 
ATOM   1582  C CZ  . PHE B  2  13  ? 15.180  -67.273 5.893   1.00 0.00 ? 12  PHE B CZ  1 
ATOM   1583  N N   . SER B  2  14  ? 13.136  -73.184 2.800   1.00 0.00 ? 13  SER B N   1 
ATOM   1584  C CA  . SER B  2  14  ? 13.043  -74.616 2.901   1.00 0.00 ? 13  SER B CA  1 
ATOM   1585  C C   . SER B  2  14  ? 12.975  -74.980 4.379   1.00 0.00 ? 13  SER B C   1 
ATOM   1586  O O   . SER B  2  14  ? 13.324  -74.137 5.197   1.00 0.00 ? 13  SER B O   1 
ATOM   1587  C CB  . SER B  2  14  ? 14.222  -75.373 2.216   1.00 0.00 ? 13  SER B CB  1 
ATOM   1588  O OG  . SER B  2  14  ? 15.398  -75.495 3.017   1.00 0.00 ? 13  SER B OG  1 
ATOM   1589  N N   . PRO B  2  15  ? 12.544  -76.160 4.791   1.00 0.00 ? 14  PRO B N   1 
ATOM   1590  C CA  . PRO B  2  15  ? 12.461  -76.573 6.173   1.00 0.00 ? 14  PRO B CA  1 
ATOM   1591  C C   . PRO B  2  15  ? 13.670  -76.369 7.055   1.00 0.00 ? 14  PRO B C   1 
ATOM   1592  O O   . PRO B  2  15  ? 13.475  -76.400 8.265   1.00 0.00 ? 14  PRO B O   1 
ATOM   1593  C CB  . PRO B  2  15  ? 12.157  -78.054 6.061   1.00 0.00 ? 14  PRO B CB  1 
ATOM   1594  C CG  . PRO B  2  15  ? 11.208  -78.115 4.869   1.00 0.00 ? 14  PRO B CG  1 
ATOM   1595  C CD  . PRO B  2  15  ? 11.778  -77.062 3.934   1.00 0.00 ? 14  PRO B CD  1 
ATOM   1596  N N   . SER B  2  16  ? 14.907  -76.244 6.519   1.00 0.00 ? 15  SER B N   1 
ATOM   1597  C CA  . SER B  2  16  ? 16.091  -76.014 7.325   1.00 0.00 ? 15  SER B CA  1 
ATOM   1598  C C   . SER B  2  16  ? 16.612  -74.618 7.134   1.00 0.00 ? 15  SER B C   1 
ATOM   1599  O O   . SER B  2  16  ? 17.598  -74.210 7.739   1.00 0.00 ? 15  SER B O   1 
ATOM   1600  C CB  . SER B  2  16  ? 17.227  -76.989 6.977   1.00 0.00 ? 15  SER B CB  1 
ATOM   1601  O OG  . SER B  2  16  ? 16.813  -78.316 7.245   1.00 0.00 ? 15  SER B OG  1 
ATOM   1602  N N   . GLY B  2  17  ? 15.896  -73.802 6.360   1.00 0.00 ? 16  GLY B N   1 
ATOM   1603  C CA  . GLY B  2  17  ? 16.256  -72.441 6.128   1.00 0.00 ? 16  GLY B CA  1 
ATOM   1604  C C   . GLY B  2  17  ? 17.211  -72.312 5.012   1.00 0.00 ? 16  GLY B C   1 
ATOM   1605  O O   . GLY B  2  17  ? 18.330  -71.852 5.222   1.00 0.00 ? 16  GLY B O   1 
ATOM   1606  N N   . LYS B  2  18  ? 16.740  -72.599 3.776   1.00 0.00 ? 17  LYS B N   1 
ATOM   1607  C CA  . LYS B  2  18  ? 17.557  -72.381 2.619   1.00 0.00 ? 17  LYS B CA  1 
ATOM   1608  C C   . LYS B  2  18  ? 16.633  -71.731 1.670   1.00 0.00 ? 17  LYS B C   1 
ATOM   1609  O O   . LYS B  2  18  ? 15.477  -72.116 1.566   1.00 0.00 ? 17  LYS B O   1 
ATOM   1610  C CB  . LYS B  2  18  ? 18.067  -73.700 1.998   1.00 0.00 ? 17  LYS B CB  1 
ATOM   1611  C CG  . LYS B  2  18  ? 18.770  -74.604 3.030   1.00 0.00 ? 17  LYS B CG  1 
ATOM   1612  C CD  . LYS B  2  18  ? 19.228  -75.949 2.472   1.00 0.00 ? 17  LYS B CD  1 
ATOM   1613  C CE  . LYS B  2  18  ? 19.906  -76.802 3.542   1.00 0.00 ? 17  LYS B CE  1 
ATOM   1614  N NZ  . LYS B  2  18  ? 20.321  -78.118 3.006   1.00 0.00 ? 17  LYS B NZ  1 
ATOM   1615  N N   . LEU B  2  19  ? 17.137  -70.739 0.927   1.00 0.00 ? 18  LEU B N   1 
ATOM   1616  C CA  . LEU B  2  19  ? 16.431  -70.009 -0.087  1.00 0.00 ? 18  LEU B CA  1 
ATOM   1617  C C   . LEU B  2  19  ? 16.508  -70.724 -1.374  1.00 0.00 ? 18  LEU B C   1 
ATOM   1618  O O   . LEU B  2  19  ? 17.484  -70.578 -2.093  1.00 0.00 ? 18  LEU B O   1 
ATOM   1619  C CB  . LEU B  2  19  ? 16.898  -68.554 -0.207  1.00 0.00 ? 18  LEU B CB  1 
ATOM   1620  C CG  . LEU B  2  19  ? 16.656  -67.773 1.098   1.00 0.00 ? 18  LEU B CG  1 
ATOM   1621  C CD1 . LEU B  2  19  ? 17.264  -66.362 1.101   1.00 0.00 ? 18  LEU B CD1 1 
ATOM   1622  C CD2 . LEU B  2  19  ? 15.166  -67.686 1.429   1.00 0.00 ? 18  LEU B CD2 1 
ATOM   1623  N N   . VAL B  2  20  ? 15.499  -71.553 -1.688  1.00 0.00 ? 19  VAL B N   1 
ATOM   1624  C CA  . VAL B  2  20  ? 15.532  -72.544 -2.727  1.00 0.00 ? 19  VAL B CA  1 
ATOM   1625  C C   . VAL B  2  20  ? 15.718  -71.871 -4.044  1.00 0.00 ? 19  VAL B C   1 
ATOM   1626  O O   . VAL B  2  20  ? 16.551  -72.300 -4.829  1.00 0.00 ? 19  VAL B O   1 
ATOM   1627  C CB  . VAL B  2  20  ? 14.249  -73.352 -2.779  1.00 0.00 ? 19  VAL B CB  1 
ATOM   1628  C CG1 . VAL B  2  20  ? 14.328  -74.422 -3.881  1.00 0.00 ? 19  VAL B CG1 1 
ATOM   1629  C CG2 . VAL B  2  20  ? 14.015  -73.996 -1.401  1.00 0.00 ? 19  VAL B CG2 1 
ATOM   1630  N N   . GLN B  2  21  ? 14.955  -70.800 -4.324  1.00 0.00 ? 20  GLN B N   1 
ATOM   1631  C CA  . GLN B  2  21  ? 15.026  -70.088 -5.573  1.00 0.00 ? 20  GLN B CA  1 
ATOM   1632  C C   . GLN B  2  21  ? 16.342  -69.446 -5.820  1.00 0.00 ? 20  GLN B C   1 
ATOM   1633  O O   . GLN B  2  21  ? 16.770  -69.411 -6.964  1.00 0.00 ? 20  GLN B O   1 
ATOM   1634  C CB  . GLN B  2  21  ? 13.910  -69.043 -5.738  1.00 0.00 ? 20  GLN B CB  1 
ATOM   1635  C CG  . GLN B  2  21  ? 12.549  -69.682 -6.034  1.00 0.00 ? 20  GLN B CG  1 
ATOM   1636  C CD  . GLN B  2  21  ? 12.688  -70.441 -7.349  1.00 0.00 ? 20  GLN B CD  1 
ATOM   1637  O OE1 . GLN B  2  21  ? 13.213  -69.876 -8.313  1.00 0.00 ? 20  GLN B OE1 1 
ATOM   1638  N NE2 . GLN B  2  21  ? 12.272  -71.739 -7.377  1.00 0.00 ? 20  GLN B NE2 1 
ATOM   1639  N N   . ILE B  2  22  ? 17.029  -68.948 -4.768  1.00 0.00 ? 21  ILE B N   1 
ATOM   1640  C CA  . ILE B  2  22  ? 18.372  -68.421 -4.859  1.00 0.00 ? 21  ILE B CA  1 
ATOM   1641  C C   . ILE B  2  22  ? 19.345  -69.512 -5.142  1.00 0.00 ? 21  ILE B C   1 
ATOM   1642  O O   . ILE B  2  22  ? 20.291  -69.284 -5.876  1.00 0.00 ? 21  ILE B O   1 
ATOM   1643  C CB  . ILE B  2  22  ? 18.806  -67.736 -3.596  1.00 0.00 ? 21  ILE B CB  1 
ATOM   1644  C CG1 . ILE B  2  22  ? 17.935  -66.500 -3.345  1.00 0.00 ? 21  ILE B CG1 1 
ATOM   1645  C CG2 . ILE B  2  22  ? 20.289  -67.338 -3.642  1.00 0.00 ? 21  ILE B CG2 1 
ATOM   1646  C CD1 . ILE B  2  22  ? 18.375  -65.732 -2.103  1.00 0.00 ? 21  ILE B CD1 1 
ATOM   1647  N N   . GLU B  2  23  ? 19.164  -70.724 -4.570  1.00 0.00 ? 22  GLU B N   1 
ATOM   1648  C CA  . GLU B  2  23  ? 20.042  -71.847 -4.800  1.00 0.00 ? 22  GLU B CA  1 
ATOM   1649  C C   . GLU B  2  23  ? 19.964  -72.266 -6.229  1.00 0.00 ? 22  GLU B C   1 
ATOM   1650  O O   . GLU B  2  23  ? 20.963  -72.660 -6.817  1.00 0.00 ? 22  GLU B O   1 
ATOM   1651  C CB  . GLU B  2  23  ? 19.742  -73.070 -3.907  1.00 0.00 ? 22  GLU B CB  1 
ATOM   1652  C CG  . GLU B  2  23  ? 20.072  -72.822 -2.427  1.00 0.00 ? 22  GLU B CG  1 
ATOM   1653  C CD  . GLU B  2  23  ? 19.676  -74.028 -1.561  1.00 0.00 ? 22  GLU B CD  1 
ATOM   1654  O OE1 . GLU B  2  23  ? 18.465  -74.383 -1.525  1.00 0.00 ? 22  GLU B OE1 1 
ATOM   1655  O OE2 . GLU B  2  23  ? 20.580  -74.604 -0.901  1.00 0.00 ? 22  GLU B OE2 1 
ATOM   1656  N N   . TYR B  2  24  ? 18.760  -72.185 -6.817  1.00 0.00 ? 23  TYR B N   1 
ATOM   1657  C CA  . TYR B  2  24  ? 18.514  -72.430 -8.209  1.00 0.00 ? 23  TYR B CA  1 
ATOM   1658  C C   . TYR B  2  24  ? 19.076  -71.364 -9.102  1.00 0.00 ? 23  TYR B C   1 
ATOM   1659  O O   . TYR B  2  24  ? 19.470  -71.619 -10.234 1.00 0.00 ? 23  TYR B O   1 
ATOM   1660  C CB  . TYR B  2  24  ? 17.019  -72.613 -8.456  1.00 0.00 ? 23  TYR B CB  1 
ATOM   1661  C CG  . TYR B  2  24  ? 16.473  -73.834 -7.768  1.00 0.00 ? 23  TYR B CG  1 
ATOM   1662  C CD1 . TYR B  2  24  ? 17.259  -74.857 -7.199  1.00 0.00 ? 23  TYR B CD1 1 
ATOM   1663  C CD2 . TYR B  2  24  ? 15.085  -73.986 -7.760  1.00 0.00 ? 23  TYR B CD2 1 
ATOM   1664  C CE1 . TYR B  2  24  ? 16.669  -75.995 -6.654  1.00 0.00 ? 23  TYR B CE1 1 
ATOM   1665  C CE2 . TYR B  2  24  ? 14.490  -75.136 -7.245  1.00 0.00 ? 23  TYR B CE2 1 
ATOM   1666  C CZ  . TYR B  2  24  ? 15.286  -76.139 -6.685  1.00 0.00 ? 23  TYR B CZ  1 
ATOM   1667  O OH  . TYR B  2  24  ? 14.698  -77.290 -6.120  1.00 0.00 ? 23  TYR B OH  1 
ATOM   1668  N N   . ALA B  2  25  ? 19.159  -70.124 -8.599  1.00 0.00 ? 24  ALA B N   1 
ATOM   1669  C CA  . ALA B  2  25  ? 19.825  -69.028 -9.246  1.00 0.00 ? 24  ALA B CA  1 
ATOM   1670  C C   . ALA B  2  25  ? 21.299  -69.265 -9.314  1.00 0.00 ? 24  ALA B C   1 
ATOM   1671  O O   . ALA B  2  25  ? 21.922  -68.836 -10.271 1.00 0.00 ? 24  ALA B O   1 
ATOM   1672  C CB  . ALA B  2  25  ? 19.558  -67.670 -8.580  1.00 0.00 ? 24  ALA B CB  1 
ATOM   1673  N N   . LEU B  2  26  ? 21.905  -69.923 -8.284  1.00 0.00 ? 25  LEU B N   1 
ATOM   1674  C CA  . LEU B  2  26  ? 23.296  -70.339 -8.266  1.00 0.00 ? 25  LEU B CA  1 
ATOM   1675  C C   . LEU B  2  26  ? 23.545  -71.417 -9.283  1.00 0.00 ? 25  LEU B C   1 
ATOM   1676  O O   . LEU B  2  26  ? 24.611  -71.470 -9.874  1.00 0.00 ? 25  LEU B O   1 
ATOM   1677  C CB  . LEU B  2  26  ? 23.795  -70.917 -6.918  1.00 0.00 ? 25  LEU B CB  1 
ATOM   1678  C CG  . LEU B  2  26  ? 23.528  -70.082 -5.647  1.00 0.00 ? 25  LEU B CG  1 
ATOM   1679  C CD1 . LEU B  2  26  ? 24.043  -70.821 -4.405  1.00 0.00 ? 25  LEU B CD1 1 
ATOM   1680  C CD2 . LEU B  2  26  ? 24.091  -68.655 -5.704  1.00 0.00 ? 25  LEU B CD2 1 
ATOM   1681  N N   . ALA B  2  27  ? 22.546  -72.275 -9.559  1.00 0.00 ? 26  ALA B N   1 
ATOM   1682  C CA  . ALA B  2  27  ? 22.558  -73.231 -10.640 1.00 0.00 ? 26  ALA B CA  1 
ATOM   1683  C C   . ALA B  2  27  ? 22.557  -72.566 -11.992 1.00 0.00 ? 26  ALA B C   1 
ATOM   1684  O O   . ALA B  2  27  ? 23.091  -73.117 -12.946 1.00 0.00 ? 26  ALA B O   1 
ATOM   1685  C CB  . ALA B  2  27  ? 21.400  -74.240 -10.587 1.00 0.00 ? 26  ALA B CB  1 
ATOM   1686  N N   . ALA B  2  28  ? 21.894  -71.386 -12.126 1.00 0.00 ? 27  ALA B N   1 
ATOM   1687  C CA  . ALA B  2  28  ? 21.891  -70.595 -13.343 1.00 0.00 ? 27  ALA B CA  1 
ATOM   1688  C C   . ALA B  2  28  ? 23.211  -69.949 -13.598 1.00 0.00 ? 27  ALA B C   1 
ATOM   1689  O O   . ALA B  2  28  ? 23.574  -69.779 -14.754 1.00 0.00 ? 27  ALA B O   1 
ATOM   1690  C CB  . ALA B  2  28  ? 20.836  -69.478 -13.360 1.00 0.00 ? 27  ALA B CB  1 
ATOM   1691  N N   . VAL B  2  29  ? 23.969  -69.612 -12.529 1.00 0.00 ? 28  VAL B N   1 
ATOM   1692  C CA  . VAL B  2  29  ? 25.330  -69.129 -12.582 1.00 0.00 ? 28  VAL B CA  1 
ATOM   1693  C C   . VAL B  2  29  ? 26.256  -70.190 -13.067 1.00 0.00 ? 28  VAL B C   1 
ATOM   1694  O O   . VAL B  2  29  ? 27.256  -69.870 -13.694 1.00 0.00 ? 28  VAL B O   1 
ATOM   1695  C CB  . VAL B  2  29  ? 25.840  -68.653 -11.230 1.00 0.00 ? 28  VAL B CB  1 
ATOM   1696  C CG1 . VAL B  2  29  ? 27.328  -68.228 -11.238 1.00 0.00 ? 28  VAL B CG1 1 
ATOM   1697  C CG2 . VAL B  2  29  ? 24.978  -67.471 -10.797 1.00 0.00 ? 28  VAL B CG2 1 
ATOM   1698  N N   . ALA B  2  30  ? 25.971  -71.478 -12.747 1.00 0.00 ? 29  ALA B N   1 
ATOM   1699  C CA  . ALA B  2  30  ? 26.760  -72.635 -13.130 1.00 0.00 ? 29  ALA B CA  1 
ATOM   1700  C C   . ALA B  2  30  ? 26.761  -72.820 -14.614 1.00 0.00 ? 29  ALA B C   1 
ATOM   1701  O O   . ALA B  2  30  ? 27.760  -73.233 -15.198 1.00 0.00 ? 29  ALA B O   1 
ATOM   1702  C CB  . ALA B  2  30  ? 26.280  -73.947 -12.493 1.00 0.00 ? 29  ALA B CB  1 
ATOM   1703  N N   . GLY B  2  31  ? 25.670  -72.372 -15.270 1.00 0.00 ? 30  GLY B N   1 
ATOM   1704  C CA  . GLY B  2  31  ? 25.570  -72.291 -16.697 1.00 0.00 ? 30  GLY B CA  1 
ATOM   1705  C C   . GLY B  2  31  ? 26.343  -71.085 -17.099 1.00 0.00 ? 30  GLY B C   1 
ATOM   1706  O O   . GLY B  2  31  ? 27.085  -70.516 -16.315 1.00 0.00 ? 30  GLY B O   1 
ATOM   1707  N N   . GLY B  2  32  ? 26.219  -70.660 -18.363 1.00 0.00 ? 31  GLY B N   1 
ATOM   1708  C CA  . GLY B  2  32  ? 26.891  -69.489 -18.867 1.00 0.00 ? 31  GLY B CA  1 
ATOM   1709  C C   . GLY B  2  32  ? 28.342  -69.778 -19.080 1.00 0.00 ? 31  GLY B C   1 
ATOM   1710  O O   . GLY B  2  32  ? 28.952  -70.602 -18.410 1.00 0.00 ? 31  GLY B O   1 
ATOM   1711  N N   . ALA B  2  33  ? 28.944  -69.085 -20.057 1.00 0.00 ? 32  ALA B N   1 
ATOM   1712  C CA  . ALA B  2  33  ? 30.313  -69.273 -20.446 1.00 0.00 ? 32  ALA B CA  1 
ATOM   1713  C C   . ALA B  2  33  ? 31.253  -68.845 -19.333 1.00 0.00 ? 32  ALA B C   1 
ATOM   1714  O O   . ALA B  2  33  ? 30.871  -67.982 -18.545 1.00 0.00 ? 32  ALA B O   1 
ATOM   1715  C CB  . ALA B  2  33  ? 30.595  -68.526 -21.760 1.00 0.00 ? 32  ALA B CB  1 
ATOM   1716  N N   . PRO B  2  34  ? 32.422  -69.454 -19.168 1.00 0.00 ? 33  PRO B N   1 
ATOM   1717  C CA  . PRO B  2  34  ? 33.344  -69.175 -18.090 1.00 0.00 ? 33  PRO B CA  1 
ATOM   1718  C C   . PRO B  2  34  ? 33.837  -67.764 -18.057 1.00 0.00 ? 33  PRO B C   1 
ATOM   1719  O O   . PRO B  2  34  ? 34.050  -67.178 -19.110 1.00 0.00 ? 33  PRO B O   1 
ATOM   1720  C CB  . PRO B  2  34  ? 34.510  -70.132 -18.319 1.00 0.00 ? 33  PRO B CB  1 
ATOM   1721  C CG  . PRO B  2  34  ? 34.443  -70.466 -19.801 1.00 0.00 ? 33  PRO B CG  1 
ATOM   1722  C CD  . PRO B  2  34  ? 32.948  -70.487 -20.045 1.00 0.00 ? 33  PRO B CD  1 
ATOM   1723  N N   . SER B  2  35  ? 34.044  -67.217 -16.847 1.00 0.00 ? 34  SER B N   1 
ATOM   1724  C CA  . SER B  2  35  ? 34.611  -65.916 -16.679 1.00 0.00 ? 34  SER B CA  1 
ATOM   1725  C C   . SER B  2  35  ? 35.782  -66.106 -15.799 1.00 0.00 ? 34  SER B C   1 
ATOM   1726  O O   . SER B  2  35  ? 35.900  -67.142 -15.155 1.00 0.00 ? 34  SER B O   1 
ATOM   1727  C CB  . SER B  2  35  ? 33.654  -64.963 -16.007 1.00 0.00 ? 34  SER B CB  1 
ATOM   1728  O OG  . SER B  2  35  ? 32.467  -64.888 -16.773 1.00 0.00 ? 34  SER B OG  1 
ATOM   1729  N N   . VAL B  2  36  ? 36.706  -65.127 -15.774 1.00 0.00 ? 35  VAL B N   1 
ATOM   1730  C CA  . VAL B  2  36  ? 37.902  -65.223 -14.984 1.00 0.00 ? 35  VAL B CA  1 
ATOM   1731  C C   . VAL B  2  36  ? 38.332  -63.811 -14.718 1.00 0.00 ? 35  VAL B C   1 
ATOM   1732  O O   . VAL B  2  36  ? 38.069  -62.933 -15.534 1.00 0.00 ? 35  VAL B O   1 
ATOM   1733  C CB  . VAL B  2  36  ? 38.973  -66.068 -15.679 1.00 0.00 ? 35  VAL B CB  1 
ATOM   1734  C CG1 . VAL B  2  36  ? 39.553  -65.367 -16.934 1.00 0.00 ? 35  VAL B CG1 1 
ATOM   1735  C CG2 . VAL B  2  36  ? 40.031  -66.528 -14.661 1.00 0.00 ? 35  VAL B CG2 1 
ATOM   1736  N N   . GLY B  2  37  ? 39.005  -63.559 -13.574 1.00 0.00 ? 36  GLY B N   1 
ATOM   1737  C CA  . GLY B  2  37  ? 39.454  -62.240 -13.236 1.00 0.00 ? 36  GLY B CA  1 
ATOM   1738  C C   . GLY B  2  37  ? 40.562  -62.322 -12.237 1.00 0.00 ? 36  GLY B C   1 
ATOM   1739  O O   . GLY B  2  37  ? 40.503  -63.129 -11.316 1.00 0.00 ? 36  GLY B O   1 
ATOM   1740  N N   . ILE B  2  38  ? 41.628  -61.500 -12.407 1.00 0.00 ? 37  ILE B N   1 
ATOM   1741  C CA  . ILE B  2  38  ? 42.813  -61.560 -11.572 1.00 0.00 ? 37  ILE B CA  1 
ATOM   1742  C C   . ILE B  2  38  ? 43.231  -60.172 -11.256 1.00 0.00 ? 37  ILE B C   1 
ATOM   1743  O O   . ILE B  2  38  ? 43.339  -59.348 -12.160 1.00 0.00 ? 37  ILE B O   1 
ATOM   1744  C CB  . ILE B  2  38  ? 44.017  -62.196 -12.257 1.00 0.00 ? 37  ILE B CB  1 
ATOM   1745  C CG1 . ILE B  2  38  ? 43.706  -63.582 -12.853 1.00 0.00 ? 37  ILE B CG1 1 
ATOM   1746  C CG2 . ILE B  2  38  ? 45.187  -62.305 -11.267 1.00 0.00 ? 37  ILE B CG2 1 
ATOM   1747  C CD1 . ILE B  2  38  ? 43.372  -63.530 -14.334 1.00 0.00 ? 37  ILE B CD1 1 
ATOM   1748  N N   . LYS B  2  39  ? 43.538  -59.924 -9.960  1.00 0.00 ? 38  LYS B N   1 
ATOM   1749  C CA  . LYS B  2  39  ? 44.175  -58.725 -9.483  1.00 0.00 ? 38  LYS B CA  1 
ATOM   1750  C C   . LYS B  2  39  ? 45.651  -58.960 -9.506  1.00 0.00 ? 38  LYS B C   1 
ATOM   1751  O O   . LYS B  2  39  ? 46.196  -59.727 -8.709  1.00 0.00 ? 38  LYS B O   1 
ATOM   1752  C CB  . LYS B  2  39  ? 43.803  -58.339 -8.037  1.00 0.00 ? 38  LYS B CB  1 
ATOM   1753  C CG  . LYS B  2  39  ? 44.722  -57.264 -7.436  1.00 0.00 ? 38  LYS B CG  1 
ATOM   1754  C CD  . LYS B  2  39  ? 44.251  -56.701 -6.096  1.00 0.00 ? 38  LYS B CD  1 
ATOM   1755  C CE  . LYS B  2  39  ? 44.405  -57.670 -4.929  1.00 0.00 ? 38  LYS B CE  1 
ATOM   1756  N NZ  . LYS B  2  39  ? 45.806  -58.135 -4.789  1.00 0.00 ? 38  LYS B NZ  1 
ATOM   1757  N N   . ALA B  2  40  ? 46.370  -58.289 -10.411 1.00 0.00 ? 39  ALA B N   1 
ATOM   1758  C CA  . ALA B  2  40  ? 47.817  -58.540 -10.556 1.00 0.00 ? 39  ALA B CA  1 
ATOM   1759  C C   . ALA B  2  40  ? 48.813  -57.606 -9.838  1.00 0.00 ? 39  ALA B C   1 
ATOM   1760  O O   . ALA B  2  40  ? 49.724  -58.077 -9.167  1.00 0.00 ? 39  ALA B O   1 
ATOM   1761  C CB  . ALA B  2  40  ? 48.178  -58.650 -12.031 1.00 0.00 ? 39  ALA B CB  1 
ATOM   1762  N N   . ALA B  2  41  ? 48.585  -56.298 -9.936  1.00 0.00 ? 40  ALA B N   1 
ATOM   1763  C CA  . ALA B  2  41  ? 49.491  -55.298 -9.366  1.00 0.00 ? 40  ALA B CA  1 
ATOM   1764  C C   . ALA B  2  41  ? 49.877  -54.184 -10.347 1.00 0.00 ? 40  ALA B C   1 
ATOM   1765  O O   . ALA B  2  41  ? 50.439  -53.166 -9.944  1.00 0.00 ? 40  ALA B O   1 
ATOM   1766  C CB  . ALA B  2  41  ? 50.738  -55.974 -8.813  1.00 0.00 ? 40  ALA B CB  1 
ATOM   1767  N N   . ASN B  2  42  ? 49.556  -54.370 -11.623 1.00 0.00 ? 41  ASN B N   1 
ATOM   1768  C CA  . ASN B  2  42  ? 49.559  -53.286 -12.591 1.00 0.00 ? 41  ASN B CA  1 
ATOM   1769  C C   . ASN B  2  42  ? 48.106  -52.882 -12.743 1.00 0.00 ? 41  ASN B C   1 
ATOM   1770  O O   . ASN B  2  42  ? 47.756  -51.704 -12.773 1.00 0.00 ? 41  ASN B O   1 
ATOM   1771  C CB  . ASN B  2  42  ? 50.109  -53.748 -13.940 1.00 0.00 ? 41  ASN B CB  1 
ATOM   1772  C CG  . ASN B  2  42  ? 51.524  -54.275 -13.848 1.00 0.00 ? 41  ASN B CG  1 
ATOM   1773  O OD1 . ASN B  2  42  ? 51.785  -55.261 -13.164 1.00 0.00 ? 41  ASN B OD1 1 
ATOM   1774  N ND2 . ASN B  2  42  ? 52.446  -53.625 -14.548 1.00 0.00 ? 41  ASN B ND2 1 
ATOM   1775  N N   . GLY B  2  43  ? 47.265  -53.902 -12.821 1.00 0.00 ? 42  GLY B N   1 
ATOM   1776  C CA  . GLY B  2  43  ? 45.823  -53.755 -12.879 1.00 0.00 ? 42  GLY B CA  1 
ATOM   1777  C C   . GLY B  2  43  ? 45.076  -55.054 -13.112 1.00 0.00 ? 42  GLY B C   1 
ATOM   1778  O O   . GLY B  2  43  ? 45.628  -56.012 -13.646 1.00 0.00 ? 42  GLY B O   1 
ATOM   1779  N N   . VAL B  2  44  ? 43.818  -55.107 -12.705 1.00 0.00 ? 43  VAL B N   1 
ATOM   1780  C CA  . VAL B  2  44  ? 43.057  -56.329 -12.894 1.00 0.00 ? 43  VAL B CA  1 
ATOM   1781  C C   . VAL B  2  44  ? 42.764  -56.567 -14.376 1.00 0.00 ? 43  VAL B C   1 
ATOM   1782  O O   . VAL B  2  44  ? 42.753  -55.646 -15.192 1.00 0.00 ? 43  VAL B O   1 
ATOM   1783  C CB  . VAL B  2  44  ? 41.770  -56.345 -12.030 1.00 0.00 ? 43  VAL B CB  1 
ATOM   1784  C CG1 . VAL B  2  44  ? 40.785  -57.409 -12.505 1.00 0.00 ? 43  VAL B CG1 1 
ATOM   1785  C CG2 . VAL B  2  44  ? 42.127  -56.580 -10.569 1.00 0.00 ? 43  VAL B CG2 1 
ATOM   1786  N N   . VAL B  2  45  ? 42.545  -57.832 -14.695 1.00 0.00 ? 44  VAL B N   1 
ATOM   1787  C CA  . VAL B  2  45  ? 42.076  -58.262 -16.001 1.00 0.00 ? 44  VAL B CA  1 
ATOM   1788  C C   . VAL B  2  45  ? 40.827  -59.067 -15.769 1.00 0.00 ? 44  VAL B C   1 
ATOM   1789  O O   . VAL B  2  45  ? 40.785  -59.809 -14.795 1.00 0.00 ? 44  VAL B O   1 
ATOM   1790  C CB  . VAL B  2  45  ? 43.059  -59.110 -16.787 1.00 0.00 ? 44  VAL B CB  1 
ATOM   1791  C CG1 . VAL B  2  45  ? 43.324  -60.480 -16.140 1.00 0.00 ? 44  VAL B CG1 1 
ATOM   1792  C CG2 . VAL B  2  45  ? 42.587  -59.231 -18.251 1.00 0.00 ? 44  VAL B CG2 1 
ATOM   1793  N N   . LEU B  2  46  ? 39.813  -58.992 -16.679 1.00 0.00 ? 45  LEU B N   1 
ATOM   1794  C CA  . LEU B  2  46  ? 38.649  -59.840 -16.674 1.00 0.00 ? 45  LEU B CA  1 
ATOM   1795  C C   . LEU B  2  46  ? 38.537  -60.327 -18.089 1.00 0.00 ? 45  LEU B C   1 
ATOM   1796  O O   . LEU B  2  46  ? 38.929  -59.647 -19.022 1.00 0.00 ? 45  LEU B O   1 
ATOM   1797  C CB  . LEU B  2  46  ? 37.321  -59.137 -16.386 1.00 0.00 ? 45  LEU B CB  1 
ATOM   1798  C CG  . LEU B  2  46  ? 37.186  -58.420 -15.027 1.00 0.00 ? 45  LEU B CG  1 
ATOM   1799  C CD1 . LEU B  2  46  ? 35.762  -57.845 -14.879 1.00 0.00 ? 45  LEU B CD1 1 
ATOM   1800  C CD2 . LEU B  2  46  ? 37.514  -59.294 -13.805 1.00 0.00 ? 45  LEU B CD2 1 
ATOM   1801  N N   . ALA B  2  47  ? 38.090  -61.570 -18.295 1.00 0.00 ? 46  ALA B N   1 
ATOM   1802  C CA  . ALA B  2  47  ? 38.035  -62.155 -19.611 1.00 0.00 ? 46  ALA B CA  1 
ATOM   1803  C C   . ALA B  2  47  ? 36.965  -63.189 -19.627 1.00 0.00 ? 46  ALA B C   1 
ATOM   1804  O O   . ALA B  2  47  ? 36.584  -63.677 -18.569 1.00 0.00 ? 46  ALA B O   1 
ATOM   1805  C CB  . ALA B  2  47  ? 39.366  -62.790 -20.030 1.00 0.00 ? 46  ALA B CB  1 
ATOM   1806  N N   . THR B  2  48  ? 36.404  -63.528 -20.804 1.00 0.00 ? 47  THR B N   1 
ATOM   1807  C CA  . THR B  2  48  ? 35.325  -64.480 -20.833 1.00 0.00 ? 47  THR B CA  1 
ATOM   1808  C C   . THR B  2  48  ? 35.301  -65.153 -22.165 1.00 0.00 ? 47  THR B C   1 
ATOM   1809  O O   . THR B  2  48  ? 35.643  -64.552 -23.176 1.00 0.00 ? 47  THR B O   1 
ATOM   1810  C CB  . THR B  2  48  ? 33.973  -63.824 -20.584 1.00 0.00 ? 47  THR B CB  1 
ATOM   1811  O OG1 . THR B  2  48  ? 32.901  -64.759 -20.555 1.00 0.00 ? 47  THR B OG1 1 
ATOM   1812  C CG2 . THR B  2  48  ? 33.677  -62.742 -21.638 1.00 0.00 ? 47  THR B CG2 1 
ATOM   1813  N N   . GLU B  2  49  ? 34.821  -66.426 -22.185 1.00 0.00 ? 48  GLU B N   1 
ATOM   1814  C CA  . GLU B  2  49  ? 34.562  -67.196 -23.375 1.00 0.00 ? 48  GLU B CA  1 
ATOM   1815  C C   . GLU B  2  49  ? 33.272  -66.662 -23.891 1.00 0.00 ? 48  GLU B C   1 
ATOM   1816  O O   . GLU B  2  49  ? 32.382  -66.376 -23.103 1.00 0.00 ? 48  GLU B O   1 
ATOM   1817  C CB  . GLU B  2  49  ? 34.423  -68.708 -23.074 1.00 0.00 ? 48  GLU B CB  1 
ATOM   1818  C CG  . GLU B  2  49  ? 33.785  -69.602 -24.174 1.00 0.00 ? 48  GLU B CG  1 
ATOM   1819  C CD  . GLU B  2  49  ? 33.876  -71.110 -23.851 1.00 0.00 ? 48  GLU B CD  1 
ATOM   1820  O OE1 . GLU B  2  49  ? 34.538  -71.474 -22.846 1.00 0.00 ? 48  GLU B OE1 1 
ATOM   1821  O OE2 . GLU B  2  49  ? 33.289  -71.916 -24.621 1.00 0.00 ? 48  GLU B OE2 1 
ATOM   1822  N N   . LYS B  2  50  ? 33.260  -66.460 -25.206 1.00 0.00 ? 49  LYS B N   1 
ATOM   1823  C CA  . LYS B  2  50  ? 32.100  -66.225 -26.044 1.00 0.00 ? 49  LYS B CA  1 
ATOM   1824  C C   . LYS B  2  50  ? 32.420  -67.023 -27.305 1.00 0.00 ? 49  LYS B C   1 
ATOM   1825  O O   . LYS B  2  50  ? 33.590  -67.276 -27.592 1.00 0.00 ? 49  LYS B O   1 
ATOM   1826  C CB  . LYS B  2  50  ? 31.954  -64.741 -26.369 1.00 0.00 ? 49  LYS B CB  1 
ATOM   1827  C CG  . LYS B  2  50  ? 30.717  -64.402 -27.186 1.00 0.00 ? 49  LYS B CG  1 
ATOM   1828  C CD  . LYS B  2  50  ? 30.610  -62.906 -27.431 1.00 0.00 ? 49  LYS B CD  1 
ATOM   1829  C CE  . LYS B  2  50  ? 29.387  -62.571 -28.268 1.00 0.00 ? 49  LYS B CE  1 
ATOM   1830  N NZ  . LYS B  2  50  ? 29.269  -61.107 -28.516 1.00 0.00 ? 49  LYS B NZ  1 
ATOM   1831  N N   . LYS B  2  51  ? 31.403  -67.437 -28.051 1.00 0.00 ? 50  LYS B N   1 
ATOM   1832  C CA  . LYS B  2  51  ? 31.618  -68.354 -29.168 1.00 0.00 ? 50  LYS B CA  1 
ATOM   1833  C C   . LYS B  2  51  ? 30.920  -67.924 -30.450 1.00 0.00 ? 50  LYS B C   1 
ATOM   1834  O O   . LYS B  2  51  ? 29.877  -67.276 -30.408 1.00 0.00 ? 50  LYS B O   1 
ATOM   1835  C CB  . LYS B  2  51  ? 31.167  -69.767 -28.784 1.00 0.00 ? 50  LYS B CB  1 
ATOM   1836  C CG  . LYS B  2  51  ? 32.187  -70.549 -27.974 1.00 0.00 ? 50  LYS B CG  1 
ATOM   1837  C CD  . LYS B  2  51  ? 33.383  -70.947 -28.825 1.00 0.00 ? 50  LYS B CD  1 
ATOM   1838  C CE  . LYS B  2  51  ? 32.952  -71.517 -30.165 1.00 0.00 ? 50  LYS B CE  1 
ATOM   1839  N NZ  . LYS B  2  51  ? 34.098  -72.120 -30.897 1.00 0.00 ? 50  LYS B NZ  1 
ATOM   1840  N N   . GLN B  2  52  ? 31.502  -68.296 -31.588 1.00 0.00 ? 51  GLN B N   1 
ATOM   1841  C CA  . GLN B  2  52  ? 30.903  -68.014 -32.890 1.00 0.00 ? 51  GLN B CA  1 
ATOM   1842  C C   . GLN B  2  52  ? 29.540  -68.686 -33.002 1.00 0.00 ? 51  GLN B C   1 
ATOM   1843  O O   . GLN B  2  52  ? 28.570  -68.083 -33.452 1.00 0.00 ? 51  GLN B O   1 
ATOM   1844  C CB  . GLN B  2  52  ? 31.816  -68.488 -34.023 1.00 0.00 ? 51  GLN B CB  1 
ATOM   1845  C CG  . GLN B  2  52  ? 31.324  -68.124 -35.419 1.00 0.00 ? 51  GLN B CG  1 
ATOM   1846  C CD  . GLN B  2  52  ? 30.579  -66.807 -35.455 1.00 0.00 ? 51  GLN B CD  1 
ATOM   1847  O OE1 . GLN B  2  52  ? 31.120  -65.780 -35.865 1.00 0.00 ? 51  GLN B OE1 1 
ATOM   1848  N NE2 . GLN B  2  52  ? 29.330  -66.829 -35.012 1.00 0.00 ? 51  GLN B NE2 1 
ATOM   1849  N N   . LYS B  2  53  ? 29.489  -69.944 -32.588 1.00 0.00 ? 52  LYS B N   1 
ATOM   1850  C CA  . LYS B  2  53  ? 28.238  -70.677 -32.443 1.00 0.00 ? 52  LYS B CA  1 
ATOM   1851  C C   . LYS B  2  53  ? 27.579  -71.038 -33.776 1.00 0.00 ? 52  LYS B C   1 
ATOM   1852  O O   . LYS B  2  53  ? 27.396  -72.213 -34.092 1.00 0.00 ? 52  LYS B O   1 
ATOM   1853  C CB  . LYS B  2  53  ? 27.265  -69.864 -31.585 1.00 0.00 ? 52  LYS B CB  1 
ATOM   1854  C CG  . LYS B  2  53  ? 27.693  -69.708 -30.137 1.00 0.00 ? 52  LYS B CG  1 
ATOM   1855  C CD  . LYS B  2  53  ? 26.693  -68.871 -29.355 1.00 0.00 ? 52  LYS B CD  1 
ATOM   1856  C CE  . LYS B  2  53  ? 27.099  -68.728 -27.896 1.00 0.00 ? 52  LYS B CE  1 
ATOM   1857  N NZ  . LYS B  2  53  ? 26.140  -67.890 -27.125 1.00 0.00 ? 52  LYS B NZ  1 
ATOM   1858  N N   . SER B  2  54  ? 27.212  -70.033 -34.561 1.00 0.00 ? 53  SER B N   1 
ATOM   1859  C CA  . SER B  2  54  ? 26.606  -70.289 -35.860 1.00 0.00 ? 53  SER B CA  1 
ATOM   1860  C C   . SER B  2  54  ? 27.518  -69.789 -36.972 1.00 0.00 ? 53  SER B C   1 
ATOM   1861  O O   . SER B  2  54  ? 27.350  -70.148 -38.136 1.00 0.00 ? 53  SER B O   1 
ATOM   1862  C CB  . SER B  2  54  ? 25.227  -69.632 -35.955 1.00 0.00 ? 53  SER B CB  1 
ATOM   1863  O OG  . SER B  2  54  ? 25.237  -68.325 -35.407 1.00 0.00 ? 53  SER B OG  1 
ATOM   1864  N N   . ILE B  2  55  ? 28.478  -68.951 -36.599 1.00 0.00 ? 54  ILE B N   1 
ATOM   1865  C CA  . ILE B  2  55  ? 29.431  -68.380 -37.543 1.00 0.00 ? 54  ILE B CA  1 
ATOM   1866  C C   . ILE B  2  55  ? 28.802  -67.192 -38.260 1.00 0.00 ? 54  ILE B C   1 
ATOM   1867  O O   . ILE B  2  55  ? 29.407  -66.592 -39.150 1.00 0.00 ? 54  ILE B O   1 
ATOM   1868  C CB  . ILE B  2  55  ? 29.919  -69.423 -38.565 1.00 0.00 ? 54  ILE B CB  1 
ATOM   1869  C CG1 . ILE B  2  55  ? 30.318  -70.718 -37.844 1.00 0.00 ? 54  ILE B CG1 1 
ATOM   1870  C CG2 . ILE B  2  55  ? 31.067  -68.859 -39.391 1.00 0.00 ? 54  ILE B CG2 1 
ATOM   1871  C CD1 . ILE B  2  55  ? 31.294  -71.593 -38.602 1.00 0.00 ? 54  ILE B CD1 1 
ATOM   1872  N N   . LEU B  2  56  ? 27.573  -66.867 -37.869 1.00 0.00 ? 55  LEU B N   1 
ATOM   1873  C CA  . LEU B  2  56  ? 26.872  -65.701 -38.388 1.00 0.00 ? 55  LEU B CA  1 
ATOM   1874  C C   . LEU B  2  56  ? 26.713  -64.599 -37.341 1.00 0.00 ? 55  LEU B C   1 
ATOM   1875  O O   . LEU B  2  56  ? 26.028  -63.607 -37.583 1.00 0.00 ? 55  LEU B O   1 
ATOM   1876  C CB  . LEU B  2  56  ? 25.511  -66.110 -38.946 1.00 0.00 ? 55  LEU B CB  1 
ATOM   1877  C CG  . LEU B  2  56  ? 25.546  -66.854 -40.281 1.00 0.00 ? 55  LEU B CG  1 
ATOM   1878  C CD1 . LEU B  2  56  ? 25.238  -68.329 -40.087 1.00 0.00 ? 55  LEU B CD1 1 
ATOM   1879  C CD2 . LEU B  2  56  ? 24.581  -66.228 -41.275 1.00 0.00 ? 55  LEU B CD2 1 
ATOM   1880  N N   . TYR B  2  57  ? 27.342  -64.777 -36.184 1.00 0.00 ? 56  TYR B N   1 
ATOM   1881  C CA  . TYR B  2  57  ? 27.184  -63.863 -35.051 1.00 0.00 ? 56  TYR B CA  1 
ATOM   1882  C C   . TYR B  2  57  ? 27.949  -62.549 -35.202 1.00 0.00 ? 56  TYR B C   1 
ATOM   1883  O O   . TYR B  2  57  ? 28.578  -62.299 -36.231 1.00 0.00 ? 56  TYR B O   1 
ATOM   1884  C CB  . TYR B  2  57  ? 27.662  -64.549 -33.773 1.00 0.00 ? 56  TYR B CB  1 
ATOM   1885  C CG  . TYR B  2  57  ? 26.612  -65.353 -33.054 1.00 0.00 ? 56  TYR B CG  1 
ATOM   1886  C CD1 . TYR B  2  57  ? 25.832  -66.277 -33.730 1.00 0.00 ? 56  TYR B CD1 1 
ATOM   1887  C CD2 . TYR B  2  57  ? 26.411  -65.196 -31.693 1.00 0.00 ? 56  TYR B CD2 1 
ATOM   1888  C CE1 . TYR B  2  57  ? 24.871  -67.019 -33.068 1.00 0.00 ? 56  TYR B CE1 1 
ATOM   1889  C CE2 . TYR B  2  57  ? 25.455  -65.931 -31.023 1.00 0.00 ? 56  TYR B CE2 1 
ATOM   1890  C CZ  . TYR B  2  57  ? 24.688  -66.842 -31.713 1.00 0.00 ? 56  TYR B CZ  1 
ATOM   1891  O OH  . TYR B  2  57  ? 23.735  -67.572 -31.042 1.00 0.00 ? 56  TYR B OH  1 
ATOM   1892  N N   . ASP B  2  58  ? 27.897  -61.717 -34.160 1.00 0.00 ? 57  ASP B N   1 
ATOM   1893  C CA  . ASP B  2  58  ? 28.795  -60.574 -34.037 1.00 0.00 ? 57  ASP B CA  1 
ATOM   1894  C C   . ASP B  2  58  ? 29.466  -60.616 -32.666 1.00 0.00 ? 57  ASP B C   1 
ATOM   1895  O O   . ASP B  2  58  ? 28.934  -61.216 -31.731 1.00 0.00 ? 57  ASP B O   1 
ATOM   1896  C CB  . ASP B  2  58  ? 28.040  -59.262 -34.229 1.00 0.00 ? 57  ASP B CB  1 
ATOM   1897  C CG  . ASP B  2  58  ? 28.074  -58.783 -35.659 1.00 0.00 ? 57  ASP B CG  1 
ATOM   1898  O OD1 . ASP B  2  58  ? 28.403  -59.594 -36.552 1.00 0.00 ? 57  ASP B OD1 1 
ATOM   1899  O OD2 . ASP B  2  58  ? 27.771  -57.595 -35.890 1.00 0.00 ? 57  ASP B OD2 1 
ATOM   1900  N N   . GLU B  2  59  ? 30.632  -59.987 -32.536 1.00 0.00 ? 58  GLU B N   1 
ATOM   1901  C CA  . GLU B  2  59  ? 31.383  -60.134 -31.329 1.00 0.00 ? 58  GLU B CA  1 
ATOM   1902  C C   . GLU B  2  59  ? 31.508  -58.828 -30.592 1.00 0.00 ? 58  GLU B C   1 
ATOM   1903  O O   . GLU B  2  59  ? 31.923  -58.822 -29.436 1.00 0.00 ? 58  GLU B O   1 
ATOM   1904  C CB  . GLU B  2  59  ? 32.783  -60.685 -31.663 1.00 0.00 ? 58  GLU B CB  1 
ATOM   1905  C CG  . GLU B  2  59  ? 32.718  -61.996 -32.469 1.00 0.00 ? 58  GLU B CG  1 
ATOM   1906  C CD  . GLU B  2  59  ? 31.984  -63.057 -31.659 1.00 0.00 ? 58  GLU B CD  1 
ATOM   1907  O OE1 . GLU B  2  59  ? 32.588  -63.585 -30.694 1.00 0.00 ? 58  GLU B OE1 1 
ATOM   1908  O OE2 . GLU B  2  59  ? 30.807  -63.346 -31.986 1.00 0.00 ? 58  GLU B OE2 1 
ATOM   1909  N N   . ARG B  2  60  ? 31.104  -57.700 -31.221 1.00 0.00 ? 59  ARG B N   1 
ATOM   1910  C CA  . ARG B  2  60  ? 31.231  -56.394 -30.631 1.00 0.00 ? 59  ARG B CA  1 
ATOM   1911  C C   . ARG B  2  60  ? 29.865  -55.899 -30.277 1.00 0.00 ? 59  ARG B C   1 
ATOM   1912  O O   . ARG B  2  60  ? 29.678  -54.717 -30.004 1.00 0.00 ? 59  ARG B O   1 
ATOM   1913  C CB  . ARG B  2  60  ? 31.898  -55.403 -31.607 1.00 0.00 ? 59  ARG B CB  1 
ATOM   1914  C CG  . ARG B  2  60  ? 32.593  -54.204 -30.935 1.00 0.00 ? 59  ARG B CG  1 
ATOM   1915  C CD  . ARG B  2  60  ? 33.247  -53.214 -31.918 1.00 0.00 ? 59  ARG B CD  1 
ATOM   1916  N NE  . ARG B  2  60  ? 32.189  -52.349 -32.555 1.00 0.00 ? 59  ARG B NE  1 
ATOM   1917  C CZ  . ARG B  2  60  ? 31.803  -52.434 -33.865 1.00 0.00 ? 59  ARG B CZ  1 
ATOM   1918  N NH1 . ARG B  2  60  ? 32.338  -53.364 -34.705 1.00 0.00 ? 59  ARG B NH1 1 
ATOM   1919  N NH2 . ARG B  2  60  ? 30.853  -51.573 -34.333 1.00 0.00 ? 59  ARG B NH2 1 
ATOM   1920  N N   . SER B  2  61  ? 28.851  -56.789 -30.303 1.00 0.00 ? 60  SER B N   1 
ATOM   1921  C CA  . SER B  2  61  ? 27.480  -56.374 -30.197 1.00 0.00 ? 60  SER B CA  1 
ATOM   1922  C C   . SER B  2  61  ? 27.099  -56.228 -28.769 1.00 0.00 ? 60  SER B C   1 
ATOM   1923  O O   . SER B  2  61  ? 26.602  -55.179 -28.370 1.00 0.00 ? 60  SER B O   1 
ATOM   1924  C CB  . SER B  2  61  ? 26.513  -57.377 -30.876 1.00 0.00 ? 60  SER B CB  1 
ATOM   1925  O OG  . SER B  2  61  ? 26.779  -58.724 -30.508 1.00 0.00 ? 60  SER B OG  1 
ATOM   1926  N N   . VAL B  2  62  ? 27.321  -57.297 -27.977 1.00 0.00 ? 61  VAL B N   1 
ATOM   1927  C CA  . VAL B  2  62  ? 26.988  -57.359 -26.584 1.00 0.00 ? 61  VAL B CA  1 
ATOM   1928  C C   . VAL B  2  62  ? 28.154  -58.020 -25.945 1.00 0.00 ? 61  VAL B C   1 
ATOM   1929  O O   . VAL B  2  62  ? 28.270  -59.238 -25.867 1.00 0.00 ? 61  VAL B O   1 
ATOM   1930  C CB  . VAL B  2  62  ? 25.709  -58.131 -26.275 1.00 0.00 ? 61  VAL B CB  1 
ATOM   1931  C CG1 . VAL B  2  62  ? 25.585  -58.199 -24.744 1.00 0.00 ? 61  VAL B CG1 1 
ATOM   1932  C CG2 . VAL B  2  62  ? 24.470  -57.472 -26.924 1.00 0.00 ? 61  VAL B CG2 1 
ATOM   1933  N N   . HIS B  2  63  ? 29.067  -57.184 -25.431 1.00 0.00 ? 62  HIS B N   1 
ATOM   1934  C CA  . HIS B  2  63  ? 30.183  -57.637 -24.678 1.00 0.00 ? 62  HIS B CA  1 
ATOM   1935  C C   . HIS B  2  63  ? 29.644  -57.943 -23.351 1.00 0.00 ? 62  HIS B C   1 
ATOM   1936  O O   . HIS B  2  63  ? 28.727  -57.267 -22.898 1.00 0.00 ? 62  HIS B O   1 
ATOM   1937  C CB  . HIS B  2  63  ? 31.267  -56.569 -24.475 1.00 0.00 ? 62  HIS B CB  1 
ATOM   1938  C CG  . HIS B  2  63  ? 31.866  -56.106 -25.756 1.00 0.00 ? 62  HIS B CG  1 
ATOM   1939  N ND1 . HIS B  2  63  ? 31.371  -55.071 -26.509 1.00 0.00 ? 62  HIS B ND1 1 
ATOM   1940  C CD2 . HIS B  2  63  ? 32.995  -56.531 -26.377 1.00 0.00 ? 62  HIS B CD2 1 
ATOM   1941  C CE1 . HIS B  2  63  ? 32.233  -54.913 -27.540 1.00 0.00 ? 62  HIS B CE1 1 
ATOM   1942  N NE2 . HIS B  2  63  ? 33.232  -55.775 -27.502 1.00 0.00 ? 62  HIS B NE2 1 
ATOM   1943  N N   . LYS B  2  64  ? 30.200  -58.984 -22.700 1.00 0.00 ? 63  LYS B N   1 
ATOM   1944  C CA  . LYS B  2  64  ? 29.942  -59.264 -21.315 1.00 0.00 ? 63  LYS B CA  1 
ATOM   1945  C C   . LYS B  2  64  ? 30.697  -58.304 -20.481 1.00 0.00 ? 63  LYS B C   1 
ATOM   1946  O O   . LYS B  2  64  ? 30.433  -58.194 -19.299 1.00 0.00 ? 63  LYS B O   1 
ATOM   1947  C CB  . LYS B  2  64  ? 30.363  -60.680 -20.911 1.00 0.00 ? 63  LYS B CB  1 
ATOM   1948  C CG  . LYS B  2  64  ? 29.898  -61.752 -21.908 1.00 0.00 ? 63  LYS B CG  1 
ATOM   1949  C CD  . LYS B  2  64  ? 29.797  -63.148 -21.276 1.00 0.00 ? 63  LYS B CD  1 
ATOM   1950  C CE  . LYS B  2  64  ? 29.221  -64.208 -22.231 1.00 0.00 ? 63  LYS B CE  1 
ATOM   1951  N NZ  . LYS B  2  64  ? 28.807  -65.441 -21.515 1.00 0.00 ? 63  LYS B NZ  1 
ATOM   1952  N N   . VAL B  2  65  ? 31.688  -57.629 -21.095 1.00 0.00 ? 64  VAL B N   1 
ATOM   1953  C CA  . VAL B  2  65  ? 32.584  -56.687 -20.511 1.00 0.00 ? 64  VAL B CA  1 
ATOM   1954  C C   . VAL B  2  65  ? 32.065  -55.328 -20.810 1.00 0.00 ? 64  VAL B C   1 
ATOM   1955  O O   . VAL B  2  65  ? 32.371  -54.751 -21.843 1.00 0.00 ? 64  VAL B O   1 
ATOM   1956  C CB  . VAL B  2  65  ? 33.992  -56.806 -21.061 1.00 0.00 ? 64  VAL B CB  1 
ATOM   1957  C CG1 . VAL B  2  65  ? 34.924  -56.191 -20.002 1.00 0.00 ? 64  VAL B CG1 1 
ATOM   1958  C CG2 . VAL B  2  65  ? 34.340  -58.276 -21.402 1.00 0.00 ? 64  VAL B CG2 1 
ATOM   1959  N N   . GLU B  2  66  ? 31.223  -54.776 -19.932 1.00 0.00 ? 65  GLU B N   1 
ATOM   1960  C CA  . GLU B  2  66  ? 30.651  -53.486 -20.171 1.00 0.00 ? 65  GLU B CA  1 
ATOM   1961  C C   . GLU B  2  66  ? 31.186  -52.530 -19.140 1.00 0.00 ? 65  GLU B C   1 
ATOM   1962  O O   . GLU B  2  66  ? 30.977  -52.797 -17.960 1.00 0.00 ? 65  GLU B O   1 
ATOM   1963  C CB  . GLU B  2  66  ? 29.115  -53.484 -20.129 1.00 0.00 ? 65  GLU B CB  1 
ATOM   1964  C CG  . GLU B  2  66  ? 28.541  -54.361 -21.255 1.00 0.00 ? 65  GLU B CG  1 
ATOM   1965  C CD  . GLU B  2  66  ? 27.033  -54.166 -21.408 1.00 0.00 ? 65  GLU B CD  1 
ATOM   1966  O OE1 . GLU B  2  66  ? 26.295  -54.458 -20.433 1.00 0.00 ? 65  GLU B OE1 1 
ATOM   1967  O OE2 . GLU B  2  66  ? 26.595  -53.734 -22.505 1.00 0.00 ? 65  GLU B OE2 1 
ATOM   1968  N N   . PRO B  2  67  ? 31.844  -51.408 -19.469 1.00 0.00 ? 66  PRO B N   1 
ATOM   1969  C CA  . PRO B  2  67  ? 32.283  -50.410 -18.511 1.00 0.00 ? 66  PRO B CA  1 
ATOM   1970  C C   . PRO B  2  67  ? 31.082  -49.797 -17.854 1.00 0.00 ? 66  PRO B C   1 
ATOM   1971  O O   . PRO B  2  67  ? 30.037  -49.745 -18.489 1.00 0.00 ? 66  PRO B O   1 
ATOM   1972  C CB  . PRO B  2  67  ? 33.043  -49.385 -19.348 1.00 0.00 ? 66  PRO B CB  1 
ATOM   1973  C CG  . PRO B  2  67  ? 32.403  -49.474 -20.731 1.00 0.00 ? 66  PRO B CG  1 
ATOM   1974  C CD  . PRO B  2  67  ? 32.049  -50.950 -20.840 1.00 0.00 ? 66  PRO B CD  1 
ATOM   1975  N N   . ILE B  2  68  ? 31.195  -49.436 -16.566 1.00 0.00 ? 67  ILE B N   1 
ATOM   1976  C CA  . ILE B  2  68  ? 30.110  -49.052 -15.698 1.00 0.00 ? 67  ILE B CA  1 
ATOM   1977  C C   . ILE B  2  68  ? 30.276  -47.645 -15.274 1.00 0.00 ? 67  ILE B C   1 
ATOM   1978  O O   . ILE B  2  68  ? 29.302  -46.961 -14.978 1.00 0.00 ? 67  ILE B O   1 
ATOM   1979  C CB  . ILE B  2  68  ? 30.064  -49.934 -14.487 1.00 0.00 ? 67  ILE B CB  1 
ATOM   1980  C CG1 . ILE B  2  68  ? 29.904  -51.382 -14.936 1.00 0.00 ? 67  ILE B CG1 1 
ATOM   1981  C CG2 . ILE B  2  68  ? 28.904  -49.564 -13.562 1.00 0.00 ? 67  ILE B CG2 1 
ATOM   1982  C CD1 . ILE B  2  68  ? 28.658  -51.655 -15.786 1.00 0.00 ? 67  ILE B CD1 1 
ATOM   1983  N N   . THR B  2  69  ? 31.553  -47.302 -15.117 1.00 0.00 ? 68  THR B N   1 
ATOM   1984  C CA  . THR B  2  69  ? 32.047  -46.060 -14.553 1.00 0.00 ? 68  THR B CA  1 
ATOM   1985  C C   . THR B  2  69  ? 33.487  -45.891 -15.041 1.00 0.00 ? 68  THR B C   1 
ATOM   1986  O O   . THR B  2  69  ? 34.079  -46.825 -15.583 1.00 0.00 ? 68  THR B O   1 
ATOM   1987  C CB  . THR B  2  69  ? 32.025  -46.082 -13.015 1.00 0.00 ? 68  THR B CB  1 
ATOM   1988  O OG1 . THR B  2  69  ? 32.331  -44.776 -12.511 1.00 0.00 ? 68  THR B OG1 1 
ATOM   1989  C CG2 . THR B  2  69  ? 33.044  -47.078 -12.482 1.00 0.00 ? 68  THR B CG2 1 
ATOM   1990  N N   . LYS B  2  70  ? 34.114  -44.774 -14.714 1.00 0.00 ? 69  LYS B N   1 
ATOM   1991  C CA  . LYS B  2  70  ? 35.321  -44.374 -15.412 1.00 0.00 ? 69  LYS B CA  1 
ATOM   1992  C C   . LYS B  2  70  ? 36.361  -45.485 -15.332 1.00 0.00 ? 69  LYS B C   1 
ATOM   1993  O O   . LYS B  2  70  ? 37.092  -45.720 -16.295 1.00 0.00 ? 69  LYS B O   1 
ATOM   1994  C CB  . LYS B  2  70  ? 35.883  -43.081 -14.818 1.00 0.00 ? 69  LYS B CB  1 
ATOM   1995  C CG  . LYS B  2  70  ? 34.948  -41.888 -14.934 1.00 0.00 ? 69  LYS B CG  1 
ATOM   1996  C CD  . LYS B  2  70  ? 35.489  -40.686 -14.179 1.00 0.00 ? 69  LYS B CD  1 
ATOM   1997  C CE  . LYS B  2  70  ? 34.749  -39.416 -14.560 1.00 0.00 ? 69  LYS B CE  1 
ATOM   1998  N NZ  . LYS B  2  70  ? 35.266  -38.229 -13.824 1.00 0.00 ? 69  LYS B NZ  1 
ATOM   1999  N N   . HIS B  2  71  ? 36.413  -46.191 -14.208 1.00 0.00 ? 70  HIS B N   1 
ATOM   2000  C CA  . HIS B  2  71  ? 37.377  -47.277 -14.063 1.00 0.00 ? 70  HIS B CA  1 
ATOM   2001  C C   . HIS B  2  71  ? 36.819  -48.559 -13.450 1.00 0.00 ? 70  HIS B C   1 
ATOM   2002  O O   . HIS B  2  71  ? 37.573  -49.363 -12.902 1.00 0.00 ? 70  HIS B O   1 
ATOM   2003  C CB  . HIS B  2  71  ? 38.611  -46.818 -13.286 1.00 0.00 ? 70  HIS B CB  1 
ATOM   2004  C CG  . HIS B  2  71  ? 39.898  -47.353 -13.831 1.00 0.00 ? 70  HIS B CG  1 
ATOM   2005  N ND1 . HIS B  2  71  ? 41.055  -47.416 -13.086 1.00 0.00 ? 70  HIS B ND1 1 
ATOM   2006  C CD2 . HIS B  2  71  ? 40.208  -47.855 -15.050 1.00 0.00 ? 70  HIS B CD2 1 
ATOM   2007  C CE1 . HIS B  2  71  ? 42.023  -47.933 -13.822 1.00 0.00 ? 70  HIS B CE1 1 
ATOM   2008  N NE2 . HIS B  2  71  ? 41.535  -48.207 -15.018 1.00 0.00 ? 70  HIS B NE2 1 
ATOM   2009  N N   . ILE B  2  72  ? 35.510  -48.759 -13.550 1.00 0.00 ? 71  ILE B N   1 
ATOM   2010  C CA  . ILE B  2  72  ? 34.933  -50.048 -13.199 1.00 0.00 ? 71  ILE B CA  1 
ATOM   2011  C C   . ILE B  2  72  ? 34.370  -50.742 -14.426 1.00 0.00 ? 71  ILE B C   1 
ATOM   2012  O O   . ILE B  2  72  ? 34.070  -50.110 -15.433 1.00 0.00 ? 71  ILE B O   1 
ATOM   2013  C CB  . ILE B  2  72  ? 33.838  -49.941 -12.127 1.00 0.00 ? 71  ILE B CB  1 
ATOM   2014  C CG1 . ILE B  2  72  ? 34.410  -49.353 -10.836 1.00 0.00 ? 71  ILE B CG1 1 
ATOM   2015  C CG2 . ILE B  2  72  ? 33.239  -51.311 -11.866 1.00 0.00 ? 71  ILE B CG2 1 
ATOM   2016  C CD1 . ILE B  2  72  ? 33.573  -49.610 -9.600  1.00 0.00 ? 71  ILE B CD1 1 
ATOM   2017  N N   . GLY B  2  73  ? 34.230  -52.054 -14.325 1.00 0.00 ? 72  GLY B N   1 
ATOM   2018  C CA  . GLY B  2  73  ? 33.685  -52.856 -15.397 1.00 0.00 ? 72  GLY B CA  1 
ATOM   2019  C C   . GLY B  2  73  ? 33.030  -54.038 -14.743 1.00 0.00 ? 72  GLY B C   1 
ATOM   2020  O O   . GLY B  2  73  ? 33.122  -54.211 -13.529 1.00 0.00 ? 72  GLY B O   1 
ATOM   2021  N N   . LEU B  2  74  ? 32.353  -54.882 -15.544 1.00 0.00 ? 73  LEU B N   1 
ATOM   2022  C CA  . LEU B  2  74  ? 31.631  -56.038 -15.079 1.00 0.00 ? 73  LEU B CA  1 
ATOM   2023  C C   . LEU B  2  74  ? 31.970  -57.108 -16.042 1.00 0.00 ? 73  LEU B C   1 
ATOM   2024  O O   . LEU B  2  74  ? 32.235  -56.798 -17.189 1.00 0.00 ? 73  LEU B O   1 
ATOM   2025  C CB  . LEU B  2  74  ? 30.097  -55.954 -15.180 1.00 0.00 ? 73  LEU B CB  1 
ATOM   2026  C CG  . LEU B  2  74  ? 29.422  -54.972 -14.223 1.00 0.00 ? 73  LEU B CG  1 
ATOM   2027  C CD1 . LEU B  2  74  ? 27.937  -54.764 -14.560 1.00 0.00 ? 73  LEU B CD1 1 
ATOM   2028  C CD2 . LEU B  2  74  ? 29.558  -55.407 -12.772 1.00 0.00 ? 73  LEU B CD2 1 
ATOM   2029  N N   . VAL B  2  75  ? 31.916  -58.389 -15.637 1.00 0.00 ? 74  VAL B N   1 
ATOM   2030  C CA  . VAL B  2  75  ? 31.885  -59.499 -16.563 1.00 0.00 ? 74  VAL B CA  1 
ATOM   2031  C C   . VAL B  2  75  ? 30.898  -60.402 -15.934 1.00 0.00 ? 74  VAL B C   1 
ATOM   2032  O O   . VAL B  2  75  ? 30.996  -60.612 -14.739 1.00 0.00 ? 74  VAL B O   1 
ATOM   2033  C CB  . VAL B  2  75  ? 33.222  -60.203 -16.726 1.00 0.00 ? 74  VAL B CB  1 
ATOM   2034  C CG1 . VAL B  2  75  ? 33.082  -61.614 -17.303 1.00 0.00 ? 74  VAL B CG1 1 
ATOM   2035  C CG2 . VAL B  2  75  ? 34.065  -59.358 -17.695 1.00 0.00 ? 74  VAL B CG2 1 
ATOM   2036  N N   . TYR B  2  76  ? 29.958  -61.012 -16.689 1.00 0.00 ? 75  TYR B N   1 
ATOM   2037  C CA  . TYR B  2  76  ? 28.940  -61.840 -16.098 1.00 0.00 ? 75  TYR B CA  1 
ATOM   2038  C C   . TYR B  2  76  ? 29.130  -63.273 -16.498 1.00 0.00 ? 75  TYR B C   1 
ATOM   2039  O O   . TYR B  2  76  ? 29.689  -63.588 -17.546 1.00 0.00 ? 75  TYR B O   1 
ATOM   2040  C CB  . TYR B  2  76  ? 27.489  -61.420 -16.453 1.00 0.00 ? 75  TYR B CB  1 
ATOM   2041  C CG  . TYR B  2  76  ? 27.062  -61.712 -17.865 1.00 0.00 ? 75  TYR B CG  1 
ATOM   2042  C CD1 . TYR B  2  76  ? 27.398  -60.845 -18.902 1.00 0.00 ? 75  TYR B CD1 1 
ATOM   2043  C CD2 . TYR B  2  76  ? 26.345  -62.872 -18.173 1.00 0.00 ? 75  TYR B CD2 1 
ATOM   2044  C CE1 . TYR B  2  76  ? 26.994  -61.104 -20.213 1.00 0.00 ? 75  TYR B CE1 1 
ATOM   2045  C CE2 . TYR B  2  76  ? 26.003  -63.179 -19.490 1.00 0.00 ? 75  TYR B CE2 1 
ATOM   2046  C CZ  . TYR B  2  76  ? 26.310  -62.280 -20.516 1.00 0.00 ? 75  TYR B CZ  1 
ATOM   2047  O OH  . TYR B  2  76  ? 25.921  -62.513 -21.856 1.00 0.00 ? 75  TYR B OH  1 
ATOM   2048  N N   . SER B  2  77  ? 28.547  -64.169 -15.681 1.00 0.00 ? 76  SER B N   1 
ATOM   2049  C CA  . SER B  2  77  ? 28.277  -65.526 -16.018 1.00 0.00 ? 76  SER B CA  1 
ATOM   2050  C C   . SER B  2  77  ? 26.876  -65.704 -15.568 1.00 0.00 ? 76  SER B C   1 
ATOM   2051  O O   . SER B  2  77  ? 26.463  -65.114 -14.575 1.00 0.00 ? 76  SER B O   1 
ATOM   2052  C CB  . SER B  2  77  ? 29.153  -66.583 -15.339 1.00 0.00 ? 76  SER B CB  1 
ATOM   2053  O OG  . SER B  2  77  ? 29.064  -66.538 -13.921 1.00 0.00 ? 76  SER B OG  1 
ATOM   2054  N N   . GLY B  2  78  ? 26.120  -66.558 -16.262 1.00 0.00 ? 77  GLY B N   1 
ATOM   2055  C CA  . GLY B  2  78  ? 24.732  -66.729 -15.983 1.00 0.00 ? 77  GLY B CA  1 
ATOM   2056  C C   . GLY B  2  78  ? 24.051  -66.345 -17.223 1.00 0.00 ? 77  GLY B C   1 
ATOM   2057  O O   . GLY B  2  78  ? 24.639  -66.378 -18.301 1.00 0.00 ? 77  GLY B O   1 
ATOM   2058  N N   . MET B  2  79  ? 22.751  -66.028 -17.079 1.00 0.00 ? 78  MET B N   1 
ATOM   2059  C CA  . MET B  2  79  ? 21.880  -65.601 -18.134 1.00 0.00 ? 78  MET B CA  1 
ATOM   2060  C C   . MET B  2  79  ? 22.288  -64.283 -18.661 1.00 0.00 ? 78  MET B C   1 
ATOM   2061  O O   . MET B  2  79  ? 22.510  -63.354 -17.907 1.00 0.00 ? 78  MET B O   1 
ATOM   2062  C CB  . MET B  2  79  ? 20.418  -65.499 -17.670 1.00 0.00 ? 78  MET B CB  1 
ATOM   2063  C CG  . MET B  2  79  ? 19.964  -66.818 -17.033 1.00 0.00 ? 78  MET B CG  1 
ATOM   2064  S SD  . MET B  2  79  ? 18.193  -66.954 -16.732 1.00 0.00 ? 78  MET B SD  1 
ATOM   2065  C CE  . MET B  2  79  ? 18.007  -65.476 -15.703 1.00 0.00 ? 78  MET B CE  1 
ATOM   2066  N N   . GLY B  2  80  ? 22.365  -64.160 -19.990 1.00 0.00 ? 79  GLY B N   1 
ATOM   2067  C CA  . GLY B  2  80  ? 22.679  -62.918 -20.636 1.00 0.00 ? 79  GLY B CA  1 
ATOM   2068  C C   . GLY B  2  80  ? 21.565  -61.933 -20.577 1.00 0.00 ? 79  GLY B C   1 
ATOM   2069  O O   . GLY B  2  80  ? 21.882  -60.767 -20.393 1.00 0.00 ? 79  GLY B O   1 
ATOM   2070  N N   . PRO B  2  81  ? 20.282  -62.255 -20.692 1.00 0.00 ? 80  PRO B N   1 
ATOM   2071  C CA  . PRO B  2  81  ? 19.245  -61.243 -20.698 1.00 0.00 ? 80  PRO B CA  1 
ATOM   2072  C C   . PRO B  2  81  ? 19.154  -60.389 -19.485 1.00 0.00 ? 80  PRO B C   1 
ATOM   2073  O O   . PRO B  2  81  ? 18.865  -59.211 -19.638 1.00 0.00 ? 80  PRO B O   1 
ATOM   2074  C CB  . PRO B  2  81  ? 17.970  -62.059 -20.801 1.00 0.00 ? 80  PRO B CB  1 
ATOM   2075  C CG  . PRO B  2  81  ? 18.346  -63.233 -21.705 1.00 0.00 ? 80  PRO B CG  1 
ATOM   2076  C CD  . PRO B  2  81  ? 19.820  -63.463 -21.395 1.00 0.00 ? 80  PRO B CD  1 
ATOM   2077  N N   . ASP B  2  82  ? 19.427  -60.981 -18.311 1.00 0.00 ? 81  ASP B N   1 
ATOM   2078  C CA  . ASP B  2  82  ? 19.350  -60.379 -17.008 1.00 0.00 ? 81  ASP B CA  1 
ATOM   2079  C C   . ASP B  2  82  ? 20.429  -59.342 -16.745 1.00 0.00 ? 81  ASP B C   1 
ATOM   2080  O O   . ASP B  2  82  ? 20.261  -58.387 -15.988 1.00 0.00 ? 81  ASP B O   1 
ATOM   2081  C CB  . ASP B  2  82  ? 19.433  -61.554 -16.006 1.00 0.00 ? 81  ASP B CB  1 
ATOM   2082  C CG  . ASP B  2  82  ? 19.059  -61.175 -14.587 1.00 0.00 ? 81  ASP B CG  1 
ATOM   2083  O OD1 . ASP B  2  82  ? 17.943  -60.630 -14.397 1.00 0.00 ? 81  ASP B OD1 1 
ATOM   2084  O OD2 . ASP B  2  82  ? 19.873  -61.433 -13.671 1.00 0.00 ? 81  ASP B OD2 1 
ATOM   2085  N N   . TYR B  2  83  ? 21.596  -59.551 -17.382 1.00 0.00 ? 82  TYR B N   1 
ATOM   2086  C CA  . TYR B  2  83  ? 22.759  -58.719 -17.309 1.00 0.00 ? 82  TYR B CA  1 
ATOM   2087  C C   . TYR B  2  83  ? 22.523  -57.357 -17.880 1.00 0.00 ? 82  TYR B C   1 
ATOM   2088  O O   . TYR B  2  83  ? 23.029  -56.377 -17.343 1.00 0.00 ? 82  TYR B O   1 
ATOM   2089  C CB  . TYR B  2  83  ? 23.901  -59.403 -18.103 1.00 0.00 ? 82  TYR B CB  1 
ATOM   2090  C CG  . TYR B  2  83  ? 25.183  -58.620 -18.149 1.00 0.00 ? 82  TYR B CG  1 
ATOM   2091  C CD1 . TYR B  2  83  ? 25.859  -58.295 -16.961 1.00 0.00 ? 82  TYR B CD1 1 
ATOM   2092  C CD2 . TYR B  2  83  ? 25.692  -58.173 -19.384 1.00 0.00 ? 82  TYR B CD2 1 
ATOM   2093  C CE1 . TYR B  2  83  ? 27.021  -57.524 -16.998 1.00 0.00 ? 82  TYR B CE1 1 
ATOM   2094  C CE2 . TYR B  2  83  ? 26.852  -57.398 -19.422 1.00 0.00 ? 82  TYR B CE2 1 
ATOM   2095  C CZ  . TYR B  2  83  ? 27.489  -57.044 -18.227 1.00 0.00 ? 82  TYR B CZ  1 
ATOM   2096  O OH  . TYR B  2  83  ? 28.568  -56.148 -18.265 1.00 0.00 ? 82  TYR B OH  1 
ATOM   2097  N N   . ARG B  2  84  ? 21.732  -57.261 -18.966 1.00 0.00 ? 83  ARG B N   1 
ATOM   2098  C CA  . ARG B  2  84  ? 21.517  -56.053 -19.711 1.00 0.00 ? 83  ARG B CA  1 
ATOM   2099  C C   . ARG B  2  84  ? 20.835  -55.005 -18.901 1.00 0.00 ? 83  ARG B C   1 
ATOM   2100  O O   . ARG B  2  84  ? 21.009  -53.821 -19.155 1.00 0.00 ? 83  ARG B O   1 
ATOM   2101  C CB  . ARG B  2  84  ? 20.681  -56.310 -20.966 1.00 0.00 ? 83  ARG B CB  1 
ATOM   2102  C CG  . ARG B  2  84  ? 21.436  -57.111 -22.036 1.00 0.00 ? 83  ARG B CG  1 
ATOM   2103  C CD  . ARG B  2  84  ? 20.496  -57.759 -23.067 1.00 0.00 ? 83  ARG B CD  1 
ATOM   2104  N NE  . ARG B  2  84  ? 21.315  -58.313 -24.200 1.00 0.00 ? 83  ARG B NE  1 
ATOM   2105  C CZ  . ARG B  2  84  ? 21.879  -59.556 -24.209 1.00 0.00 ? 83  ARG B CZ  1 
ATOM   2106  N NH1 . ARG B  2  84  ? 21.650  -60.438 -23.210 1.00 0.00 ? 83  ARG B NH1 1 
ATOM   2107  N NH2 . ARG B  2  84  ? 22.692  -59.934 -25.233 1.00 0.00 ? 83  ARG B NH2 1 
ATOM   2108  N N   . VAL B  2  85  ? 19.993  -55.410 -17.939 1.00 0.00 ? 84  VAL B N   1 
ATOM   2109  C CA  . VAL B  2  85  ? 19.250  -54.503 -17.113 1.00 0.00 ? 84  VAL B CA  1 
ATOM   2110  C C   . VAL B  2  85  ? 20.003  -54.264 -15.848 1.00 0.00 ? 84  VAL B C   1 
ATOM   2111  O O   . VAL B  2  85  ? 20.006  -53.141 -15.350 1.00 0.00 ? 84  VAL B O   1 
ATOM   2112  C CB  . VAL B  2  85  ? 17.860  -55.049 -16.851 1.00 0.00 ? 84  VAL B CB  1 
ATOM   2113  C CG1 . VAL B  2  85  ? 17.101  -54.250 -15.767 1.00 0.00 ? 84  VAL B CG1 1 
ATOM   2114  C CG2 . VAL B  2  85  ? 17.097  -54.983 -18.190 1.00 0.00 ? 84  VAL B CG2 1 
ATOM   2115  N N   . LEU B  2  86  ? 20.692  -55.279 -15.340 1.00 0.00 ? 85  LEU B N   1 
ATOM   2116  C CA  . LEU B  2  86  ? 21.465  -55.120 -14.112 1.00 0.00 ? 85  LEU B CA  1 
ATOM   2117  C C   . LEU B  2  86  ? 22.559  -54.072 -14.304 1.00 0.00 ? 85  LEU B C   1 
ATOM   2118  O O   . LEU B  2  86  ? 22.816  -53.257 -13.418 1.00 0.00 ? 85  LEU B O   1 
ATOM   2119  C CB  . LEU B  2  86  ? 22.081  -56.454 -13.687 1.00 0.00 ? 85  LEU B CB  1 
ATOM   2120  C CG  . LEU B  2  86  ? 22.761  -56.482 -12.317 1.00 0.00 ? 85  LEU B CG  1 
ATOM   2121  C CD1 . LEU B  2  86  ? 22.602  -57.847 -11.665 1.00 0.00 ? 85  LEU B CD1 1 
ATOM   2122  C CD2 . LEU B  2  86  ? 24.230  -56.109 -12.438 1.00 0.00 ? 85  LEU B CD2 1 
ATOM   2123  N N   . VAL B  2  87  ? 23.195  -54.100 -15.470 1.00 0.00 ? 86  VAL B N   1 
ATOM   2124  C CA  . VAL B  2  87  ? 24.205  -53.128 -15.829 1.00 0.00 ? 86  VAL B CA  1 
ATOM   2125  C C   . VAL B  2  87  ? 23.649  -51.744 -15.813 1.00 0.00 ? 86  VAL B C   1 
ATOM   2126  O O   . VAL B  2  87  ? 24.337  -50.811 -15.425 1.00 0.00 ? 86  VAL B O   1 
ATOM   2127  C CB  . VAL B  2  87  ? 24.680  -53.369 -17.252 1.00 0.00 ? 86  VAL B CB  1 
ATOM   2128  C CG1 . VAL B  2  87  ? 25.526  -52.223 -17.835 1.00 0.00 ? 86  VAL B CG1 1 
ATOM   2129  C CG2 . VAL B  2  87  ? 25.483  -54.661 -17.283 1.00 0.00 ? 86  VAL B CG2 1 
ATOM   2130  N N   . HIS B  2  88  ? 22.385  -51.573 -16.234 1.00 0.00 ? 87  HIS B N   1 
ATOM   2131  C CA  . HIS B  2  88  ? 21.727  -50.307 -16.362 1.00 0.00 ? 87  HIS B CA  1 
ATOM   2132  C C   . HIS B  2  88  ? 21.573  -49.711 -15.018 1.00 0.00 ? 87  HIS B C   1 
ATOM   2133  O O   . HIS B  2  88  ? 21.915  -48.558 -14.825 1.00 0.00 ? 87  HIS B O   1 
ATOM   2134  C CB  . HIS B  2  88  ? 20.365  -50.436 -17.068 1.00 0.00 ? 87  HIS B CB  1 
ATOM   2135  C CG  . HIS B  2  88  ? 20.419  -50.927 -18.489 1.00 0.00 ? 87  HIS B CG  1 
ATOM   2136  N ND1 . HIS B  2  88  ? 19.308  -51.385 -19.168 1.00 0.00 ? 87  HIS B ND1 1 
ATOM   2137  C CD2 . HIS B  2  88  ? 21.456  -51.036 -19.363 1.00 0.00 ? 87  HIS B CD2 1 
ATOM   2138  C CE1 . HIS B  2  88  ? 19.728  -51.737 -20.407 1.00 0.00 ? 87  HIS B CE1 1 
ATOM   2139  N NE2 . HIS B  2  88  ? 21.021  -51.543 -20.572 1.00 0.00 ? 87  HIS B NE2 1 
ATOM   2140  N N   . ARG B  2  89  ? 21.099  -50.479 -14.029 1.00 0.00 ? 88  ARG B N   1 
ATOM   2141  C CA  . ARG B  2  89  ? 21.006  -49.973 -12.683 1.00 0.00 ? 88  ARG B CA  1 
ATOM   2142  C C   . ARG B  2  89  ? 22.351  -49.731 -12.076 1.00 0.00 ? 88  ARG B C   1 
ATOM   2143  O O   . ARG B  2  89  ? 22.496  -48.835 -11.250 1.00 0.00 ? 88  ARG B O   1 
ATOM   2144  C CB  . ARG B  2  89  ? 20.203  -50.853 -11.704 1.00 0.00 ? 88  ARG B CB  1 
ATOM   2145  C CG  . ARG B  2  89  ? 20.000  -50.154 -10.345 1.00 0.00 ? 88  ARG B CG  1 
ATOM   2146  C CD  . ARG B  2  89  ? 18.696  -50.486 -9.620  1.00 0.00 ? 88  ARG B CD  1 
ATOM   2147  N NE  . ARG B  2  89  ? 18.684  -49.701 -8.349  1.00 0.00 ? 88  ARG B NE  1 
ATOM   2148  C CZ  . ARG B  2  89  ? 17.779  -49.918 -7.348  1.00 0.00 ? 88  ARG B CZ  1 
ATOM   2149  N NH1 . ARG B  2  89  ? 16.852  -50.913 -7.436  1.00 0.00 ? 88  ARG B NH1 1 
ATOM   2150  N NH2 . ARG B  2  89  ? 17.817  -49.133 -6.231  1.00 0.00 ? 88  ARG B NH2 1 
ATOM   2151  N N   . ALA B  2  90  ? 23.395  -50.507 -12.442 1.00 0.00 ? 89  ALA B N   1 
ATOM   2152  C CA  . ALA B  2  90  ? 24.721  -50.262 -11.902 1.00 0.00 ? 89  ALA B CA  1 
ATOM   2153  C C   . ALA B  2  90  ? 25.293  -48.944 -12.351 1.00 0.00 ? 89  ALA B C   1 
ATOM   2154  O O   . ALA B  2  90  ? 25.904  -48.225 -11.568 1.00 0.00 ? 89  ALA B O   1 
ATOM   2155  C CB  . ALA B  2  90  ? 25.705  -51.362 -12.315 1.00 0.00 ? 89  ALA B CB  1 
ATOM   2156  N N   . ARG B  2  91  ? 25.059  -48.582 -13.623 1.00 0.00 ? 90  ARG B N   1 
ATOM   2157  C CA  . ARG B  2  91  ? 25.397  -47.311 -14.193 1.00 0.00 ? 90  ARG B CA  1 
ATOM   2158  C C   . ARG B  2  91  ? 24.607  -46.198 -13.614 1.00 0.00 ? 90  ARG B C   1 
ATOM   2159  O O   . ARG B  2  91  ? 25.098  -45.083 -13.541 1.00 0.00 ? 90  ARG B O   1 
ATOM   2160  C CB  . ARG B  2  91  ? 25.097  -47.274 -15.690 1.00 0.00 ? 90  ARG B CB  1 
ATOM   2161  C CG  . ARG B  2  91  ? 26.021  -48.136 -16.530 1.00 0.00 ? 90  ARG B CG  1 
ATOM   2162  C CD  . ARG B  2  91  ? 25.591  -48.127 -17.989 1.00 0.00 ? 90  ARG B CD  1 
ATOM   2163  N NE  . ARG B  2  91  ? 26.636  -48.860 -18.752 1.00 0.00 ? 90  ARG B NE  1 
ATOM   2164  C CZ  . ARG B  2  91  ? 26.403  -49.429 -19.963 1.00 0.00 ? 90  ARG B CZ  1 
ATOM   2165  N NH1 . ARG B  2  91  ? 25.163  -49.406 -20.510 1.00 0.00 ? 90  ARG B NH1 1 
ATOM   2166  N NH2 . ARG B  2  91  ? 27.417  -50.040 -20.629 1.00 0.00 ? 90  ARG B NH2 1 
ATOM   2167  N N   . LYS B  2  92  ? 23.354  -46.451 -13.218 1.00 0.00 ? 91  LYS B N   1 
ATOM   2168  C CA  . LYS B  2  92  ? 22.487  -45.486 -12.599 1.00 0.00 ? 91  LYS B CA  1 
ATOM   2169  C C   . LYS B  2  92  ? 23.031  -45.062 -11.279 1.00 0.00 ? 91  LYS B C   1 
ATOM   2170  O O   . LYS B  2  92  ? 23.100  -43.875 -10.986 1.00 0.00 ? 91  LYS B O   1 
ATOM   2171  C CB  . LYS B  2  92  ? 21.065  -46.043 -12.354 1.00 0.00 ? 91  LYS B CB  1 
ATOM   2172  C CG  . LYS B  2  92  ? 20.038  -44.997 -11.889 1.00 0.00 ? 91  LYS B CG  1 
ATOM   2173  C CD  . LYS B  2  92  ? 18.689  -45.601 -11.468 1.00 0.00 ? 91  LYS B CD  1 
ATOM   2174  C CE  . LYS B  2  92  ? 18.720  -46.232 -10.067 1.00 0.00 ? 91  LYS B CE  1 
ATOM   2175  N NZ  . LYS B  2  92  ? 17.404  -46.810 -9.716  1.00 0.00 ? 91  LYS B NZ  1 
ATOM   2176  N N   . LEU B  2  93  ? 23.453  -46.040 -10.458 1.00 0.00 ? 92  LEU B N   1 
ATOM   2177  C CA  . LEU B  2  93  ? 24.029  -45.804 -9.164  1.00 0.00 ? 92  LEU B CA  1 
ATOM   2178  C C   . LEU B  2  93  ? 25.327  -45.073 -9.278  1.00 0.00 ? 92  LEU B C   1 
ATOM   2179  O O   . LEU B  2  93  ? 25.622  -44.233 -8.445  1.00 0.00 ? 92  LEU B O   1 
ATOM   2180  C CB  . LEU B  2  93  ? 24.309  -47.116 -8.414  1.00 0.00 ? 92  LEU B CB  1 
ATOM   2181  C CG  . LEU B  2  93  ? 23.041  -47.901 -8.032  1.00 0.00 ? 92  LEU B CG  1 
ATOM   2182  C CD1 . LEU B  2  93  ? 23.397  -49.366 -7.751  1.00 0.00 ? 92  LEU B CD1 1 
ATOM   2183  C CD2 . LEU B  2  93  ? 22.286  -47.265 -6.853  1.00 0.00 ? 92  LEU B CD2 1 
ATOM   2184  N N   . ALA B  2  94  ? 26.129  -45.344 -10.325 1.00 0.00 ? 93  ALA B N   1 
ATOM   2185  C CA  . ALA B  2  94  ? 27.395  -44.694 -10.488 1.00 0.00 ? 93  ALA B CA  1 
ATOM   2186  C C   . ALA B  2  94  ? 27.249  -43.262 -10.907 1.00 0.00 ? 93  ALA B C   1 
ATOM   2187  O O   . ALA B  2  94  ? 27.884  -42.405 -10.308 1.00 0.00 ? 93  ALA B O   1 
ATOM   2188  C CB  . ALA B  2  94  ? 28.277  -45.397 -11.526 1.00 0.00 ? 93  ALA B CB  1 
ATOM   2189  N N   . GLN B  2  95  ? 26.419  -42.933 -11.924 1.00 0.00 ? 94  GLN B N   1 
ATOM   2190  C CA  . GLN B  2  95  ? 26.197  -41.562 -12.349 1.00 0.00 ? 94  GLN B CA  1 
ATOM   2191  C C   . GLN B  2  95  ? 25.500  -40.706 -11.332 1.00 0.00 ? 94  GLN B C   1 
ATOM   2192  O O   . GLN B  2  95  ? 25.748  -39.504 -11.257 1.00 0.00 ? 94  GLN B O   1 
ATOM   2193  C CB  . GLN B  2  95  ? 25.443  -41.458 -13.680 1.00 0.00 ? 94  GLN B CB  1 
ATOM   2194  C CG  . GLN B  2  95  ? 26.275  -41.926 -14.893 1.00 0.00 ? 94  GLN B CG  1 
ATOM   2195  C CD  . GLN B  2  95  ? 27.277  -40.875 -15.410 1.00 0.00 ? 94  GLN B CD  1 
ATOM   2196  O OE1 . GLN B  2  95  ? 27.145  -40.414 -16.549 1.00 0.00 ? 94  GLN B OE1 1 
ATOM   2197  N NE2 . GLN B  2  95  ? 28.303  -40.519 -14.586 1.00 0.00 ? 94  GLN B NE2 1 
ATOM   2198  N N   . GLN B  2  96  ? 24.594  -41.314 -10.530 1.00 0.00 ? 95  GLN B N   1 
ATOM   2199  C CA  . GLN B  2  96  ? 23.848  -40.655 -9.490  1.00 0.00 ? 95  GLN B CA  1 
ATOM   2200  C C   . GLN B  2  96  ? 24.779  -40.297 -8.415  1.00 0.00 ? 95  GLN B C   1 
ATOM   2201  O O   . GLN B  2  96  ? 24.742  -39.192 -7.886  1.00 0.00 ? 95  GLN B O   1 
ATOM   2202  C CB  . GLN B  2  96  ? 22.748  -41.544 -8.884  1.00 0.00 ? 95  GLN B CB  1 
ATOM   2203  C CG  . GLN B  2  96  ? 21.975  -40.878 -7.728  1.00 0.00 ? 95  GLN B CG  1 
ATOM   2204  C CD  . GLN B  2  96  ? 20.786  -41.738 -7.276  1.00 0.00 ? 95  GLN B CD  1 
ATOM   2205  O OE1 . GLN B  2  96  ? 20.625  -42.896 -7.672  1.00 0.00 ? 95  GLN B OE1 1 
ATOM   2206  N NE2 . GLN B  2  96  ? 19.922  -41.125 -6.409  1.00 0.00 ? 95  GLN B NE2 1 
ATOM   2207  N N   . TYR B  2  97  ? 25.712  -41.192 -8.114  1.00 0.00 ? 96  TYR B N   1 
ATOM   2208  C CA  . TYR B  2  97  ? 26.748  -40.926 -7.176  1.00 0.00 ? 96  TYR B CA  1 
ATOM   2209  C C   . TYR B  2  97  ? 27.652  -39.811 -7.643  1.00 0.00 ? 96  TYR B C   1 
ATOM   2210  O O   . TYR B  2  97  ? 28.154  -39.033 -6.855  1.00 0.00 ? 96  TYR B O   1 
ATOM   2211  C CB  . TYR B  2  97  ? 27.529  -42.218 -6.966  1.00 0.00 ? 96  TYR B CB  1 
ATOM   2212  C CG  . TYR B  2  97  ? 28.477  -42.145 -5.839  1.00 0.00 ? 96  TYR B CG  1 
ATOM   2213  C CD1 . TYR B  2  97  ? 29.773  -41.674 -6.053  1.00 0.00 ? 96  TYR B CD1 1 
ATOM   2214  C CD2 . TYR B  2  97  ? 28.105  -42.612 -4.578  1.00 0.00 ? 96  TYR B CD2 1 
ATOM   2215  C CE1 . TYR B  2  97  ? 30.698  -41.695 -5.018  1.00 0.00 ? 96  TYR B CE1 1 
ATOM   2216  C CE2 . TYR B  2  97  ? 29.038  -42.646 -3.540  1.00 0.00 ? 96  TYR B CE2 1 
ATOM   2217  C CZ  . TYR B  2  97  ? 30.341  -42.216 -3.774  1.00 0.00 ? 96  TYR B CZ  1 
ATOM   2218  O OH  . TYR B  2  97  ? 31.314  -42.355 -2.773  1.00 0.00 ? 96  TYR B OH  1 
ATOM   2219  N N   . TYR B  2  98  ? 27.907  -39.671 -8.942  1.00 0.00 ? 97  TYR B N   1 
ATOM   2220  C CA  . TYR B  2  98  ? 28.804  -38.666 -9.421  1.00 0.00 ? 97  TYR B CA  1 
ATOM   2221  C C   . TYR B  2  98  ? 28.177  -37.329 -9.311  1.00 0.00 ? 97  TYR B C   1 
ATOM   2222  O O   . TYR B  2  98  ? 28.874  -36.386 -8.982  1.00 0.00 ? 97  TYR B O   1 
ATOM   2223  C CB  . TYR B  2  98  ? 29.221  -38.894 -10.884 1.00 0.00 ? 97  TYR B CB  1 
ATOM   2224  C CG  . TYR B  2  98  ? 30.305  -37.941 -11.305 1.00 0.00 ? 97  TYR B CG  1 
ATOM   2225  C CD1 . TYR B  2  98  ? 31.521  -37.890 -10.604 1.00 0.00 ? 97  TYR B CD1 1 
ATOM   2226  C CD2 . TYR B  2  98  ? 30.102  -37.070 -12.389 1.00 0.00 ? 97  TYR B CD2 1 
ATOM   2227  C CE1 . TYR B  2  98  ? 32.517  -36.981 -10.975 1.00 0.00 ? 97  TYR B CE1 1 
ATOM   2228  C CE2 . TYR B  2  98  ? 31.103  -36.168 -12.772 1.00 0.00 ? 97  TYR B CE2 1 
ATOM   2229  C CZ  . TYR B  2  98  ? 32.310  -36.121 -12.062 1.00 0.00 ? 97  TYR B CZ  1 
ATOM   2230  O OH  . TYR B  2  98  ? 33.307  -35.198 -12.430 1.00 0.00 ? 97  TYR B OH  1 
ATOM   2231  N N   . LEU B  2  99  ? 26.862  -37.170 -9.577  1.00 0.00 ? 98  LEU B N   1 
ATOM   2232  C CA  . LEU B  2  99  ? 26.265  -35.857 -9.446  1.00 0.00 ? 98  LEU B CA  1 
ATOM   2233  C C   . LEU B  2  99  ? 26.106  -35.446 -8.004  1.00 0.00 ? 98  LEU B C   1 
ATOM   2234  O O   . LEU B  2  99  ? 26.155  -34.254 -7.724  1.00 0.00 ? 98  LEU B O   1 
ATOM   2235  C CB  . LEU B  2  99  ? 24.946  -35.697 -10.235 1.00 0.00 ? 98  LEU B CB  1 
ATOM   2236  C CG  . LEU B  2  99  ? 23.805  -36.657 -9.875  1.00 0.00 ? 98  LEU B CG  1 
ATOM   2237  C CD1 . LEU B  2  99  ? 22.868  -36.138 -8.769  1.00 0.00 ? 98  LEU B CD1 1 
ATOM   2238  C CD2 . LEU B  2  99  ? 22.994  -37.035 -11.128 1.00 0.00 ? 98  LEU B CD2 1 
ATOM   2239  N N   . VAL B  2  100 ? 25.932  -36.392 -7.046  1.00 0.00 ? 99  VAL B N   1 
ATOM   2240  C CA  . VAL B  2  100 ? 25.837  -36.007 -5.662  1.00 0.00 ? 99  VAL B CA  1 
ATOM   2241  C C   . VAL B  2  100 ? 27.191  -35.769 -5.027  1.00 0.00 ? 99  VAL B C   1 
ATOM   2242  O O   . VAL B  2  100 ? 27.367  -34.787 -4.306  1.00 0.00 ? 99  VAL B O   1 
ATOM   2243  C CB  . VAL B  2  100 ? 25.124  -37.060 -4.831  1.00 0.00 ? 99  VAL B CB  1 
ATOM   2244  C CG1 . VAL B  2  100 ? 25.023  -36.623 -3.351  1.00 0.00 ? 99  VAL B CG1 1 
ATOM   2245  C CG2 . VAL B  2  100 ? 23.711  -37.288 -5.383  1.00 0.00 ? 99  VAL B CG2 1 
ATOM   2246  N N   . TYR B  2  101 ? 28.167  -36.678 -5.242  1.00 0.00 ? 100 TYR B N   1 
ATOM   2247  C CA  . TYR B  2  101 ? 29.409  -36.709 -4.496  1.00 0.00 ? 100 TYR B CA  1 
ATOM   2248  C C   . TYR B  2  101 ? 30.576  -36.155 -5.247  1.00 0.00 ? 100 TYR B C   1 
ATOM   2249  O O   . TYR B  2  101 ? 31.562  -35.765 -4.642  1.00 0.00 ? 100 TYR B O   1 
ATOM   2250  C CB  . TYR B  2  101 ? 29.782  -38.143 -4.091  1.00 0.00 ? 100 TYR B CB  1 
ATOM   2251  C CG  . TYR B  2  101 ? 28.787  -38.688 -3.121  1.00 0.00 ? 100 TYR B CG  1 
ATOM   2252  C CD1 . TYR B  2  101 ? 28.985  -38.536 -1.742  1.00 0.00 ? 100 TYR B CD1 1 
ATOM   2253  C CD2 . TYR B  2  101 ? 27.671  -39.405 -3.562  1.00 0.00 ? 100 TYR B CD2 1 
ATOM   2254  C CE1 . TYR B  2  101 ? 28.104  -39.125 -0.828  1.00 0.00 ? 100 TYR B CE1 1 
ATOM   2255  C CE2 . TYR B  2  101 ? 26.778  -39.979 -2.659  1.00 0.00 ? 100 TYR B CE2 1 
ATOM   2256  C CZ  . TYR B  2  101 ? 27.003  -39.855 -1.288  1.00 0.00 ? 100 TYR B CZ  1 
ATOM   2257  O OH  . TYR B  2  101 ? 26.128  -40.476 -0.373  1.00 0.00 ? 100 TYR B OH  1 
ATOM   2258  N N   . GLN B  2  102 ? 30.503  -36.088 -6.583  1.00 0.00 ? 101 GLN B N   1 
ATOM   2259  C CA  . GLN B  2  102 ? 31.527  -35.606 -7.485  1.00 0.00 ? 101 GLN B CA  1 
ATOM   2260  C C   . GLN B  2  102 ? 32.869  -36.245 -7.314  1.00 0.00 ? 101 GLN B C   1 
ATOM   2261  O O   . GLN B  2  102 ? 33.887  -35.559 -7.244  1.00 0.00 ? 101 GLN B O   1 
ATOM   2262  C CB  . GLN B  2  102 ? 31.693  -34.067 -7.496  1.00 0.00 ? 101 GLN B CB  1 
ATOM   2263  C CG  . GLN B  2  102 ? 30.419  -33.303 -7.890  1.00 0.00 ? 101 GLN B CG  1 
ATOM   2264  C CD  . GLN B  2  102 ? 30.060  -33.528 -9.358  1.00 0.00 ? 101 GLN B CD  1 
ATOM   2265  O OE1 . GLN B  2  102 ? 30.872  -33.990 -10.164 1.00 0.00 ? 101 GLN B OE1 1 
ATOM   2266  N NE2 . GLN B  2  102 ? 28.787  -33.174 -9.709  1.00 0.00 ? 101 GLN B NE2 1 
ATOM   2267  N N   . GLU B  2  103 ? 32.913  -37.589 -7.286  1.00 0.00 ? 102 GLU B N   1 
ATOM   2268  C CA  . GLU B  2  103 ? 34.134  -38.295 -7.553  1.00 0.00 ? 102 GLU B CA  1 
ATOM   2269  C C   . GLU B  2  103 ? 33.646  -39.590 -8.079  1.00 0.00 ? 102 GLU B C   1 
ATOM   2270  O O   . GLU B  2  103 ? 32.574  -39.997 -7.642  1.00 0.00 ? 102 GLU B O   1 
ATOM   2271  C CB  . GLU B  2  103 ? 35.096  -38.456 -6.340  1.00 0.00 ? 102 GLU B CB  1 
ATOM   2272  C CG  . GLU B  2  103 ? 35.028  -39.709 -5.437  1.00 0.00 ? 102 GLU B CG  1 
ATOM   2273  C CD  . GLU B  2  103 ? 33.796  -39.803 -4.538  1.00 0.00 ? 102 GLU B CD  1 
ATOM   2274  O OE1 . GLU B  2  103 ? 32.741  -39.225 -4.887  1.00 0.00 ? 102 GLU B OE1 1 
ATOM   2275  O OE2 . GLU B  2  103 ? 33.888  -40.496 -3.491  1.00 0.00 ? 102 GLU B OE2 1 
ATOM   2276  N N   . PRO B  2  104 ? 34.272  -40.285 -9.018  1.00 0.00 ? 103 PRO B N   1 
ATOM   2277  C CA  . PRO B  2  104 ? 33.807  -41.581 -9.460  1.00 0.00 ? 103 PRO B CA  1 
ATOM   2278  C C   . PRO B  2  104 ? 33.784  -42.554 -8.320  1.00 0.00 ? 103 PRO B C   1 
ATOM   2279  O O   . PRO B  2  104 ? 34.817  -42.744 -7.694  1.00 0.00 ? 103 PRO B O   1 
ATOM   2280  C CB  . PRO B  2  104 ? 34.775  -41.981 -10.569 1.00 0.00 ? 103 PRO B CB  1 
ATOM   2281  C CG  . PRO B  2  104 ? 36.070  -41.232 -10.245 1.00 0.00 ? 103 PRO B CG  1 
ATOM   2282  C CD  . PRO B  2  104 ? 35.572  -39.944 -9.587  1.00 0.00 ? 103 PRO B CD  1 
ATOM   2283  N N   . ILE B  2  105 ? 32.643  -43.195 -8.101  1.00 0.00 ? 104 ILE B N   1 
ATOM   2284  C CA  . ILE B  2  105 ? 32.340  -43.934 -6.884  1.00 0.00 ? 104 ILE B CA  1 
ATOM   2285  C C   . ILE B  2  105 ? 33.325  -45.059 -6.587  1.00 0.00 ? 104 ILE B C   1 
ATOM   2286  O O   . ILE B  2  105 ? 33.690  -45.831 -7.472  1.00 0.00 ? 104 ILE B O   1 
ATOM   2287  C CB  . ILE B  2  105 ? 30.943  -44.567 -7.023  1.00 0.00 ? 104 ILE B CB  1 
ATOM   2288  C CG1 . ILE B  2  105 ? 30.518  -45.279 -5.745  1.00 0.00 ? 104 ILE B CG1 1 
ATOM   2289  C CG2 . ILE B  2  105 ? 30.926  -45.547 -8.185  1.00 0.00 ? 104 ILE B CG2 1 
ATOM   2290  C CD1 . ILE B  2  105 ? 29.178  -45.972 -5.872  1.00 0.00 ? 104 ILE B CD1 1 
ATOM   2291  N N   . PRO B  2  106 ? 33.734  -45.153 -5.325  1.00 0.00 ? 105 PRO B N   1 
ATOM   2292  C CA  . PRO B  2  106 ? 34.667  -46.168 -4.884  1.00 0.00 ? 105 PRO B CA  1 
ATOM   2293  C C   . PRO B  2  106 ? 34.211  -47.526 -5.277  1.00 0.00 ? 105 PRO B C   1 
ATOM   2294  O O   . PRO B  2  106 ? 33.006  -47.741 -5.266  1.00 0.00 ? 105 PRO B O   1 
ATOM   2295  C CB  . PRO B  2  106 ? 34.754  -46.020 -3.369  1.00 0.00 ? 105 PRO B CB  1 
ATOM   2296  C CG  . PRO B  2  106 ? 34.371  -44.569 -3.120  1.00 0.00 ? 105 PRO B CG  1 
ATOM   2297  C CD  . PRO B  2  106 ? 33.357  -44.291 -4.224  1.00 0.00 ? 105 PRO B CD  1 
ATOM   2298  N N   . THR B  2  107 ? 35.130  -48.392 -5.687  1.00 0.00 ? 106 THR B N   1 
ATOM   2299  C CA  . THR B  2  107 ? 34.769  -49.698 -6.212  1.00 0.00 ? 106 THR B CA  1 
ATOM   2300  C C   . THR B  2  107 ? 33.941  -50.465 -5.208  1.00 0.00 ? 106 THR B C   1 
ATOM   2301  O O   . THR B  2  107 ? 32.939  -51.082 -5.554  1.00 0.00 ? 106 THR B O   1 
ATOM   2302  C CB  . THR B  2  107 ? 36.011  -50.533 -6.550  1.00 0.00 ? 106 THR B CB  1 
ATOM   2303  O OG1 . THR B  2  107 ? 37.070  -49.662 -6.960  1.00 0.00 ? 106 THR B OG1 1 
ATOM   2304  C CG2 . THR B  2  107 ? 35.703  -51.514 -7.671  1.00 0.00 ? 106 THR B CG2 1 
ATOM   2305  N N   . ALA B  2  108 ? 34.366  -50.424 -3.956  1.00 0.00 ? 107 ALA B N   1 
ATOM   2306  C CA  . ALA B  2  108 ? 33.699  -51.185 -2.942  1.00 0.00 ? 107 ALA B CA  1 
ATOM   2307  C C   . ALA B  2  108 ? 32.280  -50.783 -2.765  1.00 0.00 ? 107 ALA B C   1 
ATOM   2308  O O   . ALA B  2  108 ? 31.460  -51.652 -2.510  1.00 0.00 ? 107 ALA B O   1 
ATOM   2309  C CB  . ALA B  2  108 ? 34.381  -51.027 -1.575  1.00 0.00 ? 107 ALA B CB  1 
ATOM   2310  N N   . GLN B  2  109 ? 31.976  -49.469 -2.899  1.00 0.00 ? 108 GLN B N   1 
ATOM   2311  C CA  . GLN B  2  109 ? 30.649  -48.922 -2.764  1.00 0.00 ? 108 GLN B CA  1 
ATOM   2312  C C   . GLN B  2  109 ? 29.712  -49.250 -3.862  1.00 0.00 ? 108 GLN B C   1 
ATOM   2313  O O   . GLN B  2  109 ? 28.543  -49.462 -3.589  1.00 0.00 ? 108 GLN B O   1 
ATOM   2314  C CB  . GLN B  2  109 ? 30.628  -47.393 -2.668  1.00 0.00 ? 108 GLN B CB  1 
ATOM   2315  C CG  . GLN B  2  109 ? 31.525  -46.830 -1.573  1.00 0.00 ? 108 GLN B CG  1 
ATOM   2316  C CD  . GLN B  2  109 ? 30.962  -47.267 -0.237  1.00 0.00 ? 108 GLN B CD  1 
ATOM   2317  O OE1 . GLN B  2  109 ? 29.954  -46.702 0.196   1.00 0.00 ? 108 GLN B OE1 1 
ATOM   2318  N NE2 . GLN B  2  109 ? 31.615  -48.281 0.405   1.00 0.00 ? 108 GLN B NE2 1 
ATOM   2319  N N   . LEU B  2  110 ? 30.156  -49.251 -5.139  1.00 0.00 ? 109 LEU B N   1 
ATOM   2320  C CA  . LEU B  2  110 ? 29.281  -49.627 -6.223  1.00 0.00 ? 109 LEU B CA  1 
ATOM   2321  C C   . LEU B  2  110 ? 28.871  -51.052 -6.166  1.00 0.00 ? 109 LEU B C   1 
ATOM   2322  O O   . LEU B  2  110 ? 27.720  -51.367 -6.443  1.00 0.00 ? 109 LEU B O   1 
ATOM   2323  C CB  . LEU B  2  110 ? 29.889  -49.382 -7.604  1.00 0.00 ? 109 LEU B CB  1 
ATOM   2324  C CG  . LEU B  2  110 ? 28.919  -49.603 -8.783  1.00 0.00 ? 109 LEU B CG  1 
ATOM   2325  C CD1 . LEU B  2  110 ? 27.552  -48.908 -8.621  1.00 0.00 ? 109 LEU B CD1 1 
ATOM   2326  C CD2 . LEU B  2  110 ? 29.539  -49.132 -10.102 1.00 0.00 ? 109 LEU B CD2 1 
ATOM   2327  N N   . VAL B  2  111 ? 29.791  -51.938 -5.730  1.00 0.00 ? 110 VAL B N   1 
ATOM   2328  C CA  . VAL B  2  111 ? 29.551  -53.338 -5.515  1.00 0.00 ? 110 VAL B CA  1 
ATOM   2329  C C   . VAL B  2  111 ? 28.566  -53.511 -4.426  1.00 0.00 ? 110 VAL B C   1 
ATOM   2330  O O   . VAL B  2  111 ? 27.718  -54.385 -4.515  1.00 0.00 ? 110 VAL B O   1 
ATOM   2331  C CB  . VAL B  2  111 ? 30.790  -54.148 -5.272  1.00 0.00 ? 110 VAL B CB  1 
ATOM   2332  C CG1 . VAL B  2  111 ? 30.440  -55.642 -5.180  1.00 0.00 ? 110 VAL B CG1 1 
ATOM   2333  C CG2 . VAL B  2  111 ? 31.705  -53.930 -6.480  1.00 0.00 ? 110 VAL B CG2 1 
ATOM   2334  N N   . GLN B  2  112 ? 28.614  -52.672 -3.380  1.00 0.00 ? 111 GLN B N   1 
ATOM   2335  C CA  . GLN B  2  112 ? 27.726  -52.815 -2.261  1.00 0.00 ? 111 GLN B CA  1 
ATOM   2336  C C   . GLN B  2  112 ? 26.346  -52.424 -2.675  1.00 0.00 ? 111 GLN B C   1 
ATOM   2337  O O   . GLN B  2  112 ? 25.395  -53.109 -2.333  1.00 0.00 ? 111 GLN B O   1 
ATOM   2338  C CB  . GLN B  2  112 ? 28.002  -51.817 -1.120  1.00 0.00 ? 111 GLN B CB  1 
ATOM   2339  C CG  . GLN B  2  112 ? 29.144  -52.167 -0.174  1.00 0.00 ? 111 GLN B CG  1 
ATOM   2340  C CD  . GLN B  2  112 ? 29.360  -50.959 0.738   1.00 0.00 ? 111 GLN B CD  1 
ATOM   2341  O OE1 . GLN B  2  112 ? 28.731  -49.911 0.556   1.00 0.00 ? 111 GLN B OE1 1 
ATOM   2342  N NE2 . GLN B  2  112 ? 30.283  -51.120 1.733   1.00 0.00 ? 111 GLN B NE2 1 
ATOM   2343  N N   . ARG B  2  113 ? 26.197  -51.283 -3.363  1.00 0.00 ? 112 ARG B N   1 
ATOM   2344  C CA  . ARG B  2  113 ? 24.913  -50.764 -3.727  1.00 0.00 ? 112 ARG B CA  1 
ATOM   2345  C C   . ARG B  2  113 ? 24.224  -51.660 -4.679  1.00 0.00 ? 112 ARG B C   1 
ATOM   2346  O O   . ARG B  2  113 ? 23.029  -51.865 -4.524  1.00 0.00 ? 112 ARG B O   1 
ATOM   2347  C CB  . ARG B  2  113 ? 24.949  -49.325 -4.268  1.00 0.00 ? 112 ARG B CB  1 
ATOM   2348  C CG  . ARG B  2  113 ? 25.225  -48.296 -3.155  1.00 0.00 ? 112 ARG B CG  1 
ATOM   2349  C CD  . ARG B  2  113 ? 25.091  -46.847 -3.627  1.00 0.00 ? 112 ARG B CD  1 
ATOM   2350  N NE  . ARG B  2  113 ? 25.389  -45.942 -2.467  1.00 0.00 ? 112 ARG B NE  1 
ATOM   2351  C CZ  . ARG B  2  113 ? 26.618  -45.382 -2.242  1.00 0.00 ? 112 ARG B CZ  1 
ATOM   2352  N NH1 . ARG B  2  113 ? 27.647  -45.584 -3.110  1.00 0.00 ? 112 ARG B NH1 1 
ATOM   2353  N NH2 . ARG B  2  113 ? 26.822  -44.615 -1.131  1.00 0.00 ? 112 ARG B NH2 1 
ATOM   2354  N N   . VAL B  2  114 ? 24.953  -52.221 -5.673  1.00 0.00 ? 113 VAL B N   1 
ATOM   2355  C CA  . VAL B  2  114 ? 24.433  -53.174 -6.637  1.00 0.00 ? 113 VAL B CA  1 
ATOM   2356  C C   . VAL B  2  114 ? 24.060  -54.480 -5.982  1.00 0.00 ? 113 VAL B C   1 
ATOM   2357  O O   . VAL B  2  114 ? 23.138  -55.162 -6.399  1.00 0.00 ? 113 VAL B O   1 
ATOM   2358  C CB  . VAL B  2  114 ? 25.425  -53.407 -7.753  1.00 0.00 ? 113 VAL B CB  1 
ATOM   2359  C CG1 . VAL B  2  114 ? 25.038  -54.588 -8.664  1.00 0.00 ? 113 VAL B CG1 1 
ATOM   2360  C CG2 . VAL B  2  114 ? 25.484  -52.115 -8.581  1.00 0.00 ? 113 VAL B CG2 1 
ATOM   2361  N N   . ALA B  2  115 ? 24.753  -54.880 -4.917  1.00 0.00 ? 114 ALA B N   1 
ATOM   2362  C CA  . ALA B  2  115 ? 24.428  -56.055 -4.165  1.00 0.00 ? 114 ALA B CA  1 
ATOM   2363  C C   . ALA B  2  115 ? 23.102  -55.936 -3.498  1.00 0.00 ? 114 ALA B C   1 
ATOM   2364  O O   . ALA B  2  115 ? 22.382  -56.914 -3.370  1.00 0.00 ? 114 ALA B O   1 
ATOM   2365  C CB  . ALA B  2  115 ? 25.489  -56.337 -3.105  1.00 0.00 ? 114 ALA B CB  1 
ATOM   2366  N N   . SER B  2  116 ? 22.756  -54.723 -3.044  1.00 0.00 ? 115 SER B N   1 
ATOM   2367  C CA  . SER B  2  116 ? 21.506  -54.376 -2.416  1.00 0.00 ? 115 SER B CA  1 
ATOM   2368  C C   . SER B  2  116 ? 20.361  -54.456 -3.380  1.00 0.00 ? 115 SER B C   1 
ATOM   2369  O O   . SER B  2  116 ? 19.263  -54.851 -3.015  1.00 0.00 ? 115 SER B O   1 
ATOM   2370  C CB  . SER B  2  116 ? 21.552  -52.984 -1.791  1.00 0.00 ? 115 SER B CB  1 
ATOM   2371  O OG  . SER B  2  116 ? 22.642  -52.922 -0.886  1.00 0.00 ? 115 SER B OG  1 
ATOM   2372  N N   . VAL B  2  117 ? 20.600  -54.121 -4.662  1.00 0.00 ? 116 VAL B N   1 
ATOM   2373  C CA  . VAL B  2  117 ? 19.634  -54.270 -5.724  1.00 0.00 ? 116 VAL B CA  1 
ATOM   2374  C C   . VAL B  2  117 ? 19.312  -55.714 -5.943  1.00 0.00 ? 116 VAL B C   1 
ATOM   2375  O O   . VAL B  2  117 ? 18.176  -56.050 -6.253  1.00 0.00 ? 116 VAL B O   1 
ATOM   2376  C CB  . VAL B  2  117 ? 20.183  -53.762 -7.045  1.00 0.00 ? 116 VAL B CB  1 
ATOM   2377  C CG1 . VAL B  2  117 ? 19.242  -54.016 -8.237  1.00 0.00 ? 116 VAL B CG1 1 
ATOM   2378  C CG2 . VAL B  2  117 ? 20.492  -52.268 -6.872  1.00 0.00 ? 116 VAL B CG2 1 
ATOM   2379  N N   . MET B  2  118 ? 20.305  -56.617 -5.814  1.00 0.00 ? 117 MET B N   1 
ATOM   2380  C CA  . MET B  2  118 ? 20.095  -58.016 -6.064  1.00 0.00 ? 117 MET B CA  1 
ATOM   2381  C C   . MET B  2  118 ? 19.532  -58.733 -4.902  1.00 0.00 ? 117 MET B C   1 
ATOM   2382  O O   . MET B  2  118 ? 19.185  -59.902 -5.037  1.00 0.00 ? 117 MET B O   1 
ATOM   2383  C CB  . MET B  2  118 ? 21.424  -58.728 -6.337  1.00 0.00 ? 117 MET B CB  1 
ATOM   2384  C CG  . MET B  2  118 ? 22.155  -58.266 -7.589  1.00 0.00 ? 117 MET B CG  1 
ATOM   2385  S SD  . MET B  2  118 ? 23.655  -59.239 -7.776  1.00 0.00 ? 117 MET B SD  1 
ATOM   2386  C CE  . MET B  2  118 ? 22.966  -60.649 -8.671  1.00 0.00 ? 117 MET B CE  1 
ATOM   2387  N N   . GLN B  2  119 ? 19.490  -58.049 -3.744  1.00 0.00 ? 118 GLN B N   1 
ATOM   2388  C CA  . GLN B  2  119 ? 19.006  -58.539 -2.487  1.00 0.00 ? 118 GLN B CA  1 
ATOM   2389  C C   . GLN B  2  119 ? 17.578  -58.213 -2.395  1.00 0.00 ? 118 GLN B C   1 
ATOM   2390  O O   . GLN B  2  119 ? 16.810  -58.932 -1.770  1.00 0.00 ? 118 GLN B O   1 
ATOM   2391  C CB  . GLN B  2  119 ? 19.770  -57.937 -1.301  1.00 0.00 ? 118 GLN B CB  1 
ATOM   2392  C CG  . GLN B  2  119 ? 19.044  -57.916 0.057   1.00 0.00 ? 118 GLN B CG  1 
ATOM   2393  C CD  . GLN B  2  119 ? 18.540  -59.298 0.460   1.00 0.00 ? 118 GLN B CD  1 
ATOM   2394  O OE1 . GLN B  2  119 ? 19.116  -60.328 0.104   1.00 0.00 ? 118 GLN B OE1 1 
ATOM   2395  N NE2 . GLN B  2  119 ? 17.414  -59.304 1.236   1.00 0.00 ? 118 GLN B NE2 1 
ATOM   2396  N N   . GLU B  2  120 ? 17.154  -57.121 -3.047  1.00 0.00 ? 119 GLU B N   1 
ATOM   2397  C CA  . GLU B  2  120 ? 15.812  -56.644 -2.951  1.00 0.00 ? 119 GLU B CA  1 
ATOM   2398  C C   . GLU B  2  120 ? 14.866  -57.659 -3.488  1.00 0.00 ? 119 GLU B C   1 
ATOM   2399  O O   . GLU B  2  120 ? 13.795  -57.800 -2.937  1.00 0.00 ? 119 GLU B O   1 
ATOM   2400  C CB  . GLU B  2  120 ? 15.633  -55.225 -3.551  1.00 0.00 ? 119 GLU B CB  1 
ATOM   2401  C CG  . GLU B  2  120 ? 15.339  -55.119 -5.056  1.00 0.00 ? 119 GLU B CG  1 
ATOM   2402  C CD  . GLU B  2  120 ? 15.630  -53.722 -5.617  1.00 0.00 ? 119 GLU B CD  1 
ATOM   2403  O OE1 . GLU B  2  120 ? 16.020  -52.815 -4.835  1.00 0.00 ? 119 GLU B OE1 1 
ATOM   2404  O OE2 . GLU B  2  120 ? 15.464  -53.547 -6.855  1.00 0.00 ? 119 GLU B OE2 1 
ATOM   2405  N N   . TYR B  2  121 ? 15.236  -58.419 -4.539  1.00 0.00 ? 120 TYR B N   1 
ATOM   2406  C CA  . TYR B  2  121 ? 14.363  -59.392 -5.158  1.00 0.00 ? 120 TYR B CA  1 
ATOM   2407  C C   . TYR B  2  121 ? 14.341  -60.694 -4.442  1.00 0.00 ? 120 TYR B C   1 
ATOM   2408  O O   . TYR B  2  121 ? 13.501  -61.534 -4.732  1.00 0.00 ? 120 TYR B O   1 
ATOM   2409  C CB  . TYR B  2  121 ? 14.731  -59.742 -6.612  1.00 0.00 ? 120 TYR B CB  1 
ATOM   2410  C CG  . TYR B  2  121 ? 14.602  -58.599 -7.560  1.00 0.00 ? 120 TYR B CG  1 
ATOM   2411  C CD1 . TYR B  2  121 ? 14.106  -57.326 -7.235  1.00 0.00 ? 120 TYR B CD1 1 
ATOM   2412  C CD2 . TYR B  2  121 ? 14.967  -58.847 -8.878  1.00 0.00 ? 120 TYR B CD2 1 
ATOM   2413  C CE1 . TYR B  2  121 ? 13.998  -56.323 -8.201  1.00 0.00 ? 120 TYR B CE1 1 
ATOM   2414  C CE2 . TYR B  2  121 ? 14.844  -57.853 -9.854  1.00 0.00 ? 120 TYR B CE2 1 
ATOM   2415  C CZ  . TYR B  2  121 ? 14.354  -56.592 -9.519  1.00 0.00 ? 120 TYR B CZ  1 
ATOM   2416  O OH  . TYR B  2  121 ? 14.164  -55.628 -10.524 1.00 0.00 ? 120 TYR B OH  1 
ATOM   2417  N N   . THR B  2  122 ? 15.210  -60.909 -3.458  1.00 0.00 ? 121 THR B N   1 
ATOM   2418  C CA  . THR B  2  122 ? 15.116  -62.086 -2.650  1.00 0.00 ? 121 THR B CA  1 
ATOM   2419  C C   . THR B  2  122 ? 14.198  -61.828 -1.461  1.00 0.00 ? 121 THR B C   1 
ATOM   2420  O O   . THR B  2  122 ? 14.132  -62.628 -0.535  1.00 0.00 ? 121 THR B O   1 
ATOM   2421  C CB  . THR B  2  122 ? 16.482  -62.551 -2.176  1.00 0.00 ? 121 THR B CB  1 
ATOM   2422  O OG1 . THR B  2  122 ? 17.041  -61.732 -1.163  1.00 0.00 ? 121 THR B OG1 1 
ATOM   2423  C CG2 . THR B  2  122 ? 17.464  -62.587 -3.354  1.00 0.00 ? 121 THR B CG2 1 
ATOM   2424  N N   . GLN B  2  123 ? 13.643  -60.617 -1.414  1.00 0.00 ? 122 GLN B N   1 
ATOM   2425  C CA  . GLN B  2  123 ? 12.660  -60.229 -0.400  1.00 0.00 ? 122 GLN B CA  1 
ATOM   2426  C C   . GLN B  2  123 ? 11.403  -59.566 -0.979  1.00 0.00 ? 122 GLN B C   1 
ATOM   2427  O O   . GLN B  2  123 ? 10.451  -59.282 -0.252  1.00 0.00 ? 122 GLN B O   1 
ATOM   2428  C CB  . GLN B  2  123 ? 13.302  -59.308 0.640   1.00 0.00 ? 122 GLN B CB  1 
ATOM   2429  C CG  . GLN B  2  123 ? 12.641  -59.359 2.007   1.00 0.00 ? 122 GLN B CG  1 
ATOM   2430  C CD  . GLN B  2  123 ? 13.640  -59.246 3.142   1.00 0.00 ? 122 GLN B CD  1 
ATOM   2431  O OE1 . GLN B  2  123 ? 14.827  -59.009 2.919   1.00 0.00 ? 122 GLN B OE1 1 
ATOM   2432  N NE2 . GLN B  2  123 ? 13.162  -59.414 4.370   1.00 0.00 ? 122 GLN B NE2 1 
ATOM   2433  N N   . SER B  2  124 ? 11.418  -59.311 -2.283  1.00 0.00 ? 123 SER B N   1 
ATOM   2434  C CA  . SER B  2  124 ? 10.436  -58.471 -2.937  1.00 0.00 ? 123 SER B CA  1 
ATOM   2435  C C   . SER B  2  124 ? 9.516   -59.372 -3.663  1.00 0.00 ? 123 SER B C   1 
ATOM   2436  O O   . SER B  2  124 ? 9.924   -60.424 -4.158  1.00 0.00 ? 123 SER B O   1 
ATOM   2437  C CB  . SER B  2  124 ? 11.006  -57.464 -3.969  1.00 0.00 ? 123 SER B CB  1 
ATOM   2438  O OG  . SER B  2  124 ? 10.012  -56.637 -4.559  1.00 0.00 ? 123 SER B OG  1 
ATOM   2439  N N   . GLY B  2  125 ? 8.230   -58.939 -3.660  1.00 0.00 ? 124 GLY B N   1 
ATOM   2440  C CA  . GLY B  2  125 ? 7.103   -59.598 -4.230  1.00 0.00 ? 124 GLY B CA  1 
ATOM   2441  C C   . GLY B  2  125 ? 7.136   -59.772 -5.702  1.00 0.00 ? 124 GLY B C   1 
ATOM   2442  O O   . GLY B  2  125 ? 7.333   -58.817 -6.447  1.00 0.00 ? 124 GLY B O   1 
ATOM   2443  N N   . GLY B  2  126 ? 6.789   -60.993 -6.151  1.00 0.00 ? 125 GLY B N   1 
ATOM   2444  C CA  . GLY B  2  126 ? 6.394   -61.239 -7.501  1.00 0.00 ? 125 GLY B CA  1 
ATOM   2445  C C   . GLY B  2  126 ? 7.527   -61.300 -8.435  1.00 0.00 ? 125 GLY B C   1 
ATOM   2446  O O   . GLY B  2  126 ? 7.296   -61.299 -9.640  1.00 0.00 ? 125 GLY B O   1 
ATOM   2447  N N   . VAL B  2  127 ? 8.774   -61.333 -7.903  1.00 0.00 ? 126 VAL B N   1 
ATOM   2448  C CA  . VAL B  2  127 ? 9.974   -61.270 -8.690  1.00 0.00 ? 126 VAL B CA  1 
ATOM   2449  C C   . VAL B  2  127 ? 10.821  -62.406 -8.245  1.00 0.00 ? 126 VAL B C   1 
ATOM   2450  O O   . VAL B  2  127 ? 10.750  -62.821 -7.093  1.00 0.00 ? 126 VAL B O   1 
ATOM   2451  C CB  . VAL B  2  127 ? 10.742  -59.952 -8.551  1.00 0.00 ? 126 VAL B CB  1 
ATOM   2452  C CG1 . VAL B  2  127 ? 9.989   -58.833 -9.299  1.00 0.00 ? 126 VAL B CG1 1 
ATOM   2453  C CG2 . VAL B  2  127 ? 10.945  -59.567 -7.081  1.00 0.00 ? 126 VAL B CG2 1 
ATOM   2454  N N   . ARG B  2  128 ? 11.623  -62.954 -9.186  1.00 0.00 ? 127 ARG B N   1 
ATOM   2455  C CA  . ARG B  2  128 ? 12.603  -63.984 -8.939  1.00 0.00 ? 127 ARG B CA  1 
ATOM   2456  C C   . ARG B  2  128 ? 13.907  -63.273 -8.698  1.00 0.00 ? 127 ARG B C   1 
ATOM   2457  O O   . ARG B  2  128 ? 14.061  -62.156 -9.187  1.00 0.00 ? 127 ARG B O   1 
ATOM   2458  C CB  . ARG B  2  128 ? 12.820  -64.940 -10.147 1.00 0.00 ? 127 ARG B CB  1 
ATOM   2459  C CG  . ARG B  2  128 ? 13.148  -64.243 -11.483 1.00 0.00 ? 127 ARG B CG  1 
ATOM   2460  C CD  . ARG B  2  128 ? 13.497  -65.229 -12.603 1.00 0.00 ? 127 ARG B CD  1 
ATOM   2461  N NE  . ARG B  2  128 ? 13.821  -64.503 -13.880 1.00 0.00 ? 127 ARG B NE  1 
ATOM   2462  C CZ  . ARG B  2  128 ? 15.033  -63.916 -14.136 1.00 0.00 ? 127 ARG B CZ  1 
ATOM   2463  N NH1 . ARG B  2  128 ? 16.032  -63.923 -13.214 1.00 0.00 ? 127 ARG B NH1 1 
ATOM   2464  N NH2 . ARG B  2  128 ? 15.260  -63.277 -15.320 1.00 0.00 ? 127 ARG B NH2 1 
ATOM   2465  N N   . PRO B  2  129 ? 14.881  -63.940 -8.081  1.00 0.00 ? 128 PRO B N   1 
ATOM   2466  C CA  . PRO B  2  129 ? 16.249  -63.407 -7.940  1.00 0.00 ? 128 PRO B CA  1 
ATOM   2467  C C   . PRO B  2  129 ? 17.048  -63.377 -9.259  1.00 0.00 ? 128 PRO B C   1 
ATOM   2468  O O   . PRO B  2  129 ? 16.745  -64.149 -10.168 1.00 0.00 ? 128 PRO B O   1 
ATOM   2469  C CB  . PRO B  2  129 ? 16.898  -64.382 -6.955  1.00 0.00 ? 128 PRO B CB  1 
ATOM   2470  C CG  . PRO B  2  129 ? 15.760  -64.912 -6.151  1.00 0.00 ? 128 PRO B CG  1 
ATOM   2471  C CD  . PRO B  2  129 ? 14.593  -64.995 -7.094  1.00 0.00 ? 128 PRO B CD  1 
ATOM   2472  N N   . PHE B  2  130 ? 18.044  -62.492 -9.354  1.00 0.00 ? 129 PHE B N   1 
ATOM   2473  C CA  . PHE B  2  130 ? 18.803  -62.297 -10.562 1.00 0.00 ? 129 PHE B CA  1 
ATOM   2474  C C   . PHE B  2  130 ? 19.691  -63.497 -10.740 1.00 0.00 ? 129 PHE B C   1 
ATOM   2475  O O   . PHE B  2  130 ? 20.364  -63.908 -9.802  1.00 0.00 ? 129 PHE B O   1 
ATOM   2476  C CB  . PHE B  2  130 ? 19.733  -61.085 -10.456 1.00 0.00 ? 129 PHE B CB  1 
ATOM   2477  C CG  . PHE B  2  130 ? 18.970  -59.787 -10.436 1.00 0.00 ? 129 PHE B CG  1 
ATOM   2478  C CD1 . PHE B  2  130 ? 18.603  -59.207 -9.217  1.00 0.00 ? 129 PHE B CD1 1 
ATOM   2479  C CD2 . PHE B  2  130 ? 18.749  -59.056 -11.613 1.00 0.00 ? 129 PHE B CD2 1 
ATOM   2480  C CE1 . PHE B  2  130 ? 18.070  -57.917 -9.178  1.00 0.00 ? 129 PHE B CE1 1 
ATOM   2481  C CE2 . PHE B  2  130 ? 18.186  -57.777 -11.580 1.00 0.00 ? 129 PHE B CE2 1 
ATOM   2482  C CZ  . PHE B  2  130 ? 17.871  -57.195 -10.355 1.00 0.00 ? 129 PHE B CZ  1 
ATOM   2483  N N   . GLY B  2  131 ? 19.695  -64.128 -11.935 1.00 0.00 ? 130 GLY B N   1 
ATOM   2484  C CA  . GLY B  2  131 ? 20.492  -65.296 -12.193 1.00 0.00 ? 130 GLY B CA  1 
ATOM   2485  C C   . GLY B  2  131 ? 21.932  -64.969 -12.298 1.00 0.00 ? 130 GLY B C   1 
ATOM   2486  O O   . GLY B  2  131 ? 22.751  -65.689 -11.760 1.00 0.00 ? 130 GLY B O   1 
ATOM   2487  N N   . VAL B  2  132 ? 22.277  -63.866 -12.983 1.00 0.00 ? 131 VAL B N   1 
ATOM   2488  C CA  . VAL B  2  132 ? 23.608  -63.343 -13.229 1.00 0.00 ? 131 VAL B CA  1 
ATOM   2489  C C   . VAL B  2  132 ? 24.406  -63.195 -11.995 1.00 0.00 ? 131 VAL B C   1 
ATOM   2490  O O   . VAL B  2  132 ? 23.898  -62.746 -10.976 1.00 0.00 ? 131 VAL B O   1 
ATOM   2491  C CB  . VAL B  2  132 ? 23.494  -61.997 -13.900 1.00 0.00 ? 131 VAL B CB  1 
ATOM   2492  C CG1 . VAL B  2  132 ? 24.708  -61.078 -13.753 1.00 0.00 ? 131 VAL B CG1 1 
ATOM   2493  C CG2 . VAL B  2  132 ? 23.195  -62.264 -15.369 1.00 0.00 ? 131 VAL B CG2 1 
ATOM   2494  N N   . SER B  2  133 ? 25.669  -63.656 -12.069 1.00 0.00 ? 132 SER B N   1 
ATOM   2495  C CA  . SER B  2  133 ? 26.691  -63.409 -11.089 1.00 0.00 ? 132 SER B CA  1 
ATOM   2496  C C   . SER B  2  133 ? 27.731  -62.731 -11.880 1.00 0.00 ? 132 SER B C   1 
ATOM   2497  O O   . SER B  2  133 ? 27.920  -63.073 -13.040 1.00 0.00 ? 132 SER B O   1 
ATOM   2498  C CB  . SER B  2  133 ? 27.268  -64.720 -10.532 1.00 0.00 ? 132 SER B CB  1 
ATOM   2499  O OG  . SER B  2  133 ? 28.169  -64.514 -9.465  1.00 0.00 ? 132 SER B OG  1 
ATOM   2500  N N   . LEU B  2  134 ? 28.424  -61.741 -11.300 1.00 0.00 ? 133 LEU B N   1 
ATOM   2501  C CA  . LEU B  2  134 ? 29.303  -60.967 -12.109 1.00 0.00 ? 133 LEU B CA  1 
ATOM   2502  C C   . LEU B  2  134 ? 30.448  -60.490 -11.286 1.00 0.00 ? 133 LEU B C   1 
ATOM   2503  O O   . LEU B  2  134 ? 30.296  -60.026 -10.165 1.00 0.00 ? 133 LEU B O   1 
ATOM   2504  C CB  . LEU B  2  134 ? 28.567  -59.778 -12.792 1.00 0.00 ? 133 LEU B CB  1 
ATOM   2505  C CG  . LEU B  2  134 ? 27.926  -58.695 -11.878 1.00 0.00 ? 133 LEU B CG  1 
ATOM   2506  C CD1 . LEU B  2  134 ? 28.908  -57.659 -11.329 1.00 0.00 ? 133 LEU B CD1 1 
ATOM   2507  C CD2 . LEU B  2  134 ? 26.786  -57.963 -12.600 1.00 0.00 ? 133 LEU B CD2 1 
ATOM   2508  N N   . LEU B  2  135 ? 31.660  -60.576 -11.870 1.00 0.00 ? 134 LEU B N   1 
ATOM   2509  C CA  . LEU B  2  135 ? 32.875  -59.987 -11.406 1.00 0.00 ? 134 LEU B CA  1 
ATOM   2510  C C   . LEU B  2  135 ? 32.750  -58.546 -11.617 1.00 0.00 ? 134 LEU B C   1 
ATOM   2511  O O   . LEU B  2  135 ? 32.296  -58.159 -12.680 1.00 0.00 ? 134 LEU B O   1 
ATOM   2512  C CB  . LEU B  2  135 ? 34.143  -60.470 -12.139 1.00 0.00 ? 134 LEU B CB  1 
ATOM   2513  C CG  . LEU B  2  135 ? 34.324  -61.994 -12.065 1.00 0.00 ? 134 LEU B CG  1 
ATOM   2514  C CD1 . LEU B  2  135 ? 35.625  -62.473 -12.710 1.00 0.00 ? 134 LEU B CD1 1 
ATOM   2515  C CD2 . LEU B  2  135 ? 34.223  -62.508 -10.617 1.00 0.00 ? 134 LEU B CD2 1 
ATOM   2516  N N   . ILE B  2  136 ? 33.211  -57.721 -10.674 1.00 0.00 ? 135 ILE B N   1 
ATOM   2517  C CA  . ILE B  2  136 ? 33.106  -56.316 -10.776 1.00 0.00 ? 135 ILE B CA  1 
ATOM   2518  C C   . ILE B  2  136 ? 34.474  -55.880 -10.458 1.00 0.00 ? 135 ILE B C   1 
ATOM   2519  O O   . ILE B  2  136 ? 34.819  -55.786 -9.288  1.00 0.00 ? 135 ILE B O   1 
ATOM   2520  C CB  . ILE B  2  136 ? 32.098  -55.690 -9.840  1.00 0.00 ? 135 ILE B CB  1 
ATOM   2521  C CG1 . ILE B  2  136 ? 30.774  -56.487 -9.830  1.00 0.00 ? 135 ILE B CG1 1 
ATOM   2522  C CG2 . ILE B  2  136 ? 31.960  -54.219 -10.285 1.00 0.00 ? 135 ILE B CG2 1 
ATOM   2523  C CD1 . ILE B  2  136 ? 29.574  -55.740 -9.270  1.00 0.00 ? 135 ILE B CD1 1 
ATOM   2524  N N   . CYS B  2  137 ? 35.309  -55.600 -11.456 1.00 0.00 ? 136 CYS B N   1 
ATOM   2525  C CA  . CYS B  2  137 ? 36.719  -55.267 -11.177 1.00 0.00 ? 136 CYS B CA  1 
ATOM   2526  C C   . CYS B  2  137 ? 37.066  -53.776 -11.234 1.00 0.00 ? 136 CYS B C   1 
ATOM   2527  O O   . CYS B  2  137 ? 36.810  -53.121 -12.239 1.00 0.00 ? 136 CYS B O   1 
ATOM   2528  C CB  . CYS B  2  137 ? 37.654  -56.062 -12.094 1.00 0.00 ? 136 CYS B CB  1 
ATOM   2529  S SG  . CYS B  2  137 ? 38.019  -55.290 -13.684 1.00 0.00 ? 136 CYS B SG  1 
ATOM   2530  N N   . GLY B  2  138 ? 37.652  -53.250 -10.155 1.00 0.00 ? 137 GLY B N   1 
ATOM   2531  C CA  . GLY B  2  138 ? 37.950  -51.825 -10.052 1.00 0.00 ? 137 GLY B CA  1 
ATOM   2532  C C   . GLY B  2  138 ? 39.274  -51.423 -9.409  1.00 0.00 ? 137 GLY B C   1 
ATOM   2533  O O   . GLY B  2  138 ? 39.836  -52.172 -8.611  1.00 0.00 ? 137 GLY B O   1 
ATOM   2534  N N   . TRP B  2  139 ? 39.759  -50.226 -9.749  1.00 0.00 ? 138 TRP B N   1 
ATOM   2535  C CA  . TRP B  2  139 ? 41.041  -49.708 -9.253  1.00 0.00 ? 138 TRP B CA  1 
ATOM   2536  C C   . TRP B  2  139 ? 40.967  -48.225 -8.847  1.00 0.00 ? 138 TRP B C   1 
ATOM   2537  O O   . TRP B  2  139 ? 40.820  -47.352 -9.702  1.00 0.00 ? 138 TRP B O   1 
ATOM   2538  C CB  . TRP B  2  139 ? 42.117  -49.887 -10.329 1.00 0.00 ? 138 TRP B CB  1 
ATOM   2539  C CG  . TRP B  2  139 ? 43.533  -49.862 -9.820  1.00 0.00 ? 138 TRP B CG  1 
ATOM   2540  C CD1 . TRP B  2  139 ? 44.438  -50.881 -9.875  1.00 0.00 ? 138 TRP B CD1 1 
ATOM   2541  C CD2 . TRP B  2  139 ? 44.211  -48.761 -9.196  1.00 0.00 ? 138 TRP B CD2 1 
ATOM   2542  N NE1 . TRP B  2  139 ? 45.631  -50.486 -9.321  1.00 0.00 ? 138 TRP B NE1 1 
ATOM   2543  C CE2 . TRP B  2  139 ? 45.518  -49.189 -8.897  1.00 0.00 ? 138 TRP B CE2 1 
ATOM   2544  C CE3 . TRP B  2  139 ? 43.837  -47.455 -8.856  1.00 0.00 ? 138 TRP B CE3 1 
ATOM   2545  C CZ2 . TRP B  2  139 ? 46.450  -48.364 -8.276  1.00 0.00 ? 138 TRP B CZ2 1 
ATOM   2546  C CZ3 . TRP B  2  139 ? 44.767  -46.637 -8.239  1.00 0.00 ? 138 TRP B CZ3 1 
ATOM   2547  C CH2 . TRP B  2  139 ? 46.056  -47.096 -7.954  1.00 0.00 ? 138 TRP B CH2 1 
ATOM   2548  N N   . ASN B  2  140 ? 41.087  -47.940 -7.549  1.00 0.00 ? 139 ASN B N   1 
ATOM   2549  C CA  . ASN B  2  140 ? 41.010  -46.591 -7.058  1.00 0.00 ? 139 ASN B CA  1 
ATOM   2550  C C   . ASN B  2  140 ? 42.241  -46.480 -6.252  1.00 0.00 ? 139 ASN B C   1 
ATOM   2551  O O   . ASN B  2  140 ? 42.737  -47.495 -5.771  1.00 0.00 ? 139 ASN B O   1 
ATOM   2552  C CB  . ASN B  2  140 ? 39.862  -46.243 -6.068  1.00 0.00 ? 139 ASN B CB  1 
ATOM   2553  C CG  . ASN B  2  140 ? 38.476  -46.315 -6.699  1.00 0.00 ? 139 ASN B CG  1 
ATOM   2554  O OD1 . ASN B  2  140 ? 37.663  -47.145 -6.296  1.00 0.00 ? 139 ASN B OD1 1 
ATOM   2555  N ND2 . ASN B  2  140 ? 38.197  -45.410 -7.683  1.00 0.00 ? 139 ASN B ND2 1 
ATOM   2556  N N   . GLU B  2  141 ? 42.796  -45.263 -6.198  1.00 0.00 ? 140 GLU B N   1 
ATOM   2557  C CA  . GLU B  2  141 ? 43.774  -44.717 -5.219  1.00 0.00 ? 140 GLU B CA  1 
ATOM   2558  C C   . GLU B  2  141 ? 45.227  -45.249 -5.160  1.00 0.00 ? 140 GLU B C   1 
ATOM   2559  O O   . GLU B  2  141 ? 46.170  -44.548 -5.528  1.00 0.00 ? 140 GLU B O   1 
ATOM   2560  C CB  . GLU B  2  141 ? 43.169  -44.758 -3.810  1.00 0.00 ? 140 GLU B CB  1 
ATOM   2561  C CG  . GLU B  2  141 ? 43.322  -46.098 -3.107  1.00 0.00 ? 140 GLU B CG  1 
ATOM   2562  C CD  . GLU B  2  141 ? 42.059  -46.528 -2.390  1.00 0.00 ? 140 GLU B CD  1 
ATOM   2563  O OE1 . GLU B  2  141 ? 41.210  -45.656 -2.103  1.00 0.00 ? 140 GLU B OE1 1 
ATOM   2564  O OE2 . GLU B  2  141 ? 41.912  -47.737 -2.114  1.00 0.00 ? 140 GLU B OE2 1 
ATOM   2565  N N   . GLY B  2  142 ? 45.351  -46.457 -4.611  1.00 0.00 ? 141 GLY B N   1 
ATOM   2566  C CA  . GLY B  2  142 ? 46.524  -47.300 -4.735  1.00 0.00 ? 141 GLY B CA  1 
ATOM   2567  C C   . GLY B  2  142 ? 46.253  -48.794 -4.908  1.00 0.00 ? 141 GLY B C   1 
ATOM   2568  O O   . GLY B  2  142 ? 47.177  -49.590 -4.738  1.00 0.00 ? 141 GLY B O   1 
ATOM   2569  N N   . ARG B  2  143 ? 45.017  -49.199 -5.211  1.00 0.00 ? 142 ARG B N   1 
ATOM   2570  C CA  . ARG B  2  143 ? 44.671  -50.580 -5.085  1.00 0.00 ? 142 ARG B CA  1 
ATOM   2571  C C   . ARG B  2  143 ? 43.811  -50.947 -6.271  1.00 0.00 ? 142 ARG B C   1 
ATOM   2572  O O   . ARG B  2  143 ? 42.801  -50.269 -6.448  1.00 0.00 ? 142 ARG B O   1 
ATOM   2573  C CB  . ARG B  2  143 ? 43.838  -50.834 -3.814  1.00 0.00 ? 142 ARG B CB  1 
ATOM   2574  C CG  . ARG B  2  143 ? 43.847  -52.306 -3.400  1.00 0.00 ? 142 ARG B CG  1 
ATOM   2575  C CD  . ARG B  2  143 ? 42.502  -52.830 -2.909  1.00 0.00 ? 142 ARG B CD  1 
ATOM   2576  N NE  . ARG B  2  143 ? 42.723  -54.262 -2.529  1.00 0.00 ? 142 ARG B NE  1 
ATOM   2577  C CZ  . ARG B  2  143 ? 41.765  -55.234 -2.579  1.00 0.00 ? 142 ARG B CZ  1 
ATOM   2578  N NH1 . ARG B  2  143 ? 40.512  -54.977 -3.047  1.00 0.00 ? 142 ARG B NH1 1 
ATOM   2579  N NH2 . ARG B  2  143 ? 42.077  -56.497 -2.168  1.00 0.00 ? 142 ARG B NH2 1 
ATOM   2580  N N   . PRO B  2  144 ? 44.085  -52.083 -6.915  1.00 0.00 ? 143 PRO B N   1 
ATOM   2581  C CA  . PRO B  2  144 ? 43.135  -52.754 -7.812  1.00 0.00 ? 143 PRO B CA  1 
ATOM   2582  C C   . PRO B  2  144 ? 42.087  -53.595 -7.052  1.00 0.00 ? 143 PRO B C   1 
ATOM   2583  O O   . PRO B  2  144 ? 42.440  -54.329 -6.132  1.00 0.00 ? 143 PRO B O   1 
ATOM   2584  C CB  . PRO B  2  144 ? 44.038  -53.677 -8.634  1.00 0.00 ? 143 PRO B CB  1 
ATOM   2585  C CG  . PRO B  2  144 ? 45.419  -53.103 -8.523  1.00 0.00 ? 143 PRO B CG  1 
ATOM   2586  C CD  . PRO B  2  144 ? 45.413  -51.970 -7.534  1.00 0.00 ? 143 PRO B CD  1 
ATOM   2587  N N   . TYR B  2  145 ? 40.823  -53.436 -7.411  1.00 0.00 ? 144 TYR B N   1 
ATOM   2588  C CA  . TYR B  2  145 ? 39.757  -54.121 -6.714  1.00 0.00 ? 144 TYR B CA  1 
ATOM   2589  C C   . TYR B  2  145 ? 39.112  -55.139 -7.635  1.00 0.00 ? 144 TYR B C   1 
ATOM   2590  O O   . TYR B  2  145 ? 38.816  -54.841 -8.794  1.00 0.00 ? 144 TYR B O   1 
ATOM   2591  C CB  . TYR B  2  145 ? 38.709  -53.124 -6.234  1.00 0.00 ? 144 TYR B CB  1 
ATOM   2592  C CG  . TYR B  2  145 ? 39.241  -52.034 -5.333  1.00 0.00 ? 144 TYR B CG  1 
ATOM   2593  C CD1 . TYR B  2  145 ? 39.726  -50.848 -5.860  1.00 0.00 ? 144 TYR B CD1 1 
ATOM   2594  C CD2 . TYR B  2  145 ? 39.235  -52.184 -3.954  1.00 0.00 ? 144 TYR B CD2 1 
ATOM   2595  C CE1 . TYR B  2  145 ? 40.199  -49.844 -5.040  1.00 0.00 ? 144 TYR B CE1 1 
ATOM   2596  C CE2 . TYR B  2  145 ? 39.706  -51.186 -3.126  1.00 0.00 ? 144 TYR B CE2 1 
ATOM   2597  C CZ  . TYR B  2  145 ? 40.186  -50.019 -3.673  1.00 0.00 ? 144 TYR B CZ  1 
ATOM   2598  O OH  . TYR B  2  145 ? 40.661  -49.019 -2.854  1.00 0.00 ? 144 TYR B OH  1 
ATOM   2599  N N   . LEU B  2  146 ? 38.896  -56.338 -7.108  1.00 0.00 ? 145 LEU B N   1 
ATOM   2600  C CA  . LEU B  2  146 ? 38.333  -57.416 -7.872  1.00 0.00 ? 145 LEU B CA  1 
ATOM   2601  C C   . LEU B  2  146 ? 37.282  -57.930 -6.983  1.00 0.00 ? 145 LEU B C   1 
ATOM   2602  O O   . LEU B  2  146 ? 37.606  -58.313 -5.874  1.00 0.00 ? 145 LEU B O   1 
ATOM   2603  C CB  . LEU B  2  146 ? 39.359  -58.527 -8.127  1.00 0.00 ? 145 LEU B CB  1 
ATOM   2604  C CG  . LEU B  2  146 ? 38.830  -59.829 -8.757  1.00 0.00 ? 145 LEU B CG  1 
ATOM   2605  C CD1 . LEU B  2  146 ? 38.320  -59.613 -10.187 1.00 0.00 ? 145 LEU B CD1 1 
ATOM   2606  C CD2 . LEU B  2  146 ? 39.947  -60.878 -8.725  1.00 0.00 ? 145 LEU B CD2 1 
ATOM   2607  N N   . PHE B  2  147 ? 36.003  -57.897 -7.416  1.00 0.00 ? 146 PHE B N   1 
ATOM   2608  C CA  . PHE B  2  147 ? 34.856  -58.233 -6.613  1.00 0.00 ? 146 PHE B CA  1 
ATOM   2609  C C   . PHE B  2  147 ? 34.081  -59.287 -7.316  1.00 0.00 ? 146 PHE B C   1 
ATOM   2610  O O   . PHE B  2  147 ? 34.207  -59.453 -8.517  1.00 0.00 ? 146 PHE B O   1 
ATOM   2611  C CB  . PHE B  2  147 ? 33.917  -57.044 -6.354  1.00 0.00 ? 146 PHE B CB  1 
ATOM   2612  C CG  . PHE B  2  147 ? 34.469  -56.139 -5.288  1.00 0.00 ? 146 PHE B CG  1 
ATOM   2613  C CD1 . PHE B  2  147 ? 34.224  -56.443 -3.944  1.00 0.00 ? 146 PHE B CD1 1 
ATOM   2614  C CD2 . PHE B  2  147 ? 35.173  -54.962 -5.592  1.00 0.00 ? 146 PHE B CD2 1 
ATOM   2615  C CE1 . PHE B  2  147 ? 34.637  -55.582 -2.930  1.00 0.00 ? 146 PHE B CE1 1 
ATOM   2616  C CE2 . PHE B  2  147 ? 35.599  -54.105 -4.570  1.00 0.00 ? 146 PHE B CE2 1 
ATOM   2617  C CZ  . PHE B  2  147 ? 35.345  -54.422 -3.241  1.00 0.00 ? 146 PHE B CZ  1 
ATOM   2618  N N   . GLN B  2  148 ? 33.256  -60.044 -6.576  1.00 0.00 ? 147 GLN B N   1 
ATOM   2619  C CA  . GLN B  2  148 ? 32.360  -61.033 -7.098  1.00 0.00 ? 147 GLN B CA  1 
ATOM   2620  C C   . GLN B  2  148 ? 31.040  -60.728 -6.513  1.00 0.00 ? 147 GLN B C   1 
ATOM   2621  O O   . GLN B  2  148 ? 30.913  -61.044 -5.345  1.00 0.00 ? 147 GLN B O   1 
ATOM   2622  C CB  . GLN B  2  148 ? 32.735  -62.446 -6.608  1.00 0.00 ? 147 GLN B CB  1 
ATOM   2623  C CG  . GLN B  2  148 ? 31.748  -63.601 -6.852  1.00 0.00 ? 147 GLN B CG  1 
ATOM   2624  C CD  . GLN B  2  148 ? 31.708  -63.925 -8.337  1.00 0.00 ? 147 GLN B CD  1 
ATOM   2625  O OE1 . GLN B  2  148 ? 32.404  -64.827 -8.798  1.00 0.00 ? 147 GLN B OE1 1 
ATOM   2626  N NE2 . GLN B  2  148 ? 30.887  -63.155 -9.099  1.00 0.00 ? 147 GLN B NE2 1 
ATOM   2627  N N   . SER B  2  149 ? 30.012  -60.226 -7.242  1.00 0.00 ? 148 SER B N   1 
ATOM   2628  C CA  . SER B  2  149 ? 28.656  -60.231 -6.711  1.00 0.00 ? 148 SER B CA  1 
ATOM   2629  C C   . SER B  2  149 ? 27.960  -61.470 -7.192  1.00 0.00 ? 148 SER B C   1 
ATOM   2630  O O   . SER B  2  149 ? 28.237  -61.876 -8.311  1.00 0.00 ? 148 SER B O   1 
ATOM   2631  C CB  . SER B  2  149 ? 27.843  -58.993 -7.124  1.00 0.00 ? 148 SER B CB  1 
ATOM   2632  O OG  . SER B  2  149 ? 26.859  -58.680 -6.147  1.00 0.00 ? 148 SER B OG  1 
ATOM   2633  N N   . ASP B  2  150 ? 27.049  -62.100 -6.396  1.00 0.00 ? 149 ASP B N   1 
ATOM   2634  C CA  . ASP B  2  150 ? 26.365  -63.325 -6.783  1.00 0.00 ? 149 ASP B CA  1 
ATOM   2635  C C   . ASP B  2  150 ? 24.847  -63.169 -6.665  1.00 0.00 ? 149 ASP B C   1 
ATOM   2636  O O   . ASP B  2  150 ? 24.425  -62.093 -6.256  1.00 0.00 ? 149 ASP B O   1 
ATOM   2637  C CB  . ASP B  2  150 ? 26.961  -64.537 -5.995  1.00 0.00 ? 149 ASP B CB  1 
ATOM   2638  C CG  . ASP B  2  150 ? 28.375  -64.961 -6.404  1.00 0.00 ? 149 ASP B CG  1 
ATOM   2639  O OD1 . ASP B  2  150 ? 28.828  -64.526 -7.491  1.00 0.00 ? 149 ASP B OD1 1 
ATOM   2640  O OD2 . ASP B  2  150 ? 29.018  -65.711 -5.625  1.00 0.00 ? 149 ASP B OD2 1 
ATOM   2641  N N   . PRO B  2  151 ? 23.980  -64.124 -7.035  1.00 0.00 ? 150 PRO B N   1 
ATOM   2642  C CA  . PRO B  2  151 ? 22.525  -64.029 -7.020  1.00 0.00 ? 150 PRO B CA  1 
ATOM   2643  C C   . PRO B  2  151 ? 21.810  -63.639 -5.778  1.00 0.00 ? 150 PRO B C   1 
ATOM   2644  O O   . PRO B  2  151 ? 20.686  -63.175 -5.920  1.00 0.00 ? 150 PRO B O   1 
ATOM   2645  C CB  . PRO B  2  151 ? 22.047  -65.411 -7.390  1.00 0.00 ? 150 PRO B CB  1 
ATOM   2646  C CG  . PRO B  2  151 ? 23.082  -65.825 -8.419  1.00 0.00 ? 150 PRO B CG  1 
ATOM   2647  C CD  . PRO B  2  151 ? 24.375  -65.277 -7.827  1.00 0.00 ? 150 PRO B CD  1 
ATOM   2648  N N   . SER B  2  152 ? 22.382  -63.821 -4.572  1.00 0.00 ? 151 SER B N   1 
ATOM   2649  C CA  . SER B  2  152 ? 21.698  -63.491 -3.348  1.00 0.00 ? 151 SER B CA  1 
ATOM   2650  C C   . SER B  2  152 ? 22.038  -62.089 -2.962  1.00 0.00 ? 151 SER B C   1 
ATOM   2651  O O   . SER B  2  152 ? 21.496  -61.561 -2.003  1.00 0.00 ? 151 SER B O   1 
ATOM   2652  C CB  . SER B  2  152 ? 22.106  -64.399 -2.173  1.00 0.00 ? 151 SER B CB  1 
ATOM   2653  O OG  . SER B  2  152 ? 23.509  -64.451 -1.993  1.00 0.00 ? 151 SER B OG  1 
ATOM   2654  N N   . GLY B  2  153 ? 22.987  -61.457 -3.671  1.00 0.00 ? 152 GLY B N   1 
ATOM   2655  C CA  . GLY B  2  153 ? 23.444  -60.146 -3.339  1.00 0.00 ? 152 GLY B CA  1 
ATOM   2656  C C   . GLY B  2  153 ? 24.551  -60.236 -2.334  1.00 0.00 ? 152 GLY B C   1 
ATOM   2657  O O   . GLY B  2  153 ? 24.835  -59.264 -1.645  1.00 0.00 ? 152 GLY B O   1 
ATOM   2658  N N   . ALA B  2  154 ? 25.216  -61.406 -2.206  1.00 0.00 ? 153 ALA B N   1 
ATOM   2659  C CA  . ALA B  2  154 ? 26.382  -61.542 -1.376  1.00 0.00 ? 153 ALA B CA  1 
ATOM   2660  C C   . ALA B  2  154 ? 27.523  -61.217 -2.286  1.00 0.00 ? 153 ALA B C   1 
ATOM   2661  O O   . ALA B  2  154 ? 27.451  -61.526 -3.470  1.00 0.00 ? 153 ALA B O   1 
ATOM   2662  C CB  . ALA B  2  154 ? 26.549  -62.953 -0.812  1.00 0.00 ? 153 ALA B CB  1 
ATOM   2663  N N   . TYR B  2  155 ? 28.558  -60.500 -1.798  1.00 0.00 ? 154 TYR B N   1 
ATOM   2664  C CA  . TYR B  2  155 ? 29.648  -60.121 -2.630  1.00 0.00 ? 154 TYR B CA  1 
ATOM   2665  C C   . TYR B  2  155 ? 30.883  -60.275 -1.846  1.00 0.00 ? 154 TYR B C   1 
ATOM   2666  O O   . TYR B  2  155 ? 30.851  -60.154 -0.626  1.00 0.00 ? 154 TYR B O   1 
ATOM   2667  C CB  . TYR B  2  155 ? 29.540  -58.689 -3.202  1.00 0.00 ? 154 TYR B CB  1 
ATOM   2668  C CG  . TYR B  2  155 ? 29.799  -57.594 -2.205  1.00 0.00 ? 154 TYR B CG  1 
ATOM   2669  C CD1 . TYR B  2  155 ? 28.769  -57.056 -1.428  1.00 0.00 ? 154 TYR B CD1 1 
ATOM   2670  C CD2 . TYR B  2  155 ? 31.104  -57.131 -2.017  1.00 0.00 ? 154 TYR B CD2 1 
ATOM   2671  C CE1 . TYR B  2  155 ? 29.047  -56.108 -0.438  1.00 0.00 ? 154 TYR B CE1 1 
ATOM   2672  C CE2 . TYR B  2  155 ? 31.391  -56.192 -1.030  1.00 0.00 ? 154 TYR B CE2 1 
ATOM   2673  C CZ  . TYR B  2  155 ? 30.364  -55.701 -0.223  1.00 0.00 ? 154 TYR B CZ  1 
ATOM   2674  O OH  . TYR B  2  155 ? 30.677  -54.825 0.836   1.00 0.00 ? 154 TYR B OH  1 
ATOM   2675  N N   . PHE B  2  156 ? 32.013  -60.546 -2.534  1.00 0.00 ? 155 PHE B N   1 
ATOM   2676  C CA  . PHE B  2  156 ? 33.289  -60.721 -1.888  1.00 0.00 ? 155 PHE B CA  1 
ATOM   2677  C C   . PHE B  2  156 ? 34.320  -60.088 -2.775  1.00 0.00 ? 155 PHE B C   1 
ATOM   2678  O O   . PHE B  2  156 ? 34.311  -60.323 -3.969  1.00 0.00 ? 155 PHE B O   1 
ATOM   2679  C CB  . PHE B  2  156 ? 33.730  -62.205 -1.701  1.00 0.00 ? 155 PHE B CB  1 
ATOM   2680  C CG  . PHE B  2  156 ? 32.614  -63.081 -1.208  1.00 0.00 ? 155 PHE B CG  1 
ATOM   2681  C CD1 . PHE B  2  156 ? 32.341  -63.199 0.164   1.00 0.00 ? 155 PHE B CD1 1 
ATOM   2682  C CD2 . PHE B  2  156 ? 31.781  -63.746 -2.127  1.00 0.00 ? 155 PHE B CD2 1 
ATOM   2683  C CE1 . PHE B  2  156 ? 31.235  -63.933 0.612   1.00 0.00 ? 155 PHE B CE1 1 
ATOM   2684  C CE2 . PHE B  2  156 ? 30.669  -64.470 -1.684  1.00 0.00 ? 155 PHE B CE2 1 
ATOM   2685  C CZ  . PHE B  2  156 ? 30.394  -64.560 -0.314  1.00 0.00 ? 155 PHE B CZ  1 
ATOM   2686  N N   . ALA B  2  157 ? 35.303  -59.363 -2.194  1.00 0.00 ? 156 ALA B N   1 
ATOM   2687  C CA  . ALA B  2  157 ? 36.525  -58.974 -2.858  1.00 0.00 ? 156 ALA B CA  1 
ATOM   2688  C C   . ALA B  2  157 ? 37.435  -60.167 -2.902  1.00 0.00 ? 156 ALA B C   1 
ATOM   2689  O O   . ALA B  2  157 ? 37.380  -60.995 -2.004  1.00 0.00 ? 156 ALA B O   1 
ATOM   2690  C CB  . ALA B  2  157 ? 37.296  -57.871 -2.129  1.00 0.00 ? 156 ALA B CB  1 
ATOM   2691  N N   . TRP B  2  158 ? 38.231  -60.257 -3.966  1.00 0.00 ? 157 TRP B N   1 
ATOM   2692  C CA  . TRP B  2  158 ? 39.095  -61.397 -4.264  1.00 0.00 ? 157 TRP B CA  1 
ATOM   2693  C C   . TRP B  2  158 ? 40.463  -60.909 -4.728  1.00 0.00 ? 157 TRP B C   1 
ATOM   2694  O O   . TRP B  2  158 ? 40.620  -59.755 -5.126  1.00 0.00 ? 157 TRP B O   1 
ATOM   2695  C CB  . TRP B  2  158 ? 38.493  -62.240 -5.387  1.00 0.00 ? 157 TRP B CB  1 
ATOM   2696  C CG  . TRP B  2  158 ? 37.580  -63.332 -4.937  1.00 0.00 ? 157 TRP B CG  1 
ATOM   2697  C CD1 . TRP B  2  158 ? 36.285  -63.200 -4.540  1.00 0.00 ? 157 TRP B CD1 1 
ATOM   2698  C CD2 . TRP B  2  158 ? 37.883  -64.731 -4.855  1.00 0.00 ? 157 TRP B CD2 1 
ATOM   2699  N NE1 . TRP B  2  158 ? 35.762  -64.426 -4.210  1.00 0.00 ? 157 TRP B NE1 1 
ATOM   2700  C CE2 . TRP B  2  158 ? 36.725  -65.382 -4.392  1.00 0.00 ? 157 TRP B CE2 1 
ATOM   2701  C CE3 . TRP B  2  158 ? 39.024  -65.493 -5.119  1.00 0.00 ? 157 TRP B CE3 1 
ATOM   2702  C CZ2 . TRP B  2  158 ? 36.674  -66.756 -4.187  1.00 0.00 ? 157 TRP B CZ2 1 
ATOM   2703  C CZ3 . TRP B  2  158 ? 38.968  -66.859 -4.916  1.00 0.00 ? 157 TRP B CZ3 1 
ATOM   2704  C CH2 . TRP B  2  158 ? 37.802  -67.475 -4.454  1.00 0.00 ? 157 TRP B CH2 1 
ATOM   2705  N N   . LYS B  2  159 ? 41.457  -61.788 -4.670  1.00 0.00 ? 158 LYS B N   1 
ATOM   2706  C CA  . LYS B  2  159 ? 42.753  -61.520 -5.279  1.00 0.00 ? 158 LYS B CA  1 
ATOM   2707  C C   . LYS B  2  159 ? 42.813  -62.192 -6.654  1.00 0.00 ? 158 LYS B C   1 
ATOM   2708  O O   . LYS B  2  159 ? 43.571  -61.781 -7.532  1.00 0.00 ? 158 LYS B O   1 
ATOM   2709  C CB  . LYS B  2  159 ? 43.884  -62.033 -4.388  1.00 0.00 ? 158 LYS B CB  1 
ATOM   2710  C CG  . LYS B  2  159 ? 44.037  -61.273 -3.080  1.00 0.00 ? 158 LYS B CG  1 
ATOM   2711  C CD  . LYS B  2  159 ? 45.438  -61.429 -2.511  1.00 0.00 ? 158 LYS B CD  1 
ATOM   2712  C CE  . LYS B  2  159 ? 45.647  -62.819 -1.934  1.00 0.00 ? 158 LYS B CE  1 
ATOM   2713  N NZ  . LYS B  2  159 ? 44.626  -63.151 -0.902  1.00 0.00 ? 158 LYS B NZ  1 
ATOM   2714  N N   . ALA B  2  160 ? 41.994  -63.230 -6.821  1.00 0.00 ? 159 ALA B N   1 
ATOM   2715  C CA  . ALA B  2  160 ? 41.848  -63.933 -8.062  1.00 0.00 ? 159 ALA B CA  1 
ATOM   2716  C C   . ALA B  2  160 ? 40.620  -64.769 -7.913  1.00 0.00 ? 159 ALA B C   1 
ATOM   2717  O O   . ALA B  2  160 ? 40.332  -65.211 -6.807  1.00 0.00 ? 159 ALA B O   1 
ATOM   2718  C CB  . ALA B  2  160 ? 43.051  -64.804 -8.431  1.00 0.00 ? 159 ALA B CB  1 
ATOM   2719  N N   . THR B  2  161 ? 39.818  -64.940 -8.994  1.00 0.00 ? 160 THR B N   1 
ATOM   2720  C CA  . THR B  2  161 ? 38.534  -65.581 -8.886  1.00 0.00 ? 160 THR B CA  1 
ATOM   2721  C C   . THR B  2  161 ? 38.105  -65.984 -10.251 1.00 0.00 ? 160 THR B C   1 
ATOM   2722  O O   . THR B  2  161 ? 38.673  -65.514 -11.222 1.00 0.00 ? 160 THR B O   1 
ATOM   2723  C CB  . THR B  2  161 ? 37.515  -64.627 -8.308  1.00 0.00 ? 160 THR B CB  1 
ATOM   2724  O OG1 . THR B  2  161 ? 36.312  -65.265 -7.917  1.00 0.00 ? 160 THR B OG1 1 
ATOM   2725  C CG2 . THR B  2  161 ? 37.196  -63.486 -9.287  1.00 0.00 ? 160 THR B CG2 1 
ATOM   2726  N N   . ALA B  2  162 ? 37.066  -66.847 -10.358 1.00 0.00 ? 161 ALA B N   1 
ATOM   2727  C CA  . ALA B  2  162 ? 36.609  -67.346 -11.626 1.00 0.00 ? 161 ALA B CA  1 
ATOM   2728  C C   . ALA B  2  162 ? 35.131  -67.602 -11.527 1.00 0.00 ? 161 ALA B C   1 
ATOM   2729  O O   . ALA B  2  162 ? 34.629  -67.886 -10.449 1.00 0.00 ? 161 ALA B O   1 
ATOM   2730  C CB  . ALA B  2  162 ? 37.296  -68.671 -11.972 1.00 0.00 ? 161 ALA B CB  1 
ATOM   2731  N N   . MET B  2  163 ? 34.445  -67.531 -12.675 1.00 0.00 ? 162 MET B N   1 
ATOM   2732  C CA  . MET B  2  163 ? 32.990  -67.737 -12.778 1.00 0.00 ? 162 MET B CA  1 
ATOM   2733  C C   . MET B  2  163 ? 32.517  -68.444 -14.070 1.00 0.00 ? 162 MET B C   1 
ATOM   2734  O O   . MET B  2  163 ? 33.226  -68.462 -15.076 1.00 0.00 ? 162 MET B O   1 
ATOM   2735  C CB  . MET B  2  163 ? 32.252  -66.406 -12.615 1.00 0.00 ? 162 MET B CB  1 
ATOM   2736  C CG  . MET B  2  163 ? 32.725  -65.573 -11.434 1.00 0.00 ? 162 MET B CG  1 
ATOM   2737  S SD  . MET B  2  163 ? 31.885  -63.982 -11.324 1.00 0.00 ? 162 MET B SD  1 
ATOM   2738  C CE  . MET B  2  163 ? 31.499  -63.682 -13.047 1.00 0.00 ? 162 MET B CE  1 
ATOM   2739  N N   . GLY B  2  164 ? 31.312  -69.020 -14.019 1.00 0.00 ? 163 GLY B N   1 
ATOM   2740  C CA  . GLY B  2  164 ? 30.687  -69.703 -15.105 1.00 0.00 ? 163 GLY B CA  1 
ATOM   2741  C C   . GLY B  2  164 ? 30.953  -71.155 -15.026 1.00 0.00 ? 163 GLY B C   1 
ATOM   2742  O O   . GLY B  2  164 ? 31.117  -71.706 -13.943 1.00 0.00 ? 163 GLY B O   1 
ATOM   2743  N N   . LYS B  2  165 ? 31.015  -71.816 -16.203 1.00 0.00 ? 164 LYS B N   1 
ATOM   2744  C CA  . LYS B  2  165 ? 31.306  -73.220 -16.328 1.00 0.00 ? 164 LYS B CA  1 
ATOM   2745  C C   . LYS B  2  165 ? 32.682  -73.463 -15.832 1.00 0.00 ? 164 LYS B C   1 
ATOM   2746  O O   . LYS B  2  165 ? 33.595  -72.721 -16.165 1.00 0.00 ? 164 LYS B O   1 
ATOM   2747  C CB  . LYS B  2  165 ? 31.285  -73.741 -17.776 1.00 0.00 ? 164 LYS B CB  1 
ATOM   2748  C CG  . LYS B  2  165 ? 29.875  -73.874 -18.342 1.00 0.00 ? 164 LYS B CG  1 
ATOM   2749  C CD  . LYS B  2  165 ? 29.851  -74.296 -19.819 1.00 0.00 ? 164 LYS B CD  1 
ATOM   2750  C CE  . LYS B  2  165 ? 30.301  -73.196 -20.792 1.00 0.00 ? 164 LYS B CE  1 
ATOM   2751  N NZ  . LYS B  2  165 ? 30.276  -73.668 -22.198 1.00 0.00 ? 164 LYS B NZ  1 
ATOM   2752  N N   . ASN B  2  166 ? 32.843  -74.525 -15.027 1.00 0.00 ? 165 ASN B N   1 
ATOM   2753  C CA  . ASN B  2  166 ? 34.090  -74.997 -14.514 1.00 0.00 ? 165 ASN B CA  1 
ATOM   2754  C C   . ASN B  2  166 ? 34.889  -73.911 -13.844 1.00 0.00 ? 165 ASN B C   1 
ATOM   2755  O O   . ASN B  2  166 ? 36.097  -73.790 -14.020 1.00 0.00 ? 165 ASN B O   1 
ATOM   2756  C CB  . ASN B  2  166 ? 34.900  -75.729 -15.607 1.00 0.00 ? 165 ASN B CB  1 
ATOM   2757  C CG  . ASN B  2  166 ? 35.999  -76.590 -14.984 1.00 0.00 ? 165 ASN B CG  1 
ATOM   2758  O OD1 . ASN B  2  166 ? 36.091  -76.661 -13.754 1.00 0.00 ? 165 ASN B OD1 1 
ATOM   2759  N ND2 . ASN B  2  166 ? 36.836  -77.234 -15.850 1.00 0.00 ? 165 ASN B ND2 1 
ATOM   2760  N N   . TYR B  2  167 ? 34.219  -73.149 -12.963 1.00 0.00 ? 166 TYR B N   1 
ATOM   2761  C CA  . TYR B  2  167 ? 34.874  -72.249 -12.062 1.00 0.00 ? 166 TYR B CA  1 
ATOM   2762  C C   . TYR B  2  167 ? 35.591  -73.039 -11.011 1.00 0.00 ? 166 TYR B C   1 
ATOM   2763  O O   . TYR B  2  167 ? 36.509  -72.546 -10.370 1.00 0.00 ? 166 TYR B O   1 
ATOM   2764  C CB  . TYR B  2  167 ? 33.905  -71.265 -11.373 1.00 0.00 ? 166 TYR B CB  1 
ATOM   2765  C CG  . TYR B  2  167 ? 32.948  -71.884 -10.399 1.00 0.00 ? 166 TYR B CG  1 
ATOM   2766  C CD1 . TYR B  2  167 ? 31.864  -72.655 -10.837 1.00 0.00 ? 166 TYR B CD1 1 
ATOM   2767  C CD2 . TYR B  2  167 ? 33.166  -71.737 -9.025  1.00 0.00 ? 166 TYR B CD2 1 
ATOM   2768  C CE1 . TYR B  2  167 ? 31.008  -73.275 -9.918  1.00 0.00 ? 166 TYR B CE1 1 
ATOM   2769  C CE2 . TYR B  2  167 ? 32.322  -72.364 -8.097  1.00 0.00 ? 166 TYR B CE2 1 
ATOM   2770  C CZ  . TYR B  2  167 ? 31.242  -73.139 -8.544  1.00 0.00 ? 166 TYR B CZ  1 
ATOM   2771  O OH  . TYR B  2  167 ? 30.399  -73.794 -7.621  1.00 0.00 ? 166 TYR B OH  1 
ATOM   2772  N N   . VAL B  2  168 ? 35.108  -74.279 -10.773 1.00 0.00 ? 167 VAL B N   1 
ATOM   2773  C CA  . VAL B  2  168 ? 35.514  -75.134 -9.695  1.00 0.00 ? 167 VAL B CA  1 
ATOM   2774  C C   . VAL B  2  168 ? 36.958  -75.521 -9.799  1.00 0.00 ? 167 VAL B C   1 
ATOM   2775  O O   . VAL B  2  168 ? 37.667  -75.574 -8.796  1.00 0.00 ? 167 VAL B O   1 
ATOM   2776  C CB  . VAL B  2  168 ? 34.680  -76.397 -9.699  1.00 0.00 ? 167 VAL B CB  1 
ATOM   2777  C CG1 . VAL B  2  168 ? 34.808  -77.079 -8.322  1.00 0.00 ? 167 VAL B CG1 1 
ATOM   2778  C CG2 . VAL B  2  168 ? 33.214  -76.051 -10.033 1.00 0.00 ? 167 VAL B CG2 1 
ATOM   2779  N N   . ASN B  2  169 ? 37.421  -75.748 -11.048 1.00 0.00 ? 168 ASN B N   1 
ATOM   2780  C CA  . ASN B  2  169 ? 38.802  -75.980 -11.365 1.00 0.00 ? 168 ASN B CA  1 
ATOM   2781  C C   . ASN B  2  169 ? 39.531  -74.709 -11.659 1.00 0.00 ? 168 ASN B C   1 
ATOM   2782  O O   . ASN B  2  169 ? 40.735  -74.627 -11.434 1.00 0.00 ? 168 ASN B O   1 
ATOM   2783  C CB  . ASN B  2  169 ? 38.965  -77.001 -12.502 1.00 0.00 ? 168 ASN B CB  1 
ATOM   2784  C CG  . ASN B  2  169 ? 38.291  -78.318 -12.078 1.00 0.00 ? 168 ASN B CG  1 
ATOM   2785  O OD1 . ASN B  2  169 ? 37.393  -78.819 -12.756 1.00 0.00 ? 168 ASN B OD1 1 
ATOM   2786  N ND2 . ASN B  2  169 ? 38.744  -78.895 -10.921 1.00 0.00 ? 168 ASN B ND2 1 
ATOM   2787  N N   . GLY B  2  170 ? 38.823  -73.665 -12.147 1.00 0.00 ? 169 GLY B N   1 
ATOM   2788  C CA  . GLY B  2  170 ? 39.429  -72.419 -12.539 1.00 0.00 ? 169 GLY B CA  1 
ATOM   2789  C C   . GLY B  2  170 ? 40.000  -71.690 -11.366 1.00 0.00 ? 169 GLY B C   1 
ATOM   2790  O O   . GLY B  2  170 ? 41.095  -71.147 -11.433 1.00 0.00 ? 169 GLY B O   1 
ATOM   2791  N N   . LYS B  2  171 ? 39.302  -71.725 -10.215 1.00 0.00 ? 170 LYS B N   1 
ATOM   2792  C CA  . LYS B  2  171 ? 39.773  -71.168 -8.968  1.00 0.00 ? 170 LYS B CA  1 
ATOM   2793  C C   . LYS B  2  171 ? 40.946  -71.929 -8.434  1.00 0.00 ? 170 LYS B C   1 
ATOM   2794  O O   . LYS B  2  171 ? 41.785  -71.345 -7.754  1.00 0.00 ? 170 LYS B O   1 
ATOM   2795  C CB  . LYS B  2  171 ? 38.695  -71.049 -7.875  1.00 0.00 ? 170 LYS B CB  1 
ATOM   2796  C CG  . LYS B  2  171 ? 37.660  -69.969 -8.218  1.00 0.00 ? 170 LYS B CG  1 
ATOM   2797  C CD  . LYS B  2  171 ? 36.634  -69.716 -7.108  1.00 0.00 ? 170 LYS B CD  1 
ATOM   2798  C CE  . LYS B  2  171 ? 35.551  -68.726 -7.547  1.00 0.00 ? 170 LYS B CE  1 
ATOM   2799  N NZ  . LYS B  2  171 ? 34.503  -68.521 -6.530  1.00 0.00 ? 170 LYS B NZ  1 
ATOM   2800  N N   . THR B  2  172 ? 41.037  -73.250 -8.709  1.00 0.00 ? 171 THR B N   1 
ATOM   2801  C CA  . THR B  2  172 ? 42.110  -74.080 -8.214  1.00 0.00 ? 171 THR B CA  1 
ATOM   2802  C C   . THR B  2  172 ? 43.393  -73.708 -8.896  1.00 0.00 ? 171 THR B C   1 
ATOM   2803  O O   . THR B  2  172 ? 44.410  -73.560 -8.232  1.00 0.00 ? 171 THR B O   1 
ATOM   2804  C CB  . THR B  2  172 ? 41.872  -75.579 -8.361  1.00 0.00 ? 171 THR B CB  1 
ATOM   2805  O OG1 . THR B  2  172 ? 40.515  -75.901 -8.107  1.00 0.00 ? 171 THR B OG1 1 
ATOM   2806  C CG2 . THR B  2  172 ? 42.726  -76.340 -7.337  1.00 0.00 ? 171 THR B CG2 1 
ATOM   2807  N N   . PHE B  2  173 ? 43.331  -73.504 -10.207 1.00 0.00 ? 172 PHE B N   1 
ATOM   2808  C CA  . PHE B  2  173 ? 44.481  -73.038 -10.964 1.00 0.00 ? 172 PHE B CA  1 
ATOM   2809  C C   . PHE B  2  173 ? 44.906  -71.652 -10.487 1.00 0.00 ? 172 PHE B C   1 
ATOM   2810  O O   . PHE B  2  173 ? 46.099  -71.365 -10.384 1.00 0.00 ? 172 PHE B O   1 
ATOM   2811  C CB  . PHE B  2  173 ? 44.162  -73.006 -12.459 1.00 0.00 ? 172 PHE B CB  1 
ATOM   2812  C CG  . PHE B  2  173 ? 44.053  -74.367 -13.085 1.00 0.00 ? 172 PHE B CG  1 
ATOM   2813  C CD1 . PHE B  2  173 ? 45.160  -75.193 -13.175 1.00 0.00 ? 172 PHE B CD1 1 
ATOM   2814  C CD2 . PHE B  2  173 ? 42.842  -74.820 -13.583 1.00 0.00 ? 172 PHE B CD2 1 
ATOM   2815  C CE1 . PHE B  2  173 ? 45.064  -76.446 -13.750 1.00 0.00 ? 172 PHE B CE1 1 
ATOM   2816  C CE2 . PHE B  2  173 ? 42.739  -76.072 -14.159 1.00 0.00 ? 172 PHE B CE2 1 
ATOM   2817  C CZ  . PHE B  2  173 ? 43.851  -76.887 -14.243 1.00 0.00 ? 172 PHE B CZ  1 
ATOM   2818  N N   . LEU B  2  174 ? 43.931  -70.793 -10.200 1.00 0.00 ? 173 LEU B N   1 
ATOM   2819  C CA  . LEU B  2  174 ? 44.231  -69.457 -9.779  1.00 0.00 ? 173 LEU B CA  1 
ATOM   2820  C C   . LEU B  2  174 ? 44.919  -69.369 -8.436  1.00 0.00 ? 173 LEU B C   1 
ATOM   2821  O O   . LEU B  2  174 ? 45.530  -68.338 -8.166  1.00 0.00 ? 173 LEU B O   1 
ATOM   2822  C CB  . LEU B  2  174 ? 42.973  -68.588 -9.745  1.00 0.00 ? 173 LEU B CB  1 
ATOM   2823  C CG  . LEU B  2  174 ? 42.547  -68.175 -11.153 1.00 0.00 ? 173 LEU B CG  1 
ATOM   2824  C CD1 . LEU B  2  174 ? 41.111  -67.662 -11.130 1.00 0.00 ? 173 LEU B CD1 1 
ATOM   2825  C CD2 . LEU B  2  174 ? 43.489  -67.123 -11.763 1.00 0.00 ? 173 LEU B CD2 1 
ATOM   2826  N N   . GLU B  2  175 ? 44.862  -70.399 -7.556  1.00 0.00 ? 174 GLU B N   1 
ATOM   2827  C CA  . GLU B  2  175 ? 45.540  -70.299 -6.291  1.00 0.00 ? 174 GLU B CA  1 
ATOM   2828  C C   . GLU B  2  175 ? 46.896  -70.946 -6.291  1.00 0.00 ? 174 GLU B C   1 
ATOM   2829  O O   . GLU B  2  175 ? 47.714  -70.615 -5.434  1.00 0.00 ? 174 GLU B O   1 
ATOM   2830  C CB  . GLU B  2  175 ? 44.716  -70.884 -5.143  1.00 0.00 ? 174 GLU B CB  1 
ATOM   2831  C CG  . GLU B  2  175 ? 44.328  -72.362 -5.262  1.00 0.00 ? 174 GLU B CG  1 
ATOM   2832  C CD  . GLU B  2  175 ? 43.685  -72.833 -3.955  1.00 0.00 ? 174 GLU B CD  1 
ATOM   2833  O OE1 . GLU B  2  175 ? 43.525  -72.000 -3.022  1.00 0.00 ? 174 GLU B OE1 1 
ATOM   2834  O OE2 . GLU B  2  175 ? 43.358  -74.046 -3.874  1.00 0.00 ? 174 GLU B OE2 1 
ATOM   2835  N N   . LYS B  2  176 ? 47.185  -71.856 -7.255  1.00 0.00 ? 175 LYS B N   1 
ATOM   2836  C CA  . LYS B  2  176 ? 48.467  -72.512 -7.352  1.00 0.00 ? 175 LYS B CA  1 
ATOM   2837  C C   . LYS B  2  176 ? 49.286  -71.972 -8.486  1.00 0.00 ? 175 LYS B C   1 
ATOM   2838  O O   . LYS B  2  176 ? 50.480  -71.753 -8.308  1.00 0.00 ? 175 LYS B O   1 
ATOM   2839  C CB  . LYS B  2  176 ? 48.370  -74.042 -7.461  1.00 0.00 ? 175 LYS B CB  1 
ATOM   2840  C CG  . LYS B  2  176 ? 47.642  -74.621 -8.678  1.00 0.00 ? 175 LYS B CG  1 
ATOM   2841  C CD  . LYS B  2  176 ? 47.599  -76.152 -8.597  1.00 0.00 ? 175 LYS B CD  1 
ATOM   2842  C CE  . LYS B  2  176 ? 46.741  -76.818 -9.667  1.00 0.00 ? 175 LYS B CE  1 
ATOM   2843  N NZ  . LYS B  2  176 ? 45.328  -76.441 -9.515  1.00 0.00 ? 175 LYS B NZ  1 
ATOM   2844  N N   . ARG B  2  177 ? 48.699  -71.711 -9.678  1.00 0.00 ? 176 ARG B N   1 
ATOM   2845  C CA  . ARG B  2  177 ? 49.433  -71.166 -10.794 1.00 0.00 ? 176 ARG B CA  1 
ATOM   2846  C C   . ARG B  2  177 ? 49.750  -69.720 -10.554 1.00 0.00 ? 176 ARG B C   1 
ATOM   2847  O O   . ARG B  2  177 ? 50.599  -69.176 -11.255 1.00 0.00 ? 176 ARG B O   1 
ATOM   2848  C CB  . ARG B  2  177 ? 48.685  -71.161 -12.152 1.00 0.00 ? 176 ARG B CB  1 
ATOM   2849  C CG  . ARG B  2  177 ? 48.186  -72.526 -12.658 1.00 0.00 ? 176 ARG B CG  1 
ATOM   2850  C CD  . ARG B  2  177 ? 49.230  -73.325 -13.449 1.00 0.00 ? 176 ARG B CD  1 
ATOM   2851  N NE  . ARG B  2  177 ? 48.805  -74.759 -13.532 1.00 0.00 ? 176 ARG B NE  1 
ATOM   2852  C CZ  . ARG B  2  177 ? 49.120  -75.672 -12.564 1.00 0.00 ? 176 ARG B CZ  1 
ATOM   2853  N NH1 . ARG B  2  177 ? 49.794  -75.304 -11.440 1.00 0.00 ? 176 ARG B NH1 1 
ATOM   2854  N NH2 . ARG B  2  177 ? 48.773  -76.980 -12.723 1.00 0.00 ? 176 ARG B NH2 1 
ATOM   2855  N N   . TYR B  2  178 ? 49.042  -69.094 -9.623  1.00 0.00 ? 177 TYR B N   1 
ATOM   2856  C CA  . TYR B  2  178 ? 49.277  -67.694 -9.315  1.00 0.00 ? 177 TYR B CA  1 
ATOM   2857  C C   . TYR B  2  178 ? 49.201  -67.410 -7.821  1.00 0.00 ? 177 TYR B C   1 
ATOM   2858  O O   . TYR B  2  178 ? 48.436  -68.038 -7.089  1.00 0.00 ? 177 TYR B O   1 
ATOM   2859  C CB  . TYR B  2  178 ? 48.281  -66.808 -10.066 1.00 0.00 ? 177 TYR B CB  1 
ATOM   2860  C CG  . TYR B  2  178 ? 48.418  -65.334 -9.758  1.00 0.00 ? 177 TYR B CG  1 
ATOM   2861  C CD1 . TYR B  2  178 ? 49.661  -64.715 -9.768  1.00 0.00 ? 177 TYR B CD1 1 
ATOM   2862  C CD2 . TYR B  2  178 ? 47.305  -64.561 -9.456  1.00 0.00 ? 177 TYR B CD2 1 
ATOM   2863  C CE1 . TYR B  2  178 ? 49.792  -63.368 -9.486  1.00 0.00 ? 177 TYR B CE1 1 
ATOM   2864  C CE2 . TYR B  2  178 ? 47.426  -63.213 -9.173  1.00 0.00 ? 177 TYR B CE2 1 
ATOM   2865  C CZ  . TYR B  2  178 ? 48.672  -62.623 -9.190  1.00 0.00 ? 177 TYR B CZ  1 
ATOM   2866  O OH  . TYR B  2  178 ? 48.797  -61.282 -8.909  1.00 0.00 ? 177 TYR B OH  1 
ATOM   2867  N N   . ASN B  2  179 ? 49.999  -66.443 -7.389  1.00 0.00 ? 178 ASN B N   1 
ATOM   2868  C CA  . ASN B  2  179 ? 49.919  -65.894 -6.064  1.00 0.00 ? 178 ASN B CA  1 
ATOM   2869  C C   . ASN B  2  179 ? 50.744  -64.632 -5.994  1.00 0.00 ? 178 ASN B C   1 
ATOM   2870  O O   . ASN B  2  179 ? 51.593  -64.386 -6.852  1.00 0.00 ? 178 ASN B O   1 
ATOM   2871  C CB  . ASN B  2  179 ? 50.383  -66.874 -4.941  1.00 0.00 ? 178 ASN B CB  1 
ATOM   2872  C CG  . ASN B  2  179 ? 51.832  -67.405 -5.059  1.00 0.00 ? 178 ASN B CG  1 
ATOM   2873  O OD1 . ASN B  2  179 ? 52.598  -67.070 -5.969  1.00 0.00 ? 178 ASN B OD1 1 
ATOM   2874  N ND2 . ASN B  2  179 ? 52.195  -68.280 -4.070  1.00 0.00 ? 178 ASN B ND2 1 
ATOM   2875  N N   . GLU B  2  180 ? 50.505  -63.919 -4.899  1.00 0.00 ? 179 GLU B N   1 
ATOM   2876  C CA  . GLU B  2  180 ? 51.142  -62.661 -4.673  1.00 0.00 ? 179 GLU B CA  1 
ATOM   2877  C C   . GLU B  2  180 ? 50.692  -61.789 -5.809  1.00 0.00 ? 179 GLU B C   1 
ATOM   2878  O O   . GLU B  2  180 ? 49.509  -61.505 -5.999  1.00 0.00 ? 179 GLU B O   1 
ATOM   2879  C CB  . GLU B  2  180 ? 52.662  -62.814 -4.691  1.00 0.00 ? 179 GLU B CB  1 
ATOM   2880  C CG  . GLU B  2  180 ? 53.365  -62.168 -3.508  1.00 0.00 ? 179 GLU B CG  1 
ATOM   2881  C CD  . GLU B  2  180 ? 54.855  -62.004 -3.733  1.00 0.00 ? 179 GLU B CD  1 
ATOM   2882  O OE1 . GLU B  2  180 ? 55.515  -63.000 -4.097  1.00 0.00 ? 179 GLU B OE1 1 
ATOM   2883  O OE2 . GLU B  2  180 ? 55.366  -60.881 -3.545  1.00 0.00 ? 179 GLU B OE2 1 
ATOM   2884  N N   . ASP B  2  181 ? 51.689  -61.364 -6.550  1.00 0.00 ? 180 ASP B N   1 
ATOM   2885  C CA  . ASP B  2  181 ? 51.614  -60.294 -7.491  1.00 0.00 ? 180 ASP B CA  1 
ATOM   2886  C C   . ASP B  2  181 ? 52.225  -60.831 -8.733  1.00 0.00 ? 180 ASP B C   1 
ATOM   2887  O O   . ASP B  2  181 ? 53.051  -61.745 -8.685  1.00 0.00 ? 180 ASP B O   1 
ATOM   2888  C CB  . ASP B  2  181 ? 52.341  -58.967 -7.061  1.00 0.00 ? 180 ASP B CB  1 
ATOM   2889  C CG  . ASP B  2  181 ? 53.864  -59.039 -6.813  1.00 0.00 ? 180 ASP B CG  1 
ATOM   2890  O OD1 . ASP B  2  181 ? 54.451  -60.146 -6.886  1.00 0.00 ? 180 ASP B OD1 1 
ATOM   2891  O OD2 . ASP B  2  181 ? 54.455  -57.953 -6.591  1.00 0.00 ? 180 ASP B OD2 1 
ATOM   2892  N N   . LEU B  2  182 ? 51.878  -60.187 -9.853  1.00 0.00 ? 181 LEU B N   1 
ATOM   2893  C CA  . LEU B  2  182 ? 52.398  -60.495 -11.187 1.00 0.00 ? 181 LEU B CA  1 
ATOM   2894  C C   . LEU B  2  182 ? 52.085  -59.353 -12.171 1.00 0.00 ? 181 LEU B C   1 
ATOM   2895  O O   . LEU B  2  182 ? 50.925  -58.973 -12.323 1.00 0.00 ? 181 LEU B O   1 
ATOM   2896  C CB  . LEU B  2  182 ? 51.769  -61.791 -11.695 1.00 0.00 ? 181 LEU B CB  1 
ATOM   2897  C CG  . LEU B  2  182 ? 52.106  -62.285 -13.103 1.00 0.00 ? 181 LEU B CG  1 
ATOM   2898  C CD1 . LEU B  2  182 ? 53.591  -62.598 -13.198 1.00 0.00 ? 181 LEU B CD1 1 
ATOM   2899  C CD2 . LEU B  2  182 ? 51.268  -63.493 -13.494 1.00 0.00 ? 181 LEU B CD2 1 
ATOM   2900  N N   . GLU B  2  183 ? 53.077  -58.942 -12.955 1.00 0.00 ? 182 GLU B N   1 
ATOM   2901  C CA  . GLU B  2  183 ? 52.914  -57.806 -13.863 1.00 0.00 ? 182 GLU B CA  1 
ATOM   2902  C C   . GLU B  2  183 ? 51.747  -58.032 -14.823 1.00 0.00 ? 182 GLU B C   1 
ATOM   2903  O O   . GLU B  2  183 ? 51.532  -59.140 -15.314 1.00 0.00 ? 182 GLU B O   1 
ATOM   2904  C CB  . GLU B  2  183 ? 54.208  -57.564 -14.649 1.00 0.00 ? 182 GLU B CB  1 
ATOM   2905  C CG  . GLU B  2  183 ? 54.042  -56.733 -15.914 1.00 0.00 ? 182 GLU B CG  1 
ATOM   2906  C CD  . GLU B  2  183 ? 55.241  -56.828 -16.839 1.00 0.00 ? 182 GLU B CD  1 
ATOM   2907  O OE1 . GLU B  2  183 ? 56.182  -57.584 -16.518 1.00 0.00 ? 182 GLU B OE1 1 
ATOM   2908  O OE2 . GLU B  2  183 ? 55.243  -56.149 -17.886 1.00 0.00 ? 182 GLU B OE2 1 
ATOM   2909  N N   . LEU B  2  184 ? 50.999  -57.007 -15.194 1.00 0.00 ? 183 LEU B N   1 
ATOM   2910  C CA  . LEU B  2  184 ? 49.597  -57.219 -15.542 1.00 0.00 ? 183 LEU B CA  1 
ATOM   2911  C C   . LEU B  2  184 ? 49.343  -58.265 -16.644 1.00 0.00 ? 183 LEU B C   1 
ATOM   2912  O O   . LEU B  2  184 ? 48.405  -59.060 -16.529 1.00 0.00 ? 183 LEU B O   1 
ATOM   2913  C CB  . LEU B  2  184 ? 48.919  -55.890 -15.902 1.00 0.00 ? 183 LEU B CB  1 
ATOM   2914  C CG  . LEU B  2  184 ? 47.404  -55.854 -16.119 1.00 0.00 ? 183 LEU B CG  1 
ATOM   2915  C CD1 . LEU B  2  184 ? 46.828  -54.521 -15.668 1.00 0.00 ? 183 LEU B CD1 1 
ATOM   2916  C CD2 . LEU B  2  184 ? 47.074  -56.121 -17.583 1.00 0.00 ? 183 LEU B CD2 1 
ATOM   2917  N N   . GLU B  2  185 ? 50.165  -58.290 -17.687 1.00 0.00 ? 184 GLU B N   1 
ATOM   2918  C CA  . GLU B  2  185 ? 50.056  -59.293 -18.705 1.00 0.00 ? 184 GLU B CA  1 
ATOM   2919  C C   . GLU B  2  185 ? 50.489  -60.641 -18.247 1.00 0.00 ? 184 GLU B C   1 
ATOM   2920  O O   . GLU B  2  185 ? 50.013  -61.656 -18.743 1.00 0.00 ? 184 GLU B O   1 
ATOM   2921  C CB  . GLU B  2  185 ? 50.838  -58.869 -19.953 1.00 0.00 ? 184 GLU B CB  1 
ATOM   2922  C CG  . GLU B  2  185 ? 52.303  -58.527 -19.644 1.00 0.00 ? 184 GLU B CG  1 
ATOM   2923  C CD  . GLU B  2  185 ? 53.035  -58.099 -20.898 1.00 0.00 ? 184 GLU B CD  1 
ATOM   2924  O OE1 . GLU B  2  185 ? 52.374  -57.880 -21.946 1.00 0.00 ? 184 GLU B OE1 1 
ATOM   2925  O OE2 . GLU B  2  185 ? 54.284  -57.981 -20.816 1.00 0.00 ? 184 GLU B OE2 1 
ATOM   2926  N N   . ASP B  2  186 ? 51.406  -60.682 -17.277 1.00 0.00 ? 185 ASP B N   1 
ATOM   2927  C CA  . ASP B  2  186 ? 51.835  -61.876 -16.621 1.00 0.00 ? 185 ASP B CA  1 
ATOM   2928  C C   . ASP B  2  186 ? 50.758  -62.514 -15.755 1.00 0.00 ? 185 ASP B C   1 
ATOM   2929  O O   . ASP B  2  186 ? 50.649  -63.733 -15.648 1.00 0.00 ? 185 ASP B O   1 
ATOM   2930  C CB  . ASP B  2  186 ? 53.170  -61.604 -15.928 1.00 0.00 ? 185 ASP B CB  1 
ATOM   2931  C CG  . ASP B  2  186 ? 54.155  -61.239 -17.041 1.00 0.00 ? 185 ASP B CG  1 
ATOM   2932  O OD1 . ASP B  2  186 ? 54.370  -62.109 -17.925 1.00 0.00 ? 185 ASP B OD1 1 
ATOM   2933  O OD2 . ASP B  2  186 ? 54.682  -60.100 -17.049 1.00 0.00 ? 185 ASP B OD2 1 
ATOM   2934  N N   . ALA B  2  187 ? 49.877  -61.688 -15.152 1.00 0.00 ? 186 ALA B N   1 
ATOM   2935  C CA  . ALA B  2  187 ? 48.724  -62.135 -14.417 1.00 0.00 ? 186 ALA B CA  1 
ATOM   2936  C C   . ALA B  2  187 ? 47.573  -62.353 -15.359 1.00 0.00 ? 186 ALA B C   1 
ATOM   2937  O O   . ALA B  2  187 ? 46.602  -62.970 -14.939 1.00 0.00 ? 186 ALA B O   1 
ATOM   2938  C CB  . ALA B  2  187 ? 48.272  -61.142 -13.346 1.00 0.00 ? 186 ALA B CB  1 
ATOM   2939  N N   . ILE B  2  188 ? 47.691  -61.913 -16.661 1.00 0.00 ? 187 ILE B N   1 
ATOM   2940  C CA  . ILE B  2  188 ? 46.806  -62.257 -17.777 1.00 0.00 ? 187 ILE B CA  1 
ATOM   2941  C C   . ILE B  2  188 ? 47.234  -63.617 -18.282 1.00 0.00 ? 187 ILE B C   1 
ATOM   2942  O O   . ILE B  2  188 ? 46.454  -64.327 -18.898 1.00 0.00 ? 187 ILE B O   1 
ATOM   2943  C CB  . ILE B  2  188 ? 46.805  -61.272 -18.960 1.00 0.00 ? 187 ILE B CB  1 
ATOM   2944  C CG1 . ILE B  2  188 ? 46.362  -59.880 -18.487 1.00 0.00 ? 187 ILE B CG1 1 
ATOM   2945  C CG2 . ILE B  2  188 ? 45.856  -61.728 -20.083 1.00 0.00 ? 187 ILE B CG2 1 
ATOM   2946  C CD1 . ILE B  2  188 ? 46.352  -58.779 -19.561 1.00 0.00 ? 187 ILE B CD1 1 
ATOM   2947  N N   . HIS B  2  189 ? 48.472  -64.065 -17.988 1.00 0.00 ? 188 HIS B N   1 
ATOM   2948  C CA  . HIS B  2  189 ? 48.989  -65.341 -18.395 1.00 0.00 ? 188 HIS B CA  1 
ATOM   2949  C C   . HIS B  2  189 ? 48.192  -66.396 -17.745 1.00 0.00 ? 188 HIS B C   1 
ATOM   2950  O O   . HIS B  2  189 ? 47.750  -67.339 -18.386 1.00 0.00 ? 188 HIS B O   1 
ATOM   2951  C CB  . HIS B  2  189 ? 50.464  -65.557 -18.034 1.00 0.00 ? 188 HIS B CB  1 
ATOM   2952  C CG  . HIS B  2  189 ? 51.131  -66.598 -18.875 1.00 0.00 ? 188 HIS B CG  1 
ATOM   2953  N ND1 . HIS B  2  189 ? 51.511  -66.398 -20.185 1.00 0.00 ? 188 HIS B ND1 1 
ATOM   2954  C CD2 . HIS B  2  189 ? 51.546  -67.846 -18.556 1.00 0.00 ? 188 HIS B CD2 1 
ATOM   2955  C CE1 . HIS B  2  189 ? 52.141  -67.528 -20.582 1.00 0.00 ? 188 HIS B CE1 1 
ATOM   2956  N NE2 . HIS B  2  189 ? 52.188  -68.434 -19.631 1.00 0.00 ? 188 HIS B NE2 1 
ATOM   2957  N N   . THR B  2  190 ? 47.945  -66.226 -16.432 1.00 0.00 ? 189 THR B N   1 
ATOM   2958  C CA  . THR B  2  190 ? 47.107  -67.118 -15.676 1.00 0.00 ? 189 THR B CA  1 
ATOM   2959  C C   . THR B  2  190 ? 45.670  -66.989 -16.116 1.00 0.00 ? 189 THR B C   1 
ATOM   2960  O O   . THR B  2  190 ? 44.906  -67.910 -15.899 1.00 0.00 ? 189 THR B O   1 
ATOM   2961  C CB  . THR B  2  190 ? 47.309  -67.028 -14.169 1.00 0.00 ? 189 THR B CB  1 
ATOM   2962  O OG1 . THR B  2  190 ? 46.612  -68.061 -13.491 1.00 0.00 ? 189 THR B OG1 1 
ATOM   2963  C CG2 . THR B  2  190 ? 46.870  -65.680 -13.611 1.00 0.00 ? 189 THR B CG2 1 
ATOM   2964  N N   . ALA B  2  191 ? 45.233  -65.862 -16.736 1.00 0.00 ? 190 ALA B N   1 
ATOM   2965  C CA  . ALA B  2  191 ? 43.867  -65.748 -17.196 1.00 0.00 ? 190 ALA B CA  1 
ATOM   2966  C C   . ALA B  2  191 ? 43.652  -66.576 -18.395 1.00 0.00 ? 190 ALA B C   1 
ATOM   2967  O O   . ALA B  2  191 ? 42.708  -67.345 -18.483 1.00 0.00 ? 190 ALA B O   1 
ATOM   2968  C CB  . ALA B  2  191 ? 43.480  -64.334 -17.663 1.00 0.00 ? 190 ALA B CB  1 
ATOM   2969  N N   . ILE B  2  192 ? 44.526  -66.396 -19.383 1.00 0.00 ? 191 ILE B N   1 
ATOM   2970  C CA  . ILE B  2  192 ? 44.417  -67.065 -20.635 1.00 0.00 ? 191 ILE B CA  1 
ATOM   2971  C C   . ILE B  2  192 ? 44.640  -68.558 -20.486 1.00 0.00 ? 191 ILE B C   1 
ATOM   2972  O O   . ILE B  2  192 ? 44.066  -69.325 -21.253 1.00 0.00 ? 191 ILE B O   1 
ATOM   2973  C CB  . ILE B  2  192 ? 45.303  -66.333 -21.657 1.00 0.00 ? 191 ILE B CB  1 
ATOM   2974  C CG1 . ILE B  2  192 ? 44.761  -66.425 -23.097 1.00 0.00 ? 191 ILE B CG1 1 
ATOM   2975  C CG2 . ILE B  2  192 ? 46.787  -66.757 -21.587 1.00 0.00 ? 191 ILE B CG2 1 
ATOM   2976  C CD1 . ILE B  2  192 ? 43.576  -65.495 -23.364 1.00 0.00 ? 191 ILE B CD1 1 
ATOM   2977  N N   . LEU B  2  193 ? 45.447  -68.995 -19.481 1.00 0.00 ? 192 LEU B N   1 
ATOM   2978  C CA  . LEU B  2  193 ? 45.706  -70.391 -19.180 1.00 0.00 ? 192 LEU B CA  1 
ATOM   2979  C C   . LEU B  2  193 ? 44.828  -71.068 -18.139 1.00 0.00 ? 192 LEU B C   1 
ATOM   2980  O O   . LEU B  2  193 ? 44.859  -72.291 -18.001 1.00 0.00 ? 192 LEU B O   1 
ATOM   2981  C CB  . LEU B  2  193 ? 47.187  -70.613 -18.827 1.00 0.00 ? 192 LEU B CB  1 
ATOM   2982  C CG  . LEU B  2  193 ? 48.136  -70.268 -20.000 1.00 0.00 ? 192 LEU B CG  1 
ATOM   2983  C CD1 . LEU B  2  193 ? 49.594  -70.513 -19.589 1.00 0.00 ? 192 LEU B CD1 1 
ATOM   2984  C CD2 . LEU B  2  193 ? 47.827  -71.041 -21.302 1.00 0.00 ? 192 LEU B CD2 1 
ATOM   2985  N N   . THR B  2  194 ? 44.024  -70.308 -17.369 1.00 0.00 ? 193 THR B N   1 
ATOM   2986  C CA  . THR B  2  194 ? 43.035  -70.851 -16.458 1.00 0.00 ? 193 THR B CA  1 
ATOM   2987  C C   . THR B  2  194 ? 41.751  -70.973 -17.222 1.00 0.00 ? 193 THR B C   1 
ATOM   2988  O O   . THR B  2  194 ? 40.978  -71.902 -17.010 1.00 0.00 ? 193 THR B O   1 
ATOM   2989  C CB  . THR B  2  194 ? 42.857  -70.009 -15.207 1.00 0.00 ? 193 THR B CB  1 
ATOM   2990  O OG1 . THR B  2  194 ? 44.023  -70.147 -14.417 1.00 0.00 ? 193 THR B OG1 1 
ATOM   2991  C CG2 . THR B  2  194 ? 41.664  -70.467 -14.369 1.00 0.00 ? 193 THR B CG2 1 
ATOM   2992  N N   . LEU B  2  195 ? 41.486  -70.015 -18.134 1.00 0.00 ? 194 LEU B N   1 
ATOM   2993  C CA  . LEU B  2  195 ? 40.330  -69.999 -18.993 1.00 0.00 ? 194 LEU B CA  1 
ATOM   2994  C C   . LEU B  2  195 ? 40.404  -71.163 -19.934 1.00 0.00 ? 194 LEU B C   1 
ATOM   2995  O O   . LEU B  2  195 ? 39.382  -71.686 -20.369 1.00 0.00 ? 194 LEU B O   1 
ATOM   2996  C CB  . LEU B  2  195 ? 40.321  -68.695 -19.820 1.00 0.00 ? 194 LEU B CB  1 
ATOM   2997  C CG  . LEU B  2  195 ? 39.080  -68.367 -20.665 1.00 0.00 ? 194 LEU B CG  1 
ATOM   2998  C CD1 . LEU B  2  195 ? 37.973  -67.732 -19.806 1.00 0.00 ? 194 LEU B CD1 1 
ATOM   2999  C CD2 . LEU B  2  195 ? 39.483  -67.432 -21.818 1.00 0.00 ? 194 LEU B CD2 1 
ATOM   3000  N N   . LYS B  2  196 ? 41.652  -71.584 -20.254 1.00 0.00 ? 195 LYS B N   1 
ATOM   3001  C CA  . LYS B  2  196 ? 41.985  -72.691 -21.102 1.00 0.00 ? 195 LYS B CA  1 
ATOM   3002  C C   . LYS B  2  196 ? 41.538  -74.026 -20.578 1.00 0.00 ? 195 LYS B C   1 
ATOM   3003  O O   . LYS B  2  196 ? 41.249  -74.943 -21.343 1.00 0.00 ? 195 LYS B O   1 
ATOM   3004  C CB  . LYS B  2  196 ? 43.485  -72.711 -21.472 1.00 0.00 ? 195 LYS B CB  1 
ATOM   3005  C CG  . LYS B  2  196 ? 43.795  -73.485 -22.766 1.00 0.00 ? 195 LYS B CG  1 
ATOM   3006  C CD  . LYS B  2  196 ? 42.901  -73.094 -23.961 1.00 0.00 ? 195 LYS B CD  1 
ATOM   3007  C CE  . LYS B  2  196 ? 43.227  -73.840 -25.244 1.00 0.00 ? 195 LYS B CE  1 
ATOM   3008  N NZ  . LYS B  2  196 ? 42.204  -73.545 -26.261 1.00 0.00 ? 195 LYS B NZ  1 
ATOM   3009  N N   . GLU B  2  197 ? 41.438  -74.156 -19.243 1.00 0.00 ? 196 GLU B N   1 
ATOM   3010  C CA  . GLU B  2  197 ? 40.988  -75.349 -18.562 1.00 0.00 ? 196 GLU B CA  1 
ATOM   3011  C C   . GLU B  2  197 ? 39.555  -75.668 -18.920 1.00 0.00 ? 196 GLU B C   1 
ATOM   3012  O O   . GLU B  2  197 ? 39.158  -76.829 -18.997 1.00 0.00 ? 196 GLU B O   1 
ATOM   3013  C CB  . GLU B  2  197 ? 41.010  -75.093 -17.027 1.00 0.00 ? 196 GLU B CB  1 
ATOM   3014  C CG  . GLU B  2  197 ? 40.601  -76.261 -16.112 1.00 0.00 ? 196 GLU B CG  1 
ATOM   3015  C CD  . GLU B  2  197 ? 41.656  -77.366 -16.052 1.00 0.00 ? 196 GLU B CD  1 
ATOM   3016  O OE1 . GLU B  2  197 ? 42.832  -77.122 -16.430 1.00 0.00 ? 196 GLU B OE1 1 
ATOM   3017  O OE2 . GLU B  2  197 ? 41.296  -78.475 -15.583 1.00 0.00 ? 196 GLU B OE2 1 
ATOM   3018  N N   . SER B  2  198 ? 38.766  -74.609 -19.064 1.00 0.00 ? 197 SER B N   1 
ATOM   3019  C CA  . SER B  2  198 ? 37.349  -74.736 -19.345 1.00 0.00 ? 197 SER B CA  1 
ATOM   3020  C C   . SER B  2  198 ? 36.969  -74.450 -20.792 1.00 0.00 ? 197 SER B C   1 
ATOM   3021  O O   . SER B  2  198 ? 35.830  -74.706 -21.178 1.00 0.00 ? 197 SER B O   1 
ATOM   3022  C CB  . SER B  2  198 ? 36.565  -73.799 -18.425 1.00 0.00 ? 197 SER B CB  1 
ATOM   3023  O OG  . SER B  2  198 ? 37.181  -73.710 -17.152 1.00 0.00 ? 197 SER B OG  1 
ATOM   3024  N N   . ASN B  2  207 ? 36.650  -65.246 -30.592 1.00 0.00 ? 206 ASN B N   1 
ATOM   3025  C CA  . ASN B  2  207 ? 35.644  -65.669 -29.657 1.00 0.00 ? 206 ASN B CA  1 
ATOM   3026  C C   . ASN B  2  207 ? 35.676  -64.908 -28.385 1.00 0.00 ? 206 ASN B C   1 
ATOM   3027  O O   . ASN B  2  207 ? 34.649  -64.441 -27.923 1.00 0.00 ? 206 ASN B O   1 
ATOM   3028  C CB  . ASN B  2  207 ? 35.828  -67.147 -29.244 1.00 0.00 ? 206 ASN B CB  1 
ATOM   3029  C CG  . ASN B  2  207 ? 35.966  -68.000 -30.503 1.00 0.00 ? 206 ASN B CG  1 
ATOM   3030  O OD1 . ASN B  2  207 ? 36.529  -69.099 -30.462 1.00 0.00 ? 206 ASN B OD1 1 
ATOM   3031  N ND2 . ASN B  2  207 ? 35.433  -67.462 -31.641 1.00 0.00 ? 206 ASN B ND2 1 
ATOM   3032  N N   . ILE B  2  208 ? 36.846  -64.844 -27.723 1.00 0.00 ? 207 ILE B N   1 
ATOM   3033  C CA  . ILE B  2  208 ? 36.871  -64.401 -26.360 1.00 0.00 ? 207 ILE B CA  1 
ATOM   3034  C C   . ILE B  2  208 ? 37.040  -62.931 -26.278 1.00 0.00 ? 207 ILE B C   1 
ATOM   3035  O O   . ILE B  2  208 ? 37.731  -62.300 -27.075 1.00 0.00 ? 207 ILE B O   1 
ATOM   3036  C CB  . ILE B  2  208 ? 37.886  -65.142 -25.508 1.00 0.00 ? 207 ILE B CB  1 
ATOM   3037  C CG1 . ILE B  2  208 ? 39.361  -64.709 -25.647 1.00 0.00 ? 207 ILE B CG1 1 
ATOM   3038  C CG2 . ILE B  2  208 ? 37.675  -66.634 -25.800 1.00 0.00 ? 207 ILE B CG2 1 
ATOM   3039  C CD1 . ILE B  2  208 ? 39.797  -63.777 -24.509 1.00 0.00 ? 207 ILE B CD1 1 
ATOM   3040  N N   . GLU B  2  209 ? 36.304  -62.362 -25.312 1.00 0.00 ? 208 GLU B N   1 
ATOM   3041  C CA  . GLU B  2  209 ? 36.333  -60.982 -24.960 1.00 0.00 ? 208 GLU B CA  1 
ATOM   3042  C C   . GLU B  2  209 ? 37.265  -60.855 -23.804 1.00 0.00 ? 208 GLU B C   1 
ATOM   3043  O O   . GLU B  2  209 ? 37.400  -61.801 -23.033 1.00 0.00 ? 208 GLU B O   1 
ATOM   3044  C CB  . GLU B  2  209 ? 34.929  -60.459 -24.573 1.00 0.00 ? 208 GLU B CB  1 
ATOM   3045  C CG  . GLU B  2  209 ? 33.827  -60.819 -25.594 1.00 0.00 ? 208 GLU B CG  1 
ATOM   3046  C CD  . GLU B  2  209 ? 34.080  -60.259 -27.003 1.00 0.00 ? 208 GLU B CD  1 
ATOM   3047  O OE1 . GLU B  2  209 ? 34.884  -59.300 -27.144 1.00 0.00 ? 208 GLU B OE1 1 
ATOM   3048  O OE2 . GLU B  2  209 ? 33.453  -60.783 -27.964 1.00 0.00 ? 208 GLU B OE2 1 
ATOM   3049  N N   . VAL B  2  210 ? 37.856  -59.663 -23.611 1.00 0.00 ? 209 VAL B N   1 
ATOM   3050  C CA  . VAL B  2  210 ? 38.780  -59.429 -22.541 1.00 0.00 ? 209 VAL B CA  1 
ATOM   3051  C C   . VAL B  2  210 ? 38.730  -57.954 -22.301 1.00 0.00 ? 209 VAL B C   1 
ATOM   3052  O O   . VAL B  2  210 ? 38.419  -57.184 -23.205 1.00 0.00 ? 209 VAL B O   1 
ATOM   3053  C CB  . VAL B  2  210 ? 40.188  -59.948 -22.846 1.00 0.00 ? 209 VAL B CB  1 
ATOM   3054  C CG1 . VAL B  2  210 ? 40.663  -59.483 -24.217 1.00 0.00 ? 209 VAL B CG1 1 
ATOM   3055  C CG2 . VAL B  2  210 ? 41.214  -59.638 -21.737 1.00 0.00 ? 209 VAL B CG2 1 
ATOM   3056  N N   . GLY B  2  211 ? 39.027  -57.511 -21.065 1.00 0.00 ? 210 GLY B N   1 
ATOM   3057  C CA  . GLY B  2  211 ? 39.053  -56.124 -20.739 1.00 0.00 ? 210 GLY B CA  1 
ATOM   3058  C C   . GLY B  2  211 ? 39.902  -56.046 -19.539 1.00 0.00 ? 210 GLY B C   1 
ATOM   3059  O O   . GLY B  2  211 ? 39.913  -56.944 -18.713 1.00 0.00 ? 210 GLY B O   1 
ATOM   3060  N N   . ILE B  2  212 ? 40.676  -54.968 -19.452 1.00 0.00 ? 211 ILE B N   1 
ATOM   3061  C CA  . ILE B  2  212 ? 41.676  -54.786 -18.402 1.00 0.00 ? 211 ILE B CA  1 
ATOM   3062  C C   . ILE B  2  212 ? 41.476  -53.436 -17.726 1.00 0.00 ? 211 ILE B C   1 
ATOM   3063  O O   . ILE B  2  212 ? 40.736  -52.596 -18.237 1.00 0.00 ? 211 ILE B O   1 
ATOM   3064  C CB  . ILE B  2  212 ? 43.112  -54.860 -18.970 1.00 0.00 ? 211 ILE B CB  1 
ATOM   3065  C CG1 . ILE B  2  212 ? 43.156  -54.379 -20.424 1.00 0.00 ? 211 ILE B CG1 1 
ATOM   3066  C CG2 . ILE B  2  212 ? 43.655  -56.276 -18.875 1.00 0.00 ? 211 ILE B CG2 1 
ATOM   3067  C CD1 . ILE B  2  212 ? 44.524  -54.476 -21.058 1.00 0.00 ? 211 ILE B CD1 1 
ATOM   3068  N N   . CYS B  2  213 ? 42.101  -53.231 -16.563 1.00 0.00 ? 212 CYS B N   1 
ATOM   3069  C CA  . CYS B  2  213 ? 41.894  -51.991 -15.796 1.00 0.00 ? 212 CYS B CA  1 
ATOM   3070  C C   . CYS B  2  213 ? 43.102  -51.051 -15.616 1.00 0.00 ? 212 CYS B C   1 
ATOM   3071  O O   . CYS B  2  213 ? 43.038  -49.883 -16.000 1.00 0.00 ? 212 CYS B O   1 
ATOM   3072  C CB  . CYS B  2  213 ? 41.292  -52.318 -14.425 1.00 0.00 ? 212 CYS B CB  1 
ATOM   3073  S SG  . CYS B  2  213 ? 39.732  -51.475 -14.075 1.00 0.00 ? 212 CYS B SG  1 
ATOM   3074  N N   . ASN B  2  214 ? 44.195  -51.553 -15.040 1.00 0.00 ? 213 ASN B N   1 
ATOM   3075  C CA  . ASN B  2  214 ? 45.399  -50.749 -14.842 1.00 0.00 ? 213 ASN B CA  1 
ATOM   3076  C C   . ASN B  2  214 ? 45.062  -49.397 -14.188 1.00 0.00 ? 213 ASN B C   1 
ATOM   3077  O O   . ASN B  2  214 ? 44.374  -49.349 -13.171 1.00 0.00 ? 213 ASN B O   1 
ATOM   3078  C CB  . ASN B  2  214 ? 46.150  -50.572 -16.168 1.00 0.00 ? 213 ASN B CB  1 
ATOM   3079  C CG  . ASN B  2  214 ? 46.134  -51.825 -17.024 1.00 0.00 ? 213 ASN B CG  1 
ATOM   3080  O OD1 . ASN B  2  214 ? 47.179  -52.407 -17.316 1.00 0.00 ? 213 ASN B OD1 1 
ATOM   3081  N ND2 . ASN B  2  214 ? 44.944  -52.241 -17.436 1.00 0.00 ? 213 ASN B ND2 1 
ATOM   3082  N N   . GLU B  2  215 ? 45.685  -48.348 -14.717 1.00 0.00 ? 214 GLU B N   1 
ATOM   3083  C CA  . GLU B  2  215 ? 45.348  -46.962 -14.431 1.00 0.00 ? 214 GLU B CA  1 
ATOM   3084  C C   . GLU B  2  215 ? 45.477  -46.178 -15.733 1.00 0.00 ? 214 GLU B C   1 
ATOM   3085  O O   . GLU B  2  215 ? 46.385  -45.360 -15.881 1.00 0.00 ? 214 GLU B O   1 
ATOM   3086  C CB  . GLU B  2  215 ? 46.283  -46.386 -13.367 1.00 0.00 ? 214 GLU B CB  1 
ATOM   3087  C CG  . GLU B  2  215 ? 47.760  -46.532 -13.694 1.00 0.00 ? 214 GLU B CG  1 
ATOM   3088  C CD  . GLU B  2  215 ? 48.651  -45.854 -12.673 1.00 0.00 ? 214 GLU B CD  1 
ATOM   3089  O OE1 . GLU B  2  215 ? 48.195  -44.882 -12.035 1.00 0.00 ? 214 GLU B OE1 1 
ATOM   3090  O OE2 . GLU B  2  215 ? 49.809  -46.292 -12.508 1.00 0.00 ? 214 GLU B OE2 1 
ATOM   3091  N N   . ALA B  2  216 ? 44.583  -46.437 -16.680 1.00 0.00 ? 215 ALA B N   1 
ATOM   3092  C CA  . ALA B  2  216 ? 44.714  -45.895 -17.993 1.00 0.00 ? 215 ALA B CA  1 
ATOM   3093  C C   . ALA B  2  216 ? 43.329  -45.732 -18.542 1.00 0.00 ? 215 ALA B C   1 
ATOM   3094  O O   . ALA B  2  216 ? 43.097  -45.801 -19.748 1.00 0.00 ? 215 ALA B O   1 
ATOM   3095  C CB  . ALA B  2  216 ? 45.545  -46.842 -18.867 1.00 0.00 ? 215 ALA B CB  1 
ATOM   3096  N N   . GLY B  2  217 ? 42.400  -45.474 -17.626 1.00 0.00 ? 216 GLY B N   1 
ATOM   3097  C CA  . GLY B  2  217 ? 40.987  -45.464 -17.934 1.00 0.00 ? 216 GLY B CA  1 
ATOM   3098  C C   . GLY B  2  217 ? 40.641  -46.915 -18.153 1.00 0.00 ? 216 GLY B C   1 
ATOM   3099  O O   . GLY B  2  217 ? 41.463  -47.657 -18.677 1.00 0.00 ? 216 GLY B O   1 
ATOM   3100  N N   . PHE B  2  218 ? 39.454  -47.345 -17.742 1.00 0.00 ? 217 PHE B N   1 
ATOM   3101  C CA  . PHE B  2  218 ? 39.085  -48.732 -17.999 1.00 0.00 ? 217 PHE B CA  1 
ATOM   3102  C C   . PHE B  2  218 ? 39.185  -48.995 -19.485 1.00 0.00 ? 217 PHE B C   1 
ATOM   3103  O O   . PHE B  2  218 ? 39.109  -48.076 -20.299 1.00 0.00 ? 217 PHE B O   1 
ATOM   3104  C CB  . PHE B  2  218 ? 37.703  -49.101 -17.484 1.00 0.00 ? 217 PHE B CB  1 
ATOM   3105  C CG  . PHE B  2  218 ? 37.470  -50.584 -17.431 1.00 0.00 ? 217 PHE B CG  1 
ATOM   3106  C CD1 . PHE B  2  218 ? 37.014  -51.268 -18.546 1.00 0.00 ? 217 PHE B CD1 1 
ATOM   3107  C CD2 . PHE B  2  218 ? 37.729  -51.299 -16.275 1.00 0.00 ? 217 PHE B CD2 1 
ATOM   3108  C CE1 . PHE B  2  218 ? 36.802  -52.633 -18.504 1.00 0.00 ? 217 PHE B CE1 1 
ATOM   3109  C CE2 . PHE B  2  218 ? 37.517  -52.663 -16.226 1.00 0.00 ? 217 PHE B CE2 1 
ATOM   3110  C CZ  . PHE B  2  218 ? 37.053  -53.332 -17.341 1.00 0.00 ? 217 PHE B CZ  1 
ATOM   3111  N N   . ARG B  2  219 ? 39.389  -50.250 -19.837 1.00 0.00 ? 218 ARG B N   1 
ATOM   3112  C CA  . ARG B  2  219 ? 39.930  -50.540 -21.112 1.00 0.00 ? 218 ARG B CA  1 
ATOM   3113  C C   . ARG B  2  219 ? 39.502  -51.900 -21.525 1.00 0.00 ? 218 ARG B C   1 
ATOM   3114  O O   . ARG B  2  219 ? 39.579  -52.846 -20.766 1.00 0.00 ? 218 ARG B O   1 
ATOM   3115  C CB  . ARG B  2  219 ? 41.469  -50.521 -21.036 1.00 0.00 ? 218 ARG B CB  1 
ATOM   3116  C CG  . ARG B  2  219 ? 42.103  -49.147 -20.836 1.00 0.00 ? 218 ARG B CG  1 
ATOM   3117  C CD  . ARG B  2  219 ? 43.629  -49.184 -20.978 1.00 0.00 ? 218 ARG B CD  1 
ATOM   3118  N NE  . ARG B  2  219 ? 43.999  -49.521 -22.399 1.00 0.00 ? 218 ARG B NE  1 
ATOM   3119  C CZ  . ARG B  2  219 ? 44.015  -48.603 -23.419 1.00 0.00 ? 218 ARG B CZ  1 
ATOM   3120  N NH1 . ARG B  2  219 ? 43.732  -47.287 -23.196 1.00 0.00 ? 218 ARG B NH1 1 
ATOM   3121  N NH2 . ARG B  2  219 ? 44.327  -49.013 -24.684 1.00 0.00 ? 218 ARG B NH2 1 
ATOM   3122  N N   . ARG B  2  220 ? 39.233  -52.071 -22.814 1.00 0.00 ? 219 ARG B N   1 
ATOM   3123  C CA  . ARG B  2  220 ? 39.129  -53.417 -23.369 1.00 0.00 ? 219 ARG B CA  1 
ATOM   3124  C C   . ARG B  2  220 ? 40.471  -53.794 -24.011 1.00 0.00 ? 219 ARG B C   1 
ATOM   3125  O O   . ARG B  2  220 ? 40.974  -53.069 -24.869 1.00 0.00 ? 219 ARG B O   1 
ATOM   3126  C CB  . ARG B  2  220 ? 38.006  -53.489 -24.403 1.00 0.00 ? 219 ARG B CB  1 
ATOM   3127  C CG  . ARG B  2  220 ? 36.613  -53.309 -23.821 1.00 0.00 ? 219 ARG B CG  1 
ATOM   3128  C CD  . ARG B  2  220 ? 35.545  -53.441 -24.894 1.00 0.00 ? 219 ARG B CD  1 
ATOM   3129  N NE  . ARG B  2  220 ? 34.205  -53.203 -24.365 1.00 0.00 ? 219 ARG B NE  1 
ATOM   3130  C CZ  . ARG B  2  220 ? 33.107  -53.143 -25.111 1.00 0.00 ? 219 ARG B CZ  1 
ATOM   3131  N NH1 . ARG B  2  220 ? 33.185  -53.306 -26.424 1.00 0.00 ? 219 ARG B NH1 1 
ATOM   3132  N NH2 . ARG B  2  220 ? 31.929  -52.921 -24.544 1.00 0.00 ? 219 ARG B NH2 1 
ATOM   3133  N N   . LEU B  2  221 ? 41.051  -54.920 -23.593 1.00 0.00 ? 220 LEU B N   1 
ATOM   3134  C CA  . LEU B  2  221 ? 42.355  -55.319 -24.073 1.00 0.00 ? 220 LEU B CA  1 
ATOM   3135  C C   . LEU B  2  221 ? 42.189  -55.272 -25.558 1.00 0.00 ? 220 LEU B C   1 
ATOM   3136  O O   . LEU B  2  221 ? 41.236  -55.845 -26.085 1.00 0.00 ? 220 LEU B O   1 
ATOM   3137  C CB  . LEU B  2  221 ? 42.823  -56.712 -23.615 1.00 0.00 ? 220 LEU B CB  1 
ATOM   3138  C CG  . LEU B  2  221 ? 44.348  -56.886 -23.434 1.00 0.00 ? 220 LEU B CG  1 
ATOM   3139  C CD1 . LEU B  2  221 ? 44.683  -58.294 -22.922 1.00 0.00 ? 220 LEU B CD1 1 
ATOM   3140  C CD2 . LEU B  2  221 ? 45.184  -56.549 -24.673 1.00 0.00 ? 220 LEU B CD2 1 
ATOM   3141  N N   . THR B  2  222 ? 43.049  -54.469 -26.227 1.00 0.00 ? 221 THR B N   1 
ATOM   3142  C CA  . THR B  2  222 ? 42.843  -54.053 -27.588 1.00 0.00 ? 221 THR B CA  1 
ATOM   3143  C C   . THR B  2  222 ? 42.944  -55.259 -28.524 1.00 0.00 ? 221 THR B C   1 
ATOM   3144  O O   . THR B  2  222 ? 43.840  -56.068 -28.296 1.00 0.00 ? 221 THR B O   1 
ATOM   3145  C CB  . THR B  2  222 ? 43.774  -52.899 -27.957 1.00 0.00 ? 221 THR B CB  1 
ATOM   3146  O OG1 . THR B  2  222 ? 43.476  -52.373 -29.247 1.00 0.00 ? 221 THR B OG1 1 
ATOM   3147  C CG2 . THR B  2  222 ? 45.256  -53.300 -27.884 1.00 0.00 ? 221 THR B CG2 1 
ATOM   3148  N N   . PRO B  2  223 ? 42.060  -55.484 -29.512 1.00 0.00 ? 222 PRO B N   1 
ATOM   3149  C CA  . PRO B  2  223 ? 41.967  -56.770 -30.185 1.00 0.00 ? 222 PRO B CA  1 
ATOM   3150  C C   . PRO B  2  223 ? 43.197  -57.304 -30.876 1.00 0.00 ? 222 PRO B C   1 
ATOM   3151  O O   . PRO B  2  223 ? 43.358  -58.521 -30.922 1.00 0.00 ? 222 PRO B O   1 
ATOM   3152  C CB  . PRO B  2  223 ? 40.819  -56.563 -31.168 1.00 0.00 ? 222 PRO B CB  1 
ATOM   3153  C CG  . PRO B  2  223 ? 39.841  -55.714 -30.362 1.00 0.00 ? 222 PRO B CG  1 
ATOM   3154  C CD  . PRO B  2  223 ? 40.772  -54.781 -29.595 1.00 0.00 ? 222 PRO B CD  1 
ATOM   3155  N N   . THR B  2  224 ? 44.063  -56.451 -31.447 1.00 0.00 ? 223 THR B N   1 
ATOM   3156  C CA  . THR B  2  224 ? 45.291  -56.897 -32.066 1.00 0.00 ? 223 THR B CA  1 
ATOM   3157  C C   . THR B  2  224 ? 46.260  -57.496 -31.055 1.00 0.00 ? 223 THR B C   1 
ATOM   3158  O O   . THR B  2  224 ? 47.057  -58.371 -31.388 1.00 0.00 ? 223 THR B O   1 
ATOM   3159  C CB  . THR B  2  224 ? 45.925  -55.788 -32.912 1.00 0.00 ? 223 THR B CB  1 
ATOM   3160  O OG1 . THR B  2  224 ? 46.947  -56.289 -33.771 1.00 0.00 ? 223 THR B OG1 1 
ATOM   3161  C CG2 . THR B  2  224 ? 46.481  -54.641 -32.037 1.00 0.00 ? 223 THR B CG2 1 
ATOM   3162  N N   . GLU B  2  225 ? 46.207  -57.009 -29.794 1.00 0.00 ? 224 GLU B N   1 
ATOM   3163  C CA  . GLU B  2  225 ? 47.115  -57.360 -28.734 1.00 0.00 ? 224 GLU B CA  1 
ATOM   3164  C C   . GLU B  2  225 ? 46.547  -58.478 -27.879 1.00 0.00 ? 224 GLU B C   1 
ATOM   3165  O O   . GLU B  2  225 ? 47.287  -59.135 -27.145 1.00 0.00 ? 224 GLU B O   1 
ATOM   3166  C CB  . GLU B  2  225 ? 47.362  -56.112 -27.858 1.00 0.00 ? 224 GLU B CB  1 
ATOM   3167  C CG  . GLU B  2  225 ? 48.414  -56.245 -26.748 1.00 0.00 ? 224 GLU B CG  1 
ATOM   3168  C CD  . GLU B  2  225 ? 48.500  -54.928 -25.976 1.00 0.00 ? 224 GLU B CD  1 
ATOM   3169  O OE1 . GLU B  2  225 ? 47.492  -54.553 -25.321 1.00 0.00 ? 224 GLU B OE1 1 
ATOM   3170  O OE2 . GLU B  2  225 ? 49.581  -54.282 -26.027 1.00 0.00 ? 224 GLU B OE2 1 
ATOM   3171  N N   . VAL B  2  226 ? 45.231  -58.800 -27.989 1.00 0.00 ? 225 VAL B N   1 
ATOM   3172  C CA  . VAL B  2  226 ? 44.690  -59.986 -27.355 1.00 0.00 ? 225 VAL B CA  1 
ATOM   3173  C C   . VAL B  2  226 ? 45.314  -61.185 -28.021 1.00 0.00 ? 225 VAL B C   1 
ATOM   3174  O O   . VAL B  2  226 ? 45.677  -62.175 -27.391 1.00 0.00 ? 225 VAL B O   1 
ATOM   3175  C CB  . VAL B  2  226 ? 43.185  -60.117 -27.456 1.00 0.00 ? 225 VAL B CB  1 
ATOM   3176  C CG1 . VAL B  2  226 ? 42.710  -61.301 -26.585 1.00 0.00 ? 225 VAL B CG1 1 
ATOM   3177  C CG2 . VAL B  2  226 ? 42.520  -58.818 -27.005 1.00 0.00 ? 225 VAL B CG2 1 
ATOM   3178  N N   . LYS B  2  227 ? 45.508  -61.050 -29.343 1.00 0.00 ? 226 LYS B N   1 
ATOM   3179  C CA  . LYS B  2  227 ? 46.220  -61.971 -30.162 1.00 0.00 ? 226 LYS B CA  1 
ATOM   3180  C C   . LYS B  2  227 ? 47.727  -61.801 -29.847 1.00 0.00 ? 226 LYS B C   1 
ATOM   3181  C CB  . LYS B  2  227 ? 45.879  -61.646 -31.631 1.00 0.00 ? 226 LYS B CB  1 
ATOM   3182  C CG  . LYS B  2  227 ? 46.182  -62.774 -32.621 1.00 0.00 ? 226 LYS B CG  1 
ATOM   3183  C CD  . LYS B  2  227 ? 45.666  -62.477 -34.038 1.00 0.00 ? 226 LYS B CD  1 
ATOM   3184  C CE  . LYS B  2  227 ? 46.365  -61.288 -34.712 1.00 0.00 ? 226 LYS B CE  1 
ATOM   3185  N NZ  . LYS B  2  227 ? 45.911  -61.130 -36.112 1.00 0.00 ? 226 LYS B NZ  1 
ATOM   3186  N N   . SER C  3  2   ? -3.133  -66.686 -10.070 1.00 0.00 ? 2   SER C N   1 
ATOM   3187  C CA  . SER C  3  2   ? -2.515  -65.417 -9.631  1.00 0.00 ? 2   SER C CA  1 
ATOM   3188  C C   . SER C  3  2   ? -2.096  -65.540 -8.200  1.00 0.00 ? 2   SER C C   1 
ATOM   3189  O O   . SER C  3  2   ? -0.963  -65.898 -7.918  1.00 0.00 ? 2   SER C O   1 
ATOM   3190  C CB  . SER C  3  2   ? -3.478  -64.212 -9.814  1.00 0.00 ? 2   SER C CB  1 
ATOM   3191  O OG  . SER C  3  2   ? -3.785  -63.966 -11.181 1.00 0.00 ? 2   SER C OG  1 
ATOM   3192  N N   . ARG C  3  3   ? -3.000  -65.266 -7.237  1.00 0.00 ? 3   ARG C N   1 
ATOM   3193  C CA  . ARG C  3  3   ? -2.775  -65.389 -5.808  1.00 0.00 ? 3   ARG C CA  1 
ATOM   3194  C C   . ARG C  3  3   ? -2.824  -66.826 -5.363  1.00 0.00 ? 3   ARG C C   1 
ATOM   3195  O O   . ARG C  3  3   ? -2.568  -67.138 -4.206  1.00 0.00 ? 3   ARG C O   1 
ATOM   3196  C CB  . ARG C  3  3   ? -3.734  -64.552 -4.944  1.00 0.00 ? 3   ARG C CB  1 
ATOM   3197  C CG  . ARG C  3  3   ? -5.188  -65.000 -5.031  1.00 0.00 ? 3   ARG C CG  1 
ATOM   3198  C CD  . ARG C  3  3   ? -6.122  -64.004 -4.353  1.00 0.00 ? 3   ARG C CD  1 
ATOM   3199  N NE  . ARG C  3  3   ? -7.529  -64.393 -4.658  1.00 0.00 ? 3   ARG C NE  1 
ATOM   3200  C CZ  . ARG C  3  3   ? -8.585  -63.644 -4.224  1.00 0.00 ? 3   ARG C CZ  1 
ATOM   3201  N NH1 . ARG C  3  3   ? -8.382  -62.546 -3.441  1.00 0.00 ? 3   ARG C NH1 1 
ATOM   3202  N NH2 . ARG C  3  3   ? -9.848  -64.007 -4.591  1.00 0.00 ? 3   ARG C NH2 1 
ATOM   3203  N N   . ARG C  3  4   ? -3.196  -67.734 -6.289  1.00 0.00 ? 4   ARG C N   1 
ATOM   3204  C CA  . ARG C  3  4   ? -3.254  -69.167 -6.139  1.00 0.00 ? 4   ARG C CA  1 
ATOM   3205  C C   . ARG C  3  4   ? -1.882  -69.748 -5.845  1.00 0.00 ? 4   ARG C C   1 
ATOM   3206  O O   . ARG C  3  4   ? -1.768  -70.724 -5.106  1.00 0.00 ? 4   ARG C O   1 
ATOM   3207  C CB  . ARG C  3  4   ? -3.797  -69.776 -7.461  1.00 0.00 ? 4   ARG C CB  1 
ATOM   3208  C CG  . ARG C  3  4   ? -5.011  -68.991 -8.017  1.00 0.00 ? 4   ARG C CG  1 
ATOM   3209  C CD  . ARG C  3  4   ? -5.634  -69.513 -9.323  1.00 0.00 ? 4   ARG C CD  1 
ATOM   3210  N NE  . ARG C  3  4   ? -6.536  -70.674 -9.043  1.00 0.00 ? 4   ARG C NE  1 
ATOM   3211  C CZ  . ARG C  3  4   ? -6.209  -71.979 -9.283  1.00 0.00 ? 4   ARG C CZ  1 
ATOM   3212  N NH1 . ARG C  3  4   ? -4.976  -72.342 -9.734  1.00 0.00 ? 4   ARG C NH1 1 
ATOM   3213  N NH2 . ARG C  3  4   ? -7.143  -72.947 -9.050  1.00 0.00 ? 4   ARG C NH2 1 
ATOM   3214  N N   . TYR C  3  5   ? -0.844  -69.141 -6.411  1.00 0.00 ? 5   TYR C N   1 
ATOM   3215  C CA  . TYR C  3  5   ? 0.539   -69.457 -6.060  1.00 0.00 ? 5   TYR C CA  1 
ATOM   3216  C C   . TYR C  3  5   ? 0.927   -69.097 -4.616  1.00 0.00 ? 5   TYR C C   1 
ATOM   3217  O O   . TYR C  3  5   ? 1.652   -69.841 -3.956  1.00 0.00 ? 5   TYR C O   1 
ATOM   3218  C CB  . TYR C  3  5   ? 1.503   -68.784 -7.041  1.00 0.00 ? 5   TYR C CB  1 
ATOM   3219  C CG  . TYR C  3  5   ? 1.133   -68.980 -8.494  1.00 0.00 ? 5   TYR C CG  1 
ATOM   3220  C CD1 . TYR C  3  5   ? 1.014   -70.253 -9.035  1.00 0.00 ? 5   TYR C CD1 1 
ATOM   3221  C CD2 . TYR C  3  5   ? 0.903   -67.891 -9.325  1.00 0.00 ? 5   TYR C CD2 1 
ATOM   3222  C CE1 . TYR C  3  5   ? 0.676   -70.436 -10.363 1.00 0.00 ? 5   TYR C CE1 1 
ATOM   3223  C CE2 . TYR C  3  5   ? 0.564   -68.065 -10.653 1.00 0.00 ? 5   TYR C CE2 1 
ATOM   3224  C CZ  . TYR C  3  5   ? 0.452   -69.340 -11.167 1.00 0.00 ? 5   TYR C CZ  1 
ATOM   3225  O OH  . TYR C  3  5   ? 0.116   -69.518 -12.489 1.00 0.00 ? 5   TYR C OH  1 
ATOM   3226  N N   . ASP C  3  6   ? 0.452   -67.945 -4.148  1.00 0.00 ? 6   ASP C N   1 
ATOM   3227  C CA  . ASP C  3  6   ? 0.923   -67.327 -2.929  1.00 0.00 ? 6   ASP C CA  1 
ATOM   3228  C C   . ASP C  3  6   ? 0.919   -68.368 -1.868  1.00 0.00 ? 6   ASP C C   1 
ATOM   3229  O O   . ASP C  3  6   ? -0.086  -69.043 -1.691  1.00 0.00 ? 6   ASP C O   1 
ATOM   3230  C CB  . ASP C  3  6   ? 0.000   -66.135 -2.514  1.00 0.00 ? 6   ASP C CB  1 
ATOM   3231  C CG  . ASP C  3  6   ? 0.517   -65.216 -1.386  1.00 0.00 ? 6   ASP C CG  1 
ATOM   3232  O OD1 . ASP C  3  6   ? 1.638   -65.454 -0.869  1.00 0.00 ? 6   ASP C OD1 1 
ATOM   3233  O OD2 . ASP C  3  6   ? -0.217  -64.251 -1.037  1.00 0.00 ? 6   ASP C OD2 1 
ATOM   3234  N N   . SER C  3  7   ? 2.056   -68.571 -1.175  1.00 0.00 ? 7   SER C N   1 
ATOM   3235  C CA  . SER C  3  7   ? 2.147   -69.543 -0.106  1.00 0.00 ? 7   SER C CA  1 
ATOM   3236  C C   . SER C  3  7   ? 1.913   -68.881 1.220   1.00 0.00 ? 7   SER C C   1 
ATOM   3237  O O   . SER C  3  7   ? 2.008   -69.531 2.260   1.00 0.00 ? 7   SER C O   1 
ATOM   3238  C CB  . SER C  3  7   ? 3.505   -70.317 -0.099  1.00 0.00 ? 7   SER C CB  1 
ATOM   3239  O OG  . SER C  3  7   ? 4.645   -69.471 -0.048  1.00 0.00 ? 7   SER C OG  1 
ATOM   3240  N N   . ARG C  3  8   ? 1.553   -67.596 1.185   1.00 0.00 ? 8   ARG C N   1 
ATOM   3241  C CA  . ARG C  3  8   ? 1.191   -66.769 2.358   1.00 0.00 ? 8   ARG C CA  1 
ATOM   3242  C C   . ARG C  3  8   ? 2.331   -66.230 3.248   1.00 0.00 ? 8   ARG C C   1 
ATOM   3243  O O   . ARG C  3  8   ? 2.516   -65.017 3.338   1.00 0.00 ? 8   ARG C O   1 
ATOM   3244  C CB  . ARG C  3  8   ? 0.173   -67.514 3.229   1.00 0.00 ? 8   ARG C CB  1 
ATOM   3245  C CG  . ARG C  3  8   ? -1.217  -67.605 2.621   1.00 0.00 ? 8   ARG C CG  1 
ATOM   3246  C CD  . ARG C  3  8   ? -2.290  -67.639 3.697   1.00 0.00 ? 8   ARG C CD  1 
ATOM   3247  N NE  . ARG C  3  8   ? -3.621  -67.395 3.149   1.00 0.00 ? 8   ARG C NE  1 
ATOM   3248  C CZ  . ARG C  3  8   ? -4.729  -67.982 3.591   1.00 0.00 ? 8   ARG C CZ  1 
ATOM   3249  N NH1 . ARG C  3  8   ? -4.668  -68.850 4.591   1.00 0.00 ? 8   ARG C NH1 1 
ATOM   3250  N NH2 . ARG C  3  8   ? -5.898  -67.701 3.033   1.00 0.00 ? 8   ARG C NH2 1 
ATOM   3251  N N   . THR C  3  9   ? 3.097   -67.114 3.879   1.00 0.00 ? 9   THR C N   1 
ATOM   3252  C CA  . THR C  3  9   ? 4.372   -66.751 4.494   1.00 0.00 ? 9   THR C CA  1 
ATOM   3253  C C   . THR C  3  9   ? 4.129   -65.665 5.535   1.00 0.00 ? 9   THR C C   1 
ATOM   3254  O O   . THR C  3  9   ? 5.051   -64.997 6.005   1.00 0.00 ? 9   THR C O   1 
ATOM   3255  C CB  . THR C  3  9   ? 5.382   -66.240 3.450   1.00 0.00 ? 9   THR C CB  1 
ATOM   3256  O OG1 . THR C  3  9   ? 4.945   -64.976 2.938   1.00 0.00 ? 9   THR C OG1 1 
ATOM   3257  C CG2 . THR C  3  9   ? 5.506   -67.231 2.302   1.00 0.00 ? 9   THR C CG2 1 
ATOM   3258  N N   . THR C  3  10  ? 2.844   -65.421 5.785   1.00 0.00 ? 10  THR C N   1 
ATOM   3259  C CA  . THR C  3  10  ? 2.360   -64.648 6.922   1.00 0.00 ? 10  THR C CA  1 
ATOM   3260  C C   . THR C  3  10  ? 1.336   -65.469 7.711   1.00 0.00 ? 10  THR C C   1 
ATOM   3261  O O   . THR C  3  10  ? 0.820   -65.025 8.736   1.00 0.00 ? 10  THR C O   1 
ATOM   3262  C CB  . THR C  3  10  ? 1.714   -63.324 6.474   1.00 0.00 ? 10  THR C CB  1 
ATOM   3263  O OG1 . THR C  3  10  ? 1.259   -62.598 7.622   1.00 0.00 ? 10  THR C OG1 1 
ATOM   3264  C CG2 . THR C  3  10  ? 0.536   -63.593 5.550   1.00 0.00 ? 10  THR C CG2 1 
ATOM   3265  N N   . ILE C  3  11  ? 1.049   -66.666 7.207   1.00 0.00 ? 11  ILE C N   1 
ATOM   3266  C CA  . ILE C  3  11  ? 0.002   -67.509 7.709   1.00 0.00 ? 11  ILE C CA  1 
ATOM   3267  C C   . ILE C  3  11  ? 0.292   -67.826 9.135   1.00 0.00 ? 11  ILE C C   1 
ATOM   3268  O O   . ILE C  3  11  ? 1.409   -67.647 9.606   1.00 0.00 ? 11  ILE C O   1 
ATOM   3269  C CB  . ILE C  3  11  ? -0.144  -68.768 6.860   1.00 0.00 ? 11  ILE C CB  1 
ATOM   3270  C CG1 . ILE C  3  11  ? -1.566  -69.367 6.930   1.00 0.00 ? 11  ILE C CG1 1 
ATOM   3271  C CG2 . ILE C  3  11  ? 0.962   -69.800 7.170   1.00 0.00 ? 11  ILE C CG2 1 
ATOM   3272  C CD1 . ILE C  3  11  ? -1.773  -70.603 6.047   1.00 0.00 ? 11  ILE C CD1 1 
ATOM   3273  N N   . PHE C  3  12  ? -0.740  -68.287 9.831   1.00 0.00 ? 12  PHE C N   1 
ATOM   3274  C CA  . PHE C  3  12  ? -0.602  -68.807 11.177  1.00 0.00 ? 12  PHE C CA  1 
ATOM   3275  C C   . PHE C  3  12  ? -0.978  -70.273 11.114  1.00 0.00 ? 12  PHE C C   1 
ATOM   3276  O O   . PHE C  3  12  ? -2.006  -70.646 10.551  1.00 0.00 ? 12  PHE C O   1 
ATOM   3277  C CB  . PHE C  3  12  ? -1.482  -68.055 12.168  1.00 0.00 ? 12  PHE C CB  1 
ATOM   3278  C CG  . PHE C  3  12  ? -0.955  -68.080 13.570  1.00 0.00 ? 12  PHE C CG  1 
ATOM   3279  C CD1 . PHE C  3  12  ? 0.058   -67.218 13.953  1.00 0.00 ? 12  PHE C CD1 1 
ATOM   3280  C CD2 . PHE C  3  12  ? -1.477  -68.950 14.507  1.00 0.00 ? 12  PHE C CD2 1 
ATOM   3281  C CE1 . PHE C  3  12  ? 0.547   -67.228 15.241  1.00 0.00 ? 12  PHE C CE1 1 
ATOM   3282  C CE2 . PHE C  3  12  ? -0.992  -68.966 15.799  1.00 0.00 ? 12  PHE C CE2 1 
ATOM   3283  C CZ  . PHE C  3  12  ? 0.022   -68.103 16.166  1.00 0.00 ? 12  PHE C CZ  1 
ATOM   3284  N N   . SER C  3  13  ? -0.116  -71.099 11.684  1.00 0.00 ? 13  SER C N   1 
ATOM   3285  C CA  . SER C  3  13  ? -0.104  -72.510 11.417  1.00 0.00 ? 13  SER C CA  1 
ATOM   3286  C C   . SER C  3  13  ? -0.954  -73.219 12.449  1.00 0.00 ? 13  SER C C   1 
ATOM   3287  O O   . SER C  3  13  ? -1.208  -72.629 13.496  1.00 0.00 ? 13  SER C O   1 
ATOM   3288  C CB  . SER C  3  13  ? 1.327   -73.038 11.498  1.00 0.00 ? 13  SER C CB  1 
ATOM   3289  O OG  . SER C  3  13  ? 1.858   -72.746 12.771  1.00 0.00 ? 13  SER C OG  1 
ATOM   3290  N N   . PRO C  3  14  ? -1.452  -74.435 12.204  1.00 0.00 ? 14  PRO C N   1 
ATOM   3291  C CA  . PRO C  3  14  ? -2.260  -75.171 13.155  1.00 0.00 ? 14  PRO C CA  1 
ATOM   3292  C C   . PRO C  3  14  ? -1.475  -75.734 14.300  1.00 0.00 ? 14  PRO C C   1 
ATOM   3293  O O   . PRO C  3  14  ? -2.097  -76.158 15.267  1.00 0.00 ? 14  PRO C O   1 
ATOM   3294  C CB  . PRO C  3  14  ? -2.927  -76.261 12.320  1.00 0.00 ? 14  PRO C CB  1 
ATOM   3295  C CG  . PRO C  3  14  ? -2.023  -76.439 11.105  1.00 0.00 ? 14  PRO C CG  1 
ATOM   3296  C CD  . PRO C  3  14  ? -1.471  -75.045 10.880  1.00 0.00 ? 14  PRO C CD  1 
ATOM   3297  N N   . GLU C  3  15  ? -0.132  -75.684 14.269  1.00 0.00 ? 15  GLU C N   1 
ATOM   3298  C CA  . GLU C  3  15  ? 0.672   -76.066 15.400  1.00 0.00 ? 15  GLU C CA  1 
ATOM   3299  C C   . GLU C  3  15  ? 0.858   -74.859 16.270  1.00 0.00 ? 15  GLU C C   1 
ATOM   3300  O O   . GLU C  3  15  ? 1.246   -75.011 17.421  1.00 0.00 ? 15  GLU C O   1 
ATOM   3301  C CB  . GLU C  3  15  ? 2.072   -76.580 15.016  1.00 0.00 ? 15  GLU C CB  1 
ATOM   3302  C CG  . GLU C  3  15  ? 2.788   -75.659 14.014  1.00 0.00 ? 15  GLU C CG  1 
ATOM   3303  C CD  . GLU C  3  15  ? 4.252   -76.043 13.869  1.00 0.00 ? 15  GLU C CD  1 
ATOM   3304  O OE1 . GLU C  3  15  ? 4.532   -77.234 13.573  1.00 0.00 ? 15  GLU C OE1 1 
ATOM   3305  O OE2 . GLU C  3  15  ? 5.107   -75.137 14.046  1.00 0.00 ? 15  GLU C OE2 1 
ATOM   3306  N N   . GLY C  3  16  ? 0.521   -73.650 15.762  1.00 0.00 ? 16  GLY C N   1 
ATOM   3307  C CA  . GLY C  3  16  ? 0.521   -72.424 16.512  1.00 0.00 ? 16  GLY C CA  1 
ATOM   3308  C C   . GLY C  3  16  ? 1.833   -71.706 16.524  1.00 0.00 ? 16  GLY C C   1 
ATOM   3309  O O   . GLY C  3  16  ? 2.048   -70.866 17.393  1.00 0.00 ? 16  GLY C O   1 
ATOM   3310  N N   . ARG C  3  17  ? 2.751   -72.017 15.588  1.00 0.00 ? 17  ARG C N   1 
ATOM   3311  C CA  . ARG C  3  17  ? 4.041   -71.372 15.528  1.00 0.00 ? 17  ARG C CA  1 
ATOM   3312  C C   . ARG C  3  17  ? 4.333   -71.107 14.077  1.00 0.00 ? 17  ARG C C   1 
ATOM   3313  O O   . ARG C  3  17  ? 4.376   -72.058 13.303  1.00 0.00 ? 17  ARG C O   1 
ATOM   3314  C CB  . ARG C  3  17  ? 5.165   -72.288 16.071  1.00 0.00 ? 17  ARG C CB  1 
ATOM   3315  C CG  . ARG C  3  17  ? 4.793   -73.049 17.352  1.00 0.00 ? 17  ARG C CG  1 
ATOM   3316  C CD  . ARG C  3  17  ? 5.920   -73.929 17.892  1.00 0.00 ? 17  ARG C CD  1 
ATOM   3317  N NE  . ARG C  3  17  ? 6.267   -74.967 16.865  1.00 0.00 ? 17  ARG C NE  1 
ATOM   3318  C CZ  . ARG C  3  17  ? 7.212   -75.929 17.094  1.00 0.00 ? 17  ARG C CZ  1 
ATOM   3319  N NH1 . ARG C  3  17  ? 7.867   -75.997 18.289  1.00 0.00 ? 17  ARG C NH1 1 
ATOM   3320  N NH2 . ARG C  3  17  ? 7.505   -76.835 16.120  1.00 0.00 ? 17  ARG C NH2 1 
ATOM   3321  N N   . LEU C  3  18  ? 4.546   -69.835 13.655  1.00 0.00 ? 18  LEU C N   1 
ATOM   3322  C CA  . LEU C  3  18  ? 4.791   -69.488 12.265  1.00 0.00 ? 18  LEU C CA  1 
ATOM   3323  C C   . LEU C  3  18  ? 5.918   -70.257 11.606  1.00 0.00 ? 18  LEU C C   1 
ATOM   3324  O O   . LEU C  3  18  ? 6.900   -70.618 12.242  1.00 0.00 ? 18  LEU C O   1 
ATOM   3325  C CB  . LEU C  3  18  ? 5.125   -68.006 12.036  1.00 0.00 ? 18  LEU C CB  1 
ATOM   3326  C CG  . LEU C  3  18  ? 3.941   -67.041 12.214  1.00 0.00 ? 18  LEU C CG  1 
ATOM   3327  C CD1 . LEU C  3  18  ? 3.844   -66.486 13.646  1.00 0.00 ? 18  LEU C CD1 1 
ATOM   3328  C CD2 . LEU C  3  18  ? 4.039   -65.912 11.167  1.00 0.00 ? 18  LEU C CD2 1 
ATOM   3329  N N   . TYR C  3  19  ? 5.709   -70.608 10.313  1.00 0.00 ? 19  TYR C N   1 
ATOM   3330  C CA  . TYR C  3  19  ? 6.605   -71.400 9.515   1.00 0.00 ? 19  TYR C CA  1 
ATOM   3331  C C   . TYR C  3  19  ? 7.904   -70.751 9.275   1.00 0.00 ? 19  TYR C C   1 
ATOM   3332  O O   . TYR C  3  19  ? 8.942   -71.341 9.554   1.00 0.00 ? 19  TYR C O   1 
ATOM   3333  C CB  . TYR C  3  19  ? 6.033   -71.690 8.122   1.00 0.00 ? 19  TYR C CB  1 
ATOM   3334  C CG  . TYR C  3  19  ? 4.948   -72.709 8.245   1.00 0.00 ? 19  TYR C CG  1 
ATOM   3335  C CD1 . TYR C  3  19  ? 5.281   -74.058 8.439   1.00 0.00 ? 19  TYR C CD1 1 
ATOM   3336  C CD2 . TYR C  3  19  ? 3.600   -72.344 8.159   1.00 0.00 ? 19  TYR C CD2 1 
ATOM   3337  C CE1 . TYR C  3  19  ? 4.285   -75.030 8.547   1.00 0.00 ? 19  TYR C CE1 1 
ATOM   3338  C CE2 . TYR C  3  19  ? 2.599   -73.320 8.245   1.00 0.00 ? 19  TYR C CE2 1 
ATOM   3339  C CZ  . TYR C  3  19  ? 2.942   -74.661 8.451   1.00 0.00 ? 19  TYR C CZ  1 
ATOM   3340  O OH  . TYR C  3  19  ? 1.928   -75.635 8.570   1.00 0.00 ? 19  TYR C OH  1 
ATOM   3341  N N   . GLN C  3  20  ? 7.882   -69.496 8.794   1.00 0.00 ? 20  GLN C N   1 
ATOM   3342  C CA  . GLN C  3  20  ? 9.075   -68.788 8.414   1.00 0.00 ? 20  GLN C CA  1 
ATOM   3343  C C   . GLN C  3  20  ? 9.907   -68.435 9.585   1.00 0.00 ? 20  GLN C C   1 
ATOM   3344  O O   . GLN C  3  20  ? 11.106  -68.278 9.455   1.00 0.00 ? 20  GLN C O   1 
ATOM   3345  C CB  . GLN C  3  20  ? 8.820   -67.497 7.644   1.00 0.00 ? 20  GLN C CB  1 
ATOM   3346  C CG  . GLN C  3  20  ? 8.031   -67.701 6.351   1.00 0.00 ? 20  GLN C CG  1 
ATOM   3347  C CD  . GLN C  3  20  ? 8.750   -68.716 5.477   1.00 0.00 ? 20  GLN C CD  1 
ATOM   3348  O OE1 . GLN C  3  20  ? 9.926   -68.305 4.924   1.00 0.00 ? 20  GLN C OE1 1 
ATOM   3349  N NE2 . GLN C  3  20  ? 8.275   -69.843 5.313   1.00 0.00 ? 20  GLN C NE2 1 
ATOM   3350  N N   . VAL C  3  21  ? 9.296   -68.274 10.765  1.00 0.00 ? 21  VAL C N   1 
ATOM   3351  C CA  . VAL C  3  21  ? 10.009  -67.967 11.968  1.00 0.00 ? 21  VAL C CA  1 
ATOM   3352  C C   . VAL C  3  21  ? 10.799  -69.184 12.371  1.00 0.00 ? 21  VAL C C   1 
ATOM   3353  O O   . VAL C  3  21  ? 11.966  -69.045 12.731  1.00 0.00 ? 21  VAL C O   1 
ATOM   3354  C CB  . VAL C  3  21  ? 9.065   -67.537 13.073  1.00 0.00 ? 21  VAL C CB  1 
ATOM   3355  C CG1 . VAL C  3  21  ? 9.822   -67.275 14.387  1.00 0.00 ? 21  VAL C CG1 1 
ATOM   3356  C CG2 . VAL C  3  21  ? 8.343   -66.258 12.605  1.00 0.00 ? 21  VAL C CG2 1 
ATOM   3357  N N   . GLU C  3  22  ? 10.208  -70.408 12.314  1.00 0.00 ? 22  GLU C N   1 
ATOM   3358  C CA  . GLU C  3  22  ? 10.925  -71.619 12.642  1.00 0.00 ? 22  GLU C CA  1 
ATOM   3359  C C   . GLU C  3  22  ? 12.054  -71.854 11.701  1.00 0.00 ? 22  GLU C C   1 
ATOM   3360  O O   . GLU C  3  22  ? 13.114  -72.273 12.139  1.00 0.00 ? 22  GLU C O   1 
ATOM   3361  C CB  . GLU C  3  22  ? 10.080  -72.906 12.451  1.00 0.00 ? 22  GLU C CB  1 
ATOM   3362  C CG  . GLU C  3  22  ? 8.842   -73.057 13.350  1.00 0.00 ? 22  GLU C CG  1 
ATOM   3363  C CD  . GLU C  3  22  ? 7.884   -74.042 12.674  1.00 0.00 ? 22  GLU C CD  1 
ATOM   3364  O OE1 . GLU C  3  22  ? 8.252   -75.242 12.559  1.00 0.00 ? 22  GLU C OE1 1 
ATOM   3365  O OE2 . GLU C  3  22  ? 6.784   -73.605 12.242  1.00 0.00 ? 22  GLU C OE2 1 
ATOM   3366  N N   . TYR C  3  23  ? 11.845  -71.599 10.395  1.00 0.00 ? 23  TYR C N   1 
ATOM   3367  C CA  . TYR C  3  23  ? 12.842  -71.748 9.357   1.00 0.00 ? 23  TYR C CA  1 
ATOM   3368  C C   . TYR C  3  23  ? 13.953  -70.752 9.445   1.00 0.00 ? 23  TYR C C   1 
ATOM   3369  O O   . TYR C  3  23  ? 15.088  -71.023 9.078   1.00 0.00 ? 23  TYR C O   1 
ATOM   3370  C CB  . TYR C  3  23  ? 12.255  -71.814 7.943   1.00 0.00 ? 23  TYR C CB  1 
ATOM   3371  C CG  . TYR C  3  23  ? 11.228  -72.924 7.800   1.00 0.00 ? 23  TYR C CG  1 
ATOM   3372  C CD1 . TYR C  3  23  ? 11.054  -73.982 8.727   1.00 0.00 ? 23  TYR C CD1 1 
ATOM   3373  C CD2 . TYR C  3  23  ? 10.376  -72.890 6.680   1.00 0.00 ? 23  TYR C CD2 1 
ATOM   3374  C CE1 . TYR C  3  23  ? 10.037  -74.925 8.564   1.00 0.00 ? 23  TYR C CE1 1 
ATOM   3375  C CE2 . TYR C  3  23  ? 9.379   -73.854 6.502   1.00 0.00 ? 23  TYR C CE2 1 
ATOM   3376  C CZ  . TYR C  3  23  ? 9.213   -74.871 7.446   1.00 0.00 ? 23  TYR C CZ  1 
ATOM   3377  O OH  . TYR C  3  23  ? 8.256   -75.880 7.254   1.00 0.00 ? 23  TYR C OH  1 
ATOM   3378  N N   . ALA C  3  24  ? 13.650  -69.550 9.956   1.00 0.00 ? 24  ALA C N   1 
ATOM   3379  C CA  . ALA C  3  24  ? 14.595  -68.496 10.197  1.00 0.00 ? 24  ALA C CA  1 
ATOM   3380  C C   . ALA C  3  24  ? 15.518  -68.905 11.302  1.00 0.00 ? 24  ALA C C   1 
ATOM   3381  O O   . ALA C  3  24  ? 16.708  -68.633 11.228  1.00 0.00 ? 24  ALA C O   1 
ATOM   3382  C CB  . ALA C  3  24  ? 13.937  -67.169 10.585  1.00 0.00 ? 24  ALA C CB  1 
ATOM   3383  N N   . MET C  3  25  ? 15.012  -69.616 12.335  1.00 0.00 ? 25  MET C N   1 
ATOM   3384  C CA  . MET C  3  25  ? 15.849  -70.098 13.420  1.00 0.00 ? 25  MET C CA  1 
ATOM   3385  C C   . MET C  3  25  ? 16.859  -71.096 12.926  1.00 0.00 ? 25  MET C C   1 
ATOM   3386  O O   . MET C  3  25  ? 17.933  -71.219 13.503  1.00 0.00 ? 25  MET C O   1 
ATOM   3387  C CB  . MET C  3  25  ? 15.126  -70.860 14.565  1.00 0.00 ? 25  MET C CB  1 
ATOM   3388  C CG  . MET C  3  25  ? 13.828  -70.239 15.124  1.00 0.00 ? 25  MET C CG  1 
ATOM   3389  S SD  . MET C  3  25  ? 13.850  -68.468 15.519  1.00 0.00 ? 25  MET C SD  1 
ATOM   3390  C CE  . MET C  3  25  ? 15.139  -68.525 16.795  1.00 0.00 ? 25  MET C CE  1 
ATOM   3391  N N   . GLU C  3  26  ? 16.483  -71.898 11.899  1.00 0.00 ? 26  GLU C N   1 
ATOM   3392  C CA  . GLU C  3  26  ? 17.293  -72.980 11.402  1.00 0.00 ? 26  GLU C CA  1 
ATOM   3393  C C   . GLU C  3  26  ? 18.288  -72.527 10.392  1.00 0.00 ? 26  GLU C C   1 
ATOM   3394  O O   . GLU C  3  26  ? 19.285  -73.204 10.179  1.00 0.00 ? 26  GLU C O   1 
ATOM   3395  C CB  . GLU C  3  26  ? 16.449  -74.088 10.750  1.00 0.00 ? 26  GLU C CB  1 
ATOM   3396  C CG  . GLU C  3  26  ? 15.410  -74.651 11.729  1.00 0.00 ? 26  GLU C CG  1 
ATOM   3397  C CD  . GLU C  3  26  ? 15.282  -76.164 11.599  1.00 0.00 ? 26  GLU C CD  1 
ATOM   3398  O OE1 . GLU C  3  26  ? 16.259  -76.874 11.959  1.00 0.00 ? 26  GLU C OE1 1 
ATOM   3399  O OE2 . GLU C  3  26  ? 14.196  -76.630 11.160  1.00 0.00 ? 26  GLU C OE2 1 
ATOM   3400  N N   . ALA C  3  27  ? 18.063  -71.362 9.758   1.00 0.00 ? 27  ALA C N   1 
ATOM   3401  C CA  . ALA C  3  27  ? 18.971  -70.759 8.820   1.00 0.00 ? 27  ALA C CA  1 
ATOM   3402  C C   . ALA C  3  27  ? 20.242  -70.360 9.485   1.00 0.00 ? 27  ALA C C   1 
ATOM   3403  O O   . ALA C  3  27  ? 21.307  -70.452 8.895   1.00 0.00 ? 27  ALA C O   1 
ATOM   3404  C CB  . ALA C  3  27  ? 18.363  -69.520 8.147   1.00 0.00 ? 27  ALA C CB  1 
ATOM   3405  N N   . ILE C  3  28  ? 20.112  -69.941 10.739  1.00 0.00 ? 28  ILE C N   1 
ATOM   3406  C CA  . ILE C  3  28  ? 21.234  -69.495 11.549  1.00 0.00 ? 28  ILE C CA  1 
ATOM   3407  C C   . ILE C  3  28  ? 22.152  -70.647 11.921  1.00 0.00 ? 28  ILE C C   1 
ATOM   3408  O O   . ILE C  3  28  ? 23.361  -70.459 12.046  1.00 0.00 ? 28  ILE C O   1 
ATOM   3409  C CB  . ILE C  3  28  ? 20.754  -68.799 12.835  1.00 0.00 ? 28  ILE C CB  1 
ATOM   3410  C CG1 . ILE C  3  28  ? 19.733  -67.712 12.501  1.00 0.00 ? 28  ILE C CG1 1 
ATOM   3411  C CG2 . ILE C  3  28  ? 21.931  -68.211 13.595  1.00 0.00 ? 28  ILE C CG2 1 
ATOM   3412  C CD1 . ILE C  3  28  ? 18.306  -68.209 12.470  1.00 0.00 ? 28  ILE C CD1 1 
ATOM   3413  N N   . GLY C  3  29  ? 21.596  -71.842 12.093  1.00 0.00 ? 29  GLY C N   1 
ATOM   3414  C CA  . GLY C  3  29  ? 22.446  -72.971 12.388  1.00 0.00 ? 29  GLY C CA  1 
ATOM   3415  C C   . GLY C  3  29  ? 23.443  -73.209 11.286  1.00 0.00 ? 29  GLY C C   1 
ATOM   3416  O O   . GLY C  3  29  ? 24.547  -73.664 11.549  1.00 0.00 ? 29  GLY C O   1 
ATOM   3417  N N   . HIS C  3  30  ? 23.087  -72.873 10.017  1.00 0.00 ? 30  HIS C N   1 
ATOM   3418  C CA  . HIS C  3  30  ? 23.978  -72.910 8.875   1.00 0.00 ? 30  HIS C CA  1 
ATOM   3419  C C   . HIS C  3  30  ? 24.991  -71.799 8.931   1.00 0.00 ? 30  HIS C C   1 
ATOM   3420  O O   . HIS C  3  30  ? 26.098  -71.931 8.414   1.00 0.00 ? 30  HIS C O   1 
ATOM   3421  C CB  . HIS C  3  30  ? 23.255  -72.821 7.522   1.00 0.00 ? 30  HIS C CB  1 
ATOM   3422  C CG  . HIS C  3  30  ? 22.383  -74.016 7.248   1.00 0.00 ? 30  HIS C CG  1 
ATOM   3423  N ND1 . HIS C  3  30  ? 21.165  -74.253 7.841   1.00 0.00 ? 30  HIS C ND1 1 
ATOM   3424  C CD2 . HIS C  3  30  ? 22.596  -75.066 6.413   1.00 0.00 ? 30  HIS C CD2 1 
ATOM   3425  C CE1 . HIS C  3  30  ? 20.710  -75.423 7.334   1.00 0.00 ? 30  HIS C CE1 1 
ATOM   3426  N NE2 . HIS C  3  30  ? 21.545  -75.952 6.468   1.00 0.00 ? 30  HIS C NE2 1 
ATOM   3427  N N   . ALA C  3  31  ? 24.648  -70.700 9.646   1.00 0.00 ? 31  ALA C N   1 
ATOM   3428  C CA  . ALA C  3  31  ? 25.498  -69.563 9.837   1.00 0.00 ? 31  ALA C CA  1 
ATOM   3429  C C   . ALA C  3  31  ? 26.604  -69.972 10.764  1.00 0.00 ? 31  ALA C C   1 
ATOM   3430  O O   . ALA C  3  31  ? 26.396  -70.845 11.596  1.00 0.00 ? 31  ALA C O   1 
ATOM   3431  C CB  . ALA C  3  31  ? 24.764  -68.361 10.426  1.00 0.00 ? 31  ALA C CB  1 
ATOM   3432  N N   . GLY C  3  32  ? 27.810  -69.379 10.604  1.00 0.00 ? 32  GLY C N   1 
ATOM   3433  C CA  . GLY C  3  32  ? 29.013  -69.702 11.332  1.00 0.00 ? 32  GLY C CA  1 
ATOM   3434  C C   . GLY C  3  32  ? 28.971  -69.112 12.694  1.00 0.00 ? 32  GLY C C   1 
ATOM   3435  O O   . GLY C  3  32  ? 28.161  -68.239 12.970  1.00 0.00 ? 32  GLY C O   1 
ATOM   3436  N N   . THR C  3  33  ? 29.828  -69.619 13.595  1.00 0.00 ? 33  THR C N   1 
ATOM   3437  C CA  . THR C  3  33  ? 29.881  -69.260 14.997  1.00 0.00 ? 33  THR C CA  1 
ATOM   3438  C C   . THR C  3  33  ? 30.203  -67.813 15.232  1.00 0.00 ? 33  THR C C   1 
ATOM   3439  O O   . THR C  3  33  ? 30.899  -67.199 14.432  1.00 0.00 ? 33  THR C O   1 
ATOM   3440  C CB  . THR C  3  33  ? 30.864  -70.125 15.770  1.00 0.00 ? 33  THR C CB  1 
ATOM   3441  O OG1 . THR C  3  33  ? 30.483  -71.497 15.712  1.00 0.00 ? 33  THR C OG1 1 
ATOM   3442  C CG2 . THR C  3  33  ? 30.878  -69.666 17.240  1.00 0.00 ? 33  THR C CG2 1 
ATOM   3443  N N   . CYS C  3  34  ? 29.646  -67.225 16.309  1.00 0.00 ? 34  CYS C N   1 
ATOM   3444  C CA  . CYS C  3  34  ? 29.903  -65.865 16.702  1.00 0.00 ? 34  CYS C CA  1 
ATOM   3445  C C   . CYS C  3  34  ? 29.610  -65.769 18.172  1.00 0.00 ? 34  CYS C C   1 
ATOM   3446  O O   . CYS C  3  34  ? 28.696  -66.439 18.614  1.00 0.00 ? 34  CYS C O   1 
ATOM   3447  C CB  . CYS C  3  34  ? 28.972  -64.920 15.939  1.00 0.00 ? 34  CYS C CB  1 
ATOM   3448  S SG  . CYS C  3  34  ? 29.141  -63.229 16.463  1.00 0.00 ? 34  CYS C SG  1 
ATOM   3449  N N   . LEU C  3  35  ? 30.264  -64.878 18.957  1.00 0.00 ? 35  LEU C N   1 
ATOM   3450  C CA  . LEU C  3  35  ? 29.894  -64.701 20.340  1.00 0.00 ? 35  LEU C CA  1 
ATOM   3451  C C   . LEU C  3  35  ? 30.301  -63.357 20.818  1.00 0.00 ? 35  LEU C C   1 
ATOM   3452  O O   . LEU C  3  35  ? 31.341  -62.855 20.420  1.00 0.00 ? 35  LEU C O   1 
ATOM   3453  C CB  . LEU C  3  35  ? 30.497  -65.763 21.293  1.00 0.00 ? 35  LEU C CB  1 
ATOM   3454  C CG  . LEU C  3  35  ? 32.020  -66.049 21.230  1.00 0.00 ? 35  LEU C CG  1 
ATOM   3455  C CD1 . LEU C  3  35  ? 32.907  -65.115 22.078  1.00 0.00 ? 35  LEU C CD1 1 
ATOM   3456  C CD2 . LEU C  3  35  ? 32.272  -67.499 21.681  1.00 0.00 ? 35  LEU C CD2 1 
ATOM   3457  N N   . GLY C  3  36  ? 29.509  -62.754 21.733  1.00 0.00 ? 36  GLY C N   1 
ATOM   3458  C CA  . GLY C  3  36  ? 29.829  -61.479 22.324  1.00 0.00 ? 36  GLY C CA  1 
ATOM   3459  C C   . GLY C  3  36  ? 29.823  -61.714 23.784  1.00 0.00 ? 36  GLY C C   1 
ATOM   3460  O O   . GLY C  3  36  ? 29.033  -62.524 24.258  1.00 0.00 ? 36  GLY C O   1 
ATOM   3461  N N   . ILE C  3  37  ? 30.704  -61.004 24.525  1.00 0.00 ? 37  ILE C N   1 
ATOM   3462  C CA  . ILE C  3  37  ? 30.882  -61.182 25.955  1.00 0.00 ? 37  ILE C CA  1 
ATOM   3463  C C   . ILE C  3  37  ? 31.030  -59.828 26.584  1.00 0.00 ? 37  ILE C C   1 
ATOM   3464  O O   . ILE C  3  37  ? 31.995  -59.112 26.364  1.00 0.00 ? 37  ILE C O   1 
ATOM   3465  C CB  . ILE C  3  37  ? 32.055  -62.090 26.359  1.00 0.00 ? 37  ILE C CB  1 
ATOM   3466  C CG1 . ILE C  3  37  ? 31.821  -63.516 25.841  1.00 0.00 ? 37  ILE C CG1 1 
ATOM   3467  C CG2 . ILE C  3  37  ? 32.215  -62.099 27.891  1.00 0.00 ? 37  ILE C CG2 1 
ATOM   3468  C CD1 . ILE C  3  37  ? 32.815  -64.550 26.354  1.00 0.00 ? 37  ILE C CD1 1 
ATOM   3469  N N   . LEU C  3  38  ? 30.071  -59.459 27.428  1.00 0.00 ? 38  LEU C N   1 
ATOM   3470  C CA  . LEU C  3  38  ? 30.039  -58.273 28.239  1.00 0.00 ? 38  LEU C CA  1 
ATOM   3471  C C   . LEU C  3  38  ? 31.008  -58.408 29.382  1.00 0.00 ? 38  LEU C C   1 
ATOM   3472  O O   . LEU C  3  38  ? 31.291  -59.508 29.838  1.00 0.00 ? 38  LEU C O   1 
ATOM   3473  C CB  . LEU C  3  38  ? 28.587  -58.051 28.714  1.00 0.00 ? 38  LEU C CB  1 
ATOM   3474  C CG  . LEU C  3  38  ? 28.273  -56.821 29.568  1.00 0.00 ? 38  LEU C CG  1 
ATOM   3475  C CD1 . LEU C  3  38  ? 26.924  -56.228 29.147  1.00 0.00 ? 38  LEU C CD1 1 
ATOM   3476  C CD2 . LEU C  3  38  ? 28.258  -57.168 31.069  1.00 0.00 ? 38  LEU C CD2 1 
ATOM   3477  N N   . ALA C  3  39  ? 31.528  -57.272 29.877  1.00 0.00 ? 39  ALA C N   1 
ATOM   3478  C CA  . ALA C  3  39  ? 32.399  -57.160 31.024  1.00 0.00 ? 39  ALA C CA  1 
ATOM   3479  C C   . ALA C  3  39  ? 31.960  -55.864 31.626  1.00 0.00 ? 39  ALA C C   1 
ATOM   3480  O O   . ALA C  3  39  ? 31.031  -55.219 31.146  1.00 0.00 ? 39  ALA C O   1 
ATOM   3481  C CB  . ALA C  3  39  ? 33.907  -57.061 30.734  1.00 0.00 ? 39  ALA C CB  1 
ATOM   3482  N N   . ASN C  3  40  ? 32.570  -55.458 32.749  1.00 0.00 ? 40  ASN C N   1 
ATOM   3483  C CA  . ASN C  3  40  ? 32.114  -54.311 33.506  1.00 0.00 ? 40  ASN C CA  1 
ATOM   3484  C C   . ASN C  3  40  ? 32.753  -53.059 32.975  1.00 0.00 ? 40  ASN C C   1 
ATOM   3485  O O   . ASN C  3  40  ? 32.621  -51.996 33.578  1.00 0.00 ? 40  ASN C O   1 
ATOM   3486  C CB  . ASN C  3  40  ? 32.541  -54.409 35.001  1.00 0.00 ? 40  ASN C CB  1 
ATOM   3487  C CG  . ASN C  3  40  ? 31.973  -55.678 35.646  1.00 0.00 ? 40  ASN C CG  1 
ATOM   3488  O OD1 . ASN C  3  40  ? 30.760  -55.899 35.596  1.00 0.00 ? 40  ASN C OD1 1 
ATOM   3489  N ND2 . ASN C  3  40  ? 32.863  -56.510 36.267  1.00 0.00 ? 40  ASN C ND2 1 
ATOM   3490  N N   . ASP C  3  41  ? 33.621  -53.227 31.981  1.00 0.00 ? 41  ASP C N   1 
ATOM   3491  C CA  . ASP C  3  41  ? 34.340  -52.105 31.386  1.00 0.00 ? 41  ASP C CA  1 
ATOM   3492  C C   . ASP C  3  41  ? 34.245  -52.038 29.864  1.00 0.00 ? 41  ASP C C   1 
ATOM   3493  O O   . ASP C  3  41  ? 34.667  -51.053 29.258  1.00 0.00 ? 41  ASP C O   1 
ATOM   3494  C CB  . ASP C  3  41  ? 35.810  -52.130 31.814  1.00 0.00 ? 41  ASP C CB  1 
ATOM   3495  C CG  . ASP C  3  41  ? 36.334  -53.538 32.017  1.00 0.00 ? 41  ASP C CG  1 
ATOM   3496  O OD1 . ASP C  3  41  ? 35.626  -54.497 31.643  1.00 0.00 ? 41  ASP C OD1 1 
ATOM   3497  O OD2 . ASP C  3  41  ? 37.454  -53.686 32.550  1.00 0.00 ? 41  ASP C OD2 1 
ATOM   3498  N N   . GLY C  3  42  ? 33.706  -53.083 29.243  1.00 0.00 ? 42  GLY C N   1 
ATOM   3499  C CA  . GLY C  3  42  ? 33.717  -53.161 27.810  1.00 0.00 ? 42  GLY C CA  1 
ATOM   3500  C C   . GLY C  3  42  ? 33.034  -54.394 27.374  1.00 0.00 ? 42  GLY C C   1 
ATOM   3501  O O   . GLY C  3  42  ? 32.676  -55.240 28.176  1.00 0.00 ? 42  GLY C O   1 
ATOM   3502  N N   . VAL C  3  43  ? 32.763  -54.477 26.061  1.00 0.00 ? 43  VAL C N   1 
ATOM   3503  C CA  . VAL C  3  43  ? 32.017  -55.566 25.520  1.00 0.00 ? 43  VAL C CA  1 
ATOM   3504  C C   . VAL C  3  43  ? 32.723  -56.013 24.272  1.00 0.00 ? 43  VAL C C   1 
ATOM   3505  O O   . VAL C  3  43  ? 32.901  -55.273 23.315  1.00 0.00 ? 43  VAL C O   1 
ATOM   3506  C CB  . VAL C  3  43  ? 30.529  -55.189 25.372  1.00 0.00 ? 43  VAL C CB  1 
ATOM   3507  C CG1 . VAL C  3  43  ? 30.330  -53.903 24.571  1.00 0.00 ? 43  VAL C CG1 1 
ATOM   3508  C CG2 . VAL C  3  43  ? 29.680  -56.341 24.810  1.00 0.00 ? 43  VAL C CG2 1 
ATOM   3509  N N   . LEU C  3  44  ? 33.126  -57.291 24.287  1.00 0.00 ? 44  LEU C N   1 
ATOM   3510  C CA  . LEU C  3  44  ? 33.764  -58.054 23.252  1.00 0.00 ? 44  LEU C CA  1 
ATOM   3511  C C   . LEU C  3  44  ? 32.766  -58.544 22.249  1.00 0.00 ? 44  LEU C C   1 
ATOM   3512  O O   . LEU C  3  44  ? 31.626  -58.820 22.627  1.00 0.00 ? 44  LEU C O   1 
ATOM   3513  C CB  . LEU C  3  44  ? 34.522  -59.248 23.886  1.00 0.00 ? 44  LEU C CB  1 
ATOM   3514  C CG  . LEU C  3  44  ? 35.111  -60.304 22.930  1.00 0.00 ? 44  LEU C CG  1 
ATOM   3515  C CD1 . LEU C  3  44  ? 36.539  -60.695 23.325  1.00 0.00 ? 44  LEU C CD1 1 
ATOM   3516  C CD2 . LEU C  3  44  ? 34.198  -61.533 22.866  1.00 0.00 ? 44  LEU C CD2 1 
ATOM   3517  N N   . LEU C  3  45  ? 33.214  -58.746 20.977  1.00 0.00 ? 45  LEU C N   1 
ATOM   3518  C CA  . LEU C  3  45  ? 32.476  -59.506 19.996  1.00 0.00 ? 45  LEU C CA  1 
ATOM   3519  C C   . LEU C  3  45  ? 33.379  -60.308 19.104  1.00 0.00 ? 45  LEU C C   1 
ATOM   3520  O O   . LEU C  3  45  ? 33.816  -59.808 18.076  1.00 0.00 ? 45  LEU C O   1 
ATOM   3521  C CB  . LEU C  3  45  ? 31.673  -58.604 19.087  1.00 0.00 ? 45  LEU C CB  1 
ATOM   3522  C CG  . LEU C  3  45  ? 30.912  -59.320 17.971  1.00 0.00 ? 45  LEU C CG  1 
ATOM   3523  C CD1 . LEU C  3  45  ? 29.793  -60.196 18.541  1.00 0.00 ? 45  LEU C CD1 1 
ATOM   3524  C CD2 . LEU C  3  45  ? 30.466  -58.257 16.976  1.00 0.00 ? 45  LEU C CD2 1 
ATOM   3525  N N   . ALA C  3  46  ? 33.661  -61.587 19.431  1.00 0.00 ? 46  ALA C N   1 
ATOM   3526  C CA  . ALA C  3  46  ? 34.335  -62.500 18.540  1.00 0.00 ? 46  ALA C CA  1 
ATOM   3527  C C   . ALA C  3  46  ? 33.414  -63.004 17.476  1.00 0.00 ? 46  ALA C C   1 
ATOM   3528  O O   . ALA C  3  46  ? 32.212  -63.089 17.689  1.00 0.00 ? 46  ALA C O   1 
ATOM   3529  C CB  . ALA C  3  46  ? 34.931  -63.718 19.222  1.00 0.00 ? 46  ALA C CB  1 
ATOM   3530  N N   . ALA C  3  47  ? 33.961  -63.325 16.289  1.00 0.00 ? 47  ALA C N   1 
ATOM   3531  C CA  . ALA C  3  47  ? 33.200  -63.807 15.178  1.00 0.00 ? 47  ALA C CA  1 
ATOM   3532  C C   . ALA C  3  47  ? 34.161  -64.606 14.349  1.00 0.00 ? 47  ALA C C   1 
ATOM   3533  O O   . ALA C  3  47  ? 35.358  -64.363 14.427  1.00 0.00 ? 47  ALA C O   1 
ATOM   3534  C CB  . ALA C  3  47  ? 32.576  -62.654 14.384  1.00 0.00 ? 47  ALA C CB  1 
ATOM   3535  N N   . GLU C  3  48  ? 33.698  -65.606 13.558  1.00 0.00 ? 48  GLU C N   1 
ATOM   3536  C CA  . GLU C  3  48  ? 34.591  -66.445 12.785  1.00 0.00 ? 48  GLU C CA  1 
ATOM   3537  C C   . GLU C  3  48  ? 34.331  -66.191 11.343  1.00 0.00 ? 48  GLU C C   1 
ATOM   3538  O O   . GLU C  3  48  ? 33.208  -66.335 10.874  1.00 0.00 ? 48  GLU C O   1 
ATOM   3539  C CB  . GLU C  3  48  ? 34.358  -67.951 13.031  1.00 0.00 ? 48  GLU C CB  1 
ATOM   3540  C CG  . GLU C  3  48  ? 35.066  -68.927 12.056  1.00 0.00 ? 48  GLU C CG  1 
ATOM   3541  C CD  . GLU C  3  48  ? 34.114  -69.532 11.017  1.00 0.00 ? 48  GLU C CD  1 
ATOM   3542  O OE1 . GLU C  3  48  ? 32.932  -69.111 10.963  1.00 0.00 ? 48  GLU C OE1 1 
ATOM   3543  O OE2 . GLU C  3  48  ? 34.558  -70.445 10.267  1.00 0.00 ? 48  GLU C OE2 1 
ATOM   3544  N N   . ARG C  3  49  ? 35.411  -65.820 10.599  1.00 0.00 ? 49  ARG C N   1 
ATOM   3545  C CA  . ARG C  3  49  ? 35.429  -65.465 9.193   1.00 0.00 ? 49  ARG C CA  1 
ATOM   3546  C C   . ARG C  3  49  ? 35.057  -66.683 8.465   1.00 0.00 ? 49  ARG C C   1 
ATOM   3547  O O   . ARG C  3  49  ? 35.626  -67.732 8.740   1.00 0.00 ? 49  ARG C O   1 
ATOM   3548  C CB  . ARG C  3  49  ? 36.809  -64.999 8.672   1.00 0.00 ? 49  ARG C CB  1 
ATOM   3549  C CG  . ARG C  3  49  ? 37.271  -63.679 9.315   1.00 0.00 ? 49  ARG C CG  1 
ATOM   3550  C CD  . ARG C  3  49  ? 38.740  -63.342 9.038   1.00 0.00 ? 49  ARG C CD  1 
ATOM   3551  N NE  . ARG C  3  49  ? 39.124  -62.152 9.865   1.00 0.00 ? 49  ARG C NE  1 
ATOM   3552  C CZ  . ARG C  3  49  ? 40.383  -61.614 9.867   1.00 0.00 ? 49  ARG C CZ  1 
ATOM   3553  N NH1 . ARG C  3  49  ? 41.396  -62.176 9.150   1.00 0.00 ? 49  ARG C NH1 1 
ATOM   3554  N NH2 . ARG C  3  49  ? 40.626  -60.479 10.585  1.00 0.00 ? 49  ARG C NH2 1 
ATOM   3555  N N   . ARG C  3  50  ? 34.117  -66.594 7.527   1.00 0.00 ? 50  ARG C N   1 
ATOM   3556  C CA  . ARG C  3  50  ? 33.286  -67.735 7.153   1.00 0.00 ? 50  ARG C CA  1 
ATOM   3557  C C   . ARG C  3  50  ? 34.043  -68.957 6.633   1.00 0.00 ? 50  ARG C C   1 
ATOM   3558  O O   . ARG C  3  50  ? 33.763  -70.074 7.068   1.00 0.00 ? 50  ARG C O   1 
ATOM   3559  C CB  . ARG C  3  50  ? 32.218  -67.312 6.136   1.00 0.00 ? 50  ARG C CB  1 
ATOM   3560  C CG  . ARG C  3  50  ? 31.360  -68.455 5.609   1.00 0.00 ? 50  ARG C CG  1 
ATOM   3561  C CD  . ARG C  3  50  ? 30.605  -69.171 6.722   1.00 0.00 ? 50  ARG C CD  1 
ATOM   3562  N NE  . ARG C  3  50  ? 30.087  -70.475 6.306   1.00 0.00 ? 50  ARG C NE  1 
ATOM   3563  C CZ  . ARG C  3  50  ? 30.252  -71.602 6.992   1.00 0.00 ? 50  ARG C CZ  1 
ATOM   3564  N NH1 . ARG C  3  50  ? 30.922  -71.599 8.134   1.00 0.00 ? 50  ARG C NH1 1 
ATOM   3565  N NH2 . ARG C  3  50  ? 29.746  -72.736 6.534   1.00 0.00 ? 50  ARG C NH2 1 
ATOM   3566  N N   . ASN C  3  51  ? 35.021  -68.765 5.754   1.00 0.00 ? 51  ASN C N   1 
ATOM   3567  C CA  . ASN C  3  51  ? 35.931  -69.830 5.461   1.00 0.00 ? 51  ASN C CA  1 
ATOM   3568  C C   . ASN C  3  51  ? 37.281  -69.192 5.395   1.00 0.00 ? 51  ASN C C   1 
ATOM   3569  O O   . ASN C  3  51  ? 37.430  -67.977 5.320   1.00 0.00 ? 51  ASN C O   1 
ATOM   3570  C CB  . ASN C  3  51  ? 35.656  -70.564 4.117   1.00 0.00 ? 51  ASN C CB  1 
ATOM   3571  C CG  . ASN C  3  51  ? 34.425  -71.491 4.192   1.00 0.00 ? 51  ASN C CG  1 
ATOM   3572  O OD1 . ASN C  3  51  ? 33.503  -71.348 3.381   1.00 0.00 ? 51  ASN C OD1 1 
ATOM   3573  N ND2 . ASN C  3  51  ? 34.434  -72.466 5.151   1.00 0.00 ? 51  ASN C ND2 1 
ATOM   3574  N N   . ILE C  3  52  ? 38.324  -70.011 5.420   1.00 0.00 ? 52  ILE C N   1 
ATOM   3575  C CA  . ILE C  3  52  ? 39.693  -69.494 5.486   1.00 0.00 ? 52  ILE C CA  1 
ATOM   3576  C C   . ILE C  3  52  ? 40.246  -69.177 4.100   1.00 0.00 ? 52  ILE C C   1 
ATOM   3577  O O   . ILE C  3  52  ? 41.391  -68.750 3.951   1.00 0.00 ? 52  ILE C O   1 
ATOM   3578  C CB  . ILE C  3  52  ? 40.637  -70.487 6.189   1.00 0.00 ? 52  ILE C CB  1 
ATOM   3579  C CG1 . ILE C  3  52  ? 40.373  -71.913 5.700   1.00 0.00 ? 52  ILE C CG1 1 
ATOM   3580  C CG2 . ILE C  3  52  ? 40.475  -70.398 7.699   1.00 0.00 ? 52  ILE C CG2 1 
ATOM   3581  C CD1 . ILE C  3  52  ? 41.153  -72.970 6.450   1.00 0.00 ? 52  ILE C CD1 1 
ATOM   3582  N N   . HIS C  3  53  ? 39.394  -69.265 3.084   1.00 0.00 ? 53  HIS C N   1 
ATOM   3583  C CA  . HIS C  3  53  ? 39.850  -69.454 1.715   1.00 0.00 ? 53  HIS C CA  1 
ATOM   3584  C C   . HIS C  3  53  ? 40.887  -68.407 1.333   1.00 0.00 ? 53  HIS C C   1 
ATOM   3585  O O   . HIS C  3  53  ? 40.747  -67.220 1.627   1.00 0.00 ? 53  HIS C O   1 
ATOM   3586  C CB  . HIS C  3  53  ? 38.668  -69.402 0.744   1.00 0.00 ? 53  HIS C CB  1 
ATOM   3587  C CG  . HIS C  3  53  ? 39.071  -69.366 -0.697  1.00 0.00 ? 53  HIS C CG  1 
ATOM   3588  N ND1 . HIS C  3  53  ? 39.166  -70.502 -1.471  1.00 0.00 ? 53  HIS C ND1 1 
ATOM   3589  C CD2 . HIS C  3  53  ? 39.403  -68.331 -1.505  1.00 0.00 ? 53  HIS C CD2 1 
ATOM   3590  C CE1 . HIS C  3  53  ? 39.539  -70.168 -2.694  1.00 0.00 ? 53  HIS C CE1 1 
ATOM   3591  N NE2 . HIS C  3  53  ? 39.690  -68.857 -2.741  1.00 0.00 ? 53  HIS C NE2 1 
ATOM   3592  N N   . LYS C  3  54  ? 41.944  -68.890 0.685   1.00 0.00 ? 54  LYS C N   1 
ATOM   3593  C CA  . LYS C  3  54  ? 43.196  -68.205 0.592   1.00 0.00 ? 54  LYS C CA  1 
ATOM   3594  C C   . LYS C  3  54  ? 43.091  -66.903 -0.136  1.00 0.00 ? 54  LYS C C   1 
ATOM   3595  O O   . LYS C  3  54  ? 43.694  -65.927 0.304   1.00 0.00 ? 54  LYS C O   1 
ATOM   3596  C CB  . LYS C  3  54  ? 44.219  -69.149 -0.069  1.00 0.00 ? 54  LYS C CB  1 
ATOM   3597  C CG  . LYS C  3  54  ? 45.678  -68.667 -0.059  1.00 0.00 ? 54  LYS C CG  1 
ATOM   3598  C CD  . LYS C  3  54  ? 46.678  -69.785 -0.425  1.00 0.00 ? 54  LYS C CD  1 
ATOM   3599  C CE  . LYS C  3  54  ? 46.512  -70.374 -1.839  1.00 0.00 ? 54  LYS C CE  1 
ATOM   3600  N NZ  . LYS C  3  54  ? 47.287  -71.626 -2.018  1.00 0.00 ? 54  LYS C NZ  1 
ATOM   3601  N N   . LEU C  3  55  ? 42.345  -66.864 -1.273  1.00 0.00 ? 55  LEU C N   1 
ATOM   3602  C CA  . LEU C  3  55  ? 42.391  -65.766 -2.222  1.00 0.00 ? 55  LEU C CA  1 
ATOM   3603  C C   . LEU C  3  55  ? 41.350  -64.720 -1.950  1.00 0.00 ? 55  LEU C C   1 
ATOM   3604  O O   . LEU C  3  55  ? 41.294  -63.703 -2.633  1.00 0.00 ? 55  LEU C O   1 
ATOM   3605  C CB  . LEU C  3  55  ? 42.191  -66.249 -3.665  1.00 0.00 ? 55  LEU C CB  1 
ATOM   3606  C CG  . LEU C  3  55  ? 43.444  -66.796 -4.358  1.00 0.00 ? 55  LEU C CG  1 
ATOM   3607  C CD1 . LEU C  3  55  ? 44.343  -67.670 -3.488  1.00 0.00 ? 55  LEU C CD1 1 
ATOM   3608  C CD2 . LEU C  3  55  ? 43.012  -67.534 -5.636  1.00 0.00 ? 55  LEU C CD2 1 
ATOM   3609  N N   . LEU C  3  56  ? 40.540  -64.899 -0.901  1.00 0.00 ? 56  LEU C N   1 
ATOM   3610  C CA  . LEU C  3  56  ? 39.683  -63.867 -0.419  1.00 0.00 ? 56  LEU C CA  1 
ATOM   3611  C C   . LEU C  3  56  ? 40.551  -63.009 0.447   1.00 0.00 ? 56  LEU C C   1 
ATOM   3612  O O   . LEU C  3  56  ? 41.347  -63.501 1.244   1.00 0.00 ? 56  LEU C O   1 
ATOM   3613  C CB  . LEU C  3  56  ? 38.501  -64.429 0.384   1.00 0.00 ? 56  LEU C CB  1 
ATOM   3614  C CG  . LEU C  3  56  ? 37.421  -65.064 -0.511  1.00 0.00 ? 56  LEU C CG  1 
ATOM   3615  C CD1 . LEU C  3  56  ? 36.380  -65.847 0.312   1.00 0.00 ? 56  LEU C CD1 1 
ATOM   3616  C CD2 . LEU C  3  56  ? 36.735  -63.996 -1.370  1.00 0.00 ? 56  LEU C CD2 1 
ATOM   3617  N N   . ASP C  3  57  ? 40.496  -61.688 0.197   1.00 0.00 ? 57  ASP C N   1 
ATOM   3618  C CA  . ASP C  3  57  ? 41.426  -60.768 0.766   1.00 0.00 ? 57  ASP C CA  1 
ATOM   3619  C C   . ASP C  3  57  ? 41.098  -60.414 2.184   1.00 0.00 ? 57  ASP C C   1 
ATOM   3620  O O   . ASP C  3  57  ? 42.017  -60.396 3.000   1.00 0.00 ? 57  ASP C O   1 
ATOM   3621  C CB  . ASP C  3  57  ? 41.494  -59.485 -0.099  1.00 0.00 ? 57  ASP C CB  1 
ATOM   3622  C CG  . ASP C  3  57  ? 42.632  -58.559 0.336   1.00 0.00 ? 57  ASP C CG  1 
ATOM   3623  O OD1 . ASP C  3  57  ? 42.482  -57.893 1.392   1.00 0.00 ? 57  ASP C OD1 1 
ATOM   3624  O OD2 . ASP C  3  57  ? 43.667  -58.511 -0.380  1.00 0.00 ? 57  ASP C OD2 1 
ATOM   3625  N N   . LYS C  3  64  ? 31.812  -59.370 9.193   1.00 0.00 ? 64  LYS C N   1 
ATOM   3626  C CA  . LYS C  3  64  ? 30.453  -59.429 9.675   1.00 0.00 ? 64  LYS C CA  1 
ATOM   3627  C C   . LYS C  3  64  ? 30.120  -58.356 10.654  1.00 0.00 ? 64  LYS C C   1 
ATOM   3628  O O   . LYS C  3  64  ? 29.017  -57.822 10.575  1.00 0.00 ? 64  LYS C O   1 
ATOM   3629  C CB  . LYS C  3  64  ? 30.187  -60.804 10.319  1.00 0.00 ? 64  LYS C CB  1 
ATOM   3630  C CG  . LYS C  3  64  ? 30.208  -61.924 9.255   1.00 0.00 ? 64  LYS C CG  1 
ATOM   3631  C CD  . LYS C  3  64  ? 30.192  -63.362 9.782   1.00 0.00 ? 64  LYS C CD  1 
ATOM   3632  C CE  . LYS C  3  64  ? 31.326  -63.684 10.761  1.00 0.00 ? 64  LYS C CE  1 
ATOM   3633  N NZ  . LYS C  3  64  ? 32.670  -63.358 10.233  1.00 0.00 ? 64  LYS C NZ  1 
ATOM   3634  N N   . ILE C  3  65  ? 31.027  -57.972 11.588  1.00 0.00 ? 65  ILE C N   1 
ATOM   3635  C CA  . ILE C  3  65  ? 30.768  -56.854 12.492  1.00 0.00 ? 65  ILE C CA  1 
ATOM   3636  C C   . ILE C  3  65  ? 30.759  -55.530 11.738  1.00 0.00 ? 65  ILE C C   1 
ATOM   3637  O O   . ILE C  3  65  ? 31.454  -55.370 10.738  1.00 0.00 ? 65  ILE C O   1 
ATOM   3638  C CB  . ILE C  3  65  ? 31.666  -56.920 13.736  1.00 0.00 ? 65  ILE C CB  1 
ATOM   3639  C CG1 . ILE C  3  65  ? 31.654  -55.694 14.651  1.00 0.00 ? 65  ILE C CG1 1 
ATOM   3640  C CG2 . ILE C  3  65  ? 33.123  -57.231 13.400  1.00 0.00 ? 65  ILE C CG2 1 
ATOM   3641  C CD1 . ILE C  3  65  ? 30.330  -55.370 15.324  1.00 0.00 ? 65  ILE C CD1 1 
ATOM   3642  N N   . TYR C  3  66  ? 29.868  -54.589 12.148  1.00 0.00 ? 66  TYR C N   1 
ATOM   3643  C CA  . TYR C  3  66  ? 29.700  -53.296 11.518  1.00 0.00 ? 66  TYR C CA  1 
ATOM   3644  C C   . TYR C  3  66  ? 29.601  -52.195 12.539  1.00 0.00 ? 66  TYR C C   1 
ATOM   3645  O O   . TYR C  3  66  ? 29.319  -52.382 13.713  1.00 0.00 ? 66  TYR C O   1 
ATOM   3646  C CB  . TYR C  3  66  ? 28.402  -53.175 10.692  1.00 0.00 ? 66  TYR C CB  1 
ATOM   3647  C CG  . TYR C  3  66  ? 28.415  -54.058 9.486   1.00 0.00 ? 66  TYR C CG  1 
ATOM   3648  C CD1 . TYR C  3  66  ? 29.193  -53.718 8.369   1.00 0.00 ? 66  TYR C CD1 1 
ATOM   3649  C CD2 . TYR C  3  66  ? 27.574  -55.179 9.415   1.00 0.00 ? 66  TYR C CD2 1 
ATOM   3650  C CE1 . TYR C  3  66  ? 29.133  -54.486 7.199   1.00 0.00 ? 66  TYR C CE1 1 
ATOM   3651  C CE2 . TYR C  3  66  ? 27.504  -55.944 8.246   1.00 0.00 ? 66  TYR C CE2 1 
ATOM   3652  C CZ  . TYR C  3  66  ? 28.291  -55.607 7.141   1.00 0.00 ? 66  TYR C CZ  1 
ATOM   3653  O OH  . TYR C  3  66  ? 28.240  -56.410 5.980   1.00 0.00 ? 66  TYR C OH  1 
ATOM   3654  N N   . LYS C  3  67  ? 29.812  -50.971 12.051  1.00 0.00 ? 67  LYS C N   1 
ATOM   3655  C CA  . LYS C  3  67  ? 29.731  -49.752 12.781  1.00 0.00 ? 67  LYS C CA  1 
ATOM   3656  C C   . LYS C  3  67  ? 28.324  -49.260 12.676  1.00 0.00 ? 67  LYS C C   1 
ATOM   3657  O O   . LYS C  3  67  ? 27.956  -48.610 11.707  1.00 0.00 ? 67  LYS C O   1 
ATOM   3658  C CB  . LYS C  3  67  ? 30.645  -48.645 12.187  1.00 0.00 ? 67  LYS C CB  1 
ATOM   3659  C CG  . LYS C  3  67  ? 32.147  -48.960 12.102  1.00 0.00 ? 67  LYS C CG  1 
ATOM   3660  C CD  . LYS C  3  67  ? 32.900  -48.927 13.442  1.00 0.00 ? 67  LYS C CD  1 
ATOM   3661  C CE  . LYS C  3  67  ? 34.423  -48.962 13.216  1.00 0.00 ? 67  LYS C CE  1 
ATOM   3662  N NZ  . LYS C  3  67  ? 35.190  -48.937 14.483  1.00 0.00 ? 67  LYS C NZ  1 
ATOM   3663  N N   . LEU C  3  68  ? 27.472  -49.523 13.675  1.00 0.00 ? 68  LEU C N   1 
ATOM   3664  C CA  . LEU C  3  68  ? 26.187  -48.869 13.699  1.00 0.00 ? 68  LEU C CA  1 
ATOM   3665  C C   . LEU C  3  68  ? 26.358  -47.452 14.117  1.00 0.00 ? 68  LEU C C   1 
ATOM   3666  O O   . LEU C  3  68  ? 25.742  -46.562 13.539  1.00 0.00 ? 68  LEU C O   1 
ATOM   3667  C CB  . LEU C  3  68  ? 25.186  -49.479 14.679  1.00 0.00 ? 68  LEU C CB  1 
ATOM   3668  C CG  . LEU C  3  68  ? 24.837  -50.922 14.332  1.00 0.00 ? 68  LEU C CG  1 
ATOM   3669  C CD1 . LEU C  3  68  ? 23.698  -51.390 15.242  1.00 0.00 ? 68  LEU C CD1 1 
ATOM   3670  C CD2 . LEU C  3  68  ? 24.513  -51.059 12.839  1.00 0.00 ? 68  LEU C CD2 1 
ATOM   3671  N N   . ASN C  3  69  ? 27.220  -47.220 15.125  1.00 0.00 ? 69  ASN C N   1 
ATOM   3672  C CA  . ASN C  3  69  ? 27.564  -45.909 15.573  1.00 0.00 ? 69  ASN C CA  1 
ATOM   3673  C C   . ASN C  3  69  ? 28.986  -46.042 15.952  1.00 0.00 ? 69  ASN C C   1 
ATOM   3674  O O   . ASN C  3  69  ? 29.672  -46.930 15.458  1.00 0.00 ? 69  ASN C O   1 
ATOM   3675  C CB  . ASN C  3  69  ? 26.733  -45.451 16.767  1.00 0.00 ? 69  ASN C CB  1 
ATOM   3676  C CG  . ASN C  3  69  ? 25.283  -45.452 16.302  1.00 0.00 ? 69  ASN C CG  1 
ATOM   3677  O OD1 . ASN C  3  69  ? 24.510  -46.351 16.645  1.00 0.00 ? 69  ASN C OD1 1 
ATOM   3678  N ND2 . ASN C  3  69  ? 24.940  -44.439 15.456  1.00 0.00 ? 69  ASN C ND2 1 
ATOM   3679  N N   . GLU C  3  70  ? 29.505  -45.106 16.765  1.00 0.00 ? 70  GLU C N   1 
ATOM   3680  C CA  . GLU C  3  70  ? 30.853  -45.203 17.276  1.00 0.00 ? 70  GLU C CA  1 
ATOM   3681  C C   . GLU C  3  70  ? 30.790  -45.648 18.706  1.00 0.00 ? 70  GLU C C   1 
ATOM   3682  O O   . GLU C  3  70  ? 31.812  -45.853 19.365  1.00 0.00 ? 70  GLU C O   1 
ATOM   3683  C CB  . GLU C  3  70  ? 31.578  -43.834 17.162  1.00 0.00 ? 70  GLU C CB  1 
ATOM   3684  C CG  . GLU C  3  70  ? 33.121  -43.878 17.267  1.00 0.00 ? 70  GLU C CG  1 
ATOM   3685  C CD  . GLU C  3  70  ? 33.723  -44.791 16.195  1.00 0.00 ? 70  GLU C CD  1 
ATOM   3686  O OE1 . GLU C  3  70  ? 33.371  -44.602 15.004  1.00 0.00 ? 70  GLU C OE1 1 
ATOM   3687  O OE2 . GLU C  3  70  ? 34.535  -45.684 16.554  1.00 0.00 ? 70  GLU C OE2 1 
ATOM   3688  N N   . ASP C  3  71  ? 29.550  -45.817 19.201  1.00 0.00 ? 71  ASP C N   1 
ATOM   3689  C CA  . ASP C  3  71  ? 29.290  -46.114 20.568  1.00 0.00 ? 71  ASP C CA  1 
ATOM   3690  C C   . ASP C  3  71  ? 28.441  -47.368 20.645  1.00 0.00 ? 71  ASP C C   1 
ATOM   3691  O O   . ASP C  3  71  ? 28.126  -47.834 21.734  1.00 0.00 ? 71  ASP C O   1 
ATOM   3692  C CB  . ASP C  3  71  ? 28.631  -44.841 21.155  1.00 0.00 ? 71  ASP C CB  1 
ATOM   3693  C CG  . ASP C  3  71  ? 28.667  -44.760 22.676  1.00 0.00 ? 71  ASP C CG  1 
ATOM   3694  O OD1 . ASP C  3  71  ? 29.278  -45.651 23.312  1.00 0.00 ? 71  ASP C OD1 1 
ATOM   3695  O OD2 . ASP C  3  71  ? 28.088  -43.780 23.218  1.00 0.00 ? 71  ASP C OD2 1 
ATOM   3696  N N   . MET C  3  72  ? 28.155  -48.015 19.489  1.00 0.00 ? 72  MET C N   1 
ATOM   3697  C CA  . MET C  3  72  ? 27.253  -49.128 19.370  1.00 0.00 ? 72  MET C CA  1 
ATOM   3698  C C   . MET C  3  72  ? 27.696  -49.859 18.128  1.00 0.00 ? 72  MET C C   1 
ATOM   3699  O O   . MET C  3  72  ? 28.137  -49.216 17.188  1.00 0.00 ? 72  MET C O   1 
ATOM   3700  C CB  . MET C  3  72  ? 25.782  -48.695 19.162  1.00 0.00 ? 72  MET C CB  1 
ATOM   3701  C CG  . MET C  3  72  ? 25.162  -47.831 20.294  1.00 0.00 ? 72  MET C CG  1 
ATOM   3702  S SD  . MET C  3  72  ? 25.349  -45.999 20.249  1.00 0.00 ? 72  MET C SD  1 
ATOM   3703  C CE  . MET C  3  72  ? 24.990  -45.702 22.002  1.00 0.00 ? 72  MET C CE  1 
ATOM   3704  N N   . ALA C  3  73  ? 27.547  -51.203 18.040  1.00 0.00 ? 73  ALA C N   1 
ATOM   3705  C CA  . ALA C  3  73  ? 27.935  -51.956 16.862  1.00 0.00 ? 73  ALA C CA  1 
ATOM   3706  C C   . ALA C  3  73  ? 27.172  -53.240 16.870  1.00 0.00 ? 73  ALA C C   1 
ATOM   3707  O O   . ALA C  3  73  ? 26.696  -53.633 17.918  1.00 0.00 ? 73  ALA C O   1 
ATOM   3708  C CB  . ALA C  3  73  ? 29.421  -52.306 16.857  1.00 0.00 ? 73  ALA C CB  1 
ATOM   3709  N N   . CYS C  3  74  ? 26.979  -53.907 15.708  1.00 0.00 ? 74  CYS C N   1 
ATOM   3710  C CA  . CYS C  3  74  ? 26.209  -55.133 15.593  1.00 0.00 ? 74  CYS C CA  1 
ATOM   3711  C C   . CYS C  3  74  ? 26.966  -56.279 15.025  1.00 0.00 ? 74  CYS C C   1 
ATOM   3712  O O   . CYS C  3  74  ? 27.727  -56.073 14.088  1.00 0.00 ? 74  CYS C O   1 
ATOM   3713  C CB  . CYS C  3  74  ? 24.977  -54.978 14.695  1.00 0.00 ? 74  CYS C CB  1 
ATOM   3714  S SG  . CYS C  3  74  ? 25.417  -54.315 13.071  1.00 0.00 ? 74  CYS C SG  1 
ATOM   3715  N N   . SER C  3  75  ? 26.663  -57.529 15.467  1.00 0.00 ? 75  SER C N   1 
ATOM   3716  C CA  . SER C  3  75  ? 27.152  -58.694 14.778  1.00 0.00 ? 75  SER C CA  1 
ATOM   3717  C C   . SER C  3  75  ? 26.066  -59.356 14.007  1.00 0.00 ? 75  SER C C   1 
ATOM   3718  O O   . SER C  3  75  ? 25.034  -59.673 14.573  1.00 0.00 ? 75  SER C O   1 
ATOM   3719  C CB  . SER C  3  75  ? 27.685  -59.780 15.687  1.00 0.00 ? 75  SER C CB  1 
ATOM   3720  O OG  . SER C  3  75  ? 28.603  -60.579 14.947  1.00 0.00 ? 75  SER C OG  1 
ATOM   3721  N N   . VAL C  3  76  ? 26.296  -59.651 12.728  1.00 0.00 ? 76  VAL C N   1 
ATOM   3722  C CA  . VAL C  3  76  ? 25.275  -60.280 11.877  1.00 0.00 ? 76  VAL C CA  1 
ATOM   3723  C C   . VAL C  3  76  ? 25.563  -61.750 11.543  1.00 0.00 ? 76  VAL C C   1 
ATOM   3724  O O   . VAL C  3  76  ? 26.560  -62.051 10.896  1.00 0.00 ? 76  VAL C O   1 
ATOM   3725  C CB  . VAL C  3  76  ? 25.121  -59.516 10.548  1.00 0.00 ? 76  VAL C CB  1 
ATOM   3726  C CG1 . VAL C  3  76  ? 23.755  -59.784 9.933   1.00 0.00 ? 76  VAL C CG1 1 
ATOM   3727  C CG2 . VAL C  3  76  ? 25.348  -58.024 10.753  1.00 0.00 ? 76  VAL C CG2 1 
ATOM   3728  N N   . ALA C  3  77  ? 24.678  -62.652 11.960  1.00 0.00 ? 77  ALA C N   1 
ATOM   3729  C CA  . ALA C  3  77  ? 24.949  -64.092 11.884  1.00 0.00 ? 77  ALA C CA  1 
ATOM   3730  C C   . ALA C  3  77  ? 24.270  -64.909 10.774  1.00 0.00 ? 77  ALA C C   1 
ATOM   3731  O O   . ALA C  3  77  ? 24.943  -65.636 10.050  1.00 0.00 ? 77  ALA C O   1 
ATOM   3732  C CB  . ALA C  3  77  ? 24.688  -64.743 13.237  1.00 0.00 ? 77  ALA C CB  1 
ATOM   3733  N N   . GLY C  3  78  ? 22.952  -64.808 10.649  1.00 0.00 ? 78  GLY C N   1 
ATOM   3734  C CA  . GLY C  3  78  ? 22.191  -65.733 9.826   1.00 0.00 ? 78  GLY C CA  1 
ATOM   3735  C C   . GLY C  3  78  ? 22.475  -65.797 8.334   1.00 0.00 ? 78  GLY C C   1 
ATOM   3736  O O   . GLY C  3  78  ? 22.535  -66.883 7.763   1.00 0.00 ? 78  GLY C O   1 
ATOM   3737  N N   . ILE C  3  79  ? 22.656  -64.645 7.700   1.00 0.00 ? 79  ILE C N   1 
ATOM   3738  C CA  . ILE C  3  79  ? 22.943  -64.594 6.267   1.00 0.00 ? 79  ILE C CA  1 
ATOM   3739  C C   . ILE C  3  79  ? 23.618  -63.273 5.924   1.00 0.00 ? 79  ILE C C   1 
ATOM   3740  O O   . ILE C  3  79  ? 23.593  -62.334 6.721   1.00 0.00 ? 79  ILE C O   1 
ATOM   3741  C CB  . ILE C  3  79  ? 21.669  -64.751 5.415   1.00 0.00 ? 79  ILE C CB  1 
ATOM   3742  C CG1 . ILE C  3  79  ? 21.051  -66.135 5.629   1.00 0.00 ? 79  ILE C CG1 1 
ATOM   3743  C CG2 . ILE C  3  79  ? 21.981  -64.521 3.944   1.00 0.00 ? 79  ILE C CG2 1 
ATOM   3744  C CD1 . ILE C  3  79  ? 20.058  -66.540 4.562   1.00 0.00 ? 79  ILE C CD1 1 
ATOM   3745  N N   . THR C  3  80  ? 24.226  -63.189 4.746   1.00 0.00 ? 80  THR C N   1 
ATOM   3746  C CA  . THR C  3  80  ? 24.953  -61.964 4.408   1.00 0.00 ? 80  THR C CA  1 
ATOM   3747  C C   . THR C  3  80  ? 24.163  -60.923 3.604   1.00 0.00 ? 80  THR C C   1 
ATOM   3748  O O   . THR C  3  80  ? 24.275  -59.726 3.857   1.00 0.00 ? 80  THR C O   1 
ATOM   3749  C CB  . THR C  3  80  ? 26.265  -62.279 3.658   1.00 0.00 ? 80  THR C CB  1 
ATOM   3750  O OG1 . THR C  3  80  ? 26.011  -62.361 2.251   1.00 0.00 ? 80  THR C OG1 1 
ATOM   3751  C CG2 . THR C  3  80  ? 26.857  -63.594 4.141   1.00 0.00 ? 80  THR C CG2 1 
ATOM   3752  N N   . SER C  3  81  ? 23.383  -61.377 2.631   1.00 0.00 ? 81  SER C N   1 
ATOM   3753  C CA  . SER C  3  81  ? 22.695  -60.469 1.714   1.00 0.00 ? 81  SER C CA  1 
ATOM   3754  C C   . SER C  3  81  ? 21.627  -59.607 2.387   1.00 0.00 ? 81  SER C C   1 
ATOM   3755  O O   . SER C  3  81  ? 21.351  -58.491 1.958   1.00 0.00 ? 81  SER C O   1 
ATOM   3756  C CB  . SER C  3  81  ? 22.072  -61.261 0.563   1.00 0.00 ? 81  SER C CB  1 
ATOM   3757  O OG  . SER C  3  81  ? 23.074  -61.873 -0.232  1.00 0.00 ? 81  SER C OG  1 
ATOM   3758  N N   . ASP C  3  82  ? 21.031  -60.151 3.439   1.00 0.00 ? 82  ASP C N   1 
ATOM   3759  C CA  . ASP C  3  82  ? 19.950  -59.533 4.170   1.00 0.00 ? 82  ASP C CA  1 
ATOM   3760  C C   . ASP C  3  82  ? 20.516  -58.634 5.204   1.00 0.00 ? 82  ASP C C   1 
ATOM   3761  O O   . ASP C  3  82  ? 19.980  -57.569 5.489   1.00 0.00 ? 82  ASP C O   1 
ATOM   3762  C CB  . ASP C  3  82  ? 19.092  -60.567 4.931   1.00 0.00 ? 82  ASP C CB  1 
ATOM   3763  C CG  . ASP C  3  82  ? 18.259  -61.401 3.958   1.00 0.00 ? 82  ASP C CG  1 
ATOM   3764  O OD1 . ASP C  3  82  ? 18.133  -60.991 2.772   1.00 0.00 ? 82  ASP C OD1 1 
ATOM   3765  O OD2 . ASP C  3  82  ? 17.743  -62.468 4.386   1.00 0.00 ? 82  ASP C OD2 1 
ATOM   3766  N N   . ALA C  3  83  ? 21.630  -59.104 5.757   1.00 0.00 ? 83  ALA C N   1 
ATOM   3767  C CA  . ALA C  3  83  ? 22.367  -58.467 6.835   1.00 0.00 ? 83  ALA C CA  1 
ATOM   3768  C C   . ALA C  3  83  ? 22.772  -57.051 6.493   1.00 0.00 ? 83  ALA C C   1 
ATOM   3769  O O   . ALA C  3  83  ? 22.759  -56.164 7.340   1.00 0.00 ? 83  ALA C O   1 
ATOM   3770  C CB  . ALA C  3  83  ? 23.605  -59.288 7.134   1.00 0.00 ? 83  ALA C CB  1 
ATOM   3771  N N   . ASN C  3  84  ? 23.155  -56.851 5.244   1.00 0.00 ? 84  ASN C N   1 
ATOM   3772  C CA  . ASN C  3  84  ? 23.574  -55.552 4.788   1.00 0.00 ? 84  ASN C CA  1 
ATOM   3773  C C   . ASN C  3  84  ? 22.428  -54.574 4.868   1.00 0.00 ? 84  ASN C C   1 
ATOM   3774  O O   . ASN C  3  84  ? 22.625  -53.439 5.285   1.00 0.00 ? 84  ASN C O   1 
ATOM   3775  C CB  . ASN C  3  84  ? 24.048  -55.544 3.314   1.00 0.00 ? 84  ASN C CB  1 
ATOM   3776  C CG  . ASN C  3  84  ? 25.363  -56.311 3.138   1.00 0.00 ? 84  ASN C CG  1 
ATOM   3777  O OD1 . ASN C  3  84  ? 26.443  -55.791 3.431   1.00 0.00 ? 84  ASN C OD1 1 
ATOM   3778  N ND2 . ASN C  3  84  ? 25.268  -57.566 2.613   1.00 0.00 ? 84  ASN C ND2 1 
ATOM   3779  N N   . VAL C  3  85  ? 21.203  -54.982 4.463   1.00 0.00 ? 85  VAL C N   1 
ATOM   3780  C CA  . VAL C  3  85  ? 20.005  -54.174 4.538   1.00 0.00 ? 85  VAL C CA  1 
ATOM   3781  C C   . VAL C  3  85  ? 19.618  -53.894 5.968   1.00 0.00 ? 85  VAL C C   1 
ATOM   3782  O O   . VAL C  3  85  ? 19.185  -52.800 6.307   1.00 0.00 ? 85  VAL C O   1 
ATOM   3783  C CB  . VAL C  3  85  ? 18.854  -54.830 3.794   1.00 0.00 ? 85  VAL C CB  1 
ATOM   3784  C CG1 . VAL C  3  85  ? 17.564  -53.985 3.879   1.00 0.00 ? 85  VAL C CG1 1 
ATOM   3785  C CG2 . VAL C  3  85  ? 19.296  -55.008 2.324   1.00 0.00 ? 85  VAL C CG2 1 
ATOM   3786  N N   . LEU C  3  86  ? 19.840  -54.852 6.881   1.00 0.00 ? 86  LEU C N   1 
ATOM   3787  C CA  . LEU C  3  86  ? 19.591  -54.647 8.281   1.00 0.00 ? 86  LEU C CA  1 
ATOM   3788  C C   . LEU C  3  86  ? 20.504  -53.615 8.810   1.00 0.00 ? 86  LEU C C   1 
ATOM   3789  O O   . LEU C  3  86  ? 20.055  -52.717 9.498   1.00 0.00 ? 86  LEU C O   1 
ATOM   3790  C CB  . LEU C  3  86  ? 19.790  -55.903 9.139   1.00 0.00 ? 86  LEU C CB  1 
ATOM   3791  C CG  . LEU C  3  86  ? 18.825  -57.044 8.776   1.00 0.00 ? 86  LEU C CG  1 
ATOM   3792  C CD1 . LEU C  3  86  ? 19.181  -58.308 9.569   1.00 0.00 ? 86  LEU C CD1 1 
ATOM   3793  C CD2 . LEU C  3  86  ? 17.353  -56.649 8.979   1.00 0.00 ? 86  LEU C CD2 1 
ATOM   3794  N N   . THR C  3  87  ? 21.811  -53.708 8.498   1.00 0.00 ? 87  THR C N   1 
ATOM   3795  C CA  . THR C  3  87  ? 22.803  -52.768 8.956   1.00 0.00 ? 87  THR C CA  1 
ATOM   3796  C C   . THR C  3  87  ? 22.542  -51.397 8.435   1.00 0.00 ? 87  THR C C   1 
ATOM   3797  O O   . THR C  3  87  ? 22.746  -50.418 9.144   1.00 0.00 ? 87  THR C O   1 
ATOM   3798  C CB  . THR C  3  87  ? 24.186  -53.157 8.508   1.00 0.00 ? 87  THR C CB  1 
ATOM   3799  O OG1 . THR C  3  87  ? 24.476  -54.457 8.978   1.00 0.00 ? 87  THR C OG1 1 
ATOM   3800  C CG2 . THR C  3  87  ? 25.244  -52.194 9.072   1.00 0.00 ? 87  THR C CG2 1 
ATOM   3801  N N   . ASN C  3  88  ? 22.045  -51.289 7.188   1.00 0.00 ? 88  ASN C N   1 
ATOM   3802  C CA  . ASN C  3  88  ? 21.734  -50.029 6.586   1.00 0.00 ? 88  ASN C CA  1 
ATOM   3803  C C   . ASN C  3  88  ? 20.627  -49.362 7.338   1.00 0.00 ? 88  ASN C C   1 
ATOM   3804  O O   . ASN C  3  88  ? 20.753  -48.206 7.714   1.00 0.00 ? 88  ASN C O   1 
ATOM   3805  C CB  . ASN C  3  88  ? 21.364  -50.201 5.103   1.00 0.00 ? 88  ASN C CB  1 
ATOM   3806  C CG  . ASN C  3  88  ? 21.258  -48.831 4.433   1.00 0.00 ? 88  ASN C CG  1 
ATOM   3807  O OD1 . ASN C  3  88  ? 22.027  -47.919 4.757   1.00 0.00 ? 88  ASN C OD1 1 
ATOM   3808  N ND2 . ASN C  3  88  ? 20.279  -48.693 3.490   1.00 0.00 ? 88  ASN C ND2 1 
ATOM   3809  N N   . GLU C  3  89  ? 19.541  -50.093 7.633   1.00 0.00 ? 89  GLU C N   1 
ATOM   3810  C CA  . GLU C  3  89  ? 18.428  -49.573 8.371   1.00 0.00 ? 89  GLU C CA  1 
ATOM   3811  C C   . GLU C  3  89  ? 18.795  -49.213 9.773   1.00 0.00 ? 89  GLU C C   1 
ATOM   3812  O O   . GLU C  3  89  ? 18.239  -48.274 10.317  1.00 0.00 ? 89  GLU C O   1 
ATOM   3813  C CB  . GLU C  3  89  ? 17.247  -50.556 8.418   1.00 0.00 ? 89  GLU C CB  1 
ATOM   3814  C CG  . GLU C  3  89  ? 16.574  -50.774 7.051   1.00 0.00 ? 89  GLU C CG  1 
ATOM   3815  C CD  . GLU C  3  89  ? 15.924  -49.479 6.561   1.00 0.00 ? 89  GLU C CD  1 
ATOM   3816  O OE1 . GLU C  3  89  ? 14.991  -48.985 7.250   1.00 0.00 ? 89  GLU C OE1 1 
ATOM   3817  O OE2 . GLU C  3  89  ? 16.350  -48.970 5.490   1.00 0.00 ? 89  GLU C OE2 1 
ATOM   3818  N N   . LEU C  3  90  ? 19.739  -49.927 10.401  1.00 0.00 ? 90  LEU C N   1 
ATOM   3819  C CA  . LEU C  3  90  ? 20.199  -49.617 11.730  1.00 0.00 ? 90  LEU C CA  1 
ATOM   3820  C C   . LEU C  3  90  ? 20.944  -48.308 11.783  1.00 0.00 ? 90  LEU C C   1 
ATOM   3821  O O   . LEU C  3  90  ? 20.795  -47.521 12.719  1.00 0.00 ? 90  LEU C O   1 
ATOM   3822  C CB  . LEU C  3  90  ? 21.144  -50.712 12.241  1.00 0.00 ? 90  LEU C CB  1 
ATOM   3823  C CG  . LEU C  3  90  ? 20.449  -52.000 12.694  1.00 0.00 ? 90  LEU C CG  1 
ATOM   3824  C CD1 . LEU C  3  90  ? 21.404  -53.207 12.674  1.00 0.00 ? 90  LEU C CD1 1 
ATOM   3825  C CD2 . LEU C  3  90  ? 19.840  -51.812 14.097  1.00 0.00 ? 90  LEU C CD2 1 
ATOM   3826  N N   . ARG C  3  91  ? 21.802  -48.063 10.772  1.00 0.00 ? 91  ARG C N   1 
ATOM   3827  C CA  . ARG C  3  91  ? 22.552  -46.843 10.667  1.00 0.00 ? 91  ARG C CA  1 
ATOM   3828  C C   . ARG C  3  91  ? 21.643  -45.682 10.445  1.00 0.00 ? 91  ARG C C   1 
ATOM   3829  O O   . ARG C  3  91  ? 21.870  -44.622 11.016  1.00 0.00 ? 91  ARG C O   1 
ATOM   3830  C CB  . ARG C  3  91  ? 23.556  -46.903 9.501   1.00 0.00 ? 91  ARG C CB  1 
ATOM   3831  C CG  . ARG C  3  91  ? 24.722  -47.868 9.772   1.00 0.00 ? 91  ARG C CG  1 
ATOM   3832  C CD  . ARG C  3  91  ? 25.545  -48.189 8.518   1.00 0.00 ? 91  ARG C CD  1 
ATOM   3833  N NE  . ARG C  3  91  ? 26.808  -48.864 8.957   1.00 0.00 ? 91  ARG C NE  1 
ATOM   3834  C CZ  . ARG C  3  91  ? 27.617  -49.577 8.120   1.00 0.00 ? 91  ARG C CZ  1 
ATOM   3835  N NH1 . ARG C  3  91  ? 27.225  -49.858 6.848   1.00 0.00 ? 91  ARG C NH1 1 
ATOM   3836  N NH2 . ARG C  3  91  ? 28.829  -50.012 8.566   1.00 0.00 ? 91  ARG C NH2 1 
ATOM   3837  N N   . LEU C  3  92  ? 20.547  -45.870 9.671   1.00 0.00 ? 92  LEU C N   1 
ATOM   3838  C CA  . LEU C  3  92  ? 19.575  -44.838 9.410   1.00 0.00 ? 92  LEU C CA  1 
ATOM   3839  C C   . LEU C  3  92  ? 18.807  -44.496 10.627  1.00 0.00 ? 92  LEU C C   1 
ATOM   3840  O O   . LEU C  3  92  ? 18.634  -43.327 10.906  1.00 0.00 ? 92  LEU C O   1 
ATOM   3841  C CB  . LEU C  3  92  ? 18.599  -45.181 8.285   1.00 0.00 ? 92  LEU C CB  1 
ATOM   3842  C CG  . LEU C  3  92  ? 19.270  -45.086 6.901   1.00 0.00 ? 92  LEU C CG  1 
ATOM   3843  C CD1 . LEU C  3  92  ? 18.477  -45.882 5.845   1.00 0.00 ? 92  LEU C CD1 1 
ATOM   3844  C CD2 . LEU C  3  92  ? 19.465  -43.631 6.455   1.00 0.00 ? 92  LEU C CD2 1 
ATOM   3845  N N   . ILE C  3  93  ? 18.304  -45.476 11.392  1.00 0.00 ? 93  ILE C N   1 
ATOM   3846  C CA  . ILE C  3  93  ? 17.503  -45.215 12.566  1.00 0.00 ? 93  ILE C CA  1 
ATOM   3847  C C   . ILE C  3  93  ? 18.310  -44.493 13.563  1.00 0.00 ? 93  ILE C C   1 
ATOM   3848  O O   . ILE C  3  93  ? 17.824  -43.541 14.157  1.00 0.00 ? 93  ILE C O   1 
ATOM   3849  C CB  . ILE C  3  93  ? 17.054  -46.487 13.248  1.00 0.00 ? 93  ILE C CB  1 
ATOM   3850  C CG1 . ILE C  3  93  ? 16.091  -47.308 12.367  1.00 0.00 ? 93  ILE C CG1 1 
ATOM   3851  C CG2 . ILE C  3  93  ? 16.414  -46.197 14.627  1.00 0.00 ? 93  ILE C CG2 1 
ATOM   3852  C CD1 . ILE C  3  93  ? 16.232  -48.809 12.627  1.00 0.00 ? 93  ILE C CD1 1 
ATOM   3853  N N   . ALA C  3  94  ? 19.572  -44.908 13.753  1.00 0.00 ? 94  ALA C N   1 
ATOM   3854  C CA  . ALA C  3  94  ? 20.441  -44.338 14.739  1.00 0.00 ? 94  ALA C CA  1 
ATOM   3855  C C   . ALA C  3  94  ? 20.774  -42.917 14.424  1.00 0.00 ? 94  ALA C C   1 
ATOM   3856  O O   . ALA C  3  94  ? 20.836  -42.094 15.333  1.00 0.00 ? 94  ALA C O   1 
ATOM   3857  C CB  . ALA C  3  94  ? 21.744  -45.125 14.847  1.00 0.00 ? 94  ALA C CB  1 
ATOM   3858  N N   . GLN C  3  95  ? 21.011  -42.613 13.123  1.00 0.00 ? 95  GLN C N   1 
ATOM   3859  C CA  . GLN C  3  95  ? 21.408  -41.297 12.708  1.00 0.00 ? 95  GLN C CA  1 
ATOM   3860  C C   . GLN C  3  95  ? 20.262  -40.348 12.490  1.00 0.00 ? 95  GLN C C   1 
ATOM   3861  O O   . GLN C  3  95  ? 20.478  -39.146 12.399  1.00 0.00 ? 95  GLN C O   1 
ATOM   3862  C CB  . GLN C  3  95  ? 22.216  -41.383 11.399  1.00 0.00 ? 95  GLN C CB  1 
ATOM   3863  C CG  . GLN C  3  95  ? 23.613  -42.016 11.546  1.00 0.00 ? 95  GLN C CG  1 
ATOM   3864  C CD  . GLN C  3  95  ? 24.469  -41.238 12.543  1.00 0.00 ? 95  GLN C CD  1 
ATOM   3865  O OE1 . GLN C  3  95  ? 24.461  -39.884 12.409  1.00 0.00 ? 95  GLN C OE1 1 
ATOM   3866  N NE2 . GLN C  3  95  ? 25.119  -41.827 13.412  1.00 0.00 ? 95  GLN C NE2 1 
ATOM   3867  N N   . ARG C  3  96  ? 19.010  -40.842 12.426  1.00 0.00 ? 96  ARG C N   1 
ATOM   3868  C CA  . ARG C  3  96  ? 17.803  -40.053 12.463  1.00 0.00 ? 96  ARG C CA  1 
ATOM   3869  C C   . ARG C  3  96  ? 17.530  -39.702 13.872  1.00 0.00 ? 96  ARG C C   1 
ATOM   3870  O O   . ARG C  3  96  ? 17.181  -38.574 14.186  1.00 0.00 ? 96  ARG C O   1 
ATOM   3871  C CB  . ARG C  3  96  ? 16.555  -40.750 11.911  1.00 0.00 ? 96  ARG C CB  1 
ATOM   3872  C CG  . ARG C  3  96  ? 16.548  -40.876 10.377  1.00 0.00 ? 96  ARG C CG  1 
ATOM   3873  C CD  . ARG C  3  96  ? 15.275  -41.528 9.816   1.00 0.00 ? 96  ARG C CD  1 
ATOM   3874  N NE  . ARG C  3  96  ? 15.042  -42.845 10.508  1.00 0.00 ? 96  ARG C NE  1 
ATOM   3875  C CZ  . ARG C  3  96  ? 13.805  -43.411 10.675  1.00 0.00 ? 96  ARG C CZ  1 
ATOM   3876  N NH1 . ARG C  3  96  ? 12.701  -42.868 10.088  1.00 0.00 ? 96  ARG C NH1 1 
ATOM   3877  N NH2 . ARG C  3  96  ? 13.673  -44.529 11.447  1.00 0.00 ? 96  ARG C NH2 1 
ATOM   3878  N N   . TYR C  3  97  ? 17.721  -40.634 14.804  1.00 0.00 ? 97  TYR C N   1 
ATOM   3879  C CA  . TYR C  3  97  ? 17.556  -40.296 16.174  1.00 0.00 ? 97  TYR C CA  1 
ATOM   3880  C C   . TYR C  3  97  ? 18.563  -39.261 16.590  1.00 0.00 ? 97  TYR C C   1 
ATOM   3881  O O   . TYR C  3  97  ? 18.229  -38.355 17.341  1.00 0.00 ? 97  TYR C O   1 
ATOM   3882  C CB  . TYR C  3  97  ? 17.716  -41.548 17.034  1.00 0.00 ? 97  TYR C CB  1 
ATOM   3883  C CG  . TYR C  3  97  ? 17.545  -41.260 18.488  1.00 0.00 ? 97  TYR C CG  1 
ATOM   3884  C CD1 . TYR C  3  97  ? 18.613  -40.751 19.233  1.00 0.00 ? 97  TYR C CD1 1 
ATOM   3885  C CD2 . TYR C  3  97  ? 16.325  -41.496 19.118  1.00 0.00 ? 97  TYR C CD2 1 
ATOM   3886  C CE1 . TYR C  3  97  ? 18.475  -40.480 20.582  1.00 0.00 ? 97  TYR C CE1 1 
ATOM   3887  C CE2 . TYR C  3  97  ? 16.188  -41.243 20.485  1.00 0.00 ? 97  TYR C CE2 1 
ATOM   3888  C CZ  . TYR C  3  97  ? 17.270  -40.742 21.214  1.00 0.00 ? 97  TYR C CZ  1 
ATOM   3889  O OH  . TYR C  3  97  ? 17.160  -40.534 22.596  1.00 0.00 ? 97  TYR C OH  1 
ATOM   3890  N N   . LEU C  3  98  ? 19.818  -39.360 16.104  1.00 0.00 ? 98  LEU C N   1 
ATOM   3891  C CA  . LEU C  3  98  ? 20.839  -38.386 16.384  1.00 0.00 ? 98  LEU C CA  1 
ATOM   3892  C C   . LEU C  3  98  ? 20.533  -37.104 15.714  1.00 0.00 ? 98  LEU C C   1 
ATOM   3893  O O   . LEU C  3  98  ? 20.908  -36.060 16.215  1.00 0.00 ? 98  LEU C O   1 
ATOM   3894  C CB  . LEU C  3  98  ? 22.241  -38.850 15.946  1.00 0.00 ? 98  LEU C CB  1 
ATOM   3895  C CG  . LEU C  3  98  ? 23.401  -37.843 16.144  1.00 0.00 ? 98  LEU C CG  1 
ATOM   3896  C CD1 . LEU C  3  98  ? 23.484  -37.282 17.569  1.00 0.00 ? 98  LEU C CD1 1 
ATOM   3897  C CD2 . LEU C  3  98  ? 24.749  -38.475 15.765  1.00 0.00 ? 98  LEU C CD2 1 
ATOM   3898  N N   . LEU C  3  99  ? 19.784  -37.112 14.601  1.00 0.00 ? 99  LEU C N   1 
ATOM   3899  C CA  . LEU C  3  99  ? 19.412  -35.903 13.928  1.00 0.00 ? 99  LEU C CA  1 
ATOM   3900  C C   . LEU C  3  99  ? 18.466  -35.113 14.778  1.00 0.00 ? 99  LEU C C   1 
ATOM   3901  O O   . LEU C  3  99  ? 18.797  -33.976 15.074  1.00 0.00 ? 99  LEU C O   1 
ATOM   3902  C CB  . LEU C  3  99  ? 18.816  -36.170 12.521  1.00 0.00 ? 99  LEU C CB  1 
ATOM   3903  C CG  . LEU C  3  99  ? 18.311  -34.946 11.722  1.00 0.00 ? 99  LEU C CG  1 
ATOM   3904  C CD1 . LEU C  3  99  ? 19.439  -33.954 11.394  1.00 0.00 ? 99  LEU C CD1 1 
ATOM   3905  C CD2 . LEU C  3  99  ? 17.609  -35.387 10.429  1.00 0.00 ? 99  LEU C CD2 1 
ATOM   3906  N N   . GLN C  3  100 ? 17.276  -35.605 15.187  1.00 0.00 ? 100 GLN C N   1 
ATOM   3907  C CA  . GLN C  3  100 ? 16.412  -34.691 15.901  1.00 0.00 ? 100 GLN C CA  1 
ATOM   3908  C C   . GLN C  3  100 ? 16.611  -34.589 17.368  1.00 0.00 ? 100 GLN C C   1 
ATOM   3909  O O   . GLN C  3  100 ? 16.342  -33.532 17.911  1.00 0.00 ? 100 GLN C O   1 
ATOM   3910  C CB  . GLN C  3  100 ? 14.892  -34.903 15.675  1.00 0.00 ? 100 GLN C CB  1 
ATOM   3911  C CG  . GLN C  3  100 ? 14.155  -36.038 16.413  1.00 0.00 ? 100 GLN C CG  1 
ATOM   3912  C CD  . GLN C  3  100 ? 14.281  -37.371 15.684  1.00 0.00 ? 100 GLN C CD  1 
ATOM   3913  O OE1 . GLN C  3  100 ? 14.750  -37.423 14.545  1.00 0.00 ? 100 GLN C OE1 1 
ATOM   3914  N NE2 . GLN C  3  100 ? 13.787  -38.461 16.343  1.00 0.00 ? 100 GLN C NE2 1 
ATOM   3915  N N   . TYR C  3  101 ? 17.028  -35.646 18.082  1.00 0.00 ? 101 TYR C N   1 
ATOM   3916  C CA  . TYR C  3  101 ? 17.159  -35.538 19.514  1.00 0.00 ? 101 TYR C CA  1 
ATOM   3917  C C   . TYR C  3  101 ? 18.485  -35.032 19.920  1.00 0.00 ? 101 TYR C C   1 
ATOM   3918  O O   . TYR C  3  101 ? 18.629  -34.640 21.074  1.00 0.00 ? 101 TYR C O   1 
ATOM   3919  C CB  . TYR C  3  101 ? 16.957  -36.888 20.216  1.00 0.00 ? 101 TYR C CB  1 
ATOM   3920  C CG  . TYR C  3  101 ? 15.501  -37.050 20.419  1.00 0.00 ? 101 TYR C CG  1 
ATOM   3921  C CD1 . TYR C  3  101 ? 14.898  -36.481 21.550  1.00 0.00 ? 101 TYR C CD1 1 
ATOM   3922  C CD2 . TYR C  3  101 ? 14.715  -37.699 19.469  1.00 0.00 ? 101 TYR C CD2 1 
ATOM   3923  C CE1 . TYR C  3  101 ? 13.519  -36.569 21.734  1.00 0.00 ? 101 TYR C CE1 1 
ATOM   3924  C CE2 . TYR C  3  101 ? 13.330  -37.785 19.644  1.00 0.00 ? 101 TYR C CE2 1 
ATOM   3925  C CZ  . TYR C  3  101 ? 12.734  -37.226 20.780  1.00 0.00 ? 101 TYR C CZ  1 
ATOM   3926  O OH  . TYR C  3  101 ? 11.338  -37.313 20.965  1.00 0.00 ? 101 TYR C OH  1 
ATOM   3927  N N   . GLN C  3  102 ? 19.464  -35.007 18.986  1.00 0.00 ? 102 GLN C N   1 
ATOM   3928  C CA  . GLN C  3  102 ? 20.811  -34.526 19.179  1.00 0.00 ? 102 GLN C CA  1 
ATOM   3929  C C   . GLN C  3  102 ? 21.479  -35.097 20.374  1.00 0.00 ? 102 GLN C C   1 
ATOM   3930  O O   . GLN C  3  102 ? 22.000  -34.391 21.235  1.00 0.00 ? 102 GLN C O   1 
ATOM   3931  C CB  . GLN C  3  102 ? 20.914  -33.002 19.203  1.00 0.00 ? 102 GLN C CB  1 
ATOM   3932  C CG  . GLN C  3  102 ? 20.742  -32.396 17.811  1.00 0.00 ? 102 GLN C CG  1 
ATOM   3933  C CD  . GLN C  3  102 ? 22.023  -32.627 17.012  1.00 0.00 ? 102 GLN C CD  1 
ATOM   3934  O OE1 . GLN C  3  102 ? 22.106  -33.539 16.187  1.00 0.00 ? 102 GLN C OE1 1 
ATOM   3935  N NE2 . GLN C  3  102 ? 23.051  -31.761 17.262  1.00 0.00 ? 102 GLN C NE2 1 
ATOM   3936  N N   . GLU C  3  103 ? 21.475  -36.430 20.424  1.00 0.00 ? 103 GLU C N   1 
ATOM   3937  C CA  . GLU C  3  103 ? 22.247  -37.162 21.368  1.00 0.00 ? 103 GLU C CA  1 
ATOM   3938  C C   . GLU C  3  103 ? 22.370  -38.468 20.668  1.00 0.00 ? 103 GLU C C   1 
ATOM   3939  O O   . GLU C  3  103 ? 21.552  -38.723 19.787  1.00 0.00 ? 103 GLU C O   1 
ATOM   3940  C CB  . GLU C  3  103 ? 21.577  -37.264 22.763  1.00 0.00 ? 103 GLU C CB  1 
ATOM   3941  C CG  . GLU C  3  103 ? 20.286  -38.083 22.816  1.00 0.00 ? 103 GLU C CG  1 
ATOM   3942  C CD  . GLU C  3  103 ? 19.632  -38.005 24.196  1.00 0.00 ? 103 GLU C CD  1 
ATOM   3943  O OE1 . GLU C  3  103 ? 20.143  -37.255 25.070  1.00 0.00 ? 103 GLU C OE1 1 
ATOM   3944  O OE2 . GLU C  3  103 ? 18.601  -38.702 24.396  1.00 0.00 ? 103 GLU C OE2 1 
ATOM   3945  N N   . PRO C  3  104 ? 23.367  -39.300 20.904  1.00 0.00 ? 104 PRO C N   1 
ATOM   3946  C CA  . PRO C  3  104 ? 23.512  -40.567 20.204  1.00 0.00 ? 104 PRO C CA  1 
ATOM   3947  C C   . PRO C  3  104 ? 22.465  -41.496 20.695  1.00 0.00 ? 104 PRO C C   1 
ATOM   3948  O O   . PRO C  3  104 ? 22.160  -41.414 21.879  1.00 0.00 ? 104 PRO C O   1 
ATOM   3949  C CB  . PRO C  3  104 ? 24.896  -41.056 20.602  1.00 0.00 ? 104 PRO C CB  1 
ATOM   3950  C CG  . PRO C  3  104 ? 25.144  -40.405 21.967  1.00 0.00 ? 104 PRO C CG  1 
ATOM   3951  C CD  . PRO C  3  104 ? 24.442  -39.056 21.853  1.00 0.00 ? 104 PRO C CD  1 
ATOM   3952  N N   . ILE C  3  105 ? 21.863  -42.332 19.812  1.00 0.00 ? 105 ILE C N   1 
ATOM   3953  C CA  . ILE C  3  105 ? 20.756  -43.204 20.164  1.00 0.00 ? 105 ILE C CA  1 
ATOM   3954  C C   . ILE C  3  105 ? 21.133  -44.103 21.297  1.00 0.00 ? 105 ILE C C   1 
ATOM   3955  O O   . ILE C  3  105 ? 22.241  -44.630 21.282  1.00 0.00 ? 105 ILE C O   1 
ATOM   3956  C CB  . ILE C  3  105 ? 20.224  -44.008 18.976  1.00 0.00 ? 105 ILE C CB  1 
ATOM   3957  C CG1 . ILE C  3  105 ? 18.838  -44.602 19.247  1.00 0.00 ? 105 ILE C CG1 1 
ATOM   3958  C CG2 . ILE C  3  105 ? 21.216  -45.086 18.521  1.00 0.00 ? 105 ILE C CG2 1 
ATOM   3959  C CD1 . ILE C  3  105 ? 18.166  -45.142 17.991  1.00 0.00 ? 105 ILE C CD1 1 
ATOM   3960  N N   . PRO C  3  106 ? 20.322  -44.298 22.316  1.00 0.00 ? 106 PRO C N   1 
ATOM   3961  C CA  . PRO C  3  106 ? 20.586  -45.332 23.280  1.00 0.00 ? 106 PRO C CA  1 
ATOM   3962  C C   . PRO C  3  106 ? 20.320  -46.650 22.641  1.00 0.00 ? 106 PRO C C   1 
ATOM   3963  O O   . PRO C  3  106 ? 19.433  -46.770 21.815  1.00 0.00 ? 106 PRO C O   1 
ATOM   3964  C CB  . PRO C  3  106 ? 19.633  -45.043 24.407  1.00 0.00 ? 106 PRO C CB  1 
ATOM   3965  C CG  . PRO C  3  106 ? 19.549  -43.525 24.374  1.00 0.00 ? 106 PRO C CG  1 
ATOM   3966  C CD  . PRO C  3  106 ? 19.496  -43.250 22.882  1.00 0.00 ? 106 PRO C CD  1 
ATOM   3967  N N   . CYS C  3  107 ? 21.228  -47.587 22.879  1.00 0.00 ? 107 CYS C N   1 
ATOM   3968  C CA  . CYS C  3  107 ? 21.383  -48.784 22.130  1.00 0.00 ? 107 CYS C CA  1 
ATOM   3969  C C   . CYS C  3  107 ? 20.183  -49.685 22.221  1.00 0.00 ? 107 CYS C C   1 
ATOM   3970  O O   . CYS C  3  107 ? 19.808  -50.326 21.244  1.00 0.00 ? 107 CYS C O   1 
ATOM   3971  C CB  . CYS C  3  107 ? 22.673  -49.444 22.655  1.00 0.00 ? 107 CYS C CB  1 
ATOM   3972  S SG  . CYS C  3  107 ? 23.379  -50.641 21.548  1.00 0.00 ? 107 CYS C SG  1 
ATOM   3973  N N   . GLU C  3  108 ? 19.498  -49.704 23.380  1.00 0.00 ? 108 GLU C N   1 
ATOM   3974  C CA  . GLU C  3  108 ? 18.368  -50.571 23.621  1.00 0.00 ? 108 GLU C CA  1 
ATOM   3975  C C   . GLU C  3  108 ? 17.231  -50.237 22.667  1.00 0.00 ? 108 GLU C C   1 
ATOM   3976  O O   . GLU C  3  108 ? 16.579  -51.113 22.105  1.00 0.00 ? 108 GLU C O   1 
ATOM   3977  C CB  . GLU C  3  108 ? 17.944  -50.420 25.100  1.00 0.00 ? 108 GLU C CB  1 
ATOM   3978  C CG  . GLU C  3  108 ? 17.083  -51.553 25.680  1.00 0.00 ? 108 GLU C CG  1 
ATOM   3979  C CD  . GLU C  3  108 ? 15.683  -51.604 25.080  1.00 0.00 ? 108 GLU C CD  1 
ATOM   3980  O OE1 . GLU C  3  108 ? 14.915  -50.620 25.260  1.00 0.00 ? 108 GLU C OE1 1 
ATOM   3981  O OE2 . GLU C  3  108 ? 15.363  -52.632 24.430  1.00 0.00 ? 108 GLU C OE2 1 
ATOM   3982  N N   . GLN C  3  109 ? 17.066  -48.925 22.396  1.00 0.00 ? 109 GLN C N   1 
ATOM   3983  C CA  . GLN C  3  109 ? 16.105  -48.332 21.516  1.00 0.00 ? 109 GLN C CA  1 
ATOM   3984  C C   . GLN C  3  109 ? 16.368  -48.723 20.111  1.00 0.00 ? 109 GLN C C   1 
ATOM   3985  O O   . GLN C  3  109 ? 15.438  -48.985 19.365  1.00 0.00 ? 109 GLN C O   1 
ATOM   3986  C CB  . GLN C  3  109 ? 16.087  -46.809 21.540  1.00 0.00 ? 109 GLN C CB  1 
ATOM   3987  C CG  . GLN C  3  109 ? 15.910  -46.263 22.952  1.00 0.00 ? 109 GLN C CG  1 
ATOM   3988  C CD  . GLN C  3  109 ? 15.791  -44.747 22.845  1.00 0.00 ? 109 GLN C CD  1 
ATOM   3989  O OE1 . GLN C  3  109 ? 15.729  -44.192 21.744  1.00 0.00 ? 109 GLN C OE1 1 
ATOM   3990  N NE2 . GLN C  3  109 ? 15.752  -44.071 24.025  1.00 0.00 ? 109 GLN C NE2 1 
ATOM   3991  N N   . LEU C  3  110 ? 17.643  -48.710 19.687  1.00 0.00 ? 110 LEU C N   1 
ATOM   3992  C CA  . LEU C  3  110 ? 18.043  -48.974 18.336  1.00 0.00 ? 110 LEU C CA  1 
ATOM   3993  C C   . LEU C  3  110 ? 17.685  -50.373 17.991  1.00 0.00 ? 110 LEU C C   1 
ATOM   3994  O O   . LEU C  3  110 ? 17.186  -50.634 16.897  1.00 0.00 ? 110 LEU C O   1 
ATOM   3995  C CB  . LEU C  3  110 ? 19.565  -48.807 18.228  1.00 0.00 ? 110 LEU C CB  1 
ATOM   3996  C CG  . LEU C  3  110 ? 20.244  -49.188 16.902  1.00 0.00 ? 110 LEU C CG  1 
ATOM   3997  C CD1 . LEU C  3  110 ? 19.590  -48.593 15.645  1.00 0.00 ? 110 LEU C CD1 1 
ATOM   3998  C CD2 . LEU C  3  110 ? 21.725  -48.782 16.974  1.00 0.00 ? 110 LEU C CD2 1 
ATOM   3999  N N   . VAL C  3  111 ? 17.833  -51.292 18.973  1.00 0.00 ? 111 VAL C N   1 
ATOM   4000  C CA  . VAL C  3  111 ? 17.415  -52.657 18.831  1.00 0.00 ? 111 VAL C CA  1 
ATOM   4001  C C   . VAL C  3  111 ? 15.926  -52.767 18.699  1.00 0.00 ? 111 VAL C C   1 
ATOM   4002  O O   . VAL C  3  111 ? 15.456  -53.496 17.835  1.00 0.00 ? 111 VAL C O   1 
ATOM   4003  C CB  . VAL C  3  111 ? 17.886  -53.505 19.980  1.00 0.00 ? 111 VAL C CB  1 
ATOM   4004  C CG1 . VAL C  3  111 ? 17.445  -54.968 19.793  1.00 0.00 ? 111 VAL C CG1 1 
ATOM   4005  C CG2 . VAL C  3  111 ? 19.418  -53.425 20.029  1.00 0.00 ? 111 VAL C CG2 1 
ATOM   4006  N N   . THR C  3  112 ? 15.118  -52.044 19.514  1.00 0.00 ? 112 THR C N   1 
ATOM   4007  C CA  . THR C  3  112 ? 13.672  -52.136 19.397  1.00 0.00 ? 112 THR C CA  1 
ATOM   4008  C C   . THR C  3  112 ? 13.154  -51.696 18.068  1.00 0.00 ? 112 THR C C   1 
ATOM   4009  O O   . THR C  3  112 ? 12.173  -52.235 17.595  1.00 0.00 ? 112 THR C O   1 
ATOM   4010  C CB  . THR C  3  112 ? 12.856  -51.384 20.451  1.00 0.00 ? 112 THR C CB  1 
ATOM   4011  O OG1 . THR C  3  112 ? 12.802  -49.971 20.284  1.00 0.00 ? 112 THR C OG1 1 
ATOM   4012  C CG2 . THR C  3  112 ? 13.388  -51.700 21.859  1.00 0.00 ? 112 THR C CG2 1 
ATOM   4013  N N   . ALA C  3  113 ? 13.811  -50.720 17.426  1.00 0.00 ? 113 ALA C N   1 
ATOM   4014  C CA  . ALA C  3  113 ? 13.452  -50.132 16.169  1.00 0.00 ? 113 ALA C CA  1 
ATOM   4015  C C   . ALA C  3  113 ? 13.664  -51.124 15.105  1.00 0.00 ? 113 ALA C C   1 
ATOM   4016  O O   . ALA C  3  113 ? 12.773  -51.346 14.301  1.00 0.00 ? 113 ALA C O   1 
ATOM   4017  C CB  . ALA C  3  113 ? 14.263  -48.888 15.833  1.00 0.00 ? 113 ALA C CB  1 
ATOM   4018  N N   . LEU C  3  114 ? 14.846  -51.771 15.048  1.00 0.00 ? 114 LEU C N   1 
ATOM   4019  C CA  . LEU C  3  114 ? 15.054  -52.744 14.002  1.00 0.00 ? 114 LEU C CA  1 
ATOM   4020  C C   . LEU C  3  114 ? 14.168  -53.951 14.135  1.00 0.00 ? 114 LEU C C   1 
ATOM   4021  O O   . LEU C  3  114 ? 13.737  -54.541 13.155  1.00 0.00 ? 114 LEU C O   1 
ATOM   4022  C CB  . LEU C  3  114 ? 16.483  -53.302 13.998  1.00 0.00 ? 114 LEU C CB  1 
ATOM   4023  C CG  . LEU C  3  114 ? 16.801  -54.141 12.738  1.00 0.00 ? 114 LEU C CG  1 
ATOM   4024  C CD1 . LEU C  3  114 ? 16.919  -53.276 11.466  1.00 0.00 ? 114 LEU C CD1 1 
ATOM   4025  C CD2 . LEU C  3  114 ? 18.015  -55.044 12.950  1.00 0.00 ? 114 LEU C CD2 1 
ATOM   4026  N N   . CYS C  3  115 ? 13.872  -54.367 15.365  1.00 0.00 ? 115 CYS C N   1 
ATOM   4027  C CA  . CYS C  3  115 ? 12.977  -55.451 15.621  1.00 0.00 ? 115 CYS C CA  1 
ATOM   4028  C C   . CYS C  3  115 ? 11.547  -55.143 15.302  1.00 0.00 ? 115 CYS C C   1 
ATOM   4029  O O   . CYS C  3  115 ? 10.788  -56.052 14.989  1.00 0.00 ? 115 CYS C O   1 
ATOM   4030  C CB  . CYS C  3  115 ? 13.202  -56.019 17.015  1.00 0.00 ? 115 CYS C CB  1 
ATOM   4031  S SG  . CYS C  3  115 ? 14.848  -56.750 17.032  1.00 0.00 ? 115 CYS C SG  1 
ATOM   4032  N N   . ASP C  3  116 ? 11.129  -53.860 15.323  1.00 0.00 ? 116 ASP C N   1 
ATOM   4033  C CA  . ASP C  3  116 ? 9.851   -53.463 14.788  1.00 0.00 ? 116 ASP C CA  1 
ATOM   4034  C C   . ASP C  3  116 ? 9.846   -53.683 13.305  1.00 0.00 ? 116 ASP C C   1 
ATOM   4035  O O   . ASP C  3  116 ? 8.859   -54.151 12.750  1.00 0.00 ? 116 ASP C O   1 
ATOM   4036  C CB  . ASP C  3  116 ? 9.503   -51.963 14.948  1.00 0.00 ? 116 ASP C CB  1 
ATOM   4037  C CG  . ASP C  3  116 ? 9.312   -51.532 16.393  1.00 0.00 ? 116 ASP C CG  1 
ATOM   4038  O OD1 . ASP C  3  116 ? 9.363   -52.395 17.298  1.00 0.00 ? 116 ASP C OD1 1 
ATOM   4039  O OD2 . ASP C  3  116 ? 9.100   -50.307 16.610  1.00 0.00 ? 116 ASP C OD2 1 
ATOM   4040  N N   . ILE C  3  117 ? 10.950  -53.330 12.611  1.00 0.00 ? 117 ILE C N   1 
ATOM   4041  C CA  . ILE C  3  117 ? 11.022  -53.495 11.177  1.00 0.00 ? 117 ILE C CA  1 
ATOM   4042  C C   . ILE C  3  117 ? 10.989  -54.937 10.795  1.00 0.00 ? 117 ILE C C   1 
ATOM   4043  O O   . ILE C  3  117 ? 10.334  -55.287 9.826   1.00 0.00 ? 117 ILE C O   1 
ATOM   4044  C CB  . ILE C  3  117 ? 12.259  -52.840 10.566  1.00 0.00 ? 117 ILE C CB  1 
ATOM   4045  C CG1 . ILE C  3  117 ? 12.297  -51.328 10.900  1.00 0.00 ? 117 ILE C CG1 1 
ATOM   4046  C CG2 . ILE C  3  117 ? 12.293  -53.057 9.030   1.00 0.00 ? 117 ILE C CG2 1 
ATOM   4047  C CD1 . ILE C  3  117 ? 13.606  -50.650 10.505  1.00 0.00 ? 117 ILE C CD1 1 
ATOM   4048  N N   . LYS C  3  118 ? 11.645  -55.783 11.581  1.00 0.00 ? 118 LYS C N   1 
ATOM   4049  C CA  . LYS C  3  118 ? 11.642  -57.225 11.350  1.00 0.00 ? 118 LYS C CA  1 
ATOM   4050  C C   . LYS C  3  118 ? 10.252  -57.837 11.537  1.00 0.00 ? 118 LYS C C   1 
ATOM   4051  O O   . LYS C  3  118 ? 9.812   -58.658 10.735  1.00 0.00 ? 118 LYS C O   1 
ATOM   4052  C CB  . LYS C  3  118 ? 12.626  -57.911 12.301  1.00 0.00 ? 118 LYS C CB  1 
ATOM   4053  C CG  . LYS C  3  118 ? 13.885  -58.452 11.646  1.00 0.00 ? 118 LYS C CG  1 
ATOM   4054  C CD  . LYS C  3  118 ? 14.676  -59.305 12.626  1.00 0.00 ? 118 LYS C CD  1 
ATOM   4055  C CE  . LYS C  3  118 ? 16.160  -59.307 12.299  1.00 0.00 ? 118 LYS C CE  1 
ATOM   4056  N NZ  . LYS C  3  118 ? 16.972  -60.007 13.333  1.00 0.00 ? 118 LYS C NZ  1 
ATOM   4057  N N   . GLN C  3  119 ? 9.574   -57.437 12.608  1.00 0.00 ? 119 GLN C N   1 
ATOM   4058  C CA  . GLN C  3  119 ? 8.296   -58.002 12.980  1.00 0.00 ? 119 GLN C CA  1 
ATOM   4059  C C   . GLN C  3  119 ? 7.249   -57.735 11.952  1.00 0.00 ? 119 GLN C C   1 
ATOM   4060  O O   . GLN C  3  119 ? 6.372   -58.551 11.706  1.00 0.00 ? 119 GLN C O   1 
ATOM   4061  C CB  . GLN C  3  119 ? 7.816   -57.543 14.371  1.00 0.00 ? 119 GLN C CB  1 
ATOM   4062  C CG  . GLN C  3  119 ? 6.525   -58.226 14.882  1.00 0.00 ? 119 GLN C CG  1 
ATOM   4063  C CD  . GLN C  3  119 ? 6.557   -59.761 14.892  1.00 0.00 ? 119 GLN C CD  1 
ATOM   4064  O OE1 . GLN C  3  119 ? 5.559   -60.417 14.575  1.00 0.00 ? 119 GLN C OE1 1 
ATOM   4065  N NE2 . GLN C  3  119 ? 7.718   -60.343 15.309  1.00 0.00 ? 119 GLN C NE2 1 
ATOM   4066  N N   . ALA C  3  120 ? 7.361   -56.620 11.236  1.00 0.00 ? 120 ALA C N   1 
ATOM   4067  C CA  . ALA C  3  120 ? 6.416   -56.209 10.240  1.00 0.00 ? 120 ALA C CA  1 
ATOM   4068  C C   . ALA C  3  120 ? 6.438   -57.185 9.101   1.00 0.00 ? 120 ALA C C   1 
ATOM   4069  O O   . ALA C  3  120 ? 5.433   -57.362 8.426   1.00 0.00 ? 120 ALA C O   1 
ATOM   4070  C CB  . ALA C  3  120 ? 6.691   -54.803 9.696   1.00 0.00 ? 120 ALA C CB  1 
ATOM   4071  N N   . TYR C  3  121 ? 7.605   -57.792 8.797   1.00 0.00 ? 121 TYR C N   1 
ATOM   4072  C CA  . TYR C  3  121 ? 7.688   -58.790 7.756   1.00 0.00 ? 121 TYR C CA  1 
ATOM   4073  C C   . TYR C  3  121 ? 6.974   -60.078 8.062   1.00 0.00 ? 121 TYR C C   1 
ATOM   4074  O O   . TYR C  3  121 ? 6.404   -60.675 7.151   1.00 0.00 ? 121 TYR C O   1 
ATOM   4075  C CB  . TYR C  3  121 ? 9.148   -59.161 7.427   1.00 0.00 ? 121 TYR C CB  1 
ATOM   4076  C CG  . TYR C  3  121 ? 9.640   -58.185 6.422   1.00 0.00 ? 121 TYR C CG  1 
ATOM   4077  C CD1 . TYR C  3  121 ? 10.105  -56.926 6.811   1.00 0.00 ? 121 TYR C CD1 1 
ATOM   4078  C CD2 . TYR C  3  121 ? 9.513   -58.487 5.061   1.00 0.00 ? 121 TYR C CD2 1 
ATOM   4079  C CE1 . TYR C  3  121 ? 10.415  -55.961 5.849   1.00 0.00 ? 121 TYR C CE1 1 
ATOM   4080  C CE2 . TYR C  3  121 ? 9.802   -57.523 4.093   1.00 0.00 ? 121 TYR C CE2 1 
ATOM   4081  C CZ  . TYR C  3  121 ? 10.251  -56.256 4.485   1.00 0.00 ? 121 TYR C CZ  1 
ATOM   4082  O OH  . TYR C  3  121 ? 10.529  -55.286 3.500   1.00 0.00 ? 121 TYR C OH  1 
ATOM   4083  N N   . THR C  3  122 ? 6.890   -60.494 9.339   1.00 0.00 ? 122 THR C N   1 
ATOM   4084  C CA  . THR C  3  122 ? 6.128   -61.661 9.686   1.00 0.00 ? 122 THR C CA  1 
ATOM   4085  C C   . THR C  3  122 ? 4.652   -61.363 9.699   1.00 0.00 ? 122 THR C C   1 
ATOM   4086  O O   . THR C  3  122 ? 3.851   -62.147 9.202   1.00 0.00 ? 122 THR C O   1 
ATOM   4087  C CB  . THR C  3  122 ? 6.544   -62.290 11.007  1.00 0.00 ? 122 THR C CB  1 
ATOM   4088  O OG1 . THR C  3  122 ? 6.425   -61.409 12.113  1.00 0.00 ? 122 THR C OG1 1 
ATOM   4089  C CG2 . THR C  3  122 ? 8.007   -62.765 10.894  1.00 0.00 ? 122 THR C CG2 1 
ATOM   4090  N N   . GLN C  3  123 ? 4.262   -60.215 10.300  1.00 0.00 ? 123 GLN C N   1 
ATOM   4091  C CA  . GLN C  3  123 ? 2.893   -59.826 10.553  1.00 0.00 ? 123 GLN C CA  1 
ATOM   4092  C C   . GLN C  3  123 ? 2.043   -59.572 9.349   1.00 0.00 ? 123 GLN C C   1 
ATOM   4093  O O   . GLN C  3  123 ? 0.852   -59.846 9.409   1.00 0.00 ? 123 GLN C O   1 
ATOM   4094  C CB  . GLN C  3  123 ? 2.836   -58.553 11.411  1.00 0.00 ? 123 GLN C CB  1 
ATOM   4095  C CG  . GLN C  3  123 ? 3.197   -58.808 12.882  1.00 0.00 ? 123 GLN C CG  1 
ATOM   4096  C CD  . GLN C  3  123 ? 1.975   -59.221 13.708  1.00 0.00 ? 123 GLN C CD  1 
ATOM   4097  O OE1 . GLN C  3  123 ? 0.831   -59.288 13.249  1.00 0.00 ? 123 GLN C OE1 1 
ATOM   4098  N NE2 . GLN C  3  123 ? 2.248   -59.472 15.017  1.00 0.00 ? 123 GLN C NE2 1 
ATOM   4099  N N   . PHE C  3  124 ? 2.592   -59.078 8.228   1.00 0.00 ? 124 PHE C N   1 
ATOM   4100  C CA  . PHE C  3  124 ? 1.753   -58.709 7.131   1.00 0.00 ? 124 PHE C CA  1 
ATOM   4101  C C   . PHE C  3  124 ? 2.570   -58.570 5.907   1.00 0.00 ? 124 PHE C C   1 
ATOM   4102  O O   . PHE C  3  124 ? 3.776   -58.388 5.995   1.00 0.00 ? 124 PHE C O   1 
ATOM   4103  C CB  . PHE C  3  124 ? 0.965   -57.390 7.353   1.00 0.00 ? 124 PHE C CB  1 
ATOM   4104  C CG  . PHE C  3  124 ? 1.811   -56.164 7.575   1.00 0.00 ? 124 PHE C CG  1 
ATOM   4105  C CD1 . PHE C  3  124 ? 2.176   -55.769 8.873   1.00 0.00 ? 124 PHE C CD1 1 
ATOM   4106  C CD2 . PHE C  3  124 ? 2.164   -55.347 6.488   1.00 0.00 ? 124 PHE C CD2 1 
ATOM   4107  C CE1 . PHE C  3  124 ? 2.907   -54.593 9.078   1.00 0.00 ? 124 PHE C CE1 1 
ATOM   4108  C CE2 . PHE C  3  124 ? 2.902   -54.177 6.684   1.00 0.00 ? 124 PHE C CE2 1 
ATOM   4109  C CZ  . PHE C  3  124 ? 3.276   -53.801 7.981   1.00 0.00 ? 124 PHE C CZ  1 
ATOM   4110  N N   . GLY C  3  125 ? 1.900   -58.599 4.735   1.00 0.00 ? 125 GLY C N   1 
ATOM   4111  C CA  . GLY C  3  125 ? 2.459   -58.220 3.461   1.00 0.00 ? 125 GLY C CA  1 
ATOM   4112  C C   . GLY C  3  125 ? 2.857   -59.378 2.600   1.00 0.00 ? 125 GLY C C   1 
ATOM   4113  O O   . GLY C  3  125 ? 3.054   -59.205 1.399   1.00 0.00 ? 125 GLY C O   1 
ATOM   4114  N N   . GLY C  3  126 ? 2.949   -60.606 3.160   1.00 0.00 ? 126 GLY C N   1 
ATOM   4115  C CA  . GLY C  3  126 ? 3.256   -61.801 2.398   1.00 0.00 ? 126 GLY C CA  1 
ATOM   4116  C C   . GLY C  3  126 ? 4.646   -61.801 1.838   1.00 0.00 ? 126 GLY C C   1 
ATOM   4117  O O   . GLY C  3  126 ? 4.868   -62.269 0.728   1.00 0.00 ? 126 GLY C O   1 
ATOM   4118  N N   . LYS C  3  127 ? 5.603   -61.229 2.593   1.00 0.00 ? 127 LYS C N   1 
ATOM   4119  C CA  . LYS C  3  127 ? 6.977   -61.096 2.201   1.00 0.00 ? 127 LYS C CA  1 
ATOM   4120  C C   . LYS C  3  127 ? 7.766   -61.923 3.172   1.00 0.00 ? 127 LYS C C   1 
ATOM   4121  O O   . LYS C  3  127 ? 7.378   -62.042 4.333   1.00 0.00 ? 127 LYS C O   1 
ATOM   4122  C CB  . LYS C  3  127 ? 7.485   -59.648 2.312   1.00 0.00 ? 127 LYS C CB  1 
ATOM   4123  C CG  . LYS C  3  127 ? 6.776   -58.640 1.410   1.00 0.00 ? 127 LYS C CG  1 
ATOM   4124  C CD  . LYS C  3  127 ? 7.033   -58.828 -0.085  1.00 0.00 ? 127 LYS C CD  1 
ATOM   4125  C CE  . LYS C  3  127 ? 6.160   -57.889 -0.930  1.00 0.00 ? 127 LYS C CE  1 
ATOM   4126  N NZ  . LYS C  3  127 ? 6.531   -56.471 -0.747  1.00 0.00 ? 127 LYS C NZ  1 
ATOM   4127  N N   . ARG C  3  128 ? 8.893   -62.515 2.704   1.00 0.00 ? 128 ARG C N   1 
ATOM   4128  C CA  . ARG C  3  128 ? 9.785   -63.333 3.486   1.00 0.00 ? 128 ARG C CA  1 
ATOM   4129  C C   . ARG C  3  128 ? 10.445  -62.575 4.622   1.00 0.00 ? 128 ARG C C   1 
ATOM   4130  O O   . ARG C  3  128 ? 10.922  -61.474 4.367   1.00 0.00 ? 128 ARG C O   1 
ATOM   4131  C CB  . ARG C  3  128 ? 10.913  -63.874 2.614   1.00 0.00 ? 128 ARG C CB  1 
ATOM   4132  C CG  . ARG C  3  128 ? 11.884  -64.802 3.354   1.00 0.00 ? 128 ARG C CG  1 
ATOM   4133  C CD  . ARG C  3  128 ? 13.040  -65.303 2.498   1.00 0.00 ? 128 ARG C CD  1 
ATOM   4134  N NE  . ARG C  3  128 ? 13.798  -64.143 1.923   1.00 0.00 ? 128 ARG C NE  1 
ATOM   4135  C CZ  . ARG C  3  128 ? 14.835  -63.519 2.560   1.00 0.00 ? 128 ARG C CZ  1 
ATOM   4136  N NH1 . ARG C  3  128 ? 15.246  -63.908 3.802   1.00 0.00 ? 128 ARG C NH1 1 
ATOM   4137  N NH2 . ARG C  3  128 ? 15.481  -62.488 1.945   1.00 0.00 ? 128 ARG C NH2 1 
ATOM   4138  N N   . PRO C  3  129 ? 10.555  -63.061 5.854   1.00 0.00 ? 129 PRO C N   1 
ATOM   4139  C CA  . PRO C  3  129 ? 11.253  -62.352 6.911   1.00 0.00 ? 129 PRO C CA  1 
ATOM   4140  C C   . PRO C  3  129 ? 12.753  -62.470 6.806   1.00 0.00 ? 129 PRO C C   1 
ATOM   4141  O O   . PRO C  3  129 ? 13.256  -63.453 6.271   1.00 0.00 ? 129 PRO C O   1 
ATOM   4142  C CB  . PRO C  3  129 ? 10.752  -63.019 8.192   1.00 0.00 ? 129 PRO C CB  1 
ATOM   4143  C CG  . PRO C  3  129 ? 10.337  -64.414 7.766   1.00 0.00 ? 129 PRO C CG  1 
ATOM   4144  C CD  . PRO C  3  129 ? 9.815   -64.206 6.355   1.00 0.00 ? 129 PRO C CD  1 
ATOM   4145  N N   . PHE C  3  130 ? 13.488  -61.469 7.343   1.00 0.00 ? 130 PHE C N   1 
ATOM   4146  C CA  . PHE C  3  130 ? 14.927  -61.480 7.471   1.00 0.00 ? 130 PHE C CA  1 
ATOM   4147  C C   . PHE C  3  130 ? 15.268  -62.572 8.428   1.00 0.00 ? 130 PHE C C   1 
ATOM   4148  O O   . PHE C  3  130 ? 14.695  -62.608 9.516   1.00 0.00 ? 130 PHE C O   1 
ATOM   4149  C CB  . PHE C  3  130 ? 15.535  -60.185 8.074   1.00 0.00 ? 130 PHE C CB  1 
ATOM   4150  C CG  . PHE C  3  130 ? 15.115  -58.957 7.306   1.00 0.00 ? 130 PHE C CG  1 
ATOM   4151  C CD1 . PHE C  3  130 ? 13.952  -58.266 7.668   1.00 0.00 ? 130 PHE C CD1 1 
ATOM   4152  C CD2 . PHE C  3  130 ? 15.914  -58.430 6.280   1.00 0.00 ? 130 PHE C CD2 1 
ATOM   4153  C CE1 . PHE C  3  130 ? 13.602  -57.071 7.042   1.00 0.00 ? 130 PHE C CE1 1 
ATOM   4154  C CE2 . PHE C  3  130 ? 15.559  -57.243 5.628   1.00 0.00 ? 130 PHE C CE2 1 
ATOM   4155  C CZ  . PHE C  3  130 ? 14.398  -56.563 6.012   1.00 0.00 ? 130 PHE C CZ  1 
ATOM   4156  N N   . GLY C  3  131 ? 16.179  -63.475 8.070   1.00 0.00 ? 131 GLY C N   1 
ATOM   4157  C CA  . GLY C  3  131 ? 16.427  -64.698 8.834   1.00 0.00 ? 131 GLY C CA  1 
ATOM   4158  C C   . GLY C  3  131 ? 17.609  -64.676 9.792   1.00 0.00 ? 131 GLY C C   1 
ATOM   4159  O O   . GLY C  3  131 ? 18.067  -65.710 10.280  1.00 0.00 ? 131 GLY C O   1 
ATOM   4160  N N   . VAL C  3  132 ? 18.101  -63.472 10.036  1.00 0.00 ? 132 VAL C N   1 
ATOM   4161  C CA  . VAL C  3  132 ? 19.423  -63.162 10.537  1.00 0.00 ? 132 VAL C CA  1 
ATOM   4162  C C   . VAL C  3  132 ? 19.353  -62.699 11.977  1.00 0.00 ? 132 VAL C C   1 
ATOM   4163  O O   . VAL C  3  132 ? 18.866  -61.612 12.272  1.00 0.00 ? 132 VAL C O   1 
ATOM   4164  C CB  . VAL C  3  132 ? 20.088  -62.056 9.700   1.00 0.00 ? 132 VAL C CB  1 
ATOM   4165  C CG1 . VAL C  3  132 ? 21.596  -62.102 9.864   1.00 0.00 ? 132 VAL C CG1 1 
ATOM   4166  C CG2 . VAL C  3  132 ? 19.699  -62.186 8.235   1.00 0.00 ? 132 VAL C CG2 1 
ATOM   4167  N N   . SER C  3  133 ? 19.843  -63.537 12.874  1.00 0.00 ? 133 SER C N   1 
ATOM   4168  C CA  . SER C  3  133 ? 20.016  -63.150 14.274  1.00 0.00 ? 133 SER C CA  1 
ATOM   4169  C C   . SER C  3  133 ? 21.167  -62.146 14.420  1.00 0.00 ? 133 SER C C   1 
ATOM   4170  O O   . SER C  3  133 ? 22.197  -62.297 13.768  1.00 0.00 ? 133 SER C O   1 
ATOM   4171  C CB  . SER C  3  133 ? 20.311  -64.380 15.123  1.00 0.00 ? 133 SER C CB  1 
ATOM   4172  O OG  . SER C  3  133 ? 19.207  -65.264 15.138  1.00 0.00 ? 133 SER C OG  1 
ATOM   4173  N N   . LEU C  3  134 ? 21.004  -61.128 15.269  1.00 0.00 ? 134 LEU C N   1 
ATOM   4174  C CA  . LEU C  3  134 ? 22.025  -60.123 15.422  1.00 0.00 ? 134 LEU C CA  1 
ATOM   4175  C C   . LEU C  3  134 ? 22.420  -60.057 16.841  1.00 0.00 ? 134 LEU C C   1 
ATOM   4176  O O   . LEU C  3  134 ? 21.701  -60.557 17.684  1.00 0.00 ? 134 LEU C O   1 
ATOM   4177  C CB  . LEU C  3  134 ? 21.600  -58.719 14.967  1.00 0.00 ? 134 LEU C CB  1 
ATOM   4178  C CG  . LEU C  3  134 ? 21.231  -58.645 13.470  1.00 0.00 ? 134 LEU C CG  1 
ATOM   4179  C CD1 . LEU C  3  134 ? 20.626  -57.293 13.080  1.00 0.00 ? 134 LEU C CD1 1 
ATOM   4180  C CD2 . LEU C  3  134 ? 22.416  -58.945 12.556  1.00 0.00 ? 134 LEU C CD2 1 
ATOM   4181  N N   . LEU C  3  135 ? 23.583  -59.445 17.142  1.00 0.00 ? 135 LEU C N   1 
ATOM   4182  C CA  . LEU C  3  135 ? 23.980  -59.062 18.481  1.00 0.00 ? 135 LEU C CA  1 
ATOM   4183  C C   . LEU C  3  135 ? 24.152  -57.570 18.417  1.00 0.00 ? 135 LEU C C   1 
ATOM   4184  O O   . LEU C  3  135 ? 24.267  -57.013 17.333  1.00 0.00 ? 135 LEU C O   1 
ATOM   4185  C CB  . LEU C  3  135 ? 25.320  -59.666 18.954  1.00 0.00 ? 135 LEU C CB  1 
ATOM   4186  C CG  . LEU C  3  135 ? 25.334  -61.198 19.036  1.00 0.00 ? 135 LEU C CG  1 
ATOM   4187  C CD1 . LEU C  3  135 ? 26.697  -61.728 19.483  1.00 0.00 ? 135 LEU C CD1 1 
ATOM   4188  C CD2 . LEU C  3  135 ? 24.263  -61.736 19.980  1.00 0.00 ? 135 LEU C CD2 1 
ATOM   4189  N N   . TYR C  3  136 ? 23.984  -56.937 19.563  1.00 0.00 ? 136 TYR C N   1 
ATOM   4190  C CA  . TYR C  3  136 ? 24.291  -55.544 19.686  1.00 0.00 ? 136 TYR C CA  1 
ATOM   4191  C C   . TYR C  3  136 ? 25.235  -55.443 20.852  1.00 0.00 ? 136 TYR C C   1 
ATOM   4192  O O   . TYR C  3  136 ? 24.863  -55.689 21.999  1.00 0.00 ? 136 TYR C O   1 
ATOM   4193  C CB  . TYR C  3  136 ? 23.025  -54.732 19.956  1.00 0.00 ? 136 TYR C CB  1 
ATOM   4194  C CG  . TYR C  3  136 ? 21.936  -54.936 18.926  1.00 0.00 ? 136 TYR C CG  1 
ATOM   4195  C CD1 . TYR C  3  136 ? 21.965  -54.261 17.713  1.00 0.00 ? 136 TYR C CD1 1 
ATOM   4196  C CD2 . TYR C  3  136 ? 20.879  -55.803 19.168  1.00 0.00 ? 136 TYR C CD2 1 
ATOM   4197  C CE1 . TYR C  3  136 ? 20.972  -54.444 16.770  1.00 0.00 ? 136 TYR C CE1 1 
ATOM   4198  C CE2 . TYR C  3  136 ? 19.881  -55.993 18.230  1.00 0.00 ? 136 TYR C CE2 1 
ATOM   4199  C CZ  . TYR C  3  136 ? 19.933  -55.311 17.033  1.00 0.00 ? 136 TYR C CZ  1 
ATOM   4200  O OH  . TYR C  3  136 ? 18.942  -55.497 16.097  1.00 0.00 ? 136 TYR C OH  1 
ATOM   4201  N N   . ILE C  3  137 ? 26.459  -55.051 20.552  1.00 0.00 ? 137 ILE C N   1 
ATOM   4202  C CA  . ILE C  3  137 ? 27.349  -54.565 21.562  1.00 0.00 ? 137 ILE C CA  1 
ATOM   4203  C C   . ILE C  3  137 ? 27.201  -53.074 21.606  1.00 0.00 ? 137 ILE C C   1 
ATOM   4204  O O   . ILE C  3  137 ? 26.932  -52.471 20.585  1.00 0.00 ? 137 ILE C O   1 
ATOM   4205  C CB  . ILE C  3  137 ? 28.760  -55.056 21.241  1.00 0.00 ? 137 ILE C CB  1 
ATOM   4206  C CG1 . ILE C  3  137 ? 29.290  -54.556 19.884  1.00 0.00 ? 137 ILE C CG1 1 
ATOM   4207  C CG2 . ILE C  3  137 ? 28.734  -56.603 21.255  1.00 0.00 ? 137 ILE C CG2 1 
ATOM   4208  C CD1 . ILE C  3  137 ? 30.745  -54.926 19.613  1.00 0.00 ? 137 ILE C CD1 1 
ATOM   4209  N N   . GLY C  3  138 ? 27.288  -52.425 22.772  1.00 0.00 ? 138 GLY C N   1 
ATOM   4210  C CA  . GLY C  3  138 ? 27.075  -51.008 22.808  1.00 0.00 ? 138 GLY C CA  1 
ATOM   4211  C C   . GLY C  3  138 ? 27.303  -50.509 24.182  1.00 0.00 ? 138 GLY C C   1 
ATOM   4212  O O   . GLY C  3  138 ? 27.587  -51.275 25.090  1.00 0.00 ? 138 GLY C O   1 
ATOM   4213  N N   . TRP C  3  139 ? 27.279  -49.191 24.339  1.00 0.00 ? 139 TRP C N   1 
ATOM   4214  C CA  . TRP C  3  139 ? 27.397  -48.571 25.654  1.00 0.00 ? 139 TRP C CA  1 
ATOM   4215  C C   . TRP C  3  139 ? 26.433  -47.400 25.796  1.00 0.00 ? 139 TRP C C   1 
ATOM   4216  O O   . TRP C  3  139 ? 26.864  -46.247 25.781  1.00 0.00 ? 139 TRP C O   1 
ATOM   4217  C CB  . TRP C  3  139 ? 28.833  -48.102 25.898  1.00 0.00 ? 139 TRP C CB  1 
ATOM   4218  C CG  . TRP C  3  139 ? 29.030  -47.440 27.228  1.00 0.00 ? 139 TRP C CG  1 
ATOM   4219  C CD1 . TRP C  3  139 ? 29.173  -48.056 28.437  1.00 0.00 ? 139 TRP C CD1 1 
ATOM   4220  C CD2 . TRP C  3  139 ? 29.104  -46.032 27.483  1.00 0.00 ? 139 TRP C CD2 1 
ATOM   4221  N NE1 . TRP C  3  139 ? 29.333  -47.119 29.429  1.00 0.00 ? 139 TRP C NE1 1 
ATOM   4222  C CE2 . TRP C  3  139 ? 29.294  -45.869 28.870  1.00 0.00 ? 139 TRP C CE2 1 
ATOM   4223  C CE3 . TRP C  3  139 ? 29.030  -44.894 26.674  1.00 0.00 ? 139 TRP C CE3 1 
ATOM   4224  C CZ2 . TRP C  3  139 ? 29.410  -44.614 29.465  1.00 0.00 ? 139 TRP C CZ2 1 
ATOM   4225  C CZ3 . TRP C  3  139 ? 29.145  -43.649 27.267  1.00 0.00 ? 139 TRP C CZ3 1 
ATOM   4226  C CH2 . TRP C  3  139 ? 29.333  -43.520 28.649  1.00 0.00 ? 139 TRP C CH2 1 
ATOM   4227  N N   . ASP C  3  140 ? 25.136  -47.667 25.921  1.00 0.00 ? 140 ASP C N   1 
ATOM   4228  C CA  . ASP C  3  140 ? 24.206  -46.569 25.936  1.00 0.00 ? 140 ASP C CA  1 
ATOM   4229  C C   . ASP C  3  140 ? 24.501  -45.736 27.152  1.00 0.00 ? 140 ASP C C   1 
ATOM   4230  O O   . ASP C  3  140 ? 25.050  -46.218 28.141  1.00 0.00 ? 140 ASP C O   1 
ATOM   4231  C CB  . ASP C  3  140 ? 22.706  -46.940 25.851  1.00 0.00 ? 140 ASP C CB  1 
ATOM   4232  C CG  . ASP C  3  140 ? 22.059  -47.541 27.087  1.00 0.00 ? 140 ASP C CG  1 
ATOM   4233  O OD1 . ASP C  3  140 ? 22.786  -47.977 28.009  1.00 0.00 ? 140 ASP C OD1 1 
ATOM   4234  O OD2 . ASP C  3  140 ? 20.802  -47.570 27.103  1.00 0.00 ? 140 ASP C OD2 1 
ATOM   4235  N N   . LYS C  3  141 ? 24.174  -44.444 27.075  1.00 0.00 ? 141 LYS C N   1 
ATOM   4236  C CA  . LYS C  3  141 ? 24.462  -43.473 28.083  1.00 0.00 ? 141 LYS C CA  1 
ATOM   4237  C C   . LYS C  3  141 ? 23.896  -43.810 29.441  1.00 0.00 ? 141 LYS C C   1 
ATOM   4238  O O   . LYS C  3  141 ? 24.481  -43.471 30.471  1.00 0.00 ? 141 LYS C O   1 
ATOM   4239  C CB  . LYS C  3  141 ? 23.874  -42.124 27.657  1.00 0.00 ? 141 LYS C CB  1 
ATOM   4240  C CG  . LYS C  3  141 ? 24.244  -41.742 26.221  1.00 0.00 ? 141 LYS C CG  1 
ATOM   4241  C CD  . LYS C  3  141 ? 23.941  -40.273 25.900  1.00 0.00 ? 141 LYS C CD  1 
ATOM   4242  C CE  . LYS C  3  141 ? 22.452  -39.928 25.852  1.00 0.00 ? 141 LYS C CE  1 
ATOM   4243  N NZ  . LYS C  3  141 ? 21.776  -40.681 24.777  1.00 0.00 ? 141 LYS C NZ  1 
ATOM   4244  N N   . HIS C  3  142 ? 22.692  -44.423 29.449  1.00 0.00 ? 142 HIS C N   1 
ATOM   4245  C CA  . HIS C  3  142 ? 21.888  -44.594 30.624  1.00 0.00 ? 142 HIS C CA  1 
ATOM   4246  C C   . HIS C  3  142 ? 22.154  -45.866 31.378  1.00 0.00 ? 142 HIS C C   1 
ATOM   4247  O O   . HIS C  3  142 ? 21.610  -46.025 32.461  1.00 0.00 ? 142 HIS C O   1 
ATOM   4248  C CB  . HIS C  3  142 ? 20.400  -44.592 30.224  1.00 0.00 ? 142 HIS C CB  1 
ATOM   4249  C CG  . HIS C  3  142 ? 19.956  -43.347 29.484  1.00 0.00 ? 142 HIS C CG  1 
ATOM   4250  N ND1 . HIS C  3  142 ? 19.326  -42.272 30.077  1.00 0.00 ? 142 HIS C ND1 1 
ATOM   4251  C CD2 . HIS C  3  142 ? 19.967  -43.074 28.152  1.00 0.00 ? 142 HIS C CD2 1 
ATOM   4252  C CE1 . HIS C  3  142 ? 18.983  -41.421 29.080  1.00 0.00 ? 142 HIS C CE1 1 
ATOM   4253  N NE2 . HIS C  3  142 ? 19.356  -41.861 27.897  1.00 0.00 ? 142 HIS C NE2 1 
ATOM   4254  N N   . TYR C  3  143 ? 22.823  -46.823 30.740  1.00 0.00 ? 143 TYR C N   1 
ATOM   4255  C CA  . TYR C  3  143 ? 23.100  -48.112 31.369  1.00 0.00 ? 143 TYR C CA  1 
ATOM   4256  C C   . TYR C  3  143 ? 24.567  -48.542 31.344  1.00 0.00 ? 143 TYR C C   1 
ATOM   4257  O O   . TYR C  3  143 ? 24.919  -49.565 31.931  1.00 0.00 ? 143 TYR C O   1 
ATOM   4258  C CB  . TYR C  3  143 ? 22.229  -49.204 30.742  1.00 0.00 ? 143 TYR C CB  1 
ATOM   4259  C CG  . TYR C  3  143 ? 20.746  -49.005 30.958  1.00 0.00 ? 143 TYR C CG  1 
ATOM   4260  C CD1 . TYR C  3  143 ? 20.226  -48.838 32.235  1.00 0.00 ? 143 TYR C CD1 1 
ATOM   4261  C CD2 . TYR C  3  143 ? 19.865  -48.983 29.885  1.00 0.00 ? 143 TYR C CD2 1 
ATOM   4262  C CE1 . TYR C  3  143 ? 18.872  -48.655 32.437  1.00 0.00 ? 143 TYR C CE1 1 
ATOM   4263  C CE2 . TYR C  3  143 ? 18.508  -48.802 30.077  1.00 0.00 ? 143 TYR C CE2 1 
ATOM   4264  C CZ  . TYR C  3  143 ? 18.017  -48.638 31.355  1.00 0.00 ? 143 TYR C CZ  1 
ATOM   4265  O OH  . TYR C  3  143 ? 16.668  -48.457 31.551  1.00 0.00 ? 143 TYR C OH  1 
ATOM   4266  N N   . GLY C  3  144 ? 25.417  -47.786 30.656  1.00 0.00 ? 144 GLY C N   1 
ATOM   4267  C CA  . GLY C  3  144 ? 26.755  -48.246 30.408  1.00 0.00 ? 144 GLY C CA  1 
ATOM   4268  C C   . GLY C  3  144 ? 26.786  -49.324 29.374  1.00 0.00 ? 144 GLY C C   1 
ATOM   4269  O O   . GLY C  3  144 ? 25.983  -49.263 28.451  1.00 0.00 ? 144 GLY C O   1 
ATOM   4270  N N   . PHE C  3  145 ? 27.782  -50.258 29.445  1.00 0.00 ? 145 PHE C N   1 
ATOM   4271  C CA  . PHE C  3  145 ? 27.922  -51.330 28.471  1.00 0.00 ? 145 PHE C CA  1 
ATOM   4272  C C   . PHE C  3  145 ? 26.789  -52.299 28.486  1.00 0.00 ? 145 PHE C C   1 
ATOM   4273  O O   . PHE C  3  145 ? 26.273  -52.665 29.531  1.00 0.00 ? 145 PHE C O   1 
ATOM   4274  C CB  . PHE C  3  145 ? 29.239  -52.134 28.649  1.00 0.00 ? 145 PHE C CB  1 
ATOM   4275  C CG  . PHE C  3  145 ? 30.384  -51.313 28.109  1.00 0.00 ? 145 PHE C CG  1 
ATOM   4276  C CD1 . PHE C  3  145 ? 30.481  -51.072 26.725  1.00 0.00 ? 145 PHE C CD1 1 
ATOM   4277  C CD2 . PHE C  3  145 ? 31.344  -50.737 28.957  1.00 0.00 ? 145 PHE C CD2 1 
ATOM   4278  C CE1 . PHE C  3  145 ? 31.497  -50.281 26.202  1.00 0.00 ? 145 PHE C CE1 1 
ATOM   4279  C CE2 . PHE C  3  145 ? 32.360  -49.927 28.429  1.00 0.00 ? 145 PHE C CE2 1 
ATOM   4280  C CZ  . PHE C  3  145 ? 32.431  -49.706 27.051  1.00 0.00 ? 145 PHE C CZ  1 
ATOM   4281  N N   . GLN C  3  146 ? 26.382  -52.741 27.284  1.00 0.00 ? 146 GLN C N   1 
ATOM   4282  C CA  . GLN C  3  146 ? 25.288  -53.639 27.148  1.00 0.00 ? 146 GLN C CA  1 
ATOM   4283  C C   . GLN C  3  146 ? 25.400  -54.319 25.844  1.00 0.00 ? 146 GLN C C   1 
ATOM   4284  O O   . GLN C  3  146 ? 26.110  -53.865 24.961  1.00 0.00 ? 146 GLN C O   1 
ATOM   4285  C CB  . GLN C  3  146 ? 23.951  -52.925 27.251  1.00 0.00 ? 146 GLN C CB  1 
ATOM   4286  C CG  . GLN C  3  146 ? 23.796  -51.767 26.258  1.00 0.00 ? 146 GLN C CG  1 
ATOM   4287  C CD  . GLN C  3  146 ? 22.657  -50.914 26.801  1.00 0.00 ? 146 GLN C CD  1 
ATOM   4288  O OE1 . GLN C  3  146 ? 22.625  -50.652 28.006  1.00 0.00 ? 146 GLN C OE1 1 
ATOM   4289  N NE2 . GLN C  3  146 ? 21.707  -50.503 25.917  1.00 0.00 ? 146 GLN C NE2 1 
ATOM   4290  N N   . LEU C  3  147 ? 24.729  -55.473 25.746  1.00 0.00 ? 147 LEU C N   1 
ATOM   4291  C CA  . LEU C  3  147 ? 24.814  -56.411 24.677  1.00 0.00 ? 147 LEU C CA  1 
ATOM   4292  C C   . LEU C  3  147 ? 23.411  -56.893 24.580  1.00 0.00 ? 147 LEU C C   1 
ATOM   4293  O O   . LEU C  3  147 ? 22.798  -57.164 25.603  1.00 0.00 ? 147 LEU C O   1 
ATOM   4294  C CB  . LEU C  3  147 ? 25.758  -57.565 25.106  1.00 0.00 ? 147 LEU C CB  1 
ATOM   4295  C CG  . LEU C  3  147 ? 25.596  -58.958 24.465  1.00 0.00 ? 147 LEU C CG  1 
ATOM   4296  C CD1 . LEU C  3  147 ? 26.032  -59.007 22.998  1.00 0.00 ? 147 LEU C CD1 1 
ATOM   4297  C CD2 . LEU C  3  147 ? 26.363  -59.993 25.287  1.00 0.00 ? 147 LEU C CD2 1 
ATOM   4298  N N   . TYR C  3  148 ? 22.905  -56.980 23.353  1.00 0.00 ? 148 TYR C N   1 
ATOM   4299  C CA  . TYR C  3  148 ? 21.565  -57.477 23.074  1.00 0.00 ? 148 TYR C CA  1 
ATOM   4300  C C   . TYR C  3  148 ? 21.621  -58.437 21.889  1.00 0.00 ? 148 TYR C C   1 
ATOM   4301  O O   . TYR C  3  148 ? 22.514  -58.341 21.046  1.00 0.00 ? 148 TYR C O   1 
ATOM   4302  C CB  . TYR C  3  148 ? 20.612  -56.320 22.773  1.00 0.00 ? 148 TYR C CB  1 
ATOM   4303  C CG  . TYR C  3  148 ? 20.210  -55.523 23.994  1.00 0.00 ? 148 TYR C CG  1 
ATOM   4304  C CD1 . TYR C  3  148 ? 21.039  -54.533 24.505  1.00 0.00 ? 148 TYR C CD1 1 
ATOM   4305  C CD2 . TYR C  3  148 ? 19.003  -55.762 24.637  1.00 0.00 ? 148 TYR C CD2 1 
ATOM   4306  C CE1 . TYR C  3  148 ? 20.677  -53.803 25.621  1.00 0.00 ? 148 TYR C CE1 1 
ATOM   4307  C CE2 . TYR C  3  148 ? 18.632  -55.038 25.753  1.00 0.00 ? 148 TYR C CE2 1 
ATOM   4308  C CZ  . TYR C  3  148 ? 19.472  -54.059 26.241  1.00 0.00 ? 148 TYR C CZ  1 
ATOM   4309  O OH  . TYR C  3  148 ? 19.107  -53.334 27.352  1.00 0.00 ? 148 TYR C OH  1 
ATOM   4310  N N   . GLN C  3  149 ? 20.671  -59.363 21.829  1.00 0.00 ? 149 GLN C N   1 
ATOM   4311  C CA  . GLN C  3  149 ? 20.657  -60.363 20.798  1.00 0.00 ? 149 GLN C CA  1 
ATOM   4312  C C   . GLN C  3  149 ? 19.323  -60.244 20.192  1.00 0.00 ? 149 GLN C C   1 
ATOM   4313  O O   . GLN C  3  149 ? 18.374  -60.180 20.952  1.00 0.00 ? 149 GLN C O   1 
ATOM   4314  C CB  . GLN C  3  149 ? 20.815  -61.806 21.296  1.00 0.00 ? 149 GLN C CB  1 
ATOM   4315  C CG  . GLN C  3  149 ? 20.718  -62.853 20.180  1.00 0.00 ? 149 GLN C CG  1 
ATOM   4316  C CD  . GLN C  3  149 ? 20.883  -64.258 20.757  1.00 0.00 ? 149 GLN C CD  1 
ATOM   4317  O OE1 . GLN C  3  149 ? 21.331  -64.449 21.893  1.00 0.00 ? 149 GLN C OE1 1 
ATOM   4318  N NE2 . GLN C  3  149 ? 20.489  -65.271 19.926  1.00 0.00 ? 149 GLN C NE2 1 
ATOM   4319  N N   . SER C  3  150 ? 19.184  -60.252 18.850  1.00 0.00 ? 150 SER C N   1 
ATOM   4320  C CA  . SER C  3  150 ? 17.924  -60.119 18.177  1.00 0.00 ? 150 SER C CA  1 
ATOM   4321  C C   . SER C  3  150 ? 17.635  -61.409 17.502  1.00 0.00 ? 150 SER C C   1 
ATOM   4322  O O   . SER C  3  150 ? 18.281  -61.744 16.528  1.00 0.00 ? 150 SER C O   1 
ATOM   4323  C CB  . SER C  3  150 ? 17.910  -59.046 17.078  1.00 0.00 ? 150 SER C CB  1 
ATOM   4324  O OG  . SER C  3  150 ? 16.737  -59.073 16.276  1.00 0.00 ? 150 SER C OG  1 
ATOM   4325  N N   . ASP C  3  151 ? 16.641  -62.117 18.030  1.00 0.00 ? 151 ASP C N   1 
ATOM   4326  C CA  . ASP C  3  151 ? 16.074  -63.317 17.433  1.00 0.00 ? 151 ASP C CA  1 
ATOM   4327  C C   . ASP C  3  151 ? 15.566  -62.970 16.042  1.00 0.00 ? 151 ASP C C   1 
ATOM   4328  O O   . ASP C  3  151 ? 15.228  -61.807 15.787  1.00 0.00 ? 151 ASP C O   1 
ATOM   4329  C CB  . ASP C  3  151 ? 14.920  -63.811 18.316  1.00 0.00 ? 151 ASP C CB  1 
ATOM   4330  C CG  . ASP C  3  151 ? 14.055  -64.865 17.642  1.00 0.00 ? 151 ASP C CG  1 
ATOM   4331  O OD1 . ASP C  3  151 ? 13.462  -64.578 16.582  1.00 0.00 ? 151 ASP C OD1 1 
ATOM   4332  O OD2 . ASP C  3  151 ? 13.946  -65.979 18.195  1.00 0.00 ? 151 ASP C OD2 1 
ATOM   4333  N N   . PRO C  3  152 ? 15.513  -64.030 15.118  1.00 0.00 ? 152 PRO C N   1 
ATOM   4334  C CA  . PRO C  3  152 ? 15.061  -63.603 13.782  1.00 0.00 ? 152 PRO C CA  1 
ATOM   4335  C C   . PRO C  3  152 ? 13.543  -63.575 13.639  1.00 0.00 ? 152 PRO C C   1 
ATOM   4336  O O   . PRO C  3  152 ? 12.975  -64.322 12.847  1.00 0.00 ? 152 PRO C O   1 
ATOM   4337  C CB  . PRO C  3  152 ? 15.658  -64.655 12.861  1.00 0.00 ? 152 PRO C CB  1 
ATOM   4338  C CG  . PRO C  3  152 ? 15.445  -65.904 13.612  1.00 0.00 ? 152 PRO C CG  1 
ATOM   4339  C CD  . PRO C  3  152 ? 15.763  -65.553 15.037  1.00 0.00 ? 152 PRO C CD  1 
ATOM   4340  N N   . SER C  3  153 ? 12.934  -62.964 14.615  1.00 0.00 ? 153 SER C N   1 
ATOM   4341  C CA  . SER C  3  153 ? 11.552  -62.649 14.613  1.00 0.00 ? 153 SER C CA  1 
ATOM   4342  C C   . SER C  3  153 ? 11.793  -61.668 15.696  1.00 0.00 ? 153 SER C C   1 
ATOM   4343  O O   . SER C  3  153 ? 12.820  -61.728 16.372  1.00 0.00 ? 153 SER C O   1 
ATOM   4344  C CB  . SER C  3  153 ? 10.711  -63.831 15.097  1.00 0.00 ? 153 SER C CB  1 
ATOM   4345  O OG  . SER C  3  153 ? 10.878  -64.085 16.483  1.00 0.00 ? 153 SER C OG  1 
ATOM   4346  N N   . GLY C  3  154 ? 10.875  -60.746 15.950  1.00 0.00 ? 154 GLY C N   1 
ATOM   4347  C CA  . GLY C  3  154 ? 11.139  -59.748 16.981  1.00 0.00 ? 154 GLY C CA  1 
ATOM   4348  C C   . GLY C  3  154 ? 11.307  -60.316 18.386  1.00 0.00 ? 154 GLY C C   1 
ATOM   4349  O O   . GLY C  3  154 ? 10.604  -61.250 18.759  1.00 0.00 ? 154 GLY C O   1 
ATOM   4350  N N   . ASN C  3  155 ? 12.383  -59.934 19.013  1.00 0.00 ? 155 ASN C N   1 
ATOM   4351  C CA  . ASN C  3  155 ? 12.625  -60.322 20.355  1.00 0.00 ? 155 ASN C CA  1 
ATOM   4352  C C   . ASN C  3  155 ? 13.834  -59.506 20.563  1.00 0.00 ? 155 ASN C C   1 
ATOM   4353  O O   . ASN C  3  155 ? 14.393  -58.951 19.617  1.00 0.00 ? 155 ASN C O   1 
ATOM   4354  C CB  . ASN C  3  155 ? 12.961  -61.808 20.439  1.00 0.00 ? 155 ASN C CB  1 
ATOM   4355  C CG  . ASN C  3  155 ? 12.918  -62.336 21.860  1.00 0.00 ? 155 ASN C CG  1 
ATOM   4356  O OD1 . ASN C  3  155 ? 12.179  -61.825 22.702  1.00 0.00 ? 155 ASN C OD1 1 
ATOM   4357  N ND2 . ASN C  3  155 ? 13.712  -63.364 22.134  1.00 0.00 ? 155 ASN C ND2 1 
ATOM   4358  N N   . TYR C  3  156 ? 14.278  -59.445 21.788  1.00 0.00 ? 156 TYR C N   1 
ATOM   4359  C CA  . TYR C  3  156 ? 15.609  -59.022 21.984  1.00 0.00 ? 156 TYR C CA  1 
ATOM   4360  C C   . TYR C  3  156 ? 15.819  -59.342 23.411  1.00 0.00 ? 156 TYR C C   1 
ATOM   4361  O O   . TYR C  3  156 ? 14.860  -59.393 24.173  1.00 0.00 ? 156 TYR C O   1 
ATOM   4362  C CB  . TYR C  3  156 ? 15.893  -57.542 21.641  1.00 0.00 ? 156 TYR C CB  1 
ATOM   4363  C CG  . TYR C  3  156 ? 14.813  -56.628 22.124  1.00 0.00 ? 156 TYR C CG  1 
ATOM   4364  C CD1 . TYR C  3  156 ? 14.682  -56.333 23.488  1.00 0.00 ? 156 TYR C CD1 1 
ATOM   4365  C CD2 . TYR C  3  156 ? 13.880  -56.109 21.223  1.00 0.00 ? 156 TYR C CD2 1 
ATOM   4366  C CE1 . TYR C  3  156 ? 13.606  -55.574 23.948  1.00 0.00 ? 156 TYR C CE1 1 
ATOM   4367  C CE2 . TYR C  3  156 ? 12.817  -55.327 21.677  1.00 0.00 ? 156 TYR C CE2 1 
ATOM   4368  C CZ  . TYR C  3  156 ? 12.675  -55.061 23.039  1.00 0.00 ? 156 TYR C CZ  1 
ATOM   4369  O OH  . TYR C  3  156 ? 11.616  -54.251 23.495  1.00 0.00 ? 156 TYR C OH  1 
ATOM   4370  N N   . GLY C  3  157 ? 17.060  -59.609 23.825  1.00 0.00 ? 157 GLY C N   1 
ATOM   4371  C CA  . GLY C  3  157 ? 17.296  -60.044 25.166  1.00 0.00 ? 157 GLY C CA  1 
ATOM   4372  C C   . GLY C  3  157 ? 18.602  -59.470 25.516  1.00 0.00 ? 157 GLY C C   1 
ATOM   4373  O O   . GLY C  3  157 ? 19.581  -59.696 24.831  1.00 0.00 ? 157 GLY C O   1 
ATOM   4374  N N   . GLY C  3  158 ? 18.674  -58.665 26.586  1.00 0.00 ? 158 GLY C N   1 
ATOM   4375  C CA  . GLY C  3  158 ? 19.928  -58.149 27.048  1.00 0.00 ? 158 GLY C CA  1 
ATOM   4376  C C   . GLY C  3  158 ? 20.674  -59.286 27.642  1.00 0.00 ? 158 GLY C C   1 
ATOM   4377  O O   . GLY C  3  158 ? 20.189  -59.847 28.617  1.00 0.00 ? 158 GLY C O   1 
ATOM   4378  N N   . TRP C  3  159 ? 21.838  -59.619 27.087  1.00 0.00 ? 159 TRP C N   1 
ATOM   4379  C CA  . TRP C  3  159 ? 22.610  -60.783 27.517  1.00 0.00 ? 159 TRP C CA  1 
ATOM   4380  C C   . TRP C  3  159 ? 24.034  -60.427 27.948  1.00 0.00 ? 159 TRP C C   1 
ATOM   4381  O O   . TRP C  3  159 ? 24.667  -59.538 27.378  1.00 0.00 ? 159 TRP C O   1 
ATOM   4382  C CB  . TRP C  3  159 ? 22.648  -61.838 26.409  1.00 0.00 ? 159 TRP C CB  1 
ATOM   4383  C CG  . TRP C  3  159 ? 21.327  -62.503 26.170  1.00 0.00 ? 159 TRP C CG  1 
ATOM   4384  C CD1 . TRP C  3  159 ? 20.223  -61.948 25.591  1.00 0.00 ? 159 TRP C CD1 1 
ATOM   4385  C CD2 . TRP C  3  159 ? 20.971  -63.850 26.503  1.00 0.00 ? 159 TRP C CD2 1 
ATOM   4386  N NE1 . TRP C  3  159 ? 19.202  -62.866 25.543  1.00 0.00 ? 159 TRP C NE1 1 
ATOM   4387  C CE2 . TRP C  3  159 ? 19.635  -64.042 26.097  1.00 0.00 ? 159 TRP C CE2 1 
ATOM   4388  C CE3 . TRP C  3  159 ? 21.651  -64.913 27.106  1.00 0.00 ? 159 TRP C CE3 1 
ATOM   4389  C CZ2 . TRP C  3  159 ? 18.967  -65.252 26.274  1.00 0.00 ? 159 TRP C CZ2 1 
ATOM   4390  C CZ3 . TRP C  3  159 ? 20.987  -66.113 27.281  1.00 0.00 ? 159 TRP C CZ3 1 
ATOM   4391  C CH2 . TRP C  3  159 ? 19.659  -66.272 26.866  1.00 0.00 ? 159 TRP C CH2 1 
ATOM   4392  N N   . LYS C  3  160 ? 24.525  -61.131 28.965  1.00 0.00 ? 160 LYS C N   1 
ATOM   4393  C CA  . LYS C  3  160 ? 25.815  -60.873 29.545  1.00 0.00 ? 160 LYS C CA  1 
ATOM   4394  C C   . LYS C  3  160 ? 26.856  -61.590 28.738  1.00 0.00 ? 160 LYS C C   1 
ATOM   4395  O O   . LYS C  3  160 ? 28.007  -61.189 28.653  1.00 0.00 ? 160 LYS C O   1 
ATOM   4396  C CB  . LYS C  3  160 ? 25.908  -61.392 30.990  1.00 0.00 ? 160 LYS C CB  1 
ATOM   4397  C CG  . LYS C  3  160 ? 24.925  -60.678 31.910  1.00 0.00 ? 160 LYS C CG  1 
ATOM   4398  C CD  . LYS C  3  160 ? 25.163  -61.002 33.383  1.00 0.00 ? 160 LYS C CD  1 
ATOM   4399  C CE  . LYS C  3  160 ? 24.202  -60.275 34.331  1.00 0.00 ? 160 LYS C CE  1 
ATOM   4400  N NZ  . LYS C  3  160 ? 24.330  -58.802 34.216  1.00 0.00 ? 160 LYS C NZ  1 
ATOM   4401  N N   . ALA C  3  161 ? 26.471  -62.676 28.087  1.00 0.00 ? 161 ALA C N   1 
ATOM   4402  C CA  . ALA C  3  161 ? 27.356  -63.309 27.195  1.00 0.00 ? 161 ALA C CA  1 
ATOM   4403  C C   . ALA C  3  161 ? 26.438  -64.145 26.415  1.00 0.00 ? 161 ALA C C   1 
ATOM   4404  O O   . ALA C  3  161 ? 25.498  -64.703 26.965  1.00 0.00 ? 161 ALA C O   1 
ATOM   4405  C CB  . ALA C  3  161 ? 28.373  -64.197 27.912  1.00 0.00 ? 161 ALA C CB  1 
ATOM   4406  N N   . THR C  3  162 ? 26.698  -64.301 25.115  1.00 0.00 ? 162 THR C N   1 
ATOM   4407  C CA  . THR C  3  162 ? 25.841  -65.111 24.316  1.00 0.00 ? 162 THR C CA  1 
ATOM   4408  C C   . THR C  3  162 ? 26.614  -65.444 23.109  1.00 0.00 ? 162 THR C C   1 
ATOM   4409  O O   . THR C  3  162 ? 27.616  -64.805 22.812  1.00 0.00 ? 162 THR C O   1 
ATOM   4410  C CB  . THR C  3  162 ? 24.536  -64.433 23.950  1.00 0.00 ? 162 THR C CB  1 
ATOM   4411  O OG1 . THR C  3  162 ? 23.597  -65.344 23.377  1.00 0.00 ? 162 THR C OG1 1 
ATOM   4412  C CG2 . THR C  3  162 ? 24.779  -63.246 23.003  1.00 0.00 ? 162 THR C CG2 1 
ATOM   4413  N N   . CYS C  3  163 ? 26.154  -66.479 22.393  1.00 0.00 ? 163 CYS C N   1 
ATOM   4414  C CA  . CYS C  3  163 ? 26.764  -66.956 21.202  1.00 0.00 ? 163 CYS C CA  1 
ATOM   4415  C C   . CYS C  3  163 ? 25.612  -67.112 20.290  1.00 0.00 ? 163 CYS C C   1 
ATOM   4416  O O   . CYS C  3  163 ? 24.468  -67.187 20.726  1.00 0.00 ? 163 CYS C O   1 
ATOM   4417  C CB  . CYS C  3  163 ? 27.465  -68.312 21.441  1.00 0.00 ? 163 CYS C CB  1 
ATOM   4418  S SG  . CYS C  3  163 ? 28.406  -68.949 20.024  1.00 0.00 ? 163 CYS C SG  1 
ATOM   4419  N N   . ILE C  3  164 ? 25.891  -67.137 18.983  1.00 0.00 ? 164 ILE C N   1 
ATOM   4420  C CA  . ILE C  3  164 ? 24.882  -67.277 17.979  1.00 0.00 ? 164 ILE C CA  1 
ATOM   4421  C C   . ILE C  3  164 ? 25.638  -67.809 16.802  1.00 0.00 ? 164 ILE C C   1 
ATOM   4422  O O   . ILE C  3  164 ? 26.849  -67.661 16.741  1.00 0.00 ? 164 ILE C O   1 
ATOM   4423  C CB  . ILE C  3  164 ? 24.158  -65.951 17.705  1.00 0.00 ? 164 ILE C CB  1 
ATOM   4424  C CG1 . ILE C  3  164 ? 22.984  -66.091 16.716  1.00 0.00 ? 164 ILE C CG1 1 
ATOM   4425  C CG2 . ILE C  3  164 ? 25.130  -64.838 17.264  1.00 0.00 ? 164 ILE C CG2 1 
ATOM   4426  C CD1 . ILE C  3  164 ? 21.941  -67.143 17.115  1.00 0.00 ? 164 ILE C CD1 1 
ATOM   4427  N N   . GLY C  3  165 ? 24.970  -68.521 15.872  1.00 0.00 ? 165 GLY C N   1 
ATOM   4428  C CA  . GLY C  3  165 ? 25.656  -69.231 14.832  1.00 0.00 ? 165 GLY C CA  1 
ATOM   4429  C C   . GLY C  3  165 ? 25.658  -70.686 15.171  1.00 0.00 ? 165 GLY C C   1 
ATOM   4430  O O   . GLY C  3  165 ? 24.896  -71.120 16.028  1.00 0.00 ? 165 GLY C O   1 
ATOM   4431  N N   . ASN C  3  166 ? 26.488  -71.474 14.428  1.00 0.00 ? 166 ASN C N   1 
ATOM   4432  C CA  . ASN C  3  166 ? 26.680  -72.903 14.518  1.00 0.00 ? 166 ASN C CA  1 
ATOM   4433  C C   . ASN C  3  166 ? 27.182  -73.237 15.877  1.00 0.00 ? 166 ASN C C   1 
ATOM   4434  O O   . ASN C  3  166 ? 28.061  -72.544 16.376  1.00 0.00 ? 166 ASN C O   1 
ATOM   4435  C CB  . ASN C  3  166 ? 27.691  -73.382 13.454  1.00 0.00 ? 166 ASN C CB  1 
ATOM   4436  C CG  . ASN C  3  166 ? 27.578  -74.882 13.141  1.00 0.00 ? 166 ASN C CG  1 
ATOM   4437  O OD1 . ASN C  3  166 ? 27.934  -75.746 13.949  1.00 0.00 ? 166 ASN C OD1 1 
ATOM   4438  N ND2 . ASN C  3  166 ? 27.093  -75.187 11.900  1.00 0.00 ? 166 ASN C ND2 1 
ATOM   4439  N N   . ASN C  3  167 ? 26.556  -74.240 16.539  1.00 0.00 ? 167 ASN C N   1 
ATOM   4440  C CA  . ASN C  3  167 ? 26.831  -74.663 17.901  1.00 0.00 ? 167 ASN C CA  1 
ATOM   4441  C C   . ASN C  3  167 ? 26.633  -73.528 18.866  1.00 0.00 ? 167 ASN C C   1 
ATOM   4442  O O   . ASN C  3  167 ? 27.410  -73.370 19.804  1.00 0.00 ? 167 ASN C O   1 
ATOM   4443  C CB  . ASN C  3  167 ? 28.253  -75.198 18.206  1.00 0.00 ? 167 ASN C CB  1 
ATOM   4444  C CG  . ASN C  3  167 ? 28.709  -76.274 17.228  1.00 0.00 ? 167 ASN C CG  1 
ATOM   4445  O OD1 . ASN C  3  167 ? 29.587  -76.007 16.394  1.00 0.00 ? 167 ASN C OD1 1 
ATOM   4446  N ND2 . ASN C  3  167 ? 28.131  -77.504 17.372  1.00 0.00 ? 167 ASN C ND2 1 
ATOM   4447  N N   . SER C  3  168 ? 25.546  -72.735 18.707  1.00 0.00 ? 168 SER C N   1 
ATOM   4448  C CA  . SER C  3  168 ? 25.250  -71.682 19.642  1.00 0.00 ? 168 SER C CA  1 
ATOM   4449  C C   . SER C  3  168 ? 24.910  -72.306 20.954  1.00 0.00 ? 168 SER C C   1 
ATOM   4450  O O   . SER C  3  168 ? 25.287  -71.777 21.988  1.00 0.00 ? 168 SER C O   1 
ATOM   4451  C CB  . SER C  3  168 ? 24.015  -70.839 19.227  1.00 0.00 ? 168 SER C CB  1 
ATOM   4452  O OG  . SER C  3  168 ? 23.666  -69.833 20.176  1.00 0.00 ? 168 SER C OG  1 
ATOM   4453  N N   . ALA C  3  169 ? 24.199  -73.463 20.909  1.00 0.00 ? 169 ALA C N   1 
ATOM   4454  C CA  . ALA C  3  169 ? 23.693  -74.125 22.076  1.00 0.00 ? 169 ALA C CA  1 
ATOM   4455  C C   . ALA C  3  169 ? 24.769  -74.661 22.959  1.00 0.00 ? 169 ALA C C   1 
ATOM   4456  O O   . ALA C  3  169 ? 24.771  -74.407 24.152  1.00 0.00 ? 169 ALA C O   1 
ATOM   4457  C CB  . ALA C  3  169 ? 22.761  -75.272 21.681  1.00 0.00 ? 169 ALA C CB  1 
ATOM   4458  N N   . ALA C  3  170 ? 25.752  -75.376 22.391  1.00 0.00 ? 170 ALA C N   1 
ATOM   4459  C CA  . ALA C  3  170 ? 26.874  -75.891 23.129  1.00 0.00 ? 170 ALA C CA  1 
ATOM   4460  C C   . ALA C  3  170 ? 27.760  -74.805 23.658  1.00 0.00 ? 170 ALA C C   1 
ATOM   4461  O O   . ALA C  3  170 ? 28.318  -74.941 24.737  1.00 0.00 ? 170 ALA C O   1 
ATOM   4462  C CB  . ALA C  3  170 ? 27.741  -76.826 22.260  1.00 0.00 ? 170 ALA C CB  1 
ATOM   4463  N N   . ALA C  3  171 ? 27.908  -73.710 22.887  1.00 0.00 ? 171 ALA C N   1 
ATOM   4464  C CA  . ALA C  3  171 ? 28.771  -72.605 23.210  1.00 0.00 ? 171 ALA C CA  1 
ATOM   4465  C C   . ALA C  3  171 ? 28.242  -71.729 24.311  1.00 0.00 ? 171 ALA C C   1 
ATOM   4466  O O   . ALA C  3  171 ? 28.972  -71.400 25.245  1.00 0.00 ? 171 ALA C O   1 
ATOM   4467  C CB  . ALA C  3  171 ? 29.035  -71.738 21.983  1.00 0.00 ? 171 ALA C CB  1 
ATOM   4468  N N   . VAL C  3  172 ? 26.943  -71.341 24.225  1.00 0.00 ? 172 VAL C N   1 
ATOM   4469  C CA  . VAL C  3  172 ? 26.244  -70.561 25.220  1.00 0.00 ? 172 VAL C CA  1 
ATOM   4470  C C   . VAL C  3  172 ? 26.043  -71.318 26.516  1.00 0.00 ? 172 VAL C C   1 
ATOM   4471  O O   . VAL C  3  172 ? 26.139  -70.738 27.591  1.00 0.00 ? 172 VAL C O   1 
ATOM   4472  C CB  . VAL C  3  172 ? 24.945  -69.968 24.665  1.00 0.00 ? 172 VAL C CB  1 
ATOM   4473  C CG1 . VAL C  3  172 ? 23.782  -70.975 24.578  1.00 0.00 ? 172 VAL C CG1 1 
ATOM   4474  C CG2 . VAL C  3  172 ? 24.558  -68.708 25.469  1.00 0.00 ? 172 VAL C CG2 1 
ATOM   4475  N N   . SER C  3  173 ? 25.815  -72.656 26.444  1.00 0.00 ? 173 SER C N   1 
ATOM   4476  C CA  . SER C  3  173 ? 25.722  -73.538 27.578  1.00 0.00 ? 173 SER C CA  1 
ATOM   4477  C C   . SER C  3  173 ? 27.046  -73.710 28.233  1.00 0.00 ? 173 SER C C   1 
ATOM   4478  O O   . SER C  3  173 ? 27.123  -73.959 29.434  1.00 0.00 ? 173 SER C O   1 
ATOM   4479  C CB  . SER C  3  173 ? 25.125  -74.930 27.284  1.00 0.00 ? 173 SER C CB  1 
ATOM   4480  O OG  . SER C  3  173 ? 25.940  -75.715 26.426  1.00 0.00 ? 173 SER C OG  1 
ATOM   4481  N N   . MET C  3  174 ? 28.134  -73.644 27.428  1.00 0.00 ? 174 MET C N   1 
ATOM   4482  C CA  . MET C  3  174 ? 29.466  -73.710 27.954  1.00 0.00 ? 174 MET C CA  1 
ATOM   4483  C C   . MET C  3  174 ? 29.767  -72.473 28.750  1.00 0.00 ? 174 MET C C   1 
ATOM   4484  O O   . MET C  3  174 ? 30.432  -72.558 29.774  1.00 0.00 ? 174 MET C O   1 
ATOM   4485  C CB  . MET C  3  174 ? 30.506  -73.874 26.831  1.00 0.00 ? 174 MET C CB  1 
ATOM   4486  C CG  . MET C  3  174 ? 31.935  -74.008 27.352  1.00 0.00 ? 174 MET C CG  1 
ATOM   4487  S SD  . MET C  3  174 ? 33.109  -74.763 26.199  1.00 0.00 ? 174 MET C SD  1 
ATOM   4488  C CE  . MET C  3  174 ? 34.255  -75.175 27.550  1.00 0.00 ? 174 MET C CE  1 
ATOM   4489  N N   . LEU C  3  175 ? 29.229  -71.303 28.321  1.00 0.00 ? 175 LEU C N   1 
ATOM   4490  C CA  . LEU C  3  175 ? 29.382  -70.039 29.003  1.00 0.00 ? 175 LEU C CA  1 
ATOM   4491  C C   . LEU C  3  175 ? 28.462  -69.906 30.170  1.00 0.00 ? 175 LEU C C   1 
ATOM   4492  O O   . LEU C  3  175 ? 28.601  -68.948 30.913  1.00 0.00 ? 175 LEU C O   1 
ATOM   4493  C CB  . LEU C  3  175 ? 29.084  -68.810 28.100  1.00 0.00 ? 175 LEU C CB  1 
ATOM   4494  C CG  . LEU C  3  175 ? 30.136  -68.496 27.019  1.00 0.00 ? 175 LEU C CG  1 
ATOM   4495  C CD1 . LEU C  3  175 ? 29.554  -67.532 25.970  1.00 0.00 ? 175 LEU C CD1 1 
ATOM   4496  C CD2 . LEU C  3  175 ? 31.450  -67.944 27.605  1.00 0.00 ? 175 LEU C CD2 1 
ATOM   4497  N N   . LYS C  3  176 ? 27.473  -70.796 30.361  1.00 0.00 ? 176 LYS C N   1 
ATOM   4498  C CA  . LYS C  3  176 ? 26.526  -70.702 31.462  1.00 0.00 ? 176 LYS C CA  1 
ATOM   4499  C C   . LYS C  3  176 ? 27.186  -70.797 32.827  1.00 0.00 ? 176 LYS C C   1 
ATOM   4500  O O   . LYS C  3  176 ? 26.839  -70.096 33.782  1.00 0.00 ? 176 LYS C O   1 
ATOM   4501  C CB  . LYS C  3  176 ? 25.452  -71.804 31.338  1.00 0.00 ? 176 LYS C CB  1 
ATOM   4502  C CG  . LYS C  3  176 ? 24.318  -71.714 32.360  1.00 0.00 ? 176 LYS C CG  1 
ATOM   4503  C CD  . LYS C  3  176 ? 23.368  -72.914 32.291  1.00 0.00 ? 176 LYS C CD  1 
ATOM   4504  C CE  . LYS C  3  176 ? 22.414  -72.902 31.097  1.00 0.00 ? 176 LYS C CE  1 
ATOM   4505  N NZ  . LYS C  3  176 ? 21.440  -71.800 31.218  1.00 0.00 ? 176 LYS C NZ  1 
ATOM   4506  N N   . GLN C  3  177 ? 28.153  -71.722 32.912  1.00 0.00 ? 177 GLN C N   1 
ATOM   4507  C CA  . GLN C  3  177 ? 28.913  -72.013 34.086  1.00 0.00 ? 177 GLN C CA  1 
ATOM   4508  C C   . GLN C  3  177 ? 30.288  -71.420 33.959  1.00 0.00 ? 177 GLN C C   1 
ATOM   4509  O O   . GLN C  3  177 ? 30.975  -71.296 34.970  1.00 0.00 ? 177 GLN C O   1 
ATOM   4510  C CB  . GLN C  3  177 ? 29.072  -73.545 34.212  1.00 0.00 ? 177 GLN C CB  1 
ATOM   4511  C CG  . GLN C  3  177 ? 29.269  -74.206 32.825  1.00 0.00 ? 177 GLN C CG  1 
ATOM   4512  C CD  . GLN C  3  177 ? 29.943  -75.572 32.908  1.00 0.00 ? 177 GLN C CD  1 
ATOM   4513  O OE1 . GLN C  3  177 ? 30.182  -76.105 33.995  1.00 0.00 ? 177 GLN C OE1 1 
ATOM   4514  N NE2 . GLN C  3  177 ? 30.273  -76.123 31.700  1.00 0.00 ? 177 GLN C NE2 1 
ATOM   4515  N N   . ASP C  3  178 ? 30.747  -71.093 32.718  1.00 0.00 ? 178 ASP C N   1 
ATOM   4516  C CA  . ASP C  3  178 ? 32.104  -70.634 32.493  1.00 0.00 ? 178 ASP C CA  1 
ATOM   4517  C C   . ASP C  3  178 ? 32.155  -69.154 32.408  1.00 0.00 ? 178 ASP C C   1 
ATOM   4518  O O   . ASP C  3  178 ? 33.241  -68.590 32.380  1.00 0.00 ? 178 ASP C O   1 
ATOM   4519  C CB  . ASP C  3  178 ? 32.751  -71.185 31.202  1.00 0.00 ? 178 ASP C CB  1 
ATOM   4520  C CG  . ASP C  3  178 ? 32.889  -72.707 31.260  1.00 0.00 ? 178 ASP C CG  1 
ATOM   4521  O OD1 . ASP C  3  178 ? 32.586  -73.320 32.313  1.00 0.00 ? 178 ASP C OD1 1 
ATOM   4522  O OD2 . ASP C  3  178 ? 33.317  -73.283 30.230  1.00 0.00 ? 178 ASP C OD2 1 
ATOM   4523  N N   . TYR C  3  179 ? 30.995  -68.489 32.536  1.00 0.00 ? 179 TYR C N   1 
ATOM   4524  C CA  . TYR C  3  179 ? 30.932  -67.065 32.653  1.00 0.00 ? 179 TYR C CA  1 
ATOM   4525  C C   . TYR C  3  179 ? 30.329  -66.949 34.028  1.00 0.00 ? 179 TYR C C   1 
ATOM   4526  O O   . TYR C  3  179 ? 29.138  -67.164 34.247  1.00 0.00 ? 179 TYR C O   1 
ATOM   4527  C CB  . TYR C  3  179 ? 30.063  -66.365 31.552  1.00 0.00 ? 179 TYR C CB  1 
ATOM   4528  C CG  . TYR C  3  179 ? 29.968  -64.866 31.703  1.00 0.00 ? 179 TYR C CG  1 
ATOM   4529  C CD1 . TYR C  3  179 ? 28.989  -64.306 32.548  1.00 0.00 ? 179 TYR C CD1 1 
ATOM   4530  C CD2 . TYR C  3  179 ? 30.833  -64.010 31.022  1.00 0.00 ? 179 TYR C CD2 1 
ATOM   4531  C CE1 . TYR C  3  179 ? 28.874  -62.926 32.707  1.00 0.00 ? 179 TYR C CE1 1 
ATOM   4532  C CE2 . TYR C  3  179 ? 30.702  -62.625 31.163  1.00 0.00 ? 179 TYR C CE2 1 
ATOM   4533  C CZ  . TYR C  3  179 ? 29.714  -62.081 31.986  1.00 0.00 ? 179 TYR C CZ  1 
ATOM   4534  O OH  . TYR C  3  179 ? 29.522  -60.688 32.064  1.00 0.00 ? 179 TYR C OH  1 
ATOM   4535  N N   . LYS C  3  180 ? 31.188  -66.559 34.990  1.00 0.00 ? 180 LYS C N   1 
ATOM   4536  C CA  . LYS C  3  180 ? 30.838  -66.254 36.339  1.00 0.00 ? 180 LYS C CA  1 
ATOM   4537  C C   . LYS C  3  180 ? 30.239  -64.892 36.246  1.00 0.00 ? 180 LYS C C   1 
ATOM   4538  O O   . LYS C  3  180 ? 30.521  -64.164 35.298  1.00 0.00 ? 180 LYS C O   1 
ATOM   4539  C CB  . LYS C  3  180 ? 32.086  -66.265 37.239  1.00 0.00 ? 180 LYS C CB  1 
ATOM   4540  C CG  . LYS C  3  180 ? 31.820  -66.061 38.731  1.00 0.00 ? 180 LYS C CG  1 
ATOM   4541  C CD  . LYS C  3  180 ? 33.028  -66.454 39.591  1.00 0.00 ? 180 LYS C CD  1 
ATOM   4542  C CE  . LYS C  3  180 ? 32.773  -66.342 41.097  1.00 0.00 ? 180 LYS C CE  1 
ATOM   4543  N NZ  . LYS C  3  180 ? 33.996  -66.689 41.858  1.00 0.00 ? 180 LYS C NZ  1 
ATOM   4544  N N   . GLU C  3  181 ? 29.324  -64.522 37.165  1.00 0.00 ? 181 GLU C N   1 
ATOM   4545  C CA  . GLU C  3  181 ? 28.621  -63.270 37.054  1.00 0.00 ? 181 GLU C CA  1 
ATOM   4546  C C   . GLU C  3  181 ? 29.458  -62.185 37.662  1.00 0.00 ? 181 GLU C C   1 
ATOM   4547  O O   . GLU C  3  181 ? 30.177  -62.436 38.627  1.00 0.00 ? 181 GLU C O   1 
ATOM   4548  C CB  . GLU C  3  181 ? 27.238  -63.344 37.737  1.00 0.00 ? 181 GLU C CB  1 
ATOM   4549  C CG  . GLU C  3  181 ? 26.292  -62.183 37.370  1.00 0.00 ? 181 GLU C CG  1 
ATOM   4550  C CD  . GLU C  3  181 ? 24.879  -62.395 37.924  1.00 0.00 ? 181 GLU C CD  1 
ATOM   4551  O OE1 . GLU C  3  181 ? 24.646  -63.410 38.633  1.00 0.00 ? 181 GLU C OE1 1 
ATOM   4552  O OE2 . GLU C  3  181 ? 24.006  -61.532 37.635  1.00 0.00 ? 181 GLU C OE2 1 
ATOM   4553  N N   . GLY C  3  182 ? 29.354  -60.956 37.089  1.00 0.00 ? 182 GLY C N   1 
ATOM   4554  C CA  . GLY C  3  182 ? 29.815  -59.694 37.624  1.00 0.00 ? 182 GLY C CA  1 
ATOM   4555  C C   . GLY C  3  182 ? 31.187  -59.684 38.232  1.00 0.00 ? 182 GLY C C   1 
ATOM   4556  O O   . GLY C  3  182 ? 31.336  -59.286 39.387  1.00 0.00 ? 182 GLY C O   1 
ATOM   4557  N N   . GLU C  3  183 ? 32.143  -60.291 37.537  1.00 0.00 ? 183 GLU C N   1 
ATOM   4558  C CA  . GLU C  3  183 ? 33.525  -60.306 37.991  1.00 0.00 ? 183 GLU C CA  1 
ATOM   4559  C C   . GLU C  3  183 ? 34.538  -59.888 36.928  1.00 0.00 ? 183 GLU C C   1 
ATOM   4560  O O   . GLU C  3  183 ? 35.729  -59.787 37.220  1.00 0.00 ? 183 GLU C O   1 
ATOM   4561  C CB  . GLU C  3  183 ? 33.889  -61.690 38.536  1.00 0.00 ? 183 GLU C CB  1 
ATOM   4562  C CG  . GLU C  3  183 ? 35.344  -61.832 38.951  1.00 0.00 ? 183 GLU C CG  1 
ATOM   4563  C CD  . GLU C  3  183 ? 35.807  -63.276 38.968  1.00 0.00 ? 183 GLU C CD  1 
ATOM   4564  O OE1 . GLU C  3  183 ? 35.660  -63.961 37.934  1.00 0.00 ? 183 GLU C OE1 1 
ATOM   4565  O OE2 . GLU C  3  183 ? 36.318  -63.725 40.016  1.00 0.00 ? 183 GLU C OE2 1 
ATOM   4566  N N   . MET C  3  184 ? 34.088  -59.674 35.693  1.00 0.00 ? 184 MET C N   1 
ATOM   4567  C CA  . MET C  3  184 ? 35.029  -59.616 34.608  1.00 0.00 ? 184 MET C CA  1 
ATOM   4568  C C   . MET C  3  184 ? 35.645  -58.272 34.417  1.00 0.00 ? 184 MET C C   1 
ATOM   4569  O O   . MET C  3  184 ? 35.000  -57.294 34.068  1.00 0.00 ? 184 MET C O   1 
ATOM   4570  C CB  . MET C  3  184 ? 34.405  -60.100 33.277  1.00 0.00 ? 184 MET C CB  1 
ATOM   4571  C CG  . MET C  3  184 ? 33.666  -61.442 33.430  1.00 0.00 ? 184 MET C CG  1 
ATOM   4572  S SD  . MET C  3  184 ? 34.626  -62.726 34.285  1.00 0.00 ? 184 MET C SD  1 
ATOM   4573  C CE  . MET C  3  184 ? 33.482  -64.117 34.194  1.00 0.00 ? 184 MET C CE  1 
ATOM   4574  N N   . THR C  3  185 ? 36.982  -58.261 34.533  1.00 0.00 ? 185 THR C N   1 
ATOM   4575  C CA  . THR C  3  185 ? 37.839  -57.255 33.974  1.00 0.00 ? 185 THR C CA  1 
ATOM   4576  C C   . THR C  3  185 ? 37.938  -57.675 32.523  1.00 0.00 ? 185 THR C C   1 
ATOM   4577  O O   . THR C  3  185 ? 37.620  -58.816 32.207  1.00 0.00 ? 185 THR C O   1 
ATOM   4578  C CB  . THR C  3  185 ? 39.182  -57.238 34.688  1.00 0.00 ? 185 THR C CB  1 
ATOM   4579  O OG1 . THR C  3  185 ? 40.058  -56.248 34.173  1.00 0.00 ? 185 THR C OG1 1 
ATOM   4580  C CG2 . THR C  3  185 ? 39.860  -58.618 34.617  1.00 0.00 ? 185 THR C CG2 1 
ATOM   4581  N N   . LEU C  3  186 ? 38.302  -56.788 31.570  1.00 0.00 ? 186 LEU C N   1 
ATOM   4582  C CA  . LEU C  3  186 ? 38.259  -57.112 30.164  1.00 0.00 ? 186 LEU C CA  1 
ATOM   4583  C C   . LEU C  3  186 ? 39.147  -58.277 29.809  1.00 0.00 ? 186 LEU C C   1 
ATOM   4584  O O   . LEU C  3  186 ? 38.946  -58.982 28.822  1.00 0.00 ? 186 LEU C O   1 
ATOM   4585  C CB  . LEU C  3  186 ? 38.525  -55.906 29.242  1.00 0.00 ? 186 LEU C CB  1 
ATOM   4586  C CG  . LEU C  3  186 ? 38.274  -56.255 27.744  1.00 0.00 ? 186 LEU C CG  1 
ATOM   4587  C CD1 . LEU C  3  186 ? 37.740  -55.048 26.955  1.00 0.00 ? 186 LEU C CD1 1 
ATOM   4588  C CD2 . LEU C  3  186 ? 39.478  -56.921 27.049  1.00 0.00 ? 186 LEU C CD2 1 
ATOM   4589  N N   . LYS C  3  187 ? 40.196  -58.488 30.625  1.00 0.00 ? 187 LYS C N   1 
ATOM   4590  C CA  . LYS C  3  187 ? 41.163  -59.545 30.505  1.00 0.00 ? 187 LYS C CA  1 
ATOM   4591  C C   . LYS C  3  187 ? 40.450  -60.872 30.594  1.00 0.00 ? 187 LYS C C   1 
ATOM   4592  O O   . LYS C  3  187 ? 40.690  -61.733 29.751  1.00 0.00 ? 187 LYS C O   1 
ATOM   4593  C CB  . LYS C  3  187 ? 42.290  -59.387 31.560  1.00 0.00 ? 187 LYS C CB  1 
ATOM   4594  C CG  . LYS C  3  187 ? 43.350  -60.498 31.611  1.00 0.00 ? 187 LYS C CG  1 
ATOM   4595  C CD  . LYS C  3  187 ? 44.040  -60.825 30.274  1.00 0.00 ? 187 LYS C CD  1 
ATOM   4596  C CE  . LYS C  3  187 ? 44.861  -62.123 30.340  1.00 0.00 ? 187 LYS C CE  1 
ATOM   4597  N NZ  . LYS C  3  187 ? 44.879  -62.807 29.030  1.00 0.00 ? 187 LYS C NZ  1 
ATOM   4598  N N   . SER C  3  188 ? 39.530  -61.056 31.568  1.00 0.00 ? 188 SER C N   1 
ATOM   4599  C CA  . SER C  3  188 ? 38.721  -62.261 31.693  1.00 0.00 ? 188 SER C CA  1 
ATOM   4600  C C   . SER C  3  188 ? 37.777  -62.466 30.506  1.00 0.00 ? 188 SER C C   1 
ATOM   4601  O O   . SER C  3  188 ? 37.452  -63.603 30.157  1.00 0.00 ? 188 SER C O   1 
ATOM   4602  C CB  . SER C  3  188 ? 37.807  -62.222 32.948  1.00 0.00 ? 188 SER C CB  1 
ATOM   4603  O OG  . SER C  3  188 ? 38.536  -62.029 34.150  1.00 0.00 ? 188 SER C OG  1 
ATOM   4604  N N   . ALA C  3  189 ? 37.322  -61.363 29.851  1.00 0.00 ? 189 ALA C N   1 
ATOM   4605  C CA  . ALA C  3  189 ? 36.502  -61.421 28.656  1.00 0.00 ? 189 ALA C CA  1 
ATOM   4606  C C   . ALA C  3  189 ? 37.254  -61.979 27.476  1.00 0.00 ? 189 ALA C C   1 
ATOM   4607  O O   . ALA C  3  189 ? 36.731  -62.766 26.696  1.00 0.00 ? 189 ALA C O   1 
ATOM   4608  C CB  . ALA C  3  189 ? 35.954  -60.035 28.236  1.00 0.00 ? 189 ALA C CB  1 
ATOM   4609  N N   . LEU C  3  190 ? 38.524  -61.586 27.303  1.00 0.00 ? 190 LEU C N   1 
ATOM   4610  C CA  . LEU C  3  190 ? 39.341  -62.146 26.263  1.00 0.00 ? 190 LEU C CA  1 
ATOM   4611  C C   . LEU C  3  190 ? 39.639  -63.599 26.465  1.00 0.00 ? 190 LEU C C   1 
ATOM   4612  O O   . LEU C  3  190 ? 39.684  -64.371 25.514  1.00 0.00 ? 190 LEU C O   1 
ATOM   4613  C CB  . LEU C  3  190 ? 40.621  -61.317 26.087  1.00 0.00 ? 190 LEU C CB  1 
ATOM   4614  C CG  . LEU C  3  190 ? 40.328  -59.997 25.329  1.00 0.00 ? 190 LEU C CG  1 
ATOM   4615  C CD1 . LEU C  3  190 ? 41.407  -58.935 25.592  1.00 0.00 ? 190 LEU C CD1 1 
ATOM   4616  C CD2 . LEU C  3  190 ? 40.132  -60.226 23.825  1.00 0.00 ? 190 LEU C CD2 1 
ATOM   4617  N N   . ALA C  3  191 ? 39.820  -64.022 27.729  1.00 0.00 ? 191 ALA C N   1 
ATOM   4618  C CA  . ALA C  3  191 ? 40.175  -65.382 28.048  1.00 0.00 ? 191 ALA C CA  1 
ATOM   4619  C C   . ALA C  3  191 ? 39.057  -66.328 27.746  1.00 0.00 ? 191 ALA C C   1 
ATOM   4620  O O   . ALA C  3  191 ? 39.277  -67.334 27.079  1.00 0.00 ? 191 ALA C O   1 
ATOM   4621  C CB  . ALA C  3  191 ? 40.544  -65.544 29.531  1.00 0.00 ? 191 ALA C CB  1 
ATOM   4622  N N   . LEU C  3  192 ? 37.823  -65.996 28.214  1.00 0.00 ? 192 LEU C N   1 
ATOM   4623  C CA  . LEU C  3  192 ? 36.621  -66.767 27.969  1.00 0.00 ? 192 LEU C CA  1 
ATOM   4624  C C   . LEU C  3  192 ? 36.211  -66.747 26.544  1.00 0.00 ? 192 LEU C C   1 
ATOM   4625  O O   . LEU C  3  192 ? 35.637  -67.719 26.066  1.00 0.00 ? 192 LEU C O   1 
ATOM   4626  C CB  . LEU C  3  192 ? 35.396  -66.297 28.788  1.00 0.00 ? 192 LEU C CB  1 
ATOM   4627  C CG  . LEU C  3  192 ? 35.559  -66.438 30.325  1.00 0.00 ? 192 LEU C CG  1 
ATOM   4628  C CD1 . LEU C  3  192 ? 34.353  -65.835 31.079  1.00 0.00 ? 192 LEU C CD1 1 
ATOM   4629  C CD2 . LEU C  3  192 ? 35.808  -67.894 30.759  1.00 0.00 ? 192 LEU C CD2 1 
ATOM   4630  N N   . ALA C  3  193 ? 36.472  -65.647 25.811  1.00 0.00 ? 193 ALA C N   1 
ATOM   4631  C CA  . ALA C  3  193 ? 36.087  -65.566 24.425  1.00 0.00 ? 193 ALA C CA  1 
ATOM   4632  C C   . ALA C  3  193 ? 36.830  -66.569 23.659  1.00 0.00 ? 193 ALA C C   1 
ATOM   4633  O O   . ALA C  3  193 ? 36.214  -67.380 22.985  1.00 0.00 ? 193 ALA C O   1 
ATOM   4634  C CB  . ALA C  3  193 ? 36.387  -64.213 23.771  1.00 0.00 ? 193 ALA C CB  1 
ATOM   4635  N N   . ILE C  3  194 ? 38.171  -66.534 23.815  1.00 0.00 ? 194 ILE C N   1 
ATOM   4636  C CA  . ILE C  3  194 ? 39.120  -67.390 23.150  1.00 0.00 ? 194 ILE C CA  1 
ATOM   4637  C C   . ILE C  3  194 ? 38.910  -68.822 23.528  1.00 0.00 ? 194 ILE C C   1 
ATOM   4638  O O   . ILE C  3  194 ? 38.984  -69.687 22.661  1.00 0.00 ? 194 ILE C O   1 
ATOM   4639  C CB  . ILE C  3  194 ? 40.540  -66.901 23.409  1.00 0.00 ? 194 ILE C CB  1 
ATOM   4640  C CG1 . ILE C  3  194 ? 40.768  -65.516 22.753  1.00 0.00 ? 194 ILE C CG1 1 
ATOM   4641  C CG2 . ILE C  3  194 ? 41.595  -67.905 22.905  1.00 0.00 ? 194 ILE C CG2 1 
ATOM   4642  C CD1 . ILE C  3  194 ? 40.683  -65.492 21.225  1.00 0.00 ? 194 ILE C CD1 1 
ATOM   4643  N N   . LYS C  3  195 ? 38.489  -69.103 24.778  1.00 0.00 ? 195 LYS C N   1 
ATOM   4644  C CA  . LYS C  3  195 ? 38.135  -70.443 25.168  1.00 0.00 ? 195 LYS C CA  1 
ATOM   4645  C C   . LYS C  3  195 ? 37.008  -70.958 24.328  1.00 0.00 ? 195 LYS C C   1 
ATOM   4646  O O   . LYS C  3  195 ? 37.189  -71.960 23.654  1.00 0.00 ? 195 LYS C O   1 
ATOM   4647  C CB  . LYS C  3  195 ? 37.657  -70.502 26.646  1.00 0.00 ? 195 LYS C CB  1 
ATOM   4648  C CG  . LYS C  3  195 ? 36.911  -71.762 27.117  1.00 0.00 ? 195 LYS C CG  1 
ATOM   4649  C CD  . LYS C  3  195 ? 36.231  -71.581 28.479  1.00 0.00 ? 195 LYS C CD  1 
ATOM   4650  C CE  . LYS C  3  195 ? 37.208  -71.384 29.647  1.00 0.00 ? 195 LYS C CE  1 
ATOM   4651  N NZ  . LYS C  3  195 ? 36.521  -71.542 30.953  1.00 0.00 ? 195 LYS C NZ  1 
ATOM   4652  N N   . VAL C  3  196 ? 35.812  -70.329 24.383  1.00 0.00 ? 196 VAL C N   1 
ATOM   4653  C CA  . VAL C  3  196 ? 34.629  -70.884 23.766  1.00 0.00 ? 196 VAL C CA  1 
ATOM   4654  C C   . VAL C  3  196 ? 34.689  -70.983 22.284  1.00 0.00 ? 196 VAL C C   1 
ATOM   4655  O O   . VAL C  3  196 ? 34.237  -71.982 21.728  1.00 0.00 ? 196 VAL C O   1 
ATOM   4656  C CB  . VAL C  3  196 ? 33.392  -70.141 24.187  1.00 0.00 ? 196 VAL C CB  1 
ATOM   4657  C CG1 . VAL C  3  196 ? 32.126  -70.660 23.477  1.00 0.00 ? 196 VAL C CG1 1 
ATOM   4658  C CG2 . VAL C  3  196 ? 33.288  -70.378 25.708  1.00 0.00 ? 196 VAL C CG2 1 
ATOM   4659  N N   . LEU C  3  197 ? 35.319  -70.007 21.599  1.00 0.00 ? 197 LEU C N   1 
ATOM   4660  C CA  . LEU C  3  197 ? 35.463  -70.060 20.172  1.00 0.00 ? 197 LEU C CA  1 
ATOM   4661  C C   . LEU C  3  197 ? 36.420  -71.158 19.781  1.00 0.00 ? 197 LEU C C   1 
ATOM   4662  O O   . LEU C  3  197 ? 36.332  -71.674 18.673  1.00 0.00 ? 197 LEU C O   1 
ATOM   4663  C CB  . LEU C  3  197 ? 35.754  -68.693 19.533  1.00 0.00 ? 197 LEU C CB  1 
ATOM   4664  C CG  . LEU C  3  197 ? 36.943  -67.908 20.096  1.00 0.00 ? 197 LEU C CG  1 
ATOM   4665  C CD1 . LEU C  3  197 ? 38.304  -68.317 19.546  1.00 0.00 ? 197 LEU C CD1 1 
ATOM   4666  C CD2 . LEU C  3  197 ? 36.717  -66.411 19.918  1.00 0.00 ? 197 LEU C CD2 1 
ATOM   4667  N N   . ASN C  3  198 ? 37.375  -71.427 20.665  1.00 0.00 ? 198 ASN C N   1 
ATOM   4668  C CA  . ASN C  3  198 ? 38.288  -72.549 20.535  1.00 0.00 ? 198 ASN C CA  1 
ATOM   4669  C C   . ASN C  3  198 ? 37.584  -73.896 20.639  1.00 0.00 ? 198 ASN C C   1 
ATOM   4670  O O   . ASN C  3  198 ? 37.910  -74.831 19.907  1.00 0.00 ? 198 ASN C O   1 
ATOM   4671  C CB  . ASN C  3  198 ? 39.400  -72.456 21.583  1.00 0.00 ? 198 ASN C CB  1 
ATOM   4672  C CG  . ASN C  3  198 ? 40.519  -71.523 21.166  1.00 0.00 ? 198 ASN C CG  1 
ATOM   4673  O OD1 . ASN C  3  198 ? 41.330  -71.100 21.989  1.00 0.00 ? 198 ASN C OD1 1 
ATOM   4674  N ND2 . ASN C  3  198 ? 40.567  -71.195 19.880  1.00 0.00 ? 198 ASN C ND2 1 
ATOM   4675  N N   . LYS C  3  199 ? 36.626  -73.998 21.558  1.00 0.00 ? 199 LYS C N   1 
ATOM   4676  C CA  . LYS C  3  199 ? 36.010  -75.278 21.829  1.00 0.00 ? 199 LYS C CA  1 
ATOM   4677  C C   . LYS C  3  199 ? 34.958  -75.628 20.801  1.00 0.00 ? 199 LYS C C   1 
ATOM   4678  O O   . LYS C  3  199 ? 34.770  -76.810 20.526  1.00 0.00 ? 199 LYS C O   1 
ATOM   4679  C CB  . LYS C  3  199 ? 35.330  -75.325 23.212  1.00 0.00 ? 199 LYS C CB  1 
ATOM   4680  C CG  . LYS C  3  199 ? 36.248  -74.976 24.398  1.00 0.00 ? 199 LYS C CG  1 
ATOM   4681  C CD  . LYS C  3  199 ? 37.576  -75.734 24.514  1.00 0.00 ? 199 LYS C CD  1 
ATOM   4682  C CE  . LYS C  3  199 ? 38.541  -75.105 25.536  1.00 0.00 ? 199 LYS C CE  1 
ATOM   4683  N NZ  . LYS C  3  199 ? 39.178  -73.873 25.012  1.00 0.00 ? 199 LYS C NZ  1 
ATOM   4684  N N   . THR C  3  200 ? 34.258  -74.617 20.218  1.00 0.00 ? 200 THR C N   1 
ATOM   4685  C CA  . THR C  3  200 ? 33.190  -74.771 19.243  1.00 0.00 ? 200 THR C CA  1 
ATOM   4686  C C   . THR C  3  200 ? 33.627  -75.297 17.907  1.00 0.00 ? 200 THR C C   1 
ATOM   4687  O O   . THR C  3  200 ? 32.850  -75.965 17.231  1.00 0.00 ? 200 THR C O   1 
ATOM   4688  C CB  . THR C  3  200 ? 32.395  -73.479 19.028  1.00 0.00 ? 200 THR C CB  1 
ATOM   4689  O OG1 . THR C  3  200 ? 31.343  -73.606 18.071  1.00 0.00 ? 200 THR C OG1 1 
ATOM   4690  C CG2 . THR C  3  200 ? 33.320  -72.342 18.593  1.00 0.00 ? 200 THR C CG2 1 
ATOM   4691  N N   . MET C  3  201 ? 34.858  -75.017 17.462  1.00 0.00 ? 201 MET C N   1 
ATOM   4692  C CA  . MET C  3  201 ? 35.272  -75.485 16.172  1.00 0.00 ? 201 MET C CA  1 
ATOM   4693  C C   . MET C  3  201 ? 35.942  -76.771 16.421  1.00 0.00 ? 201 MET C C   1 
ATOM   4694  O O   . MET C  3  201 ? 36.424  -77.011 17.525  1.00 0.00 ? 201 MET C O   1 
ATOM   4695  C CB  . MET C  3  201 ? 36.287  -74.573 15.455  1.00 0.00 ? 201 MET C CB  1 
ATOM   4696  C CG  . MET C  3  201 ? 35.847  -73.108 15.325  1.00 0.00 ? 201 MET C CG  1 
ATOM   4697  S SD  . MET C  3  201 ? 34.282  -72.858 14.477  1.00 0.00 ? 201 MET C SD  1 
ATOM   4698  C CE  . MET C  3  201 ? 34.314  -71.089 14.839  1.00 0.00 ? 201 MET C CE  1 
ATOM   4699  N N   . ASP C  3  202 ? 36.029  -77.611 15.369  1.00 0.00 ? 202 ASP C N   1 
ATOM   4700  C CA  . ASP C  3  202 ? 36.704  -78.888 15.424  1.00 0.00 ? 202 ASP C CA  1 
ATOM   4701  C C   . ASP C  3  202 ? 38.202  -78.673 15.373  1.00 0.00 ? 202 ASP C C   1 
ATOM   4702  O O   . ASP C  3  202 ? 38.972  -79.499 15.849  1.00 0.00 ? 202 ASP C O   1 
ATOM   4703  C CB  . ASP C  3  202 ? 36.245  -79.810 14.269  1.00 0.00 ? 202 ASP C CB  1 
ATOM   4704  C CG  . ASP C  3  202 ? 36.454  -81.293 14.577  1.00 0.00 ? 202 ASP C CG  1 
ATOM   4705  O OD1 . ASP C  3  202 ? 36.954  -81.628 15.680  1.00 0.00 ? 202 ASP C OD1 1 
ATOM   4706  O OD2 . ASP C  3  202 ? 36.093  -82.121 13.699  1.00 0.00 ? 202 ASP C OD2 1 
ATOM   4707  N N   . VAL C  3  203 ? 38.636  -77.460 14.946  1.00 0.00 ? 203 VAL C N   1 
ATOM   4708  C CA  . VAL C  3  203 ? 40.010  -77.028 15.019  1.00 0.00 ? 203 VAL C CA  1 
ATOM   4709  C C   . VAL C  3  203 ? 40.193  -76.668 16.498  1.00 0.00 ? 203 VAL C C   1 
ATOM   4710  O O   . VAL C  3  203 ? 39.371  -75.959 17.088  1.00 0.00 ? 203 VAL C O   1 
ATOM   4711  C CB  . VAL C  3  203 ? 40.344  -75.835 14.105  1.00 0.00 ? 203 VAL C CB  1 
ATOM   4712  C CG1 . VAL C  3  203 ? 41.836  -75.900 13.712  1.00 0.00 ? 203 VAL C CG1 1 
ATOM   4713  C CG2 . VAL C  3  203 ? 39.427  -75.818 12.863  1.00 0.00 ? 203 VAL C CG2 1 
ATOM   4714  N N   . SER C  3  204 ? 41.221  -77.274 17.149  1.00 0.00 ? 204 SER C N   1 
ATOM   4715  C CA  . SER C  3  204 ? 41.501  -77.174 18.567  1.00 0.00 ? 204 SER C CA  1 
ATOM   4716  C C   . SER C  3  204 ? 41.750  -75.773 19.038  1.00 0.00 ? 204 SER C C   1 
ATOM   4717  O O   . SER C  3  204 ? 41.280  -75.390 20.103  1.00 0.00 ? 204 SER C O   1 
ATOM   4718  C CB  . SER C  3  204 ? 42.698  -78.067 18.981  1.00 0.00 ? 204 SER C CB  1 
ATOM   4719  O OG  . SER C  3  204 ? 43.863  -77.825 18.202  1.00 0.00 ? 204 SER C OG  1 
ATOM   4720  N N   . LYS C  3  205 ? 42.448  -74.981 18.208  1.00 0.00 ? 205 LYS C N   1 
ATOM   4721  C CA  . LYS C  3  205 ? 42.808  -73.610 18.428  1.00 0.00 ? 205 LYS C CA  1 
ATOM   4722  C C   . LYS C  3  205 ? 42.325  -73.000 17.149  1.00 0.00 ? 205 LYS C C   1 
ATOM   4723  O O   . LYS C  3  205 ? 41.914  -73.729 16.254  1.00 0.00 ? 205 LYS C O   1 
ATOM   4724  C CB  . LYS C  3  205 ? 44.327  -73.356 18.511  1.00 0.00 ? 205 LYS C CB  1 
ATOM   4725  C CG  . LYS C  3  205 ? 45.118  -74.428 19.262  1.00 0.00 ? 205 LYS C CG  1 
ATOM   4726  C CD  . LYS C  3  205 ? 46.632  -74.230 19.139  1.00 0.00 ? 205 LYS C CD  1 
ATOM   4727  C CE  . LYS C  3  205 ? 47.173  -74.311 17.703  1.00 0.00 ? 205 LYS C CE  1 
ATOM   4728  N NZ  . LYS C  3  205 ? 48.643  -74.201 17.684  1.00 0.00 ? 205 LYS C NZ  1 
ATOM   4729  N N   . LEU C  3  206 ? 42.308  -71.663 17.015  1.00 0.00 ? 206 LEU C N   1 
ATOM   4730  C CA  . LEU C  3  206 ? 41.805  -71.042 15.815  1.00 0.00 ? 206 LEU C CA  1 
ATOM   4731  C C   . LEU C  3  206 ? 42.874  -70.140 15.273  1.00 0.00 ? 206 LEU C C   1 
ATOM   4732  O O   . LEU C  3  206 ? 43.706  -69.629 16.014  1.00 0.00 ? 206 LEU C O   1 
ATOM   4733  C CB  . LEU C  3  206 ? 40.500  -70.256 16.092  1.00 0.00 ? 206 LEU C CB  1 
ATOM   4734  C CG  . LEU C  3  206 ? 39.176  -71.077 15.985  1.00 0.00 ? 206 LEU C CG  1 
ATOM   4735  C CD1 . LEU C  3  206 ? 39.129  -72.469 16.648  1.00 0.00 ? 206 LEU C CD1 1 
ATOM   4736  C CD2 . LEU C  3  206 ? 37.988  -70.236 16.457  1.00 0.00 ? 206 LEU C CD2 1 
ATOM   4737  N N   . SER C  3  207 ? 42.888  -69.975 13.925  1.00 0.00 ? 207 SER C N   1 
ATOM   4738  C CA  . SER C  3  207 ? 43.863  -69.225 13.156  1.00 0.00 ? 207 SER C CA  1 
ATOM   4739  C C   . SER C  3  207 ? 43.379  -67.814 13.083  1.00 0.00 ? 207 SER C C   1 
ATOM   4740  O O   . SER C  3  207 ? 42.278  -67.523 13.532  1.00 0.00 ? 207 SER C O   1 
ATOM   4741  C CB  . SER C  3  207 ? 44.053  -69.799 11.722  1.00 0.00 ? 207 SER C CB  1 
ATOM   4742  O OG  . SER C  3  207 ? 45.180  -69.256 11.042  1.00 0.00 ? 207 SER C OG  1 
ATOM   4743  N N   . ALA C  3  208 ? 44.222  -66.883 12.580  1.00 0.00 ? 208 ALA C N   1 
ATOM   4744  C CA  . ALA C  3  208 ? 43.937  -65.466 12.573  1.00 0.00 ? 208 ALA C CA  1 
ATOM   4745  C C   . ALA C  3  208 ? 42.982  -65.127 11.499  1.00 0.00 ? 208 ALA C C   1 
ATOM   4746  O O   . ALA C  3  208 ? 42.427  -64.032 11.509  1.00 0.00 ? 208 ALA C O   1 
ATOM   4747  C CB  . ALA C  3  208 ? 45.165  -64.575 12.332  1.00 0.00 ? 208 ALA C CB  1 
ATOM   4748  N N   . GLU C  3  209 ? 42.785  -66.059 10.548  1.00 0.00 ? 209 GLU C N   1 
ATOM   4749  C CA  . GLU C  3  209 ? 41.866  -65.908 9.458   1.00 0.00 ? 209 GLU C CA  1 
ATOM   4750  C C   . GLU C  3  209 ? 40.575  -66.550 9.865   1.00 0.00 ? 209 GLU C C   1 
ATOM   4751  O O   . GLU C  3  209 ? 39.701  -66.757 9.034   1.00 0.00 ? 209 GLU C O   1 
ATOM   4752  C CB  . GLU C  3  209 ? 42.393  -66.552 8.145   1.00 0.00 ? 209 GLU C CB  1 
ATOM   4753  C CG  . GLU C  3  209 ? 43.354  -65.662 7.322   1.00 0.00 ? 209 GLU C CG  1 
ATOM   4754  C CD  . GLU C  3  209 ? 44.687  -65.380 8.019   1.00 0.00 ? 209 GLU C CD  1 
ATOM   4755  O OE1 . GLU C  3  209 ? 45.482  -66.333 8.225   1.00 0.00 ? 209 GLU C OE1 1 
ATOM   4756  O OE2 . GLU C  3  209 ? 44.939  -64.190 8.335   1.00 0.00 ? 209 GLU C OE2 1 
ATOM   4757  N N   . LYS C  3  210 ? 40.453  -66.880 11.154  1.00 0.00 ? 210 LYS C N   1 
ATOM   4758  C CA  . LYS C  3  210 ? 39.205  -67.415 11.716  1.00 0.00 ? 210 LYS C CA  1 
ATOM   4759  C C   . LYS C  3  210 ? 38.491  -66.467 12.697  1.00 0.00 ? 210 LYS C C   1 
ATOM   4760  O O   . LYS C  3  210 ? 37.310  -66.167 12.526  1.00 0.00 ? 210 LYS C O   1 
ATOM   4761  C CB  . LYS C  3  210 ? 39.462  -68.765 12.391  1.00 0.00 ? 210 LYS C CB  1 
ATOM   4762  C CG  . LYS C  3  210 ? 40.274  -69.736 11.549  1.00 0.00 ? 210 LYS C CG  1 
ATOM   4763  C CD  . LYS C  3  210 ? 40.739  -70.927 12.371  1.00 0.00 ? 210 LYS C CD  1 
ATOM   4764  C CE  . LYS C  3  210 ? 40.996  -72.139 11.491  1.00 0.00 ? 210 LYS C CE  1 
ATOM   4765  N NZ  . LYS C  3  210 ? 41.385  -73.334 12.291  1.00 0.00 ? 210 LYS C NZ  1 
ATOM   4766  N N   . VAL C  3  211 ? 39.214  -65.992 13.712  1.00 0.00 ? 211 VAL C N   1 
ATOM   4767  C CA  . VAL C  3  211 ? 38.730  -64.987 14.598  1.00 0.00 ? 211 VAL C CA  1 
ATOM   4768  C C   . VAL C  3  211 ? 39.086  -63.589 14.187  1.00 0.00 ? 211 VAL C C   1 
ATOM   4769  O O   . VAL C  3  211 ? 40.071  -63.328 13.507  1.00 0.00 ? 211 VAL C O   1 
ATOM   4770  C CB  . VAL C  3  211 ? 39.194  -65.227 16.009  1.00 0.00 ? 211 VAL C CB  1 
ATOM   4771  C CG1 . VAL C  3  211 ? 38.600  -66.567 16.454  1.00 0.00 ? 211 VAL C CG1 1 
ATOM   4772  C CG2 . VAL C  3  211 ? 40.728  -65.240 16.106  1.00 0.00 ? 211 VAL C CG2 1 
ATOM   4773  N N   . GLU C  3  212 ? 38.198  -62.674 14.590  1.00 0.00 ? 212 GLU C N   1 
ATOM   4774  C CA  . GLU C  3  212 ? 38.371  -61.260 14.505  1.00 0.00 ? 212 GLU C CA  1 
ATOM   4775  C C   . GLU C  3  212 ? 37.469  -60.839 15.600  1.00 0.00 ? 212 GLU C C   1 
ATOM   4776  O O   . GLU C  3  212 ? 36.427  -61.449 15.819  1.00 0.00 ? 212 GLU C O   1 
ATOM   4777  C CB  . GLU C  3  212 ? 37.862  -60.655 13.177  1.00 0.00 ? 212 GLU C CB  1 
ATOM   4778  C CG  . GLU C  3  212 ? 36.471  -61.164 12.751  1.00 0.00 ? 212 GLU C CG  1 
ATOM   4779  C CD  . GLU C  3  212 ? 36.125  -60.758 11.328  1.00 0.00 ? 212 GLU C CD  1 
ATOM   4780  O OE1 . GLU C  3  212 ? 36.881  -59.962 10.716  1.00 0.00 ? 212 GLU C OE1 1 
ATOM   4781  O OE2 . GLU C  3  212 ? 35.085  -61.259 10.827  1.00 0.00 ? 212 GLU C OE2 1 
ATOM   4782  N N   . ILE C  3  213 ? 37.922  -59.845 16.379  1.00 0.00 ? 213 ILE C N   1 
ATOM   4783  C CA  . ILE C  3  213 ? 37.292  -59.521 17.613  1.00 0.00 ? 213 ILE C CA  1 
ATOM   4784  C C   . ILE C  3  213 ? 37.123  -58.062 17.610  1.00 0.00 ? 213 ILE C C   1 
ATOM   4785  O O   . ILE C  3  213 ? 38.117  -57.356 17.650  1.00 0.00 ? 213 ILE C O   1 
ATOM   4786  C CB  . ILE C  3  213 ? 38.122  -59.955 18.810  1.00 0.00 ? 213 ILE C CB  1 
ATOM   4787  C CG1 . ILE C  3  213 ? 38.427  -61.470 18.761  1.00 0.00 ? 213 ILE C CG1 1 
ATOM   4788  C CG2 . ILE C  3  213 ? 37.352  -59.604 20.099  1.00 0.00 ? 213 ILE C CG2 1 
ATOM   4789  C CD1 . ILE C  3  213 ? 39.309  -61.974 19.901  1.00 0.00 ? 213 ILE C CD1 1 
ATOM   4790  N N   . ALA C  3  214 ? 35.879  -57.548 17.593  1.00 0.00 ? 214 ALA C N   1 
ATOM   4791  C CA  . ALA C  3  214 ? 35.639  -56.143 17.769  1.00 0.00 ? 214 ALA C CA  1 
ATOM   4792  C C   . ALA C  3  214 ? 35.394  -55.919 19.208  1.00 0.00 ? 214 ALA C C   1 
ATOM   4793  O O   . ALA C  3  214 ? 34.326  -56.254 19.709  1.00 0.00 ? 214 ALA C O   1 
ATOM   4794  C CB  . ALA C  3  214 ? 34.435  -55.584 17.024  1.00 0.00 ? 214 ALA C CB  1 
ATOM   4795  N N   . THR C  3  215 ? 36.394  -55.354 19.921  1.00 0.00 ? 215 THR C N   1 
ATOM   4796  C CA  . THR C  3  215 ? 36.222  -54.937 21.288  1.00 0.00 ? 215 THR C CA  1 
ATOM   4797  C C   . THR C  3  215 ? 35.741  -53.520 21.305  1.00 0.00 ? 215 THR C C   1 
ATOM   4798  O O   . THR C  3  215 ? 36.234  -52.669 20.582  1.00 0.00 ? 215 THR C O   1 
ATOM   4799  C CB  . THR C  3  215 ? 37.467  -55.081 22.135  1.00 0.00 ? 215 THR C CB  1 
ATOM   4800  O OG1 . THR C  3  215 ? 38.542  -54.278 21.661  1.00 0.00 ? 215 THR C OG1 1 
ATOM   4801  C CG2 . THR C  3  215 ? 37.863  -56.573 22.125  1.00 0.00 ? 215 THR C CG2 1 
ATOM   4802  N N   . LEU C  3  216 ? 34.714  -53.292 22.133  1.00 0.00 ? 216 LEU C N   1 
ATOM   4803  C CA  . LEU C  3  216 ? 34.066  -52.046 22.379  1.00 0.00 ? 216 LEU C CA  1 
ATOM   4804  C C   . LEU C  3  216 ? 34.518  -51.640 23.741  1.00 0.00 ? 216 LEU C C   1 
ATOM   4805  O O   . LEU C  3  216 ? 34.327  -52.349 24.724  1.00 0.00 ? 216 LEU C O   1 
ATOM   4806  C CB  . LEU C  3  216 ? 32.530  -52.134 22.276  1.00 0.00 ? 216 LEU C CB  1 
ATOM   4807  C CG  . LEU C  3  216 ? 31.818  -50.815 22.611  1.00 0.00 ? 216 LEU C CG  1 
ATOM   4808  C CD1 . LEU C  3  216 ? 32.196  -49.714 21.619  1.00 0.00 ? 216 LEU C CD1 1 
ATOM   4809  C CD2 . LEU C  3  216 ? 30.302  -50.939 22.681  1.00 0.00 ? 216 LEU C CD2 1 
ATOM   4810  N N   . THR C  3  217 ? 35.242  -50.516 23.783  1.00 0.00 ? 217 THR C N   1 
ATOM   4811  C CA  . THR C  3  217 ? 36.017  -50.113 24.904  1.00 0.00 ? 217 THR C CA  1 
ATOM   4812  C C   . THR C  3  217 ? 35.690  -48.669 25.015  1.00 0.00 ? 217 THR C C   1 
ATOM   4813  O O   . THR C  3  217 ? 35.542  -47.972 24.018  1.00 0.00 ? 217 THR C O   1 
ATOM   4814  C CB  . THR C  3  217 ? 37.523  -50.213 24.634  1.00 0.00 ? 217 THR C CB  1 
ATOM   4815  O OG1 . THR C  3  217 ? 37.861  -49.689 23.353  1.00 0.00 ? 217 THR C OG1 1 
ATOM   4816  C CG2 . THR C  3  217 ? 37.997  -51.679 24.697  1.00 0.00 ? 217 THR C CG2 1 
ATOM   4817  N N   . ARG C  3  218 ? 35.631  -48.167 26.258  1.00 0.00 ? 218 ARG C N   1 
ATOM   4818  C CA  . ARG C  3  218 ? 35.346  -46.794 26.511  1.00 0.00 ? 218 ARG C CA  1 
ATOM   4819  C C   . ARG C  3  218 ? 36.675  -46.128 26.417  1.00 0.00 ? 218 ARG C C   1 
ATOM   4820  O O   . ARG C  3  218 ? 37.418  -46.175 27.393  1.00 0.00 ? 218 ARG C O   1 
ATOM   4821  C CB  . ARG C  3  218 ? 34.702  -46.657 27.900  1.00 0.00 ? 218 ARG C CB  1 
ATOM   4822  C CG  . ARG C  3  218 ? 34.088  -45.283 28.191  1.00 0.00 ? 218 ARG C CG  1 
ATOM   4823  C CD  . ARG C  3  218 ? 32.785  -45.430 28.984  1.00 0.00 ? 218 ARG C CD  1 
ATOM   4824  N NE  . ARG C  3  218 ? 32.300  -44.081 29.431  1.00 0.00 ? 218 ARG C NE  1 
ATOM   4825  C CZ  . ARG C  3  218 ? 32.371  -43.645 30.730  1.00 0.00 ? 218 ARG C CZ  1 
ATOM   4826  N NH1 . ARG C  3  218 ? 33.036  -44.353 31.690  1.00 0.00 ? 218 ARG C NH1 1 
ATOM   4827  N NH2 . ARG C  3  218 ? 31.757  -42.476 31.078  1.00 0.00 ? 218 ARG C NH2 1 
ATOM   4828  N N   . GLU C  3  219 ? 37.064  -45.565 25.239  1.00 0.00 ? 219 GLU C N   1 
ATOM   4829  C CA  . GLU C  3  219 ? 38.434  -45.133 25.076  1.00 0.00 ? 219 GLU C CA  1 
ATOM   4830  C C   . GLU C  3  219 ? 38.597  -43.732 25.561  1.00 0.00 ? 219 GLU C C   1 
ATOM   4831  O O   . GLU C  3  219 ? 38.360  -42.780 24.829  1.00 0.00 ? 219 GLU C O   1 
ATOM   4832  C CB  . GLU C  3  219 ? 38.934  -45.170 23.611  1.00 0.00 ? 219 GLU C CB  1 
ATOM   4833  C CG  . GLU C  3  219 ? 40.464  -44.928 23.507  1.00 0.00 ? 219 GLU C CG  1 
ATOM   4834  C CD  . GLU C  3  219 ? 40.961  -44.816 22.062  1.00 0.00 ? 219 GLU C CD  1 
ATOM   4835  O OE1 . GLU C  3  219 ? 40.570  -45.669 21.222  1.00 0.00 ? 219 GLU C OE1 1 
ATOM   4836  O OE2 . GLU C  3  219 ? 41.757  -43.877 21.789  1.00 0.00 ? 219 GLU C OE2 1 
ATOM   4837  N N   . ASN C  3  220 ? 39.039  -43.572 26.823  1.00 0.00 ? 220 ASN C N   1 
ATOM   4838  C CA  . ASN C  3  220 ? 39.428  -42.309 27.403  1.00 0.00 ? 220 ASN C CA  1 
ATOM   4839  C C   . ASN C  3  220 ? 38.343  -41.257 27.304  1.00 0.00 ? 220 ASN C C   1 
ATOM   4840  O O   . ASN C  3  220 ? 38.594  -40.114 26.937  1.00 0.00 ? 220 ASN C O   1 
ATOM   4841  C CB  . ASN C  3  220 ? 40.768  -41.777 26.825  1.00 0.00 ? 220 ASN C CB  1 
ATOM   4842  C CG  . ASN C  3  220 ? 41.887  -42.784 27.138  1.00 0.00 ? 220 ASN C CG  1 
ATOM   4843  O OD1 . ASN C  3  220 ? 42.190  -43.027 28.312  1.00 0.00 ? 220 ASN C OD1 1 
ATOM   4844  N ND2 . ASN C  3  220 ? 42.506  -43.371 26.070  1.00 0.00 ? 220 ASN C ND2 1 
ATOM   4845  N N   . GLY C  3  221 ? 37.097  -41.630 27.666  1.00 0.00 ? 221 GLY C N   1 
ATOM   4846  C CA  . GLY C  3  221 ? 35.968  -40.735 27.678  1.00 0.00 ? 221 GLY C CA  1 
ATOM   4847  C C   . GLY C  3  221 ? 35.319  -40.541 26.337  1.00 0.00 ? 221 GLY C C   1 
ATOM   4848  O O   . GLY C  3  221 ? 34.375  -39.759 26.224  1.00 0.00 ? 221 GLY C O   1 
ATOM   4849  N N   . LYS C  3  222 ? 35.782  -41.260 25.290  1.00 0.00 ? 222 LYS C N   1 
ATOM   4850  C CA  . LYS C  3  222 ? 35.151  -41.255 24.000  1.00 0.00 ? 222 LYS C CA  1 
ATOM   4851  C C   . LYS C  3  222 ? 35.160  -42.697 23.680  1.00 0.00 ? 222 LYS C C   1 
ATOM   4852  O O   . LYS C  3  222 ? 36.203  -43.282 23.430  1.00 0.00 ? 222 LYS C O   1 
ATOM   4853  C CB  . LYS C  3  222 ? 35.951  -40.522 22.899  1.00 0.00 ? 222 LYS C CB  1 
ATOM   4854  C CG  . LYS C  3  222 ? 36.033  -39.004 23.118  1.00 0.00 ? 222 LYS C CG  1 
ATOM   4855  C CD  . LYS C  3  222 ? 36.952  -38.265 22.127  1.00 0.00 ? 222 LYS C CD  1 
ATOM   4856  C CE  . LYS C  3  222 ? 36.429  -38.226 20.682  1.00 0.00 ? 222 LYS C CE  1 
ATOM   4857  N NZ  . LYS C  3  222 ? 37.326  -37.425 19.811  1.00 0.00 ? 222 LYS C NZ  1 
ATOM   4858  N N   . THR C  3  223 ? 33.993  -43.349 23.704  1.00 0.00 ? 223 THR C N   1 
ATOM   4859  C CA  . THR C  3  223 ? 33.875  -44.756 23.429  1.00 0.00 ? 223 THR C CA  1 
ATOM   4860  C C   . THR C  3  223 ? 34.263  -45.049 21.994  1.00 0.00 ? 223 THR C C   1 
ATOM   4861  O O   . THR C  3  223 ? 33.979  -44.269 21.081  1.00 0.00 ? 223 THR C O   1 
ATOM   4862  C CB  . THR C  3  223 ? 32.499  -45.249 23.782  1.00 0.00 ? 223 THR C CB  1 
ATOM   4863  O OG1 . THR C  3  223 ? 32.155  -44.778 25.072  1.00 0.00 ? 223 THR C OG1 1 
ATOM   4864  C CG2 . THR C  3  223 ? 32.442  -46.777 23.800  1.00 0.00 ? 223 THR C CG2 1 
ATOM   4865  N N   . VAL C  3  224 ? 35.043  -46.141 21.804  1.00 0.00 ? 224 VAL C N   1 
ATOM   4866  C CA  . VAL C  3  224 ? 35.601  -46.501 20.527  1.00 0.00 ? 224 VAL C CA  1 
ATOM   4867  C C   . VAL C  3  224 ? 35.424  -47.981 20.435  1.00 0.00 ? 224 VAL C C   1 
ATOM   4868  O O   . VAL C  3  224 ? 35.617  -48.721 21.397  1.00 0.00 ? 224 VAL C O   1 
ATOM   4869  C CB  . VAL C  3  224 ? 37.094  -46.164 20.436  1.00 0.00 ? 224 VAL C CB  1 
ATOM   4870  C CG1 . VAL C  3  224 ? 37.781  -46.807 19.221  1.00 0.00 ? 224 VAL C CG1 1 
ATOM   4871  C CG2 . VAL C  3  224 ? 37.278  -44.640 20.364  1.00 0.00 ? 224 VAL C CG2 1 
ATOM   4872  N N   . ILE C  3  225 ? 35.029  -48.404 19.210  1.00 0.00 ? 225 ILE C N   1 
ATOM   4873  C CA  . ILE C  3  225 ? 34.920  -49.753 18.713  1.00 0.00 ? 225 ILE C CA  1 
ATOM   4874  C C   . ILE C  3  225 ? 36.199  -49.915 18.007  1.00 0.00 ? 225 ILE C C   1 
ATOM   4875  O O   . ILE C  3  225 ? 36.606  -48.988 17.321  1.00 0.00 ? 225 ILE C O   1 
ATOM   4876  C CB  . ILE C  3  225 ? 33.801  -49.935 17.682  1.00 0.00 ? 225 ILE C CB  1 
ATOM   4877  C CG1 . ILE C  3  225 ? 32.407  -49.631 18.263  1.00 0.00 ? 225 ILE C CG1 1 
ATOM   4878  C CG2 . ILE C  3  225 ? 33.801  -51.356 17.070  1.00 0.00 ? 225 ILE C CG2 1 
ATOM   4879  C CD1 . ILE C  3  225 ? 31.459  -49.047 17.220  1.00 0.00 ? 225 ILE C CD1 1 
ATOM   4880  N N   . ARG C  3  226 ? 36.835  -51.089 18.105  1.00 0.00 ? 226 ARG C N   1 
ATOM   4881  C CA  . ARG C  3  226 ? 38.008  -51.327 17.315  1.00 0.00 ? 226 ARG C CA  1 
ATOM   4882  C C   . ARG C  3  226 ? 38.022  -52.793 17.003  1.00 0.00 ? 226 ARG C C   1 
ATOM   4883  O O   . ARG C  3  226 ? 37.900  -53.643 17.882  1.00 0.00 ? 226 ARG C O   1 
ATOM   4884  C CB  . ARG C  3  226 ? 39.289  -50.926 18.097  1.00 0.00 ? 226 ARG C CB  1 
ATOM   4885  C CG  . ARG C  3  226 ? 39.476  -51.609 19.457  1.00 0.00 ? 226 ARG C CG  1 
ATOM   4886  C CD  . ARG C  3  226 ? 40.719  -51.150 20.226  1.00 0.00 ? 226 ARG C CD  1 
ATOM   4887  N NE  . ARG C  3  226 ? 40.441  -49.827 20.892  1.00 0.00 ? 226 ARG C NE  1 
ATOM   4888  C CZ  . ARG C  3  226 ? 40.851  -49.526 22.165  1.00 0.00 ? 226 ARG C CZ  1 
ATOM   4889  N NH1 . ARG C  3  226 ? 41.591  -50.406 22.899  1.00 0.00 ? 226 ARG C NH1 1 
ATOM   4890  N NH2 . ARG C  3  226 ? 40.499  -48.327 22.717  1.00 0.00 ? 226 ARG C NH2 1 
ATOM   4891  N N   . VAL C  3  227 ? 38.171  -53.159 15.703  1.00 0.00 ? 227 VAL C N   1 
ATOM   4892  C CA  . VAL C  3  227 ? 38.496  -54.524 15.355  1.00 0.00 ? 227 VAL C CA  1 
ATOM   4893  C C   . VAL C  3  227 ? 39.907  -54.692 15.784  1.00 0.00 ? 227 VAL C C   1 
ATOM   4894  O O   . VAL C  3  227 ? 40.687  -53.754 15.640  1.00 0.00 ? 227 VAL C O   1 
ATOM   4895  C CB  . VAL C  3  227 ? 38.293  -54.887 13.878  1.00 0.00 ? 227 VAL C CB  1 
ATOM   4896  C CG1 . VAL C  3  227 ? 39.188  -54.064 12.932  1.00 0.00 ? 227 VAL C CG1 1 
ATOM   4897  C CG2 . VAL C  3  227 ? 38.461  -56.406 13.668  1.00 0.00 ? 227 VAL C CG2 1 
ATOM   4898  N N   . LEU C  3  228 ? 40.280  -55.855 16.353  1.00 0.00 ? 228 LEU C N   1 
ATOM   4899  C CA  . LEU C  3  228 ? 41.623  -56.059 16.785  1.00 0.00 ? 228 LEU C CA  1 
ATOM   4900  C C   . LEU C  3  228 ? 42.506  -56.109 15.596  1.00 0.00 ? 228 LEU C C   1 
ATOM   4901  O O   . LEU C  3  228 ? 42.127  -56.601 14.536  1.00 0.00 ? 228 LEU C O   1 
ATOM   4902  C CB  . LEU C  3  228 ? 41.862  -57.327 17.615  1.00 0.00 ? 228 LEU C CB  1 
ATOM   4903  C CG  . LEU C  3  228 ? 41.261  -57.287 19.036  1.00 0.00 ? 228 LEU C CG  1 
ATOM   4904  C CD1 . LEU C  3  228 ? 41.624  -58.579 19.783  1.00 0.00 ? 228 LEU C CD1 1 
ATOM   4905  C CD2 . LEU C  3  228 ? 41.655  -56.047 19.865  1.00 0.00 ? 228 LEU C CD2 1 
ATOM   4906  N N   . LYS C  3  229 ? 43.719  -55.554 15.786  1.00 0.00 ? 229 LYS C N   1 
ATOM   4907  C CA  . LYS C  3  229 ? 44.785  -55.559 14.839  1.00 0.00 ? 229 LYS C CA  1 
ATOM   4908  C C   . LYS C  3  229 ? 45.371  -56.924 14.950  1.00 0.00 ? 229 LYS C C   1 
ATOM   4909  O O   . LYS C  3  229 ? 45.489  -57.436 16.056  1.00 0.00 ? 229 LYS C O   1 
ATOM   4910  C CB  . LYS C  3  229 ? 45.821  -54.459 15.126  1.00 0.00 ? 229 LYS C CB  1 
ATOM   4911  C CG  . LYS C  3  229 ? 46.046  -54.170 16.615  1.00 0.00 ? 229 LYS C CG  1 
ATOM   4912  C CD  . LYS C  3  229 ? 47.078  -53.059 16.887  1.00 0.00 ? 229 LYS C CD  1 
ATOM   4913  C CE  . LYS C  3  229 ? 48.517  -53.461 16.539  1.00 0.00 ? 229 LYS C CE  1 
ATOM   4914  N NZ  . LYS C  3  229 ? 49.469  -52.381 16.882  1.00 0.00 ? 229 LYS C NZ  1 
ATOM   4915  N N   . GLN C  3  230 ? 45.624  -57.573 13.784  1.00 0.00 ? 230 GLN C N   1 
ATOM   4916  C CA  . GLN C  3  230 ? 45.847  -58.991 13.625  1.00 0.00 ? 230 GLN C CA  1 
ATOM   4917  C C   . GLN C  3  230 ? 47.025  -59.523 14.391  1.00 0.00 ? 230 GLN C C   1 
ATOM   4918  O O   . GLN C  3  230 ? 47.051  -60.682 14.775  1.00 0.00 ? 230 GLN C O   1 
ATOM   4919  C CB  . GLN C  3  230 ? 46.005  -59.386 12.147  1.00 0.00 ? 230 GLN C CB  1 
ATOM   4920  C CG  . GLN C  3  230 ? 45.746  -60.888 11.917  1.00 0.00 ? 230 GLN C CG  1 
ATOM   4921  C CD  . GLN C  3  230 ? 46.101  -61.285 10.485  1.00 0.00 ? 230 GLN C CD  1 
ATOM   4922  O OE1 . GLN C  3  230 ? 45.210  -61.441 9.642   1.00 0.00 ? 230 GLN C OE1 1 
ATOM   4923  N NE2 . GLN C  3  230 ? 47.434  -61.463 10.242  1.00 0.00 ? 230 GLN C NE2 1 
ATOM   4924  N N   . LYS C  3  231 ? 48.036  -58.677 14.645  1.00 0.00 ? 231 LYS C N   1 
ATOM   4925  C CA  . LYS C  3  231 ? 49.206  -58.964 15.444  1.00 0.00 ? 231 LYS C CA  1 
ATOM   4926  C C   . LYS C  3  231 ? 48.841  -59.233 16.898  1.00 0.00 ? 231 LYS C C   1 
ATOM   4927  O O   . LYS C  3  231 ? 49.430  -60.111 17.525  1.00 0.00 ? 231 LYS C O   1 
ATOM   4928  C CB  . LYS C  3  231 ? 50.169  -57.758 15.379  1.00 0.00 ? 231 LYS C CB  1 
ATOM   4929  C CG  . LYS C  3  231 ? 50.645  -57.420 13.952  1.00 0.00 ? 231 LYS C CG  1 
ATOM   4930  C CD  . LYS C  3  231 ? 51.605  -58.456 13.352  1.00 0.00 ? 231 LYS C CD  1 
ATOM   4931  C CE  . LYS C  3  231 ? 52.965  -58.521 14.059  1.00 0.00 ? 231 LYS C CE  1 
ATOM   4932  N NZ  . LYS C  3  231 ? 53.824  -59.559 13.447  1.00 0.00 ? 231 LYS C NZ  1 
ATOM   4933  N N   . GLU C  3  232 ? 47.798  -58.523 17.410  1.00 0.00 ? 232 GLU C N   1 
ATOM   4934  C CA  . GLU C  3  232 ? 47.155  -58.701 18.693  1.00 0.00 ? 232 GLU C CA  1 
ATOM   4935  C C   . GLU C  3  232 ? 46.236  -59.881 18.683  1.00 0.00 ? 232 GLU C C   1 
ATOM   4936  O O   . GLU C  3  232 ? 46.092  -60.580 19.680  1.00 0.00 ? 232 GLU C O   1 
ATOM   4937  C CB  . GLU C  3  232 ? 46.328  -57.493 19.163  1.00 0.00 ? 232 GLU C CB  1 
ATOM   4938  C CG  . GLU C  3  232 ? 47.225  -56.298 19.526  1.00 0.00 ? 232 GLU C CG  1 
ATOM   4939  C CD  . GLU C  3  232 ? 46.393  -55.103 19.988  1.00 0.00 ? 232 GLU C CD  1 
ATOM   4940  O OE1 . GLU C  3  232 ? 45.150  -55.114 19.806  1.00 0.00 ? 232 GLU C OE1 1 
ATOM   4941  O OE2 . GLU C  3  232 ? 47.013  -54.145 20.520  1.00 0.00 ? 232 GLU C OE2 1 
ATOM   4942  N N   . VAL C  3  233 ? 45.584  -60.156 17.532  1.00 0.00 ? 233 VAL C N   1 
ATOM   4943  C CA  . VAL C  3  233 ? 44.743  -61.319 17.340  1.00 0.00 ? 233 VAL C CA  1 
ATOM   4944  C C   . VAL C  3  233 ? 45.592  -62.539 17.476  1.00 0.00 ? 233 VAL C C   1 
ATOM   4945  O O   . VAL C  3  233 ? 45.158  -63.523 18.057  1.00 0.00 ? 233 VAL C O   1 
ATOM   4946  C CB  . VAL C  3  233 ? 44.028  -61.351 15.993  1.00 0.00 ? 233 VAL C CB  1 
ATOM   4947  C CG1 . VAL C  3  233 ? 43.307  -62.696 15.761  1.00 0.00 ? 233 VAL C CG1 1 
ATOM   4948  C CG2 . VAL C  3  233 ? 43.011  -60.191 15.942  1.00 0.00 ? 233 VAL C CG2 1 
ATOM   4949  N N   . GLU C  3  234 ? 46.841  -62.482 16.982  1.00 0.00 ? 234 GLU C N   1 
ATOM   4950  C CA  . GLU C  3  234 ? 47.765  -63.574 17.064  1.00 0.00 ? 234 GLU C CA  1 
ATOM   4951  C C   . GLU C  3  234 ? 48.488  -63.645 18.377  1.00 0.00 ? 234 GLU C C   1 
ATOM   4952  O O   . GLU C  3  234 ? 49.086  -64.672 18.633  1.00 0.00 ? 234 GLU C O   1 
ATOM   4953  C CB  . GLU C  3  234 ? 48.798  -63.565 15.907  1.00 0.00 ? 234 GLU C CB  1 
ATOM   4954  C CG  . GLU C  3  234 ? 48.241  -64.191 14.613  1.00 0.00 ? 234 GLU C CG  1 
ATOM   4955  C CD  . GLU C  3  234 ? 48.091  -65.710 14.753  1.00 0.00 ? 234 GLU C CD  1 
ATOM   4956  O OE1 . GLU C  3  234 ? 49.121  -66.376 15.028  1.00 0.00 ? 234 GLU C OE1 1 
ATOM   4957  O OE2 . GLU C  3  234 ? 46.966  -66.235 14.580  1.00 0.00 ? 234 GLU C OE2 1 
ATOM   4958  N N   . GLN C  3  235 ? 48.475  -62.620 19.256  1.00 0.00 ? 235 GLN C N   1 
ATOM   4959  C CA  . GLN C  3  235 ? 49.033  -62.792 20.581  1.00 0.00 ? 235 GLN C CA  1 
ATOM   4960  C C   . GLN C  3  235 ? 48.041  -63.525 21.460  1.00 0.00 ? 235 GLN C C   1 
ATOM   4961  O O   . GLN C  3  235 ? 48.414  -64.312 22.326  1.00 0.00 ? 235 GLN C O   1 
ATOM   4962  C CB  . GLN C  3  235 ? 49.510  -61.488 21.280  1.00 0.00 ? 235 GLN C CB  1 
ATOM   4963  C CG  . GLN C  3  235 ? 48.417  -60.548 21.831  1.00 0.00 ? 235 GLN C CG  1 
ATOM   4964  C CD  . GLN C  3  235 ? 48.995  -59.378 22.629  1.00 0.00 ? 235 GLN C CD  1 
ATOM   4965  O OE1 . GLN C  3  235 ? 50.168  -59.369 23.014  1.00 0.00 ? 235 GLN C OE1 1 
ATOM   4966  N NE2 . GLN C  3  235 ? 48.108  -58.371 22.885  1.00 0.00 ? 235 GLN C NE2 1 
ATOM   4967  N N   . LEU C  3  236 ? 46.734  -63.284 21.246  1.00 0.00 ? 236 LEU C N   1 
ATOM   4968  C CA  . LEU C  3  236 ? 45.690  -64.006 21.912  1.00 0.00 ? 236 LEU C CA  1 
ATOM   4969  C C   . LEU C  3  236 ? 45.646  -65.449 21.489  1.00 0.00 ? 236 LEU C C   1 
ATOM   4970  O O   . LEU C  3  236 ? 45.409  -66.323 22.320  1.00 0.00 ? 236 LEU C O   1 
ATOM   4971  C CB  . LEU C  3  236 ? 44.323  -63.403 21.578  1.00 0.00 ? 236 LEU C CB  1 
ATOM   4972  C CG  . LEU C  3  236 ? 44.088  -62.009 22.190  1.00 0.00 ? 236 LEU C CG  1 
ATOM   4973  C CD1 . LEU C  3  236 ? 42.958  -61.289 21.445  1.00 0.00 ? 236 LEU C CD1 1 
ATOM   4974  C CD2 . LEU C  3  236 ? 43.805  -62.066 23.701  1.00 0.00 ? 236 LEU C CD2 1 
ATOM   4975  N N   . ILE C  3  237 ? 45.891  -65.728 20.182  1.00 0.00 ? 237 ILE C N   1 
ATOM   4976  C CA  . ILE C  3  237 ? 45.942  -67.067 19.633  1.00 0.00 ? 237 ILE C CA  1 
ATOM   4977  C C   . ILE C  3  237 ? 47.185  -67.783 20.072  1.00 0.00 ? 237 ILE C C   1 
ATOM   4978  O O   . ILE C  3  237 ? 47.100  -68.955 20.431  1.00 0.00 ? 237 ILE C O   1 
ATOM   4979  C CB  . ILE C  3  237 ? 45.853  -67.051 18.130  1.00 0.00 ? 237 ILE C CB  1 
ATOM   4980  C CG1 . ILE C  3  237 ? 44.443  -66.590 17.714  1.00 0.00 ? 237 ILE C CG1 1 
ATOM   4981  C CG2 . ILE C  3  237 ? 46.144  -68.450 17.538  1.00 0.00 ? 237 ILE C CG2 1 
ATOM   4982  C CD1 . ILE C  3  237 ? 44.343  -66.204 16.238  1.00 0.00 ? 237 ILE C CD1 1 
ATOM   4983  N N   . LYS C  3  238 ? 48.345  -67.072 20.104  1.00 0.00 ? 238 LYS C N   1 
ATOM   4984  C CA  . LYS C  3  238 ? 49.629  -67.565 20.559  1.00 0.00 ? 238 LYS C CA  1 
ATOM   4985  C C   . LYS C  3  238 ? 49.609  -67.898 22.036  1.00 0.00 ? 238 LYS C C   1 
ATOM   4986  O O   . LYS C  3  238 ? 50.249  -68.851 22.470  1.00 0.00 ? 238 LYS C O   1 
ATOM   4987  C CB  . LYS C  3  238 ? 50.785  -66.577 20.304  1.00 0.00 ? 238 LYS C CB  1 
ATOM   4988  C CG  . LYS C  3  238 ? 52.193  -67.192 20.295  1.00 0.00 ? 238 LYS C CG  1 
ATOM   4989  C CD  . LYS C  3  238 ? 52.507  -67.893 18.965  1.00 0.00 ? 238 LYS C CD  1 
ATOM   4990  C CE  . LYS C  3  238 ? 53.922  -68.472 18.879  1.00 0.00 ? 238 LYS C CE  1 
ATOM   4991  N NZ  . LYS C  3  238 ? 54.932  -67.394 18.903  1.00 0.00 ? 238 LYS C NZ  1 
ATOM   4992  N N   . LYS C  3  239 ? 48.828  -67.137 22.839  1.00 0.00 ? 239 LYS C N   1 
ATOM   4993  C CA  . LYS C  3  239 ? 48.522  -67.450 24.215  1.00 0.00 ? 239 LYS C CA  1 
ATOM   4994  C C   . LYS C  3  239 ? 47.660  -68.672 24.279  1.00 0.00 ? 239 LYS C C   1 
ATOM   4995  O O   . LYS C  3  239 ? 47.819  -69.484 25.174  1.00 0.00 ? 239 LYS C O   1 
ATOM   4996  C CB  . LYS C  3  239 ? 47.780  -66.302 24.941  1.00 0.00 ? 239 LYS C CB  1 
ATOM   4997  C CG  . LYS C  3  239 ? 47.339  -66.594 26.390  1.00 0.00 ? 239 LYS C CG  1 
ATOM   4998  C CD  . LYS C  3  239 ? 46.442  -65.518 27.029  1.00 0.00 ? 239 LYS C CD  1 
ATOM   4999  C CE  . LYS C  3  239 ? 45.183  -65.131 26.234  1.00 0.00 ? 239 LYS C CE  1 
ATOM   5000  N NZ  . LYS C  3  239 ? 44.384  -66.297 25.830  1.00 0.00 ? 239 LYS C NZ  1 
ATOM   5001  N N   . HIS C  3  240 ? 46.780  -68.838 23.298  1.00 0.00 ? 240 HIS C N   1 
ATOM   5002  C CA  . HIS C  3  240 ? 45.919  -70.016 23.234  1.00 0.00 ? 240 HIS C CA  1 
ATOM   5003  C C   . HIS C  3  240 ? 46.711  -71.317 23.070  1.00 0.00 ? 240 HIS C C   1 
ATOM   5004  O O   . HIS C  3  240 ? 46.382  -72.330 23.686  1.00 0.00 ? 240 HIS C O   1 
ATOM   5005  C CB  . HIS C  3  240 ? 44.904  -69.874 22.097  1.00 0.00 ? 240 HIS C CB  1 
ATOM   5006  C CG  . HIS C  3  240 ? 44.103  -71.113 21.845  1.00 0.00 ? 240 HIS C CG  1 
ATOM   5007  N ND1 . HIS C  3  240 ? 43.310  -71.697 22.809  1.00 0.00 ? 240 HIS C ND1 1 
ATOM   5008  C CD2 . HIS C  3  240 ? 43.972  -71.880 20.736  1.00 0.00 ? 240 HIS C CD2 1 
ATOM   5009  C CE1 . HIS C  3  240 ? 42.726  -72.769 22.307  1.00 0.00 ? 240 HIS C CE1 1 
ATOM   5010  N NE2 . HIS C  3  240 ? 43.110  -72.903 21.050  1.00 0.00 ? 240 HIS C NE2 1 
ATOM   5011  N N   . GLU C  3  241 ? 47.749  -71.285 22.238  1.00 0.00 ? 241 GLU C N   1 
ATOM   5012  C CA  . GLU C  3  241 ? 48.544  -72.450 21.977  1.00 0.00 ? 241 GLU C CA  1 
ATOM   5013  C C   . GLU C  3  241 ? 49.175  -72.975 23.252  1.00 0.00 ? 241 GLU C C   1 
ATOM   5014  O O   . GLU C  3  241 ? 49.324  -74.180 23.400  1.00 0.00 ? 241 GLU C O   1 
ATOM   5015  C CB  . GLU C  3  241 ? 49.697  -72.143 21.002  1.00 0.00 ? 241 GLU C CB  1 
ATOM   5016  C CG  . GLU C  3  241 ? 49.237  -71.320 19.790  1.00 0.00 ? 241 GLU C CG  1 
ATOM   5017  C CD  . GLU C  3  241 ? 50.311  -71.198 18.715  1.00 0.00 ? 241 GLU C CD  1 
ATOM   5018  O OE1 . GLU C  3  241 ? 51.426  -71.751 18.905  1.00 0.00 ? 241 GLU C OE1 1 
ATOM   5019  O OE2 . GLU C  3  241 ? 50.011  -70.547 17.678  1.00 0.00 ? 241 GLU C OE2 1 
ATOM   5020  N N   . GLU C  3  242 ? 49.550  -72.067 24.202  1.00 0.00 ? 242 GLU C N   1 
ATOM   5021  C CA  . GLU C  3  242 ? 50.014  -72.396 25.532  1.00 0.00 ? 242 GLU C CA  1 
ATOM   5022  C C   . GLU C  3  242 ? 48.908  -72.549 26.543  1.00 0.00 ? 242 GLU C C   1 
ATOM   5023  O O   . GLU C  3  242 ? 49.150  -73.125 27.602  1.00 0.00 ? 242 GLU C O   1 
ATOM   5024  C CB  . GLU C  3  242 ? 51.053  -71.393 26.082  1.00 0.00 ? 242 GLU C CB  1 
ATOM   5025  C CG  . GLU C  3  242 ? 50.529  -69.963 26.206  1.00 0.00 ? 242 GLU C CG  1 
ATOM   5026  C CD  . GLU C  3  242 ? 51.510  -69.015 26.881  1.00 0.00 ? 242 GLU C CD  1 
ATOM   5027  O OE1 . GLU C  3  242 ? 52.664  -69.427 27.156  1.00 0.00 ? 242 GLU C OE1 1 
ATOM   5028  O OE2 . GLU C  3  242 ? 51.102  -67.850 27.134  1.00 0.00 ? 242 GLU C OE2 1 
ATOM   5029  N N   . GLU C  3  243 ? 47.670  -72.051 26.277  1.00 0.00 ? 243 GLU C N   1 
ATOM   5030  C CA  . GLU C  3  243 ? 46.505  -72.351 27.098  1.00 0.00 ? 243 GLU C CA  1 
ATOM   5031  C C   . GLU C  3  243 ? 46.081  -73.790 26.908  1.00 0.00 ? 243 GLU C C   1 
ATOM   5032  O O   . GLU C  3  243 ? 45.475  -74.392 27.793  1.00 0.00 ? 243 GLU C O   1 
ATOM   5033  C CB  . GLU C  3  243 ? 45.264  -71.473 26.824  1.00 0.00 ? 243 GLU C CB  1 
ATOM   5034  C CG  . GLU C  3  243 ? 45.385  -70.044 27.376  1.00 0.00 ? 243 GLU C CG  1 
ATOM   5035  C CD  . GLU C  3  243 ? 44.037  -69.322 27.385  1.00 0.00 ? 243 GLU C CD  1 
ATOM   5036  O OE1 . GLU C  3  243 ? 43.128  -69.718 26.616  1.00 0.00 ? 243 GLU C OE1 1 
ATOM   5037  O OE2 . GLU C  3  243 ? 43.898  -68.360 28.182  1.00 0.00 ? 243 GLU C OE2 1 
ATOM   5038  N N   . GLU C  3  244 ? 46.478  -74.381 25.764  1.00 0.00 ? 244 GLU C N   1 
ATOM   5039  C CA  . GLU C  3  244 ? 46.267  -75.753 25.434  1.00 0.00 ? 244 GLU C CA  1 
ATOM   5040  C C   . GLU C  3  244 ? 47.333  -76.593 26.180  1.00 0.00 ? 244 GLU C C   1 
ATOM   5041  C CB  . GLU C  3  244 ? 46.400  -75.909 23.906  1.00 0.00 ? 244 GLU C CB  1 
ATOM   5042  C CG  . GLU C  3  244 ? 46.077  -77.284 23.306  1.00 0.00 ? 244 GLU C CG  1 
ATOM   5043  C CD  . GLU C  3  244 ? 46.334  -77.189 21.805  1.00 0.00 ? 244 GLU C CD  1 
ATOM   5044  O OE1 . GLU C  3  244 ? 47.525  -77.085 21.401  1.00 0.00 ? 244 GLU C OE1 1 
ATOM   5045  O OE2 . GLU C  3  244 ? 45.334  -77.206 21.042  1.00 0.00 ? 244 GLU C OE2 1 
ATOM   5046  N N   . ARG D  4  5   ? -5.141  -61.036 -1.238  1.00 0.00 ? 5   ARG D N   1 
ATOM   5047  C CA  . ARG D  4  5   ? -5.637  -62.317 -0.710  1.00 0.00 ? 5   ARG D CA  1 
ATOM   5048  C C   . ARG D  4  5   ? -6.206  -62.124 0.659   1.00 0.00 ? 5   ARG D C   1 
ATOM   5049  O O   . ARG D  4  5   ? -5.570  -61.519 1.515   1.00 0.00 ? 5   ARG D O   1 
ATOM   5050  C CB  . ARG D  4  5   ? -4.488  -63.353 -0.700  1.00 0.00 ? 5   ARG D CB  1 
ATOM   5051  C CG  . ARG D  4  5   ? -4.955  -64.774 -0.379  1.00 0.00 ? 5   ARG D CG  1 
ATOM   5052  C CD  . ARG D  4  5   ? -3.880  -65.838 -0.607  1.00 0.00 ? 5   ARG D CD  1 
ATOM   5053  N NE  . ARG D  4  5   ? -4.474  -67.145 -0.187  1.00 0.00 ? 5   ARG D NE  1 
ATOM   5054  C CZ  . ARG D  4  5   ? -4.017  -68.363 -0.597  1.00 0.00 ? 5   ARG D CZ  1 
ATOM   5055  N NH1 . ARG D  4  5   ? -2.952  -68.470 -1.432  1.00 0.00 ? 5   ARG D NH1 1 
ATOM   5056  N NH2 . ARG D  4  5   ? -4.646  -69.490 -0.155  1.00 0.00 ? 5   ARG D NH2 1 
ATOM   5057  N N   . ALA D  4  6   ? -7.422  -62.676 0.892   1.00 0.00 ? 6   ALA D N   1 
ATOM   5058  C CA  . ALA D  4  6   ? -8.100  -62.710 2.165   1.00 0.00 ? 6   ALA D CA  1 
ATOM   5059  C C   . ALA D  4  6   ? -7.536  -63.893 2.888   1.00 0.00 ? 6   ALA D C   1 
ATOM   5060  O O   . ALA D  4  6   ? -7.412  -64.967 2.305   1.00 0.00 ? 6   ALA D O   1 
ATOM   5061  C CB  . ALA D  4  6   ? -9.616  -62.922 2.035   1.00 0.00 ? 6   ALA D CB  1 
ATOM   5062  N N   . ILE D  4  7   ? -7.064  -63.682 4.135   1.00 0.00 ? 7   ILE D N   1 
ATOM   5063  C CA  . ILE D  4  7   ? -6.291  -64.666 4.858   1.00 0.00 ? 7   ILE D CA  1 
ATOM   5064  C C   . ILE D  4  7   ? -7.153  -65.470 5.775   1.00 0.00 ? 7   ILE D C   1 
ATOM   5065  O O   . ILE D  4  7   ? -7.094  -66.698 5.787   1.00 0.00 ? 7   ILE D O   1 
ATOM   5066  C CB  . ILE D  4  7   ? -5.189  -63.976 5.633   1.00 0.00 ? 7   ILE D CB  1 
ATOM   5067  C CG1 . ILE D  4  7   ? -4.400  -63.046 4.685   1.00 0.00 ? 7   ILE D CG1 1 
ATOM   5068  C CG2 . ILE D  4  7   ? -4.251  -64.997 6.301   1.00 0.00 ? 7   ILE D CG2 1 
ATOM   5069  C CD1 . ILE D  4  7   ? -3.860  -63.685 3.396   1.00 0.00 ? 7   ILE D CD1 1 
ATOM   5070  N N   . THR D  4  8   ? -7.877  -64.745 6.624   1.00 0.00 ? 8   THR D N   1 
ATOM   5071  C CA  . THR D  4  8   ? -8.836  -65.335 7.537   1.00 0.00 ? 8   THR D CA  1 
ATOM   5072  C C   . THR D  4  8   ? -10.210 -65.445 6.891   1.00 0.00 ? 8   THR D C   1 
ATOM   5073  O O   . THR D  4  8   ? -11.189 -64.879 7.379   1.00 0.00 ? 8   THR D O   1 
ATOM   5074  C CB  . THR D  4  8   ? -8.943  -64.524 8.843   1.00 0.00 ? 8   THR D CB  1 
ATOM   5075  O OG1 . THR D  4  8   ? -7.668  -63.952 9.160   1.00 0.00 ? 8   THR D OG1 1 
ATOM   5076  C CG2 . THR D  4  8   ? -9.392  -65.418 9.990   1.00 0.00 ? 8   THR D CG2 1 
ATOM   5077  N N   . VAL D  4  9   ? -10.279 -66.196 5.800   1.00 0.00 ? 9   VAL D N   1 
ATOM   5078  C CA  . VAL D  4  9   ? -11.549 -66.652 5.270   1.00 0.00 ? 9   VAL D CA  1 
ATOM   5079  C C   . VAL D  4  9   ? -12.127 -67.722 6.147   1.00 0.00 ? 9   VAL D C   1 
ATOM   5080  O O   . VAL D  4  9   ? -11.389 -68.553 6.667   1.00 0.00 ? 9   VAL D O   1 
ATOM   5081  C CB  . VAL D  4  9   ? -11.466 -67.197 3.853   1.00 0.00 ? 9   VAL D CB  1 
ATOM   5082  C CG1 . VAL D  4  9   ? -11.292 -66.020 2.881   1.00 0.00 ? 9   VAL D CG1 1 
ATOM   5083  C CG2 . VAL D  4  9   ? -10.324 -68.227 3.706   1.00 0.00 ? 9   VAL D CG2 1 
ATOM   5084  N N   . PHE D  4  10  ? -13.465 -67.696 6.357   1.00 0.00 ? 10  PHE D N   1 
ATOM   5085  C CA  . PHE D  4  10  ? -14.176 -68.659 7.172   1.00 0.00 ? 10  PHE D CA  1 
ATOM   5086  C C   . PHE D  4  10  ? -13.974 -70.056 6.697   1.00 0.00 ? 10  PHE D C   1 
ATOM   5087  O O   . PHE D  4  10  ? -13.974 -70.346 5.505   1.00 0.00 ? 10  PHE D O   1 
ATOM   5088  C CB  . PHE D  4  10  ? -15.711 -68.474 7.209   1.00 0.00 ? 10  PHE D CB  1 
ATOM   5089  C CG  . PHE D  4  10  ? -16.092 -67.370 8.120   1.00 0.00 ? 10  PHE D CG  1 
ATOM   5090  C CD1 . PHE D  4  10  ? -16.174 -67.611 9.498   1.00 0.00 ? 10  PHE D CD1 1 
ATOM   5091  C CD2 . PHE D  4  10  ? -16.408 -66.106 7.622   1.00 0.00 ? 10  PHE D CD2 1 
ATOM   5092  C CE1 . PHE D  4  10  ? -16.579 -66.602 10.375  1.00 0.00 ? 10  PHE D CE1 1 
ATOM   5093  C CE2 . PHE D  4  10  ? -16.779 -65.088 8.502   1.00 0.00 ? 10  PHE D CE2 1 
ATOM   5094  C CZ  . PHE D  4  10  ? -16.870 -65.330 9.874   1.00 0.00 ? 10  PHE D CZ  1 
ATOM   5095  N N   . SER D  4  11  ? -13.811 -70.955 7.677   1.00 0.00 ? 11  SER D N   1 
ATOM   5096  C CA  . SER D  4  11  ? -13.742 -72.371 7.489   1.00 0.00 ? 11  SER D CA  1 
ATOM   5097  C C   . SER D  4  11  ? -15.098 -72.902 7.098   1.00 0.00 ? 11  SER D C   1 
ATOM   5098  O O   . SER D  4  11  ? -16.068 -72.168 7.229   1.00 0.00 ? 11  SER D O   1 
ATOM   5099  C CB  . SER D  4  11  ? -13.229 -73.030 8.789   1.00 0.00 ? 11  SER D CB  1 
ATOM   5100  O OG  . SER D  4  11  ? -14.122 -72.859 9.870   1.00 0.00 ? 11  SER D OG  1 
ATOM   5101  N N   . PRO D  4  12  ? -15.277 -74.115 6.614   1.00 0.00 ? 12  PRO D N   1 
ATOM   5102  C CA  . PRO D  4  12  ? -16.588 -74.718 6.454   1.00 0.00 ? 12  PRO D CA  1 
ATOM   5103  C C   . PRO D  4  12  ? -17.196 -75.070 7.772   1.00 0.00 ? 12  PRO D C   1 
ATOM   5104  O O   . PRO D  4  12  ? -18.318 -75.566 7.781   1.00 0.00 ? 12  PRO D O   1 
ATOM   5105  C CB  . PRO D  4  12  ? -16.331 -75.982 5.632   1.00 0.00 ? 12  PRO D CB  1 
ATOM   5106  C CG  . PRO D  4  12  ? -14.881 -76.349 5.956   1.00 0.00 ? 12  PRO D CG  1 
ATOM   5107  C CD  . PRO D  4  12  ? -14.212 -74.986 6.128   1.00 0.00 ? 12  PRO D CD  1 
ATOM   5108  N N   . ASP D  4  13  ? -16.425 -74.918 8.863   1.00 0.00 ? 13  ASP D N   1 
ATOM   5109  C CA  . ASP D  4  13  ? -16.843 -75.159 10.212  1.00 0.00 ? 13  ASP D CA  1 
ATOM   5110  C C   . ASP D  4  13  ? -17.644 -74.016 10.748  1.00 0.00 ? 13  ASP D C   1 
ATOM   5111  O O   . ASP D  4  13  ? -18.528 -74.210 11.575  1.00 0.00 ? 13  ASP D O   1 
ATOM   5112  C CB  . ASP D  4  13  ? -15.647 -75.402 11.181  1.00 0.00 ? 13  ASP D CB  1 
ATOM   5113  C CG  . ASP D  4  13  ? -14.488 -76.181 10.532  1.00 0.00 ? 13  ASP D CG  1 
ATOM   5114  O OD1 . ASP D  4  13  ? -14.736 -77.128 9.740   1.00 0.00 ? 13  ASP D OD1 1 
ATOM   5115  O OD2 . ASP D  4  13  ? -13.319 -75.827 10.841  1.00 0.00 ? 13  ASP D OD2 1 
ATOM   5116  N N   . GLY D  4  14  ? -17.269 -72.788 10.347  1.00 0.00 ? 14  GLY D N   1 
ATOM   5117  C CA  . GLY D  4  14  ? -17.862 -71.554 10.805  1.00 0.00 ? 14  GLY D CA  1 
ATOM   5118  C C   . GLY D  4  14  ? -16.858 -70.843 11.667  1.00 0.00 ? 14  GLY D C   1 
ATOM   5119  O O   . GLY D  4  14  ? -16.989 -69.655 11.948  1.00 0.00 ? 14  GLY D O   1 
ATOM   5120  N N   . HIS D  4  15  ? -15.774 -71.563 12.047  1.00 0.00 ? 15  HIS D N   1 
ATOM   5121  C CA  . HIS D  4  15  ? -14.621 -71.066 12.742  1.00 0.00 ? 15  HIS D CA  1 
ATOM   5122  C C   . HIS D  4  15  ? -13.803 -70.294 11.770  1.00 0.00 ? 15  HIS D C   1 
ATOM   5123  O O   . HIS D  4  15  ? -14.118 -70.226 10.587  1.00 0.00 ? 15  HIS D O   1 
ATOM   5124  C CB  . HIS D  4  15  ? -13.737 -72.188 13.316  1.00 0.00 ? 15  HIS D CB  1 
ATOM   5125  C CG  . HIS D  4  15  ? -14.304 -72.822 14.545  1.00 0.00 ? 15  HIS D CG  1 
ATOM   5126  N ND1 . HIS D  4  15  ? -15.571 -73.345 14.657  1.00 0.00 ? 15  HIS D ND1 1 
ATOM   5127  C CD2 . HIS D  4  15  ? -13.702 -73.042 15.743  1.00 0.00 ? 15  HIS D CD2 1 
ATOM   5128  C CE1 . HIS D  4  15  ? -15.668 -73.853 15.909  1.00 0.00 ? 15  HIS D CE1 1 
ATOM   5129  N NE2 . HIS D  4  15  ? -14.559 -73.696 16.604  1.00 0.00 ? 15  HIS D NE2 1 
ATOM   5130  N N   . LEU D  4  16  ? -12.773 -69.598 12.285  1.00 0.00 ? 16  LEU D N   1 
ATOM   5131  C CA  . LEU D  4  16  ? -11.825 -68.872 11.491  1.00 0.00 ? 16  LEU D CA  1 
ATOM   5132  C C   . LEU D  4  16  ? -10.549 -69.528 11.827  1.00 0.00 ? 16  LEU D C   1 
ATOM   5133  O O   . LEU D  4  16  ? -10.315 -69.851 12.983  1.00 0.00 ? 16  LEU D O   1 
ATOM   5134  C CB  . LEU D  4  16  ? -11.782 -67.401 11.908  1.00 0.00 ? 16  LEU D CB  1 
ATOM   5135  C CG  . LEU D  4  16  ? -13.061 -66.636 11.541  1.00 0.00 ? 16  LEU D CG  1 
ATOM   5136  C CD1 . LEU D  4  16  ? -13.272 -65.406 12.437  1.00 0.00 ? 16  LEU D CD1 1 
ATOM   5137  C CD2 . LEU D  4  16  ? -13.060 -66.260 10.060  1.00 0.00 ? 16  LEU D CD2 1 
ATOM   5138  N N   . PHE D  4  17  ? -9.734  -69.833 10.805  1.00 0.00 ? 17  PHE D N   1 
ATOM   5139  C CA  . PHE D  4  17  ? -8.536  -70.611 10.973  1.00 0.00 ? 17  PHE D CA  1 
ATOM   5140  C C   . PHE D  4  17  ? -7.496  -69.905 11.777  1.00 0.00 ? 17  PHE D C   1 
ATOM   5141  O O   . PHE D  4  17  ? -7.036  -70.397 12.800  1.00 0.00 ? 17  PHE D O   1 
ATOM   5142  C CB  . PHE D  4  17  ? -7.906  -70.982 9.619   1.00 0.00 ? 17  PHE D CB  1 
ATOM   5143  C CG  . PHE D  4  17  ? -8.790  -71.920 8.872   1.00 0.00 ? 17  PHE D CG  1 
ATOM   5144  C CD1 . PHE D  4  17  ? -9.207  -73.126 9.452   1.00 0.00 ? 17  PHE D CD1 1 
ATOM   5145  C CD2 . PHE D  4  17  ? -9.164  -71.637 7.552   1.00 0.00 ? 17  PHE D CD2 1 
ATOM   5146  C CE1 . PHE D  4  17  ? -9.983  -74.034 8.726   1.00 0.00 ? 17  PHE D CE1 1 
ATOM   5147  C CE2 . PHE D  4  17  ? -9.928  -72.550 6.814   1.00 0.00 ? 17  PHE D CE2 1 
ATOM   5148  C CZ  . PHE D  4  17  ? -10.335 -73.753 7.400   1.00 0.00 ? 17  PHE D CZ  1 
ATOM   5149  N N   . GLN D  4  18  ? -7.101  -68.704 11.341  1.00 0.00 ? 18  GLN D N   1 
ATOM   5150  C CA  . GLN D  4  18  ? -5.966  -68.021 11.894  1.00 0.00 ? 18  GLN D CA  1 
ATOM   5151  C C   . GLN D  4  18  ? -6.191  -67.635 13.321  1.00 0.00 ? 18  GLN D C   1 
ATOM   5152  O O   . GLN D  4  18  ? -5.262  -67.585 14.126  1.00 0.00 ? 18  GLN D O   1 
ATOM   5153  C CB  . GLN D  4  18  ? -5.580  -66.793 11.058  1.00 0.00 ? 18  GLN D CB  1 
ATOM   5154  C CG  . GLN D  4  18  ? -5.735  -66.994 9.534   1.00 0.00 ? 18  GLN D CG  1 
ATOM   5155  C CD  . GLN D  4  18  ? -4.968  -68.200 8.979   1.00 0.00 ? 18  GLN D CD  1 
ATOM   5156  O OE1 . GLN D  4  18  ? -3.981  -68.668 9.555   1.00 0.00 ? 18  GLN D OE1 1 
ATOM   5157  N NE2 . GLN D  4  18  ? -5.454  -68.706 7.803   1.00 0.00 ? 18  GLN D NE2 1 
ATOM   5158  N N   . VAL D  4  19  ? -7.473  -67.363 13.645  1.00 0.00 ? 19  VAL D N   1 
ATOM   5159  C CA  . VAL D  4  19  ? -7.924  -66.917 14.927  1.00 0.00 ? 19  VAL D CA  1 
ATOM   5160  C C   . VAL D  4  19  ? -7.825  -68.021 15.921  1.00 0.00 ? 19  VAL D C   1 
ATOM   5161  O O   . VAL D  4  19  ? -7.288  -67.795 16.994  1.00 0.00 ? 19  VAL D O   1 
ATOM   5162  C CB  . VAL D  4  19  ? -9.317  -66.341 14.890  1.00 0.00 ? 19  VAL D CB  1 
ATOM   5163  C CG1 . VAL D  4  19  ? -9.645  -65.727 16.261  1.00 0.00 ? 19  VAL D CG1 1 
ATOM   5164  C CG2 . VAL D  4  19  ? -9.365  -65.267 13.783  1.00 0.00 ? 19  VAL D CG2 1 
ATOM   5165  N N   . GLU D  4  20  ? -8.339  -69.239 15.621  1.00 0.00 ? 20  GLU D N   1 
ATOM   5166  C CA  . GLU D  4  20  ? -8.252  -70.355 16.540  1.00 0.00 ? 20  GLU D CA  1 
ATOM   5167  C C   . GLU D  4  20  ? -6.816  -70.784 16.751  1.00 0.00 ? 20  GLU D C   1 
ATOM   5168  O O   . GLU D  4  20  ? -6.428  -71.175 17.851  1.00 0.00 ? 20  GLU D O   1 
ATOM   5169  C CB  . GLU D  4  20  ? -9.117  -71.570 16.089  1.00 0.00 ? 20  GLU D CB  1 
ATOM   5170  C CG  . GLU D  4  20  ? -8.763  -72.147 14.702  1.00 0.00 ? 20  GLU D CG  1 
ATOM   5171  C CD  . GLU D  4  20  ? -9.710  -73.225 14.167  1.00 0.00 ? 20  GLU D CD  1 
ATOM   5172  O OE1 . GLU D  4  20  ? -10.517 -73.790 14.944  1.00 0.00 ? 20  GLU D OE1 1 
ATOM   5173  O OE2 . GLU D  4  20  ? -9.619  -73.503 12.945  1.00 0.00 ? 20  GLU D OE2 1 
ATOM   5174  N N   . TYR D  4  21  ? -5.963  -70.681 15.704  1.00 0.00 ? 21  TYR D N   1 
ATOM   5175  C CA  . TYR D  4  21  ? -4.549  -70.972 15.805  1.00 0.00 ? 21  TYR D CA  1 
ATOM   5176  C C   . TYR D  4  21  ? -3.847  -70.027 16.712  1.00 0.00 ? 21  TYR D C   1 
ATOM   5177  O O   . TYR D  4  21  ? -2.957  -70.434 17.449  1.00 0.00 ? 21  TYR D O   1 
ATOM   5178  C CB  . TYR D  4  21  ? -3.810  -70.876 14.464  1.00 0.00 ? 21  TYR D CB  1 
ATOM   5179  C CG  . TYR D  4  21  ? -4.379  -71.776 13.405  1.00 0.00 ? 21  TYR D CG  1 
ATOM   5180  C CD1 . TYR D  4  21  ? -5.011  -73.003 13.663  1.00 0.00 ? 21  TYR D CD1 1 
ATOM   5181  C CD2 . TYR D  4  21  ? -4.238  -71.364 12.076  1.00 0.00 ? 21  TYR D CD2 1 
ATOM   5182  C CE1 . TYR D  4  21  ? -5.440  -73.812 12.604  1.00 0.00 ? 21  TYR D CE1 1 
ATOM   5183  C CE2 . TYR D  4  21  ? -4.670  -72.159 11.019  1.00 0.00 ? 21  TYR D CE2 1 
ATOM   5184  C CZ  . TYR D  4  21  ? -5.255  -73.401 11.277  1.00 0.00 ? 21  TYR D CZ  1 
ATOM   5185  O OH  . TYR D  4  21  ? -5.645  -74.224 10.196  1.00 0.00 ? 21  TYR D OH  1 
ATOM   5186  N N   . ALA D  4  22  ? -4.253  -68.746 16.678  1.00 0.00 ? 22  ALA D N   1 
ATOM   5187  C CA  . ALA D  4  22  ? -3.781  -67.709 17.555  1.00 0.00 ? 22  ALA D CA  1 
ATOM   5188  C C   . ALA D  4  22  ? -4.203  -67.949 18.977  1.00 0.00 ? 22  ALA D C   1 
ATOM   5189  O O   . ALA D  4  22  ? -3.453  -67.591 19.876  1.00 0.00 ? 22  ALA D O   1 
ATOM   5190  C CB  . ALA D  4  22  ? -4.223  -66.312 17.116  1.00 0.00 ? 22  ALA D CB  1 
ATOM   5191  N N   . GLN D  4  23  ? -5.388  -68.581 19.225  1.00 0.00 ? 23  GLN D N   1 
ATOM   5192  C CA  . GLN D  4  23  ? -5.869  -68.949 20.546  1.00 0.00 ? 23  GLN D CA  1 
ATOM   5193  C C   . GLN D  4  23  ? -4.981  -69.983 21.154  1.00 0.00 ? 23  GLN D C   1 
ATOM   5194  O O   . GLN D  4  23  ? -4.768  -69.992 22.361  1.00 0.00 ? 23  GLN D O   1 
ATOM   5195  C CB  . GLN D  4  23  ? -7.271  -69.603 20.607  1.00 0.00 ? 23  GLN D CB  1 
ATOM   5196  C CG  . GLN D  4  23  ? -8.438  -68.748 20.103  1.00 0.00 ? 23  GLN D CG  1 
ATOM   5197  C CD  . GLN D  4  23  ? -8.513  -67.447 20.893  1.00 0.00 ? 23  GLN D CD  1 
ATOM   5198  O OE1 . GLN D  4  23  ? -8.467  -67.452 22.130  1.00 0.00 ? 23  GLN D OE1 1 
ATOM   5199  N NE2 . GLN D  4  23  ? -8.637  -66.313 20.139  1.00 0.00 ? 23  GLN D NE2 1 
ATOM   5200  N N   . GLU D  4  24  ? -4.442  -70.896 20.319  1.00 0.00 ? 24  GLU D N   1 
ATOM   5201  C CA  . GLU D  4  24  ? -3.498  -71.896 20.784  1.00 0.00 ? 24  GLU D CA  1 
ATOM   5202  C C   . GLU D  4  24  ? -2.094  -71.363 20.903  1.00 0.00 ? 24  GLU D C   1 
ATOM   5203  O O   . GLU D  4  24  ? -1.248  -72.005 21.509  1.00 0.00 ? 24  GLU D O   1 
ATOM   5204  C CB  . GLU D  4  24  ? -3.446  -73.127 19.847  1.00 0.00 ? 24  GLU D CB  1 
ATOM   5205  C CG  . GLU D  4  24  ? -4.818  -73.790 19.616  1.00 0.00 ? 24  GLU D CG  1 
ATOM   5206  C CD  . GLU D  4  24  ? -5.467  -74.193 20.938  1.00 0.00 ? 24  GLU D CD  1 
ATOM   5207  O OE1 . GLU D  4  24  ? -4.912  -75.084 21.631  1.00 0.00 ? 24  GLU D OE1 1 
ATOM   5208  O OE2 . GLU D  4  24  ? -6.535  -73.621 21.275  1.00 0.00 ? 24  GLU D OE2 1 
ATOM   5209  N N   . ALA D  4  25  ? -1.805  -70.175 20.337  1.00 0.00 ? 25  ALA D N   1 
ATOM   5210  C CA  . ALA D  4  25  ? -0.507  -69.561 20.372  1.00 0.00 ? 25  ALA D CA  1 
ATOM   5211  C C   . ALA D  4  25  ? -0.313  -68.861 21.686  1.00 0.00 ? 25  ALA D C   1 
ATOM   5212  O O   . ALA D  4  25  ? 0.766   -68.922 22.266  1.00 0.00 ? 25  ALA D O   1 
ATOM   5213  C CB  . ALA D  4  25  ? -0.290  -68.559 19.235  1.00 0.00 ? 25  ALA D CB  1 
ATOM   5214  N N   . VAL D  4  26  ? -1.365  -68.233 22.249  1.00 0.00 ? 26  VAL D N   1 
ATOM   5215  C CA  . VAL D  4  26  ? -1.275  -67.647 23.566  1.00 0.00 ? 26  VAL D CA  1 
ATOM   5216  C C   . VAL D  4  26  ? -1.153  -68.696 24.646  1.00 0.00 ? 26  VAL D C   1 
ATOM   5217  O O   . VAL D  4  26  ? -0.606  -68.456 25.715  1.00 0.00 ? 26  VAL D O   1 
ATOM   5218  C CB  . VAL D  4  26  ? -2.411  -66.676 23.865  1.00 0.00 ? 26  VAL D CB  1 
ATOM   5219  C CG1 . VAL D  4  26  ? -3.769  -67.264 23.459  1.00 0.00 ? 26  VAL D CG1 1 
ATOM   5220  C CG2 . VAL D  4  26  ? -2.377  -66.244 25.345  1.00 0.00 ? 26  VAL D CG2 1 
ATOM   5221  N N   . LYS D  4  27  ? -1.636  -69.919 24.389  1.00 0.00 ? 27  LYS D N   1 
ATOM   5222  C CA  . LYS D  4  27  ? -1.523  -71.007 25.315  1.00 0.00 ? 27  LYS D CA  1 
ATOM   5223  C C   . LYS D  4  27  ? -0.106  -71.448 25.522  1.00 0.00 ? 27  LYS D C   1 
ATOM   5224  O O   . LYS D  4  27  ? 0.184   -72.081 26.526  1.00 0.00 ? 27  LYS D O   1 
ATOM   5225  C CB  . LYS D  4  27  ? -2.392  -72.201 24.875  1.00 0.00 ? 27  LYS D CB  1 
ATOM   5226  C CG  . LYS D  4  27  ? -3.886  -71.911 25.080  1.00 0.00 ? 27  LYS D CG  1 
ATOM   5227  C CD  . LYS D  4  27  ? -4.805  -73.014 24.550  1.00 0.00 ? 27  LYS D CD  1 
ATOM   5228  C CE  . LYS D  4  27  ? -6.259  -72.907 25.035  1.00 0.00 ? 27  LYS D CE  1 
ATOM   5229  N NZ  . LYS D  4  27  ? -6.859  -71.589 24.729  1.00 0.00 ? 27  LYS D NZ  1 
ATOM   5230  N N   . LYS D  4  28  ? 0.801   -71.138 24.573  1.00 0.00 ? 28  LYS D N   1 
ATOM   5231  C CA  . LYS D  4  28  ? 2.215   -71.403 24.660  1.00 0.00 ? 28  LYS D CA  1 
ATOM   5232  C C   . LYS D  4  28  ? 2.940   -70.338 25.428  1.00 0.00 ? 28  LYS D C   1 
ATOM   5233  O O   . LYS D  4  28  ? 4.050   -70.570 25.897  1.00 0.00 ? 28  LYS D O   1 
ATOM   5234  C CB  . LYS D  4  28  ? 2.855   -71.455 23.267  1.00 0.00 ? 28  LYS D CB  1 
ATOM   5235  C CG  . LYS D  4  28  ? 2.224   -72.518 22.361  1.00 0.00 ? 28  LYS D CG  1 
ATOM   5236  C CD  . LYS D  4  28  ? 2.650   -72.359 20.898  1.00 0.00 ? 28  LYS D CD  1 
ATOM   5237  C CE  . LYS D  4  28  ? 2.183   -73.515 20.016  1.00 0.00 ? 28  LYS D CE  1 
ATOM   5238  N NZ  . LYS D  4  28  ? 0.714   -73.678 20.060  1.00 0.00 ? 28  LYS D NZ  1 
ATOM   5239  N N   . GLY D  4  29  ? 2.290   -69.174 25.661  1.00 0.00 ? 29  GLY D N   1 
ATOM   5240  C CA  . GLY D  4  29  ? 2.828   -68.070 26.419  1.00 0.00 ? 29  GLY D CA  1 
ATOM   5241  C C   . GLY D  4  29  ? 2.859   -68.450 27.857  1.00 0.00 ? 29  GLY D C   1 
ATOM   5242  O O   . GLY D  4  29  ? 2.483   -69.557 28.203  1.00 0.00 ? 29  GLY D O   1 
ATOM   5243  N N   . SER D  4  30  ? 3.405   -67.588 28.730  1.00 0.00 ? 30  SER D N   1 
ATOM   5244  C CA  . SER D  4  30  ? 3.576   -67.927 30.119  1.00 0.00 ? 30  SER D CA  1 
ATOM   5245  C C   . SER D  4  30  ? 2.450   -67.401 30.917  1.00 0.00 ? 30  SER D C   1 
ATOM   5246  O O   . SER D  4  30  ? 1.727   -66.541 30.432  1.00 0.00 ? 30  SER D O   1 
ATOM   5247  C CB  . SER D  4  30  ? 4.872   -67.373 30.696  1.00 0.00 ? 30  SER D CB  1 
ATOM   5248  O OG  . SER D  4  30  ? 5.979   -67.897 29.985  1.00 0.00 ? 30  SER D OG  1 
ATOM   5249  N N   . THR D  4  31  ? 2.355   -67.869 32.161  1.00 0.00 ? 31  THR D N   1 
ATOM   5250  C CA  . THR D  4  31  ? 1.153   -67.786 32.971  1.00 0.00 ? 31  THR D CA  1 
ATOM   5251  C C   . THR D  4  31  ? 0.999   -66.439 33.638  1.00 0.00 ? 31  THR D C   1 
ATOM   5252  O O   . THR D  4  31  ? 1.343   -66.232 34.799  1.00 0.00 ? 31  THR D O   1 
ATOM   5253  C CB  . THR D  4  31  ? 1.140   -68.867 34.053  1.00 0.00 ? 31  THR D CB  1 
ATOM   5254  O OG1 . THR D  4  31  ? 1.392   -70.140 33.449  1.00 0.00 ? 31  THR D OG1 1 
ATOM   5255  C CG2 . THR D  4  31  ? -0.210  -68.895 34.747  1.00 0.00 ? 31  THR D CG2 1 
ATOM   5256  N N   . ALA D  4  32  ? 0.444   -65.538 32.846  1.00 0.00 ? 32  ALA D N   1 
ATOM   5257  C CA  . ALA D  4  32  ? 0.178   -64.190 33.182  1.00 0.00 ? 32  ALA D CA  1 
ATOM   5258  C C   . ALA D  4  32  ? -1.049  -64.192 33.996  1.00 0.00 ? 32  ALA D C   1 
ATOM   5259  O O   . ALA D  4  32  ? -2.136  -64.088 33.446  1.00 0.00 ? 32  ALA D O   1 
ATOM   5260  C CB  . ALA D  4  32  ? 0.014   -63.288 31.957  1.00 0.00 ? 32  ALA D CB  1 
ATOM   5261  N N   . VAL D  4  33  ? -0.876  -64.347 35.321  1.00 0.00 ? 33  VAL D N   1 
ATOM   5262  C CA  . VAL D  4  33  ? -1.863  -64.284 36.362  1.00 0.00 ? 33  VAL D CA  1 
ATOM   5263  C C   . VAL D  4  33  ? -2.171  -62.840 36.597  1.00 0.00 ? 33  VAL D C   1 
ATOM   5264  O O   . VAL D  4  33  ? -1.358  -61.971 36.307  1.00 0.00 ? 33  VAL D O   1 
ATOM   5265  C CB  . VAL D  4  33  ? -1.426  -65.015 37.632  1.00 0.00 ? 33  VAL D CB  1 
ATOM   5266  C CG1 . VAL D  4  33  ? -0.313  -64.266 38.372  1.00 0.00 ? 33  VAL D CG1 1 
ATOM   5267  C CG2 . VAL D  4  33  ? -2.605  -65.323 38.569  1.00 0.00 ? 33  VAL D CG2 1 
ATOM   5268  N N   . GLY D  4  34  ? -3.398  -62.581 36.999  1.00 0.00 ? 34  GLY D N   1 
ATOM   5269  C CA  . GLY D  4  34  ? -3.778  -61.255 37.398  1.00 0.00 ? 34  GLY D CA  1 
ATOM   5270  C C   . GLY D  4  34  ? -4.948  -61.400 38.323  1.00 0.00 ? 34  GLY D C   1 
ATOM   5271  O O   . GLY D  4  34  ? -5.717  -62.357 38.233  1.00 0.00 ? 34  GLY D O   1 
ATOM   5272  N N   . VAL D  4  35  ? -5.103  -60.431 39.203  1.00 0.00 ? 35  VAL D N   1 
ATOM   5273  C CA  . VAL D  4  35  ? -6.342  -60.292 39.915  1.00 0.00 ? 35  VAL D CA  1 
ATOM   5274  C C   . VAL D  4  35  ? -6.531  -58.859 40.295  1.00 0.00 ? 35  VAL D C   1 
ATOM   5275  O O   . VAL D  4  35  ? -5.609  -58.059 40.435  1.00 0.00 ? 35  VAL D O   1 
ATOM   5276  C CB  . VAL D  4  35  ? -6.465  -61.125 41.176  1.00 0.00 ? 35  VAL D CB  1 
ATOM   5277  C CG1 . VAL D  4  35  ? -6.474  -62.604 40.762  1.00 0.00 ? 35  VAL D CG1 1 
ATOM   5278  C CG2 . VAL D  4  35  ? -5.350  -60.805 42.187  1.00 0.00 ? 35  VAL D CG2 1 
ATOM   5279  N N   . ARG D  4  36  ? -7.813  -58.504 40.315  1.00 0.00 ? 36  ARG D N   1 
ATOM   5280  C CA  . ARG D  4  36  ? -8.242  -57.160 40.638  1.00 0.00 ? 36  ARG D CA  1 
ATOM   5281  C C   . ARG D  4  36  ? -8.437  -57.136 42.132  1.00 0.00 ? 36  ARG D C   1 
ATOM   5282  O O   . ARG D  4  36  ? -9.521  -57.411 42.646  1.00 0.00 ? 36  ARG D O   1 
ATOM   5283  C CB  . ARG D  4  36  ? -9.552  -56.826 39.925  1.00 0.00 ? 36  ARG D CB  1 
ATOM   5284  C CG  . ARG D  4  36  ? -10.019 -55.393 40.124  1.00 0.00 ? 36  ARG D CG  1 
ATOM   5285  C CD  . ARG D  4  36  ? -11.495 -55.242 39.795  1.00 0.00 ? 36  ARG D CD  1 
ATOM   5286  N NE  . ARG D  4  36  ? -12.320 -56.199 40.528  1.00 0.00 ? 36  ARG D NE  1 
ATOM   5287  C CZ  . ARG D  4  36  ? -13.070 -55.887 41.580  1.00 0.00 ? 36  ARG D CZ  1 
ATOM   5288  N NH1 . ARG D  4  36  ? -13.103 -54.639 42.026  1.00 0.00 ? 36  ARG D NH1 1 
ATOM   5289  N NH2 . ARG D  4  36  ? -13.787 -56.823 42.185  1.00 0.00 ? 36  ARG D NH2 1 
ATOM   5290  N N   . GLY D  4  37  ? -7.360  -56.805 42.823  1.00 0.00 ? 37  GLY D N   1 
ATOM   5291  C CA  . GLY D  4  37  ? -7.354  -56.780 44.271  1.00 0.00 ? 37  GLY D CA  1 
ATOM   5292  C C   . GLY D  4  37  ? -8.212  -55.663 44.678  1.00 0.00 ? 37  GLY D C   1 
ATOM   5293  O O   . GLY D  4  37  ? -8.201  -54.637 44.013  1.00 0.00 ? 37  GLY D O   1 
ATOM   5294  N N   . ARG D  4  38  ? -9.033  -55.854 45.728  1.00 0.00 ? 38  ARG D N   1 
ATOM   5295  C CA  . ARG D  4  38  ? -9.999  -54.864 46.133  1.00 0.00 ? 38  ARG D CA  1 
ATOM   5296  C C   . ARG D  4  38  ? -9.332  -53.552 46.500  1.00 0.00 ? 38  ARG D C   1 
ATOM   5297  O O   . ARG D  4  38  ? -9.827  -52.474 46.176  1.00 0.00 ? 38  ARG D O   1 
ATOM   5298  C CB  . ARG D  4  38  ? -10.907 -55.398 47.275  1.00 0.00 ? 38  ARG D CB  1 
ATOM   5299  C CG  . ARG D  4  38  ? -10.206 -55.642 48.624  1.00 0.00 ? 38  ARG D CG  1 
ATOM   5300  C CD  . ARG D  4  38  ? -11.119 -56.241 49.691  1.00 0.00 ? 38  ARG D CD  1 
ATOM   5301  N NE  . ARG D  4  38  ? -10.440 -56.067 51.009  1.00 0.00 ? 38  ARG D NE  1 
ATOM   5302  C CZ  . ARG D  4  38  ? -10.992 -56.456 52.197  1.00 0.00 ? 38  ARG D CZ  1 
ATOM   5303  N NH1 . ARG D  4  38  ? -12.206 -57.070 52.246  1.00 0.00 ? 38  ARG D NH1 1 
ATOM   5304  N NH2 . ARG D  4  38  ? -10.314 -56.231 53.358  1.00 0.00 ? 38  ARG D NH2 1 
ATOM   5305  N N   . ASP D  4  39  ? -8.149  -53.638 47.146  1.00 0.00 ? 39  ASP D N   1 
ATOM   5306  C CA  . ASP D  4  39  ? -7.348  -52.507 47.502  1.00 0.00 ? 39  ASP D CA  1 
ATOM   5307  C C   . ASP D  4  39  ? -6.768  -51.858 46.266  1.00 0.00 ? 39  ASP D C   1 
ATOM   5308  O O   . ASP D  4  39  ? -6.911  -50.654 46.067  1.00 0.00 ? 39  ASP D O   1 
ATOM   5309  C CB  . ASP D  4  39  ? -6.149  -52.901 48.429  1.00 0.00 ? 39  ASP D CB  1 
ATOM   5310  C CG  . ASP D  4  39  ? -6.467  -54.026 49.423  1.00 0.00 ? 39  ASP D CG  1 
ATOM   5311  O OD1 . ASP D  4  39  ? -7.360  -53.841 50.284  1.00 0.00 ? 39  ASP D OD1 1 
ATOM   5312  O OD2 . ASP D  4  39  ? -5.803  -55.090 49.329  1.00 0.00 ? 39  ASP D OD2 1 
ATOM   5313  N N   . ILE D  4  40  ? -6.033  -52.679 45.468  1.00 0.00 ? 40  ILE D N   1 
ATOM   5314  C CA  . ILE D  4  40  ? -5.221  -52.289 44.337  1.00 0.00 ? 40  ILE D CA  1 
ATOM   5315  C C   . ILE D  4  40  ? -5.105  -53.470 43.393  1.00 0.00 ? 40  ILE D C   1 
ATOM   5316  O O   . ILE D  4  40  ? -5.331  -54.601 43.795  1.00 0.00 ? 40  ILE D O   1 
ATOM   5317  C CB  . ILE D  4  40  ? -3.802  -51.863 44.778  1.00 0.00 ? 40  ILE D CB  1 
ATOM   5318  C CG1 . ILE D  4  40  ? -3.684  -50.700 45.823  1.00 0.00 ? 40  ILE D CG1 1 
ATOM   5319  C CG2 . ILE D  4  40  ? -2.988  -51.465 43.521  1.00 0.00 ? 40  ILE D CG2 1 
ATOM   5320  C CD1 . ILE D  4  40  ? -4.268  -49.321 45.511  1.00 0.00 ? 40  ILE D CD1 1 
ATOM   5321  N N   . VAL D  4  41  ? -4.764  -53.253 42.092  1.00 0.00 ? 41  VAL D N   1 
ATOM   5322  C CA  . VAL D  4  41  ? -4.498  -54.339 41.150  1.00 0.00 ? 41  VAL D CA  1 
ATOM   5323  C C   . VAL D  4  41  ? -3.183  -54.994 41.424  1.00 0.00 ? 41  VAL D C   1 
ATOM   5324  O O   . VAL D  4  41  ? -2.260  -54.368 41.923  1.00 0.00 ? 41  VAL D O   1 
ATOM   5325  C CB  . VAL D  4  41  ? -4.479  -53.934 39.677  1.00 0.00 ? 41  VAL D CB  1 
ATOM   5326  C CG1 . VAL D  4  41  ? -5.855  -53.358 39.301  1.00 0.00 ? 41  VAL D CG1 1 
ATOM   5327  C CG2 . VAL D  4  41  ? -3.344  -52.936 39.389  1.00 0.00 ? 41  VAL D CG2 1 
ATOM   5328  N N   . VAL D  4  42  ? -3.064  -56.282 41.074  1.00 0.00 ? 42  VAL D N   1 
ATOM   5329  C CA  . VAL D  4  42  ? -1.810  -56.968 41.153  1.00 0.00 ? 42  VAL D CA  1 
ATOM   5330  C C   . VAL D  4  42  ? -1.849  -57.936 40.019  1.00 0.00 ? 42  VAL D C   1 
ATOM   5331  O O   . VAL D  4  42  ? -2.902  -58.402 39.612  1.00 0.00 ? 42  VAL D O   1 
ATOM   5332  C CB  . VAL D  4  42  ? -1.548  -57.644 42.491  1.00 0.00 ? 42  VAL D CB  1 
ATOM   5333  C CG1 . VAL D  4  42  ? -2.655  -58.645 42.802  1.00 0.00 ? 42  VAL D CG1 1 
ATOM   5334  C CG2 . VAL D  4  42  ? -0.151  -58.295 42.558  1.00 0.00 ? 42  VAL D CG2 1 
ATOM   5335  N N   . LEU D  4  43  ? -0.691  -58.167 39.394  1.00 0.00 ? 43  LEU D N   1 
ATOM   5336  C CA  . LEU D  4  43  ? -0.595  -58.920 38.199  1.00 0.00 ? 43  LEU D CA  1 
ATOM   5337  C C   . LEU D  4  43  ? 0.767   -59.469 38.209  1.00 0.00 ? 43  LEU D C   1 
ATOM   5338  O O   . LEU D  4  43  ? 1.644   -58.943 38.880  1.00 0.00 ? 43  LEU D O   1 
ATOM   5339  C CB  . LEU D  4  43  ? -0.854  -58.092 36.924  1.00 0.00 ? 43  LEU D CB  1 
ATOM   5340  C CG  . LEU D  4  43  ? -0.219  -56.676 36.856  1.00 0.00 ? 43  LEU D CG  1 
ATOM   5341  C CD1 . LEU D  4  43  ? 1.316   -56.642 36.828  1.00 0.00 ? 43  LEU D CD1 1 
ATOM   5342  C CD2 . LEU D  4  43  ? -0.739  -55.919 35.622  1.00 0.00 ? 43  LEU D CD2 1 
ATOM   5343  N N   . GLY D  4  44  ? 1.006   -60.545 37.448  1.00 0.00 ? 44  GLY D N   1 
ATOM   5344  C CA  . GLY D  4  44  ? 2.340   -61.053 37.398  1.00 0.00 ? 44  GLY D CA  1 
ATOM   5345  C C   . GLY D  4  44  ? 2.417   -62.040 36.312  1.00 0.00 ? 44  GLY D C   1 
ATOM   5346  O O   . GLY D  4  44  ? 1.410   -62.435 35.746  1.00 0.00 ? 44  GLY D O   1 
ATOM   5347  N N   . VAL D  4  45  ? 3.652   -62.427 35.961  1.00 0.00 ? 45  VAL D N   1 
ATOM   5348  C CA  . VAL D  4  45  ? 3.958   -63.323 34.880  1.00 0.00 ? 45  VAL D CA  1 
ATOM   5349  C C   . VAL D  4  45  ? 4.948   -64.287 35.430  1.00 0.00 ? 45  VAL D C   1 
ATOM   5350  O O   . VAL D  4  45  ? 5.379   -64.121 36.567  1.00 0.00 ? 45  VAL D O   1 
ATOM   5351  C CB  . VAL D  4  45  ? 4.468   -62.611 33.635  1.00 0.00 ? 45  VAL D CB  1 
ATOM   5352  C CG1 . VAL D  4  45  ? 3.348   -61.655 33.164  1.00 0.00 ? 45  VAL D CG1 1 
ATOM   5353  C CG2 . VAL D  4  45  ? 5.793   -61.856 33.899  1.00 0.00 ? 45  VAL D CG2 1 
ATOM   5354  N N   . GLU D  4  46  ? 5.341   -65.322 34.656  1.00 0.00 ? 46  GLU D N   1 
ATOM   5355  C CA  . GLU D  4  46  ? 6.228   -66.340 35.175  1.00 0.00 ? 46  GLU D CA  1 
ATOM   5356  C C   . GLU D  4  46  ? 6.971   -66.881 34.005  1.00 0.00 ? 46  GLU D C   1 
ATOM   5357  O O   . GLU D  4  46  ? 6.704   -66.469 32.884  1.00 0.00 ? 46  GLU D O   1 
ATOM   5358  C CB  . GLU D  4  46  ? 5.510   -67.507 35.909  1.00 0.00 ? 46  GLU D CB  1 
ATOM   5359  C CG  . GLU D  4  46  ? 6.348   -68.160 37.042  1.00 0.00 ? 46  GLU D CG  1 
ATOM   5360  C CD  . GLU D  4  46  ? 5.640   -69.379 37.636  1.00 0.00 ? 46  GLU D CD  1 
ATOM   5361  O OE1 . GLU D  4  46  ? 4.507   -69.675 37.183  1.00 0.00 ? 46  GLU D OE1 1 
ATOM   5362  O OE2 . GLU D  4  46  ? 6.219   -70.023 38.549  1.00 0.00 ? 46  GLU D OE2 1 
ATOM   5363  N N   . LYS D  4  47  ? 7.902   -67.834 34.267  1.00 0.00 ? 47  LYS D N   1 
ATOM   5364  C CA  . LYS D  4  47  ? 8.759   -68.560 33.351  1.00 0.00 ? 47  LYS D CA  1 
ATOM   5365  C C   . LYS D  4  47  ? 9.574   -67.705 32.436  1.00 0.00 ? 47  LYS D C   1 
ATOM   5366  O O   . LYS D  4  47  ? 9.385   -67.694 31.222  1.00 0.00 ? 47  LYS D O   1 
ATOM   5367  C CB  . LYS D  4  47  ? 8.012   -69.643 32.550  1.00 0.00 ? 47  LYS D CB  1 
ATOM   5368  C CG  . LYS D  4  47  ? 7.387   -70.709 33.462  1.00 0.00 ? 47  LYS D CG  1 
ATOM   5369  C CD  . LYS D  4  47  ? 6.467   -71.691 32.736  1.00 0.00 ? 47  LYS D CD  1 
ATOM   5370  C CE  . LYS D  4  47  ? 5.235   -70.995 32.158  1.00 0.00 ? 47  LYS D CE  1 
ATOM   5371  N NZ  . LYS D  4  47  ? 4.246   -71.981 31.712  1.00 0.00 ? 47  LYS D NZ  1 
ATOM   5372  N N   . LYS D  4  48  ? 10.520  -66.955 33.031  1.00 0.00 ? 48  LYS D N   1 
ATOM   5373  C CA  . LYS D  4  48  ? 11.476  -66.160 32.309  1.00 0.00 ? 48  LYS D CA  1 
ATOM   5374  C C   . LYS D  4  48  ? 12.562  -67.002 31.676  1.00 0.00 ? 48  LYS D C   1 
ATOM   5375  O O   . LYS D  4  48  ? 13.220  -66.535 30.749  1.00 0.00 ? 48  LYS D O   1 
ATOM   5376  C CB  . LYS D  4  48  ? 12.161  -65.177 33.259  1.00 0.00 ? 48  LYS D CB  1 
ATOM   5377  C CG  . LYS D  4  48  ? 11.226  -64.076 33.757  1.00 0.00 ? 48  LYS D CG  1 
ATOM   5378  C CD  . LYS D  4  48  ? 11.709  -63.463 35.077  1.00 0.00 ? 48  LYS D CD  1 
ATOM   5379  C CE  . LYS D  4  48  ? 13.058  -62.734 35.043  1.00 0.00 ? 48  LYS D CE  1 
ATOM   5380  N NZ  . LYS D  4  48  ? 13.507  -62.394 36.413  1.00 0.00 ? 48  LYS D NZ  1 
ATOM   5381  N N   . SER D  4  49  ? 12.759  -68.253 32.174  1.00 0.00 ? 49  SER D N   1 
ATOM   5382  C CA  . SER D  4  49  ? 13.761  -69.217 31.773  1.00 0.00 ? 49  SER D CA  1 
ATOM   5383  C C   . SER D  4  49  ? 15.157  -68.689 31.917  1.00 0.00 ? 49  SER D C   1 
ATOM   5384  O O   . SER D  4  49  ? 15.921  -68.633 30.957  1.00 0.00 ? 49  SER D O   1 
ATOM   5385  C CB  . SER D  4  49  ? 13.532  -69.885 30.387  1.00 0.00 ? 49  SER D CB  1 
ATOM   5386  O OG  . SER D  4  49  ? 13.502  -68.963 29.307  1.00 0.00 ? 49  SER D OG  1 
ATOM   5387  N N   . VAL D  4  50  ? 15.491  -68.301 33.172  1.00 0.00 ? 50  VAL D N   1 
ATOM   5388  C CA  . VAL D  4  50  ? 16.732  -67.725 33.642  1.00 0.00 ? 50  VAL D CA  1 
ATOM   5389  C C   . VAL D  4  50  ? 17.912  -68.594 33.283  1.00 0.00 ? 50  VAL D C   1 
ATOM   5390  O O   . VAL D  4  50  ? 17.989  -69.735 33.735  1.00 0.00 ? 50  VAL D O   1 
ATOM   5391  C CB  . VAL D  4  50  ? 16.679  -67.539 35.163  1.00 0.00 ? 50  VAL D CB  1 
ATOM   5392  C CG1 . VAL D  4  50  ? 18.000  -66.980 35.739  1.00 0.00 ? 50  VAL D CG1 1 
ATOM   5393  C CG2 . VAL D  4  50  ? 15.497  -66.609 35.508  1.00 0.00 ? 50  VAL D CG2 1 
ATOM   5394  N N   . ALA D  4  51  ? 18.874  -68.031 32.499  1.00 0.00 ? 51  ALA D N   1 
ATOM   5395  C CA  . ALA D  4  51  ? 20.112  -68.684 32.135  1.00 0.00 ? 51  ALA D CA  1 
ATOM   5396  C C   . ALA D  4  51  ? 21.215  -68.075 32.957  1.00 0.00 ? 51  ALA D C   1 
ATOM   5397  O O   . ALA D  4  51  ? 22.291  -68.655 33.098  1.00 0.00 ? 51  ALA D O   1 
ATOM   5398  C CB  . ALA D  4  51  ? 20.477  -68.484 30.655  1.00 0.00 ? 51  ALA D CB  1 
ATOM   5399  N N   . LYS D  4  52  ? 20.908  -66.914 33.587  1.00 0.00 ? 52  LYS D N   1 
ATOM   5400  C CA  . LYS D  4  52  ? 21.757  -66.136 34.459  1.00 0.00 ? 52  LYS D CA  1 
ATOM   5401  C C   . LYS D  4  52  ? 22.818  -65.389 33.686  1.00 0.00 ? 52  LYS D C   1 
ATOM   5402  O O   . LYS D  4  52  ? 23.717  -64.769 34.254  1.00 0.00 ? 52  LYS D O   1 
ATOM   5403  C CB  . LYS D  4  52  ? 22.350  -66.974 35.622  1.00 0.00 ? 52  LYS D CB  1 
ATOM   5404  C CG  . LYS D  4  52  ? 22.561  -66.206 36.938  1.00 0.00 ? 52  LYS D CG  1 
ATOM   5405  C CD  . LYS D  4  52  ? 21.249  -65.889 37.679  1.00 0.00 ? 52  LYS D CD  1 
ATOM   5406  C CE  . LYS D  4  52  ? 21.451  -65.082 38.970  1.00 0.00 ? 52  LYS D CE  1 
ATOM   5407  N NZ  . LYS D  4  52  ? 22.320  -65.805 39.921  1.00 0.00 ? 52  LYS D NZ  1 
ATOM   5408  N N   . LEU D  4  53  ? 22.658  -65.388 32.346  1.00 0.00 ? 53  LEU D N   1 
ATOM   5409  C CA  . LEU D  4  53  ? 23.429  -64.642 31.398  1.00 0.00 ? 53  LEU D CA  1 
ATOM   5410  C C   . LEU D  4  53  ? 22.470  -63.638 30.852  1.00 0.00 ? 53  LEU D C   1 
ATOM   5411  O O   . LEU D  4  53  ? 22.602  -63.224 29.712  1.00 0.00 ? 53  LEU D O   1 
ATOM   5412  C CB  . LEU D  4  53  ? 23.936  -65.491 30.212  1.00 0.00 ? 53  LEU D CB  1 
ATOM   5413  C CG  . LEU D  4  53  ? 24.869  -66.657 30.598  1.00 0.00 ? 53  LEU D CG  1 
ATOM   5414  C CD1 . LEU D  4  53  ? 25.152  -67.535 29.365  1.00 0.00 ? 53  LEU D CD1 1 
ATOM   5415  C CD2 . LEU D  4  53  ? 26.176  -66.193 31.256  1.00 0.00 ? 53  LEU D CD2 1 
ATOM   5416  N N   . GLN D  4  54  ? 21.457  -63.238 31.652  1.00 0.00 ? 54  GLN D N   1 
ATOM   5417  C CA  . GLN D  4  54  ? 20.381  -62.402 31.216  1.00 0.00 ? 54  GLN D CA  1 
ATOM   5418  C C   . GLN D  4  54  ? 20.330  -61.194 32.092  1.00 0.00 ? 54  GLN D C   1 
ATOM   5419  O O   . GLN D  4  54  ? 20.776  -61.222 33.235  1.00 0.00 ? 54  GLN D O   1 
ATOM   5420  C CB  . GLN D  4  54  ? 19.040  -63.159 31.339  1.00 0.00 ? 54  GLN D CB  1 
ATOM   5421  C CG  . GLN D  4  54  ? 17.937  -62.688 30.380  1.00 0.00 ? 54  GLN D CG  1 
ATOM   5422  C CD  . GLN D  4  54  ? 18.365  -63.006 28.957  1.00 0.00 ? 54  GLN D CD  1 
ATOM   5423  O OE1 . GLN D  4  54  ? 17.669  -62.375 27.968  1.00 0.00 ? 54  GLN D OE1 1 
ATOM   5424  N NE2 . GLN D  4  54  ? 19.286  -63.795 28.739  1.00 0.00 ? 54  GLN D NE2 1 
ATOM   5425  N N   . CYS D  4  63  ? 4.103   -54.109 31.348  1.00 0.00 ? 63  CYS D N   1 
ATOM   5426  C CA  . CYS D  4  63  ? 4.274   -52.833 30.691  1.00 0.00 ? 63  CYS D CA  1 
ATOM   5427  C C   . CYS D  4  63  ? 3.369   -51.865 31.389  1.00 0.00 ? 63  CYS D C   1 
ATOM   5428  O O   . CYS D  4  63  ? 2.552   -52.246 32.217  1.00 0.00 ? 63  CYS D O   1 
ATOM   5429  C CB  . CYS D  4  63  ? 3.809   -52.780 29.234  1.00 0.00 ? 63  CYS D CB  1 
ATOM   5430  S SG  . CYS D  4  63  ? 4.859   -53.695 28.125  1.00 0.00 ? 63  CYS D SG  1 
ATOM   5431  N N   . ALA D  4  64  ? 3.533   -50.565 31.076  1.00 0.00 ? 64  ALA D N   1 
ATOM   5432  C CA  . ALA D  4  64  ? 2.734   -49.490 31.571  1.00 0.00 ? 64  ALA D CA  1 
ATOM   5433  C C   . ALA D  4  64  ? 2.437   -48.680 30.381  1.00 0.00 ? 64  ALA D C   1 
ATOM   5434  O O   . ALA D  4  64  ? 3.347   -48.353 29.633  1.00 0.00 ? 64  ALA D O   1 
ATOM   5435  C CB  . ALA D  4  64  ? 3.468   -48.604 32.578  1.00 0.00 ? 64  ALA D CB  1 
ATOM   5436  N N   . LEU D  4  65  ? 1.156   -48.339 30.155  1.00 0.00 ? 65  LEU D N   1 
ATOM   5437  C CA  . LEU D  4  65  ? 0.779   -47.555 29.012  1.00 0.00 ? 65  LEU D CA  1 
ATOM   5438  C C   . LEU D  4  65  ? 0.468   -46.162 29.441  1.00 0.00 ? 65  LEU D C   1 
ATOM   5439  O O   . LEU D  4  65  ? 0.443   -45.272 28.599  1.00 0.00 ? 65  LEU D O   1 
ATOM   5440  C CB  . LEU D  4  65  ? -0.495  -48.037 28.309  1.00 0.00 ? 65  LEU D CB  1 
ATOM   5441  C CG  . LEU D  4  65  ? -0.426  -49.416 27.635  1.00 0.00 ? 65  LEU D CG  1 
ATOM   5442  C CD1 . LEU D  4  65  ? -0.766  -50.559 28.587  1.00 0.00 ? 65  LEU D CD1 1 
ATOM   5443  C CD2 . LEU D  4  65  ? -1.379  -49.456 26.437  1.00 0.00 ? 65  LEU D CD2 1 
ATOM   5444  N N   . ASP D  4  66  ? 0.323   -45.936 30.763  1.00 0.00 ? 66  ASP D N   1 
ATOM   5445  C CA  . ASP D  4  66  ? -0.076  -44.688 31.350  1.00 0.00 ? 66  ASP D CA  1 
ATOM   5446  C C   . ASP D  4  66  ? 0.310   -44.832 32.780  1.00 0.00 ? 66  ASP D C   1 
ATOM   5447  O O   . ASP D  4  66  ? 0.887   -45.838 33.174  1.00 0.00 ? 66  ASP D O   1 
ATOM   5448  C CB  . ASP D  4  66  ? -1.589  -44.366 31.293  1.00 0.00 ? 66  ASP D CB  1 
ATOM   5449  C CG  . ASP D  4  66  ? -2.043  -44.113 29.860  1.00 0.00 ? 66  ASP D CG  1 
ATOM   5450  O OD1 . ASP D  4  66  ? -1.850  -42.975 29.357  1.00 0.00 ? 66  ASP D OD1 1 
ATOM   5451  O OD2 . ASP D  4  66  ? -2.590  -45.067 29.249  1.00 0.00 ? 66  ASP D OD2 1 
ATOM   5452  N N   . ASP D  4  67  ? -0.015  -43.821 33.613  1.00 0.00 ? 67  ASP D N   1 
ATOM   5453  C CA  . ASP D  4  67  ? 0.220   -43.865 35.034  1.00 0.00 ? 67  ASP D CA  1 
ATOM   5454  C C   . ASP D  4  67  ? -1.014  -44.420 35.715  1.00 0.00 ? 67  ASP D C   1 
ATOM   5455  O O   . ASP D  4  67  ? -1.083  -44.506 36.940  1.00 0.00 ? 67  ASP D O   1 
ATOM   5456  C CB  . ASP D  4  67  ? 0.566   -42.468 35.606  1.00 0.00 ? 67  ASP D CB  1 
ATOM   5457  C CG  . ASP D  4  67  ? 1.228   -42.531 36.993  1.00 0.00 ? 67  ASP D CG  1 
ATOM   5458  O OD1 . ASP D  4  67  ? 1.411   -43.649 37.542  1.00 0.00 ? 67  ASP D OD1 1 
ATOM   5459  O OD2 . ASP D  4  67  ? 1.562   -41.435 37.518  1.00 0.00 ? 67  ASP D OD2 1 
ATOM   5460  N N   . ASN D  4  68  ? -1.995  -44.799 34.895  1.00 0.00 ? 68  ASN D N   1 
ATOM   5461  C CA  . ASN D  4  68  ? -3.157  -45.563 35.339  1.00 0.00 ? 68  ASN D CA  1 
ATOM   5462  C C   . ASN D  4  68  ? -3.231  -46.946 34.676  1.00 0.00 ? 68  ASN D C   1 
ATOM   5463  O O   . ASN D  4  68  ? -3.252  -47.973 35.348  1.00 0.00 ? 68  ASN D O   1 
ATOM   5464  C CB  . ASN D  4  68  ? -4.434  -44.784 35.031  1.00 0.00 ? 68  ASN D CB  1 
ATOM   5465  C CG  . ASN D  4  68  ? -4.521  -44.366 33.572  1.00 0.00 ? 68  ASN D CG  1 
ATOM   5466  O OD1 . ASN D  4  68  ? -3.506  -44.091 32.933  1.00 0.00 ? 68  ASN D OD1 1 
ATOM   5467  N ND2 . ASN D  4  68  ? -5.739  -44.321 33.037  1.00 0.00 ? 68  ASN D ND2 1 
ATOM   5468  N N   . VAL D  4  69  ? -3.247  -46.956 33.346  1.00 0.00 ? 69  VAL D N   1 
ATOM   5469  C CA  . VAL D  4  69  ? -3.301  -48.168 32.578  1.00 0.00 ? 69  VAL D CA  1 
ATOM   5470  C C   . VAL D  4  69  ? -1.967  -48.839 32.551  1.00 0.00 ? 69  VAL D C   1 
ATOM   5471  O O   . VAL D  4  69  ? -0.941  -48.175 32.526  1.00 0.00 ? 69  VAL D O   1 
ATOM   5472  C CB  . VAL D  4  69  ? -3.762  -47.904 31.156  1.00 0.00 ? 69  VAL D CB  1 
ATOM   5473  C CG1 . VAL D  4  69  ? -4.148  -49.223 30.462  1.00 0.00 ? 69  VAL D CG1 1 
ATOM   5474  C CG2 . VAL D  4  69  ? -4.966  -46.935 31.182  1.00 0.00 ? 69  VAL D CG2 1 
ATOM   5475  N N   . CYS D  4  70  ? -1.968  -50.183 32.596  1.00 0.00 ? 70  CYS D N   1 
ATOM   5476  C CA  . CYS D  4  70  ? -0.817  -51.038 32.550  1.00 0.00 ? 70  CYS D CA  1 
ATOM   5477  C C   . CYS D  4  70  ? -1.204  -52.325 31.881  1.00 0.00 ? 70  CYS D C   1 
ATOM   5478  O O   . CYS D  4  70  ? -2.387  -52.565 31.688  1.00 0.00 ? 70  CYS D O   1 
ATOM   5479  C CB  . CYS D  4  70  ? -0.211  -51.293 33.928  1.00 0.00 ? 70  CYS D CB  1 
ATOM   5480  S SG  . CYS D  4  70  ? -1.418  -51.900 35.115  1.00 0.00 ? 70  CYS D SG  1 
ATOM   5481  N N   . MET D  4  71  ? -0.237  -53.174 31.470  1.00 0.00 ? 71  MET D N   1 
ATOM   5482  C CA  . MET D  4  71  ? -0.519  -54.321 30.641  1.00 0.00 ? 71  MET D CA  1 
ATOM   5483  C C   . MET D  4  71  ? 0.346   -55.460 31.036  1.00 0.00 ? 71  MET D C   1 
ATOM   5484  O O   . MET D  4  71  ? 1.472   -55.247 31.450  1.00 0.00 ? 71  MET D O   1 
ATOM   5485  C CB  . MET D  4  71  ? -0.332  -53.981 29.170  1.00 0.00 ? 71  MET D CB  1 
ATOM   5486  C CG  . MET D  4  71  ? -0.598  -55.086 28.156  1.00 0.00 ? 71  MET D CG  1 
ATOM   5487  S SD  . MET D  4  71  ? -1.120  -54.357 26.581  1.00 0.00 ? 71  MET D SD  1 
ATOM   5488  C CE  . MET D  4  71  ? -0.241  -55.422 25.402  1.00 0.00 ? 71  MET D CE  1 
ATOM   5489  N N   . ALA D  4  72  ? -0.164  -56.710 30.970  1.00 0.00 ? 72  ALA D N   1 
ATOM   5490  C CA  . ALA D  4  72  ? 0.556   -57.913 31.325  1.00 0.00 ? 72  ALA D CA  1 
ATOM   5491  C C   . ALA D  4  72  ? 0.226   -58.915 30.286  1.00 0.00 ? 72  ALA D C   1 
ATOM   5492  O O   . ALA D  4  72  ? -0.527  -59.847 30.522  1.00 0.00 ? 72  ALA D O   1 
ATOM   5493  C CB  . ALA D  4  72  ? 0.236   -58.519 32.698  1.00 0.00 ? 72  ALA D CB  1 
ATOM   5494  N N   . PHE D  4  73  ? 0.751   -58.734 29.068  1.00 0.00 ? 73  PHE D N   1 
ATOM   5495  C CA  . PHE D  4  73  ? 0.478   -59.608 27.962  1.00 0.00 ? 73  PHE D CA  1 
ATOM   5496  C C   . PHE D  4  73  ? 1.027   -60.994 28.162  1.00 0.00 ? 73  PHE D C   1 
ATOM   5497  O O   . PHE D  4  73  ? 2.077   -61.171 28.769  1.00 0.00 ? 73  PHE D O   1 
ATOM   5498  C CB  . PHE D  4  73  ? 0.976   -59.053 26.608  1.00 0.00 ? 73  PHE D CB  1 
ATOM   5499  C CG  . PHE D  4  73  ? 2.454   -58.729 26.638  1.00 0.00 ? 73  PHE D CG  1 
ATOM   5500  C CD1 . PHE D  4  73  ? 3.410   -59.752 26.491  1.00 0.00 ? 73  PHE D CD1 1 
ATOM   5501  C CD2 . PHE D  4  73  ? 2.906   -57.401 26.763  1.00 0.00 ? 73  PHE D CD2 1 
ATOM   5502  C CE1 . PHE D  4  73  ? 4.776   -59.465 26.529  1.00 0.00 ? 73  PHE D CE1 1 
ATOM   5503  C CE2 . PHE D  4  73  ? 4.275   -57.114 26.748  1.00 0.00 ? 73  PHE D CE2 1 
ATOM   5504  C CZ  . PHE D  4  73  ? 5.211   -58.144 26.650  1.00 0.00 ? 73  PHE D CZ  1 
ATOM   5505  N N   . ALA D  4  74  ? 0.360   -61.990 27.552  1.00 0.00 ? 74  ALA D N   1 
ATOM   5506  C CA  . ALA D  4  74  ? 0.799   -63.357 27.446  1.00 0.00 ? 74  ALA D CA  1 
ATOM   5507  C C   . ALA D  4  74  ? 0.673   -63.602 25.985  1.00 0.00 ? 74  ALA D C   1 
ATOM   5508  O O   . ALA D  4  74  ? -0.134  -62.953 25.331  1.00 0.00 ? 74  ALA D O   1 
ATOM   5509  C CB  . ALA D  4  74  ? -0.082  -64.363 28.192  1.00 0.00 ? 74  ALA D CB  1 
ATOM   5510  N N   . GLY D  4  75  ? 1.415   -64.570 25.485  1.00 0.00 ? 75  GLY D N   1 
ATOM   5511  C CA  . GLY D  4  75  ? 1.400   -64.815 24.072  1.00 0.00 ? 75  GLY D CA  1 
ATOM   5512  C C   . GLY D  4  75  ? 2.845   -64.817 23.675  1.00 0.00 ? 75  GLY D C   1 
ATOM   5513  O O   . GLY D  4  75  ? 3.713   -65.318 24.390  1.00 0.00 ? 75  GLY D O   1 
ATOM   5514  N N   . LEU D  4  76  ? 3.096   -64.251 22.512  1.00 0.00 ? 76  LEU D N   1 
ATOM   5515  C CA  . LEU D  4  76  ? 4.411   -64.244 21.967  1.00 0.00 ? 76  LEU D CA  1 
ATOM   5516  C C   . LEU D  4  76  ? 4.735   -62.794 22.085  1.00 0.00 ? 76  LEU D C   1 
ATOM   5517  O O   . LEU D  4  76  ? 4.006   -61.959 21.563  1.00 0.00 ? 76  LEU D O   1 
ATOM   5518  C CB  . LEU D  4  76  ? 4.538   -64.743 20.496  1.00 0.00 ? 76  LEU D CB  1 
ATOM   5519  C CG  . LEU D  4  76  ? 4.211   -66.224 20.154  1.00 0.00 ? 76  LEU D CG  1 
ATOM   5520  C CD1 . LEU D  4  76  ? 4.265   -66.432 18.629  1.00 0.00 ? 76  LEU D CD1 1 
ATOM   5521  C CD2 . LEU D  4  76  ? 5.171   -67.250 20.782  1.00 0.00 ? 76  LEU D CD2 1 
ATOM   5522  N N   . THR D  4  77  ? 5.811   -62.454 22.836  1.00 0.00 ? 77  THR D N   1 
ATOM   5523  C CA  . THR D  4  77  ? 6.158   -61.093 23.206  1.00 0.00 ? 77  THR D CA  1 
ATOM   5524  C C   . THR D  4  77  ? 6.627   -60.264 22.021  1.00 0.00 ? 77  THR D C   1 
ATOM   5525  O O   . THR D  4  77  ? 6.544   -59.032 22.030  1.00 0.00 ? 77  THR D O   1 
ATOM   5526  C CB  . THR D  4  77  ? 7.205   -61.106 24.326  1.00 0.00 ? 77  THR D CB  1 
ATOM   5527  O OG1 . THR D  4  77  ? 7.533   -59.805 24.797  1.00 0.00 ? 77  THR D OG1 1 
ATOM   5528  C CG2 . THR D  4  77  ? 8.507   -61.797 23.898  1.00 0.00 ? 77  THR D CG2 1 
ATOM   5529  N N   . ALA D  4  78  ? 7.028   -60.954 20.930  1.00 0.00 ? 78  ALA D N   1 
ATOM   5530  C CA  . ALA D  4  78  ? 7.495   -60.386 19.699  1.00 0.00 ? 78  ALA D CA  1 
ATOM   5531  C C   . ALA D  4  78  ? 6.468   -59.537 19.045  1.00 0.00 ? 78  ALA D C   1 
ATOM   5532  O O   . ALA D  4  78  ? 6.809   -58.618 18.313  1.00 0.00 ? 78  ALA D O   1 
ATOM   5533  C CB  . ALA D  4  78  ? 7.863   -61.477 18.693  1.00 0.00 ? 78  ALA D CB  1 
ATOM   5534  N N   . ASP D  4  79  ? 5.191   -59.930 19.234  1.00 0.00 ? 79  ASP D N   1 
ATOM   5535  C CA  . ASP D  4  79  ? 4.012   -59.294 18.710  1.00 0.00 ? 79  ASP D CA  1 
ATOM   5536  C C   . ASP D  4  79  ? 3.515   -58.335 19.725  1.00 0.00 ? 79  ASP D C   1 
ATOM   5537  O O   . ASP D  4  79  ? 2.941   -57.314 19.384  1.00 0.00 ? 79  ASP D O   1 
ATOM   5538  C CB  . ASP D  4  79  ? 2.832   -60.285 18.522  1.00 0.00 ? 79  ASP D CB  1 
ATOM   5539  C CG  . ASP D  4  79  ? 3.083   -61.419 17.523  1.00 0.00 ? 79  ASP D CG  1 
ATOM   5540  O OD1 . ASP D  4  79  ? 4.251   -61.852 17.343  1.00 0.00 ? 79  ASP D OD1 1 
ATOM   5541  O OD2 . ASP D  4  79  ? 2.069   -61.889 16.938  1.00 0.00 ? 79  ASP D OD2 1 
ATOM   5542  N N   . ALA D  4  80  ? 3.677   -58.682 21.012  1.00 0.00 ? 80  ALA D N   1 
ATOM   5543  C CA  . ALA D  4  80  ? 3.061   -57.973 22.092  1.00 0.00 ? 80  ALA D CA  1 
ATOM   5544  C C   . ALA D  4  80  ? 3.502   -56.585 22.311  1.00 0.00 ? 80  ALA D C   1 
ATOM   5545  O O   . ALA D  4  80  ? 2.699   -55.720 22.649  1.00 0.00 ? 80  ALA D O   1 
ATOM   5546  C CB  . ALA D  4  80  ? 3.285   -58.667 23.429  1.00 0.00 ? 80  ALA D CB  1 
ATOM   5547  N N   . ARG D  4  81  ? 4.798   -56.334 22.147  1.00 0.00 ? 81  ARG D N   1 
ATOM   5548  C CA  . ARG D  4  81  ? 5.330   -54.972 22.175  1.00 0.00 ? 81  ARG D CA  1 
ATOM   5549  C C   . ARG D  4  81  ? 4.802   -54.130 21.010  1.00 0.00 ? 81  ARG D C   1 
ATOM   5550  O O   . ARG D  4  81  ? 4.461   -52.959 21.172  1.00 0.00 ? 81  ARG D O   1 
ATOM   5551  C CB  . ARG D  4  81  ? 6.860   -54.995 22.156  1.00 0.00 ? 81  ARG D CB  1 
ATOM   5552  C CG  . ARG D  4  81  ? 7.454   -56.032 21.217  1.00 0.00 ? 81  ARG D CG  1 
ATOM   5553  C CD  . ARG D  4  81  ? 8.954   -56.166 21.420  1.00 0.00 ? 81  ARG D CD  1 
ATOM   5554  N NE  . ARG D  4  81  ? 9.643   -56.535 20.187  1.00 0.00 ? 81  ARG D NE  1 
ATOM   5555  C CZ  . ARG D  4  81  ? 9.959   -55.677 19.222  1.00 0.00 ? 81  ARG D CZ  1 
ATOM   5556  N NH1 . ARG D  4  81  ? 9.649   -54.394 19.346  1.00 0.00 ? 81  ARG D NH1 1 
ATOM   5557  N NH2 . ARG D  4  81  ? 10.585  -56.102 18.134  1.00 0.00 ? 81  ARG D NH2 1 
ATOM   5558  N N   . ILE D  4  82  ? 4.743   -54.754 19.837  1.00 0.00 ? 82  ILE D N   1 
ATOM   5559  C CA  . ILE D  4  82  ? 4.275   -54.141 18.618  1.00 0.00 ? 82  ILE D CA  1 
ATOM   5560  C C   . ILE D  4  82  ? 2.838   -53.720 18.732  1.00 0.00 ? 82  ILE D C   1 
ATOM   5561  O O   . ILE D  4  82  ? 2.422   -52.735 18.130  1.00 0.00 ? 82  ILE D O   1 
ATOM   5562  C CB  . ILE D  4  82  ? 4.520   -55.054 17.440  1.00 0.00 ? 82  ILE D CB  1 
ATOM   5563  C CG1 . ILE D  4  82  ? 6.011   -55.450 17.391  1.00 0.00 ? 82  ILE D CG1 1 
ATOM   5564  C CG2 . ILE D  4  82  ? 4.093   -54.393 16.106  1.00 0.00 ? 82  ILE D CG2 1 
ATOM   5565  C CD1 . ILE D  4  82  ? 7.004   -54.292 17.319  1.00 0.00 ? 82  ILE D CD1 1 
ATOM   5566  N N   . VAL D  4  83  ? 2.036   -54.449 19.540  1.00 0.00 ? 83  VAL D N   1 
ATOM   5567  C CA  . VAL D  4  83  ? 0.679   -54.066 19.837  1.00 0.00 ? 83  VAL D CA  1 
ATOM   5568  C C   . VAL D  4  83  ? 0.721   -52.916 20.794  1.00 0.00 ? 83  VAL D C   1 
ATOM   5569  O O   . VAL D  4  83  ? 0.016   -51.928 20.605  1.00 0.00 ? 83  VAL D O   1 
ATOM   5570  C CB  . VAL D  4  83  ? -0.088  -55.201 20.493  1.00 0.00 ? 83  VAL D CB  1 
ATOM   5571  C CG1 . VAL D  4  83  ? -1.390  -54.725 21.165  1.00 0.00 ? 83  VAL D CG1 1 
ATOM   5572  C CG2 . VAL D  4  83  ? -0.387  -56.239 19.403  1.00 0.00 ? 83  VAL D CG2 1 
ATOM   5573  N N   . ILE D  4  84  ? 1.567   -52.997 21.841  1.00 0.00 ? 84  ILE D N   1 
ATOM   5574  C CA  . ILE D  4  84  ? 1.574   -51.986 22.859  1.00 0.00 ? 84  ILE D CA  1 
ATOM   5575  C C   . ILE D  4  84  ? 2.075   -50.656 22.409  1.00 0.00 ? 84  ILE D C   1 
ATOM   5576  O O   . ILE D  4  84  ? 1.691   -49.647 22.978  1.00 0.00 ? 84  ILE D O   1 
ATOM   5577  C CB  . ILE D  4  84  ? 2.224   -52.426 24.153  1.00 0.00 ? 84  ILE D CB  1 
ATOM   5578  C CG1 . ILE D  4  84  ? 1.431   -51.806 25.308  1.00 0.00 ? 84  ILE D CG1 1 
ATOM   5579  C CG2 . ILE D  4  84  ? 3.715   -52.047 24.246  1.00 0.00 ? 84  ILE D CG2 1 
ATOM   5580  C CD1 . ILE D  4  84  ? 1.987   -52.194 26.660  1.00 0.00 ? 84  ILE D CD1 1 
ATOM   5581  N N   . ASN D  4  85  ? 2.946   -50.592 21.382  1.00 0.00 ? 85  ASN D N   1 
ATOM   5582  C CA  . ASN D  4  85  ? 3.447   -49.341 20.874  1.00 0.00 ? 85  ASN D CA  1 
ATOM   5583  C C   . ASN D  4  85  ? 2.340   -48.544 20.303  1.00 0.00 ? 85  ASN D C   1 
ATOM   5584  O O   . ASN D  4  85  ? 2.197   -47.372 20.612  1.00 0.00 ? 85  ASN D O   1 
ATOM   5585  C CB  . ASN D  4  85  ? 4.533   -49.475 19.786  1.00 0.00 ? 85  ASN D CB  1 
ATOM   5586  C CG  . ASN D  4  85  ? 5.806   -50.141 20.337  1.00 0.00 ? 85  ASN D CG  1 
ATOM   5587  O OD1 . ASN D  4  85  ? 6.328   -51.079 19.721  1.00 0.00 ? 85  ASN D OD1 1 
ATOM   5588  N ND2 . ASN D  4  85  ? 6.314   -49.634 21.497  1.00 0.00 ? 85  ASN D ND2 1 
ATOM   5589  N N   . ARG D  4  86  ? 1.513   -49.167 19.456  1.00 0.00 ? 86  ARG D N   1 
ATOM   5590  C CA  . ARG D  4  86  ? 0.367   -48.531 18.862  1.00 0.00 ? 86  ARG D CA  1 
ATOM   5591  C C   . ARG D  4  86  ? -0.666  -48.161 19.894  1.00 0.00 ? 86  ARG D C   1 
ATOM   5592  O O   . ARG D  4  86  ? -1.316  -47.125 19.799  1.00 0.00 ? 86  ARG D O   1 
ATOM   5593  C CB  . ARG D  4  86  ? -0.244  -49.452 17.790  1.00 0.00 ? 86  ARG D CB  1 
ATOM   5594  C CG  . ARG D  4  86  ? -1.359  -48.822 16.953  1.00 0.00 ? 86  ARG D CG  1 
ATOM   5595  C CD  . ARG D  4  86  ? -0.973  -47.501 16.279  1.00 0.00 ? 86  ARG D CD  1 
ATOM   5596  N NE  . ARG D  4  86  ? -2.164  -46.997 15.516  1.00 0.00 ? 86  ARG D NE  1 
ATOM   5597  C CZ  . ARG D  4  86  ? -2.400  -45.671 15.274  1.00 0.00 ? 86  ARG D CZ  1 
ATOM   5598  N NH1 . ARG D  4  86  ? -1.523  -44.707 15.678  1.00 0.00 ? 86  ARG D NH1 1 
ATOM   5599  N NH2 . ARG D  4  86  ? -3.538  -45.307 14.613  1.00 0.00 ? 86  ARG D NH2 1 
ATOM   5600  N N   . ALA D  4  87  ? -0.797  -48.978 20.952  1.00 0.00 ? 87  ALA D N   1 
ATOM   5601  C CA  . ALA D  4  87  ? -1.644  -48.686 22.063  1.00 0.00 ? 87  ALA D CA  1 
ATOM   5602  C C   . ALA D  4  87  ? -1.199  -47.482 22.821  1.00 0.00 ? 87  ALA D C   1 
ATOM   5603  O O   . ALA D  4  87  ? -2.042  -46.754 23.318  1.00 0.00 ? 87  ALA D O   1 
ATOM   5604  C CB  . ALA D  4  87  ? -1.729  -49.842 23.037  1.00 0.00 ? 87  ALA D CB  1 
ATOM   5605  N N   . ARG D  4  88  ? 0.123   -47.231 22.935  1.00 0.00 ? 88  ARG D N   1 
ATOM   5606  C CA  . ARG D  4  88  ? 0.698   -46.111 23.647  1.00 0.00 ? 88  ARG D CA  1 
ATOM   5607  C C   . ARG D  4  88  ? 0.522   -44.841 22.878  1.00 0.00 ? 88  ARG D C   1 
ATOM   5608  O O   . ARG D  4  88  ? 0.250   -43.798 23.469  1.00 0.00 ? 88  ARG D O   1 
ATOM   5609  C CB  . ARG D  4  88  ? 2.193   -46.302 23.915  1.00 0.00 ? 88  ARG D CB  1 
ATOM   5610  C CG  . ARG D  4  88  ? 2.484   -47.243 25.088  1.00 0.00 ? 88  ARG D CG  1 
ATOM   5611  C CD  . ARG D  4  88  ? 3.928   -47.740 25.057  1.00 0.00 ? 88  ARG D CD  1 
ATOM   5612  N NE  . ARG D  4  88  ? 4.238   -48.353 26.377  1.00 0.00 ? 88  ARG D NE  1 
ATOM   5613  C CZ  . ARG D  4  88  ? 5.365   -49.096 26.572  1.00 0.00 ? 88  ARG D CZ  1 
ATOM   5614  N NH1 . ARG D  4  88  ? 6.155   -49.441 25.514  1.00 0.00 ? 88  ARG D NH1 1 
ATOM   5615  N NH2 . ARG D  4  88  ? 5.711   -49.499 27.829  1.00 0.00 ? 88  ARG D NH2 1 
ATOM   5616  N N   . VAL D  4  89  ? 0.624   -44.892 21.528  1.00 0.00 ? 89  VAL D N   1 
ATOM   5617  C CA  . VAL D  4  89  ? 0.317   -43.752 20.678  1.00 0.00 ? 89  VAL D CA  1 
ATOM   5618  C C   . VAL D  4  89  ? -1.131  -43.379 20.825  1.00 0.00 ? 89  VAL D C   1 
ATOM   5619  O O   . VAL D  4  89  ? -1.485  -42.205 20.836  1.00 0.00 ? 89  VAL D O   1 
ATOM   5620  C CB  . VAL D  4  89  ? 0.568   -44.036 19.195  1.00 0.00 ? 89  VAL D CB  1 
ATOM   5621  C CG1 . VAL D  4  89  ? 0.164   -42.847 18.297  1.00 0.00 ? 89  VAL D CG1 1 
ATOM   5622  C CG2 . VAL D  4  89  ? 2.057   -44.345 18.986  1.00 0.00 ? 89  VAL D CG2 1 
ATOM   5623  N N   . GLU D  4  90  ? -2.015  -44.380 20.958  1.00 0.00 ? 90  GLU D N   1 
ATOM   5624  C CA  . GLU D  4  90  ? -3.406  -44.144 21.196  1.00 0.00 ? 90  GLU D CA  1 
ATOM   5625  C C   . GLU D  4  90  ? -3.691  -43.530 22.542  1.00 0.00 ? 90  GLU D C   1 
ATOM   5626  O O   . GLU D  4  90  ? -4.600  -42.713 22.633  1.00 0.00 ? 90  GLU D O   1 
ATOM   5627  C CB  . GLU D  4  90  ? -4.203  -45.450 20.972  1.00 0.00 ? 90  GLU D CB  1 
ATOM   5628  C CG  . GLU D  4  90  ? -5.731  -45.331 21.112  1.00 0.00 ? 90  GLU D CG  1 
ATOM   5629  C CD  . GLU D  4  90  ? -6.157  -45.713 22.526  1.00 0.00 ? 90  GLU D CD  1 
ATOM   5630  O OE1 . GLU D  4  90  ? -6.040  -46.918 22.875  1.00 0.00 ? 90  GLU D OE1 1 
ATOM   5631  O OE2 . GLU D  4  90  ? -6.592  -44.805 23.281  1.00 0.00 ? 90  GLU D OE2 1 
ATOM   5632  N N   . CYS D  4  91  ? -2.924  -43.848 23.610  1.00 0.00 ? 91  CYS D N   1 
ATOM   5633  C CA  . CYS D  4  91  ? -3.125  -43.267 24.921  1.00 0.00 ? 91  CYS D CA  1 
ATOM   5634  C C   . CYS D  4  91  ? -2.830  -41.806 24.956  1.00 0.00 ? 91  CYS D C   1 
ATOM   5635  O O   . CYS D  4  91  ? -3.581  -41.007 25.513  1.00 0.00 ? 91  CYS D O   1 
ATOM   5636  C CB  . CYS D  4  91  ? -2.188  -43.837 26.003  1.00 0.00 ? 91  CYS D CB  1 
ATOM   5637  S SG  . CYS D  4  91  ? -2.286  -45.635 26.151  1.00 0.00 ? 91  CYS D SG  1 
ATOM   5638  N N   . GLN D  4  92  ? -1.664  -41.430 24.411  1.00 0.00 ? 92  GLN D N   1 
ATOM   5639  C CA  . GLN D  4  92  ? -1.219  -40.064 24.416  1.00 0.00 ? 92  GLN D CA  1 
ATOM   5640  C C   . GLN D  4  92  ? -2.028  -39.172 23.546  1.00 0.00 ? 92  GLN D C   1 
ATOM   5641  O O   . GLN D  4  92  ? -2.239  -38.012 23.869  1.00 0.00 ? 92  GLN D O   1 
ATOM   5642  C CB  . GLN D  4  92  ? 0.252   -39.971 23.974  1.00 0.00 ? 92  GLN D CB  1 
ATOM   5643  C CG  . GLN D  4  92  ? 1.223   -40.669 24.941  1.00 0.00 ? 92  GLN D CG  1 
ATOM   5644  C CD  . GLN D  4  92  ? 1.178   -40.033 26.334  1.00 0.00 ? 92  GLN D CD  1 
ATOM   5645  O OE1 . GLN D  4  92  ? 0.890   -40.705 27.330  1.00 0.00 ? 92  GLN D OE1 1 
ATOM   5646  N NE2 . GLN D  4  92  ? 1.491   -38.710 26.400  1.00 0.00 ? 92  GLN D NE2 1 
ATOM   5647  N N   . SER D  4  93  ? -2.517  -39.700 22.415  1.00 0.00 ? 93  SER D N   1 
ATOM   5648  C CA  . SER D  4  93  ? -3.371  -38.993 21.491  1.00 0.00 ? 93  SER D CA  1 
ATOM   5649  C C   . SER D  4  93  ? -4.702  -38.682 22.099  1.00 0.00 ? 93  SER D C   1 
ATOM   5650  O O   . SER D  4  93  ? -5.310  -37.665 21.799  1.00 0.00 ? 93  SER D O   1 
ATOM   5651  C CB  . SER D  4  93  ? -3.536  -39.744 20.154  1.00 0.00 ? 93  SER D CB  1 
ATOM   5652  O OG  . SER D  4  93  ? -2.282  -39.795 19.482  1.00 0.00 ? 93  SER D OG  1 
ATOM   5653  N N   . HIS D  4  94  ? -5.171  -39.541 23.002  1.00 0.00 ? 94  HIS D N   1 
ATOM   5654  C CA  . HIS D  4  94  ? -6.404  -39.348 23.697  1.00 0.00 ? 94  HIS D CA  1 
ATOM   5655  C C   . HIS D  4  94  ? -6.241  -38.295 24.765  1.00 0.00 ? 94  HIS D C   1 
ATOM   5656  O O   . HIS D  4  94  ? -7.150  -37.506 24.981  1.00 0.00 ? 94  HIS D O   1 
ATOM   5657  C CB  . HIS D  4  94  ? -6.899  -40.646 24.347  1.00 0.00 ? 94  HIS D CB  1 
ATOM   5658  C CG  . HIS D  4  94  ? -8.143  -40.421 25.123  1.00 0.00 ? 94  HIS D CG  1 
ATOM   5659  N ND1 . HIS D  4  94  ? -8.150  -40.036 26.435  1.00 0.00 ? 94  HIS D ND1 1 
ATOM   5660  C CD2 . HIS D  4  94  ? -9.426  -40.361 24.706  1.00 0.00 ? 94  HIS D CD2 1 
ATOM   5661  C CE1 . HIS D  4  94  ? -9.434  -39.770 26.750  1.00 0.00 ? 94  HIS D CE1 1 
ATOM   5662  N NE2 . HIS D  4  94  ? -10.244 -39.952 25.734  1.00 0.00 ? 94  HIS D NE2 1 
ATOM   5663  N N   . ARG D  4  95  ? -5.100  -38.248 25.473  1.00 0.00 ? 95  ARG D N   1 
ATOM   5664  C CA  . ARG D  4  95  ? -4.834  -37.258 26.501  1.00 0.00 ? 95  ARG D CA  1 
ATOM   5665  C C   . ARG D  4  95  ? -4.778  -35.831 25.953  1.00 0.00 ? 95  ARG D C   1 
ATOM   5666  O O   . ARG D  4  95  ? -5.042  -34.852 26.651  1.00 0.00 ? 95  ARG D O   1 
ATOM   5667  C CB  . ARG D  4  95  ? -3.512  -37.577 27.227  1.00 0.00 ? 95  ARG D CB  1 
ATOM   5668  C CG  . ARG D  4  95  ? -3.330  -36.833 28.556  1.00 0.00 ? 95  ARG D CG  1 
ATOM   5669  C CD  . ARG D  4  95  ? -1.997  -37.145 29.243  1.00 0.00 ? 95  ARG D CD  1 
ATOM   5670  N NE  . ARG D  4  95  ? -1.922  -38.607 29.571  1.00 0.00 ? 95  ARG D NE  1 
ATOM   5671  C CZ  . ARG D  4  95  ? -1.733  -39.098 30.836  1.00 0.00 ? 95  ARG D CZ  1 
ATOM   5672  N NH1 . ARG D  4  95  ? -1.741  -38.288 31.933  1.00 0.00 ? 95  ARG D NH1 1 
ATOM   5673  N NH2 . ARG D  4  95  ? -1.546  -40.440 31.008  1.00 0.00 ? 95  ARG D NH2 1 
ATOM   5674  N N   . LEU D  4  96  ? -4.394  -35.672 24.672  1.00 0.00 ? 96  LEU D N   1 
ATOM   5675  C CA  . LEU D  4  96  ? -4.384  -34.396 24.001  1.00 0.00 ? 96  LEU D CA  1 
ATOM   5676  C C   . LEU D  4  96  ? -5.748  -34.025 23.498  1.00 0.00 ? 96  LEU D C   1 
ATOM   5677  O O   . LEU D  4  96  ? -6.026  -32.842 23.347  1.00 0.00 ? 96  LEU D O   1 
ATOM   5678  C CB  . LEU D  4  96  ? -3.408  -34.465 22.809  1.00 0.00 ? 96  LEU D CB  1 
ATOM   5679  C CG  . LEU D  4  96  ? -3.197  -33.184 21.980  1.00 0.00 ? 96  LEU D CG  1 
ATOM   5680  C CD1 . LEU D  4  96  ? -1.716  -33.043 21.579  1.00 0.00 ? 96  LEU D CD1 1 
ATOM   5681  C CD2 . LEU D  4  96  ? -4.091  -33.123 20.726  1.00 0.00 ? 96  LEU D CD2 1 
ATOM   5682  N N   . THR D  4  97  ? -6.635  -34.993 23.228  1.00 0.00 ? 97  THR D N   1 
ATOM   5683  C CA  . THR D  4  97  ? -7.976  -34.657 22.689  1.00 0.00 ? 97  THR D CA  1 
ATOM   5684  C C   . THR D  4  97  ? -9.121  -34.421 23.704  1.00 0.00 ? 97  THR D C   1 
ATOM   5685  O O   . THR D  4  97  ? -9.761  -33.370 23.683  1.00 0.00 ? 97  THR D O   1 
ATOM   5686  C CB  . THR D  4  97  ? -8.442  -35.712 21.666  1.00 0.00 ? 97  THR D CB  1 
ATOM   5687  O OG1 . THR D  4  97  ? -8.572  -36.984 22.313  1.00 0.00 ? 97  THR D OG1 1 
ATOM   5688  C CG2 . THR D  4  97  ? -7.442  -35.828 20.526  1.00 0.00 ? 97  THR D CG2 1 
ATOM   5689  N N   . VAL D  4  98  ? -9.354  -35.384 24.595  1.00 0.00 ? 98  VAL D N   1 
ATOM   5690  C CA  . VAL D  4  98  ? -9.971  -35.164 25.880  1.00 0.00 ? 98  VAL D CA  1 
ATOM   5691  C C   . VAL D  4  98  ? -8.897  -34.695 26.810  1.00 0.00 ? 98  VAL D C   1 
ATOM   5692  O O   . VAL D  4  98  ? -7.762  -35.111 26.658  1.00 0.00 ? 98  VAL D O   1 
ATOM   5693  C CB  . VAL D  4  98  ? -10.601 -36.453 26.353  1.00 0.00 ? 98  VAL D CB  1 
ATOM   5694  C CG1 . VAL D  4  98  ? -10.953 -36.456 27.858  1.00 0.00 ? 98  VAL D CG1 1 
ATOM   5695  C CG2 . VAL D  4  98  ? -11.820 -36.705 25.444  1.00 0.00 ? 98  VAL D CG2 1 
ATOM   5696  N N   . GLU D  4  99  ? -9.183  -33.774 27.742  1.00 0.00 ? 99  GLU D N   1 
ATOM   5697  C CA  . GLU D  4  99  ? -8.177  -33.227 28.617  1.00 0.00 ? 99  GLU D CA  1 
ATOM   5698  C C   . GLU D  4  99  ? -7.554  -34.257 29.535  1.00 0.00 ? 99  GLU D C   1 
ATOM   5699  O O   . GLU D  4  99  ? -6.347  -34.241 29.764  1.00 0.00 ? 99  GLU D O   1 
ATOM   5700  C CB  . GLU D  4  99  ? -8.775  -32.111 29.499  1.00 0.00 ? 99  GLU D CB  1 
ATOM   5701  C CG  . GLU D  4  99  ? -7.756  -31.347 30.369  1.00 0.00 ? 99  GLU D CG  1 
ATOM   5702  C CD  . GLU D  4  99  ? -8.487  -30.509 31.420  1.00 0.00 ? 99  GLU D CD  1 
ATOM   5703  O OE1 . GLU D  4  99  ? -9.126  -31.121 32.319  1.00 0.00 ? 99  GLU D OE1 1 
ATOM   5704  O OE2 . GLU D  4  99  ? -8.411  -29.254 31.343  1.00 0.00 ? 99  GLU D OE2 1 
ATOM   5705  N N   . ASP D  4  100 ? -8.400  -35.116 30.146  1.00 0.00 ? 100 ASP D N   1 
ATOM   5706  C CA  . ASP D  4  100 ? -8.040  -36.163 31.075  1.00 0.00 ? 100 ASP D CA  1 
ATOM   5707  C C   . ASP D  4  100 ? -7.393  -37.334 30.390  1.00 0.00 ? 100 ASP D C   1 
ATOM   5708  O O   . ASP D  4  100 ? -7.474  -37.449 29.170  1.00 0.00 ? 100 ASP D O   1 
ATOM   5709  C CB  . ASP D  4  100 ? -9.293  -36.652 31.850  1.00 0.00 ? 100 ASP D CB  1 
ATOM   5710  C CG  . ASP D  4  100 ? -9.487  -35.921 33.175  1.00 0.00 ? 100 ASP D CG  1 
ATOM   5711  O OD1 . ASP D  4  100 ? -8.605  -35.114 33.565  1.00 0.00 ? 100 ASP D OD1 1 
ATOM   5712  O OD2 . ASP D  4  100 ? -10.536 -36.180 33.824  1.00 0.00 ? 100 ASP D OD2 1 
ATOM   5713  N N   . PRO D  4  101 ? -6.710  -38.214 31.123  1.00 0.00 ? 101 PRO D N   1 
ATOM   5714  C CA  . PRO D  4  101 ? -6.103  -39.397 30.571  1.00 0.00 ? 101 PRO D CA  1 
ATOM   5715  C C   . PRO D  4  101 ? -7.136  -40.403 30.195  1.00 0.00 ? 101 PRO D C   1 
ATOM   5716  O O   . PRO D  4  101 ? -8.273  -40.351 30.653  1.00 0.00 ? 101 PRO D O   1 
ATOM   5717  C CB  . PRO D  4  101 ? -5.225  -39.950 31.698  1.00 0.00 ? 101 PRO D CB  1 
ATOM   5718  C CG  . PRO D  4  101 ? -5.879  -39.455 32.977  1.00 0.00 ? 101 PRO D CG  1 
ATOM   5719  C CD  . PRO D  4  101 ? -6.384  -38.078 32.547  1.00 0.00 ? 101 PRO D CD  1 
ATOM   5720  N N   . VAL D  4  102 ? -6.697  -41.363 29.371  1.00 0.00 ? 102 VAL D N   1 
ATOM   5721  C CA  . VAL D  4  102 ? -7.474  -42.447 28.858  1.00 0.00 ? 102 VAL D CA  1 
ATOM   5722  C C   . VAL D  4  102 ? -7.818  -43.386 29.975  1.00 0.00 ? 102 VAL D C   1 
ATOM   5723  O O   . VAL D  4  102 ? -7.015  -43.597 30.884  1.00 0.00 ? 102 VAL D O   1 
ATOM   5724  C CB  . VAL D  4  102 ? -6.690  -43.110 27.742  1.00 0.00 ? 102 VAL D CB  1 
ATOM   5725  C CG1 . VAL D  4  102 ? -5.429  -43.805 28.284  1.00 0.00 ? 102 VAL D CG1 1 
ATOM   5726  C CG2 . VAL D  4  102 ? -7.602  -44.015 26.915  1.00 0.00 ? 102 VAL D CG2 1 
ATOM   5727  N N   . THR D  4  103 ? -9.044  -43.957 29.938  1.00 0.00 ? 103 THR D N   1 
ATOM   5728  C CA  . THR D  4  103 ? -9.472  -44.910 30.932  1.00 0.00 ? 103 THR D CA  1 
ATOM   5729  C C   . THR D  4  103 ? -9.072  -46.258 30.434  1.00 0.00 ? 103 THR D C   1 
ATOM   5730  O O   . THR D  4  103 ? -8.775  -46.427 29.257  1.00 0.00 ? 103 THR D O   1 
ATOM   5731  C CB  . THR D  4  103 ? -10.956 -44.829 31.222  1.00 0.00 ? 103 THR D CB  1 
ATOM   5732  O OG1 . THR D  4  103 ? -11.293 -45.618 32.349  1.00 0.00 ? 103 THR D OG1 1 
ATOM   5733  C CG2 . THR D  4  103 ? -11.796 -45.253 30.008  1.00 0.00 ? 103 THR D CG2 1 
ATOM   5734  N N   . VAL D  4  104 ? -8.996  -47.249 31.341  1.00 0.00 ? 104 VAL D N   1 
ATOM   5735  C CA  . VAL D  4  104 ? -8.507  -48.576 31.081  1.00 0.00 ? 104 VAL D CA  1 
ATOM   5736  C C   . VAL D  4  104 ? -9.368  -49.246 30.061  1.00 0.00 ? 104 VAL D C   1 
ATOM   5737  O O   . VAL D  4  104 ? -8.879  -49.979 29.214  1.00 0.00 ? 104 VAL D O   1 
ATOM   5738  C CB  . VAL D  4  104 ? -8.560  -49.432 32.323  1.00 0.00 ? 104 VAL D CB  1 
ATOM   5739  C CG1 . VAL D  4  104 ? -7.661  -50.670 32.160  1.00 0.00 ? 104 VAL D CG1 1 
ATOM   5740  C CG2 . VAL D  4  104 ? -8.155  -48.591 33.537  1.00 0.00 ? 104 VAL D CG2 1 
ATOM   5741  N N   . GLU D  4  105 ? -10.681 -48.956 30.113  1.00 0.00 ? 105 GLU D N   1 
ATOM   5742  C CA  . GLU D  4  105 ? -11.711 -49.477 29.267  1.00 0.00 ? 105 GLU D CA  1 
ATOM   5743  C C   . GLU D  4  105 ? -11.529 -49.040 27.854  1.00 0.00 ? 105 GLU D C   1 
ATOM   5744  O O   . GLU D  4  105 ? -11.734 -49.838 26.952  1.00 0.00 ? 105 GLU D O   1 
ATOM   5745  C CB  . GLU D  4  105 ? -13.113 -49.059 29.749  1.00 0.00 ? 105 GLU D CB  1 
ATOM   5746  C CG  . GLU D  4  105 ? -13.398 -49.522 31.191  1.00 0.00 ? 105 GLU D CG  1 
ATOM   5747  C CD  . GLU D  4  105 ? -12.842 -48.592 32.275  1.00 0.00 ? 105 GLU D CD  1 
ATOM   5748  O OE1 . GLU D  4  105 ? -13.477 -47.533 32.512  1.00 0.00 ? 105 GLU D OE1 1 
ATOM   5749  O OE2 . GLU D  4  105 ? -11.804 -48.944 32.895  1.00 0.00 ? 105 GLU D OE2 1 
ATOM   5750  N N   . TYR D  4  106 ? -11.160 -47.759 27.621  1.00 0.00 ? 106 TYR D N   1 
ATOM   5751  C CA  . TYR D  4  106 ? -10.937 -47.211 26.304  1.00 0.00 ? 106 TYR D CA  1 
ATOM   5752  C C   . TYR D  4  106 ? -9.743  -47.812 25.676  1.00 0.00 ? 106 TYR D C   1 
ATOM   5753  O O   . TYR D  4  106 ? -9.729  -48.048 24.474  1.00 0.00 ? 106 TYR D O   1 
ATOM   5754  C CB  . TYR D  4  106 ? -10.757 -45.672 26.366  1.00 0.00 ? 106 TYR D CB  1 
ATOM   5755  C CG  . TYR D  4  106 ? -10.803 -44.946 25.033  1.00 0.00 ? 106 TYR D CG  1 
ATOM   5756  C CD1 . TYR D  4  106 ? -9.679  -44.881 24.191  1.00 0.00 ? 106 TYR D CD1 1 
ATOM   5757  C CD2 . TYR D  4  106 ? -11.952 -44.229 24.656  1.00 0.00 ? 106 TYR D CD2 1 
ATOM   5758  C CE1 . TYR D  4  106 ? -9.702  -44.134 23.006  1.00 0.00 ? 106 TYR D CE1 1 
ATOM   5759  C CE2 . TYR D  4  106 ? -11.989 -43.487 23.470  1.00 0.00 ? 106 TYR D CE2 1 
ATOM   5760  C CZ  . TYR D  4  106 ? -10.862 -43.441 22.640  1.00 0.00 ? 106 TYR D CZ  1 
ATOM   5761  O OH  . TYR D  4  106 ? -10.889 -42.684 21.447  1.00 0.00 ? 106 TYR D OH  1 
ATOM   5762  N N   . ILE D  4  107 ? -8.716  -48.119 26.481  1.00 0.00 ? 107 ILE D N   1 
ATOM   5763  C CA  . ILE D  4  107 ? -7.552  -48.824 26.013  1.00 0.00 ? 107 ILE D CA  1 
ATOM   5764  C C   . ILE D  4  107 ? -7.905  -50.191 25.572  1.00 0.00 ? 107 ILE D C   1 
ATOM   5765  O O   . ILE D  4  107 ? -7.481  -50.622 24.510  1.00 0.00 ? 107 ILE D O   1 
ATOM   5766  C CB  . ILE D  4  107 ? -6.451  -48.862 27.056  1.00 0.00 ? 107 ILE D CB  1 
ATOM   5767  C CG1 . ILE D  4  107 ? -5.932  -47.434 27.323  1.00 0.00 ? 107 ILE D CG1 1 
ATOM   5768  C CG2 . ILE D  4  107 ? -5.291  -49.782 26.616  1.00 0.00 ? 107 ILE D CG2 1 
ATOM   5769  C CD1 . ILE D  4  107 ? -5.496  -46.687 26.060  1.00 0.00 ? 107 ILE D CD1 1 
ATOM   5770  N N   . THR D  4  108 ? -8.703  -50.906 26.381  1.00 0.00 ? 108 THR D N   1 
ATOM   5771  C CA  . THR D  4  108 ? -9.092  -52.260 26.127  1.00 0.00 ? 108 THR D CA  1 
ATOM   5772  C C   . THR D  4  108 ? -9.893  -52.322 24.874  1.00 0.00 ? 108 THR D C   1 
ATOM   5773  O O   . THR D  4  108 ? -9.747  -53.265 24.107  1.00 0.00 ? 108 THR D O   1 
ATOM   5774  C CB  . THR D  4  108 ? -9.875  -52.869 27.273  1.00 0.00 ? 108 THR D CB  1 
ATOM   5775  O OG1 . THR D  4  108 ? -9.267  -52.599 28.528  1.00 0.00 ? 108 THR D OG1 1 
ATOM   5776  C CG2 . THR D  4  108 ? -9.932  -54.393 27.100  1.00 0.00 ? 108 THR D CG2 1 
ATOM   5777  N N   . ARG D  4  109 ? -10.721 -51.289 24.610  1.00 0.00 ? 109 ARG D N   1 
ATOM   5778  C CA  . ARG D  4  109 ? -11.548 -51.209 23.438  1.00 0.00 ? 109 ARG D CA  1 
ATOM   5779  C C   . ARG D  4  109 ? -10.702 -51.030 22.239  1.00 0.00 ? 109 ARG D C   1 
ATOM   5780  O O   . ARG D  4  109 ? -10.956 -51.672 21.233  1.00 0.00 ? 109 ARG D O   1 
ATOM   5781  C CB  . ARG D  4  109 ? -12.520 -50.006 23.418  1.00 0.00 ? 109 ARG D CB  1 
ATOM   5782  C CG  . ARG D  4  109 ? -13.777 -50.191 24.274  1.00 0.00 ? 109 ARG D CG  1 
ATOM   5783  C CD  . ARG D  4  109 ? -14.827 -49.086 24.060  1.00 0.00 ? 109 ARG D CD  1 
ATOM   5784  N NE  . ARG D  4  109 ? -14.320 -47.789 24.629  1.00 0.00 ? 109 ARG D NE  1 
ATOM   5785  C CZ  . ARG D  4  109 ? -14.901 -47.138 25.684  1.00 0.00 ? 109 ARG D CZ  1 
ATOM   5786  N NH1 . ARG D  4  109 ? -16.091 -47.547 26.211  1.00 0.00 ? 109 ARG D NH1 1 
ATOM   5787  N NH2 . ARG D  4  109 ? -14.270 -46.067 26.237  1.00 0.00 ? 109 ARG D NH2 1 
ATOM   5788  N N   . TYR D  4  110 ? -9.697  -50.135 22.286  1.00 0.00 ? 110 TYR D N   1 
ATOM   5789  C CA  . TYR D  4  110 ? -8.879  -49.927 21.129  1.00 0.00 ? 110 TYR D CA  1 
ATOM   5790  C C   . TYR D  4  110 ? -8.034  -51.096 20.789  1.00 0.00 ? 110 TYR D C   1 
ATOM   5791  O O   . TYR D  4  110 ? -7.817  -51.364 19.620  1.00 0.00 ? 110 TYR D O   1 
ATOM   5792  C CB  . TYR D  4  110 ? -7.933  -48.726 21.263  1.00 0.00 ? 110 TYR D CB  1 
ATOM   5793  C CG  . TYR D  4  110 ? -7.128  -48.538 19.999  1.00 0.00 ? 110 TYR D CG  1 
ATOM   5794  C CD1 . TYR D  4  110 ? -7.764  -48.431 18.751  1.00 0.00 ? 110 TYR D CD1 1 
ATOM   5795  C CD2 . TYR D  4  110 ? -5.734  -48.645 20.043  1.00 0.00 ? 110 TYR D CD2 1 
ATOM   5796  C CE1 . TYR D  4  110 ? -7.013  -48.426 17.573  1.00 0.00 ? 110 TYR D CE1 1 
ATOM   5797  C CE2 . TYR D  4  110 ? -4.982  -48.628 18.867  1.00 0.00 ? 110 TYR D CE2 1 
ATOM   5798  C CZ  . TYR D  4  110 ? -5.618  -48.526 17.629  1.00 0.00 ? 110 TYR D CZ  1 
ATOM   5799  O OH  . TYR D  4  110 ? -4.861  -48.474 16.440  1.00 0.00 ? 110 TYR D OH  1 
ATOM   5800  N N   . ILE D  4  111 ? -7.483  -51.796 21.782  1.00 0.00 ? 111 ILE D N   1 
ATOM   5801  C CA  . ILE D  4  111 ? -6.571  -52.879 21.546  1.00 0.00 ? 111 ILE D CA  1 
ATOM   5802  C C   . ILE D  4  111 ? -7.362  -53.989 20.972  1.00 0.00 ? 111 ILE D C   1 
ATOM   5803  O O   . ILE D  4  111 ? -6.927  -54.624 20.027  1.00 0.00 ? 111 ILE D O   1 
ATOM   5804  C CB  . ILE D  4  111 ? -5.835  -53.246 22.807  1.00 0.00 ? 111 ILE D CB  1 
ATOM   5805  C CG1 . ILE D  4  111 ? -4.846  -52.096 23.098  1.00 0.00 ? 111 ILE D CG1 1 
ATOM   5806  C CG2 . ILE D  4  111 ? -5.096  -54.588 22.630  1.00 0.00 ? 111 ILE D CG2 1 
ATOM   5807  C CD1 . ILE D  4  111 ? -4.007  -52.269 24.365  1.00 0.00 ? 111 ILE D CD1 1 
ATOM   5808  N N   . ALA D  4  112 ? -8.576  -54.212 21.489  1.00 0.00 ? 112 ALA D N   1 
ATOM   5809  C CA  . ALA D  4  112 ? -9.480  -55.182 20.971  1.00 0.00 ? 112 ALA D CA  1 
ATOM   5810  C C   . ALA D  4  112 ? -9.924  -54.869 19.566  1.00 0.00 ? 112 ALA D C   1 
ATOM   5811  O O   . ALA D  4  112 ? -10.068 -55.789 18.768  1.00 0.00 ? 112 ALA D O   1 
ATOM   5812  C CB  . ALA D  4  112 ? -10.703 -55.262 21.880  1.00 0.00 ? 112 ALA D CB  1 
ATOM   5813  N N   . SER D  4  113 ? -10.147 -53.578 19.210  1.00 0.00 ? 113 SER D N   1 
ATOM   5814  C CA  . SER D  4  113 ? -10.479 -53.184 17.855  1.00 0.00 ? 113 SER D CA  1 
ATOM   5815  C C   . SER D  4  113 ? -9.363  -53.349 16.881  1.00 0.00 ? 113 SER D C   1 
ATOM   5816  O O   . SER D  4  113 ? -9.587  -53.638 15.713  1.00 0.00 ? 113 SER D O   1 
ATOM   5817  C CB  . SER D  4  113 ? -11.021 -51.740 17.732  1.00 0.00 ? 113 SER D CB  1 
ATOM   5818  O OG  . SER D  4  113 ? -10.053 -50.733 17.959  1.00 0.00 ? 113 SER D OG  1 
ATOM   5819  N N   . LEU D  4  114 ? -8.133  -53.131 17.373  1.00 0.00 ? 114 LEU D N   1 
ATOM   5820  C CA  . LEU D  4  114 ? -6.898  -53.207 16.656  1.00 0.00 ? 114 LEU D CA  1 
ATOM   5821  C C   . LEU D  4  114 ? -6.575  -54.614 16.294  1.00 0.00 ? 114 LEU D C   1 
ATOM   5822  O O   . LEU D  4  114 ? -6.201  -54.886 15.159  1.00 0.00 ? 114 LEU D O   1 
ATOM   5823  C CB  . LEU D  4  114 ? -5.792  -52.595 17.530  1.00 0.00 ? 114 LEU D CB  1 
ATOM   5824  C CG  . LEU D  4  114 ? -4.346  -52.643 17.022  1.00 0.00 ? 114 LEU D CG  1 
ATOM   5825  C CD1 . LEU D  4  114 ? -4.173  -51.960 15.652  1.00 0.00 ? 114 LEU D CD1 1 
ATOM   5826  C CD2 . LEU D  4  114 ? -3.418  -52.055 18.107  1.00 0.00 ? 114 LEU D CD2 1 
ATOM   5827  N N   . LYS D  4  115 ? -6.731  -55.552 17.247  1.00 0.00 ? 115 LYS D N   1 
ATOM   5828  C CA  . LYS D  4  115 ? -6.545  -56.961 17.027  1.00 0.00 ? 115 LYS D CA  1 
ATOM   5829  C C   . LYS D  4  115 ? -7.552  -57.565 16.097  1.00 0.00 ? 115 LYS D C   1 
ATOM   5830  O O   . LYS D  4  115 ? -7.225  -58.486 15.356  1.00 0.00 ? 115 LYS D O   1 
ATOM   5831  C CB  . LYS D  4  115 ? -6.630  -57.749 18.331  1.00 0.00 ? 115 LYS D CB  1 
ATOM   5832  C CG  . LYS D  4  115 ? -5.464  -57.499 19.288  1.00 0.00 ? 115 LYS D CG  1 
ATOM   5833  C CD  . LYS D  4  115 ? -5.711  -58.224 20.612  1.00 0.00 ? 115 LYS D CD  1 
ATOM   5834  C CE  . LYS D  4  115 ? -4.504  -58.195 21.531  1.00 0.00 ? 115 LYS D CE  1 
ATOM   5835  N NZ  . LYS D  4  115 ? -4.789  -58.951 22.763  1.00 0.00 ? 115 LYS D NZ  1 
ATOM   5836  N N   . GLN D  4  116 ? -8.807  -57.063 16.123  1.00 0.00 ? 116 GLN D N   1 
ATOM   5837  C CA  . GLN D  4  116 ? -9.883  -57.491 15.267  1.00 0.00 ? 116 GLN D CA  1 
ATOM   5838  C C   . GLN D  4  116 ? -9.580  -57.150 13.863  1.00 0.00 ? 116 GLN D C   1 
ATOM   5839  O O   . GLN D  4  116 ? -9.986  -57.827 12.933  1.00 0.00 ? 116 GLN D O   1 
ATOM   5840  C CB  . GLN D  4  116 ? -11.251 -56.859 15.631  1.00 0.00 ? 116 GLN D CB  1 
ATOM   5841  C CG  . GLN D  4  116 ? -12.486 -57.422 14.869  1.00 0.00 ? 116 GLN D CG  1 
ATOM   5842  C CD  . GLN D  4  116 ? -12.731 -56.773 13.487  1.00 0.00 ? 116 GLN D CD  1 
ATOM   5843  O OE1 . GLN D  4  116 ? -12.219 -55.693 13.180  1.00 0.00 ? 116 GLN D OE1 1 
ATOM   5844  N NE2 . GLN D  4  116 ? -13.550 -57.452 12.632  1.00 0.00 ? 116 GLN D NE2 1 
ATOM   5845  N N   . ARG D  4  117 ? -8.904  -56.028 13.650  1.00 0.00 ? 117 ARG D N   1 
ATOM   5846  C CA  . ARG D  4  117 ? -8.780  -55.461 12.353  1.00 0.00 ? 117 ARG D CA  1 
ATOM   5847  C C   . ARG D  4  117 ? -8.022  -56.335 11.410  1.00 0.00 ? 117 ARG D C   1 
ATOM   5848  O O   . ARG D  4  117 ? -8.331  -56.348 10.231  1.00 0.00 ? 117 ARG D O   1 
ATOM   5849  C CB  . ARG D  4  117 ? -8.097  -54.090 12.476  1.00 0.00 ? 117 ARG D CB  1 
ATOM   5850  C CG  . ARG D  4  117 ? -8.441  -53.104 11.350  1.00 0.00 ? 117 ARG D CG  1 
ATOM   5851  C CD  . ARG D  4  117 ? -7.942  -51.674 11.628  1.00 0.00 ? 117 ARG D CD  1 
ATOM   5852  N NE  . ARG D  4  117 ? -8.571  -51.191 12.908  1.00 0.00 ? 117 ARG D NE  1 
ATOM   5853  C CZ  . ARG D  4  117 ? -7.915  -50.441 13.842  1.00 0.00 ? 117 ARG D CZ  1 
ATOM   5854  N NH1 . ARG D  4  117 ? -6.697  -49.891 13.584  1.00 0.00 ? 117 ARG D NH1 1 
ATOM   5855  N NH2 . ARG D  4  117 ? -8.492  -50.246 15.061  1.00 0.00 ? 117 ARG D NH2 1 
ATOM   5856  N N   . TYR D  4  118 ? -7.003  -57.063 11.908  1.00 0.00 ? 118 TYR D N   1 
ATOM   5857  C CA  . TYR D  4  118 ? -6.072  -57.822 11.111  1.00 0.00 ? 118 TYR D CA  1 
ATOM   5858  C C   . TYR D  4  118 ? -6.650  -59.117 10.625  1.00 0.00 ? 118 TYR D C   1 
ATOM   5859  O O   . TYR D  4  118 ? -6.114  -59.734 9.709   1.00 0.00 ? 118 TYR D O   1 
ATOM   5860  C CB  . TYR D  4  118 ? -4.790  -58.166 11.907  1.00 0.00 ? 118 TYR D CB  1 
ATOM   5861  C CG  . TYR D  4  118 ? -3.801  -57.017 11.993  1.00 0.00 ? 118 TYR D CG  1 
ATOM   5862  C CD1 . TYR D  4  118 ? -4.166  -55.693 12.312  1.00 0.00 ? 118 TYR D CD1 1 
ATOM   5863  C CD2 . TYR D  4  118 ? -2.436  -57.287 11.788  1.00 0.00 ? 118 TYR D CD2 1 
ATOM   5864  C CE1 . TYR D  4  118 ? -3.214  -54.670 12.356  1.00 0.00 ? 118 TYR D CE1 1 
ATOM   5865  C CE2 . TYR D  4  118 ? -1.477  -56.271 11.831  1.00 0.00 ? 118 TYR D CE2 1 
ATOM   5866  C CZ  . TYR D  4  118 ? -1.869  -54.954 12.099  1.00 0.00 ? 118 TYR D CZ  1 
ATOM   5867  O OH  . TYR D  4  118 ? -0.905  -53.922 12.147  1.00 0.00 ? 118 TYR D OH  1 
ATOM   5868  N N   . THR D  4  119 ? -7.770  -59.582 11.205  1.00 0.00 ? 119 THR D N   1 
ATOM   5869  C CA  . THR D  4  119 ? -8.447  -60.751 10.721  1.00 0.00 ? 119 THR D CA  1 
ATOM   5870  C C   . THR D  4  119 ? -9.220  -60.418 9.471   1.00 0.00 ? 119 THR D C   1 
ATOM   5871  O O   . THR D  4  119 ? -9.267  -61.189 8.519   1.00 0.00 ? 119 THR D O   1 
ATOM   5872  C CB  . THR D  4  119 ? -9.363  -61.325 11.782  1.00 0.00 ? 119 THR D CB  1 
ATOM   5873  O OG1 . THR D  4  119 ? -10.410 -60.444 12.168  1.00 0.00 ? 119 THR D OG1 1 
ATOM   5874  C CG2 . THR D  4  119 ? -8.508  -61.655 13.014  1.00 0.00 ? 119 THR D CG2 1 
ATOM   5875  N N   . GLN D  4  120 ? -9.912  -59.285 9.533   1.00 0.00 ? 120 GLN D N   1 
ATOM   5876  C CA  . GLN D  4  120 ? -10.561 -58.699 8.375   1.00 0.00 ? 120 GLN D CA  1 
ATOM   5877  C C   . GLN D  4  120 ? -9.571  -57.753 7.716   1.00 0.00 ? 120 GLN D C   1 
ATOM   5878  O O   . GLN D  4  120 ? -9.609  -56.543 7.939   1.00 0.00 ? 120 GLN D O   1 
ATOM   5879  C CB  . GLN D  4  120 ? -11.824 -57.943 8.789   1.00 0.00 ? 120 GLN D CB  1 
ATOM   5880  C CG  . GLN D  4  120 ? -12.793 -57.682 7.648   1.00 0.00 ? 120 GLN D CG  1 
ATOM   5881  C CD  . GLN D  4  120 ? -14.036 -56.938 8.097   1.00 0.00 ? 120 GLN D CD  1 
ATOM   5882  O OE1 . GLN D  4  120 ? -14.239 -55.776 7.748   1.00 0.00 ? 120 GLN D OE1 1 
ATOM   5883  N NE2 . GLN D  4  120 ? -14.876 -57.609 8.877   1.00 0.00 ? 120 GLN D NE2 1 
ATOM   5884  N N   . SER D  4  121 ? -8.682  -58.312 6.907   1.00 0.00 ? 121 SER D N   1 
ATOM   5885  C CA  . SER D  4  121 ? -7.666  -57.538 6.253   1.00 0.00 ? 121 SER D CA  1 
ATOM   5886  C C   . SER D  4  121 ? -7.080  -58.430 5.226   1.00 0.00 ? 121 SER D C   1 
ATOM   5887  O O   . SER D  4  121 ? -7.269  -59.647 5.229   1.00 0.00 ? 121 SER D O   1 
ATOM   5888  C CB  . SER D  4  121 ? -6.493  -57.146 7.163   1.00 0.00 ? 121 SER D CB  1 
ATOM   5889  O OG  . SER D  4  121 ? -6.865  -56.090 8.023   1.00 0.00 ? 121 SER D OG  1 
ATOM   5890  N N   . ASN D  4  122 ? -6.308  -57.807 4.323   1.00 0.00 ? 122 ASN D N   1 
ATOM   5891  C CA  . ASN D  4  122 ? -5.532  -58.471 3.317   1.00 0.00 ? 122 ASN D CA  1 
ATOM   5892  C C   . ASN D  4  122 ? -4.143  -58.679 3.868   1.00 0.00 ? 122 ASN D C   1 
ATOM   5893  O O   . ASN D  4  122 ? -3.424  -57.738 4.181   1.00 0.00 ? 122 ASN D O   1 
ATOM   5894  C CB  . ASN D  4  122 ? -5.489  -57.610 2.018   1.00 0.00 ? 122 ASN D CB  1 
ATOM   5895  C CG  . ASN D  4  122 ? -4.905  -58.330 0.794   1.00 0.00 ? 122 ASN D CG  1 
ATOM   5896  O OD1 . ASN D  4  122 ? -4.043  -59.202 0.907   1.00 0.00 ? 122 ASN D OD1 1 
ATOM   5897  N ND2 . ASN D  4  122 ? -5.384  -57.922 -0.419  1.00 0.00 ? 122 ASN D ND2 1 
ATOM   5898  N N   . GLY D  4  123 ? -3.713  -59.952 3.890   1.00 0.00 ? 123 GLY D N   1 
ATOM   5899  C CA  . GLY D  4  123 ? -2.348  -60.351 4.122   1.00 0.00 ? 123 GLY D CA  1 
ATOM   5900  C C   . GLY D  4  123 ? -1.928  -60.408 5.552   1.00 0.00 ? 123 GLY D C   1 
ATOM   5901  O O   . GLY D  4  123 ? -0.793  -60.776 5.842   1.00 0.00 ? 123 GLY D O   1 
ATOM   5902  N N   . ARG D  4  124 ? -2.818  -60.060 6.491   1.00 0.00 ? 124 ARG D N   1 
ATOM   5903  C CA  . ARG D  4  124 ? -2.442  -59.958 7.860   1.00 0.00 ? 124 ARG D CA  1 
ATOM   5904  C C   . ARG D  4  124 ? -2.891  -61.161 8.578   1.00 0.00 ? 124 ARG D C   1 
ATOM   5905  O O   . ARG D  4  124 ? -3.697  -61.932 8.080   1.00 0.00 ? 124 ARG D O   1 
ATOM   5906  C CB  . ARG D  4  124 ? -3.036  -58.705 8.491   1.00 0.00 ? 124 ARG D CB  1 
ATOM   5907  C CG  . ARG D  4  124 ? -2.761  -57.493 7.604   1.00 0.00 ? 124 ARG D CG  1 
ATOM   5908  C CD  . ARG D  4  124 ? -2.784  -56.161 8.340   1.00 0.00 ? 124 ARG D CD  1 
ATOM   5909  N NE  . ARG D  4  124 ? -2.273  -55.144 7.367   1.00 0.00 ? 124 ARG D NE  1 
ATOM   5910  C CZ  . ARG D  4  124 ? -1.294  -54.231 7.642   1.00 0.00 ? 124 ARG D CZ  1 
ATOM   5911  N NH1 . ARG D  4  124 ? -0.769  -54.100 8.893   1.00 0.00 ? 124 ARG D NH1 1 
ATOM   5912  N NH2 . ARG D  4  124 ? -0.837  -53.424 6.640   1.00 0.00 ? 124 ARG D NH2 1 
ATOM   5913  N N   . ARG D  4  125 ? -2.341  -61.359 9.780   1.00 0.00 ? 125 ARG D N   1 
ATOM   5914  C CA  . ARG D  4  125 ? -2.704  -62.445 10.633  1.00 0.00 ? 125 ARG D CA  1 
ATOM   5915  C C   . ARG D  4  125 ? -3.010  -61.839 11.979  1.00 0.00 ? 125 ARG D C   1 
ATOM   5916  O O   . ARG D  4  125 ? -2.420  -60.818 12.323  1.00 0.00 ? 125 ARG D O   1 
ATOM   5917  C CB  . ARG D  4  125 ? -1.581  -63.490 10.780  1.00 0.00 ? 125 ARG D CB  1 
ATOM   5918  C CG  . ARG D  4  125 ? -0.236  -62.898 11.197  1.00 0.00 ? 125 ARG D CG  1 
ATOM   5919  C CD  . ARG D  4  125 ? 0.777   -63.971 11.558  1.00 0.00 ? 125 ARG D CD  1 
ATOM   5920  N NE  . ARG D  4  125 ? 1.978   -63.308 12.148  1.00 0.00 ? 125 ARG D NE  1 
ATOM   5921  C CZ  . ARG D  4  125 ? 2.100   -63.026 13.479  1.00 0.00 ? 125 ARG D CZ  1 
ATOM   5922  N NH1 . ARG D  4  125 ? 1.096   -63.283 14.361  1.00 0.00 ? 125 ARG D NH1 1 
ATOM   5923  N NH2 . ARG D  4  125 ? 3.264   -62.475 13.933  1.00 0.00 ? 125 ARG D NH2 1 
ATOM   5924  N N   . PRO D  4  126 ? -3.935  -62.375 12.764  1.00 0.00 ? 126 PRO D N   1 
ATOM   5925  C CA  . PRO D  4  126 ? -4.219  -61.923 14.109  1.00 0.00 ? 126 PRO D CA  1 
ATOM   5926  C C   . PRO D  4  126 ? -3.006  -61.852 14.984  1.00 0.00 ? 126 PRO D C   1 
ATOM   5927  O O   . PRO D  4  126 ? -2.163  -62.736 14.903  1.00 0.00 ? 126 PRO D O   1 
ATOM   5928  C CB  . PRO D  4  126 ? -5.248  -62.922 14.661  1.00 0.00 ? 126 PRO D CB  1 
ATOM   5929  C CG  . PRO D  4  126 ? -5.199  -64.113 13.716  1.00 0.00 ? 126 PRO D CG  1 
ATOM   5930  C CD  . PRO D  4  126 ? -4.772  -63.508 12.395  1.00 0.00 ? 126 PRO D CD  1 
ATOM   5931  N N   . PHE D  4  127 ? -2.888  -60.810 15.834  1.00 0.00 ? 127 PHE D N   1 
ATOM   5932  C CA  . PHE D  4  127 ? -1.832  -60.723 16.812  1.00 0.00 ? 127 PHE D CA  1 
ATOM   5933  C C   . PHE D  4  127 ? -2.044  -61.813 17.802  1.00 0.00 ? 127 PHE D C   1 
ATOM   5934  O O   . PHE D  4  127 ? -3.157  -62.001 18.278  1.00 0.00 ? 127 PHE D O   1 
ATOM   5935  C CB  . PHE D  4  127 ? -1.794  -59.403 17.597  1.00 0.00 ? 127 PHE D CB  1 
ATOM   5936  C CG  . PHE D  4  127 ? -1.505  -58.247 16.687  1.00 0.00 ? 127 PHE D CG  1 
ATOM   5937  C CD1 . PHE D  4  127 ? -0.188  -57.821 16.484  1.00 0.00 ? 127 PHE D CD1 1 
ATOM   5938  C CD2 . PHE D  4  127 ? -2.547  -57.508 16.107  1.00 0.00 ? 127 PHE D CD2 1 
ATOM   5939  C CE1 . PHE D  4  127 ? 0.085   -56.650 15.764  1.00 0.00 ? 127 PHE D CE1 1 
ATOM   5940  C CE2 . PHE D  4  127 ? -2.289  -56.336 15.394  1.00 0.00 ? 127 PHE D CE2 1 
ATOM   5941  C CZ  . PHE D  4  127 ? -0.970  -55.900 15.233  1.00 0.00 ? 127 PHE D CZ  1 
ATOM   5942  N N   . GLY D  4  128 ? -0.990  -62.606 18.054  1.00 0.00 ? 128 GLY D N   1 
ATOM   5943  C CA  . GLY D  4  128 ? -1.069  -63.818 18.819  1.00 0.00 ? 128 GLY D CA  1 
ATOM   5944  C C   . GLY D  4  128 ? -1.157  -63.632 20.298  1.00 0.00 ? 128 GLY D C   1 
ATOM   5945  O O   . GLY D  4  128 ? -1.125  -64.608 21.040  1.00 0.00 ? 128 GLY D O   1 
ATOM   5946  N N   . ILE D  4  129 ? -1.202  -62.381 20.788  1.00 0.00 ? 129 ILE D N   1 
ATOM   5947  C CA  . ILE D  4  129 ? -1.194  -62.104 22.200  1.00 0.00 ? 129 ILE D CA  1 
ATOM   5948  C C   . ILE D  4  129 ? -2.583  -62.079 22.731  1.00 0.00 ? 129 ILE D C   1 
ATOM   5949  O O   . ILE D  4  129 ? -3.526  -61.808 21.996  1.00 0.00 ? 129 ILE D O   1 
ATOM   5950  C CB  . ILE D  4  129 ? -0.491  -60.792 22.514  1.00 0.00 ? 129 ILE D CB  1 
ATOM   5951  C CG1 . ILE D  4  129 ? -1.337  -59.536 22.246  1.00 0.00 ? 129 ILE D CG1 1 
ATOM   5952  C CG2 . ILE D  4  129 ? 0.797   -60.780 21.685  1.00 0.00 ? 129 ILE D CG2 1 
ATOM   5953  C CD1 . ILE D  4  129 ? -0.670  -58.219 22.637  1.00 0.00 ? 129 ILE D CD1 1 
ATOM   5954  N N   . SER D  4  130 ? -2.730  -62.365 24.036  1.00 0.00 ? 130 SER D N   1 
ATOM   5955  C CA  . SER D  4  130 ? -3.937  -62.091 24.751  1.00 0.00 ? 130 SER D CA  1 
ATOM   5956  C C   . SER D  4  130 ? -3.496  -61.314 25.924  1.00 0.00 ? 130 SER D C   1 
ATOM   5957  O O   . SER D  4  130 ? -2.864  -61.855 26.823  1.00 0.00 ? 130 SER D O   1 
ATOM   5958  C CB  . SER D  4  130 ? -4.708  -63.306 25.291  1.00 0.00 ? 130 SER D CB  1 
ATOM   5959  O OG  . SER D  4  130 ? -5.064  -64.185 24.240  1.00 0.00 ? 130 SER D OG  1 
ATOM   5960  N N   . ALA D  4  131 ? -3.793  -60.007 25.921  1.00 0.00 ? 131 ALA D N   1 
ATOM   5961  C CA  . ALA D  4  131 ? -3.254  -59.106 26.884  1.00 0.00 ? 131 ALA D CA  1 
ATOM   5962  C C   . ALA D  4  131 ? -4.121  -59.052 28.086  1.00 0.00 ? 131 ALA D C   1 
ATOM   5963  O O   . ALA D  4  131 ? -5.330  -58.921 27.950  1.00 0.00 ? 131 ALA D O   1 
ATOM   5964  C CB  . ALA D  4  131 ? -3.128  -57.697 26.304  1.00 0.00 ? 131 ALA D CB  1 
ATOM   5965  N N   . LEU D  4  132 ? -3.514  -59.083 29.299  1.00 0.00 ? 132 LEU D N   1 
ATOM   5966  C CA  . LEU D  4  132 ? -4.209  -58.731 30.501  1.00 0.00 ? 132 LEU D CA  1 
ATOM   5967  C C   . LEU D  4  132 ? -3.991  -57.265 30.700  1.00 0.00 ? 132 LEU D C   1 
ATOM   5968  O O   . LEU D  4  132 ? -3.148  -56.883 31.499  1.00 0.00 ? 132 LEU D O   1 
ATOM   5969  C CB  . LEU D  4  132 ? -3.783  -59.452 31.811  1.00 0.00 ? 132 LEU D CB  1 
ATOM   5970  C CG  . LEU D  4  132 ? -4.156  -60.951 31.895  1.00 0.00 ? 132 LEU D CG  1 
ATOM   5971  C CD1 . LEU D  4  132 ? -3.165  -61.835 31.125  1.00 0.00 ? 132 LEU D CD1 1 
ATOM   5972  C CD2 . LEU D  4  132 ? -4.258  -61.416 33.356  1.00 0.00 ? 132 LEU D CD2 1 
ATOM   5973  N N   . ILE D  4  133 ? -4.765  -56.392 30.016  1.00 0.00 ? 133 ILE D N   1 
ATOM   5974  C CA  . ILE D  4  133 ? -4.824  -54.970 30.262  1.00 0.00 ? 133 ILE D CA  1 
ATOM   5975  C C   . ILE D  4  133 ? -5.450  -54.765 31.616  1.00 0.00 ? 133 ILE D C   1 
ATOM   5976  O O   . ILE D  4  133 ? -6.384  -55.464 31.972  1.00 0.00 ? 133 ILE D O   1 
ATOM   5977  C CB  . ILE D  4  133 ? -5.534  -54.209 29.172  1.00 0.00 ? 133 ILE D CB  1 
ATOM   5978  C CG1 . ILE D  4  133 ? -4.969  -54.596 27.802  1.00 0.00 ? 133 ILE D CG1 1 
ATOM   5979  C CG2 . ILE D  4  133 ? -5.354  -52.700 29.397  1.00 0.00 ? 133 ILE D CG2 1 
ATOM   5980  C CD1 . ILE D  4  133 ? -5.864  -54.161 26.658  1.00 0.00 ? 133 ILE D CD1 1 
ATOM   5981  N N   . VAL D  4  134 ? -4.888  -53.876 32.439  1.00 0.00 ? 134 VAL D N   1 
ATOM   5982  C CA  . VAL D  4  134 ? -5.166  -53.726 33.841  1.00 0.00 ? 134 VAL D CA  1 
ATOM   5983  C C   . VAL D  4  134 ? -5.062  -52.247 34.074  1.00 0.00 ? 134 VAL D C   1 
ATOM   5984  O O   . VAL D  4  134 ? -4.441  -51.549 33.287  1.00 0.00 ? 134 VAL D O   1 
ATOM   5985  C CB  . VAL D  4  134 ? -4.155  -54.494 34.685  1.00 0.00 ? 134 VAL D CB  1 
ATOM   5986  C CG1 . VAL D  4  134 ? -4.203  -54.156 36.175  1.00 0.00 ? 134 VAL D CG1 1 
ATOM   5987  C CG2 . VAL D  4  134 ? -4.444  -55.988 34.517  1.00 0.00 ? 134 VAL D CG2 1 
ATOM   5988  N N   . GLY D  4  135 ? -5.709  -51.684 35.114  1.00 0.00 ? 135 GLY D N   1 
ATOM   5989  C CA  . GLY D  4  135 ? -5.472  -50.308 35.413  1.00 0.00 ? 135 GLY D CA  1 
ATOM   5990  C C   . GLY D  4  135 ? -6.498  -49.792 36.340  1.00 0.00 ? 135 GLY D C   1 
ATOM   5991  O O   . GLY D  4  135 ? -7.604  -50.313 36.438  1.00 0.00 ? 135 GLY D O   1 
ATOM   5992  N N   . PHE D  4  136 ? -6.120  -48.718 37.057  1.00 0.00 ? 136 PHE D N   1 
ATOM   5993  C CA  . PHE D  4  136 ? -6.983  -47.930 37.885  1.00 0.00 ? 136 PHE D CA  1 
ATOM   5994  C C   . PHE D  4  136 ? -7.827  -47.057 37.034  1.00 0.00 ? 136 PHE D C   1 
ATOM   5995  O O   . PHE D  4  136 ? -7.427  -46.712 35.929  1.00 0.00 ? 136 PHE D O   1 
ATOM   5996  C CB  . PHE D  4  136 ? -6.217  -46.994 38.832  1.00 0.00 ? 136 PHE D CB  1 
ATOM   5997  C CG  . PHE D  4  136 ? -5.589  -47.813 39.912  1.00 0.00 ? 136 PHE D CG  1 
ATOM   5998  C CD1 . PHE D  4  136 ? -4.424  -48.544 39.663  1.00 0.00 ? 136 PHE D CD1 1 
ATOM   5999  C CD2 . PHE D  4  136 ? -6.195  -47.903 41.175  1.00 0.00 ? 136 PHE D CD2 1 
ATOM   6000  C CE1 . PHE D  4  136 ? -3.895  -49.364 40.655  1.00 0.00 ? 136 PHE D CE1 1 
ATOM   6001  C CE2 . PHE D  4  136 ? -5.676  -48.737 42.161  1.00 0.00 ? 136 PHE D CE2 1 
ATOM   6002  C CZ  . PHE D  4  136 ? -4.519  -49.471 41.893  1.00 0.00 ? 136 PHE D CZ  1 
ATOM   6003  N N   . ASP D  4  137 ? -9.009  -46.663 37.564  1.00 0.00 ? 137 ASP D N   1 
ATOM   6004  C CA  . ASP D  4  137 ? -9.892  -45.693 36.956  1.00 0.00 ? 137 ASP D CA  1 
ATOM   6005  C C   . ASP D  4  137 ? -9.693  -44.393 37.675  1.00 0.00 ? 137 ASP D C   1 
ATOM   6006  O O   . ASP D  4  137 ? -8.843  -44.267 38.549  1.00 0.00 ? 137 ASP D O   1 
ATOM   6007  C CB  . ASP D  4  137 ? -11.383 -46.033 37.102  1.00 0.00 ? 137 ASP D CB  1 
ATOM   6008  C CG  . ASP D  4  137 ? -11.657 -47.403 36.525  1.00 0.00 ? 137 ASP D CG  1 
ATOM   6009  O OD1 . ASP D  4  137 ? -11.358 -47.612 35.325  1.00 0.00 ? 137 ASP D OD1 1 
ATOM   6010  O OD2 . ASP D  4  137 ? -12.191 -48.251 37.281  1.00 0.00 ? 137 ASP D OD2 1 
ATOM   6011  N N   . GLY D  4  140 ? -10.458 -44.974 40.992  1.00 0.00 ? 140 GLY D N   1 
ATOM   6012  C CA  . GLY D  4  140 ? -9.325  -45.579 41.614  1.00 0.00 ? 140 GLY D CA  1 
ATOM   6013  C C   . GLY D  4  140 ? -9.667  -46.991 41.893  1.00 0.00 ? 140 GLY D C   1 
ATOM   6014  O O   . GLY D  4  140 ? -9.103  -47.611 42.795  1.00 0.00 ? 140 GLY D O   1 
ATOM   6015  N N   . THR D  4  141 ? -10.688 -47.491 41.170  1.00 0.00 ? 141 THR D N   1 
ATOM   6016  C CA  . THR D  4  141 ? -11.196 -48.812 41.322  1.00 0.00 ? 141 THR D CA  1 
ATOM   6017  C C   . THR D  4  141 ? -10.477 -49.660 40.315  1.00 0.00 ? 141 THR D C   1 
ATOM   6018  O O   . THR D  4  141 ? -10.341 -49.252 39.165  1.00 0.00 ? 141 THR D O   1 
ATOM   6019  C CB  . THR D  4  141 ? -12.682 -48.808 41.103  1.00 0.00 ? 141 THR D CB  1 
ATOM   6020  O OG1 . THR D  4  141 ? -13.262 -47.994 42.106  1.00 0.00 ? 141 THR D OG1 1 
ATOM   6021  C CG2 . THR D  4  141 ? -13.318 -50.200 41.211  1.00 0.00 ? 141 THR D CG2 1 
ATOM   6022  N N   . PRO D  4  142 ? -9.980  -50.826 40.702  1.00 0.00 ? 142 PRO D N   1 
ATOM   6023  C CA  . PRO D  4  142 ? -9.261  -51.756 39.849  1.00 0.00 ? 142 PRO D CA  1 
ATOM   6024  C C   . PRO D  4  142 ? -10.125 -52.287 38.746  1.00 0.00 ? 142 PRO D C   1 
ATOM   6025  O O   . PRO D  4  142 ? -11.317 -52.441 38.973  1.00 0.00 ? 142 PRO D O   1 
ATOM   6026  C CB  . PRO D  4  142 ? -8.846  -52.861 40.818  1.00 0.00 ? 142 PRO D CB  1 
ATOM   6027  C CG  . PRO D  4  142 ? -9.944  -52.864 41.868  1.00 0.00 ? 142 PRO D CG  1 
ATOM   6028  C CD  . PRO D  4  142 ? -10.140 -51.381 42.055  1.00 0.00 ? 142 PRO D CD  1 
ATOM   6029  N N   . ARG D  4  143 ? -9.542  -52.560 37.553  1.00 0.00 ? 143 ARG D N   1 
ATOM   6030  C CA  . ARG D  4  143 ? -10.242 -53.125 36.413  1.00 0.00 ? 143 ARG D CA  1 
ATOM   6031  C C   . ARG D  4  143 ? -9.283  -54.063 35.758  1.00 0.00 ? 143 ARG D C   1 
ATOM   6032  O O   . ARG D  4  143 ? -8.145  -53.696 35.512  1.00 0.00 ? 143 ARG D O   1 
ATOM   6033  C CB  . ARG D  4  143 ? -10.628 -52.099 35.331  1.00 0.00 ? 143 ARG D CB  1 
ATOM   6034  C CG  . ARG D  4  143 ? -11.463 -50.939 35.876  1.00 0.00 ? 143 ARG D CG  1 
ATOM   6035  C CD  . ARG D  4  143 ? -12.826 -51.321 36.481  1.00 0.00 ? 143 ARG D CD  1 
ATOM   6036  N NE  . ARG D  4  143 ? -13.909 -51.070 35.481  1.00 0.00 ? 143 ARG D NE  1 
ATOM   6037  C CZ  . ARG D  4  143 ? -14.577 -52.058 34.822  1.00 0.00 ? 143 ARG D CZ  1 
ATOM   6038  N NH1 . ARG D  4  143 ? -14.193 -53.362 34.905  1.00 0.00 ? 143 ARG D NH1 1 
ATOM   6039  N NH2 . ARG D  4  143 ? -15.665 -51.723 34.072  1.00 0.00 ? 143 ARG D NH2 1 
ATOM   6040  N N   . LEU D  4  144 ? -9.698  -55.320 35.513  1.00 0.00 ? 144 LEU D N   1 
ATOM   6041  C CA  . LEU D  4  144 ? -8.792  -56.341 35.077  1.00 0.00 ? 144 LEU D CA  1 
ATOM   6042  C C   . LEU D  4  144 ? -9.415  -57.063 33.907  1.00 0.00 ? 144 LEU D C   1 
ATOM   6043  O O   . LEU D  4  144 ? -10.093 -58.070 34.042  1.00 0.00 ? 144 LEU D O   1 
ATOM   6044  C CB  . LEU D  4  144 ? -8.480  -57.312 36.232  1.00 0.00 ? 144 LEU D CB  1 
ATOM   6045  C CG  . LEU D  4  144 ? -7.370  -58.335 35.931  1.00 0.00 ? 144 LEU D CG  1 
ATOM   6046  C CD1 . LEU D  4  144 ? -6.560  -58.682 37.180  1.00 0.00 ? 144 LEU D CD1 1 
ATOM   6047  C CD2 . LEU D  4  144 ? -7.931  -59.607 35.311  1.00 0.00 ? 144 LEU D CD2 1 
ATOM   6048  N N   . TYR D  4  145 ? -9.221  -56.513 32.700  1.00 0.00 ? 145 TYR D N   1 
ATOM   6049  C CA  . TYR D  4  145 ? -9.648  -57.035 31.437  1.00 0.00 ? 145 TYR D CA  1 
ATOM   6050  C C   . TYR D  4  145 ? -8.781  -58.110 30.887  1.00 0.00 ? 145 TYR D C   1 
ATOM   6051  O O   . TYR D  4  145 ? -7.609  -58.188 31.210  1.00 0.00 ? 145 TYR D O   1 
ATOM   6052  C CB  . TYR D  4  145 ? -9.718  -55.930 30.400  1.00 0.00 ? 145 TYR D CB  1 
ATOM   6053  C CG  . TYR D  4  145 ? -10.885 -55.059 30.742  1.00 0.00 ? 145 TYR D CG  1 
ATOM   6054  C CD1 . TYR D  4  145 ? -10.783 -53.960 31.610  1.00 0.00 ? 145 TYR D CD1 1 
ATOM   6055  C CD2 . TYR D  4  145 ? -12.107 -55.328 30.127  1.00 0.00 ? 145 TYR D CD2 1 
ATOM   6056  C CE1 . TYR D  4  145 ? -11.890 -53.133 31.830  1.00 0.00 ? 145 TYR D CE1 1 
ATOM   6057  C CE2 . TYR D  4  145 ? -13.209 -54.513 30.348  1.00 0.00 ? 145 TYR D CE2 1 
ATOM   6058  C CZ  . TYR D  4  145 ? -13.100 -53.410 31.192  1.00 0.00 ? 145 TYR D CZ  1 
ATOM   6059  O OH  . TYR D  4  145 ? -14.216 -52.578 31.367  1.00 0.00 ? 145 TYR D OH  1 
ATOM   6060  N N   . GLN D  4  146 ? -9.367  -58.981 30.043  1.00 0.00 ? 146 GLN D N   1 
ATOM   6061  C CA  . GLN D  4  146 ? -8.671  -59.856 29.141  1.00 0.00 ? 146 GLN D CA  1 
ATOM   6062  C C   . GLN D  4  146 ? -9.014  -59.333 27.800  1.00 0.00 ? 146 GLN D C   1 
ATOM   6063  O O   . GLN D  4  146 ? -10.138 -58.901 27.579  1.00 0.00 ? 146 GLN D O   1 
ATOM   6064  C CB  . GLN D  4  146 ? -9.103  -61.357 29.122  1.00 0.00 ? 146 GLN D CB  1 
ATOM   6065  C CG  . GLN D  4  146 ? -10.264 -61.763 28.161  1.00 0.00 ? 146 GLN D CG  1 
ATOM   6066  C CD  . GLN D  4  146 ? -10.643 -63.253 28.189  1.00 0.00 ? 146 GLN D CD  1 
ATOM   6067  O OE1 . GLN D  4  146 ? -9.799  -64.140 28.352  1.00 0.00 ? 146 GLN D OE1 1 
ATOM   6068  N NE2 . GLN D  4  146 ? -11.968 -63.512 27.960  1.00 0.00 ? 146 GLN D NE2 1 
ATOM   6069  N N   . THR D  4  147 ? -8.098  -59.496 26.840  1.00 0.00 ? 147 THR D N   1 
ATOM   6070  C CA  . THR D  4  147 ? -8.353  -59.222 25.456  1.00 0.00 ? 147 THR D CA  1 
ATOM   6071  C C   . THR D  4  147 ? -7.824  -60.436 24.772  1.00 0.00 ? 147 THR D C   1 
ATOM   6072  O O   . THR D  4  147 ? -6.730  -60.827 25.128  1.00 0.00 ? 147 THR D O   1 
ATOM   6073  C CB  . THR D  4  147 ? -7.659  -57.982 24.955  1.00 0.00 ? 147 THR D CB  1 
ATOM   6074  O OG1 . THR D  4  147 ? -7.899  -56.920 25.861  1.00 0.00 ? 147 THR D OG1 1 
ATOM   6075  C CG2 . THR D  4  147 ? -8.209  -57.605 23.567  1.00 0.00 ? 147 THR D CG2 1 
ATOM   6076  N N   . ASP D  4  148 ? -8.463  -61.004 23.723  1.00 0.00 ? 148 ASP D N   1 
ATOM   6077  C CA  . ASP D  4  148 ? -8.001  -62.236 23.103  1.00 0.00 ? 148 ASP D CA  1 
ATOM   6078  C C   . ASP D  4  148 ? -7.844  -61.910 21.633  1.00 0.00 ? 148 ASP D C   1 
ATOM   6079  O O   . ASP D  4  148 ? -8.305  -60.834 21.262  1.00 0.00 ? 148 ASP D O   1 
ATOM   6080  C CB  . ASP D  4  148 ? -8.900  -63.475 23.373  1.00 0.00 ? 148 ASP D CB  1 
ATOM   6081  C CG  . ASP D  4  148 ? -10.338 -63.402 22.863  1.00 0.00 ? 148 ASP D CG  1 
ATOM   6082  O OD1 . ASP D  4  148 ? -10.639 -62.551 21.990  1.00 0.00 ? 148 ASP D OD1 1 
ATOM   6083  O OD2 . ASP D  4  148 ? -11.158 -64.227 23.349  1.00 0.00 ? 148 ASP D OD2 1 
ATOM   6084  N N   . PRO D  4  149 ? -7.146  -62.664 20.773  1.00 0.00 ? 149 PRO D N   1 
ATOM   6085  C CA  . PRO D  4  149 ? -6.860  -62.311 19.390  1.00 0.00 ? 149 PRO D CA  1 
ATOM   6086  C C   . PRO D  4  149 ? -8.037  -61.982 18.541  1.00 0.00 ? 149 PRO D C   1 
ATOM   6087  O O   . PRO D  4  149 ? -7.884  -61.271 17.552  1.00 0.00 ? 149 PRO D O   1 
ATOM   6088  C CB  . PRO D  4  149 ? -6.170  -63.538 18.817  1.00 0.00 ? 149 PRO D CB  1 
ATOM   6089  C CG  . PRO D  4  149 ? -5.379  -64.072 19.996  1.00 0.00 ? 149 PRO D CG  1 
ATOM   6090  C CD  . PRO D  4  149 ? -6.269  -63.744 21.192  1.00 0.00 ? 149 PRO D CD  1 
ATOM   6091  N N   . SER D  4  150 ? -9.189  -62.594 18.856  1.00 0.00 ? 150 SER D N   1 
ATOM   6092  C CA  . SER D  4  150 ? -10.433 -62.430 18.165  1.00 0.00 ? 150 SER D CA  1 
ATOM   6093  C C   . SER D  4  150 ? -10.866 -60.997 18.160  1.00 0.00 ? 150 SER D C   1 
ATOM   6094  O O   . SER D  4  150 ? -11.388 -60.501 17.164  1.00 0.00 ? 150 SER D O   1 
ATOM   6095  C CB  . SER D  4  150 ? -11.522 -63.281 18.824  1.00 0.00 ? 150 SER D CB  1 
ATOM   6096  O OG  . SER D  4  150 ? -11.020 -64.586 19.071  1.00 0.00 ? 150 SER D OG  1 
ATOM   6097  N N   . GLY D  4  151 ? -10.614 -60.299 19.287  1.00 0.00 ? 151 GLY D N   1 
ATOM   6098  C CA  . GLY D  4  151 ? -10.917 -58.908 19.455  1.00 0.00 ? 151 GLY D CA  1 
ATOM   6099  C C   . GLY D  4  151 ? -11.997 -58.832 20.457  1.00 0.00 ? 151 GLY D C   1 
ATOM   6100  O O   . GLY D  4  151 ? -12.696 -57.831 20.550  1.00 0.00 ? 151 GLY D O   1 
ATOM   6101  N N   . THR D  4  152 ? -12.210 -59.927 21.202  1.00 0.00 ? 152 THR D N   1 
ATOM   6102  C CA  . THR D  4  152 ? -13.196 -59.977 22.227  1.00 0.00 ? 152 THR D CA  1 
ATOM   6103  C C   . THR D  4  152 ? -12.488 -59.485 23.421  1.00 0.00 ? 152 THR D C   1 
ATOM   6104  O O   . THR D  4  152 ? -11.323 -59.807 23.603  1.00 0.00 ? 152 THR D O   1 
ATOM   6105  C CB  . THR D  4  152 ? -13.711 -61.379 22.479  1.00 0.00 ? 152 THR D CB  1 
ATOM   6106  O OG1 . THR D  4  152 ? -13.945 -62.037 21.240  1.00 0.00 ? 152 THR D OG1 1 
ATOM   6107  C CG2 . THR D  4  152 ? -15.032 -61.314 23.280  1.00 0.00 ? 152 THR D CG2 1 
ATOM   6108  N N   . TYR D  4  153 ? -13.153 -58.673 24.249  1.00 0.00 ? 153 TYR D N   1 
ATOM   6109  C CA  . TYR D  4  153 ? -12.543 -58.190 25.431  1.00 0.00 ? 153 TYR D CA  1 
ATOM   6110  C C   . TYR D  4  153 ? -13.566 -58.322 26.471  1.00 0.00 ? 153 TYR D C   1 
ATOM   6111  O O   . TYR D  4  153 ? -14.722 -58.001 26.237  1.00 0.00 ? 153 TYR D O   1 
ATOM   6112  C CB  . TYR D  4  153 ? -12.002 -56.755 25.298  1.00 0.00 ? 153 TYR D CB  1 
ATOM   6113  C CG  . TYR D  4  153 ? -13.017 -55.652 25.354  1.00 0.00 ? 153 TYR D CG  1 
ATOM   6114  C CD1 . TYR D  4  153 ? -13.635 -55.161 24.203  1.00 0.00 ? 153 TYR D CD1 1 
ATOM   6115  C CD2 . TYR D  4  153 ? -13.322 -55.078 26.597  1.00 0.00 ? 153 TYR D CD2 1 
ATOM   6116  C CE1 . TYR D  4  153 ? -14.544 -54.104 24.300  1.00 0.00 ? 153 TYR D CE1 1 
ATOM   6117  C CE2 . TYR D  4  153 ? -14.230 -54.029 26.700  1.00 0.00 ? 153 TYR D CE2 1 
ATOM   6118  C CZ  . TYR D  4  153 ? -14.846 -53.543 25.548  1.00 0.00 ? 153 TYR D CZ  1 
ATOM   6119  O OH  . TYR D  4  153 ? -15.792 -52.499 25.649  1.00 0.00 ? 153 TYR D OH  1 
ATOM   6120  N N   . HIS D  4  154 ? -13.176 -58.818 27.644  1.00 0.00 ? 154 HIS D N   1 
ATOM   6121  C CA  . HIS D  4  154 ? -14.103 -59.106 28.680  1.00 0.00 ? 154 HIS D CA  1 
ATOM   6122  C C   . HIS D  4  154 ? -13.477 -58.609 29.891  1.00 0.00 ? 154 HIS D C   1 
ATOM   6123  O O   . HIS D  4  154 ? -12.291 -58.814 30.068  1.00 0.00 ? 154 HIS D O   1 
ATOM   6124  C CB  . HIS D  4  154 ? -14.306 -60.609 28.857  1.00 0.00 ? 154 HIS D CB  1 
ATOM   6125  C CG  . HIS D  4  154 ? -15.168 -61.170 27.777  1.00 0.00 ? 154 HIS D CG  1 
ATOM   6126  N ND1 . HIS D  4  154 ? -15.030 -62.434 27.255  1.00 0.00 ? 154 HIS D ND1 1 
ATOM   6127  C CD2 . HIS D  4  154 ? -16.239 -60.619 27.148  1.00 0.00 ? 154 HIS D CD2 1 
ATOM   6128  C CE1 . HIS D  4  154 ? -16.013 -62.578 26.335  1.00 0.00 ? 154 HIS D CE1 1 
ATOM   6129  N NE2 . HIS D  4  154 ? -16.769 -61.502 26.234  1.00 0.00 ? 154 HIS D NE2 1 
ATOM   6130  N N   . ALA D  4  155 ? -14.261 -58.016 30.802  1.00 0.00 ? 155 ALA D N   1 
ATOM   6131  C CA  . ALA D  4  155 ? -13.804 -57.666 32.122  1.00 0.00 ? 155 ALA D CA  1 
ATOM   6132  C C   . ALA D  4  155 ? -13.750 -58.908 32.933  1.00 0.00 ? 155 ALA D C   1 
ATOM   6133  O O   . ALA D  4  155 ? -14.600 -59.766 32.751  1.00 0.00 ? 155 ALA D O   1 
ATOM   6134  C CB  . ALA D  4  155 ? -14.713 -56.671 32.865  1.00 0.00 ? 155 ALA D CB  1 
ATOM   6135  N N   . TRP D  4  156 ? -12.839 -58.961 33.917  1.00 0.00 ? 156 TRP D N   1 
ATOM   6136  C CA  . TRP D  4  156 ? -12.652 -60.085 34.787  1.00 0.00 ? 156 TRP D CA  1 
ATOM   6137  C C   . TRP D  4  156 ? -12.335 -59.458 36.076  1.00 0.00 ? 156 TRP D C   1 
ATOM   6138  O O   . TRP D  4  156 ? -12.259 -58.238 36.176  1.00 0.00 ? 156 TRP D O   1 
ATOM   6139  C CB  . TRP D  4  156 ? -11.487 -61.027 34.441  1.00 0.00 ? 156 TRP D CB  1 
ATOM   6140  C CG  . TRP D  4  156 ? -11.745 -61.767 33.182  1.00 0.00 ? 156 TRP D CG  1 
ATOM   6141  C CD1 . TRP D  4  156 ? -11.664 -61.301 31.920  1.00 0.00 ? 156 TRP D CD1 1 
ATOM   6142  C CD2 . TRP D  4  156 ? -12.162 -63.131 33.088  1.00 0.00 ? 156 TRP D CD2 1 
ATOM   6143  N NE1 . TRP D  4  156 ? -12.068 -62.258 31.036  1.00 0.00 ? 156 TRP D NE1 1 
ATOM   6144  C CE2 . TRP D  4  156 ? -12.341 -63.407 31.725  1.00 0.00 ? 156 TRP D CE2 1 
ATOM   6145  C CE3 . TRP D  4  156 ? -12.361 -64.112 34.051  1.00 0.00 ? 156 TRP D CE3 1 
ATOM   6146  C CZ2 . TRP D  4  156 ? -12.685 -64.677 31.290  1.00 0.00 ? 156 TRP D CZ2 1 
ATOM   6147  C CZ3 . TRP D  4  156 ? -12.655 -65.408 33.617  1.00 0.00 ? 156 TRP D CZ3 1 
ATOM   6148  C CH2 . TRP D  4  156 ? -12.797 -65.684 32.250  1.00 0.00 ? 156 TRP D CH2 1 
ATOM   6149  N N   . LYS D  4  157 ? -12.278 -60.292 37.112  1.00 0.00 ? 157 LYS D N   1 
ATOM   6150  C CA  . LYS D  4  157 ? -11.774 -59.913 38.423  1.00 0.00 ? 157 LYS D CA  1 
ATOM   6151  C C   . LYS D  4  157 ? -10.593 -60.808 38.786  1.00 0.00 ? 157 LYS D C   1 
ATOM   6152  O O   . LYS D  4  157 ? -9.917  -60.592 39.792  1.00 0.00 ? 157 LYS D O   1 
ATOM   6153  C CB  . LYS D  4  157 ? -12.874 -60.033 39.479  1.00 0.00 ? 157 LYS D CB  1 
ATOM   6154  C CG  . LYS D  4  157 ? -13.110 -61.452 39.970  1.00 0.00 ? 157 LYS D CG  1 
ATOM   6155  C CD  . LYS D  4  157 ? -14.205 -61.495 41.024  1.00 0.00 ? 157 LYS D CD  1 
ATOM   6156  C CE  . LYS D  4  157 ? -14.005 -60.414 42.073  1.00 0.00 ? 157 LYS D CE  1 
ATOM   6157  N NZ  . LYS D  4  157 ? -15.078 -60.437 43.106  1.00 0.00 ? 157 LYS D NZ  1 
ATOM   6158  N N   . ALA D  4  158 ? -10.500 -61.910 38.072  1.00 0.00 ? 158 ALA D N   1 
ATOM   6159  C CA  . ALA D  4  158 ? -9.360  -62.776 38.144  1.00 0.00 ? 158 ALA D CA  1 
ATOM   6160  C C   . ALA D  4  158 ? -9.297  -63.325 36.751  1.00 0.00 ? 158 ALA D C   1 
ATOM   6161  O O   . ALA D  4  158 ? -10.330 -63.580 36.132  1.00 0.00 ? 158 ALA D O   1 
ATOM   6162  C CB  . ALA D  4  158 ? -9.595  -63.888 39.150  1.00 0.00 ? 158 ALA D CB  1 
ATOM   6163  N N   . ASN D  4  159 ? -8.096  -63.529 36.249  1.00 0.00 ? 159 ASN D N   1 
ATOM   6164  C CA  . ASN D  4  159 ? -7.983  -64.201 34.998  1.00 0.00 ? 159 ASN D CA  1 
ATOM   6165  C C   . ASN D  4  159 ? -6.538  -64.517 34.914  1.00 0.00 ? 159 ASN D C   1 
ATOM   6166  O O   . ASN D  4  159 ? -5.713  -63.866 35.541  1.00 0.00 ? 159 ASN D O   1 
ATOM   6167  C CB  . ASN D  4  159 ? -8.406  -63.325 33.791  1.00 0.00 ? 159 ASN D CB  1 
ATOM   6168  C CG  . ASN D  4  159 ? -8.459  -64.123 32.472  1.00 0.00 ? 159 ASN D CG  1 
ATOM   6169  O OD1 . ASN D  4  159 ? -8.825  -65.301 32.439  1.00 0.00 ? 159 ASN D OD1 1 
ATOM   6170  N ND2 . ASN D  4  159 ? -8.088  -63.440 31.354  1.00 0.00 ? 159 ASN D ND2 1 
ATOM   6171  N N   . ALA D  4  160 ? -6.187  -65.559 34.153  1.00 0.00 ? 160 ALA D N   1 
ATOM   6172  C CA  . ALA D  4  160 ? -4.819  -65.885 33.983  1.00 0.00 ? 160 ALA D CA  1 
ATOM   6173  C C   . ALA D  4  160 ? -4.737  -66.561 32.676  1.00 0.00 ? 160 ALA D C   1 
ATOM   6174  O O   . ALA D  4  160 ? -5.454  -67.517 32.405  1.00 0.00 ? 160 ALA D O   1 
ATOM   6175  C CB  . ALA D  4  160 ? -4.297  -66.828 35.068  1.00 0.00 ? 160 ALA D CB  1 
ATOM   6176  N N   . ILE D  4  161 ? -3.855  -66.045 31.804  1.00 0.00 ? 161 ILE D N   1 
ATOM   6177  C CA  . ILE D  4  161 ? -3.750  -66.541 30.463  1.00 0.00 ? 161 ILE D CA  1 
ATOM   6178  C C   . ILE D  4  161 ? -2.317  -66.896 30.311  1.00 0.00 ? 161 ILE D C   1 
ATOM   6179  O O   . ILE D  4  161 ? -1.449  -66.130 30.713  1.00 0.00 ? 161 ILE D O   1 
ATOM   6180  C CB  . ILE D  4  161 ? -4.130  -65.537 29.380  1.00 0.00 ? 161 ILE D CB  1 
ATOM   6181  C CG1 . ILE D  4  161 ? -5.288  -64.611 29.804  1.00 0.00 ? 161 ILE D CG1 1 
ATOM   6182  C CG2 . ILE D  4  161 ? -4.503  -66.354 28.128  1.00 0.00 ? 161 ILE D CG2 1 
ATOM   6183  C CD1 . ILE D  4  161 ? -5.583  -63.501 28.794  1.00 0.00 ? 161 ILE D CD1 1 
ATOM   6184  N N   . GLY D  4  162 ? -2.055  -68.101 29.772  1.00 0.00 ? 162 GLY D N   1 
ATOM   6185  C CA  . GLY D  4  162 ? -0.733  -68.606 29.649  1.00 0.00 ? 162 GLY D CA  1 
ATOM   6186  C C   . GLY D  4  162 ? -0.804  -70.090 29.694  1.00 0.00 ? 162 GLY D C   1 
ATOM   6187  O O   . GLY D  4  162 ? -1.878  -70.688 29.701  1.00 0.00 ? 162 GLY D O   1 
ATOM   6188  N N   . ARG D  4  163 ? 0.393   -70.706 29.680  1.00 0.00 ? 163 ARG D N   1 
ATOM   6189  C CA  . ARG D  4  163 ? 0.629   -72.117 29.672  1.00 0.00 ? 163 ARG D CA  1 
ATOM   6190  C C   . ARG D  4  163 ? 0.465   -72.580 31.080  1.00 0.00 ? 163 ARG D C   1 
ATOM   6191  O O   . ARG D  4  163 ? 1.251   -72.239 31.956  1.00 0.00 ? 163 ARG D O   1 
ATOM   6192  C CB  . ARG D  4  163 ? 2.061   -72.419 29.154  1.00 0.00 ? 163 ARG D CB  1 
ATOM   6193  C CG  . ARG D  4  163 ? 2.618   -73.849 29.335  1.00 0.00 ? 163 ARG D CG  1 
ATOM   6194  C CD  . ARG D  4  163 ? 1.835   -74.964 28.626  1.00 0.00 ? 163 ARG D CD  1 
ATOM   6195  N NE  . ARG D  4  163 ? 1.943   -74.771 27.140  1.00 0.00 ? 163 ARG D NE  1 
ATOM   6196  C CZ  . ARG D  4  163 ? 0.921   -75.029 26.268  1.00 0.00 ? 163 ARG D CZ  1 
ATOM   6197  N NH1 . ARG D  4  163 ? -0.285  -75.487 26.710  1.00 0.00 ? 163 ARG D NH1 1 
ATOM   6198  N NH2 . ARG D  4  163 ? 1.113   -74.804 24.934  1.00 0.00 ? 163 ARG D NH2 1 
ATOM   6199  N N   . GLY D  4  164 ? -0.608  -73.355 31.331  1.00 0.00 ? 164 GLY D N   1 
ATOM   6200  C CA  . GLY D  4  164 ? -0.934  -73.872 32.634  1.00 0.00 ? 164 GLY D CA  1 
ATOM   6201  C C   . GLY D  4  164 ? -1.690  -72.862 33.440  1.00 0.00 ? 164 GLY D C   1 
ATOM   6202  O O   . GLY D  4  164 ? -2.060  -73.121 34.579  1.00 0.00 ? 164 GLY D O   1 
ATOM   6203  N N   . ALA D  4  165 ? -1.973  -71.686 32.857  1.00 0.00 ? 165 ALA D N   1 
ATOM   6204  C CA  . ALA D  4  165 ? -2.709  -70.630 33.487  1.00 0.00 ? 165 ALA D CA  1 
ATOM   6205  C C   . ALA D  4  165 ? -4.164  -70.950 33.674  1.00 0.00 ? 165 ALA D C   1 
ATOM   6206  O O   . ALA D  4  165 ? -4.842  -70.401 34.528  1.00 0.00 ? 165 ALA D O   1 
ATOM   6207  C CB  . ALA D  4  165 ? -2.640  -69.351 32.675  1.00 0.00 ? 165 ALA D CB  1 
ATOM   6208  N N   . LYS D  4  166 ? -4.703  -71.844 32.838  1.00 0.00 ? 166 LYS D N   1 
ATOM   6209  C CA  . LYS D  4  166 ? -6.073  -72.259 32.881  1.00 0.00 ? 166 LYS D CA  1 
ATOM   6210  C C   . LYS D  4  166 ? -6.355  -73.032 34.145  1.00 0.00 ? 166 LYS D C   1 
ATOM   6211  O O   . LYS D  4  166 ? -7.389  -72.864 34.799  1.00 0.00 ? 166 LYS D O   1 
ATOM   6212  C CB  . LYS D  4  166 ? -6.379  -73.126 31.649  1.00 0.00 ? 166 LYS D CB  1 
ATOM   6213  C CG  . LYS D  4  166 ? -5.981  -72.394 30.366  1.00 0.00 ? 166 LYS D CG  1 
ATOM   6214  C CD  . LYS D  4  166 ? -6.528  -73.036 29.089  1.00 0.00 ? 166 LYS D CD  1 
ATOM   6215  C CE  . LYS D  4  166 ? -8.061  -73.023 28.959  1.00 0.00 ? 166 LYS D CE  1 
ATOM   6216  N NZ  . LYS D  4  166 ? -8.605  -71.645 29.008  1.00 0.00 ? 166 LYS D NZ  1 
ATOM   6217  N N   . SER D  4  167 ? -5.390  -73.899 34.508  1.00 0.00 ? 167 SER D N   1 
ATOM   6218  C CA  . SER D  4  167 ? -5.426  -74.688 35.703  1.00 0.00 ? 167 SER D CA  1 
ATOM   6219  C C   . SER D  4  167 ? -5.323  -73.814 36.920  1.00 0.00 ? 167 SER D C   1 
ATOM   6220  O O   . SER D  4  167 ? -5.908  -74.118 37.954  1.00 0.00 ? 167 SER D O   1 
ATOM   6221  C CB  . SER D  4  167 ? -4.220  -75.642 35.729  1.00 0.00 ? 167 SER D CB  1 
ATOM   6222  O OG  . SER D  4  167 ? -3.982  -76.191 34.438  1.00 0.00 ? 167 SER D OG  1 
ATOM   6223  N N   . VAL D  4  168 ? -4.594  -72.681 36.782  1.00 0.00 ? 168 VAL D N   1 
ATOM   6224  C CA  . VAL D  4  168 ? -4.476  -71.596 37.732  1.00 0.00 ? 168 VAL D CA  1 
ATOM   6225  C C   . VAL D  4  168 ? -5.751  -70.823 37.890  1.00 0.00 ? 168 VAL D C   1 
ATOM   6226  O O   . VAL D  4  168 ? -6.066  -70.402 38.995  1.00 0.00 ? 168 VAL D O   1 
ATOM   6227  C CB  . VAL D  4  168 ? -3.264  -70.715 37.441  1.00 0.00 ? 168 VAL D CB  1 
ATOM   6228  C CG1 . VAL D  4  168 ? -3.432  -69.246 37.869  1.00 0.00 ? 168 VAL D CG1 1 
ATOM   6229  C CG2 . VAL D  4  168 ? -2.064  -71.375 38.150  1.00 0.00 ? 168 VAL D CG2 1 
ATOM   6230  N N   . ARG D  4  169 ? -6.532  -70.611 36.803  1.00 0.00 ? 169 ARG D N   1 
ATOM   6231  C CA  . ARG D  4  169 ? -7.793  -69.911 36.903  1.00 0.00 ? 169 ARG D CA  1 
ATOM   6232  C C   . ARG D  4  169 ? -8.736  -70.740 37.699  1.00 0.00 ? 169 ARG D C   1 
ATOM   6233  O O   . ARG D  4  169 ? -9.464  -70.186 38.509  1.00 0.00 ? 169 ARG D O   1 
ATOM   6234  C CB  . ARG D  4  169 ? -8.533  -69.676 35.576  1.00 0.00 ? 169 ARG D CB  1 
ATOM   6235  C CG  . ARG D  4  169 ? -7.898  -68.630 34.658  1.00 0.00 ? 169 ARG D CG  1 
ATOM   6236  C CD  . ARG D  4  169 ? -8.689  -68.378 33.364  1.00 0.00 ? 169 ARG D CD  1 
ATOM   6237  N NE  . ARG D  4  169 ? -8.799  -69.659 32.600  1.00 0.00 ? 169 ARG D NE  1 
ATOM   6238  C CZ  . ARG D  4  169 ? -9.909  -70.454 32.638  1.00 0.00 ? 169 ARG D CZ  1 
ATOM   6239  N NH1 . ARG D  4  169 ? -11.071 -70.022 33.204  1.00 0.00 ? 169 ARG D NH1 1 
ATOM   6240  N NH2 . ARG D  4  169 ? -9.847  -71.717 32.126  1.00 0.00 ? 169 ARG D NH2 1 
ATOM   6241  N N   . GLU D  4  170 ? -8.722  -72.083 37.490  1.00 0.00 ? 170 GLU D N   1 
ATOM   6242  C CA  . GLU D  4  170 ? -9.514  -73.001 38.268  1.00 0.00 ? 170 GLU D CA  1 
ATOM   6243  C C   . GLU D  4  170 ? -9.073  -73.074 39.682  1.00 0.00 ? 170 GLU D C   1 
ATOM   6244  O O   . GLU D  4  170 ? -9.904  -73.254 40.566  1.00 0.00 ? 170 GLU D O   1 
ATOM   6245  C CB  . GLU D  4  170 ? -9.556  -74.430 37.727  1.00 0.00 ? 170 GLU D CB  1 
ATOM   6246  C CG  . GLU D  4  170 ? -10.240 -74.496 36.354  1.00 0.00 ? 170 GLU D CG  1 
ATOM   6247  C CD  . GLU D  4  170 ? -10.901 -75.861 36.182  1.00 0.00 ? 170 GLU D CD  1 
ATOM   6248  O OE1 . GLU D  4  170 ? -10.214 -76.889 36.404  1.00 0.00 ? 170 GLU D OE1 1 
ATOM   6249  O OE2 . GLU D  4  170 ? -12.110 -75.888 35.833  1.00 0.00 ? 170 GLU D OE2 1 
ATOM   6250  N N   . PHE D  4  171 ? -7.752  -72.912 39.918  1.00 0.00 ? 171 PHE D N   1 
ATOM   6251  C CA  . PHE D  4  171 ? -7.150  -72.848 41.229  1.00 0.00 ? 171 PHE D CA  1 
ATOM   6252  C C   . PHE D  4  171 ? -7.608  -71.616 41.980  1.00 0.00 ? 171 PHE D C   1 
ATOM   6253  O O   . PHE D  4  171 ? -7.776  -71.631 43.195  1.00 0.00 ? 171 PHE D O   1 
ATOM   6254  C CB  . PHE D  4  171 ? -5.611  -72.859 41.121  1.00 0.00 ? 171 PHE D CB  1 
ATOM   6255  C CG  . PHE D  4  171 ? -4.957  -72.792 42.463  1.00 0.00 ? 171 PHE D CG  1 
ATOM   6256  C CD1 . PHE D  4  171 ? -4.891  -73.920 43.290  1.00 0.00 ? 171 PHE D CD1 1 
ATOM   6257  C CD2 . PHE D  4  171 ? -4.435  -71.576 42.914  1.00 0.00 ? 171 PHE D CD2 1 
ATOM   6258  C CE1 . PHE D  4  171 ? -4.314  -73.832 44.560  1.00 0.00 ? 171 PHE D CE1 1 
ATOM   6259  C CE2 . PHE D  4  171 ? -3.830  -71.494 44.162  1.00 0.00 ? 171 PHE D CE2 1 
ATOM   6260  C CZ  . PHE D  4  171 ? -3.770  -72.620 44.991  1.00 0.00 ? 171 PHE D CZ  1 
ATOM   6261  N N   . LEU D  4  172 ? -7.820  -70.516 41.238  1.00 0.00 ? 172 LEU D N   1 
ATOM   6262  C CA  . LEU D  4  172 ? -8.393  -69.306 41.730  1.00 0.00 ? 172 LEU D CA  1 
ATOM   6263  C C   . LEU D  4  172 ? -9.840  -69.502 41.964  1.00 0.00 ? 172 LEU D C   1 
ATOM   6264  O O   . LEU D  4  172 ? -10.327 -69.011 42.956  1.00 0.00 ? 172 LEU D O   1 
ATOM   6265  C CB  . LEU D  4  172 ? -8.163  -68.109 40.773  1.00 0.00 ? 172 LEU D CB  1 
ATOM   6266  C CG  . LEU D  4  172 ? -6.683  -67.675 40.586  1.00 0.00 ? 172 LEU D CG  1 
ATOM   6267  C CD1 . LEU D  4  172 ? -6.427  -66.586 39.533  1.00 0.00 ? 172 LEU D CD1 1 
ATOM   6268  C CD2 . LEU D  4  172 ? -6.057  -67.271 41.933  1.00 0.00 ? 172 LEU D CD2 1 
ATOM   6269  N N   . GLU D  4  173 ? -10.592 -70.205 41.099  1.00 0.00 ? 173 GLU D N   1 
ATOM   6270  C CA  . GLU D  4  173 ? -12.035 -70.282 41.209  1.00 0.00 ? 173 GLU D CA  1 
ATOM   6271  C C   . GLU D  4  173 ? -12.482 -70.942 42.469  1.00 0.00 ? 173 GLU D C   1 
ATOM   6272  O O   . GLU D  4  173 ? -13.498 -70.543 43.028  1.00 0.00 ? 173 GLU D O   1 
ATOM   6273  C CB  . GLU D  4  173 ? -12.688 -70.999 40.012  1.00 0.00 ? 173 GLU D CB  1 
ATOM   6274  C CG  . GLU D  4  173 ? -12.721 -70.126 38.747  1.00 0.00 ? 173 GLU D CG  1 
ATOM   6275  C CD  . GLU D  4  173 ? -12.932 -70.978 37.497  1.00 0.00 ? 173 GLU D CD  1 
ATOM   6276  O OE1 . GLU D  4  173 ? -13.733 -71.944 37.565  1.00 0.00 ? 173 GLU D OE1 1 
ATOM   6277  O OE2 . GLU D  4  173 ? -12.305 -70.673 36.450  1.00 0.00 ? 173 GLU D OE2 1 
ATOM   6278  N N   . LYS D  4  174 ? -11.702 -71.930 42.963  1.00 0.00 ? 174 LYS D N   1 
ATOM   6279  C CA  . LYS D  4  174 ? -11.983 -72.631 44.188  1.00 0.00 ? 174 LYS D CA  1 
ATOM   6280  C C   . LYS D  4  174 ? -11.422 -71.913 45.393  1.00 0.00 ? 174 LYS D C   1 
ATOM   6281  O O   . LYS D  4  174 ? -11.679 -72.319 46.524  1.00 0.00 ? 174 LYS D O   1 
ATOM   6282  C CB  . LYS D  4  174 ? -11.434 -74.065 44.163  1.00 0.00 ? 174 LYS D CB  1 
ATOM   6283  C CG  . LYS D  4  174 ? -9.924  -74.168 43.944  1.00 0.00 ? 174 LYS D CG  1 
ATOM   6284  C CD  . LYS D  4  174 ? -9.429  -75.618 43.969  1.00 0.00 ? 174 LYS D CD  1 
ATOM   6285  C CE  . LYS D  4  174 ? -7.916  -75.741 43.771  1.00 0.00 ? 174 LYS D CE  1 
ATOM   6286  N NZ  . LYS D  4  174 ? -7.449  -77.121 44.026  1.00 0.00 ? 174 LYS D NZ  1 
ATOM   6287  N N   . ASN D  4  175 ? -10.594 -70.899 45.156  1.00 0.00 ? 175 ASN D N   1 
ATOM   6288  C CA  . ASN D  4  175 ? -10.005 -70.113 46.241  1.00 0.00 ? 175 ASN D CA  1 
ATOM   6289  C C   . ASN D  4  175 ? -10.334 -68.616 46.238  1.00 0.00 ? 175 ASN D C   1 
ATOM   6290  O O   . ASN D  4  175 ? -9.720  -67.849 46.980  1.00 0.00 ? 175 ASN D O   1 
ATOM   6291  C CB  . ASN D  4  175 ? -8.486  -70.308 46.272  1.00 0.00 ? 175 ASN D CB  1 
ATOM   6292  C CG  . ASN D  4  175 ? -8.085  -71.688 46.755  1.00 0.00 ? 175 ASN D CG  1 
ATOM   6293  O OD1 . ASN D  4  175 ? -8.614  -72.189 47.747  1.00 0.00 ? 175 ASN D OD1 1 
ATOM   6294  N ND2 . ASN D  4  175 ? -7.145  -72.311 46.054  1.00 0.00 ? 175 ASN D ND2 1 
ATOM   6295  N N   . TYR D  4  176 ? -11.276 -68.193 45.400  1.00 0.00 ? 176 TYR D N   1 
ATOM   6296  C CA  . TYR D  4  176 ? -11.449 -66.783 45.134  1.00 0.00 ? 176 TYR D CA  1 
ATOM   6297  C C   . TYR D  4  176 ? -12.704 -66.383 45.825  1.00 0.00 ? 176 TYR D C   1 
ATOM   6298  O O   . TYR D  4  176 ? -13.782 -66.938 45.618  1.00 0.00 ? 176 TYR D O   1 
ATOM   6299  C CB  . TYR D  4  176 ? -11.577 -66.364 43.648  1.00 0.00 ? 176 TYR D CB  1 
ATOM   6300  C CG  . TYR D  4  176 ? -11.397 -64.881 43.526  1.00 0.00 ? 176 TYR D CG  1 
ATOM   6301  C CD1 . TYR D  4  176 ? -12.432 -63.990 43.844  1.00 0.00 ? 176 TYR D CD1 1 
ATOM   6302  C CD2 . TYR D  4  176 ? -10.159 -64.373 43.122  1.00 0.00 ? 176 TYR D CD2 1 
ATOM   6303  C CE1 . TYR D  4  176 ? -12.217 -62.616 43.796  1.00 0.00 ? 176 TYR D CE1 1 
ATOM   6304  C CE2 . TYR D  4  176 ? -9.955  -62.997 43.026  1.00 0.00 ? 176 TYR D CE2 1 
ATOM   6305  C CZ  . TYR D  4  176 ? -10.986 -62.112 43.362  1.00 0.00 ? 176 TYR D CZ  1 
ATOM   6306  O OH  . TYR D  4  176 ? -10.798 -60.717 43.257  1.00 0.00 ? 176 TYR D OH  1 
ATOM   6307  N N   . ASP D  4  184 ? -2.903  -56.231 50.850  1.00 0.00 ? 184 ASP D N   1 
ATOM   6308  C CA  . ASP D  4  184 ? -1.820  -56.109 49.908  1.00 0.00 ? 184 ASP D CA  1 
ATOM   6309  C C   . ASP D  4  184 ? -1.043  -57.400 49.875  1.00 0.00 ? 184 ASP D C   1 
ATOM   6310  O O   . ASP D  4  184 ? -0.735  -57.963 48.825  1.00 0.00 ? 184 ASP D O   1 
ATOM   6311  C CB  . ASP D  4  184 ? -0.902  -54.968 50.400  1.00 0.00 ? 184 ASP D CB  1 
ATOM   6312  C CG  . ASP D  4  184 ? 0.243   -54.679 49.447  1.00 0.00 ? 184 ASP D CG  1 
ATOM   6313  O OD1 . ASP D  4  184 ? -0.038  -54.102 48.367  1.00 0.00 ? 184 ASP D OD1 1 
ATOM   6314  O OD2 . ASP D  4  184 ? 1.404   -55.020 49.792  1.00 0.00 ? 184 ASP D OD2 1 
ATOM   6315  N N   . ASP D  4  185 ? -0.811  -57.941 51.085  1.00 0.00 ? 185 ASP D N   1 
ATOM   6316  C CA  . ASP D  4  185 ? -0.155  -59.197 51.296  1.00 0.00 ? 185 ASP D CA  1 
ATOM   6317  C C   . ASP D  4  185 ? -0.979  -60.334 50.776  1.00 0.00 ? 185 ASP D C   1 
ATOM   6318  O O   . ASP D  4  185 ? -0.432  -61.280 50.241  1.00 0.00 ? 185 ASP D O   1 
ATOM   6319  C CB  . ASP D  4  185 ? 0.109   -59.363 52.819  1.00 0.00 ? 185 ASP D CB  1 
ATOM   6320  C CG  . ASP D  4  185 ? 0.667   -60.724 53.227  1.00 0.00 ? 185 ASP D CG  1 
ATOM   6321  O OD1 . ASP D  4  185 ? 1.780   -61.082 52.769  1.00 0.00 ? 185 ASP D OD1 1 
ATOM   6322  O OD2 . ASP D  4  185 ? -0.029  -61.424 54.005  1.00 0.00 ? 185 ASP D OD2 1 
ATOM   6323  N N   . LEU D  4  186 ? -2.308  -60.272 50.920  1.00 0.00 ? 186 LEU D N   1 
ATOM   6324  C CA  . LEU D  4  186 ? -3.192  -61.346 50.583  1.00 0.00 ? 186 LEU D CA  1 
ATOM   6325  C C   . LEU D  4  186 ? -3.458  -61.419 49.126  1.00 0.00 ? 186 LEU D C   1 
ATOM   6326  O O   . LEU D  4  186 ? -3.578  -62.518 48.596  1.00 0.00 ? 186 LEU D O   1 
ATOM   6327  C CB  . LEU D  4  186 ? -4.476  -61.341 51.438  1.00 0.00 ? 186 LEU D CB  1 
ATOM   6328  C CG  . LEU D  4  186 ? -4.152  -61.740 52.908  1.00 0.00 ? 186 LEU D CG  1 
ATOM   6329  C CD1 . LEU D  4  186 ? -5.189  -61.260 53.934  1.00 0.00 ? 186 LEU D CD1 1 
ATOM   6330  C CD2 . LEU D  4  186 ? -3.943  -63.259 53.055  1.00 0.00 ? 186 LEU D CD2 1 
ATOM   6331  N N   . THR D  4  187 ? -3.591  -60.281 48.409  1.00 0.00 ? 187 THR D N   1 
ATOM   6332  C CA  . THR D  4  187 ? -3.730  -60.345 46.976  1.00 0.00 ? 187 THR D CA  1 
ATOM   6333  C C   . THR D  4  187 ? -2.454  -60.814 46.342  1.00 0.00 ? 187 THR D C   1 
ATOM   6334  O O   . THR D  4  187 ? -2.489  -61.545 45.356  1.00 0.00 ? 187 THR D O   1 
ATOM   6335  C CB  . THR D  4  187 ? -4.213  -59.028 46.369  1.00 0.00 ? 187 THR D CB  1 
ATOM   6336  O OG1 . THR D  4  187 ? -4.617  -59.213 45.022  1.00 0.00 ? 187 THR D OG1 1 
ATOM   6337  C CG2 . THR D  4  187 ? -3.175  -57.895 46.436  1.00 0.00 ? 187 THR D CG2 1 
ATOM   6338  N N   . ILE D  4  188 ? -1.288  -60.416 46.920  1.00 0.00 ? 188 ILE D N   1 
ATOM   6339  C CA  . ILE D  4  188 ? 0.001   -60.921 46.518  1.00 0.00 ? 188 ILE D CA  1 
ATOM   6340  C C   . ILE D  4  188 ? 0.141   -62.380 46.843  1.00 0.00 ? 188 ILE D C   1 
ATOM   6341  O O   . ILE D  4  188 ? 0.740   -63.115 46.071  1.00 0.00 ? 188 ILE D O   1 
ATOM   6342  C CB  . ILE D  4  188 ? 1.118   -60.053 47.090  1.00 0.00 ? 188 ILE D CB  1 
ATOM   6343  C CG1 . ILE D  4  188 ? 1.009   -58.648 46.455  1.00 0.00 ? 188 ILE D CG1 1 
ATOM   6344  C CG2 . ILE D  4  188 ? 2.525   -60.652 46.841  1.00 0.00 ? 188 ILE D CG2 1 
ATOM   6345  C CD1 . ILE D  4  188 ? 0.327   -57.610 47.344  1.00 0.00 ? 188 ILE D CD1 1 
ATOM   6346  N N   . LYS D  4  189 ? -0.459  -62.857 47.963  1.00 0.00 ? 189 LYS D N   1 
ATOM   6347  C CA  . LYS D  4  189 ? -0.487  -64.246 48.332  1.00 0.00 ? 189 LYS D CA  1 
ATOM   6348  C C   . LYS D  4  189 ? -1.245  -65.007 47.322  1.00 0.00 ? 189 LYS D C   1 
ATOM   6349  O O   . LYS D  4  189 ? -0.868  -66.125 47.062  1.00 0.00 ? 189 LYS D O   1 
ATOM   6350  C CB  . LYS D  4  189 ? -1.191  -64.654 49.657  1.00 0.00 ? 189 LYS D CB  1 
ATOM   6351  C CG  . LYS D  4  189 ? -0.473  -64.307 50.963  1.00 0.00 ? 189 LYS D CG  1 
ATOM   6352  C CD  . LYS D  4  189 ? -0.806  -65.298 52.095  1.00 0.00 ? 189 LYS D CD  1 
ATOM   6353  C CE  . LYS D  4  189 ? -0.276  -64.886 53.470  1.00 0.00 ? 189 LYS D CE  1 
ATOM   6354  N NZ  . LYS D  4  189 ? 1.150   -64.525 53.398  1.00 0.00 ? 189 LYS D NZ  1 
ATOM   6355  N N   . LEU D  4  190 ? -2.316  -64.464 46.721  1.00 0.00 ? 190 LEU D N   1 
ATOM   6356  C CA  . LEU D  4  190 ? -3.081  -65.146 45.721  1.00 0.00 ? 190 LEU D CA  1 
ATOM   6357  C C   . LEU D  4  190 ? -2.242  -65.312 44.479  1.00 0.00 ? 190 LEU D C   1 
ATOM   6358  O O   . LEU D  4  190 ? -2.145  -66.405 43.914  1.00 0.00 ? 190 LEU D O   1 
ATOM   6359  C CB  . LEU D  4  190 ? -4.384  -64.365 45.469  1.00 0.00 ? 190 LEU D CB  1 
ATOM   6360  C CG  . LEU D  4  190 ? -5.392  -65.004 44.478  1.00 0.00 ? 190 LEU D CG  1 
ATOM   6361  C CD1 . LEU D  4  190 ? -6.855  -64.633 44.823  1.00 0.00 ? 190 LEU D CD1 1 
ATOM   6362  C CD2 . LEU D  4  190 ? -5.069  -64.629 43.020  1.00 0.00 ? 190 LEU D CD2 1 
ATOM   6363  N N   . VAL D  4  191 ? -1.582  -64.211 44.046  1.00 0.00 ? 191 VAL D N   1 
ATOM   6364  C CA  . VAL D  4  191 ? -0.764  -64.168 42.851  1.00 0.00 ? 191 VAL D CA  1 
ATOM   6365  C C   . VAL D  4  191 ? 0.437   -65.076 42.953  1.00 0.00 ? 191 VAL D C   1 
ATOM   6366  O O   . VAL D  4  191 ? 0.791   -65.731 41.981  1.00 0.00 ? 191 VAL D O   1 
ATOM   6367  C CB  . VAL D  4  191 ? -0.369  -62.722 42.561  1.00 0.00 ? 191 VAL D CB  1 
ATOM   6368  C CG1 . VAL D  4  191 ? 0.868   -62.587 41.641  1.00 0.00 ? 191 VAL D CG1 1 
ATOM   6369  C CG2 . VAL D  4  191 ? -1.590  -62.038 41.917  1.00 0.00 ? 191 VAL D CG2 1 
ATOM   6370  N N   . ILE D  4  192 ? 1.058   -65.197 44.141  1.00 0.00 ? 192 ILE D N   1 
ATOM   6371  C CA  . ILE D  4  192 ? 2.163   -66.095 44.365  1.00 0.00 ? 192 ILE D CA  1 
ATOM   6372  C C   . ILE D  4  192 ? 1.675   -67.488 44.415  1.00 0.00 ? 192 ILE D C   1 
ATOM   6373  O O   . ILE D  4  192 ? 2.366   -68.360 43.929  1.00 0.00 ? 192 ILE D O   1 
ATOM   6374  C CB  . ILE D  4  192 ? 2.865   -65.844 45.703  1.00 0.00 ? 192 ILE D CB  1 
ATOM   6375  C CG1 . ILE D  4  192 ? 3.825   -64.645 45.650  1.00 0.00 ? 192 ILE D CG1 1 
ATOM   6376  C CG2 . ILE D  4  192 ? 3.666   -67.053 46.253  1.00 0.00 ? 192 ILE D CG2 1 
ATOM   6377  C CD1 . ILE D  4  192 ? 5.051   -64.870 44.766  1.00 0.00 ? 192 ILE D CD1 1 
ATOM   6378  N N   . LYS D  4  193 ? 0.582   -67.734 45.167  1.00 0.00 ? 193 LYS D N   1 
ATOM   6379  C CA  . LYS D  4  193 ? 0.123   -69.031 45.603  1.00 0.00 ? 193 LYS D CA  1 
ATOM   6380  C C   . LYS D  4  193 ? -0.255  -69.813 44.442  1.00 0.00 ? 193 LYS D C   1 
ATOM   6381  O O   . LYS D  4  193 ? 0.049   -70.998 44.405  1.00 0.00 ? 193 LYS D O   1 
ATOM   6382  C CB  . LYS D  4  193 ? -1.088  -68.949 46.554  1.00 0.00 ? 193 LYS D CB  1 
ATOM   6383  C CG  . LYS D  4  193 ? -1.655  -70.278 47.058  1.00 0.00 ? 193 LYS D CG  1 
ATOM   6384  C CD  . LYS D  4  193 ? -2.912  -70.119 47.943  1.00 0.00 ? 193 LYS D CD  1 
ATOM   6385  C CE  . LYS D  4  193 ? -4.063  -69.348 47.274  1.00 0.00 ? 193 LYS D CE  1 
ATOM   6386  N NZ  . LYS D  4  193 ? -5.342  -69.583 47.971  1.00 0.00 ? 193 LYS D NZ  1 
ATOM   6387  N N   . ALA D  4  194 ? -0.844  -69.146 43.430  1.00 0.00 ? 194 ALA D N   1 
ATOM   6388  C CA  . ALA D  4  194 ? -1.270  -69.812 42.236  1.00 0.00 ? 194 ALA D CA  1 
ATOM   6389  C C   . ALA D  4  194 ? -0.104  -70.417 41.505  1.00 0.00 ? 194 ALA D C   1 
ATOM   6390  O O   . ALA D  4  194 ? -0.235  -71.444 40.852  1.00 0.00 ? 194 ALA D O   1 
ATOM   6391  C CB  . ALA D  4  194 ? -1.962  -68.828 41.290  1.00 0.00 ? 194 ALA D CB  1 
ATOM   6392  N N   . LEU D  4  195 ? 1.064   -69.763 41.586  1.00 0.00 ? 195 LEU D N   1 
ATOM   6393  C CA  . LEU D  4  195 ? 2.243   -70.164 40.883  1.00 0.00 ? 195 LEU D CA  1 
ATOM   6394  C C   . LEU D  4  195 ? 3.173   -71.029 41.691  1.00 0.00 ? 195 LEU D C   1 
ATOM   6395  O O   . LEU D  4  195 ? 3.770   -71.953 41.172  1.00 0.00 ? 195 LEU D O   1 
ATOM   6396  C CB  . LEU D  4  195 ? 2.953   -68.895 40.375  1.00 0.00 ? 195 LEU D CB  1 
ATOM   6397  C CG  . LEU D  4  195 ? 2.018   -67.995 39.524  1.00 0.00 ? 195 LEU D CG  1 
ATOM   6398  C CD1 . LEU D  4  195 ? 2.766   -66.809 38.902  1.00 0.00 ? 195 LEU D CD1 1 
ATOM   6399  C CD2 . LEU D  4  195 ? 1.263   -68.747 38.421  1.00 0.00 ? 195 LEU D CD2 1 
ATOM   6400  N N   . LEU D  4  196 ? 3.355   -70.782 42.988  1.00 0.00 ? 196 LEU D N   1 
ATOM   6401  C CA  . LEU D  4  196 ? 4.293   -71.517 43.790  1.00 0.00 ? 196 LEU D CA  1 
ATOM   6402  C C   . LEU D  4  196 ? 3.684   -72.799 44.293  1.00 0.00 ? 196 LEU D C   1 
ATOM   6403  O O   . LEU D  4  196 ? 4.442   -73.674 44.698  1.00 0.00 ? 196 LEU D O   1 
ATOM   6404  C CB  . LEU D  4  196 ? 4.816   -70.664 44.978  1.00 0.00 ? 196 LEU D CB  1 
ATOM   6405  C CG  . LEU D  4  196 ? 5.986   -71.273 45.819  1.00 0.00 ? 196 LEU D CG  1 
ATOM   6406  C CD1 . LEU D  4  196 ? 6.966   -70.227 46.384  1.00 0.00 ? 196 LEU D CD1 1 
ATOM   6407  C CD2 . LEU D  4  196 ? 5.527   -72.232 46.926  1.00 0.00 ? 196 LEU D CD2 1 
ATOM   6408  N N   . GLU D  4  197 ? 2.343   -73.011 44.130  1.00 0.00 ? 197 GLU D N   1 
ATOM   6409  C CA  . GLU D  4  197 ? 1.719   -74.310 44.331  1.00 0.00 ? 197 GLU D CA  1 
ATOM   6410  C C   . GLU D  4  197 ? 1.600   -75.065 43.026  1.00 0.00 ? 197 GLU D C   1 
ATOM   6411  O O   . GLU D  4  197 ? 1.931   -76.246 42.953  1.00 0.00 ? 197 GLU D O   1 
ATOM   6412  C CB  . GLU D  4  197 ? 0.293   -74.263 44.915  1.00 0.00 ? 197 GLU D CB  1 
ATOM   6413  C CG  . GLU D  4  197 ? -0.320  -75.669 45.105  1.00 0.00 ? 197 GLU D CG  1 
ATOM   6414  C CD  . GLU D  4  197 ? -1.637  -75.680 45.883  1.00 0.00 ? 197 GLU D CD  1 
ATOM   6415  O OE1 . GLU D  4  197 ? -1.979  -74.656 46.532  1.00 0.00 ? 197 GLU D OE1 1 
ATOM   6416  O OE2 . GLU D  4  197 ? -2.314  -76.743 45.838  1.00 0.00 ? 197 GLU D OE2 1 
ATOM   6417  N N   . VAL D  4  198 ? 1.018   -74.430 41.976  1.00 0.00 ? 198 VAL D N   1 
ATOM   6418  C CA  . VAL D  4  198 ? 0.733   -75.142 40.746  1.00 0.00 ? 198 VAL D CA  1 
ATOM   6419  C C   . VAL D  4  198 ? 1.874   -75.122 39.783  1.00 0.00 ? 198 VAL D C   1 
ATOM   6420  O O   . VAL D  4  198 ? 2.312   -76.187 39.352  1.00 0.00 ? 198 VAL D O   1 
ATOM   6421  C CB  . VAL D  4  198 ? -0.516  -74.603 40.036  1.00 0.00 ? 198 VAL D CB  1 
ATOM   6422  C CG1 . VAL D  4  198 ? -0.820  -75.395 38.735  1.00 0.00 ? 198 VAL D CG1 1 
ATOM   6423  C CG2 . VAL D  4  198 ? -1.709  -74.666 41.023  1.00 0.00 ? 198 VAL D CG2 1 
ATOM   6424  N N   . VAL D  4  199 ? 2.383   -73.936 39.391  1.00 0.00 ? 199 VAL D N   1 
ATOM   6425  C CA  . VAL D  4  199 ? 3.474   -73.878 38.441  1.00 0.00 ? 199 VAL D CA  1 
ATOM   6426  C C   . VAL D  4  199 ? 4.765   -74.155 39.185  1.00 0.00 ? 199 VAL D C   1 
ATOM   6427  O O   . VAL D  4  199 ? 4.776   -74.250 40.412  1.00 0.00 ? 199 VAL D O   1 
ATOM   6428  C CB  . VAL D  4  199 ? 3.498   -72.561 37.675  1.00 0.00 ? 199 VAL D CB  1 
ATOM   6429  C CG1 . VAL D  4  199 ? 4.333   -72.687 36.379  1.00 0.00 ? 199 VAL D CG1 1 
ATOM   6430  C CG2 . VAL D  4  199 ? 2.050   -72.144 37.320  1.00 0.00 ? 199 VAL D CG2 1 
ATOM   6431  N N   . GLN D  4  200 ? 5.898   -74.351 38.467  1.00 0.00 ? 200 GLN D N   1 
ATOM   6432  C CA  . GLN D  4  200 ? 7.175   -74.699 39.052  1.00 0.00 ? 200 GLN D CA  1 
ATOM   6433  C C   . GLN D  4  200 ? 7.593   -73.598 39.964  1.00 0.00 ? 200 GLN D C   1 
ATOM   6434  O O   . GLN D  4  200 ? 7.378   -72.428 39.661  1.00 0.00 ? 200 GLN D O   1 
ATOM   6435  C CB  . GLN D  4  200 ? 8.331   -74.898 38.032  1.00 0.00 ? 200 GLN D CB  1 
ATOM   6436  C CG  . GLN D  4  200 ? 8.338   -76.257 37.314  1.00 0.00 ? 200 GLN D CG  1 
ATOM   6437  C CD  . GLN D  4  200 ? 7.239   -76.341 36.255  1.00 0.00 ? 200 GLN D CD  1 
ATOM   6438  O OE1 . GLN D  4  200 ? 7.396   -75.797 35.160  1.00 0.00 ? 200 GLN D OE1 1 
ATOM   6439  N NE2 . GLN D  4  200 ? 6.114   -77.042 36.584  1.00 0.00 ? 200 GLN D NE2 1 
ATOM   6440  N N   . SER D  4  201 ? 8.206   -73.954 41.109  1.00 0.00 ? 201 SER D N   1 
ATOM   6441  C CA  . SER D  4  201 ? 8.607   -72.994 42.098  1.00 0.00 ? 201 SER D CA  1 
ATOM   6442  C C   . SER D  4  201 ? 9.787   -72.221 41.567  1.00 0.00 ? 201 SER D C   1 
ATOM   6443  O O   . SER D  4  201 ? 10.795  -72.798 41.161  1.00 0.00 ? 201 SER D O   1 
ATOM   6444  C CB  . SER D  4  201 ? 8.922   -73.666 43.460  1.00 0.00 ? 201 SER D CB  1 
ATOM   6445  O OG  . SER D  4  201 ? 9.744   -74.815 43.312  1.00 0.00 ? 201 SER D OG  1 
ATOM   6446  N N   . GLY D  4  202 ? 9.641   -70.885 41.474  1.00 0.00 ? 202 GLY D N   1 
ATOM   6447  C CA  . GLY D  4  202 ? 10.676  -70.065 40.909  1.00 0.00 ? 202 GLY D CA  1 
ATOM   6448  C C   . GLY D  4  202 ? 10.641  -68.770 41.632  1.00 0.00 ? 202 GLY D C   1 
ATOM   6449  O O   . GLY D  4  202 ? 9.681   -68.009 41.527  1.00 0.00 ? 202 GLY D O   1 
ATOM   6450  N N   . GLY D  4  203 ? 11.743  -68.501 42.369  1.00 0.00 ? 203 GLY D N   1 
ATOM   6451  C CA  . GLY D  4  203 ? 11.944  -67.309 43.140  1.00 0.00 ? 203 GLY D CA  1 
ATOM   6452  C C   . GLY D  4  203 ? 12.413  -66.165 42.281  1.00 0.00 ? 203 GLY D C   1 
ATOM   6453  O O   . GLY D  4  203 ? 12.617  -65.058 42.775  1.00 0.00 ? 203 GLY D O   1 
ATOM   6454  N N   . LYS D  4  204 ? 12.728  -66.464 41.021  1.00 0.00 ? 204 LYS D N   1 
ATOM   6455  C CA  . LYS D  4  204 ? 13.139  -65.444 40.054  1.00 0.00 ? 204 LYS D CA  1 
ATOM   6456  C C   . LYS D  4  204 ? 12.266  -65.419 38.796  1.00 0.00 ? 204 LYS D C   1 
ATOM   6457  O O   . LYS D  4  204 ? 12.128  -64.388 38.138  1.00 0.00 ? 204 LYS D O   1 
ATOM   6458  C CB  . LYS D  4  204 ? 14.608  -65.637 39.667  1.00 0.00 ? 204 LYS D CB  1 
ATOM   6459  C CG  . LYS D  4  204 ? 15.217  -64.456 38.930  1.00 0.00 ? 204 LYS D CG  1 
ATOM   6460  C CD  . LYS D  4  204 ? 16.735  -64.485 39.000  1.00 0.00 ? 204 LYS D CD  1 
ATOM   6461  C CE  . LYS D  4  204 ? 17.237  -63.930 40.323  1.00 0.00 ? 204 LYS D CE  1 
ATOM   6462  N NZ  . LYS D  4  204 ? 16.919  -62.483 40.475  1.00 0.00 ? 204 LYS D NZ  1 
ATOM   6463  N N   . ASN D  4  205 ? 11.684  -66.570 38.476  1.00 0.00 ? 205 ASN D N   1 
ATOM   6464  C CA  . ASN D  4  205 ? 10.833  -66.743 37.307  1.00 0.00 ? 205 ASN D CA  1 
ATOM   6465  C C   . ASN D  4  205 ? 9.609   -65.869 37.402  1.00 0.00 ? 205 ASN D C   1 
ATOM   6466  O O   . ASN D  4  205 ? 9.227   -65.190 36.452  1.00 0.00 ? 205 ASN D O   1 
ATOM   6467  C CB  . ASN D  4  205 ? 10.299  -68.195 37.166  1.00 0.00 ? 205 ASN D CB  1 
ATOM   6468  C CG  . ASN D  4  205 ? 11.356  -69.145 36.598  1.00 0.00 ? 205 ASN D CG  1 
ATOM   6469  O OD1 . ASN D  4  205 ? 12.472  -68.742 36.257  1.00 0.00 ? 205 ASN D OD1 1 
ATOM   6470  N ND2 . ASN D  4  205 ? 10.944  -70.443 36.467  1.00 0.00 ? 205 ASN D ND2 1 
ATOM   6471  N N   . ILE D  4  206 ? 9.019   -65.858 38.611  1.00 0.00 ? 206 ILE D N   1 
ATOM   6472  C CA  . ILE D  4  206 ? 7.939   -65.006 39.020  1.00 0.00 ? 206 ILE D CA  1 
ATOM   6473  C C   . ILE D  4  206 ? 8.400   -63.559 39.087  1.00 0.00 ? 206 ILE D C   1 
ATOM   6474  O O   . ILE D  4  206 ? 9.481   -63.272 39.598  1.00 0.00 ? 206 ILE D O   1 
ATOM   6475  C CB  . ILE D  4  206 ? 7.377   -65.530 40.337  1.00 0.00 ? 206 ILE D CB  1 
ATOM   6476  C CG1 . ILE D  4  206 ? 5.926   -65.099 40.539  1.00 0.00 ? 206 ILE D CG1 1 
ATOM   6477  C CG2 . ILE D  4  206 ? 8.260   -65.172 41.556  1.00 0.00 ? 206 ILE D CG2 1 
ATOM   6478  C CD1 . ILE D  4  206 ? 5.197   -66.083 41.449  1.00 0.00 ? 206 ILE D CD1 1 
ATOM   6479  N N   . GLU D  4  207 ? 7.630   -62.677 38.462  1.00 0.00 ? 207 GLU D N   1 
ATOM   6480  C CA  . GLU D  4  207 ? 7.882   -61.248 38.528  1.00 0.00 ? 207 GLU D CA  1 
ATOM   6481  C C   . GLU D  4  207 ? 6.579   -60.490 38.743  1.00 0.00 ? 207 GLU D C   1 
ATOM   6482  O O   . GLU D  4  207 ? 6.118   -59.785 37.846  1.00 0.00 ? 207 GLU D O   1 
ATOM   6483  C CB  . GLU D  4  207 ? 8.568   -60.764 37.250  1.00 0.00 ? 207 GLU D CB  1 
ATOM   6484  C CG  . GLU D  4  207 ? 10.057  -61.063 37.194  1.00 0.00 ? 207 GLU D CG  1 
ATOM   6485  C CD  . GLU D  4  207 ? 10.824  -60.418 38.331  1.00 0.00 ? 207 GLU D CD  1 
ATOM   6486  O OE1 . GLU D  4  207 ? 11.097  -59.202 38.252  1.00 0.00 ? 207 GLU D OE1 1 
ATOM   6487  O OE2 . GLU D  4  207 ? 11.155  -61.127 39.304  1.00 0.00 ? 207 GLU D OE2 1 
ATOM   6488  N N   . LEU D  4  208 ? 5.982   -60.624 39.923  1.00 0.00 ? 208 LEU D N   1 
ATOM   6489  C CA  . LEU D  4  208 ? 4.772   -59.900 40.190  1.00 0.00 ? 208 LEU D CA  1 
ATOM   6490  C C   . LEU D  4  208 ? 5.036   -58.445 40.404  1.00 0.00 ? 208 LEU D C   1 
ATOM   6491  O O   . LEU D  4  208 ? 6.062   -58.095 40.971  1.00 0.00 ? 208 LEU D O   1 
ATOM   6492  C CB  . LEU D  4  208 ? 4.039   -60.520 41.398  1.00 0.00 ? 208 LEU D CB  1 
ATOM   6493  C CG  . LEU D  4  208 ? 4.863   -60.670 42.706  1.00 0.00 ? 208 LEU D CG  1 
ATOM   6494  C CD1 . LEU D  4  208 ? 4.730   -59.458 43.652  1.00 0.00 ? 208 LEU D CD1 1 
ATOM   6495  C CD2 . LEU D  4  208 ? 4.428   -61.940 43.445  1.00 0.00 ? 208 LEU D CD2 1 
ATOM   6496  N N   . ALA D  4  209 ? 4.096   -57.564 39.989  1.00 0.00 ? 209 ALA D N   1 
ATOM   6497  C CA  . ALA D  4  209 ? 4.205   -56.147 40.217  1.00 0.00 ? 209 ALA D CA  1 
ATOM   6498  C C   . ALA D  4  209 ? 2.898   -55.602 40.661  1.00 0.00 ? 209 ALA D C   1 
ATOM   6499  O O   . ALA D  4  209 ? 2.001   -55.397 39.854  1.00 0.00 ? 209 ALA D O   1 
ATOM   6500  C CB  . ALA D  4  209 ? 4.662   -55.335 38.999  1.00 0.00 ? 209 ALA D CB  1 
ATOM   6501  N N   . VAL D  4  210 ? 2.764   -55.247 41.946  1.00 0.00 ? 210 VAL D N   1 
ATOM   6502  C CA  . VAL D  4  210 ? 1.617   -54.526 42.424  1.00 0.00 ? 210 VAL D CA  1 
ATOM   6503  C C   . VAL D  4  210 ? 1.680   -53.120 41.843  1.00 0.00 ? 210 VAL D C   1 
ATOM   6504  O O   . VAL D  4  210 ? 2.759   -52.563 41.666  1.00 0.00 ? 210 VAL D O   1 
ATOM   6505  C CB  . VAL D  4  210 ? 1.570   -54.547 43.956  1.00 0.00 ? 210 VAL D CB  1 
ATOM   6506  C CG1 . VAL D  4  210 ? 2.856   -53.951 44.577  1.00 0.00 ? 210 VAL D CG1 1 
ATOM   6507  C CG2 . VAL D  4  210 ? 0.295   -53.871 44.492  1.00 0.00 ? 210 VAL D CG2 1 
ATOM   6508  N N   . MET D  4  211 ? 0.521   -52.503 41.542  1.00 0.00 ? 211 MET D N   1 
ATOM   6509  C CA  . MET D  4  211 ? 0.437   -51.137 41.110  1.00 0.00 ? 211 MET D CA  1 
ATOM   6510  C C   . MET D  4  211 ? -0.287  -50.519 42.218  1.00 0.00 ? 211 MET D C   1 
ATOM   6511  O O   . MET D  4  211 ? -1.380  -50.962 42.549  1.00 0.00 ? 211 MET D O   1 
ATOM   6512  C CB  . MET D  4  211 ? -0.402  -50.928 39.837  1.00 0.00 ? 211 MET D CB  1 
ATOM   6513  C CG  . MET D  4  211 ? -0.426  -49.484 39.321  1.00 0.00 ? 211 MET D CG  1 
ATOM   6514  S SD  . MET D  4  211 ? -1.001  -49.340 37.607  1.00 0.00 ? 211 MET D SD  1 
ATOM   6515  C CE  . MET D  4  211 ? -0.643  -47.583 37.464  1.00 0.00 ? 211 MET D CE  1 
ATOM   6516  N N   . ARG D  4  212 ? 0.308   -49.499 42.859  1.00 0.00 ? 212 ARG D N   1 
ATOM   6517  C CA  . ARG D  4  212 ? -0.341  -48.812 43.945  1.00 0.00 ? 212 ARG D CA  1 
ATOM   6518  C C   . ARG D  4  212 ? -1.277  -47.832 43.319  1.00 0.00 ? 212 ARG D C   1 
ATOM   6519  O O   . ARG D  4  212 ? -1.288  -47.693 42.099  1.00 0.00 ? 212 ARG D O   1 
ATOM   6520  C CB  . ARG D  4  212 ? 0.624   -48.105 44.926  1.00 0.00 ? 212 ARG D CB  1 
ATOM   6521  C CG  . ARG D  4  212 ? 1.892   -48.923 45.255  1.00 0.00 ? 212 ARG D CG  1 
ATOM   6522  C CD  . ARG D  4  212 ? 1.676   -50.358 45.796  1.00 0.00 ? 212 ARG D CD  1 
ATOM   6523  N NE  . ARG D  4  212 ? 1.460   -50.385 47.286  1.00 0.00 ? 212 ARG D NE  1 
ATOM   6524  C CZ  . ARG D  4  212 ? 0.232   -50.435 47.887  1.00 0.00 ? 212 ARG D CZ  1 
ATOM   6525  N NH1 . ARG D  4  212 ? -0.918  -50.240 47.187  1.00 0.00 ? 212 ARG D NH1 1 
ATOM   6526  N NH2 . ARG D  4  212 ? 0.164   -50.690 49.226  1.00 0.00 ? 212 ARG D NH2 1 
ATOM   6527  N N   . ARG D  4  213 ? -2.135  -47.175 44.123  1.00 0.00 ? 213 ARG D N   1 
ATOM   6528  C CA  . ARG D  4  213 ? -3.221  -46.371 43.623  1.00 0.00 ? 213 ARG D CA  1 
ATOM   6529  C C   . ARG D  4  213 ? -2.764  -45.269 42.680  1.00 0.00 ? 213 ARG D C   1 
ATOM   6530  O O   . ARG D  4  213 ? -3.313  -45.126 41.590  1.00 0.00 ? 213 ARG D O   1 
ATOM   6531  C CB  . ARG D  4  213 ? -4.025  -45.805 44.824  1.00 0.00 ? 213 ARG D CB  1 
ATOM   6532  C CG  . ARG D  4  213 ? -5.051  -44.702 44.520  1.00 0.00 ? 213 ARG D CG  1 
ATOM   6533  C CD  . ARG D  4  213 ? -6.134  -45.074 43.496  1.00 0.00 ? 213 ARG D CD  1 
ATOM   6534  N NE  . ARG D  4  213 ? -6.794  -43.807 43.008  1.00 0.00 ? 213 ARG D NE  1 
ATOM   6535  C CZ  . ARG D  4  213 ? -6.812  -43.402 41.700  1.00 0.00 ? 213 ARG D CZ  1 
ATOM   6536  N NH1 . ARG D  4  213 ? -6.221  -44.130 40.711  1.00 0.00 ? 213 ARG D NH1 1 
ATOM   6537  N NH2 . ARG D  4  213 ? -7.447  -42.237 41.377  1.00 0.00 ? 213 ARG D NH2 1 
ATOM   6538  N N   . ASP D  4  214 ? -1.730  -44.490 43.033  1.00 0.00 ? 214 ASP D N   1 
ATOM   6539  C CA  . ASP D  4  214 ? -1.257  -43.456 42.148  1.00 0.00 ? 214 ASP D CA  1 
ATOM   6540  C C   . ASP D  4  214 ? 0.220   -43.589 41.947  1.00 0.00 ? 214 ASP D C   1 
ATOM   6541  O O   . ASP D  4  214 ? 0.816   -42.831 41.186  1.00 0.00 ? 214 ASP D O   1 
ATOM   6542  C CB  . ASP D  4  214 ? -1.582  -42.047 42.688  1.00 0.00 ? 214 ASP D CB  1 
ATOM   6543  C CG  . ASP D  4  214 ? -3.099  -41.866 42.707  1.00 0.00 ? 214 ASP D CG  1 
ATOM   6544  O OD1 . ASP D  4  214 ? -3.722  -42.020 41.623  1.00 0.00 ? 214 ASP D OD1 1 
ATOM   6545  O OD2 . ASP D  4  214 ? -3.659  -41.570 43.795  1.00 0.00 ? 214 ASP D OD2 1 
ATOM   6546  N N   . GLN D  4  215 ? 0.845   -44.639 42.515  1.00 0.00 ? 215 GLN D N   1 
ATOM   6547  C CA  . GLN D  4  215 ? 2.225   -44.886 42.237  1.00 0.00 ? 215 GLN D CA  1 
ATOM   6548  C C   . GLN D  4  215 ? 2.182   -45.824 41.090  1.00 0.00 ? 215 GLN D C   1 
ATOM   6549  O O   . GLN D  4  215 ? 1.453   -46.809 41.109  1.00 0.00 ? 215 GLN D O   1 
ATOM   6550  C CB  . GLN D  4  215 ? 3.007   -45.522 43.407  1.00 0.00 ? 215 GLN D CB  1 
ATOM   6551  C CG  . GLN D  4  215 ? 4.531   -45.542 43.172  1.00 0.00 ? 215 GLN D CG  1 
ATOM   6552  C CD  . GLN D  4  215 ? 5.298   -45.731 44.488  1.00 0.00 ? 215 GLN D CD  1 
ATOM   6553  O OE1 . GLN D  4  215 ? 4.725   -45.786 45.582  1.00 0.00 ? 215 GLN D OE1 1 
ATOM   6554  N NE2 . GLN D  4  215 ? 6.658   -45.813 44.359  1.00 0.00 ? 215 GLN D NE2 1 
ATOM   6555  N N   . SER D  4  216 ? 3.076   -45.577 40.137  1.00 0.00 ? 216 SER D N   1 
ATOM   6556  C CA  . SER D  4  216 ? 3.160   -46.294 38.869  1.00 0.00 ? 216 SER D CA  1 
ATOM   6557  C C   . SER D  4  216 ? 3.519   -47.761 39.072  1.00 0.00 ? 216 SER D C   1 
ATOM   6558  O O   . SER D  4  216 ? 4.113   -48.131 40.082  1.00 0.00 ? 216 SER D O   1 
ATOM   6559  C CB  . SER D  4  216 ? 4.200   -45.617 37.965  1.00 0.00 ? 216 SER D CB  1 
ATOM   6560  O OG  . SER D  4  216 ? 4.284   -46.239 36.696  1.00 0.00 ? 216 SER D OG  1 
ATOM   6561  N N   . LEU D  4  217 ? 3.138   -48.597 38.113  1.00 0.00 ? 217 LEU D N   1 
ATOM   6562  C CA  . LEU D  4  217 ? 3.221   -50.014 38.356  1.00 0.00 ? 217 LEU D CA  1 
ATOM   6563  C C   . LEU D  4  217 ? 4.653   -50.226 38.745  1.00 0.00 ? 217 LEU D C   1 
ATOM   6564  O O   . LEU D  4  217 ? 5.585   -49.812 38.059  1.00 0.00 ? 217 LEU D O   1 
ATOM   6565  C CB  . LEU D  4  217 ? 2.886   -50.814 37.102  1.00 0.00 ? 217 LEU D CB  1 
ATOM   6566  C CG  . LEU D  4  217 ? 2.606   -52.303 37.324  1.00 0.00 ? 217 LEU D CG  1 
ATOM   6567  C CD1 . LEU D  4  217 ? 1.935   -52.544 38.667  1.00 0.00 ? 217 LEU D CD1 1 
ATOM   6568  C CD2 . LEU D  4  217 ? 1.767   -52.869 36.190  1.00 0.00 ? 217 LEU D CD2 1 
ATOM   6569  N N   . LYS D  4  218 ? 4.804   -50.905 39.863  1.00 0.00 ? 218 LYS D N   1 
ATOM   6570  C CA  . LYS D  4  218 ? 6.031   -50.952 40.590  1.00 0.00 ? 218 LYS D CA  1 
ATOM   6571  C C   . LYS D  4  218 ? 6.342   -52.375 40.881  1.00 0.00 ? 218 LYS D C   1 
ATOM   6572  O O   . LYS D  4  218 ? 5.647   -53.039 41.640  1.00 0.00 ? 218 LYS D O   1 
ATOM   6573  C CB  . LYS D  4  218 ? 5.849   -50.189 41.919  1.00 0.00 ? 218 LYS D CB  1 
ATOM   6574  C CG  . LYS D  4  218 ? 6.994   -50.300 42.936  1.00 0.00 ? 218 LYS D CG  1 
ATOM   6575  C CD  . LYS D  4  218 ? 6.646   -49.631 44.274  1.00 0.00 ? 218 LYS D CD  1 
ATOM   6576  C CE  . LYS D  4  218 ? 7.653   -49.913 45.398  1.00 0.00 ? 218 LYS D CE  1 
ATOM   6577  N NZ  . LYS D  4  218 ? 7.659   -51.343 45.779  1.00 0.00 ? 218 LYS D NZ  1 
ATOM   6578  N N   . ILE D  4  219 ? 7.445   -52.868 40.302  1.00 0.00 ? 219 ILE D N   1 
ATOM   6579  C CA  . ILE D  4  219 ? 8.045   -54.145 40.590  1.00 0.00 ? 219 ILE D CA  1 
ATOM   6580  C C   . ILE D  4  219 ? 8.741   -54.059 41.917  1.00 0.00 ? 219 ILE D C   1 
ATOM   6581  O O   . ILE D  4  219 ? 8.960   -52.978 42.452  1.00 0.00 ? 219 ILE D O   1 
ATOM   6582  C CB  . ILE D  4  219 ? 9.008   -54.538 39.470  1.00 0.00 ? 219 ILE D CB  1 
ATOM   6583  C CG1 . ILE D  4  219 ? 9.612   -55.964 39.536  1.00 0.00 ? 219 ILE D CG1 1 
ATOM   6584  C CG2 . ILE D  4  219 ? 10.121  -53.471 39.293  1.00 0.00 ? 219 ILE D CG2 1 
ATOM   6585  C CD1 . ILE D  4  219 ? 8.616   -57.087 39.815  1.00 0.00 ? 219 ILE D CD1 1 
ATOM   6586  N N   . LEU D  4  220 ? 9.058   -55.220 42.502  1.00 0.00 ? 220 LEU D N   1 
ATOM   6587  C CA  . LEU D  4  220 ? 9.793   -55.362 43.723  1.00 0.00 ? 220 LEU D CA  1 
ATOM   6588  C C   . LEU D  4  220 ? 11.118  -56.014 43.385  1.00 0.00 ? 220 LEU D C   1 
ATOM   6589  O O   . LEU D  4  220 ? 11.285  -56.695 42.377  1.00 0.00 ? 220 LEU D O   1 
ATOM   6590  C CB  . LEU D  4  220 ? 9.018   -56.281 44.696  1.00 0.00 ? 220 LEU D CB  1 
ATOM   6591  C CG  . LEU D  4  220 ? 7.938   -55.596 45.573  1.00 0.00 ? 220 LEU D CG  1 
ATOM   6592  C CD1 . LEU D  4  220 ? 6.894   -54.742 44.818  1.00 0.00 ? 220 LEU D CD1 1 
ATOM   6593  C CD2 . LEU D  4  220 ? 7.228   -56.665 46.429  1.00 0.00 ? 220 LEU D CD2 1 
ATOM   6594  N N   . ASN D  4  221 ? 12.112  -55.858 44.281  1.00 0.00 ? 221 ASN D N   1 
ATOM   6595  C CA  . ASN D  4  221 ? 13.330  -56.628 44.253  1.00 0.00 ? 221 ASN D CA  1 
ATOM   6596  C C   . ASN D  4  221 ? 12.983  -58.022 44.720  1.00 0.00 ? 221 ASN D C   1 
ATOM   6597  O O   . ASN D  4  221 ? 12.049  -58.110 45.506  1.00 0.00 ? 221 ASN D O   1 
ATOM   6598  C CB  . ASN D  4  221 ? 14.407  -56.068 45.203  1.00 0.00 ? 221 ASN D CB  1 
ATOM   6599  C CG  . ASN D  4  221 ? 14.882  -54.708 44.690  1.00 0.00 ? 221 ASN D CG  1 
ATOM   6600  O OD1 . ASN D  4  221 ? 14.474  -53.658 45.194  1.00 0.00 ? 221 ASN D OD1 1 
ATOM   6601  N ND2 . ASN D  4  221 ? 15.770  -54.745 43.653  1.00 0.00 ? 221 ASN D ND2 1 
ATOM   6602  N N   . PRO D  4  222 ? 13.638  -59.115 44.307  1.00 0.00 ? 222 PRO D N   1 
ATOM   6603  C CA  . PRO D  4  222 ? 13.276  -60.485 44.659  1.00 0.00 ? 222 PRO D CA  1 
ATOM   6604  C C   . PRO D  4  222 ? 13.202  -60.765 46.144  1.00 0.00 ? 222 PRO D C   1 
ATOM   6605  O O   . PRO D  4  222 ? 12.421  -61.618 46.560  1.00 0.00 ? 222 PRO D O   1 
ATOM   6606  C CB  . PRO D  4  222 ? 14.333  -61.338 43.952  1.00 0.00 ? 222 PRO D CB  1 
ATOM   6607  C CG  . PRO D  4  222 ? 14.581  -60.564 42.667  1.00 0.00 ? 222 PRO D CG  1 
ATOM   6608  C CD  . PRO D  4  222 ? 14.530  -59.113 43.147  1.00 0.00 ? 222 PRO D CD  1 
ATOM   6609  N N   . GLU D  4  223 ? 14.040  -60.081 46.943  1.00 0.00 ? 223 GLU D N   1 
ATOM   6610  C CA  . GLU D  4  223 ? 14.057  -60.172 48.378  1.00 0.00 ? 223 GLU D CA  1 
ATOM   6611  C C   . GLU D  4  223 ? 12.794  -59.600 49.007  1.00 0.00 ? 223 GLU D C   1 
ATOM   6612  O O   . GLU D  4  223 ? 12.339  -60.074 50.045  1.00 0.00 ? 223 GLU D O   1 
ATOM   6613  C CB  . GLU D  4  223 ? 15.303  -59.446 48.933  1.00 0.00 ? 223 GLU D CB  1 
ATOM   6614  C CG  . GLU D  4  223 ? 15.703  -59.857 50.362  1.00 0.00 ? 223 GLU D CG  1 
ATOM   6615  C CD  . GLU D  4  223 ? 16.909  -59.020 50.784  1.00 0.00 ? 223 GLU D CD  1 
ATOM   6616  O OE1 . GLU D  4  223 ? 16.721  -57.793 50.994  1.00 0.00 ? 223 GLU D OE1 1 
ATOM   6617  O OE2 . GLU D  4  223 ? 18.029  -59.581 50.894  1.00 0.00 ? 223 GLU D OE2 1 
ATOM   6618  N N   . GLU D  4  224 ? 12.186  -58.552 48.403  1.00 0.00 ? 224 GLU D N   1 
ATOM   6619  C CA  . GLU D  4  224 ? 10.938  -57.991 48.877  1.00 0.00 ? 224 GLU D CA  1 
ATOM   6620  C C   . GLU D  4  224 ? 9.758   -58.893 48.589  1.00 0.00 ? 224 GLU D C   1 
ATOM   6621  O O   . GLU D  4  224 ? 8.735   -58.820 49.263  1.00 0.00 ? 224 GLU D O   1 
ATOM   6622  C CB  . GLU D  4  224 ? 10.623  -56.618 48.257  1.00 0.00 ? 224 GLU D CB  1 
ATOM   6623  C CG  . GLU D  4  224 ? 11.713  -55.567 48.504  1.00 0.00 ? 224 GLU D CG  1 
ATOM   6624  C CD  . GLU D  4  224 ? 11.282  -54.215 47.936  1.00 0.00 ? 224 GLU D CD  1 
ATOM   6625  O OE1 . GLU D  4  224 ? 10.955  -54.148 46.724  1.00 0.00 ? 224 GLU D OE1 1 
ATOM   6626  O OE2 . GLU D  4  224 ? 11.284  -53.224 48.711  1.00 0.00 ? 224 GLU D OE2 1 
ATOM   6627  N N   . ILE D  4  225 ? 9.875   -59.778 47.569  1.00 0.00 ? 225 ILE D N   1 
ATOM   6628  C CA  . ILE D  4  225 ? 8.861   -60.731 47.165  1.00 0.00 ? 225 ILE D CA  1 
ATOM   6629  C C   . ILE D  4  225 ? 8.841   -61.869 48.153  1.00 0.00 ? 225 ILE D C   1 
ATOM   6630  O O   . ILE D  4  225 ? 7.878   -62.623 48.232  1.00 0.00 ? 225 ILE D O   1 
ATOM   6631  C CB  . ILE D  4  225 ? 9.044   -61.281 45.745  1.00 0.00 ? 225 ILE D CB  1 
ATOM   6632  C CG1 . ILE D  4  225 ? 9.543   -60.198 44.763  1.00 0.00 ? 225 ILE D CG1 1 
ATOM   6633  C CG2 . ILE D  4  225 ? 7.690   -61.832 45.254  1.00 0.00 ? 225 ILE D CG2 1 
ATOM   6634  C CD1 . ILE D  4  225 ? 9.783   -60.711 43.341  1.00 0.00 ? 225 ILE D CD1 1 
ATOM   6635  N N   . GLU D  4  226 ? 9.888   -61.971 49.005  1.00 0.00 ? 226 GLU D N   1 
ATOM   6636  C CA  . GLU D  4  226 ? 10.099  -63.044 49.939  1.00 0.00 ? 226 GLU D CA  1 
ATOM   6637  C C   . GLU D  4  226 ? 9.167   -62.902 51.106  1.00 0.00 ? 226 GLU D C   1 
ATOM   6638  O O   . GLU D  4  226 ? 9.148   -63.721 52.014  1.00 0.00 ? 226 GLU D O   1 
ATOM   6639  C CB  . GLU D  4  226 ? 11.553  -63.042 50.434  1.00 0.00 ? 226 GLU D CB  1 
ATOM   6640  C CG  . GLU D  4  226 ? 12.000  -64.355 51.076  1.00 0.00 ? 226 GLU D CG  1 
ATOM   6641  C CD  . GLU D  4  226 ? 13.415  -64.248 51.623  1.00 0.00 ? 226 GLU D CD  1 
ATOM   6642  O OE1 . GLU D  4  226 ? 14.107  -63.238 51.339  1.00 0.00 ? 226 GLU D OE1 1 
ATOM   6643  O OE2 . GLU D  4  226 ? 13.815  -65.191 52.356  1.00 0.00 ? 226 GLU D OE2 1 
ATOM   6644  N N   . LYS D  4  227 ? 8.278   -61.889 51.070  1.00 0.00 ? 227 LYS D N   1 
ATOM   6645  C CA  . LYS D  4  227 ? 7.246   -61.668 52.046  1.00 0.00 ? 227 LYS D CA  1 
ATOM   6646  C C   . LYS D  4  227 ? 6.290   -62.832 52.117  1.00 0.00 ? 227 LYS D C   1 
ATOM   6647  O O   . LYS D  4  227 ? 5.790   -63.153 53.191  1.00 0.00 ? 227 LYS D O   1 
ATOM   6648  C CB  . LYS D  4  227 ? 6.442   -60.406 51.649  1.00 0.00 ? 227 LYS D CB  1 
ATOM   6649  C CG  . LYS D  4  227 ? 5.355   -59.983 52.643  1.00 0.00 ? 227 LYS D CG  1 
ATOM   6650  C CD  . LYS D  4  227 ? 4.643   -58.676 52.269  1.00 0.00 ? 227 LYS D CD  1 
ATOM   6651  C CE  . LYS D  4  227 ? 3.839   -58.774 50.970  1.00 0.00 ? 227 LYS D CE  1 
ATOM   6652  N NZ  . LYS D  4  227 ? 2.980   -57.583 50.805  1.00 0.00 ? 227 LYS D NZ  1 
ATOM   6653  N N   . TYR D  4  228 ? 5.999   -63.380 50.934  1.00 0.00 ? 228 TYR D N   1 
ATOM   6654  C CA  . TYR D  4  228 ? 5.243   -64.614 50.764  1.00 0.00 ? 228 TYR D CA  1 
ATOM   6655  C C   . TYR D  4  228 ? 6.013   -65.745 50.056  1.00 0.00 ? 228 TYR D C   1 
ATOM   6656  O O   . TYR D  4  228 ? 5.666   -66.913 50.223  1.00 0.00 ? 228 TYR D O   1 
ATOM   6657  C CB  . TYR D  4  228 ? 3.933   -64.335 50.022  1.00 0.00 ? 228 TYR D CB  1 
ATOM   6658  C CG  . TYR D  4  228 ? 4.014   -63.181 49.048  1.00 0.00 ? 228 TYR D CG  1 
ATOM   6659  C CD1 . TYR D  4  228 ? 4.402   -63.386 47.730  1.00 0.00 ? 228 TYR D CD1 1 
ATOM   6660  C CD2 . TYR D  4  228 ? 3.705   -61.887 49.446  1.00 0.00 ? 228 TYR D CD2 1 
ATOM   6661  C CE1 . TYR D  4  228 ? 4.478   -62.334 46.836  1.00 0.00 ? 228 TYR D CE1 1 
ATOM   6662  C CE2 . TYR D  4  228 ? 3.777   -60.830 48.559  1.00 0.00 ? 228 TYR D CE2 1 
ATOM   6663  C CZ  . TYR D  4  228 ? 4.164   -61.059 47.256  1.00 0.00 ? 228 TYR D CZ  1 
ATOM   6664  O OH  . TYR D  4  228 ? 4.238   -60.009 46.370  1.00 0.00 ? 228 TYR D OH  1 
ATOM   6665  N N   . VAL D  4  229 ? 7.048   -65.421 49.274  1.00 0.00 ? 229 VAL D N   1 
ATOM   6666  C CA  . VAL D  4  229 ? 7.799   -66.475 48.606  1.00 0.00 ? 229 VAL D CA  1 
ATOM   6667  C C   . VAL D  4  229 ? 8.466   -67.354 49.660  1.00 0.00 ? 229 VAL D C   1 
ATOM   6668  O O   . VAL D  4  229 ? 8.549   -68.560 49.476  1.00 0.00 ? 229 VAL D O   1 
ATOM   6669  C CB  . VAL D  4  229 ? 8.810   -65.939 47.577  1.00 0.00 ? 229 VAL D CB  1 
ATOM   6670  C CG1 . VAL D  4  229 ? 9.773   -67.022 47.045  1.00 0.00 ? 229 VAL D CG1 1 
ATOM   6671  C CG2 . VAL D  4  229 ? 8.029   -65.356 46.391  1.00 0.00 ? 229 VAL D CG2 1 
ATOM   6672  N N   . ALA D  4  230 ? 8.867   -66.782 50.824  1.00 0.00 ? 230 ALA D N   1 
ATOM   6673  C CA  . ALA D  4  230 ? 9.260   -67.532 51.990  1.00 0.00 ? 230 ALA D CA  1 
ATOM   6674  C C   . ALA D  4  230 ? 8.101   -67.910 52.854  1.00 0.00 ? 230 ALA D C   1 
ATOM   6675  O O   . ALA D  4  230 ? 8.103   -69.012 53.374  1.00 0.00 ? 230 ALA D O   1 
ATOM   6676  C CB  . ALA D  4  230 ? 10.259  -66.823 52.905  1.00 0.00 ? 230 ALA D CB  1 
ATOM   6677  N N   . GLU D  4  231 ? 7.066   -67.053 53.047  1.00 0.00 ? 231 GLU D N   1 
ATOM   6678  C CA  . GLU D  4  231 ? 5.948   -67.363 53.931  1.00 0.00 ? 231 GLU D CA  1 
ATOM   6679  C C   . GLU D  4  231 ? 5.089   -68.502 53.417  1.00 0.00 ? 231 GLU D C   1 
ATOM   6680  O O   . GLU D  4  231 ? 4.515   -69.232 54.210  1.00 0.00 ? 231 GLU D O   1 
ATOM   6681  C CB  . GLU D  4  231 ? 5.122   -66.126 54.361  1.00 0.00 ? 231 GLU D CB  1 
ATOM   6682  C CG  . GLU D  4  231 ? 4.095   -66.337 55.497  1.00 0.00 ? 231 GLU D CG  1 
ATOM   6683  C CD  . GLU D  4  231 ? 3.548   -64.988 55.985  1.00 0.00 ? 231 GLU D CD  1 
ATOM   6684  O OE1 . GLU D  4  231 ? 4.370   -64.089 56.292  1.00 0.00 ? 231 GLU D OE1 1 
ATOM   6685  O OE2 . GLU D  4  231 ? 2.305   -64.837 56.068  1.00 0.00 ? 231 GLU D OE2 1 
ATOM   6686  N N   . ILE D  4  232 ? 5.017   -68.734 52.077  1.00 0.00 ? 232 ILE D N   1 
ATOM   6687  C CA  . ILE D  4  232 ? 4.373   -69.887 51.464  1.00 0.00 ? 232 ILE D CA  1 
ATOM   6688  C C   . ILE D  4  232 ? 5.122   -71.141 51.793  1.00 0.00 ? 232 ILE D C   1 
ATOM   6689  O O   . ILE D  4  232 ? 4.528   -72.203 51.932  1.00 0.00 ? 232 ILE D O   1 
ATOM   6690  C CB  . ILE D  4  232 ? 4.175   -69.817 49.947  1.00 0.00 ? 232 ILE D CB  1 
ATOM   6691  C CG1 . ILE D  4  232 ? 3.138   -70.873 49.485  1.00 0.00 ? 232 ILE D CG1 1 
ATOM   6692  C CG2 . ILE D  4  232 ? 5.506   -69.939 49.179  1.00 0.00 ? 232 ILE D CG2 1 
ATOM   6693  C CD1 . ILE D  4  232 ? 2.735   -70.747 48.019  1.00 0.00 ? 232 ILE D CD1 1 
ATOM   6694  N N   . GLU D  4  233 ? 6.456   -71.054 51.976  1.00 0.00 ? 233 GLU D N   1 
ATOM   6695  C CA  . GLU D  4  233 ? 7.251   -72.174 52.418  1.00 0.00 ? 233 GLU D CA  1 
ATOM   6696  C C   . GLU D  4  233 ? 6.895   -72.521 53.853  1.00 0.00 ? 233 GLU D C   1 
ATOM   6697  O O   . GLU D  4  233 ? 6.952   -73.687 54.240  1.00 0.00 ? 233 GLU D O   1 
ATOM   6698  C CB  . GLU D  4  233 ? 8.773   -71.923 52.230  1.00 0.00 ? 233 GLU D CB  1 
ATOM   6699  C CG  . GLU D  4  233 ? 9.125   -71.622 50.748  1.00 0.00 ? 233 GLU D CG  1 
ATOM   6700  C CD  . GLU D  4  233 ? 10.508  -70.985 50.539  1.00 0.00 ? 233 GLU D CD  1 
ATOM   6701  O OE1 . GLU D  4  233 ? 11.324  -70.964 51.494  1.00 0.00 ? 233 GLU D OE1 1 
ATOM   6702  O OE2 . GLU D  4  233 ? 10.757  -70.494 49.407  1.00 0.00 ? 233 GLU D OE2 1 
ATOM   6703  N N   . LYS D  4  234 ? 6.468   -71.507 54.653  1.00 0.00 ? 234 LYS D N   1 
ATOM   6704  C CA  . LYS D  4  234 ? 5.914   -71.660 55.985  1.00 0.00 ? 234 LYS D CA  1 
ATOM   6705  C C   . LYS D  4  234 ? 4.458   -72.080 55.994  1.00 0.00 ? 234 LYS D C   1 
ATOM   6706  O O   . LYS D  4  234 ? 3.961   -72.519 57.031  1.00 0.00 ? 234 LYS D O   1 
ATOM   6707  C CB  . LYS D  4  234 ? 6.039   -70.383 56.854  1.00 0.00 ? 234 LYS D CB  1 
ATOM   6708  C CG  . LYS D  4  234 ? 7.489   -69.908 57.012  1.00 0.00 ? 234 LYS D CG  1 
ATOM   6709  C CD  . LYS D  4  234 ? 7.675   -68.777 58.039  1.00 0.00 ? 234 LYS D CD  1 
ATOM   6710  C CE  . LYS D  4  234 ? 6.949   -67.476 57.674  1.00 0.00 ? 234 LYS D CE  1 
ATOM   6711  N NZ  . LYS D  4  234 ? 7.300   -66.356 58.581  1.00 0.00 ? 234 LYS D NZ  1 
ATOM   6712  N N   . GLU D  4  235 ? 3.739   -71.935 54.854  1.00 0.00 ? 235 GLU D N   1 
ATOM   6713  C CA  . GLU D  4  235 ? 2.342   -72.308 54.734  1.00 0.00 ? 235 GLU D CA  1 
ATOM   6714  C C   . GLU D  4  235 ? 2.199   -73.570 53.876  1.00 0.00 ? 235 GLU D C   1 
ATOM   6715  C CB  . GLU D  4  235 ? 1.449   -71.203 54.094  1.00 0.00 ? 235 GLU D CB  1 
ATOM   6716  C CG  . GLU D  4  235 ? 1.284   -69.925 54.939  1.00 0.00 ? 235 GLU D CG  1 
ATOM   6717  C CD  . GLU D  4  235 ? 0.770   -70.277 56.333  1.00 0.00 ? 235 GLU D CD  1 
ATOM   6718  O OE1 . GLU D  4  235 ? -0.368  -70.804 56.444  1.00 0.00 ? 235 GLU D OE1 1 
ATOM   6719  O OE2 . GLU D  4  235 ? 1.526   -70.037 57.312  1.00 0.00 ? 235 GLU D OE2 1 
ATOM   6720  N N   . ASN E  5  13  ? -16.771 -65.337 -2.351  1.00 0.00 ? 13  ASN E N   1 
ATOM   6721  C CA  . ASN E  5  13  ? -16.396 -64.927 -3.735  1.00 0.00 ? 13  ASN E CA  1 
ATOM   6722  C C   . ASN E  5  13  ? -16.832 -65.945 -4.761  1.00 0.00 ? 13  ASN E C   1 
ATOM   6723  O O   . ASN E  5  13  ? -17.267 -65.617 -5.861  1.00 0.00 ? 13  ASN E O   1 
ATOM   6724  C CB  . ASN E  5  13  ? -14.871 -64.705 -3.804  1.00 0.00 ? 13  ASN E CB  1 
ATOM   6725  C CG  . ASN E  5  13  ? -14.490 -64.094 -5.157  1.00 0.00 ? 13  ASN E CG  1 
ATOM   6726  O OD1 . ASN E  5  13  ? -14.562 -62.872 -5.317  1.00 0.00 ? 13  ASN E OD1 1 
ATOM   6727  N ND2 . ASN E  5  13  ? -14.101 -64.964 -6.137  1.00 0.00 ? 13  ASN E ND2 1 
ATOM   6728  N N   . THR E  5  14  ? -16.750 -67.235 -4.406  1.00 0.00 ? 14  THR E N   1 
ATOM   6729  C CA  . THR E  5  14  ? -17.138 -68.289 -5.274  1.00 0.00 ? 14  THR E CA  1 
ATOM   6730  C C   . THR E  5  14  ? -18.574 -68.549 -4.956  1.00 0.00 ? 14  THR E C   1 
ATOM   6731  O O   . THR E  5  14  ? -18.928 -68.948 -3.847  1.00 0.00 ? 14  THR E O   1 
ATOM   6732  C CB  . THR E  5  14  ? -16.314 -69.537 -5.027  1.00 0.00 ? 14  THR E CB  1 
ATOM   6733  O OG1 . THR E  5  14  ? -14.936 -69.243 -5.216  1.00 0.00 ? 14  THR E OG1 1 
ATOM   6734  C CG2 . THR E  5  14  ? -16.716 -70.672 -5.993  1.00 0.00 ? 14  THR E CG2 1 
ATOM   6735  N N   . PHE E  5  15  ? -19.439 -68.384 -5.975  1.00 0.00 ? 15  PHE E N   1 
ATOM   6736  C CA  . PHE E  5  15  ? -20.794 -68.841 -5.935  1.00 0.00 ? 15  PHE E CA  1 
ATOM   6737  C C   . PHE E  5  15  ? -20.692 -70.319 -6.107  1.00 0.00 ? 15  PHE E C   1 
ATOM   6738  O O   . PHE E  5  15  ? -20.186 -70.773 -7.128  1.00 0.00 ? 15  PHE E O   1 
ATOM   6739  C CB  . PHE E  5  15  ? -21.647 -68.335 -7.109  1.00 0.00 ? 15  PHE E CB  1 
ATOM   6740  C CG  . PHE E  5  15  ? -21.890 -66.870 -7.016  1.00 0.00 ? 15  PHE E CG  1 
ATOM   6741  C CD1 . PHE E  5  15  ? -22.466 -66.325 -5.863  1.00 0.00 ? 15  PHE E CD1 1 
ATOM   6742  C CD2 . PHE E  5  15  ? -21.630 -66.034 -8.114  1.00 0.00 ? 15  PHE E CD2 1 
ATOM   6743  C CE1 . PHE E  5  15  ? -22.765 -64.964 -5.800  1.00 0.00 ? 15  PHE E CE1 1 
ATOM   6744  C CE2 . PHE E  5  15  ? -21.944 -64.679 -8.067  1.00 0.00 ? 15  PHE E CE2 1 
ATOM   6745  C CZ  . PHE E  5  15  ? -22.510 -64.140 -6.905  1.00 0.00 ? 15  PHE E CZ  1 
ATOM   6746  N N   . SER E  5  16  ? -21.112 -71.110 -5.092  1.00 0.00 ? 16  SER E N   1 
ATOM   6747  C CA  . SER E  5  16  ? -21.149 -72.551 -5.156  1.00 0.00 ? 16  SER E CA  1 
ATOM   6748  C C   . SER E  5  16  ? -21.921 -73.032 -6.346  1.00 0.00 ? 16  SER E C   1 
ATOM   6749  O O   . SER E  5  16  ? -22.782 -72.295 -6.813  1.00 0.00 ? 16  SER E O   1 
ATOM   6750  C CB  . SER E  5  16  ? -21.731 -73.217 -3.878  1.00 0.00 ? 16  SER E CB  1 
ATOM   6751  O OG  . SER E  5  16  ? -23.123 -73.005 -3.695  1.00 0.00 ? 16  SER E OG  1 
ATOM   6752  N N   . PRO E  5  17  ? -21.709 -74.225 -6.869  1.00 0.00 ? 17  PRO E N   1 
ATOM   6753  C CA  . PRO E  5  17  ? -22.518 -74.779 -7.938  1.00 0.00 ? 17  PRO E CA  1 
ATOM   6754  C C   . PRO E  5  17  ? -23.991 -74.844 -7.624  1.00 0.00 ? 17  PRO E C   1 
ATOM   6755  O O   . PRO E  5  17  ? -24.779 -74.995 -8.555  1.00 0.00 ? 17  PRO E O   1 
ATOM   6756  C CB  . PRO E  5  17  ? -21.927 -76.172 -8.169  1.00 0.00 ? 17  PRO E CB  1 
ATOM   6757  C CG  . PRO E  5  17  ? -20.446 -76.007 -7.819  1.00 0.00 ? 17  PRO E CG  1 
ATOM   6758  C CD  . PRO E  5  17  ? -20.477 -74.990 -6.679  1.00 0.00 ? 17  PRO E CD  1 
ATOM   6759  N N   . GLU E  5  18  ? -24.350 -74.769 -6.323  1.00 0.00 ? 18  GLU E N   1 
ATOM   6760  C CA  . GLU E  5  18  ? -25.688 -74.803 -5.809  1.00 0.00 ? 18  GLU E CA  1 
ATOM   6761  C C   . GLU E  5  18  ? -26.225 -73.414 -5.533  1.00 0.00 ? 18  GLU E C   1 
ATOM   6762  O O   . GLU E  5  18  ? -27.160 -73.271 -4.752  1.00 0.00 ? 18  GLU E O   1 
ATOM   6763  C CB  . GLU E  5  18  ? -25.762 -75.629 -4.512  1.00 0.00 ? 18  GLU E CB  1 
ATOM   6764  C CG  . GLU E  5  18  ? -25.230 -77.069 -4.664  1.00 0.00 ? 18  GLU E CG  1 
ATOM   6765  C CD  . GLU E  5  18  ? -25.320 -77.846 -3.341  1.00 0.00 ? 18  GLU E CD  1 
ATOM   6766  O OE1 . GLU E  5  18  ? -25.954 -77.347 -2.372  1.00 0.00 ? 18  GLU E OE1 1 
ATOM   6767  O OE2 . GLU E  5  18  ? -24.740 -78.964 -3.287  1.00 0.00 ? 18  GLU E OE2 1 
ATOM   6768  N N   . GLY E  5  19  ? -25.685 -72.454 -6.282  1.00 0.00 ? 19  GLY E N   1 
ATOM   6769  C CA  . GLY E  5  19  ? -26.077 -71.064 -6.215  1.00 0.00 ? 19  GLY E CA  1 
ATOM   6770  C C   . GLY E  5  19  ? -25.273 -70.255 -5.224  1.00 0.00 ? 19  GLY E C   1 
ATOM   6771  O O   . GLY E  5  19  ? -24.207 -69.723 -5.535  1.00 0.00 ? 19  GLY E O   1 
ATOM   6772  N N   . ARG E  5  20  ? -25.780 -70.247 -3.993  1.00 0.00 ? 20  ARG E N   1 
ATOM   6773  C CA  . ARG E  5  20  ? -25.381 -69.332 -2.925  1.00 0.00 ? 20  ARG E CA  1 
ATOM   6774  C C   . ARG E  5  20  ? -23.939 -69.442 -2.432  1.00 0.00 ? 20  ARG E C   1 
ATOM   6775  O O   . ARG E  5  20  ? -23.335 -70.514 -2.426  1.00 0.00 ? 20  ARG E O   1 
ATOM   6776  C CB  . ARG E  5  20  ? -26.340 -69.463 -1.737  1.00 0.00 ? 20  ARG E CB  1 
ATOM   6777  C CG  . ARG E  5  20  ? -27.747 -68.961 -2.018  1.00 0.00 ? 20  ARG E CG  1 
ATOM   6778  C CD  . ARG E  5  20  ? -28.686 -69.275 -0.864  1.00 0.00 ? 20  ARG E CD  1 
ATOM   6779  N NE  . ARG E  5  20  ? -28.854 -70.712 -0.671  1.00 0.00 ? 20  ARG E NE  1 
ATOM   6780  C CZ  . ARG E  5  20  ? -29.619 -71.256 0.269   1.00 0.00 ? 20  ARG E CZ  1 
ATOM   6781  N NH1 . ARG E  5  20  ? -30.294 -70.481 1.108   1.00 0.00 ? 20  ARG E NH1 1 
ATOM   6782  N NH2 . ARG E  5  20  ? -29.713 -72.575 0.372   1.00 0.00 ? 20  ARG E NH2 1 
ATOM   6783  N N   . LEU E  5  21  ? -23.413 -68.292 -2.023  1.00 0.00 ? 21  LEU E N   1 
ATOM   6784  C CA  . LEU E  5  21  ? -22.021 -68.120 -1.586  1.00 0.00 ? 21  LEU E CA  1 
ATOM   6785  C C   . LEU E  5  21  ? -21.606 -69.036 -0.428  1.00 0.00 ? 21  LEU E C   1 
ATOM   6786  O O   . LEU E  5  21  ? -22.454 -69.634 0.235   1.00 0.00 ? 21  LEU E O   1 
ATOM   6787  C CB  . LEU E  5  21  ? -21.757 -66.658 -1.214  1.00 0.00 ? 21  LEU E CB  1 
ATOM   6788  C CG  . LEU E  5  21  ? -21.943 -65.630 -2.332  1.00 0.00 ? 21  LEU E CG  1 
ATOM   6789  C CD1 . LEU E  5  21  ? -22.203 -64.248 -1.754  1.00 0.00 ? 21  LEU E CD1 1 
ATOM   6790  C CD2 . LEU E  5  21  ? -20.731 -65.612 -3.251  1.00 0.00 ? 21  LEU E CD2 1 
ATOM   6791  N N   . PHE E  5  22  ? -20.297 -69.150 -0.202  1.00 0.00 ? 22  PHE E N   1 
ATOM   6792  C CA  . PHE E  5  22  ? -19.757 -70.119 0.709   1.00 0.00 ? 22  PHE E CA  1 
ATOM   6793  C C   . PHE E  5  22  ? -19.562 -69.415 1.982   1.00 0.00 ? 22  PHE E C   1 
ATOM   6794  O O   . PHE E  5  22  ? -20.095 -69.841 2.999   1.00 0.00 ? 22  PHE E O   1 
ATOM   6795  C CB  . PHE E  5  22  ? -18.382 -70.668 0.294   1.00 0.00 ? 22  PHE E CB  1 
ATOM   6796  C CG  . PHE E  5  22  ? -18.528 -71.816 -0.642  1.00 0.00 ? 22  PHE E CG  1 
ATOM   6797  C CD1 . PHE E  5  22  ? -19.376 -72.898 -0.340  1.00 0.00 ? 22  PHE E CD1 1 
ATOM   6798  C CD2 . PHE E  5  22  ? -17.776 -71.847 -1.826  1.00 0.00 ? 22  PHE E CD2 1 
ATOM   6799  C CE1 . PHE E  5  22  ? -19.483 -73.976 -1.220  1.00 0.00 ? 22  PHE E CE1 1 
ATOM   6800  C CE2 . PHE E  5  22  ? -17.879 -72.927 -2.709  1.00 0.00 ? 22  PHE E CE2 1 
ATOM   6801  C CZ  . PHE E  5  22  ? -18.731 -73.994 -2.403  1.00 0.00 ? 22  PHE E CZ  1 
ATOM   6802  N N   . GLN E  5  23  ? -18.788 -68.316 1.981   1.00 0.00 ? 23  GLN E N   1 
ATOM   6803  C CA  . GLN E  5  23  ? -18.360 -67.696 3.208   1.00 0.00 ? 23  GLN E CA  1 
ATOM   6804  C C   . GLN E  5  23  ? -19.514 -67.210 4.034   1.00 0.00 ? 23  GLN E C   1 
ATOM   6805  O O   . GLN E  5  23  ? -19.463 -67.257 5.255   1.00 0.00 ? 23  GLN E O   1 
ATOM   6806  C CB  . GLN E  5  23  ? -17.390 -66.511 2.969   1.00 0.00 ? 23  GLN E CB  1 
ATOM   6807  C CG  . GLN E  5  23  ? -16.199 -66.843 2.061   1.00 0.00 ? 23  GLN E CG  1 
ATOM   6808  C CD  . GLN E  5  23  ? -15.505 -68.102 2.570   1.00 0.00 ? 23  GLN E CD  1 
ATOM   6809  O OE1 . GLN E  5  23  ? -15.202 -68.224 3.758   1.00 0.00 ? 23  GLN E OE1 1 
ATOM   6810  N NE2 . GLN E  5  23  ? -15.262 -69.067 1.637   1.00 0.00 ? 23  GLN E NE2 1 
ATOM   6811  N N   . VAL E  5  24  ? -20.603 -66.783 3.370   1.00 0.00 ? 24  VAL E N   1 
ATOM   6812  C CA  . VAL E  5  24  ? -21.809 -66.323 3.982   1.00 0.00 ? 24  VAL E CA  1 
ATOM   6813  C C   . VAL E  5  24  ? -22.459 -67.447 4.703   1.00 0.00 ? 24  VAL E C   1 
ATOM   6814  O O   . VAL E  5  24  ? -22.855 -67.284 5.843   1.00 0.00 ? 24  VAL E O   1 
ATOM   6815  C CB  . VAL E  5  24  ? -22.751 -65.635 3.038   1.00 0.00 ? 24  VAL E CB  1 
ATOM   6816  C CG1 . VAL E  5  24  ? -23.932 -65.054 3.846   1.00 0.00 ? 24  VAL E CG1 1 
ATOM   6817  C CG2 . VAL E  5  24  ? -21.954 -64.512 2.345   1.00 0.00 ? 24  VAL E CG2 1 
ATOM   6818  N N   . GLU E  5  25  ? -22.622 -68.617 4.074   1.00 0.00 ? 25  GLU E N   1 
ATOM   6819  C CA  . GLU E  5  25  ? -23.257 -69.753 4.699   1.00 0.00 ? 25  GLU E CA  1 
ATOM   6820  C C   . GLU E  5  25  ? -22.440 -70.287 5.858   1.00 0.00 ? 25  GLU E C   1 
ATOM   6821  O O   . GLU E  5  25  ? -22.966 -70.759 6.861   1.00 0.00 ? 25  GLU E O   1 
ATOM   6822  C CB  . GLU E  5  25  ? -23.461 -70.854 3.648   1.00 0.00 ? 25  GLU E CB  1 
ATOM   6823  C CG  . GLU E  5  25  ? -24.449 -70.465 2.517   1.00 0.00 ? 25  GLU E CG  1 
ATOM   6824  C CD  . GLU E  5  25  ? -25.862 -70.077 2.984   1.00 0.00 ? 25  GLU E CD  1 
ATOM   6825  O OE1 . GLU E  5  25  ? -26.408 -70.728 3.917   1.00 0.00 ? 25  GLU E OE1 1 
ATOM   6826  O OE2 . GLU E  5  25  ? -26.406 -69.096 2.409   1.00 0.00 ? 25  GLU E OE2 1 
ATOM   6827  N N   . TYR E  5  26  ? -21.108 -70.170 5.774   1.00 0.00 ? 26  TYR E N   1 
ATOM   6828  C CA  . TYR E  5  26  ? -20.212 -70.419 6.882   1.00 0.00 ? 26  TYR E CA  1 
ATOM   6829  C C   . TYR E  5  26  ? -20.316 -69.411 7.995   1.00 0.00 ? 26  TYR E C   1 
ATOM   6830  O O   . TYR E  5  26  ? -20.121 -69.764 9.149   1.00 0.00 ? 26  TYR E O   1 
ATOM   6831  C CB  . TYR E  5  26  ? -18.738 -70.509 6.439   1.00 0.00 ? 26  TYR E CB  1 
ATOM   6832  C CG  . TYR E  5  26  ? -18.527 -71.515 5.320   1.00 0.00 ? 26  TYR E CG  1 
ATOM   6833  C CD1 . TYR E  5  26  ? -19.303 -72.678 5.156   1.00 0.00 ? 26  TYR E CD1 1 
ATOM   6834  C CD2 . TYR E  5  26  ? -17.492 -71.282 4.411   1.00 0.00 ? 26  TYR E CD2 1 
ATOM   6835  C CE1 . TYR E  5  26  ? -19.063 -73.559 4.096   1.00 0.00 ? 26  TYR E CE1 1 
ATOM   6836  C CE2 . TYR E  5  26  ? -17.232 -72.171 3.371   1.00 0.00 ? 26  TYR E CE2 1 
ATOM   6837  C CZ  . TYR E  5  26  ? -18.014 -73.314 3.206   1.00 0.00 ? 26  TYR E CZ  1 
ATOM   6838  O OH  . TYR E  5  26  ? -17.713 -74.236 2.179   1.00 0.00 ? 26  TYR E OH  1 
ATOM   6839  N N   . ALA E  5  27  ? -20.601 -68.126 7.677   1.00 0.00 ? 27  ALA E N   1 
ATOM   6840  C CA  . ALA E  5  27  ? -20.877 -67.061 8.615   1.00 0.00 ? 27  ALA E CA  1 
ATOM   6841  C C   . ALA E  5  27  ? -22.181 -67.265 9.319   1.00 0.00 ? 27  ALA E C   1 
ATOM   6842  O O   . ALA E  5  27  ? -22.297 -66.966 10.498  1.00 0.00 ? 27  ALA E O   1 
ATOM   6843  C CB  . ALA E  5  27  ? -20.877 -65.674 7.972   1.00 0.00 ? 27  ALA E CB  1 
ATOM   6844  N N   . ILE E  5  28  ? -23.185 -67.846 8.631   1.00 0.00 ? 28  ILE E N   1 
ATOM   6845  C CA  . ILE E  5  28  ? -24.458 -68.243 9.180   1.00 0.00 ? 28  ILE E CA  1 
ATOM   6846  C C   . ILE E  5  28  ? -24.235 -69.347 10.184  1.00 0.00 ? 28  ILE E C   1 
ATOM   6847  O O   . ILE E  5  28  ? -24.879 -69.377 11.225  1.00 0.00 ? 28  ILE E O   1 
ATOM   6848  C CB  . ILE E  5  28  ? -25.399 -68.672 8.066   1.00 0.00 ? 28  ILE E CB  1 
ATOM   6849  C CG1 . ILE E  5  28  ? -25.965 -67.448 7.317   1.00 0.00 ? 28  ILE E CG1 1 
ATOM   6850  C CG2 . ILE E  5  28  ? -26.560 -69.563 8.559   1.00 0.00 ? 28  ILE E CG2 1 
ATOM   6851  C CD1 . ILE E  5  28  ? -27.069 -66.694 8.069   1.00 0.00 ? 28  ILE E CD1 1 
ATOM   6852  N N   . GLU E  5  29  ? -23.291 -70.276 9.912   1.00 0.00 ? 29  GLU E N   1 
ATOM   6853  C CA  . GLU E  5  29  ? -22.885 -71.297 10.858  1.00 0.00 ? 29  GLU E CA  1 
ATOM   6854  C C   . GLU E  5  29  ? -22.172 -70.694 12.035  1.00 0.00 ? 29  GLU E C   1 
ATOM   6855  O O   . GLU E  5  29  ? -22.179 -71.268 13.117  1.00 0.00 ? 29  GLU E O   1 
ATOM   6856  C CB  . GLU E  5  29  ? -21.955 -72.373 10.260  1.00 0.00 ? 29  GLU E CB  1 
ATOM   6857  C CG  . GLU E  5  29  ? -22.662 -73.313 9.275   1.00 0.00 ? 29  GLU E CG  1 
ATOM   6858  C CD  . GLU E  5  29  ? -21.645 -74.280 8.673   1.00 0.00 ? 29  GLU E CD  1 
ATOM   6859  O OE1 . GLU E  5  29  ? -20.856 -74.879 9.450   1.00 0.00 ? 29  GLU E OE1 1 
ATOM   6860  O OE2 . GLU E  5  29  ? -21.645 -74.440 7.424   1.00 0.00 ? 29  GLU E OE2 1 
ATOM   6861  N N   . ALA E  5  30  ? -21.511 -69.531 11.873  1.00 0.00 ? 30  ALA E N   1 
ATOM   6862  C CA  . ALA E  5  30  ? -20.857 -68.863 12.970  1.00 0.00 ? 30  ALA E CA  1 
ATOM   6863  C C   . ALA E  5  30  ? -21.835 -68.320 13.979  1.00 0.00 ? 30  ALA E C   1 
ATOM   6864  O O   . ALA E  5  30  ? -21.480 -68.184 15.144  1.00 0.00 ? 30  ALA E O   1 
ATOM   6865  C CB  . ALA E  5  30  ? -19.967 -67.691 12.526  1.00 0.00 ? 30  ALA E CB  1 
ATOM   6866  N N   . ILE E  5  31  ? -23.084 -67.997 13.567  1.00 0.00 ? 31  ILE E N   1 
ATOM   6867  C CA  . ILE E  5  31  ? -24.141 -67.524 14.434  1.00 0.00 ? 31  ILE E CA  1 
ATOM   6868  C C   . ILE E  5  31  ? -24.559 -68.549 15.447  1.00 0.00 ? 31  ILE E C   1 
ATOM   6869  O O   . ILE E  5  31  ? -24.967 -68.196 16.545  1.00 0.00 ? 31  ILE E O   1 
ATOM   6870  C CB  . ILE E  5  31  ? -25.332 -67.038 13.626  1.00 0.00 ? 31  ILE E CB  1 
ATOM   6871  C CG1 . ILE E  5  31  ? -24.883 -65.808 12.818  1.00 0.00 ? 31  ILE E CG1 1 
ATOM   6872  C CG2 . ILE E  5  31  ? -26.524 -66.672 14.537  1.00 0.00 ? 31  ILE E CG2 1 
ATOM   6873  C CD1 . ILE E  5  31  ? -25.930 -65.262 11.855  1.00 0.00 ? 31  ILE E CD1 1 
ATOM   6874  N N   . LYS E  5  32  ? -24.452 -69.850 15.110  1.00 0.00 ? 32  LYS E N   1 
ATOM   6875  C CA  . LYS E  5  32  ? -24.872 -70.969 15.926  1.00 0.00 ? 32  LYS E CA  1 
ATOM   6876  C C   . LYS E  5  32  ? -24.051 -71.101 17.160  1.00 0.00 ? 32  LYS E C   1 
ATOM   6877  O O   . LYS E  5  32  ? -24.487 -71.741 18.109  1.00 0.00 ? 32  LYS E O   1 
ATOM   6878  C CB  . LYS E  5  32  ? -24.838 -72.322 15.188  1.00 0.00 ? 32  LYS E CB  1 
ATOM   6879  C CG  . LYS E  5  32  ? -26.053 -72.574 14.269  1.00 0.00 ? 32  LYS E CG  1 
ATOM   6880  C CD  . LYS E  5  32  ? -26.309 -71.501 13.203  1.00 0.00 ? 32  LYS E CD  1 
ATOM   6881  C CE  . LYS E  5  32  ? -27.420 -71.871 12.226  1.00 0.00 ? 32  LYS E CE  1 
ATOM   6882  N NZ  . LYS E  5  32  ? -27.793 -70.699 11.416  1.00 0.00 ? 32  LYS E NZ  1 
ATOM   6883  N N   . LEU E  5  33  ? -22.835 -70.516 17.165  1.00 0.00 ? 33  LEU E N   1 
ATOM   6884  C CA  . LEU E  5  33  ? -21.993 -70.439 18.332  1.00 0.00 ? 33  LEU E CA  1 
ATOM   6885  C C   . LEU E  5  33  ? -22.079 -69.059 18.939  1.00 0.00 ? 33  LEU E C   1 
ATOM   6886  O O   . LEU E  5  33  ? -21.177 -68.618 19.642  1.00 0.00 ? 33  LEU E O   1 
ATOM   6887  C CB  . LEU E  5  33  ? -20.519 -70.801 18.021  1.00 0.00 ? 33  LEU E CB  1 
ATOM   6888  C CG  . LEU E  5  33  ? -20.302 -72.278 17.594  1.00 0.00 ? 33  LEU E CG  1 
ATOM   6889  C CD1 . LEU E  5  33  ? -18.828 -72.544 17.234  1.00 0.00 ? 33  LEU E CD1 1 
ATOM   6890  C CD2 . LEU E  5  33  ? -20.778 -73.294 18.651  1.00 0.00 ? 33  LEU E CD2 1 
ATOM   6891  N N   . GLY E  5  34  ? -23.222 -68.383 18.744  1.00 0.00 ? 34  GLY E N   1 
ATOM   6892  C CA  . GLY E  5  34  ? -23.495 -67.071 19.248  1.00 0.00 ? 34  GLY E CA  1 
ATOM   6893  C C   . GLY E  5  34  ? -24.630 -67.204 20.204  1.00 0.00 ? 34  GLY E C   1 
ATOM   6894  O O   . GLY E  5  34  ? -25.334 -68.204 20.199  1.00 0.00 ? 34  GLY E O   1 
ATOM   6895  N N   . SER E  5  35  ? -24.805 -66.205 21.097  1.00 0.00 ? 35  SER E N   1 
ATOM   6896  C CA  . SER E  5  35  ? -25.850 -66.146 22.096  1.00 0.00 ? 35  SER E CA  1 
ATOM   6897  C C   . SER E  5  35  ? -27.225 -66.143 21.514  1.00 0.00 ? 35  SER E C   1 
ATOM   6898  O O   . SER E  5  35  ? -27.480 -65.476 20.519  1.00 0.00 ? 35  SER E O   1 
ATOM   6899  C CB  . SER E  5  35  ? -25.741 -64.872 22.968  1.00 0.00 ? 35  SER E CB  1 
ATOM   6900  O OG  . SER E  5  35  ? -26.606 -64.902 24.098  1.00 0.00 ? 35  SER E OG  1 
ATOM   6901  N N   . THR E  5  36  ? -28.170 -66.829 22.194  1.00 0.00 ? 36  THR E N   1 
ATOM   6902  C CA  . THR E  5  36  ? -29.587 -66.782 21.904  1.00 0.00 ? 36  THR E CA  1 
ATOM   6903  C C   . THR E  5  36  ? -30.072 -65.387 22.212  1.00 0.00 ? 36  THR E C   1 
ATOM   6904  O O   . THR E  5  36  ? -29.458 -64.717 23.033  1.00 0.00 ? 36  THR E O   1 
ATOM   6905  C CB  . THR E  5  36  ? -30.317 -67.872 22.681  1.00 0.00 ? 36  THR E CB  1 
ATOM   6906  O OG1 . THR E  5  36  ? -31.717 -67.868 22.431  1.00 0.00 ? 36  THR E OG1 1 
ATOM   6907  C CG2 . THR E  5  36  ? -30.046 -67.748 24.193  1.00 0.00 ? 36  THR E CG2 1 
ATOM   6908  N N   . ALA E  5  37  ? -30.971 -64.900 21.369  1.00 0.00 ? 37  ALA E N   1 
ATOM   6909  C CA  . ALA E  5  37  ? -31.536 -63.575 21.520  1.00 0.00 ? 37  ALA E CA  1 
ATOM   6910  C C   . ALA E  5  37  ? -32.950 -63.497 20.959  1.00 0.00 ? 37  ALA E C   1 
ATOM   6911  O O   . ALA E  5  37  ? -33.162 -63.589 19.752  1.00 0.00 ? 37  ALA E O   1 
ATOM   6912  C CB  . ALA E  5  37  ? -30.642 -62.540 20.854  1.00 0.00 ? 37  ALA E CB  1 
ATOM   6913  N N   . ILE E  5  38  ? -33.904 -63.281 21.847  1.00 0.00 ? 38  ILE E N   1 
ATOM   6914  C CA  . ILE E  5  38  ? -35.238 -62.911 21.482  1.00 0.00 ? 38  ILE E CA  1 
ATOM   6915  C C   . ILE E  5  38  ? -35.324 -61.448 21.143  1.00 0.00 ? 38  ILE E C   1 
ATOM   6916  O O   . ILE E  5  38  ? -34.715 -60.621 21.807  1.00 0.00 ? 38  ILE E O   1 
ATOM   6917  C CB  . ILE E  5  38  ? -36.220 -63.248 22.588  1.00 0.00 ? 38  ILE E CB  1 
ATOM   6918  C CG1 . ILE E  5  38  ? -35.903 -64.635 23.190  1.00 0.00 ? 38  ILE E CG1 1 
ATOM   6919  C CG2 . ILE E  5  38  ? -37.644 -63.232 21.997  1.00 0.00 ? 38  ILE E CG2 1 
ATOM   6920  C CD1 . ILE E  5  38  ? -36.835 -65.019 24.334  1.00 0.00 ? 38  ILE E CD1 1 
ATOM   6921  N N   . GLY E  5  39  ? -36.124 -61.140 20.131  1.00 0.00 ? 39  GLY E N   1 
ATOM   6922  C CA  . GLY E  5  39  ? -36.309 -59.779 19.683  1.00 0.00 ? 39  GLY E CA  1 
ATOM   6923  C C   . GLY E  5  39  ? -37.795 -59.523 19.661  1.00 0.00 ? 39  GLY E C   1 
ATOM   6924  O O   . GLY E  5  39  ? -38.435 -59.484 18.614  1.00 0.00 ? 39  GLY E O   1 
ATOM   6925  N N   . ILE E  5  40  ? -38.342 -59.363 20.856  1.00 0.00 ? 40  ILE E N   1 
ATOM   6926  C CA  . ILE E  5  40  ? -39.762 -59.163 21.036  1.00 0.00 ? 40  ILE E CA  1 
ATOM   6927  C C   . ILE E  5  40  ? -40.172 -57.838 20.475  1.00 0.00 ? 40  ILE E C   1 
ATOM   6928  O O   . ILE E  5  40  ? -39.496 -56.846 20.719  1.00 0.00 ? 40  ILE E O   1 
ATOM   6929  C CB  . ILE E  5  40  ? -40.128 -59.213 22.516  1.00 0.00 ? 40  ILE E CB  1 
ATOM   6930  C CG1 . ILE E  5  40  ? -39.821 -60.575 23.176  1.00 0.00 ? 40  ILE E CG1 1 
ATOM   6931  C CG2 . ILE E  5  40  ? -41.598 -58.845 22.755  1.00 0.00 ? 40  ILE E CG2 1 
ATOM   6932  C CD1 . ILE E  5  40  ? -40.680 -61.740 22.691  1.00 0.00 ? 40  ILE E CD1 1 
ATOM   6933  N N   . GLN E  5  41  ? -41.323 -57.784 19.769  1.00 0.00 ? 41  GLN E N   1 
ATOM   6934  C CA  . GLN E  5  41  ? -41.942 -56.530 19.430  1.00 0.00 ? 41  GLN E CA  1 
ATOM   6935  C C   . GLN E  5  41  ? -43.316 -56.598 19.971  1.00 0.00 ? 41  GLN E C   1 
ATOM   6936  O O   . GLN E  5  41  ? -44.174 -57.333 19.492  1.00 0.00 ? 41  GLN E O   1 
ATOM   6937  C CB  . GLN E  5  41  ? -42.087 -56.207 17.928  1.00 0.00 ? 41  GLN E CB  1 
ATOM   6938  C CG  . GLN E  5  41  ? -42.704 -54.825 17.671  1.00 0.00 ? 41  GLN E CG  1 
ATOM   6939  C CD  . GLN E  5  41  ? -42.960 -54.643 16.183  1.00 0.00 ? 41  GLN E CD  1 
ATOM   6940  O OE1 . GLN E  5  41  ? -42.418 -55.374 15.355  1.00 0.00 ? 41  GLN E OE1 1 
ATOM   6941  N NE2 . GLN E  5  41  ? -43.825 -53.649 15.834  1.00 0.00 ? 41  GLN E NE2 1 
ATOM   6942  N N   . THR E  5  42  ? -43.550 -55.740 20.970  1.00 0.00 ? 42  THR E N   1 
ATOM   6943  C CA  . THR E  5  42  ? -44.837 -55.384 21.458  1.00 0.00 ? 42  THR E CA  1 
ATOM   6944  C C   . THR E  5  42  ? -45.093 -54.135 20.685  1.00 0.00 ? 42  THR E C   1 
ATOM   6945  O O   . THR E  5  42  ? -44.168 -53.453 20.264  1.00 0.00 ? 42  THR E O   1 
ATOM   6946  C CB  . THR E  5  42  ? -44.839 -55.188 22.975  1.00 0.00 ? 42  THR E CB  1 
ATOM   6947  O OG1 . THR E  5  42  ? -43.940 -54.184 23.408  1.00 0.00 ? 42  THR E OG1 1 
ATOM   6948  C CG2 . THR E  5  42  ? -44.533 -56.497 23.724  1.00 0.00 ? 42  THR E CG2 1 
ATOM   6949  N N   . SER E  5  43  ? -46.374 -53.864 20.458  1.00 0.00 ? 43  SER E N   1 
ATOM   6950  C CA  . SER E  5  43  ? -46.812 -52.716 19.682  1.00 0.00 ? 43  SER E CA  1 
ATOM   6951  C C   . SER E  5  43  ? -46.892 -51.495 20.587  1.00 0.00 ? 43  SER E C   1 
ATOM   6952  O O   . SER E  5  43  ? -47.144 -50.378 20.134  1.00 0.00 ? 43  SER E O   1 
ATOM   6953  C CB  . SER E  5  43  ? -48.163 -53.007 19.026  1.00 0.00 ? 43  SER E CB  1 
ATOM   6954  O OG  . SER E  5  43  ? -48.168 -54.289 18.420  1.00 0.00 ? 43  SER E OG  1 
ATOM   6955  N N   . GLU E  5  44  ? -46.670 -51.731 21.876  1.00 0.00 ? 44  GLU E N   1 
ATOM   6956  C CA  . GLU E  5  44  ? -46.520 -50.693 22.849  1.00 0.00 ? 44  GLU E CA  1 
ATOM   6957  C C   . GLU E  5  44  ? -45.089 -50.182 22.786  1.00 0.00 ? 44  GLU E C   1 
ATOM   6958  O O   . GLU E  5  44  ? -44.875 -48.979 22.712  1.00 0.00 ? 44  GLU E O   1 
ATOM   6959  C CB  . GLU E  5  44  ? -46.866 -51.186 24.276  1.00 0.00 ? 44  GLU E CB  1 
ATOM   6960  C CG  . GLU E  5  44  ? -47.010 -50.034 25.298  1.00 0.00 ? 44  GLU E CG  1 
ATOM   6961  C CD  . GLU E  5  44  ? -47.432 -50.477 26.708  1.00 0.00 ? 44  GLU E CD  1 
ATOM   6962  O OE1 . GLU E  5  44  ? -48.444 -51.213 26.835  1.00 0.00 ? 44  GLU E OE1 1 
ATOM   6963  O OE2 . GLU E  5  44  ? -46.755 -50.051 27.681  1.00 0.00 ? 44  GLU E OE2 1 
ATOM   6964  N N   . GLY E  5  45  ? -44.178 -51.153 22.876  1.00 0.00 ? 45  GLY E N   1 
ATOM   6965  C CA  . GLY E  5  45  ? -42.766 -50.991 23.155  1.00 0.00 ? 45  GLY E CA  1 
ATOM   6966  C C   . GLY E  5  45  ? -41.937 -52.175 22.666  1.00 0.00 ? 45  GLY E C   1 
ATOM   6967  O O   . GLY E  5  45  ? -42.467 -53.207 22.255  1.00 0.00 ? 45  GLY E O   1 
ATOM   6968  N N   . VAL E  5  46  ? -40.622 -51.996 22.714  1.00 0.00 ? 46  VAL E N   1 
ATOM   6969  C CA  . VAL E  5  46  ? -39.613 -52.878 22.142  1.00 0.00 ? 46  VAL E CA  1 
ATOM   6970  C C   . VAL E  5  46  ? -39.033 -53.570 23.328  1.00 0.00 ? 46  VAL E C   1 
ATOM   6971  O O   . VAL E  5  46  ? -39.000 -53.010 24.417  1.00 0.00 ? 46  VAL E O   1 
ATOM   6972  C CB  . VAL E  5  46  ? -38.522 -52.122 21.403  1.00 0.00 ? 46  VAL E CB  1 
ATOM   6973  C CG1 . VAL E  5  46  ? -37.211 -52.912 21.272  1.00 0.00 ? 46  VAL E CG1 1 
ATOM   6974  C CG2 . VAL E  5  46  ? -39.064 -51.751 20.011  1.00 0.00 ? 46  VAL E CG2 1 
ATOM   6975  N N   . CYS E  5  47  ? -38.647 -54.848 23.172  1.00 0.00 ? 47  CYS E N   1 
ATOM   6976  C CA  . CYS E  5  47  ? -38.081 -55.603 24.255  1.00 0.00 ? 47  CYS E CA  1 
ATOM   6977  C C   . CYS E  5  47  ? -37.011 -56.549 23.753  1.00 0.00 ? 47  CYS E C   1 
ATOM   6978  O O   . CYS E  5  47  ? -37.177 -57.763 23.722  1.00 0.00 ? 47  CYS E O   1 
ATOM   6979  C CB  . CYS E  5  47  ? -39.198 -56.328 25.020  1.00 0.00 ? 47  CYS E CB  1 
ATOM   6980  S SG  . CYS E  5  47  ? -38.590 -57.428 26.304  1.00 0.00 ? 47  CYS E SG  1 
ATOM   6981  N N   . LEU E  5  48  ? -35.848 -56.021 23.357  1.00 0.00 ? 48  LEU E N   1 
ATOM   6982  C CA  . LEU E  5  48  ? -34.717 -56.819 23.001  1.00 0.00 ? 48  LEU E CA  1 
ATOM   6983  C C   . LEU E  5  48  ? -34.194 -57.532 24.219  1.00 0.00 ? 48  LEU E C   1 
ATOM   6984  O O   . LEU E  5  48  ? -34.177 -56.987 25.320  1.00 0.00 ? 48  LEU E O   1 
ATOM   6985  C CB  . LEU E  5  48  ? -33.633 -55.927 22.416  1.00 0.00 ? 48  LEU E CB  1 
ATOM   6986  C CG  . LEU E  5  48  ? -34.059 -55.163 21.142  1.00 0.00 ? 48  LEU E CG  1 
ATOM   6987  C CD1 . LEU E  5  48  ? -33.024 -54.087 20.766  1.00 0.00 ? 48  LEU E CD1 1 
ATOM   6988  C CD2 . LEU E  5  48  ? -34.328 -56.108 19.961  1.00 0.00 ? 48  LEU E CD2 1 
ATOM   6989  N N   . ALA E  5  49  ? -33.803 -58.808 24.053  1.00 0.00 ? 49  ALA E N   1 
ATOM   6990  C CA  . ALA E  5  49  ? -33.458 -59.660 25.159  1.00 0.00 ? 49  ALA E CA  1 
ATOM   6991  C C   . ALA E  5  49  ? -32.426 -60.608 24.671  1.00 0.00 ? 49  ALA E C   1 
ATOM   6992  O O   . ALA E  5  49  ? -32.427 -60.975 23.506  1.00 0.00 ? 49  ALA E O   1 
ATOM   6993  C CB  . ALA E  5  49  ? -34.651 -60.487 25.653  1.00 0.00 ? 49  ALA E CB  1 
ATOM   6994  N N   . VAL E  5  50  ? -31.486 -60.996 25.549  1.00 0.00 ? 50  VAL E N   1 
ATOM   6995  C CA  . VAL E  5  50  ? -30.351 -61.765 25.145  1.00 0.00 ? 50  VAL E CA  1 
ATOM   6996  C C   . VAL E  5  50  ? -29.847 -62.440 26.375  1.00 0.00 ? 50  VAL E C   1 
ATOM   6997  O O   . VAL E  5  50  ? -29.840 -61.854 27.452  1.00 0.00 ? 50  VAL E O   1 
ATOM   6998  C CB  . VAL E  5  50  ? -29.305 -60.856 24.496  1.00 0.00 ? 50  VAL E CB  1 
ATOM   6999  C CG1 . VAL E  5  50  ? -29.008 -59.609 25.366  1.00 0.00 ? 50  VAL E CG1 1 
ATOM   7000  C CG2 . VAL E  5  50  ? -28.028 -61.615 24.091  1.00 0.00 ? 50  VAL E CG2 1 
ATOM   7001  N N   . GLU E  5  51  ? -29.394 -63.712 26.240  1.00 0.00 ? 51  GLU E N   1 
ATOM   7002  C CA  . GLU E  5  51  ? -28.748 -64.466 27.289  1.00 0.00 ? 51  GLU E CA  1 
ATOM   7003  C C   . GLU E  5  51  ? -27.424 -63.839 27.527  1.00 0.00 ? 51  GLU E C   1 
ATOM   7004  O O   . GLU E  5  51  ? -26.781 -63.424 26.570  1.00 0.00 ? 51  GLU E O   1 
ATOM   7005  C CB  . GLU E  5  51  ? -28.578 -65.961 26.936  1.00 0.00 ? 51  GLU E CB  1 
ATOM   7006  C CG  . GLU E  5  51  ? -28.222 -66.896 28.115  1.00 0.00 ? 51  GLU E CG  1 
ATOM   7007  C CD  . GLU E  5  51  ? -26.755 -67.345 28.138  1.00 0.00 ? 51  GLU E CD  1 
ATOM   7008  O OE1 . GLU E  5  51  ? -26.346 -68.060 27.187  1.00 0.00 ? 51  GLU E OE1 1 
ATOM   7009  O OE2 . GLU E  5  51  ? -26.041 -67.028 29.124  1.00 0.00 ? 51  GLU E OE2 1 
ATOM   7010  N N   . LYS E  5  52  ? -26.986 -63.766 28.813  1.00 0.00 ? 52  LYS E N   1 
ATOM   7011  C CA  . LYS E  5  52  ? -25.865 -62.983 29.320  1.00 0.00 ? 52  LYS E CA  1 
ATOM   7012  C C   . LYS E  5  52  ? -24.627 -63.309 28.564  1.00 0.00 ? 52  LYS E C   1 
ATOM   7013  O O   . LYS E  5  52  ? -23.892 -62.416 28.160  1.00 0.00 ? 52  LYS E O   1 
ATOM   7014  C CB  . LYS E  5  52  ? -25.613 -63.352 30.793  1.00 0.00 ? 52  LYS E CB  1 
ATOM   7015  C CG  . LYS E  5  52  ? -24.597 -62.527 31.580  1.00 0.00 ? 52  LYS E CG  1 
ATOM   7016  C CD  . LYS E  5  52  ? -25.091 -61.121 31.920  1.00 0.00 ? 52  LYS E CD  1 
ATOM   7017  C CE  . LYS E  5  52  ? -24.397 -60.478 33.126  1.00 0.00 ? 52  LYS E CE  1 
ATOM   7018  N NZ  . LYS E  5  52  ? -24.856 -59.083 33.292  1.00 0.00 ? 52  LYS E NZ  1 
ATOM   7019  N N   . ARG E  5  53  ? -24.485 -64.642 28.339  1.00 0.00 ? 53  ARG E N   1 
ATOM   7020  C CA  . ARG E  5  53  ? -23.571 -65.419 27.542  1.00 0.00 ? 53  ARG E CA  1 
ATOM   7021  C C   . ARG E  5  53  ? -22.309 -65.636 28.322  1.00 0.00 ? 53  ARG E C   1 
ATOM   7022  O O   . ARG E  5  53  ? -21.309 -66.179 27.858  1.00 0.00 ? 53  ARG E O   1 
ATOM   7023  C CB  . ARG E  5  53  ? -23.365 -64.864 26.116  1.00 0.00 ? 53  ARG E CB  1 
ATOM   7024  C CG  . ARG E  5  53  ? -22.689 -65.838 25.139  1.00 0.00 ? 53  ARG E CG  1 
ATOM   7025  C CD  . ARG E  5  53  ? -23.350 -67.225 25.054  1.00 0.00 ? 53  ARG E CD  1 
ATOM   7026  N NE  . ARG E  5  53  ? -22.490 -68.132 24.233  1.00 0.00 ? 53  ARG E NE  1 
ATOM   7027  C CZ  . ARG E  5  53  ? -21.427 -68.817 24.756  1.00 0.00 ? 53  ARG E CZ  1 
ATOM   7028  N NH1 . ARG E  5  53  ? -21.121 -68.761 26.082  1.00 0.00 ? 53  ARG E NH1 1 
ATOM   7029  N NH2 . ARG E  5  53  ? -20.655 -69.580 23.927  1.00 0.00 ? 53  ARG E NH2 1 
ATOM   7030  N N   . ILE E  5  54  ? -22.373 -65.277 29.618  1.00 0.00 ? 54  ILE E N   1 
ATOM   7031  C CA  . ILE E  5  54  ? -21.354 -65.501 30.587  1.00 0.00 ? 54  ILE E CA  1 
ATOM   7032  C C   . ILE E  5  54  ? -21.302 -66.966 30.833  1.00 0.00 ? 54  ILE E C   1 
ATOM   7033  O O   . ILE E  5  54  ? -22.316 -67.651 30.695  1.00 0.00 ? 54  ILE E O   1 
ATOM   7034  C CB  . ILE E  5  54  ? -21.623 -64.683 31.834  1.00 0.00 ? 54  ILE E CB  1 
ATOM   7035  C CG1 . ILE E  5  54  ? -20.327 -64.306 32.558  1.00 0.00 ? 54  ILE E CG1 1 
ATOM   7036  C CG2 . ILE E  5  54  ? -22.651 -65.385 32.756  1.00 0.00 ? 54  ILE E CG2 1 
ATOM   7037  C CD1 . ILE E  5  54  ? -20.555 -63.233 33.620  1.00 0.00 ? 54  ILE E CD1 1 
ATOM   7038  N N   . THR E  5  55  ? -20.087 -67.489 30.964  1.00 0.00 ? 55  THR E N   1 
ATOM   7039  C CA  . THR E  5  55  ? -19.859 -68.878 31.349  1.00 0.00 ? 55  THR E CA  1 
ATOM   7040  C C   . THR E  5  55  ? -18.871 -68.982 32.512  1.00 0.00 ? 55  THR E C   1 
ATOM   7041  O O   . THR E  5  55  ? -18.924 -69.914 33.312  1.00 0.00 ? 55  THR E O   1 
ATOM   7042  C CB  . THR E  5  55  ? -19.375 -69.727 30.153  1.00 0.00 ? 55  THR E CB  1 
ATOM   7043  O OG1 . THR E  5  55  ? -19.599 -71.116 30.424  1.00 0.00 ? 55  THR E OG1 1 
ATOM   7044  C CG2 . THR E  5  55  ? -17.893 -69.495 29.879  1.00 0.00 ? 55  THR E CG2 1 
ATOM   7045  N N   . SER E  5  56  ? -17.975 -68.001 32.583  1.00 0.00 ? 56  SER E N   1 
ATOM   7046  C CA  . SER E  5  56  ? -16.875 -67.988 33.509  1.00 0.00 ? 56  SER E CA  1 
ATOM   7047  C C   . SER E  5  56  ? -17.266 -67.179 34.729  1.00 0.00 ? 56  SER E C   1 
ATOM   7048  O O   . SER E  5  56  ? -17.941 -66.178 34.534  1.00 0.00 ? 56  SER E O   1 
ATOM   7049  C CB  . SER E  5  56  ? -15.647 -67.391 32.818  1.00 0.00 ? 56  SER E CB  1 
ATOM   7050  O OG  . SER E  5  56  ? -15.330 -68.136 31.650  1.00 0.00 ? 56  SER E OG  1 
ATOM   7051  N N   . PRO E  5  57  ? -17.051 -67.624 35.975  1.00 0.00 ? 57  PRO E N   1 
ATOM   7052  C CA  . PRO E  5  57  ? -17.578 -66.969 37.165  1.00 0.00 ? 57  PRO E CA  1 
ATOM   7053  C C   . PRO E  5  57  ? -16.806 -65.783 37.653  1.00 0.00 ? 57  PRO E C   1 
ATOM   7054  O O   . PRO E  5  57  ? -17.397 -65.000 38.392  1.00 0.00 ? 57  PRO E O   1 
ATOM   7055  C CB  . PRO E  5  57  ? -17.537 -68.057 38.236  1.00 0.00 ? 57  PRO E CB  1 
ATOM   7056  C CG  . PRO E  5  57  ? -16.346 -68.915 37.828  1.00 0.00 ? 57  PRO E CG  1 
ATOM   7057  C CD  . PRO E  5  57  ? -16.407 -68.889 36.303  1.00 0.00 ? 57  PRO E CD  1 
ATOM   7058  N N   . LEU E  5  58  ? -15.505 -65.630 37.321  1.00 0.00 ? 58  LEU E N   1 
ATOM   7059  C CA  . LEU E  5  58  ? -14.728 -64.519 37.818  1.00 0.00 ? 58  LEU E CA  1 
ATOM   7060  C C   . LEU E  5  58  ? -14.667 -63.488 36.725  1.00 0.00 ? 58  LEU E C   1 
ATOM   7061  O O   . LEU E  5  58  ? -14.293 -62.348 36.970  1.00 0.00 ? 58  LEU E O   1 
ATOM   7062  C CB  . LEU E  5  58  ? -13.303 -64.941 38.248  1.00 0.00 ? 58  LEU E CB  1 
ATOM   7063  C CG  . LEU E  5  58  ? -13.258 -66.130 39.252  1.00 0.00 ? 58  LEU E CG  1 
ATOM   7064  C CD1 . LEU E  5  58  ? -11.812 -66.510 39.630  1.00 0.00 ? 58  LEU E CD1 1 
ATOM   7065  C CD2 . LEU E  5  58  ? -14.118 -65.917 40.520  1.00 0.00 ? 58  LEU E CD2 1 
ATOM   7066  N N   . MET E  5  59  ? -15.234 -63.818 35.532  1.00 0.00 ? 59  MET E N   1 
ATOM   7067  C CA  . MET E  5  59  ? -15.560 -62.886 34.488  1.00 0.00 ? 59  MET E CA  1 
ATOM   7068  C C   . MET E  5  59  ? -16.694 -62.095 35.044  1.00 0.00 ? 59  MET E C   1 
ATOM   7069  O O   . MET E  5  59  ? -17.530 -62.629 35.763  1.00 0.00 ? 59  MET E O   1 
ATOM   7070  C CB  . MET E  5  59  ? -15.994 -63.576 33.190  1.00 0.00 ? 59  MET E CB  1 
ATOM   7071  C CG  . MET E  5  59  ? -16.410 -62.617 32.068  1.00 0.00 ? 59  MET E CG  1 
ATOM   7072  S SD  . MET E  5  59  ? -16.686 -63.429 30.473  1.00 0.00 ? 59  MET E SD  1 
ATOM   7073  C CE  . MET E  5  59  ? -17.501 -61.947 29.887  1.00 0.00 ? 59  MET E CE  1 
ATOM   7074  N N   . GLU E  5  60  ? -16.654 -60.768 34.878  1.00 0.00 ? 60  GLU E N   1 
ATOM   7075  C CA  . GLU E  5  60  ? -17.540 -59.868 35.572  1.00 0.00 ? 60  GLU E CA  1 
ATOM   7076  C C   . GLU E  5  60  ? -19.012 -60.076 35.295  1.00 0.00 ? 60  GLU E C   1 
ATOM   7077  O O   . GLU E  5  60  ? -19.360 -60.398 34.160  1.00 0.00 ? 60  GLU E O   1 
ATOM   7078  C CB  . GLU E  5  60  ? -17.132 -58.402 35.298  1.00 0.00 ? 60  GLU E CB  1 
ATOM   7079  C CG  . GLU E  5  60  ? -17.178 -57.489 36.529  1.00 0.00 ? 60  GLU E CG  1 
ATOM   7080  C CD  . GLU E  5  60  ? -16.331 -58.073 37.668  1.00 0.00 ? 60  GLU E CD  1 
ATOM   7081  O OE1 . GLU E  5  60  ? -15.283 -58.707 37.382  1.00 0.00 ? 60  GLU E OE1 1 
ATOM   7082  O OE2 . GLU E  5  60  ? -16.729 -57.893 38.849  1.00 0.00 ? 60  GLU E OE2 1 
ATOM   7083  N N   . PRO E  5  61  ? -19.906 -59.941 36.277  1.00 0.00 ? 61  PRO E N   1 
ATOM   7084  C CA  . PRO E  5  61  ? -21.318 -60.165 36.079  1.00 0.00 ? 61  PRO E CA  1 
ATOM   7085  C C   . PRO E  5  61  ? -22.023 -58.903 35.681  1.00 0.00 ? 61  PRO E C   1 
ATOM   7086  O O   . PRO E  5  61  ? -23.246 -58.961 35.660  1.00 0.00 ? 61  PRO E O   1 
ATOM   7087  C CB  . PRO E  5  61  ? -21.838 -60.580 37.459  1.00 0.00 ? 61  PRO E CB  1 
ATOM   7088  C CG  . PRO E  5  61  ? -20.921 -59.842 38.419  1.00 0.00 ? 61  PRO E CG  1 
ATOM   7089  C CD  . PRO E  5  61  ? -19.581 -59.966 37.702  1.00 0.00 ? 61  PRO E CD  1 
ATOM   7090  N N   . SER E  5  62  ? -21.338 -57.777 35.541  1.00 0.00 ? 62  SER E N   1 
ATOM   7091  C CA  . SER E  5  62  ? -22.023 -56.549 35.159  1.00 0.00 ? 62  SER E CA  1 
ATOM   7092  C C   . SER E  5  62  ? -21.259 -55.702 34.149  1.00 0.00 ? 62  SER E C   1 
ATOM   7093  O O   . SER E  5  62  ? -21.541 -54.515 33.991  1.00 0.00 ? 62  SER E O   1 
ATOM   7094  C CB  . SER E  5  62  ? -22.383 -55.723 36.396  1.00 0.00 ? 62  SER E CB  1 
ATOM   7095  O OG  . SER E  5  62  ? -23.548 -56.235 37.024  1.00 0.00 ? 62  SER E OG  1 
ATOM   7096  N N   . SER E  5  63  ? -20.182 -56.262 33.604  1.00 0.00 ? 63  SER E N   1 
ATOM   7097  C CA  . SER E  5  63  ? -19.327 -55.534 32.669  1.00 0.00 ? 63  SER E CA  1 
ATOM   7098  C C   . SER E  5  63  ? -19.359 -56.172 31.290  1.00 0.00 ? 63  SER E C   1 
ATOM   7099  O O   . SER E  5  63  ? -18.839 -55.623 30.318  1.00 0.00 ? 63  SER E O   1 
ATOM   7100  C CB  . SER E  5  63  ? -17.890 -55.479 33.190  1.00 0.00 ? 63  SER E CB  1 
ATOM   7101  O OG  . SER E  5  63  ? -17.260 -54.264 32.822  1.00 0.00 ? 63  SER E OG  1 
ATOM   7102  N N   . ILE E  5  64  ? -19.979 -57.342 31.223  1.00 0.00 ? 64  ILE E N   1 
ATOM   7103  C CA  . ILE E  5  64  ? -20.122 -58.072 30.006  1.00 0.00 ? 64  ILE E CA  1 
ATOM   7104  C C   . ILE E  5  64  ? -21.331 -57.348 29.484  1.00 0.00 ? 64  ILE E C   1 
ATOM   7105  O O   . ILE E  5  64  ? -22.116 -56.823 30.269  1.00 0.00 ? 64  ILE E O   1 
ATOM   7106  C CB  . ILE E  5  64  ? -20.382 -59.567 30.197  1.00 0.00 ? 64  ILE E CB  1 
ATOM   7107  C CG1 . ILE E  5  64  ? -20.792 -60.275 28.873  1.00 0.00 ? 64  ILE E CG1 1 
ATOM   7108  C CG2 . ILE E  5  64  ? -21.397 -59.793 31.341  1.00 0.00 ? 64  ILE E CG2 1 
ATOM   7109  C CD1 . ILE E  5  64  ? -20.991 -61.788 28.962  1.00 0.00 ? 64  ILE E CD1 1 
ATOM   7110  N N   . GLU E  5  65  ? -21.486 -57.219 28.155  1.00 0.00 ? 65  GLU E N   1 
ATOM   7111  C CA  . GLU E  5  65  ? -22.605 -56.516 27.618  1.00 0.00 ? 65  GLU E CA  1 
ATOM   7112  C C   . GLU E  5  65  ? -22.875 -57.188 26.331  1.00 0.00 ? 65  GLU E C   1 
ATOM   7113  O O   . GLU E  5  65  ? -22.002 -57.880 25.813  1.00 0.00 ? 65  GLU E O   1 
ATOM   7114  C CB  . GLU E  5  65  ? -22.332 -55.003 27.428  1.00 0.00 ? 65  GLU E CB  1 
ATOM   7115  C CG  . GLU E  5  65  ? -23.586 -54.150 27.116  1.00 0.00 ? 65  GLU E CG  1 
ATOM   7116  C CD  . GLU E  5  65  ? -24.657 -54.344 28.197  1.00 0.00 ? 65  GLU E CD  1 
ATOM   7117  O OE1 . GLU E  5  65  ? -24.412 -53.886 29.345  1.00 0.00 ? 65  GLU E OE1 1 
ATOM   7118  O OE2 . GLU E  5  65  ? -25.722 -54.950 27.898  1.00 0.00 ? 65  GLU E OE2 1 
ATOM   7119  N N   . LYS E  5  66  ? -24.150 -57.154 25.938  1.00 0.00 ? 66  LYS E N   1 
ATOM   7120  C CA  . LYS E  5  66  ? -24.636 -57.741 24.694  1.00 0.00 ? 66  LYS E CA  1 
ATOM   7121  C C   . LYS E  5  66  ? -25.427 -56.772 23.814  1.00 0.00 ? 66  LYS E C   1 
ATOM   7122  O O   . LYS E  5  66  ? -25.449 -56.924 22.597  1.00 0.00 ? 66  LYS E O   1 
ATOM   7123  C CB  . LYS E  5  66  ? -25.501 -58.970 24.995  1.00 0.00 ? 66  LYS E CB  1 
ATOM   7124  C CG  . LYS E  5  66  ? -24.806 -60.035 25.826  1.00 0.00 ? 66  LYS E CG  1 
ATOM   7125  C CD  . LYS E  5  66  ? -25.008 -61.415 25.225  1.00 0.00 ? 66  LYS E CD  1 
ATOM   7126  C CE  . LYS E  5  66  ? -23.900 -61.755 24.245  1.00 0.00 ? 66  LYS E CE  1 
ATOM   7127  N NZ  . LYS E  5  66  ? -23.976 -63.174 23.807  1.00 0.00 ? 66  LYS E NZ  1 
ATOM   7128  N N   . ILE E  5  67  ? -26.081 -55.789 24.434  1.00 0.00 ? 67  ILE E N   1 
ATOM   7129  C CA  . ILE E  5  67  ? -26.982 -54.902 23.743  1.00 0.00 ? 67  ILE E CA  1 
ATOM   7130  C C   . ILE E  5  67  ? -26.565 -53.491 23.942  1.00 0.00 ? 67  ILE E C   1 
ATOM   7131  O O   . ILE E  5  67  ? -26.330 -53.043 25.060  1.00 0.00 ? 67  ILE E O   1 
ATOM   7132  C CB  . ILE E  5  67  ? -28.416 -55.106 24.169  1.00 0.00 ? 67  ILE E CB  1 
ATOM   7133  C CG1 . ILE E  5  67  ? -29.334 -54.051 23.540  1.00 0.00 ? 67  ILE E CG1 1 
ATOM   7134  C CG2 . ILE E  5  67  ? -28.569 -55.169 25.706  1.00 0.00 ? 67  ILE E CG2 1 
ATOM   7135  C CD1 . ILE E  5  67  ? -30.787 -54.498 23.487  1.00 0.00 ? 67  ILE E CD1 1 
ATOM   7136  N N   . VAL E  5  68  ? -26.380 -52.772 22.821  1.00 0.00 ? 68  VAL E N   1 
ATOM   7137  C CA  . VAL E  5  68  ? -25.881 -51.421 22.793  1.00 0.00 ? 68  VAL E CA  1 
ATOM   7138  C C   . VAL E  5  68  ? -26.887 -50.459 22.249  1.00 0.00 ? 68  VAL E C   1 
ATOM   7139  O O   . VAL E  5  68  ? -27.682 -50.795 21.390  1.00 0.00 ? 68  VAL E O   1 
ATOM   7140  C CB  . VAL E  5  68  ? -24.623 -51.294 21.970  1.00 0.00 ? 68  VAL E CB  1 
ATOM   7141  C CG1 . VAL E  5  68  ? -23.465 -51.971 22.738  1.00 0.00 ? 68  VAL E CG1 1 
ATOM   7142  C CG2 . VAL E  5  68  ? -24.826 -51.922 20.590  1.00 0.00 ? 68  VAL E CG2 1 
ATOM   7143  N N   . GLU E  5  69  ? -26.811 -49.188 22.686  1.00 0.00 ? 69  GLU E N   1 
ATOM   7144  C CA  . GLU E  5  69  ? -27.579 -48.086 22.168  1.00 0.00 ? 69  GLU E CA  1 
ATOM   7145  C C   . GLU E  5  69  ? -27.019 -47.708 20.842  1.00 0.00 ? 69  GLU E C   1 
ATOM   7146  O O   . GLU E  5  69  ? -25.844 -47.934 20.597  1.00 0.00 ? 69  GLU E O   1 
ATOM   7147  C CB  . GLU E  5  69  ? -27.518 -46.854 23.090  1.00 0.00 ? 69  GLU E CB  1 
ATOM   7148  C CG  . GLU E  5  69  ? -26.088 -46.474 23.541  1.00 0.00 ? 69  GLU E CG  1 
ATOM   7149  C CD  . GLU E  5  69  ? -26.097 -45.368 24.606  1.00 0.00 ? 69  GLU E CD  1 
ATOM   7150  O OE1 . GLU E  5  69  ? -27.180 -44.780 24.860  1.00 0.00 ? 69  GLU E OE1 1 
ATOM   7151  O OE2 . GLU E  5  69  ? -25.006 -45.100 25.182  1.00 0.00 ? 69  GLU E OE2 1 
ATOM   7152  N N   . ILE E  5  70  ? -27.856 -47.158 19.962  1.00 0.00 ? 70  ILE E N   1 
ATOM   7153  C CA  . ILE E  5  70  ? -27.392 -46.541 18.718  1.00 0.00 ? 70  ILE E CA  1 
ATOM   7154  C C   . ILE E  5  70  ? -27.768 -45.057 18.686  1.00 0.00 ? 70  ILE E C   1 
ATOM   7155  O O   . ILE E  5  70  ? -26.915 -44.184 18.526  1.00 0.00 ? 70  ILE E O   1 
ATOM   7156  C CB  . ILE E  5  70  ? -27.985 -47.242 17.482  1.00 0.00 ? 70  ILE E CB  1 
ATOM   7157  C CG1 . ILE E  5  70  ? -28.176 -48.735 17.757  1.00 0.00 ? 70  ILE E CG1 1 
ATOM   7158  C CG2 . ILE E  5  70  ? -27.093 -47.028 16.269  1.00 0.00 ? 70  ILE E CG2 1 
ATOM   7159  C CD1 . ILE E  5  70  ? -26.891 -49.533 17.714  1.00 0.00 ? 70  ILE E CD1 1 
ATOM   7160  N N   . ASP E  5  71  ? -29.061 -44.796 18.855  1.00 0.00 ? 71  ASP E N   1 
ATOM   7161  C CA  . ASP E  5  71  ? -29.598 -43.497 19.101  1.00 0.00 ? 71  ASP E CA  1 
ATOM   7162  C C   . ASP E  5  71  ? -30.309 -43.671 20.383  1.00 0.00 ? 71  ASP E C   1 
ATOM   7163  O O   . ASP E  5  71  ? -30.295 -44.742 20.977  1.00 0.00 ? 71  ASP E O   1 
ATOM   7164  C CB  . ASP E  5  71  ? -30.636 -43.039 18.057  1.00 0.00 ? 71  ASP E CB  1 
ATOM   7165  C CG  . ASP E  5  71  ? -29.955 -42.677 16.745  1.00 0.00 ? 71  ASP E CG  1 
ATOM   7166  O OD1 . ASP E  5  71  ? -29.077 -41.771 16.746  1.00 0.00 ? 71  ASP E OD1 1 
ATOM   7167  O OD2 . ASP E  5  71  ? -30.343 -43.292 15.717  1.00 0.00 ? 71  ASP E OD2 1 
ATOM   7168  N N   . ALA E  5  72  ? -30.979 -42.605 20.831  1.00 0.00 ? 72  ALA E N   1 
ATOM   7169  C CA  . ALA E  5  72  ? -31.758 -42.609 22.025  1.00 0.00 ? 72  ALA E CA  1 
ATOM   7170  C C   . ALA E  5  72  ? -33.035 -43.388 21.794  1.00 0.00 ? 72  ALA E C   1 
ATOM   7171  O O   . ALA E  5  72  ? -33.635 -43.892 22.744  1.00 0.00 ? 72  ALA E O   1 
ATOM   7172  C CB  . ALA E  5  72  ? -32.124 -41.180 22.446  1.00 0.00 ? 72  ALA E CB  1 
ATOM   7173  N N   . HIS E  5  73  ? -33.431 -43.495 20.524  1.00 0.00 ? 73  HIS E N   1 
ATOM   7174  C CA  . HIS E  5  73  ? -34.606 -44.273 20.120  1.00 0.00 ? 73  HIS E CA  1 
ATOM   7175  C C   . HIS E  5  73  ? -34.354 -45.682 19.540  1.00 0.00 ? 73  HIS E C   1 
ATOM   7176  O O   . HIS E  5  73  ? -35.288 -46.477 19.447  1.00 0.00 ? 73  HIS E O   1 
ATOM   7177  C CB  . HIS E  5  73  ? -35.461 -43.463 19.141  1.00 0.00 ? 73  HIS E CB  1 
ATOM   7178  C CG  . HIS E  5  73  ? -34.925 -43.442 17.744  1.00 0.00 ? 73  HIS E CG  1 
ATOM   7179  N ND1 . HIS E  5  73  ? -33.758 -42.791 17.404  1.00 0.00 ? 73  HIS E ND1 1 
ATOM   7180  C CD2 . HIS E  5  73  ? -35.395 -43.993 16.599  1.00 0.00 ? 73  HIS E CD2 1 
ATOM   7181  C CE1 . HIS E  5  73  ? -33.533 -42.941 16.111  1.00 0.00 ? 73  HIS E CE1 1 
ATOM   7182  N NE2 . HIS E  5  73  ? -34.512 -43.666 15.599  1.00 0.00 ? 73  HIS E NE2 1 
ATOM   7183  N N   . ILE E  5  74  ? -33.117 -46.000 19.155  1.00 0.00 ? 74  ILE E N   1 
ATOM   7184  C CA  . ILE E  5  74  ? -32.822 -47.322 18.631  1.00 0.00 ? 74  ILE E CA  1 
ATOM   7185  C C   . ILE E  5  74  ? -31.890 -48.096 19.512  1.00 0.00 ? 74  ILE E C   1 
ATOM   7186  O O   . ILE E  5  74  ? -30.759 -47.687 19.705  1.00 0.00 ? 74  ILE E O   1 
ATOM   7187  C CB  . ILE E  5  74  ? -32.210 -47.273 17.244  1.00 0.00 ? 74  ILE E CB  1 
ATOM   7188  C CG1 . ILE E  5  74  ? -33.103 -46.470 16.298  1.00 0.00 ? 74  ILE E CG1 1 
ATOM   7189  C CG2 . ILE E  5  74  ? -32.012 -48.710 16.715  1.00 0.00 ? 74  ILE E CG2 1 
ATOM   7190  C CD1 . ILE E  5  74  ? -32.632 -46.529 14.851  1.00 0.00 ? 74  ILE E CD1 1 
ATOM   7191  N N   . GLY E  5  75  ? -32.320 -49.258 20.056  1.00 0.00 ? 75  GLY E N   1 
ATOM   7192  C CA  . GLY E  5  75  ? -31.411 -50.198 20.689  1.00 0.00 ? 75  GLY E CA  1 
ATOM   7193  C C   . GLY E  5  75  ? -30.898 -51.161 19.653  1.00 0.00 ? 75  GLY E C   1 
ATOM   7194  O O   . GLY E  5  75  ? -31.450 -51.226 18.562  1.00 0.00 ? 75  GLY E O   1 
ATOM   7195  N N   . CYS E  5  76  ? -29.834 -51.941 19.959  1.00 0.00 ? 76  CYS E N   1 
ATOM   7196  C CA  . CYS E  5  76  ? -29.204 -52.852 19.030  1.00 0.00 ? 76  CYS E CA  1 
ATOM   7197  C C   . CYS E  5  76  ? -28.632 -54.053 19.744  1.00 0.00 ? 76  CYS E C   1 
ATOM   7198  O O   . CYS E  5  76  ? -27.541 -53.959 20.292  1.00 0.00 ? 76  CYS E O   1 
ATOM   7199  C CB  . CYS E  5  76  ? -28.105 -52.141 18.229  1.00 0.00 ? 76  CYS E CB  1 
ATOM   7200  S SG  . CYS E  5  76  ? -27.187 -53.191 17.076  1.00 0.00 ? 76  CYS E SG  1 
ATOM   7201  N N   . ALA E  5  77  ? -29.319 -55.208 19.782  1.00 0.00 ? 77  ALA E N   1 
ATOM   7202  C CA  . ALA E  5  77  ? -28.786 -56.461 20.286  1.00 0.00 ? 77  ALA E CA  1 
ATOM   7203  C C   . ALA E  5  77  ? -27.916 -57.084 19.246  1.00 0.00 ? 77  ALA E C   1 
ATOM   7204  O O   . ALA E  5  77  ? -28.069 -56.752 18.080  1.00 0.00 ? 77  ALA E O   1 
ATOM   7205  C CB  . ALA E  5  77  ? -29.835 -57.484 20.743  1.00 0.00 ? 77  ALA E CB  1 
ATOM   7206  N N   . MET E  5  78  ? -26.958 -57.968 19.628  1.00 0.00 ? 78  MET E N   1 
ATOM   7207  C CA  . MET E  5  78  ? -26.022 -58.563 18.693  1.00 0.00 ? 78  MET E CA  1 
ATOM   7208  C C   . MET E  5  78  ? -25.855 -60.019 19.066  1.00 0.00 ? 78  MET E C   1 
ATOM   7209  O O   . MET E  5  78  ? -26.196 -60.442 20.167  1.00 0.00 ? 78  MET E O   1 
ATOM   7210  C CB  . MET E  5  78  ? -24.613 -57.905 18.789  1.00 0.00 ? 78  MET E CB  1 
ATOM   7211  C CG  . MET E  5  78  ? -23.852 -58.216 20.110  1.00 0.00 ? 78  MET E CG  1 
ATOM   7212  S SD  . MET E  5  78  ? -22.454 -57.134 20.568  1.00 0.00 ? 78  MET E SD  1 
ATOM   7213  C CE  . MET E  5  78  ? -23.300 -55.584 21.000  1.00 0.00 ? 78  MET E CE  1 
ATOM   7214  N N   . SER E  5  79  ? -25.357 -60.832 18.108  1.00 0.00 ? 79  SER E N   1 
ATOM   7215  C CA  . SER E  5  79  ? -25.172 -62.259 18.241  1.00 0.00 ? 79  SER E CA  1 
ATOM   7216  C C   . SER E  5  79  ? -24.164 -62.662 17.206  1.00 0.00 ? 79  SER E C   1 
ATOM   7217  O O   . SER E  5  79  ? -23.887 -61.911 16.281  1.00 0.00 ? 79  SER E O   1 
ATOM   7218  C CB  . SER E  5  79  ? -26.458 -63.070 18.003  1.00 0.00 ? 79  SER E CB  1 
ATOM   7219  O OG  . SER E  5  79  ? -26.289 -64.458 18.247  1.00 0.00 ? 79  SER E OG  1 
ATOM   7220  N N   . GLY E  5  80  ? -23.585 -63.870 17.354  1.00 0.00 ? 80  GLY E N   1 
ATOM   7221  C CA  . GLY E  5  80  ? -22.583 -64.413 16.489  1.00 0.00 ? 80  GLY E CA  1 
ATOM   7222  C C   . GLY E  5  80  ? -21.258 -64.010 17.013  1.00 0.00 ? 80  GLY E C   1 
ATOM   7223  O O   . GLY E  5  80  ? -20.933 -64.352 18.147  1.00 0.00 ? 80  GLY E O   1 
ATOM   7224  N N   . LEU E  5  81  ? -20.429 -63.354 16.168  1.00 0.00 ? 81  LEU E N   1 
ATOM   7225  C CA  . LEU E  5  81  ? -19.080 -62.977 16.508  1.00 0.00 ? 81  LEU E CA  1 
ATOM   7226  C C   . LEU E  5  81  ? -19.097 -61.630 17.140  1.00 0.00 ? 81  LEU E C   1 
ATOM   7227  O O   . LEU E  5  81  ? -19.259 -60.622 16.465  1.00 0.00 ? 81  LEU E O   1 
ATOM   7228  C CB  . LEU E  5  81  ? -18.163 -62.932 15.276  1.00 0.00 ? 81  LEU E CB  1 
ATOM   7229  C CG  . LEU E  5  81  ? -18.036 -64.285 14.544  1.00 0.00 ? 81  LEU E CG  1 
ATOM   7230  C CD1 . LEU E  5  81  ? -17.098 -64.143 13.340  1.00 0.00 ? 81  LEU E CD1 1 
ATOM   7231  C CD2 . LEU E  5  81  ? -17.599 -65.447 15.455  1.00 0.00 ? 81  LEU E CD2 1 
ATOM   7232  N N   . ILE E  5  82  ? -18.963 -61.616 18.486  1.00 0.00 ? 82  ILE E N   1 
ATOM   7233  C CA  . ILE E  5  82  ? -19.196 -60.476 19.335  1.00 0.00 ? 82  ILE E CA  1 
ATOM   7234  C C   . ILE E  5  82  ? -18.244 -59.350 19.039  1.00 0.00 ? 82  ILE E C   1 
ATOM   7235  O O   . ILE E  5  82  ? -18.646 -58.188 19.030  1.00 0.00 ? 82  ILE E O   1 
ATOM   7236  C CB  . ILE E  5  82  ? -19.096 -60.856 20.814  1.00 0.00 ? 82  ILE E CB  1 
ATOM   7237  C CG1 . ILE E  5  82  ? -19.961 -62.096 21.144  1.00 0.00 ? 82  ILE E CG1 1 
ATOM   7238  C CG2 . ILE E  5  82  ? -19.541 -59.673 21.703  1.00 0.00 ? 82  ILE E CG2 1 
ATOM   7239  C CD1 . ILE E  5  82  ? -19.212 -63.435 21.109  1.00 0.00 ? 82  ILE E CD1 1 
ATOM   7240  N N   . ALA E  5  83  ? -16.967 -59.678 18.727  1.00 0.00 ? 83  ALA E N   1 
ATOM   7241  C CA  . ALA E  5  83  ? -15.967 -58.690 18.412  1.00 0.00 ? 83  ALA E CA  1 
ATOM   7242  C C   . ALA E  5  83  ? -16.236 -57.955 17.122  1.00 0.00 ? 83  ALA E C   1 
ATOM   7243  O O   . ALA E  5  83  ? -16.004 -56.757 16.996  1.00 0.00 ? 83  ALA E O   1 
ATOM   7244  C CB  . ALA E  5  83  ? -14.591 -59.352 18.268  1.00 0.00 ? 83  ALA E CB  1 
ATOM   7245  N N   . ASP E  5  84  ? -16.756 -58.680 16.123  1.00 0.00 ? 84  ASP E N   1 
ATOM   7246  C CA  . ASP E  5  84  ? -16.994 -58.175 14.804  1.00 0.00 ? 84  ASP E CA  1 
ATOM   7247  C C   . ASP E  5  84  ? -18.126 -57.215 14.819  1.00 0.00 ? 84  ASP E C   1 
ATOM   7248  O O   . ASP E  5  84  ? -18.212 -56.352 13.954  1.00 0.00 ? 84  ASP E O   1 
ATOM   7249  C CB  . ASP E  5  84  ? -17.325 -59.291 13.786  1.00 0.00 ? 84  ASP E CB  1 
ATOM   7250  C CG  . ASP E  5  84  ? -16.125 -60.195 13.478  1.00 0.00 ? 84  ASP E CG  1 
ATOM   7251  O OD1 . ASP E  5  84  ? -15.035 -60.023 14.085  1.00 0.00 ? 84  ASP E OD1 1 
ATOM   7252  O OD2 . ASP E  5  84  ? -16.298 -61.081 12.599  1.00 0.00 ? 84  ASP E OD2 1 
ATOM   7253  N N   . ALA E  5  85  ? -19.048 -57.365 15.794  1.00 0.00 ? 85  ALA E N   1 
ATOM   7254  C CA  . ALA E  5  85  ? -20.285 -56.624 15.842  1.00 0.00 ? 85  ALA E CA  1 
ATOM   7255  C C   . ALA E  5  85  ? -20.056 -55.168 16.047  1.00 0.00 ? 85  ALA E C   1 
ATOM   7256  O O   . ALA E  5  85  ? -20.735 -54.350 15.438  1.00 0.00 ? 85  ALA E O   1 
ATOM   7257  C CB  . ALA E  5  85  ? -21.192 -57.120 16.984  1.00 0.00 ? 85  ALA E CB  1 
ATOM   7258  N N   . LYS E  5  86  ? -19.032 -54.839 16.863  1.00 0.00 ? 86  LYS E N   1 
ATOM   7259  C CA  . LYS E  5  86  ? -18.767 -53.519 17.343  1.00 0.00 ? 86  LYS E CA  1 
ATOM   7260  C C   . LYS E  5  86  ? -18.292 -52.593 16.273  1.00 0.00 ? 86  LYS E C   1 
ATOM   7261  O O   . LYS E  5  86  ? -18.478 -51.390 16.376  1.00 0.00 ? 86  LYS E O   1 
ATOM   7262  C CB  . LYS E  5  86  ? -17.764 -53.538 18.505  1.00 0.00 ? 86  LYS E CB  1 
ATOM   7263  C CG  . LYS E  5  86  ? -18.301 -54.401 19.658  1.00 0.00 ? 86  LYS E CG  1 
ATOM   7264  C CD  . LYS E  5  86  ? -17.615 -54.160 21.010  1.00 0.00 ? 86  LYS E CD  1 
ATOM   7265  C CE  . LYS E  5  86  ? -18.291 -54.957 22.136  1.00 0.00 ? 86  LYS E CE  1 
ATOM   7266  N NZ  . LYS E  5  86  ? -17.722 -54.621 23.461  1.00 0.00 ? 86  LYS E NZ  1 
ATOM   7267  N N   . THR E  5  87  ? -17.709 -53.113 15.180  1.00 0.00 ? 87  THR E N   1 
ATOM   7268  C CA  . THR E  5  87  ? -17.368 -52.293 14.053  1.00 0.00 ? 87  THR E CA  1 
ATOM   7269  C C   . THR E  5  87  ? -18.602 -51.763 13.360  1.00 0.00 ? 87  THR E C   1 
ATOM   7270  O O   . THR E  5  87  ? -18.724 -50.556 13.172  1.00 0.00 ? 87  THR E O   1 
ATOM   7271  C CB  . THR E  5  87  ? -16.452 -53.010 13.069  1.00 0.00 ? 87  THR E CB  1 
ATOM   7272  O OG1 . THR E  5  87  ? -17.015 -54.201 12.546  1.00 0.00 ? 87  THR E OG1 1 
ATOM   7273  C CG2 . THR E  5  87  ? -15.127 -53.361 13.773  1.00 0.00 ? 87  THR E CG2 1 
ATOM   7274  N N   . LEU E  5  88  ? -19.564 -52.650 13.002  1.00 0.00 ? 88  LEU E N   1 
ATOM   7275  C CA  . LEU E  5  88  ? -20.817 -52.312 12.365  1.00 0.00 ? 88  LEU E CA  1 
ATOM   7276  C C   . LEU E  5  88  ? -21.705 -51.483 13.238  1.00 0.00 ? 88  LEU E C   1 
ATOM   7277  O O   . LEU E  5  88  ? -22.460 -50.663 12.730  1.00 0.00 ? 88  LEU E O   1 
ATOM   7278  C CB  . LEU E  5  88  ? -21.636 -53.549 11.951  1.00 0.00 ? 88  LEU E CB  1 
ATOM   7279  C CG  . LEU E  5  88  ? -21.044 -54.351 10.767  1.00 0.00 ? 88  LEU E CG  1 
ATOM   7280  C CD1 . LEU E  5  88  ? -21.908 -55.592 10.481  1.00 0.00 ? 88  LEU E CD1 1 
ATOM   7281  C CD2 . LEU E  5  88  ? -20.892 -53.507 9.483   1.00 0.00 ? 88  LEU E CD2 1 
ATOM   7282  N N   . ILE E  5  89  ? -21.628 -51.663 14.572  1.00 0.00 ? 89  ILE E N   1 
ATOM   7283  C CA  . ILE E  5  89  ? -22.360 -50.905 15.554  1.00 0.00 ? 89  ILE E CA  1 
ATOM   7284  C C   . ILE E  5  89  ? -21.864 -49.508 15.603  1.00 0.00 ? 89  ILE E C   1 
ATOM   7285  O O   . ILE E  5  89  ? -22.662 -48.582 15.615  1.00 0.00 ? 89  ILE E O   1 
ATOM   7286  C CB  . ILE E  5  89  ? -22.224 -51.547 16.911  1.00 0.00 ? 89  ILE E CB  1 
ATOM   7287  C CG1 . ILE E  5  89  ? -23.180 -52.761 16.967  1.00 0.00 ? 89  ILE E CG1 1 
ATOM   7288  C CG2 . ILE E  5  89  ? -22.495 -50.571 18.080  1.00 0.00 ? 89  ILE E CG2 1 
ATOM   7289  C CD1 . ILE E  5  89  ? -22.842 -53.778 18.059  1.00 0.00 ? 89  ILE E CD1 1 
ATOM   7290  N N   . ASP E  5  90  ? -20.532 -49.297 15.651  1.00 0.00 ? 90  ASP E N   1 
ATOM   7291  C CA  . ASP E  5  90  ? -19.977 -47.971 15.754  1.00 0.00 ? 90  ASP E CA  1 
ATOM   7292  C C   . ASP E  5  90  ? -20.270 -47.228 14.511  1.00 0.00 ? 90  ASP E C   1 
ATOM   7293  O O   . ASP E  5  90  ? -20.623 -46.059 14.574  1.00 0.00 ? 90  ASP E O   1 
ATOM   7294  C CB  . ASP E  5  90  ? -18.459 -47.898 16.042  1.00 0.00 ? 90  ASP E CB  1 
ATOM   7295  C CG  . ASP E  5  90  ? -18.156 -48.306 17.490  1.00 0.00 ? 90  ASP E CG  1 
ATOM   7296  O OD1 . ASP E  5  90  ? -18.811 -47.770 18.423  1.00 0.00 ? 90  ASP E OD1 1 
ATOM   7297  O OD2 . ASP E  5  90  ? -17.240 -49.150 17.683  1.00 0.00 ? 90  ASP E OD2 1 
ATOM   7298  N N   . LYS E  5  91  ? -20.148 -47.874 13.343  1.00 0.00 ? 91  LYS E N   1 
ATOM   7299  C CA  . LYS E  5  91  ? -20.479 -47.237 12.100  1.00 0.00 ? 91  LYS E CA  1 
ATOM   7300  C C   . LYS E  5  91  ? -21.935 -46.907 11.983  1.00 0.00 ? 91  LYS E C   1 
ATOM   7301  O O   . LYS E  5  91  ? -22.285 -45.930 11.332  1.00 0.00 ? 91  LYS E O   1 
ATOM   7302  C CB  . LYS E  5  91  ? -20.043 -48.053 10.879  1.00 0.00 ? 91  LYS E CB  1 
ATOM   7303  C CG  . LYS E  5  91  ? -18.512 -48.185 10.758  1.00 0.00 ? 91  LYS E CG  1 
ATOM   7304  C CD  . LYS E  5  91  ? -17.730 -46.860 10.651  1.00 0.00 ? 91  LYS E CD  1 
ATOM   7305  C CE  . LYS E  5  91  ? -18.146 -45.976 9.464   1.00 0.00 ? 91  LYS E CE  1 
ATOM   7306  N NZ  . LYS E  5  91  ? -17.331 -44.740 9.413   1.00 0.00 ? 91  LYS E NZ  1 
ATOM   7307  N N   . ALA E  5  92  ? -22.833 -47.684 12.616  1.00 0.00 ? 92  ALA E N   1 
ATOM   7308  C CA  . ALA E  5  92  ? -24.236 -47.350 12.662  1.00 0.00 ? 92  ALA E CA  1 
ATOM   7309  C C   . ALA E  5  92  ? -24.520 -46.091 13.441  1.00 0.00 ? 92  ALA E C   1 
ATOM   7310  O O   . ALA E  5  92  ? -25.343 -45.284 13.042  1.00 0.00 ? 92  ALA E O   1 
ATOM   7311  C CB  . ALA E  5  92  ? -25.079 -48.471 13.287  1.00 0.00 ? 92  ALA E CB  1 
ATOM   7312  N N   . ARG E  5  93  ? -23.813 -45.859 14.554  1.00 0.00 ? 93  ARG E N   1 
ATOM   7313  C CA  . ARG E  5  93  ? -23.915 -44.661 15.340  1.00 0.00 ? 93  ARG E CA  1 
ATOM   7314  C C   . ARG E  5  93  ? -23.436 -43.453 14.593  1.00 0.00 ? 93  ARG E C   1 
ATOM   7315  O O   . ARG E  5  93  ? -24.038 -42.387 14.682  1.00 0.00 ? 93  ARG E O   1 
ATOM   7316  C CB  . ARG E  5  93  ? -23.105 -44.789 16.622  1.00 0.00 ? 93  ARG E CB  1 
ATOM   7317  C CG  . ARG E  5  93  ? -23.716 -45.817 17.573  1.00 0.00 ? 93  ARG E CG  1 
ATOM   7318  C CD  . ARG E  5  93  ? -22.654 -46.389 18.497  1.00 0.00 ? 93  ARG E CD  1 
ATOM   7319  N NE  . ARG E  5  93  ? -23.278 -46.751 19.785  1.00 0.00 ? 93  ARG E NE  1 
ATOM   7320  C CZ  . ARG E  5  93  ? -22.561 -47.368 20.760  1.00 0.00 ? 93  ARG E CZ  1 
ATOM   7321  N NH1 . ARG E  5  93  ? -21.333 -47.886 20.494  1.00 0.00 ? 93  ARG E NH1 1 
ATOM   7322  N NH2 . ARG E  5  93  ? -23.077 -47.466 22.016  1.00 0.00 ? 93  ARG E NH2 1 
ATOM   7323  N N   . VAL E  5  94  ? -22.354 -43.597 13.801  1.00 0.00 ? 94  VAL E N   1 
ATOM   7324  C CA  . VAL E  5  94  ? -21.827 -42.537 12.976  1.00 0.00 ? 94  VAL E CA  1 
ATOM   7325  C C   . VAL E  5  94  ? -22.821 -42.158 11.901  1.00 0.00 ? 94  VAL E C   1 
ATOM   7326  O O   . VAL E  5  94  ? -22.963 -40.993 11.557  1.00 0.00 ? 94  VAL E O   1 
ATOM   7327  C CB  . VAL E  5  94  ? -20.508 -42.975 12.347  1.00 0.00 ? 94  VAL E CB  1 
ATOM   7328  C CG1 . VAL E  5  94  ? -19.990 -41.990 11.278  1.00 0.00 ? 94  VAL E CG1 1 
ATOM   7329  C CG2 . VAL E  5  94  ? -19.462 -43.151 13.464  1.00 0.00 ? 94  VAL E CG2 1 
ATOM   7330  N N   . GLU E  5  95  ? -23.562 -43.131 11.353  1.00 0.00 ? 95  GLU E N   1 
ATOM   7331  C CA  . GLU E  5  95  ? -24.538 -42.911 10.324  1.00 0.00 ? 95  GLU E CA  1 
ATOM   7332  C C   . GLU E  5  95  ? -25.732 -42.188 10.826  1.00 0.00 ? 95  GLU E C   1 
ATOM   7333  O O   . GLU E  5  95  ? -26.251 -41.310 10.144  1.00 0.00 ? 95  GLU E O   1 
ATOM   7334  C CB  . GLU E  5  95  ? -25.009 -44.226 9.676   1.00 0.00 ? 95  GLU E CB  1 
ATOM   7335  C CG  . GLU E  5  95  ? -24.022 -44.750 8.626   1.00 0.00 ? 95  GLU E CG  1 
ATOM   7336  C CD  . GLU E  5  95  ? -24.002 -43.775 7.452   1.00 0.00 ? 95  GLU E CD  1 
ATOM   7337  O OE1 . GLU E  5  95  ? -25.080 -43.598 6.823   1.00 0.00 ? 95  GLU E OE1 1 
ATOM   7338  O OE2 . GLU E  5  95  ? -22.922 -43.187 7.179   1.00 0.00 ? 95  GLU E OE2 1 
ATOM   7339  N N   . THR E  5  96  ? -26.221 -42.560 12.025  1.00 0.00 ? 96  THR E N   1 
ATOM   7340  C CA  . THR E  5  96  ? -27.374 -41.941 12.602  1.00 0.00 ? 96  THR E CA  1 
ATOM   7341  C C   . THR E  5  96  ? -27.152 -40.521 12.988  1.00 0.00 ? 96  THR E C   1 
ATOM   7342  O O   . THR E  5  96  ? -27.996 -39.682 12.705  1.00 0.00 ? 96  THR E O   1 
ATOM   7343  C CB  . THR E  5  96  ? -27.888 -42.679 13.795  1.00 0.00 ? 96  THR E CB  1 
ATOM   7344  O OG1 . THR E  5  96  ? -26.914 -42.824 14.811  1.00 0.00 ? 96  THR E OG1 1 
ATOM   7345  C CG2 . THR E  5  96  ? -28.374 -44.055 13.330  1.00 0.00 ? 96  THR E CG2 1 
ATOM   7346  N N   . GLN E  5  97  ? -25.989 -40.203 13.597  1.00 0.00 ? 97  GLN E N   1 
ATOM   7347  C CA  . GLN E  5  97  ? -25.628 -38.847 13.917  1.00 0.00 ? 97  GLN E CA  1 
ATOM   7348  C C   . GLN E  5  97  ? -25.375 -38.043 12.709  1.00 0.00 ? 97  GLN E C   1 
ATOM   7349  O O   . GLN E  5  97  ? -25.590 -36.846 12.719  1.00 0.00 ? 97  GLN E O   1 
ATOM   7350  C CB  . GLN E  5  97  ? -24.404 -38.712 14.821  1.00 0.00 ? 97  GLN E CB  1 
ATOM   7351  C CG  . GLN E  5  97  ? -24.565 -39.405 16.171  1.00 0.00 ? 97  GLN E CG  1 
ATOM   7352  C CD  . GLN E  5  97  ? -25.848 -38.918 16.818  1.00 0.00 ? 97  GLN E CD  1 
ATOM   7353  O OE1 . GLN E  5  97  ? -26.050 -37.713 16.995  1.00 0.00 ? 97  GLN E OE1 1 
ATOM   7354  N NE2 . GLN E  5  97  ? -26.736 -39.900 17.149  1.00 0.00 ? 97  GLN E NE2 1 
ATOM   7355  N N   . ASN E  5  98  ? -24.881 -38.649 11.630  1.00 0.00 ? 98  ASN E N   1 
ATOM   7356  C CA  . ASN E  5  98  ? -24.717 -37.951 10.393  1.00 0.00 ? 98  ASN E CA  1 
ATOM   7357  C C   . ASN E  5  98  ? -26.042 -37.570 9.802   1.00 0.00 ? 98  ASN E C   1 
ATOM   7358  O O   . ASN E  5  98  ? -26.147 -36.502 9.214   1.00 0.00 ? 98  ASN E O   1 
ATOM   7359  C CB  . ASN E  5  98  ? -23.945 -38.897 9.437   1.00 0.00 ? 98  ASN E CB  1 
ATOM   7360  C CG  . ASN E  5  98  ? -23.739 -38.429 7.994   1.00 0.00 ? 98  ASN E CG  1 
ATOM   7361  O OD1 . ASN E  5  98  ? -22.633 -38.015 7.635   1.00 0.00 ? 98  ASN E OD1 1 
ATOM   7362  N ND2 . ASN E  5  98  ? -24.806 -38.553 7.151   1.00 0.00 ? 98  ASN E ND2 1 
ATOM   7363  N N   . HIS E  5  99  ? -27.041 -38.435 9.962   1.00 0.00 ? 99  HIS E N   1 
ATOM   7364  C CA  . HIS E  5  99  ? -28.409 -38.133 9.555   1.00 0.00 ? 99  HIS E CA  1 
ATOM   7365  C C   . HIS E  5  99  ? -28.997 -36.970 10.354  1.00 0.00 ? 99  HIS E C   1 
ATOM   7366  O O   . HIS E  5  99  ? -29.675 -36.107 9.796   1.00 0.00 ? 99  HIS E O   1 
ATOM   7367  C CB  . HIS E  5  99  ? -29.295 -39.372 9.702   1.00 0.00 ? 99  HIS E CB  1 
ATOM   7368  C CG  . HIS E  5  99  ? -30.721 -39.146 9.306   1.00 0.00 ? 99  HIS E CG  1 
ATOM   7369  N ND1 . HIS E  5  99  ? -31.139 -39.151 7.992   1.00 0.00 ? 99  HIS E ND1 1 
ATOM   7370  C CD2 . HIS E  5  99  ? -31.826 -38.906 10.051  1.00 0.00 ? 99  HIS E CD2 1 
ATOM   7371  C CE1 . HIS E  5  99  ? -32.439 -38.925 7.945   1.00 0.00 ? 99  HIS E CE1 1 
ATOM   7372  N NE2 . HIS E  5  99  ? -32.881 -38.773 9.181   1.00 0.00 ? 99  HIS E NE2 1 
ATOM   7373  N N   . TRP E  5  100 ? -28.731 -36.963 11.656  1.00 0.00 ? 100 TRP E N   1 
ATOM   7374  C CA  . TRP E  5  100 ? -29.178 -35.884 12.528  1.00 0.00 ? 100 TRP E CA  1 
ATOM   7375  C C   . TRP E  5  100 ? -28.535 -34.560 12.128  1.00 0.00 ? 100 TRP E C   1 
ATOM   7376  O O   . TRP E  5  100 ? -29.188 -33.517 12.133  1.00 0.00 ? 100 TRP E O   1 
ATOM   7377  C CB  . TRP E  5  100 ? -28.855 -36.206 13.988  1.00 0.00 ? 100 TRP E CB  1 
ATOM   7378  C CG  . TRP E  5  100 ? -29.411 -35.210 14.959  1.00 0.00 ? 100 TRP E CG  1 
ATOM   7379  C CD1 . TRP E  5  100 ? -30.420 -35.415 15.854  1.00 0.00 ? 100 TRP E CD1 1 
ATOM   7380  C CD2 . TRP E  5  100 ? -28.987 -33.852 15.133  1.00 0.00 ? 100 TRP E CD2 1 
ATOM   7381  N NE1 . TRP E  5  100 ? -30.652 -34.268 16.575  1.00 0.00 ? 100 TRP E NE1 1 
ATOM   7382  C CE2 . TRP E  5  100 ? -29.785 -33.295 16.151  1.00 0.00 ? 100 TRP E CE2 1 
ATOM   7383  C CE3 . TRP E  5  100 ? -28.011 -33.055 14.527  1.00 0.00 ? 100 TRP E CE3 1 
ATOM   7384  C CZ2 . TRP E  5  100 ? -29.638 -31.975 16.577  1.00 0.00 ? 100 TRP E CZ2 1 
ATOM   7385  C CZ3 . TRP E  5  100 ? -27.867 -31.746 14.951  1.00 0.00 ? 100 TRP E CZ3 1 
ATOM   7386  C CH2 . TRP E  5  100 ? -28.676 -31.220 15.966  1.00 0.00 ? 100 TRP E CH2 1 
ATOM   7387  N N   . PHE E  5  101 ? -27.252 -34.609 11.782  1.00 0.00 ? 101 PHE E N   1 
ATOM   7388  C CA  . PHE E  5  101 ? -26.539 -33.429 11.394  1.00 0.00 ? 101 PHE E CA  1 
ATOM   7389  C C   . PHE E  5  101 ? -27.026 -32.882 10.090  1.00 0.00 ? 101 PHE E C   1 
ATOM   7390  O O   . PHE E  5  101 ? -26.964 -31.679 9.886   1.00 0.00 ? 101 PHE E O   1 
ATOM   7391  C CB  . PHE E  5  101 ? -25.046 -33.775 11.248  1.00 0.00 ? 101 PHE E CB  1 
ATOM   7392  C CG  . PHE E  5  101 ? -24.183 -32.620 10.836  1.00 0.00 ? 101 PHE E CG  1 
ATOM   7393  C CD1 . PHE E  5  101 ? -23.942 -32.354 9.477   1.00 0.00 ? 101 PHE E CD1 1 
ATOM   7394  C CD2 . PHE E  5  101 ? -23.587 -31.819 11.806  1.00 0.00 ? 101 PHE E CD2 1 
ATOM   7395  C CE1 . PHE E  5  101 ? -23.141 -31.278 9.096   1.00 0.00 ? 101 PHE E CE1 1 
ATOM   7396  C CE2 . PHE E  5  101 ? -22.772 -30.758 11.421  1.00 0.00 ? 101 PHE E CE2 1 
ATOM   7397  C CZ  . PHE E  5  101 ? -22.563 -30.475 10.071  1.00 0.00 ? 101 PHE E CZ  1 
ATOM   7398  N N   . THR E  5  102 ? -27.526 -33.710 9.169   1.00 0.00 ? 102 THR E N   1 
ATOM   7399  C CA  . THR E  5  102 ? -27.873 -33.221 7.873   1.00 0.00 ? 102 THR E CA  1 
ATOM   7400  C C   . THR E  5  102 ? -29.317 -32.901 7.860   1.00 0.00 ? 102 THR E C   1 
ATOM   7401  O O   . THR E  5  102 ? -29.700 -32.016 7.117   1.00 0.00 ? 102 THR E O   1 
ATOM   7402  C CB  . THR E  5  102 ? -27.559 -34.194 6.776   1.00 0.00 ? 102 THR E CB  1 
ATOM   7403  O OG1 . THR E  5  102 ? -26.196 -34.553 6.873   1.00 0.00 ? 102 THR E OG1 1 
ATOM   7404  C CG2 . THR E  5  102 ? -27.781 -33.562 5.389   1.00 0.00 ? 102 THR E CG2 1 
ATOM   7405  N N   . TYR E  5  103 ? -30.190 -33.579 8.635   1.00 0.00 ? 103 TYR E N   1 
ATOM   7406  C CA  . TYR E  5  103 ? -31.598 -33.324 8.450   1.00 0.00 ? 103 TYR E CA  1 
ATOM   7407  C C   . TYR E  5  103 ? -32.336 -33.070 9.721   1.00 0.00 ? 103 TYR E C   1 
ATOM   7408  O O   . TYR E  5  103 ? -33.550 -32.929 9.667   1.00 0.00 ? 103 TYR E O   1 
ATOM   7409  C CB  . TYR E  5  103 ? -32.296 -34.555 7.860   1.00 0.00 ? 103 TYR E CB  1 
ATOM   7410  C CG  . TYR E  5  103 ? -31.669 -34.958 6.586   1.00 0.00 ? 103 TYR E CG  1 
ATOM   7411  C CD1 . TYR E  5  103 ? -32.013 -34.294 5.402   1.00 0.00 ? 103 TYR E CD1 1 
ATOM   7412  C CD2 . TYR E  5  103 ? -30.759 -36.020 6.544   1.00 0.00 ? 103 TYR E CD2 1 
ATOM   7413  C CE1 . TYR E  5  103 ? -31.459 -34.690 4.184   1.00 0.00 ? 103 TYR E CE1 1 
ATOM   7414  C CE2 . TYR E  5  103 ? -30.185 -36.404 5.328   1.00 0.00 ? 103 TYR E CE2 1 
ATOM   7415  C CZ  . TYR E  5  103 ? -30.539 -35.735 4.150   1.00 0.00 ? 103 TYR E CZ  1 
ATOM   7416  O OH  . TYR E  5  103 ? -29.981 -36.121 2.921   1.00 0.00 ? 103 TYR E OH  1 
ATOM   7417  N N   . ASN E  5  104 ? -31.703 -33.193 10.874  1.00 0.00 ? 104 ASN E N   1 
ATOM   7418  C CA  . ASN E  5  104 ? -32.283 -32.722 12.132  1.00 0.00 ? 104 ASN E CA  1 
ATOM   7419  C C   . ASN E  5  104 ? -33.376 -33.648 12.670  1.00 0.00 ? 104 ASN E C   1 
ATOM   7420  O O   . ASN E  5  104 ? -33.762 -33.571 13.835  1.00 0.00 ? 104 ASN E O   1 
ATOM   7421  C CB  . ASN E  5  104 ? -32.819 -31.297 11.994  1.00 0.00 ? 104 ASN E CB  1 
ATOM   7422  C CG  . ASN E  5  104 ? -33.331 -30.739 13.309  1.00 0.00 ? 104 ASN E CG  1 
ATOM   7423  O OD1 . ASN E  5  104 ? -32.962 -31.211 14.381  1.00 0.00 ? 104 ASN E OD1 1 
ATOM   7424  N ND2 . ASN E  5  104 ? -34.184 -29.727 13.233  1.00 0.00 ? 104 ASN E ND2 1 
ATOM   7425  N N   . GLU E  5  105 ? -33.828 -34.559 11.819  1.00 0.00 ? 105 GLU E N   1 
ATOM   7426  C CA  . GLU E  5  105 ? -34.681 -35.639 12.206  1.00 0.00 ? 105 GLU E CA  1 
ATOM   7427  C C   . GLU E  5  105 ? -33.782 -36.760 12.526  1.00 0.00 ? 105 GLU E C   1 
ATOM   7428  O O   . GLU E  5  105 ? -32.677 -36.819 12.002  1.00 0.00 ? 105 GLU E O   1 
ATOM   7429  C CB  . GLU E  5  105 ? -35.657 -36.068 11.078  1.00 0.00 ? 105 GLU E CB  1 
ATOM   7430  C CG  . GLU E  5  105 ? -35.032 -35.981 9.673   1.00 0.00 ? 105 GLU E CG  1 
ATOM   7431  C CD  . GLU E  5  105 ? -35.845 -36.748 8.635   1.00 0.00 ? 105 GLU E CD  1 
ATOM   7432  O OE1 . GLU E  5  105 ? -35.776 -38.004 8.622   1.00 0.00 ? 105 GLU E OE1 1 
ATOM   7433  O OE2 . GLU E  5  105 ? -36.534 -36.080 7.825   1.00 0.00 ? 105 GLU E OE2 1 
ATOM   7434  N N   . THR E  5  106 ? -34.243 -37.672 13.402  1.00 0.00 ? 106 THR E N   1 
ATOM   7435  C CA  . THR E  5  106 ? -33.518 -38.862 13.738  1.00 0.00 ? 106 THR E CA  1 
ATOM   7436  C C   . THR E  5  106 ? -33.782 -39.907 12.700  1.00 0.00 ? 106 THR E C   1 
ATOM   7437  O O   . THR E  5  106 ? -34.835 -39.942 12.068  1.00 0.00 ? 106 THR E O   1 
ATOM   7438  C CB  . THR E  5  106 ? -33.867 -39.387 15.111  1.00 0.00 ? 106 THR E CB  1 
ATOM   7439  O OG1 . THR E  5  106 ? -35.271 -39.529 15.304  1.00 0.00 ? 106 THR E OG1 1 
ATOM   7440  C CG2 . THR E  5  106 ? -33.293 -38.401 16.141  1.00 0.00 ? 106 THR E CG2 1 
ATOM   7441  N N   . MET E  5  107 ? -32.758 -40.748 12.451  1.00 0.00 ? 107 MET E N   1 
ATOM   7442  C CA  . MET E  5  107 ? -32.814 -41.757 11.432  1.00 0.00 ? 107 MET E CA  1 
ATOM   7443  C C   . MET E  5  107 ? -33.649 -42.913 11.844  1.00 0.00 ? 107 MET E C   1 
ATOM   7444  O O   . MET E  5  107 ? -33.347 -43.549 12.842  1.00 0.00 ? 107 MET E O   1 
ATOM   7445  C CB  . MET E  5  107 ? -31.424 -42.282 11.068  1.00 0.00 ? 107 MET E CB  1 
ATOM   7446  C CG  . MET E  5  107 ? -31.424 -42.830 9.646   1.00 0.00 ? 107 MET E CG  1 
ATOM   7447  S SD  . MET E  5  107 ? -29.881 -43.624 9.236   1.00 0.00 ? 107 MET E SD  1 
ATOM   7448  C CE  . MET E  5  107 ? -29.877 -43.104 7.503   1.00 0.00 ? 107 MET E CE  1 
ATOM   7449  N N   . THR E  5  108 ? -34.738 -43.181 11.098  1.00 0.00 ? 108 THR E N   1 
ATOM   7450  C CA  . THR E  5  108 ? -35.655 -44.280 11.290  1.00 0.00 ? 108 THR E CA  1 
ATOM   7451  C C   . THR E  5  108 ? -34.976 -45.605 11.200  1.00 0.00 ? 108 THR E C   1 
ATOM   7452  O O   . THR E  5  108 ? -33.979 -45.712 10.501  1.00 0.00 ? 108 THR E O   1 
ATOM   7453  C CB  . THR E  5  108 ? -36.786 -44.235 10.291  1.00 0.00 ? 108 THR E CB  1 
ATOM   7454  O OG1 . THR E  5  108 ? -36.295 -44.171 8.955   1.00 0.00 ? 108 THR E OG1 1 
ATOM   7455  C CG2 . THR E  5  108 ? -37.634 -42.979 10.572  1.00 0.00 ? 108 THR E CG2 1 
ATOM   7456  N N   . VAL E  5  109 ? -35.508 -46.641 11.887  1.00 0.00 ? 109 VAL E N   1 
ATOM   7457  C CA  . VAL E  5  109 ? -34.900 -47.951 11.995  1.00 0.00 ? 109 VAL E CA  1 
ATOM   7458  C C   . VAL E  5  109 ? -34.738 -48.656 10.682  1.00 0.00 ? 109 VAL E C   1 
ATOM   7459  O O   . VAL E  5  109 ? -33.773 -49.391 10.528  1.00 0.00 ? 109 VAL E O   1 
ATOM   7460  C CB  . VAL E  5  109 ? -35.704 -48.898 12.856  1.00 0.00 ? 109 VAL E CB  1 
ATOM   7461  C CG1 . VAL E  5  109 ? -35.003 -50.248 13.083  1.00 0.00 ? 109 VAL E CG1 1 
ATOM   7462  C CG2 . VAL E  5  109 ? -35.936 -48.222 14.203  1.00 0.00 ? 109 VAL E CG2 1 
ATOM   7463  N N   . GLU E  5  110 ? -35.629 -48.442 9.684   1.00 0.00 ? 110 GLU E N   1 
ATOM   7464  C CA  . GLU E  5  110 ? -35.536 -49.085 8.396   1.00 0.00 ? 110 GLU E CA  1 
ATOM   7465  C C   . GLU E  5  110 ? -34.309 -48.700 7.649   1.00 0.00 ? 110 GLU E C   1 
ATOM   7466  O O   . GLU E  5  110 ? -33.705 -49.543 7.000   1.00 0.00 ? 110 GLU E O   1 
ATOM   7467  C CB  . GLU E  5  110 ? -36.757 -48.724 7.521   1.00 0.00 ? 110 GLU E CB  1 
ATOM   7468  C CG  . GLU E  5  110 ? -36.926 -49.485 6.177   1.00 0.00 ? 110 GLU E CG  1 
ATOM   7469  C CD  . GLU E  5  110 ? -36.108 -48.901 5.014   1.00 0.00 ? 110 GLU E CD  1 
ATOM   7470  O OE1 . GLU E  5  110 ? -36.221 -47.670 4.774   1.00 0.00 ? 110 GLU E OE1 1 
ATOM   7471  O OE2 . GLU E  5  110 ? -35.382 -49.682 4.342   1.00 0.00 ? 110 GLU E OE2 1 
ATOM   7472  N N   . SER E  5  111 ? -33.890 -47.425 7.760   1.00 0.00 ? 111 SER E N   1 
ATOM   7473  C CA  . SER E  5  111 ? -32.717 -46.921 7.097   1.00 0.00 ? 111 SER E CA  1 
ATOM   7474  C C   . SER E  5  111 ? -31.462 -47.097 7.913   1.00 0.00 ? 111 SER E C   1 
ATOM   7475  O O   . SER E  5  111 ? -30.379 -47.218 7.353   1.00 0.00 ? 111 SER E O   1 
ATOM   7476  C CB  . SER E  5  111 ? -32.886 -45.459 6.676   1.00 0.00 ? 111 SER E CB  1 
ATOM   7477  O OG  . SER E  5  111 ? -33.860 -45.372 5.650   1.00 0.00 ? 111 SER E OG  1 
ATOM   7478  N N   . VAL E  5  112 ? -31.561 -47.132 9.257   1.00 0.00 ? 112 VAL E N   1 
ATOM   7479  C CA  . VAL E  5  112 ? -30.457 -47.445 10.135  1.00 0.00 ? 112 VAL E CA  1 
ATOM   7480  C C   . VAL E  5  112 ? -29.956 -48.836 9.916   1.00 0.00 ? 112 VAL E C   1 
ATOM   7481  O O   . VAL E  5  112 ? -28.760 -49.088 10.001  1.00 0.00 ? 112 VAL E O   1 
ATOM   7482  C CB  . VAL E  5  112 ? -30.878 -47.295 11.583  1.00 0.00 ? 112 VAL E CB  1 
ATOM   7483  C CG1 . VAL E  5  112 ? -29.867 -47.873 12.592  1.00 0.00 ? 112 VAL E CG1 1 
ATOM   7484  C CG2 . VAL E  5  112 ? -31.009 -45.790 11.804  1.00 0.00 ? 112 VAL E CG2 1 
ATOM   7485  N N   . THR E  5  113 ? -30.872 -49.764 9.590   1.00 0.00 ? 113 THR E N   1 
ATOM   7486  C CA  . THR E  5  113 ? -30.596 -51.151 9.364   1.00 0.00 ? 113 THR E CA  1 
ATOM   7487  C C   . THR E  5  113 ? -30.095 -51.297 7.971   1.00 0.00 ? 113 THR E C   1 
ATOM   7488  O O   . THR E  5  113 ? -29.211 -52.101 7.713   1.00 0.00 ? 113 THR E O   1 
ATOM   7489  C CB  . THR E  5  113 ? -31.792 -52.051 9.618   1.00 0.00 ? 113 THR E CB  1 
ATOM   7490  O OG1 . THR E  5  113 ? -32.322 -51.791 10.914  1.00 0.00 ? 113 THR E OG1 1 
ATOM   7491  C CG2 . THR E  5  113 ? -31.343 -53.522 9.608   1.00 0.00 ? 113 THR E CG2 1 
ATOM   7492  N N   . GLN E  5  114 ? -30.654 -50.521 7.023   1.00 0.00 ? 114 GLN E N   1 
ATOM   7493  C CA  . GLN E  5  114 ? -30.299 -50.572 5.624   1.00 0.00 ? 114 GLN E CA  1 
ATOM   7494  C C   . GLN E  5  114 ? -28.874 -50.156 5.412   1.00 0.00 ? 114 GLN E C   1 
ATOM   7495  O O   . GLN E  5  114 ? -28.156 -50.779 4.646   1.00 0.00 ? 114 GLN E O   1 
ATOM   7496  C CB  . GLN E  5  114 ? -31.163 -49.604 4.799   1.00 0.00 ? 114 GLN E CB  1 
ATOM   7497  C CG  . GLN E  5  114 ? -30.871 -49.562 3.293   1.00 0.00 ? 114 GLN E CG  1 
ATOM   7498  C CD  . GLN E  5  114 ? -31.602 -48.361 2.695   1.00 0.00 ? 114 GLN E CD  1 
ATOM   7499  O OE1 . GLN E  5  114 ? -30.975 -47.374 2.301   1.00 0.00 ? 114 GLN E OE1 1 
ATOM   7500  N NE2 . GLN E  5  114 ? -32.965 -48.450 2.639   1.00 0.00 ? 114 GLN E NE2 1 
ATOM   7501  N N   . ALA E  5  115 ? -28.406 -49.113 6.114   1.00 0.00 ? 115 ALA E N   1 
ATOM   7502  C CA  . ALA E  5  115 ? -27.073 -48.581 5.985   1.00 0.00 ? 115 ALA E CA  1 
ATOM   7503  C C   . ALA E  5  115 ? -26.046 -49.579 6.409   1.00 0.00 ? 115 ALA E C   1 
ATOM   7504  O O   . ALA E  5  115 ? -24.935 -49.564 5.896   1.00 0.00 ? 115 ALA E O   1 
ATOM   7505  C CB  . ALA E  5  115 ? -26.873 -47.309 6.826   1.00 0.00 ? 115 ALA E CB  1 
ATOM   7506  N N   . VAL E  5  116 ? -26.391 -50.438 7.390   1.00 0.00 ? 116 VAL E N   1 
ATOM   7507  C CA  . VAL E  5  116 ? -25.532 -51.462 7.921   1.00 0.00 ? 116 VAL E CA  1 
ATOM   7508  C C   . VAL E  5  116 ? -25.550 -52.641 7.008   1.00 0.00 ? 116 VAL E C   1 
ATOM   7509  O O   . VAL E  5  116 ? -24.534 -53.303 6.858   1.00 0.00 ? 116 VAL E O   1 
ATOM   7510  C CB  . VAL E  5  116 ? -26.013 -51.884 9.299   1.00 0.00 ? 116 VAL E CB  1 
ATOM   7511  C CG1 . VAL E  5  116 ? -25.233 -53.084 9.857   1.00 0.00 ? 116 VAL E CG1 1 
ATOM   7512  C CG2 . VAL E  5  116 ? -25.859 -50.676 10.240  1.00 0.00 ? 116 VAL E CG2 1 
ATOM   7513  N N   . SER E  5  117 ? -26.672 -52.918 6.321   1.00 0.00 ? 117 SER E N   1 
ATOM   7514  C CA  . SER E  5  117 ? -26.740 -53.968 5.339   1.00 0.00 ? 117 SER E CA  1 
ATOM   7515  C C   . SER E  5  117 ? -25.882 -53.693 4.147   1.00 0.00 ? 117 SER E C   1 
ATOM   7516  O O   . SER E  5  117 ? -25.408 -54.627 3.512   1.00 0.00 ? 117 SER E O   1 
ATOM   7517  C CB  . SER E  5  117 ? -28.159 -54.212 4.807   1.00 0.00 ? 117 SER E CB  1 
ATOM   7518  O OG  . SER E  5  117 ? -28.994 -54.711 5.828   1.00 0.00 ? 117 SER E OG  1 
ATOM   7519  N N   . ASN E  5  118 ? -25.694 -52.405 3.782   1.00 0.00 ? 118 ASN E N   1 
ATOM   7520  C CA  . ASN E  5  118 ? -24.911 -51.974 2.653   1.00 0.00 ? 118 ASN E CA  1 
ATOM   7521  C C   . ASN E  5  118 ? -23.486 -52.334 2.852   1.00 0.00 ? 118 ASN E C   1 
ATOM   7522  O O   . ASN E  5  118 ? -22.791 -52.625 1.889   1.00 0.00 ? 118 ASN E O   1 
ATOM   7523  C CB  . ASN E  5  118 ? -24.939 -50.453 2.397   1.00 0.00 ? 118 ASN E CB  1 
ATOM   7524  C CG  . ASN E  5  118 ? -26.319 -49.950 1.947   1.00 0.00 ? 118 ASN E CG  1 
ATOM   7525  O OD1 . ASN E  5  118 ? -26.942 -49.128 2.629   1.00 0.00 ? 118 ASN E OD1 1 
ATOM   7526  N ND2 . ASN E  5  118 ? -26.777 -50.420 0.748   1.00 0.00 ? 118 ASN E ND2 1 
ATOM   7527  N N   . LEU E  5  119 ? -23.006 -52.334 4.107   1.00 0.00 ? 119 LEU E N   1 
ATOM   7528  C CA  . LEU E  5  119 ? -21.619 -52.589 4.393   1.00 0.00 ? 119 LEU E CA  1 
ATOM   7529  C C   . LEU E  5  119 ? -21.385 -54.065 4.561   1.00 0.00 ? 119 LEU E C   1 
ATOM   7530  O O   . LEU E  5  119 ? -20.248 -54.471 4.782   1.00 0.00 ? 119 LEU E O   1 
ATOM   7531  C CB  . LEU E  5  119 ? -21.192 -51.968 5.748   1.00 0.00 ? 119 LEU E CB  1 
ATOM   7532  C CG  . LEU E  5  119 ? -21.398 -50.445 5.845   1.00 0.00 ? 119 LEU E CG  1 
ATOM   7533  C CD1 . LEU E  5  119 ? -21.158 -49.950 7.286   1.00 0.00 ? 119 LEU E CD1 1 
ATOM   7534  C CD2 . LEU E  5  119 ? -20.531 -49.665 4.836   1.00 0.00 ? 119 LEU E CD2 1 
ATOM   7535  N N   . ALA E  5  120 ? -22.454 -54.887 4.578   1.00 0.00 ? 120 ALA E N   1 
ATOM   7536  C CA  . ALA E  5  120 ? -22.355 -56.257 4.998   1.00 0.00 ? 120 ALA E CA  1 
ATOM   7537  C C   . ALA E  5  120 ? -21.506 -57.147 4.147   1.00 0.00 ? 120 ALA E C   1 
ATOM   7538  O O   . ALA E  5  120 ? -20.757 -57.949 4.697   1.00 0.00 ? 120 ALA E O   1 
ATOM   7539  C CB  . ALA E  5  120 ? -23.731 -56.907 5.144   1.00 0.00 ? 120 ALA E CB  1 
ATOM   7540  N N   . LEU E  5  121 ? -21.637 -57.054 2.833   1.00 0.00 ? 121 LEU E N   1 
ATOM   7541  C CA  . LEU E  5  121 ? -20.890 -57.942 1.965   1.00 0.00 ? 121 LEU E CA  1 
ATOM   7542  C C   . LEU E  5  121 ? -20.186 -57.075 0.957   1.00 0.00 ? 121 LEU E C   1 
ATOM   7543  O O   . LEU E  5  121 ? -20.455 -57.124 -0.243  1.00 0.00 ? 121 LEU E O   1 
ATOM   7544  C CB  . LEU E  5  121 ? -21.832 -58.911 1.249   1.00 0.00 ? 121 LEU E CB  1 
ATOM   7545  C CG  . LEU E  5  121 ? -22.732 -59.785 2.121   1.00 0.00 ? 121 LEU E CG  1 
ATOM   7546  C CD1 . LEU E  5  121 ? -23.084 -61.070 1.392   1.00 0.00 ? 121 LEU E CD1 1 
ATOM   7547  C CD2 . LEU E  5  121 ? -22.062 -60.085 3.453   1.00 0.00 ? 121 LEU E CD2 1 
ATOM   7548  N N   . GLN E  5  122 ? -19.250 -56.289 1.468   1.00 0.00 ? 122 GLN E N   1 
ATOM   7549  C CA  . GLN E  5  122 ? -18.442 -55.450 0.632   1.00 0.00 ? 122 GLN E CA  1 
ATOM   7550  C C   . GLN E  5  122 ? -17.089 -56.035 0.379   1.00 0.00 ? 122 GLN E C   1 
ATOM   7551  O O   . GLN E  5  122 ? -16.223 -55.332 -0.132  1.00 0.00 ? 122 GLN E O   1 
ATOM   7552  C CB  . GLN E  5  122 ? -18.297 -54.041 1.226   1.00 0.00 ? 122 GLN E CB  1 
ATOM   7553  C CG  . GLN E  5  122 ? -19.633 -53.282 1.273   1.00 0.00 ? 122 GLN E CG  1 
ATOM   7554  C CD  . GLN E  5  122 ? -20.236 -53.153 -0.134  1.00 0.00 ? 122 GLN E CD  1 
ATOM   7555  O OE1 . GLN E  5  122 ? -21.295 -53.727 -0.415  1.00 0.00 ? 122 GLN E OE1 1 
ATOM   7556  N NE2 . GLN E  5  122 ? -19.534 -52.395 -1.029  1.00 0.00 ? 122 GLN E NE2 1 
ATOM   7557  N N   . PHE E  5  123 ? -16.896 -57.359 0.621   1.00 0.00 ? 123 PHE E N   1 
ATOM   7558  C CA  . PHE E  5  123 ? -15.618 -58.006 0.441   1.00 0.00 ? 123 PHE E CA  1 
ATOM   7559  C C   . PHE E  5  123 ? -15.348 -58.249 -1.021  1.00 0.00 ? 123 PHE E C   1 
ATOM   7560  O O   . PHE E  5  123 ? -15.882 -59.145 -1.677  1.00 0.00 ? 123 PHE E O   1 
ATOM   7561  C CB  . PHE E  5  123 ? -15.417 -59.343 1.205   1.00 0.00 ? 123 PHE E CB  1 
ATOM   7562  C CG  . PHE E  5  123 ? -16.581 -60.281 1.124   1.00 0.00 ? 123 PHE E CG  1 
ATOM   7563  C CD1 . PHE E  5  123 ? -17.676 -60.094 1.975   1.00 0.00 ? 123 PHE E CD1 1 
ATOM   7564  C CD2 . PHE E  5  123 ? -16.566 -61.384 0.256   1.00 0.00 ? 123 PHE E CD2 1 
ATOM   7565  C CE1 . PHE E  5  123 ? -18.749 -60.979 1.943   1.00 0.00 ? 123 PHE E CE1 1 
ATOM   7566  C CE2 . PHE E  5  123 ? -17.642 -62.274 0.226   1.00 0.00 ? 123 PHE E CE2 1 
ATOM   7567  C CZ  . PHE E  5  123 ? -18.739 -62.067 1.067   1.00 0.00 ? 123 PHE E CZ  1 
ATOM   7568  N N   . GLY E  5  124 ? -14.385 -57.460 -1.518  1.00 0.00 ? 124 GLY E N   1 
ATOM   7569  C CA  . GLY E  5  124 ? -13.824 -57.602 -2.812  1.00 0.00 ? 124 GLY E CA  1 
ATOM   7570  C C   . GLY E  5  124 ? -12.459 -57.926 -2.376  1.00 0.00 ? 124 GLY E C   1 
ATOM   7571  O O   . GLY E  5  124 ? -11.709 -57.029 -2.016  1.00 0.00 ? 124 GLY E O   1 
ATOM   7572  N N   . SER E  5  134 ? -12.071 -57.896 4.043   1.00 0.00 ? 134 SER E N   1 
ATOM   7573  C CA  . SER E  5  134 ? -11.787 -59.022 3.152   1.00 0.00 ? 134 SER E CA  1 
ATOM   7574  C C   . SER E  5  134 ? -12.701 -60.259 3.299   1.00 0.00 ? 134 SER E C   1 
ATOM   7575  O O   . SER E  5  134 ? -12.649 -61.161 2.464   1.00 0.00 ? 134 SER E O   1 
ATOM   7576  C CB  . SER E  5  134 ? -10.321 -59.442 3.251   1.00 0.00 ? 134 SER E CB  1 
ATOM   7577  O OG  . SER E  5  134 ? -9.984  -60.316 2.188   1.00 0.00 ? 134 SER E OG  1 
ATOM   7578  N N   . ARG E  5  135 ? -13.522 -60.300 4.352   1.00 0.00 ? 135 ARG E N   1 
ATOM   7579  C CA  . ARG E  5  135 ? -14.287 -61.474 4.708   1.00 0.00 ? 135 ARG E CA  1 
ATOM   7580  C C   . ARG E  5  135 ? -15.572 -60.991 5.324   1.00 0.00 ? 135 ARG E C   1 
ATOM   7581  O O   . ARG E  5  135 ? -15.548 -59.931 5.947   1.00 0.00 ? 135 ARG E O   1 
ATOM   7582  C CB  . ARG E  5  135 ? -13.587 -62.391 5.724   1.00 0.00 ? 135 ARG E CB  1 
ATOM   7583  C CG  . ARG E  5  135 ? -13.460 -61.829 7.146   1.00 0.00 ? 135 ARG E CG  1 
ATOM   7584  C CD  . ARG E  5  135 ? -12.860 -62.860 8.099   1.00 0.00 ? 135 ARG E CD  1 
ATOM   7585  N NE  . ARG E  5  135 ? -12.628 -62.266 9.436   1.00 0.00 ? 135 ARG E NE  1 
ATOM   7586  C CZ  . ARG E  5  135 ? -13.634 -62.027 10.318  1.00 0.00 ? 135 ARG E CZ  1 
ATOM   7587  N NH1 . ARG E  5  135 ? -14.901 -62.460 10.074  1.00 0.00 ? 135 ARG E NH1 1 
ATOM   7588  N NH2 . ARG E  5  135 ? -13.365 -61.338 11.462  1.00 0.00 ? 135 ARG E NH2 1 
ATOM   7589  N N   . PRO E  5  136 ? -16.666 -61.739 5.201   1.00 0.00 ? 136 PRO E N   1 
ATOM   7590  C CA  . PRO E  5  136 ? -17.975 -61.324 5.740   1.00 0.00 ? 136 PRO E CA  1 
ATOM   7591  C C   . PRO E  5  136 ? -18.091 -61.337 7.275   1.00 0.00 ? 136 PRO E C   1 
ATOM   7592  O O   . PRO E  5  136 ? -17.401 -62.120 7.929   1.00 0.00 ? 136 PRO E O   1 
ATOM   7593  C CB  . PRO E  5  136 ? -18.936 -62.351 5.136   1.00 0.00 ? 136 PRO E CB  1 
ATOM   7594  C CG  . PRO E  5  136 ? -18.094 -63.561 4.912   1.00 0.00 ? 136 PRO E CG  1 
ATOM   7595  C CD  . PRO E  5  136 ? -16.732 -63.051 4.534   1.00 0.00 ? 136 PRO E CD  1 
ATOM   7596  N N   . PHE E  5  137 ? -18.954 -60.482 7.832   1.00 0.00 ? 137 PHE E N   1 
ATOM   7597  C CA  . PHE E  5  137 ? -19.153 -60.416 9.252   1.00 0.00 ? 137 PHE E CA  1 
ATOM   7598  C C   . PHE E  5  137 ? -20.011 -61.600 9.600   1.00 0.00 ? 137 PHE E C   1 
ATOM   7599  O O   . PHE E  5  137 ? -20.745 -62.095 8.746   1.00 0.00 ? 137 PHE E O   1 
ATOM   7600  C CB  . PHE E  5  137 ? -19.903 -59.148 9.682   1.00 0.00 ? 137 PHE E CB  1 
ATOM   7601  C CG  . PHE E  5  137 ? -19.145 -57.927 9.246   1.00 0.00 ? 137 PHE E CG  1 
ATOM   7602  C CD1 . PHE E  5  137 ? -18.130 -57.389 10.048  1.00 0.00 ? 137 PHE E CD1 1 
ATOM   7603  C CD2 . PHE E  5  137 ? -19.479 -57.277 8.046   1.00 0.00 ? 137 PHE E CD2 1 
ATOM   7604  C CE1 . PHE E  5  137 ? -17.461 -56.223 9.661   1.00 0.00 ? 137 PHE E CE1 1 
ATOM   7605  C CE2 . PHE E  5  137 ? -18.818 -56.109 7.665   1.00 0.00 ? 137 PHE E CE2 1 
ATOM   7606  C CZ  . PHE E  5  137 ? -17.801 -55.588 8.466   1.00 0.00 ? 137 PHE E CZ  1 
ATOM   7607  N N   . GLY E  5  138 ? -19.885 -62.136 10.836  1.00 0.00 ? 138 GLY E N   1 
ATOM   7608  C CA  . GLY E  5  138 ? -20.671 -63.265 11.295  1.00 0.00 ? 138 GLY E CA  1 
ATOM   7609  C C   . GLY E  5  138 ? -21.853 -62.872 12.119  1.00 0.00 ? 138 GLY E C   1 
ATOM   7610  O O   . GLY E  5  138 ? -22.560 -63.725 12.639  1.00 0.00 ? 138 GLY E O   1 
ATOM   7611  N N   . VAL E  5  139 ? -22.035 -61.562 12.333  1.00 0.00 ? 139 VAL E N   1 
ATOM   7612  C CA  . VAL E  5  139 ? -22.976 -61.001 13.262  1.00 0.00 ? 139 VAL E CA  1 
ATOM   7613  C C   . VAL E  5  139 ? -24.413 -61.075 12.781  1.00 0.00 ? 139 VAL E C   1 
ATOM   7614  O O   . VAL E  5  139 ? -24.706 -60.746 11.637  1.00 0.00 ? 139 VAL E O   1 
ATOM   7615  C CB  . VAL E  5  139 ? -22.587 -59.547 13.502  1.00 0.00 ? 139 VAL E CB  1 
ATOM   7616  C CG1 . VAL E  5  139 ? -23.254 -59.005 14.774  1.00 0.00 ? 139 VAL E CG1 1 
ATOM   7617  C CG2 . VAL E  5  139 ? -21.052 -59.428 13.605  1.00 0.00 ? 139 VAL E CG2 1 
ATOM   7618  N N   . ALA E  5  140 ? -25.365 -61.417 13.677  1.00 0.00 ? 140 ALA E N   1 
ATOM   7619  C CA  . ALA E  5  140 ? -26.769 -61.140 13.479  1.00 0.00 ? 140 ALA E CA  1 
ATOM   7620  C C   . ALA E  5  140 ? -27.060 -59.980 14.367  1.00 0.00 ? 140 ALA E C   1 
ATOM   7621  O O   . ALA E  5  140 ? -26.482 -59.889 15.444  1.00 0.00 ? 140 ALA E O   1 
ATOM   7622  C CB  . ALA E  5  140 ? -27.696 -62.294 13.874  1.00 0.00 ? 140 ALA E CB  1 
ATOM   7623  N N   . LEU E  5  141 ? -27.950 -59.053 13.957  1.00 0.00 ? 141 LEU E N   1 
ATOM   7624  C CA  . LEU E  5  141 ? -28.212 -57.856 14.713  1.00 0.00 ? 141 LEU E CA  1 
ATOM   7625  C C   . LEU E  5  141 ? -29.680 -57.752 14.864  1.00 0.00 ? 141 LEU E C   1 
ATOM   7626  O O   . LEU E  5  141 ? -30.422 -58.272 14.048  1.00 0.00 ? 141 LEU E O   1 
ATOM   7627  C CB  . LEU E  5  141 ? -27.722 -56.587 13.993  1.00 0.00 ? 141 LEU E CB  1 
ATOM   7628  C CG  . LEU E  5  141 ? -26.197 -56.539 13.784  1.00 0.00 ? 141 LEU E CG  1 
ATOM   7629  C CD1 . LEU E  5  141 ? -25.810 -55.541 12.683  1.00 0.00 ? 141 LEU E CD1 1 
ATOM   7630  C CD2 . LEU E  5  141 ? -25.458 -56.226 15.097  1.00 0.00 ? 141 LEU E CD2 1 
ATOM   7631  N N   . LEU E  5  142 ? -30.131 -57.095 15.945  1.00 0.00 ? 142 LEU E N   1 
ATOM   7632  C CA  . LEU E  5  142 ? -31.521 -56.822 16.180  1.00 0.00 ? 142 LEU E CA  1 
ATOM   7633  C C   . LEU E  5  142 ? -31.633 -55.402 16.613  1.00 0.00 ? 142 LEU E C   1 
ATOM   7634  O O   . LEU E  5  142 ? -31.610 -55.088 17.798  1.00 0.00 ? 142 LEU E O   1 
ATOM   7635  C CB  . LEU E  5  142 ? -32.154 -57.611 17.340  1.00 0.00 ? 142 LEU E CB  1 
ATOM   7636  C CG  . LEU E  5  142 ? -32.407 -59.095 17.113  1.00 0.00 ? 142 LEU E CG  1 
ATOM   7637  C CD1 . LEU E  5  142 ? -32.789 -59.710 18.466  1.00 0.00 ? 142 LEU E CD1 1 
ATOM   7638  C CD2 . LEU E  5  142 ? -33.468 -59.345 16.030  1.00 0.00 ? 142 LEU E CD2 1 
ATOM   7639  N N   . PHE E  5  143 ? -31.832 -54.500 15.654  1.00 0.00 ? 143 PHE E N   1 
ATOM   7640  C CA  . PHE E  5  143 ? -32.189 -53.137 15.930  1.00 0.00 ? 143 PHE E CA  1 
ATOM   7641  C C   . PHE E  5  143 ? -33.615 -53.142 16.411  1.00 0.00 ? 143 PHE E C   1 
ATOM   7642  O O   . PHE E  5  143 ? -34.405 -53.954 15.943  1.00 0.00 ? 143 PHE E O   1 
ATOM   7643  C CB  . PHE E  5  143 ? -32.111 -52.216 14.697  1.00 0.00 ? 143 PHE E CB  1 
ATOM   7644  C CG  . PHE E  5  143 ? -30.750 -52.285 14.080  1.00 0.00 ? 143 PHE E CG  1 
ATOM   7645  C CD1 . PHE E  5  143 ? -30.365 -53.382 13.291  1.00 0.00 ? 143 PHE E CD1 1 
ATOM   7646  C CD2 . PHE E  5  143 ? -29.845 -51.242 14.284  1.00 0.00 ? 143 PHE E CD2 1 
ATOM   7647  C CE1 . PHE E  5  143 ? -29.079 -53.461 12.768  1.00 0.00 ? 143 PHE E CE1 1 
ATOM   7648  C CE2 . PHE E  5  143 ? -28.561 -51.304 13.733  1.00 0.00 ? 143 PHE E CE2 1 
ATOM   7649  C CZ  . PHE E  5  143 ? -28.176 -52.422 12.988  1.00 0.00 ? 143 PHE E CZ  1 
ATOM   7650  N N   . GLY E  5  144 ? -33.869 -52.406 17.476  1.00 0.00 ? 144 GLY E N   1 
ATOM   7651  C CA  . GLY E  5  144 ? -35.215 -52.165 17.917  1.00 0.00 ? 144 GLY E CA  1 
ATOM   7652  C C   . GLY E  5  144 ? -35.255 -50.677 18.099  1.00 0.00 ? 144 GLY E C   1 
ATOM   7653  O O   . GLY E  5  144 ? -34.484 -50.128 18.888  1.00 0.00 ? 144 GLY E O   1 
ATOM   7654  N N   . GLY E  5  145 ? -36.149 -50.008 17.395  1.00 0.00 ? 145 GLY E N   1 
ATOM   7655  C CA  . GLY E  5  145 ? -36.300 -48.605 17.655  1.00 0.00 ? 145 GLY E CA  1 
ATOM   7656  C C   . GLY E  5  145 ? -37.700 -48.194 17.423  1.00 0.00 ? 145 GLY E C   1 
ATOM   7657  O O   . GLY E  5  145 ? -38.328 -48.539 16.433  1.00 0.00 ? 145 GLY E O   1 
ATOM   7658  N N   . VAL E  5  146 ? -38.241 -47.456 18.404  1.00 0.00 ? 146 VAL E N   1 
ATOM   7659  C CA  . VAL E  5  146 ? -39.564 -46.915 18.406  1.00 0.00 ? 146 VAL E CA  1 
ATOM   7660  C C   . VAL E  5  146 ? -39.454 -45.572 17.794  1.00 0.00 ? 146 VAL E C   1 
ATOM   7661  O O   . VAL E  5  146 ? -38.921 -44.654 18.402  1.00 0.00 ? 146 VAL E O   1 
ATOM   7662  C CB  . VAL E  5  146 ? -40.155 -46.786 19.809  1.00 0.00 ? 146 VAL E CB  1 
ATOM   7663  C CG1 . VAL E  5  146 ? -41.646 -46.455 19.692  1.00 0.00 ? 146 VAL E CG1 1 
ATOM   7664  C CG2 . VAL E  5  146 ? -39.975 -48.085 20.613  1.00 0.00 ? 146 VAL E CG2 1 
ATOM   7665  N N   . ASP E  5  147 ? -40.018 -45.507 16.579  1.00 0.00 ? 147 ASP E N   1 
ATOM   7666  C CA  . ASP E  5  147 ? -39.969 -44.412 15.601  1.00 0.00 ? 147 ASP E CA  1 
ATOM   7667  C C   . ASP E  5  147 ? -41.395 -44.133 15.098  1.00 0.00 ? 147 ASP E C   1 
ATOM   7668  O O   . ASP E  5  147 ? -42.295 -44.946 15.310  1.00 0.00 ? 147 ASP E O   1 
ATOM   7669  C CB  . ASP E  5  147 ? -39.052 -44.770 14.432  1.00 0.00 ? 147 ASP E CB  1 
ATOM   7670  C CG  . ASP E  5  147 ? -39.695 -45.746 13.465  1.00 0.00 ? 147 ASP E CG  1 
ATOM   7671  O OD1 . ASP E  5  147 ? -40.600 -46.494 13.888  1.00 0.00 ? 147 ASP E OD1 1 
ATOM   7672  O OD2 . ASP E  5  147 ? -39.294 -45.762 12.282  1.00 0.00 ? 147 ASP E OD2 1 
ATOM   7673  N N   . GLU E  5  148 ? -41.606 -42.981 14.460  1.00 0.00 ? 148 GLU E N   1 
ATOM   7674  C CA  . GLU E  5  148 ? -42.838 -42.258 14.575  1.00 0.00 ? 148 GLU E CA  1 
ATOM   7675  C C   . GLU E  5  148 ? -43.948 -43.266 14.312  1.00 0.00 ? 148 GLU E C   1 
ATOM   7676  O O   . GLU E  5  148 ? -45.082 -43.081 14.746  1.00 0.00 ? 148 GLU E O   1 
ATOM   7677  C CB  . GLU E  5  148 ? -42.889 -41.141 13.537  1.00 0.00 ? 148 GLU E CB  1 
ATOM   7678  C CG  . GLU E  5  148 ? -44.132 -40.271 13.630  1.00 0.00 ? 148 GLU E CG  1 
ATOM   7679  C CD  . GLU E  5  148 ? -44.135 -39.141 12.621  1.00 0.00 ? 148 GLU E CD  1 
ATOM   7680  O OE1 . GLU E  5  148 ? -43.180 -39.059 11.821  1.00 0.00 ? 148 GLU E OE1 1 
ATOM   7681  O OE2 . GLU E  5  148 ? -45.091 -38.337 12.632  1.00 0.00 ? 148 GLU E OE2 1 
ATOM   7682  N N   . LYS E  5  149 ? -43.623 -44.325 13.583  1.00 0.00 ? 149 LYS E N   1 
ATOM   7683  C CA  . LYS E  5  149 ? -44.576 -45.367 13.273  1.00 0.00 ? 149 LYS E CA  1 
ATOM   7684  C C   . LYS E  5  149 ? -44.955 -46.089 14.536  1.00 0.00 ? 149 LYS E C   1 
ATOM   7685  O O   . LYS E  5  149 ? -45.937 -46.826 14.566  1.00 0.00 ? 149 LYS E O   1 
ATOM   7686  C CB  . LYS E  5  149 ? -44.014 -46.396 12.243  1.00 0.00 ? 149 LYS E CB  1 
ATOM   7687  C CG  . LYS E  5  149 ? -43.961 -45.888 10.790  1.00 0.00 ? 149 LYS E CG  1 
ATOM   7688  C CD  . LYS E  5  149 ? -43.084 -44.646 10.577  1.00 0.00 ? 149 LYS E CD  1 
ATOM   7689  C CE  . LYS E  5  149 ? -42.736 -44.331 9.123   1.00 0.00 ? 149 LYS E CE  1 
ATOM   7690  N NZ  . LYS E  5  149 ? -41.829 -43.166 9.053   1.00 0.00 ? 149 LYS E NZ  1 
ATOM   7691  N N   . GLY E  5  150 ? -44.178 -45.877 15.619  1.00 0.00 ? 150 GLY E N   1 
ATOM   7692  C CA  . GLY E  5  150 ? -44.296 -46.629 16.827  1.00 0.00 ? 150 GLY E CA  1 
ATOM   7693  C C   . GLY E  5  150 ? -43.321 -47.736 16.683  1.00 0.00 ? 150 GLY E C   1 
ATOM   7694  O O   . GLY E  5  150 ? -42.348 -47.563 15.960  1.00 0.00 ? 150 GLY E O   1 
ATOM   7695  N N   . PRO E  5  151 ? -43.552 -48.854 17.362  1.00 0.00 ? 151 PRO E N   1 
ATOM   7696  C CA  . PRO E  5  151 ? -42.543 -49.913 17.480  1.00 0.00 ? 151 PRO E CA  1 
ATOM   7697  C C   . PRO E  5  151 ? -42.157 -50.534 16.144  1.00 0.00 ? 151 PRO E C   1 
ATOM   7698  O O   . PRO E  5  151 ? -43.010 -50.750 15.283  1.00 0.00 ? 151 PRO E O   1 
ATOM   7699  C CB  . PRO E  5  151 ? -43.239 -50.955 18.359  1.00 0.00 ? 151 PRO E CB  1 
ATOM   7700  C CG  . PRO E  5  151 ? -44.691 -50.758 18.091  1.00 0.00 ? 151 PRO E CG  1 
ATOM   7701  C CD  . PRO E  5  151 ? -44.867 -49.282 17.873  1.00 0.00 ? 151 PRO E CD  1 
ATOM   7702  N N   . GLN E  5  152 ? -40.867 -50.815 15.984  1.00 0.00 ? 152 GLN E N   1 
ATOM   7703  C CA  . GLN E  5  152 ? -40.365 -51.406 14.784  1.00 0.00 ? 152 GLN E CA  1 
ATOM   7704  C C   . GLN E  5  152 ? -39.255 -52.232 15.271  1.00 0.00 ? 152 GLN E C   1 
ATOM   7705  O O   . GLN E  5  152 ? -38.606 -51.890 16.252  1.00 0.00 ? 152 GLN E O   1 
ATOM   7706  C CB  . GLN E  5  152 ? -39.800 -50.423 13.750  1.00 0.00 ? 152 GLN E CB  1 
ATOM   7707  C CG  . GLN E  5  152 ? -40.910 -49.788 12.909  1.00 0.00 ? 152 GLN E CG  1 
ATOM   7708  C CD  . GLN E  5  152 ? -40.248 -48.784 11.979  1.00 0.00 ? 152 GLN E CD  1 
ATOM   7709  O OE1 . GLN E  5  152 ? -39.151 -48.300 12.278  1.00 0.00 ? 152 GLN E OE1 1 
ATOM   7710  N NE2 . GLN E  5  152 ? -40.931 -48.466 10.839  1.00 0.00 ? 152 GLN E NE2 1 
ATOM   7711  N N   . LEU E  5  153 ? -39.023 -53.365 14.603  1.00 0.00 ? 153 LEU E N   1 
ATOM   7712  C CA  . LEU E  5  153 ? -38.011 -54.257 15.043  1.00 0.00 ? 153 LEU E CA  1 
ATOM   7713  C C   . LEU E  5  153 ? -37.498 -54.908 13.820  1.00 0.00 ? 153 LEU E C   1 
ATOM   7714  O O   . LEU E  5  153 ? -38.181 -55.720 13.209  1.00 0.00 ? 153 LEU E O   1 
ATOM   7715  C CB  . LEU E  5  153 ? -38.516 -55.296 16.053  1.00 0.00 ? 153 LEU E CB  1 
ATOM   7716  C CG  . LEU E  5  153 ? -37.382 -56.137 16.651  1.00 0.00 ? 153 LEU E CG  1 
ATOM   7717  C CD1 . LEU E  5  153 ? -37.549 -56.264 18.167  1.00 0.00 ? 153 LEU E CD1 1 
ATOM   7718  C CD2 . LEU E  5  153 ? -37.260 -57.500 15.967  1.00 0.00 ? 153 LEU E CD2 1 
ATOM   7719  N N   . PHE E  5  154 ? -36.268 -54.541 13.415  1.00 0.00 ? 154 PHE E N   1 
ATOM   7720  C CA  . PHE E  5  154 ? -35.699 -55.029 12.202  1.00 0.00 ? 154 PHE E CA  1 
ATOM   7721  C C   . PHE E  5  154 ? -34.612 -55.929 12.631  1.00 0.00 ? 154 PHE E C   1 
ATOM   7722  O O   . PHE E  5  154 ? -33.665 -55.455 13.245  1.00 0.00 ? 154 PHE E O   1 
ATOM   7723  C CB  . PHE E  5  154 ? -35.098 -53.920 11.329  1.00 0.00 ? 154 PHE E CB  1 
ATOM   7724  C CG  . PHE E  5  154 ? -36.174 -53.250 10.508  1.00 0.00 ? 154 PHE E CG  1 
ATOM   7725  C CD1 . PHE E  5  154 ? -37.311 -52.649 11.070  1.00 0.00 ? 154 PHE E CD1 1 
ATOM   7726  C CD2 . PHE E  5  154 ? -36.021 -53.191 9.122   1.00 0.00 ? 154 PHE E CD2 1 
ATOM   7727  C CE1 . PHE E  5  154 ? -38.260 -52.015 10.267  1.00 0.00 ? 154 PHE E CE1 1 
ATOM   7728  C CE2 . PHE E  5  154 ? -36.974 -52.580 8.310   1.00 0.00 ? 154 PHE E CE2 1 
ATOM   7729  C CZ  . PHE E  5  154 ? -38.092 -51.985 8.884   1.00 0.00 ? 154 PHE E CZ  1 
ATOM   7730  N N   . HIS E  5  155 ? -34.716 -57.232 12.264  1.00 0.00 ? 155 HIS E N   1 
ATOM   7731  C CA  . HIS E  5  155 ? -33.677 -58.233 12.294  1.00 0.00 ? 155 HIS E CA  1 
ATOM   7732  C C   . HIS E  5  155 ? -32.750 -57.975 11.180  1.00 0.00 ? 155 HIS E C   1 
ATOM   7733  O O   . HIS E  5  155 ? -33.206 -57.559 10.125  1.00 0.00 ? 155 HIS E O   1 
ATOM   7734  C CB  . HIS E  5  155 ? -34.218 -59.661 12.118  1.00 0.00 ? 155 HIS E CB  1 
ATOM   7735  C CG  . HIS E  5  155 ? -33.185 -60.753 12.070  1.00 0.00 ? 155 HIS E CG  1 
ATOM   7736  N ND1 . HIS E  5  155 ? -33.129 -61.713 11.089  1.00 0.00 ? 155 HIS E ND1 1 
ATOM   7737  C CD2 . HIS E  5  155 ? -32.133 -60.999 12.890  1.00 0.00 ? 155 HIS E CD2 1 
ATOM   7738  C CE1 . HIS E  5  155 ? -32.045 -62.478 11.364  1.00 0.00 ? 155 HIS E CE1 1 
ATOM   7739  N NE2 . HIS E  5  155 ? -31.406 -62.079 12.441  1.00 0.00 ? 155 HIS E NE2 1 
ATOM   7740  N N   . MET E  5  156 ? -31.442 -58.234 11.369  1.00 0.00 ? 156 MET E N   1 
ATOM   7741  C CA  . MET E  5  156 ? -30.491 -58.182 10.297  1.00 0.00 ? 156 MET E CA  1 
ATOM   7742  C C   . MET E  5  156 ? -29.634 -59.411 10.232  1.00 0.00 ? 156 MET E C   1 
ATOM   7743  O O   . MET E  5  156 ? -28.871 -59.687 11.150  1.00 0.00 ? 156 MET E O   1 
ATOM   7744  C CB  . MET E  5  156 ? -29.587 -56.969 10.374  1.00 0.00 ? 156 MET E CB  1 
ATOM   7745  C CG  . MET E  5  156 ? -29.148 -56.570 8.975   1.00 0.00 ? 156 MET E CG  1 
ATOM   7746  S SD  . MET E  5  156 ? -27.720 -55.516 9.004   1.00 0.00 ? 156 MET E SD  1 
ATOM   7747  C CE  . MET E  5  156 ? -26.528 -56.869 8.775   1.00 0.00 ? 156 MET E CE  1 
ATOM   7748  N N   . ASP E  5  157 ? -29.800 -60.203 9.148   1.00 0.00 ? 157 ASP E N   1 
ATOM   7749  C CA  . ASP E  5  157 ? -29.035 -61.367 8.742   1.00 0.00 ? 157 ASP E CA  1 
ATOM   7750  C C   . ASP E  5  157 ? -27.657 -60.947 8.324   1.00 0.00 ? 157 ASP E C   1 
ATOM   7751  O O   . ASP E  5  157 ? -27.511 -59.766 8.051   1.00 0.00 ? 157 ASP E O   1 
ATOM   7752  C CB  . ASP E  5  157 ? -29.724 -62.112 7.568   1.00 0.00 ? 157 ASP E CB  1 
ATOM   7753  C CG  . ASP E  5  157 ? -31.157 -62.502 7.948   1.00 0.00 ? 157 ASP E CG  1 
ATOM   7754  O OD1 . ASP E  5  157 ? -32.068 -61.632 7.849   1.00 0.00 ? 157 ASP E OD1 1 
ATOM   7755  O OD2 . ASP E  5  157 ? -31.351 -63.685 8.340   1.00 0.00 ? 157 ASP E OD2 1 
ATOM   7756  N N   . PRO E  5  158 ? -26.601 -61.760 8.333   1.00 0.00 ? 158 PRO E N   1 
ATOM   7757  C CA  . PRO E  5  158 ? -25.243 -61.380 7.938   1.00 0.00 ? 158 PRO E CA  1 
ATOM   7758  C C   . PRO E  5  158 ? -25.063 -61.570 6.482   1.00 0.00 ? 158 PRO E C   1 
ATOM   7759  O O   . PRO E  5  158 ? -23.927 -61.582 6.026   1.00 0.00 ? 158 PRO E O   1 
ATOM   7760  C CB  . PRO E  5  158 ? -24.356 -62.416 8.611   1.00 0.00 ? 158 PRO E CB  1 
ATOM   7761  C CG  . PRO E  5  158 ? -25.219 -63.677 8.556   1.00 0.00 ? 158 PRO E CG  1 
ATOM   7762  C CD  . PRO E  5  158 ? -26.634 -63.134 8.811   1.00 0.00 ? 158 PRO E CD  1 
ATOM   7763  N N   . SER E  5  159 ? -26.162 -61.811 5.763   1.00 0.00 ? 159 SER E N   1 
ATOM   7764  C CA  . SER E  5  159 ? -26.175 -62.023 4.349   1.00 0.00 ? 159 SER E CA  1 
ATOM   7765  C C   . SER E  5  159 ? -26.412 -60.720 3.675   1.00 0.00 ? 159 SER E C   1 
ATOM   7766  O O   . SER E  5  159 ? -26.518 -60.669 2.454   1.00 0.00 ? 159 SER E O   1 
ATOM   7767  C CB  . SER E  5  159 ? -27.324 -62.981 3.973   1.00 0.00 ? 159 SER E CB  1 
ATOM   7768  O OG  . SER E  5  159 ? -27.255 -64.168 4.757   1.00 0.00 ? 159 SER E OG  1 
ATOM   7769  N N   . GLY E  5  160 ? -26.529 -59.638 4.477   1.00 0.00 ? 160 GLY E N   1 
ATOM   7770  C CA  . GLY E  5  160 ? -26.751 -58.301 4.005   1.00 0.00 ? 160 GLY E CA  1 
ATOM   7771  C C   . GLY E  5  160 ? -28.198 -58.095 3.750   1.00 0.00 ? 160 GLY E C   1 
ATOM   7772  O O   . GLY E  5  160 ? -28.535 -57.342 2.844   1.00 0.00 ? 160 GLY E O   1 
ATOM   7773  N N   . THR E  5  161 ? -29.066 -58.827 4.487   1.00 0.00 ? 161 THR E N   1 
ATOM   7774  C CA  . THR E  5  161 ? -30.486 -58.821 4.299   1.00 0.00 ? 161 THR E CA  1 
ATOM   7775  C C   . THR E  5  161 ? -31.048 -58.403 5.603   1.00 0.00 ? 161 THR E C   1 
ATOM   7776  O O   . THR E  5  161 ? -30.756 -59.009 6.624   1.00 0.00 ? 161 THR E O   1 
ATOM   7777  C CB  . THR E  5  161 ? -31.043 -60.188 3.979   1.00 0.00 ? 161 THR E CB  1 
ATOM   7778  O OG1 . THR E  5  161 ? -30.381 -60.706 2.845   1.00 0.00 ? 161 THR E OG1 1 
ATOM   7779  C CG2 . THR E  5  161 ? -32.551 -60.112 3.671   1.00 0.00 ? 161 THR E CG2 1 
ATOM   7780  N N   . PHE E  5  162 ? -31.872 -57.340 5.602   1.00 0.00 ? 162 PHE E N   1 
ATOM   7781  C CA  . PHE E  5  162 ? -32.591 -56.882 6.752   1.00 0.00 ? 162 PHE E CA  1 
ATOM   7782  C C   . PHE E  5  162 ? -33.985 -57.250 6.510   1.00 0.00 ? 162 PHE E C   1 
ATOM   7783  O O   . PHE E  5  162 ? -34.414 -57.255 5.367   1.00 0.00 ? 162 PHE E O   1 
ATOM   7784  C CB  . PHE E  5  162 ? -32.524 -55.352 6.993   1.00 0.00 ? 162 PHE E CB  1 
ATOM   7785  C CG  . PHE E  5  162 ? -33.120 -54.474 5.921   1.00 0.00 ? 162 PHE E CG  1 
ATOM   7786  C CD1 . PHE E  5  162 ? -34.487 -54.137 5.964   1.00 0.00 ? 162 PHE E CD1 1 
ATOM   7787  C CD2 . PHE E  5  162 ? -32.333 -53.993 4.864   1.00 0.00 ? 162 PHE E CD2 1 
ATOM   7788  C CE1 . PHE E  5  162 ? -35.058 -53.325 4.986   1.00 0.00 ? 162 PHE E CE1 1 
ATOM   7789  C CE2 . PHE E  5  162 ? -32.901 -53.172 3.883   1.00 0.00 ? 162 PHE E CE2 1 
ATOM   7790  C CZ  . PHE E  5  162 ? -34.261 -52.838 3.947   1.00 0.00 ? 162 PHE E CZ  1 
ATOM   7791  N N   . VAL E  5  163 ? -34.762 -57.475 7.567   1.00 0.00 ? 163 VAL E N   1 
ATOM   7792  C CA  . VAL E  5  163 ? -36.130 -57.817 7.353   1.00 0.00 ? 163 VAL E CA  1 
ATOM   7793  C C   . VAL E  5  163 ? -36.838 -57.273 8.528   1.00 0.00 ? 163 VAL E C   1 
ATOM   7794  O O   . VAL E  5  163 ? -36.332 -57.297 9.641   1.00 0.00 ? 163 VAL E O   1 
ATOM   7795  C CB  . VAL E  5  163 ? -36.331 -59.309 7.130   1.00 0.00 ? 163 VAL E CB  1 
ATOM   7796  C CG1 . VAL E  5  163 ? -35.901 -60.143 8.354   1.00 0.00 ? 163 VAL E CG1 1 
ATOM   7797  C CG2 . VAL E  5  163 ? -37.769 -59.579 6.657   1.00 0.00 ? 163 VAL E CG2 1 
ATOM   7798  N N   . GLN E  5  164 ? -38.031 -56.704 8.309   1.00 0.00 ? 164 GLN E N   1 
ATOM   7799  C CA  . GLN E  5  164 ? -38.905 -56.272 9.365   1.00 0.00 ? 164 GLN E CA  1 
ATOM   7800  C C   . GLN E  5  164 ? -39.455 -57.476 10.068  1.00 0.00 ? 164 GLN E C   1 
ATOM   7801  O O   . GLN E  5  164 ? -39.649 -58.517 9.451   1.00 0.00 ? 164 GLN E O   1 
ATOM   7802  C CB  . GLN E  5  164 ? -40.031 -55.359 8.832   1.00 0.00 ? 164 GLN E CB  1 
ATOM   7803  C CG  . GLN E  5  164 ? -40.848 -54.711 9.958   1.00 0.00 ? 164 GLN E CG  1 
ATOM   7804  C CD  . GLN E  5  164 ? -41.676 -53.563 9.396   1.00 0.00 ? 164 GLN E CD  1 
ATOM   7805  O OE1 . GLN E  5  164 ? -42.181 -53.652 8.272   1.00 0.00 ? 164 GLN E OE1 1 
ATOM   7806  N NE2 . GLN E  5  164 ? -41.809 -52.468 10.203  1.00 0.00 ? 164 GLN E NE2 1 
ATOM   7807  N N   . CYS E  5  165 ? -39.663 -57.389 11.388  1.00 0.00 ? 165 CYS E N   1 
ATOM   7808  C CA  . CYS E  5  165 ? -40.072 -58.530 12.144  1.00 0.00 ? 165 CYS E CA  1 
ATOM   7809  C C   . CYS E  5  165 ? -41.134 -58.105 13.081  1.00 0.00 ? 165 CYS E C   1 
ATOM   7810  O O   . CYS E  5  165 ? -41.605 -56.972 13.062  1.00 0.00 ? 165 CYS E O   1 
ATOM   7811  C CB  . CYS E  5  165 ? -38.931 -59.171 12.972  1.00 0.00 ? 165 CYS E CB  1 
ATOM   7812  S SG  . CYS E  5  165 ? -37.559 -59.722 11.952  1.00 0.00 ? 165 CYS E SG  1 
ATOM   7813  N N   . ASP E  5  166 ? -41.660 -59.131 13.749  1.00 0.00 ? 166 ASP E N   1 
ATOM   7814  C CA  . ASP E  5  166 ? -42.614 -59.029 14.839  1.00 0.00 ? 166 ASP E CA  1 
ATOM   7815  C C   . ASP E  5  166 ? -42.023 -59.777 16.027  1.00 0.00 ? 166 ASP E C   1 
ATOM   7816  O O   . ASP E  5  166 ? -41.972 -59.250 17.139  1.00 0.00 ? 166 ASP E O   1 
ATOM   7817  C CB  . ASP E  5  166 ? -43.958 -59.638 14.441  1.00 0.00 ? 166 ASP E CB  1 
ATOM   7818  C CG  . ASP E  5  166 ? -44.736 -58.757 13.485  1.00 0.00 ? 166 ASP E CG  1 
ATOM   7819  O OD1 . ASP E  5  166 ? -44.463 -57.539 13.441  1.00 0.00 ? 166 ASP E OD1 1 
ATOM   7820  O OD2 . ASP E  5  166 ? -45.621 -59.282 12.777  1.00 0.00 ? 166 ASP E OD2 1 
ATOM   7821  N N   . ALA E  5  167 ? -41.560 -61.006 15.786  1.00 0.00 ? 167 ALA E N   1 
ATOM   7822  C CA  . ALA E  5  167 ? -40.802 -61.698 16.782  1.00 0.00 ? 167 ALA E CA  1 
ATOM   7823  C C   . ALA E  5  167 ? -39.929 -62.611 16.018  1.00 0.00 ? 167 ALA E C   1 
ATOM   7824  O O   . ALA E  5  167 ? -40.355 -63.270 15.072  1.00 0.00 ? 167 ALA E O   1 
ATOM   7825  C CB  . ALA E  5  167 ? -41.625 -62.505 17.784  1.00 0.00 ? 167 ALA E CB  1 
ATOM   7826  N N   . ARG E  5  168 ? -38.650 -62.409 16.266  1.00 0.00 ? 168 ARG E N   1 
ATOM   7827  C CA  . ARG E  5  168 ? -37.592 -63.193 15.704  1.00 0.00 ? 168 ARG E CA  1 
ATOM   7828  C C   . ARG E  5  168 ? -36.661 -63.260 16.877  1.00 0.00 ? 168 ARG E C   1 
ATOM   7829  O O   . ARG E  5  168 ? -36.533 -62.301 17.638  1.00 0.00 ? 168 ARG E O   1 
ATOM   7830  C CB  . ARG E  5  168 ? -36.933 -62.462 14.537  1.00 0.00 ? 168 ARG E CB  1 
ATOM   7831  C CG  . ARG E  5  168 ? -35.781 -63.221 13.899  1.00 0.00 ? 168 ARG E CG  1 
ATOM   7832  C CD  . ARG E  5  168 ? -36.240 -64.562 13.349  1.00 0.00 ? 168 ARG E CD  1 
ATOM   7833  N NE  . ARG E  5  168 ? -36.273 -64.572 11.890  1.00 0.00 ? 168 ARG E NE  1 
ATOM   7834  C CZ  . ARG E  5  168 ? -36.318 -65.677 11.152  1.00 0.00 ? 168 ARG E CZ  1 
ATOM   7835  N NH1 . ARG E  5  168 ? -36.335 -66.867 11.736  1.00 0.00 ? 168 ARG E NH1 1 
ATOM   7836  N NH2 . ARG E  5  168 ? -36.344 -65.592 9.829   1.00 0.00 ? 168 ARG E NH2 1 
ATOM   7837  N N   . ALA E  5  169 ? -36.105 -64.450 17.076  1.00 0.00 ? 169 ALA E N   1 
ATOM   7838  C CA  . ALA E  5  169 ? -35.116 -64.710 18.103  1.00 0.00 ? 169 ALA E CA  1 
ATOM   7839  C C   . ALA E  5  169 ? -33.898 -65.210 17.358  1.00 0.00 ? 169 ALA E C   1 
ATOM   7840  O O   . ALA E  5  169 ? -34.000 -66.103 16.517  1.00 0.00 ? 169 ALA E O   1 
ATOM   7841  C CB  . ALA E  5  169 ? -35.620 -65.759 19.078  1.00 0.00 ? 169 ALA E CB  1 
ATOM   7842  N N   . ILE E  5  170 ? -32.746 -64.627 17.650  1.00 0.00 ? 170 ILE E N   1 
ATOM   7843  C CA  . ILE E  5  170 ? -31.569 -64.883 16.850  1.00 0.00 ? 170 ILE E CA  1 
ATOM   7844  C C   . ILE E  5  170 ? -30.562 -65.656 17.643  1.00 0.00 ? 170 ILE E C   1 
ATOM   7845  O O   . ILE E  5  170 ? -30.515 -65.547 18.861  1.00 0.00 ? 170 ILE E O   1 
ATOM   7846  C CB  . ILE E  5  170 ? -30.924 -63.595 16.391  1.00 0.00 ? 170 ILE E CB  1 
ATOM   7847  C CG1 . ILE E  5  170 ? -30.415 -62.678 17.522  1.00 0.00 ? 170 ILE E CG1 1 
ATOM   7848  C CG2 . ILE E  5  170 ? -31.965 -62.853 15.539  1.00 0.00 ? 170 ILE E CG2 1 
ATOM   7849  C CD1 . ILE E  5  170 ? -29.523 -61.537 17.022  1.00 0.00 ? 170 ILE E CD1 1 
ATOM   7850  N N   . GLY E  5  171 ? -29.680 -66.429 16.978  1.00 0.00 ? 171 GLY E N   1 
ATOM   7851  C CA  . GLY E  5  171 ? -28.663 -67.165 17.685  1.00 0.00 ? 171 GLY E CA  1 
ATOM   7852  C C   . GLY E  5  171 ? -28.851 -68.642 17.619  1.00 0.00 ? 171 GLY E C   1 
ATOM   7853  O O   . GLY E  5  171 ? -29.423 -69.169 16.667  1.00 0.00 ? 171 GLY E O   1 
ATOM   7854  N N   . SER E  5  172 ? -28.204 -69.332 18.575  1.00 0.00 ? 172 SER E N   1 
ATOM   7855  C CA  . SER E  5  172 ? -28.099 -70.815 18.661  1.00 0.00 ? 172 SER E CA  1 
ATOM   7856  C C   . SER E  5  172 ? -29.252 -71.792 19.047  1.00 0.00 ? 172 SER E C   1 
ATOM   7857  O O   . SER E  5  172 ? -29.499 -72.752 18.313  1.00 0.00 ? 172 SER E O   1 
ATOM   7858  C CB  . SER E  5  172 ? -26.896 -71.154 19.547  1.00 0.00 ? 172 SER E CB  1 
ATOM   7859  O OG  . SER E  5  172 ? -27.045 -70.566 20.825  1.00 0.00 ? 172 SER E OG  1 
ATOM   7860  N N   . ALA E  5  173 ? -29.968 -71.549 20.151  1.00 0.00 ? 173 ALA E N   1 
ATOM   7861  C CA  . ALA E  5  173 ? -31.120 -72.361 20.504  1.00 0.00 ? 173 ALA E CA  1 
ATOM   7862  C C   . ALA E  5  173 ? -32.379 -71.681 20.058  1.00 0.00 ? 173 ALA E C   1 
ATOM   7863  O O   . ALA E  5  173 ? -33.506 -72.057 20.379  1.00 0.00 ? 173 ALA E O   1 
ATOM   7864  C CB  . ALA E  5  173 ? -31.176 -72.598 22.018  1.00 0.00 ? 173 ALA E CB  1 
ATOM   7865  N N   . SER E  5  174 ? -32.162 -70.645 19.249  1.00 0.00 ? 174 SER E N   1 
ATOM   7866  C CA  . SER E  5  174 ? -33.094 -69.774 18.648  1.00 0.00 ? 174 SER E CA  1 
ATOM   7867  C C   . SER E  5  174 ? -34.087 -70.447 17.759  1.00 0.00 ? 174 SER E C   1 
ATOM   7868  O O   . SER E  5  174 ? -35.194 -69.960 17.633  1.00 0.00 ? 174 SER E O   1 
ATOM   7869  C CB  . SER E  5  174 ? -32.361 -68.708 17.859  1.00 0.00 ? 174 SER E CB  1 
ATOM   7870  O OG  . SER E  5  174 ? -33.256 -67.667 17.557  1.00 0.00 ? 174 SER E OG  1 
ATOM   7871  N N   . GLU E  5  175 ? -33.751 -71.558 17.091  1.00 0.00 ? 175 GLU E N   1 
ATOM   7872  C CA  . GLU E  5  175 ? -34.701 -72.237 16.239  1.00 0.00 ? 175 GLU E CA  1 
ATOM   7873  C C   . GLU E  5  175 ? -35.872 -72.771 17.034  1.00 0.00 ? 175 GLU E C   1 
ATOM   7874  O O   . GLU E  5  175 ? -37.017 -72.621 16.627  1.00 0.00 ? 175 GLU E O   1 
ATOM   7875  C CB  . GLU E  5  175 ? -34.022 -73.330 15.399  1.00 0.00 ? 175 GLU E CB  1 
ATOM   7876  C CG  . GLU E  5  175 ? -32.970 -72.690 14.476  1.00 0.00 ? 175 GLU E CG  1 
ATOM   7877  C CD  . GLU E  5  175 ? -32.421 -73.714 13.496  1.00 0.00 ? 175 GLU E CD  1 
ATOM   7878  O OE1 . GLU E  5  175 ? -33.238 -74.271 12.717  1.00 0.00 ? 175 GLU E OE1 1 
ATOM   7879  O OE2 . GLU E  5  175 ? -31.182 -73.941 13.498  1.00 0.00 ? 175 GLU E OE2 1 
ATOM   7880  N N   . GLY E  5  176 ? -35.595 -73.287 18.254  1.00 0.00 ? 176 GLY E N   1 
ATOM   7881  C CA  . GLY E  5  176 ? -36.588 -73.693 19.216  1.00 0.00 ? 176 GLY E CA  1 
ATOM   7882  C C   . GLY E  5  176 ? -37.305 -72.496 19.806  1.00 0.00 ? 176 GLY E C   1 
ATOM   7883  O O   . GLY E  5  176 ? -38.483 -72.568 20.143  1.00 0.00 ? 176 GLY E O   1 
ATOM   7884  N N   . ALA E  5  177 ? -36.596 -71.348 19.952  1.00 0.00 ? 177 ALA E N   1 
ATOM   7885  C CA  . ALA E  5  177 ? -37.186 -70.091 20.378  1.00 0.00 ? 177 ALA E CA  1 
ATOM   7886  C C   . ALA E  5  177 ? -38.076 -69.495 19.315  1.00 0.00 ? 177 ALA E C   1 
ATOM   7887  O O   . ALA E  5  177 ? -39.001 -68.775 19.640  1.00 0.00 ? 177 ALA E O   1 
ATOM   7888  C CB  . ALA E  5  177 ? -36.151 -69.007 20.730  1.00 0.00 ? 177 ALA E CB  1 
ATOM   7889  N N   . GLN E  5  178 ? -37.858 -69.828 18.023  1.00 0.00 ? 178 GLN E N   1 
ATOM   7890  C CA  . GLN E  5  178 ? -38.580 -69.357 16.873  1.00 0.00 ? 178 GLN E CA  1 
ATOM   7891  C C   . GLN E  5  178 ? -39.911 -70.049 16.912  1.00 0.00 ? 178 GLN E C   1 
ATOM   7892  O O   . GLN E  5  178 ? -40.939 -69.392 16.980  1.00 0.00 ? 178 GLN E O   1 
ATOM   7893  C CB  . GLN E  5  178 ? -37.867 -69.680 15.544  1.00 0.00 ? 178 GLN E CB  1 
ATOM   7894  C CG  . GLN E  5  178 ? -38.458 -68.998 14.295  1.00 0.00 ? 178 GLN E CG  1 
ATOM   7895  C CD  . GLN E  5  178 ? -37.825 -67.620 14.108  1.00 0.00 ? 178 GLN E CD  1 
ATOM   7896  O OE1 . GLN E  5  178 ? -36.619 -67.536 13.860  1.00 0.00 ? 178 GLN E OE1 1 
ATOM   7897  N NE2 . GLN E  5  178 ? -38.654 -66.542 14.217  1.00 0.00 ? 178 GLN E NE2 1 
ATOM   7898  N N   . SER E  5  179 ? -39.903 -71.412 16.942  1.00 0.00 ? 179 SER E N   1 
ATOM   7899  C CA  . SER E  5  179 ? -41.083 -72.244 16.979  1.00 0.00 ? 179 SER E CA  1 
ATOM   7900  C C   . SER E  5  179 ? -41.925 -72.059 18.209  1.00 0.00 ? 179 SER E C   1 
ATOM   7901  O O   . SER E  5  179 ? -43.139 -72.106 18.096  1.00 0.00 ? 179 SER E O   1 
ATOM   7902  C CB  . SER E  5  179 ? -40.772 -73.746 16.855  1.00 0.00 ? 179 SER E CB  1 
ATOM   7903  O OG  . SER E  5  179 ? -40.005 -74.239 17.947  1.00 0.00 ? 179 SER E OG  1 
ATOM   7904  N N   . SER E  5  180 ? -41.313 -71.786 19.403  1.00 0.00 ? 180 SER E N   1 
ATOM   7905  C CA  . SER E  5  180 ? -42.009 -71.478 20.649  1.00 0.00 ? 180 SER E CA  1 
ATOM   7906  C C   . SER E  5  180 ? -42.790 -70.206 20.534  1.00 0.00 ? 180 SER E C   1 
ATOM   7907  O O   . SER E  5  180 ? -43.958 -70.127 20.903  1.00 0.00 ? 180 SER E O   1 
ATOM   7908  C CB  . SER E  5  180 ? -41.136 -71.470 21.911  1.00 0.00 ? 180 SER E CB  1 
ATOM   7909  O OG  . SER E  5  180 ? -40.090 -70.530 21.817  1.00 0.00 ? 180 SER E OG  1 
ATOM   7910  N N   . LEU E  5  181 ? -42.158 -69.199 19.898  1.00 0.00 ? 181 LEU E N   1 
ATOM   7911  C CA  . LEU E  5  181 ? -42.710 -67.905 19.615  1.00 0.00 ? 181 LEU E CA  1 
ATOM   7912  C C   . LEU E  5  181 ? -43.898 -68.063 18.714  1.00 0.00 ? 181 LEU E C   1 
ATOM   7913  O O   . LEU E  5  181 ? -44.840 -67.292 18.796  1.00 0.00 ? 181 LEU E O   1 
ATOM   7914  C CB  . LEU E  5  181 ? -41.721 -66.919 18.959  1.00 0.00 ? 181 LEU E CB  1 
ATOM   7915  C CG  . LEU E  5  181 ? -40.779 -66.217 19.949  1.00 0.00 ? 181 LEU E CG  1 
ATOM   7916  C CD1 . LEU E  5  181 ? -39.542 -65.665 19.215  1.00 0.00 ? 181 LEU E CD1 1 
ATOM   7917  C CD2 . LEU E  5  181 ? -41.519 -65.119 20.736  1.00 0.00 ? 181 LEU E CD2 1 
ATOM   7918  N N   . GLN E  5  182 ? -43.900 -69.103 17.861  1.00 0.00 ? 182 GLN E N   1 
ATOM   7919  C CA  . GLN E  5  182 ? -44.911 -69.352 16.873  1.00 0.00 ? 182 GLN E CA  1 
ATOM   7920  C C   . GLN E  5  182 ? -46.275 -69.586 17.460  1.00 0.00 ? 182 GLN E C   1 
ATOM   7921  O O   . GLN E  5  182 ? -47.268 -69.383 16.764  1.00 0.00 ? 182 GLN E O   1 
ATOM   7922  C CB  . GLN E  5  182 ? -44.558 -70.553 15.961  1.00 0.00 ? 182 GLN E CB  1 
ATOM   7923  C CG  . GLN E  5  182 ? -45.312 -70.644 14.627  1.00 0.00 ? 182 GLN E CG  1 
ATOM   7924  C CD  . GLN E  5  182 ? -44.889 -69.485 13.734  1.00 0.00 ? 182 GLN E CD  1 
ATOM   7925  O OE1 . GLN E  5  182 ? -43.721 -69.416 13.341  1.00 0.00 ? 182 GLN E OE1 1 
ATOM   7926  N NE2 . GLN E  5  182 ? -45.850 -68.571 13.418  1.00 0.00 ? 182 GLN E NE2 1 
ATOM   7927  N N   . GLU E  5  183 ? -46.368 -70.098 18.715  1.00 0.00 ? 183 GLU E N   1 
ATOM   7928  C CA  . GLU E  5  183 ? -47.672 -70.347 19.299  1.00 0.00 ? 183 GLU E CA  1 
ATOM   7929  C C   . GLU E  5  183 ? -48.116 -69.191 20.122  1.00 0.00 ? 183 GLU E C   1 
ATOM   7930  O O   . GLU E  5  183 ? -49.315 -68.988 20.276  1.00 0.00 ? 183 GLU E O   1 
ATOM   7931  C CB  . GLU E  5  183 ? -47.724 -71.548 20.276  1.00 0.00 ? 183 GLU E CB  1 
ATOM   7932  C CG  . GLU E  5  183 ? -47.464 -72.937 19.665  1.00 0.00 ? 183 GLU E CG  1 
ATOM   7933  C CD  . GLU E  5  183 ? -45.995 -73.352 19.726  1.00 0.00 ? 183 GLU E CD  1 
ATOM   7934  O OE1 . GLU E  5  183 ? -45.131 -72.465 19.900  1.00 0.00 ? 183 GLU E OE1 1 
ATOM   7935  O OE2 . GLU E  5  183 ? -45.713 -74.574 19.612  1.00 0.00 ? 183 GLU E OE2 1 
ATOM   7936  N N   . VAL E  5  184 ? -47.162 -68.437 20.698  1.00 0.00 ? 184 VAL E N   1 
ATOM   7937  C CA  . VAL E  5  184 ? -47.429 -67.484 21.738  1.00 0.00 ? 184 VAL E CA  1 
ATOM   7938  C C   . VAL E  5  184 ? -47.474 -66.085 21.176  1.00 0.00 ? 184 VAL E C   1 
ATOM   7939  O O   . VAL E  5  184 ? -47.850 -65.144 21.875  1.00 0.00 ? 184 VAL E O   1 
ATOM   7940  C CB  . VAL E  5  184 ? -46.381 -67.634 22.831  1.00 0.00 ? 184 VAL E CB  1 
ATOM   7941  C CG1 . VAL E  5  184 ? -45.014 -67.141 22.343  1.00 0.00 ? 184 VAL E CG1 1 
ATOM   7942  C CG2 . VAL E  5  184 ? -46.839 -66.964 24.138  1.00 0.00 ? 184 VAL E CG2 1 
ATOM   7943  N N   . TYR E  5  185 ? -47.092 -65.919 19.916  1.00 0.00 ? 185 TYR E N   1 
ATOM   7944  C CA  . TYR E  5  185 ? -47.088 -64.582 19.345  1.00 0.00 ? 185 TYR E CA  1 
ATOM   7945  C C   . TYR E  5  185 ? -48.520 -64.079 19.386  1.00 0.00 ? 185 TYR E C   1 
ATOM   7946  O O   . TYR E  5  185 ? -49.449 -64.820 19.063  1.00 0.00 ? 185 TYR E O   1 
ATOM   7947  C CB  . TYR E  5  185 ? -46.573 -64.609 17.906  1.00 0.00 ? 185 TYR E CB  1 
ATOM   7948  C CG  . TYR E  5  185 ? -46.222 -63.246 17.355  1.00 0.00 ? 185 TYR E CG  1 
ATOM   7949  C CD1 . TYR E  5  185 ? -45.010 -62.643 17.663  1.00 0.00 ? 185 TYR E CD1 1 
ATOM   7950  C CD2 . TYR E  5  185 ? -47.102 -62.562 16.528  1.00 0.00 ? 185 TYR E CD2 1 
ATOM   7951  C CE1 . TYR E  5  185 ? -44.684 -61.397 17.161  1.00 0.00 ? 185 TYR E CE1 1 
ATOM   7952  C CE2 . TYR E  5  185 ? -46.785 -61.316 16.022  1.00 0.00 ? 185 TYR E CE2 1 
ATOM   7953  C CZ  . TYR E  5  185 ? -45.576 -60.738 16.342  1.00 0.00 ? 185 TYR E CZ  1 
ATOM   7954  O OH  . TYR E  5  185 ? -45.257 -59.497 15.840  1.00 0.00 ? 185 TYR E OH  1 
ATOM   7955  N N   . HIS E  5  186 ? -48.707 -62.827 19.789  1.00 0.00 ? 186 HIS E N   1 
ATOM   7956  C CA  . HIS E  5  186 ? -50.063 -62.306 19.935  1.00 0.00 ? 186 HIS E CA  1 
ATOM   7957  C C   . HIS E  5  186 ? -50.375 -61.081 19.090  1.00 0.00 ? 186 HIS E C   1 
ATOM   7958  O O   . HIS E  5  186 ? -49.527 -60.212 18.893  1.00 0.00 ? 186 HIS E O   1 
ATOM   7959  C CB  . HIS E  5  186 ? -50.396 -62.023 21.404  1.00 0.00 ? 186 HIS E CB  1 
ATOM   7960  C CG  . HIS E  5  186 ? -51.859 -62.103 21.711  1.00 0.00 ? 186 HIS E CG  1 
ATOM   7961  N ND1 . HIS E  5  186 ? -52.677 -60.994 21.737  1.00 0.00 ? 186 HIS E ND1 1 
ATOM   7962  C CD2 . HIS E  5  186 ? -52.656 -63.163 21.984  1.00 0.00 ? 186 HIS E CD2 1 
ATOM   7963  C CE1 . HIS E  5  186 ? -53.911 -61.366 22.022  1.00 0.00 ? 186 HIS E CE1 1 
ATOM   7964  N NE2 . HIS E  5  186 ? -53.926 -62.678 22.174  1.00 0.00 ? 186 HIS E NE2 1 
ATOM   7965  N N   . LYS E  5  187 ? -51.621 -61.009 18.632  1.00 0.00 ? 187 LYS E N   1 
ATOM   7966  C CA  . LYS E  5  187 ? -52.092 -59.853 17.896  1.00 0.00 ? 187 LYS E CA  1 
ATOM   7967  C C   . LYS E  5  187 ? -51.959 -58.705 18.870  1.00 0.00 ? 187 LYS E C   1 
ATOM   7968  O O   . LYS E  5  187 ? -52.275 -58.850 20.049  1.00 0.00 ? 187 LYS E O   1 
ATOM   7969  C CB  . LYS E  5  187 ? -53.560 -60.020 17.487  1.00 0.00 ? 187 LYS E CB  1 
ATOM   7970  C CG  . LYS E  5  187 ? -54.583 -59.703 18.571  1.00 0.00 ? 187 LYS E CG  1 
ATOM   7971  C CD  . LYS E  5  187 ? -56.007 -59.851 18.055  1.00 0.00 ? 187 LYS E CD  1 
ATOM   7972  C CE  . LYS E  5  187 ? -57.032 -59.559 19.141  1.00 0.00 ? 187 LYS E CE  1 
ATOM   7973  N NZ  . LYS E  5  187 ? -58.429 -59.701 18.645  1.00 0.00 ? 187 LYS E NZ  1 
ATOM   7974  N N   . SER E  5  188 ? -51.478 -57.566 18.394  1.00 0.00 ? 188 SER E N   1 
ATOM   7975  C CA  . SER E  5  188 ? -51.148 -56.491 19.307  1.00 0.00 ? 188 SER E CA  1 
ATOM   7976  C C   . SER E  5  188 ? -50.107 -57.054 20.282  1.00 0.00 ? 188 SER E C   1 
ATOM   7977  O O   . SER E  5  188 ? -49.173 -57.722 19.843  1.00 0.00 ? 188 SER E O   1 
ATOM   7978  C CB  . SER E  5  188 ? -52.410 -56.015 20.034  1.00 0.00 ? 188 SER E CB  1 
ATOM   7979  O OG  . SER E  5  188 ? -52.724 -56.872 21.119  1.00 0.00 ? 188 SER E OG  1 
ATOM   7980  N N   . MET E  5  189 ? -50.306 -56.803 21.578  1.00 0.00 ? 189 MET E N   1 
ATOM   7981  C CA  . MET E  5  189 ? -49.474 -57.250 22.707  1.00 0.00 ? 189 MET E CA  1 
ATOM   7982  C C   . MET E  5  189 ? -49.323 -56.087 23.678  1.00 0.00 ? 189 MET E C   1 
ATOM   7983  O O   . MET E  5  189 ? -49.428 -54.921 23.293  1.00 0.00 ? 189 MET E O   1 
ATOM   7984  C CB  . MET E  5  189 ? -48.090 -57.786 22.311  1.00 0.00 ? 189 MET E CB  1 
ATOM   7985  C CG  . MET E  5  189 ? -47.886 -59.270 22.609  1.00 0.00 ? 189 MET E CG  1 
ATOM   7986  S SD  . MET E  5  189 ? -46.251 -59.906 22.164  1.00 0.00 ? 189 MET E SD  1 
ATOM   7987  C CE  . MET E  5  189 ? -46.607 -61.625 21.816  1.00 0.00 ? 189 MET E CE  1 
ATOM   7988  N N   . THR E  5  190 ? -49.080 -56.418 24.941  1.00 0.00 ? 190 THR E N   1 
ATOM   7989  C CA  . THR E  5  190 ? -48.946 -55.434 25.992  1.00 0.00 ? 190 THR E CA  1 
ATOM   7990  C C   . THR E  5  190 ? -47.494 -55.389 26.329  1.00 0.00 ? 190 THR E C   1 
ATOM   7991  O O   . THR E  5  190 ? -46.807 -56.378 26.102  1.00 0.00 ? 190 THR E O   1 
ATOM   7992  C CB  . THR E  5  190 ? -49.740 -55.855 27.197  1.00 0.00 ? 190 THR E CB  1 
ATOM   7993  O OG1 . THR E  5  190 ? -51.076 -56.125 26.807  1.00 0.00 ? 190 THR E OG1 1 
ATOM   7994  C CG2 . THR E  5  190 ? -49.747 -54.758 28.280  1.00 0.00 ? 190 THR E CG2 1 
ATOM   7995  N N   . LEU E  5  191 ? -46.948 -54.272 26.853  1.00 0.00 ? 191 LEU E N   1 
ATOM   7996  C CA  . LEU E  5  191 ? -45.512 -54.162 26.970  1.00 0.00 ? 191 LEU E CA  1 
ATOM   7997  C C   . LEU E  5  191 ? -44.957 -55.118 27.971  1.00 0.00 ? 191 LEU E C   1 
ATOM   7998  O O   . LEU E  5  191 ? -44.050 -55.874 27.649  1.00 0.00 ? 191 LEU E O   1 
ATOM   7999  C CB  . LEU E  5  191 ? -45.101 -52.738 27.405  1.00 0.00 ? 191 LEU E CB  1 
ATOM   8000  C CG  . LEU E  5  191 ? -43.620 -52.465 27.744  1.00 0.00 ? 191 LEU E CG  1 
ATOM   8001  C CD1 . LEU E  5  191 ? -43.121 -51.206 27.013  1.00 0.00 ? 191 LEU E CD1 1 
ATOM   8002  C CD2 . LEU E  5  191 ? -43.412 -52.338 29.267  1.00 0.00 ? 191 LEU E CD2 1 
ATOM   8003  N N   . LYS E  5  192 ? -45.532 -55.144 29.185  1.00 0.00 ? 192 LYS E N   1 
ATOM   8004  C CA  . LYS E  5  192 ? -45.097 -55.979 30.266  1.00 0.00 ? 192 LYS E CA  1 
ATOM   8005  C C   . LYS E  5  192 ? -45.293 -57.443 29.986  1.00 0.00 ? 192 LYS E C   1 
ATOM   8006  O O   . LYS E  5  192 ? -44.469 -58.264 30.370  1.00 0.00 ? 192 LYS E O   1 
ATOM   8007  C CB  . LYS E  5  192 ? -45.807 -55.549 31.559  1.00 0.00 ? 192 LYS E CB  1 
ATOM   8008  C CG  . LYS E  5  192 ? -45.231 -56.162 32.842  1.00 0.00 ? 192 LYS E CG  1 
ATOM   8009  C CD  . LYS E  5  192 ? -45.879 -55.592 34.117  1.00 0.00 ? 192 LYS E CD  1 
ATOM   8010  C CE  . LYS E  5  192 ? -47.395 -55.823 34.259  1.00 0.00 ? 192 LYS E CE  1 
ATOM   8011  N NZ  . LYS E  5  192 ? -47.734 -57.262 34.337  1.00 0.00 ? 192 LYS E NZ  1 
ATOM   8012  N N   . GLU E  5  193 ? -46.401 -57.820 29.314  1.00 0.00 ? 193 GLU E N   1 
ATOM   8013  C CA  . GLU E  5  193 ? -46.670 -59.199 28.963  1.00 0.00 ? 193 GLU E CA  1 
ATOM   8014  C C   . GLU E  5  193 ? -45.707 -59.780 27.958  1.00 0.00 ? 193 GLU E C   1 
ATOM   8015  O O   . GLU E  5  193 ? -45.374 -60.965 28.006  1.00 0.00 ? 193 GLU E O   1 
ATOM   8016  C CB  . GLU E  5  193 ? -48.073 -59.398 28.364  1.00 0.00 ? 193 GLU E CB  1 
ATOM   8017  C CG  . GLU E  5  193 ? -49.198 -59.141 29.373  1.00 0.00 ? 193 GLU E CG  1 
ATOM   8018  C CD  . GLU E  5  193 ? -50.472 -59.732 28.782  1.00 0.00 ? 193 GLU E CD  1 
ATOM   8019  O OE1 . GLU E  5  193 ? -50.910 -59.227 27.715  1.00 0.00 ? 193 GLU E OE1 1 
ATOM   8020  O OE2 . GLU E  5  193 ? -51.011 -60.706 29.370  1.00 0.00 ? 193 GLU E OE2 1 
ATOM   8021  N N   . ALA E  5  194 ? -45.266 -58.928 27.016  1.00 0.00 ? 194 ALA E N   1 
ATOM   8022  C CA  . ALA E  5  194 ? -44.301 -59.237 26.001  1.00 0.00 ? 194 ALA E CA  1 
ATOM   8023  C C   . ALA E  5  194 ? -42.923 -59.462 26.546  1.00 0.00 ? 194 ALA E C   1 
ATOM   8024  O O   . ALA E  5  194 ? -42.152 -60.254 26.009  1.00 0.00 ? 194 ALA E O   1 
ATOM   8025  C CB  . ALA E  5  194 ? -44.230 -58.082 25.009  1.00 0.00 ? 194 ALA E CB  1 
ATOM   8026  N N   . ILE E  5  195 ? -42.595 -58.728 27.642  1.00 0.00 ? 195 ILE E N   1 
ATOM   8027  C CA  . ILE E  5  195 ? -41.384 -58.844 28.414  1.00 0.00 ? 195 ILE E CA  1 
ATOM   8028  C C   . ILE E  5  195 ? -41.383 -60.158 29.102  1.00 0.00 ? 195 ILE E C   1 
ATOM   8029  O O   . ILE E  5  195 ? -40.398 -60.880 29.036  1.00 0.00 ? 195 ILE E O   1 
ATOM   8030  C CB  . ILE E  5  195 ? -41.231 -57.695 29.397  1.00 0.00 ? 195 ILE E CB  1 
ATOM   8031  C CG1 . ILE E  5  195 ? -40.891 -56.396 28.634  1.00 0.00 ? 195 ILE E CG1 1 
ATOM   8032  C CG2 . ILE E  5  195 ? -40.150 -58.008 30.451  1.00 0.00 ? 195 ILE E CG2 1 
ATOM   8033  C CD1 . ILE E  5  195 ? -41.196 -55.109 29.392  1.00 0.00 ? 195 ILE E CD1 1 
ATOM   8034  N N   . LYS E  5  196 ? -42.517 -60.553 29.711  1.00 0.00 ? 196 LYS E N   1 
ATOM   8035  C CA  . LYS E  5  196 ? -42.624 -61.816 30.397  1.00 0.00 ? 196 LYS E CA  1 
ATOM   8036  C C   . LYS E  5  196 ? -42.424 -62.970 29.465  1.00 0.00 ? 196 LYS E C   1 
ATOM   8037  O O   . LYS E  5  196 ? -41.915 -64.002 29.879  1.00 0.00 ? 196 LYS E O   1 
ATOM   8038  C CB  . LYS E  5  196 ? -43.923 -62.000 31.182  1.00 0.00 ? 196 LYS E CB  1 
ATOM   8039  C CG  . LYS E  5  196 ? -43.882 -63.224 32.105  1.00 0.00 ? 196 LYS E CG  1 
ATOM   8040  C CD  . LYS E  5  196 ? -45.030 -63.239 33.108  1.00 0.00 ? 196 LYS E CD  1 
ATOM   8041  C CE  . LYS E  5  196 ? -45.218 -64.609 33.740  1.00 0.00 ? 196 LYS E CE  1 
ATOM   8042  N NZ  . LYS E  5  196 ? -46.270 -64.547 34.766  1.00 0.00 ? 196 LYS E NZ  1 
ATOM   8043  N N   . SER E  5  197 ? -42.785 -62.817 28.170  1.00 0.00 ? 197 SER E N   1 
ATOM   8044  C CA  . SER E  5  197 ? -42.591 -63.851 27.178  1.00 0.00 ? 197 SER E CA  1 
ATOM   8045  C C   . SER E  5  197 ? -41.122 -64.132 27.008  1.00 0.00 ? 197 SER E C   1 
ATOM   8046  O O   . SER E  5  197 ? -40.731 -65.293 26.967  1.00 0.00 ? 197 SER E O   1 
ATOM   8047  C CB  . SER E  5  197 ? -43.131 -63.447 25.779  1.00 0.00 ? 197 SER E CB  1 
ATOM   8048  O OG  . SER E  5  197 ? -43.030 -64.509 24.844  1.00 0.00 ? 197 SER E OG  1 
ATOM   8049  N N   . SER E  5  198 ? -40.272 -63.082 26.907  1.00 0.00 ? 198 SER E N   1 
ATOM   8050  C CA  . SER E  5  198 ? -38.851 -63.275 26.807  1.00 0.00 ? 198 SER E CA  1 
ATOM   8051  C C   . SER E  5  198 ? -38.269 -63.862 28.042  1.00 0.00 ? 198 SER E C   1 
ATOM   8052  O O   . SER E  5  198 ? -37.380 -64.695 27.944  1.00 0.00 ? 198 SER E O   1 
ATOM   8053  C CB  . SER E  5  198 ? -38.065 -61.998 26.412  1.00 0.00 ? 198 SER E CB  1 
ATOM   8054  O OG  . SER E  5  198 ? -38.417 -60.848 27.168  1.00 0.00 ? 198 SER E OG  1 
ATOM   8055  N N   . LEU E  5  199 ? -38.773 -63.492 29.233  1.00 0.00 ? 199 LEU E N   1 
ATOM   8056  C CA  . LEU E  5  199 ? -38.278 -64.022 30.481  1.00 0.00 ? 199 LEU E CA  1 
ATOM   8057  C C   . LEU E  5  199 ? -38.521 -65.506 30.638  1.00 0.00 ? 199 LEU E C   1 
ATOM   8058  O O   . LEU E  5  199 ? -37.720 -66.192 31.269  1.00 0.00 ? 199 LEU E O   1 
ATOM   8059  C CB  . LEU E  5  199 ? -38.843 -63.292 31.711  1.00 0.00 ? 199 LEU E CB  1 
ATOM   8060  C CG  . LEU E  5  199 ? -38.474 -61.788 31.813  1.00 0.00 ? 199 LEU E CG  1 
ATOM   8061  C CD1 . LEU E  5  199 ? -39.129 -61.147 33.051  1.00 0.00 ? 199 LEU E CD1 1 
ATOM   8062  C CD2 . LEU E  5  199 ? -36.958 -61.526 31.802  1.00 0.00 ? 199 LEU E CD2 1 
ATOM   8063  N N   . ILE E  5  200 ? -39.621 -66.045 30.060  1.00 0.00 ? 200 ILE E N   1 
ATOM   8064  C CA  . ILE E  5  200 ? -39.960 -67.452 30.117  1.00 0.00 ? 200 ILE E CA  1 
ATOM   8065  C C   . ILE E  5  200 ? -39.213 -68.215 29.059  1.00 0.00 ? 200 ILE E C   1 
ATOM   8066  O O   . ILE E  5  200 ? -38.691 -69.298 29.320  1.00 0.00 ? 200 ILE E O   1 
ATOM   8067  C CB  . ILE E  5  200 ? -41.455 -67.659 29.951  1.00 0.00 ? 200 ILE E CB  1 
ATOM   8068  C CG1 . ILE E  5  200 ? -42.158 -67.192 31.241  1.00 0.00 ? 200 ILE E CG1 1 
ATOM   8069  C CG2 . ILE E  5  200 ? -41.799 -69.139 29.652  1.00 0.00 ? 200 ILE E CG2 1 
ATOM   8070  C CD1 . ILE E  5  200 ? -43.678 -67.089 31.101  1.00 0.00 ? 200 ILE E CD1 1 
ATOM   8071  N N   . ILE E  5  201 ? -39.160 -67.693 27.817  1.00 0.00 ? 201 ILE E N   1 
ATOM   8072  C CA  . ILE E  5  201 ? -38.537 -68.399 26.720  1.00 0.00 ? 201 ILE E CA  1 
ATOM   8073  C C   . ILE E  5  201 ? -37.048 -68.506 26.921  1.00 0.00 ? 201 ILE E C   1 
ATOM   8074  O O   . ILE E  5  201 ? -36.429 -69.477 26.491  1.00 0.00 ? 201 ILE E O   1 
ATOM   8075  C CB  . ILE E  5  201 ? -38.911 -67.812 25.353  1.00 0.00 ? 201 ILE E CB  1 
ATOM   8076  C CG1 . ILE E  5  201 ? -40.420 -68.020 25.085  1.00 0.00 ? 201 ILE E CG1 1 
ATOM   8077  C CG2 . ILE E  5  201 ? -38.100 -68.467 24.210  1.00 0.00 ? 201 ILE E CG2 1 
ATOM   8078  C CD1 . ILE E  5  201 ? -40.901 -67.306 23.827  1.00 0.00 ? 201 ILE E CD1 1 
ATOM   8079  N N   . LEU E  5  202 ? -36.413 -67.512 27.580  1.00 0.00 ? 202 LEU E N   1 
ATOM   8080  C CA  . LEU E  5  202 ? -34.993 -67.571 27.836  1.00 0.00 ? 202 LEU E CA  1 
ATOM   8081  C C   . LEU E  5  202 ? -34.584 -68.654 28.794  1.00 0.00 ? 202 LEU E C   1 
ATOM   8082  O O   . LEU E  5  202 ? -33.456 -69.125 28.708  1.00 0.00 ? 202 LEU E O   1 
ATOM   8083  C CB  . LEU E  5  202 ? -34.390 -66.230 28.285  1.00 0.00 ? 202 LEU E CB  1 
ATOM   8084  C CG  . LEU E  5  202 ? -34.174 -65.257 27.108  1.00 0.00 ? 202 LEU E CG  1 
ATOM   8085  C CD1 . LEU E  5  202 ? -34.043 -63.826 27.622  1.00 0.00 ? 202 LEU E CD1 1 
ATOM   8086  C CD2 . LEU E  5  202 ? -32.957 -65.603 26.238  1.00 0.00 ? 202 LEU E CD2 1 
ATOM   8087  N N   . LYS E  5  203 ? -35.475 -69.100 29.708  1.00 0.00 ? 203 LYS E N   1 
ATOM   8088  C CA  . LYS E  5  203 ? -35.249 -70.280 30.520  1.00 0.00 ? 203 LYS E CA  1 
ATOM   8089  C C   . LYS E  5  203 ? -35.216 -71.549 29.710  1.00 0.00 ? 203 LYS E C   1 
ATOM   8090  O O   . LYS E  5  203 ? -34.535 -72.490 30.100  1.00 0.00 ? 203 LYS E O   1 
ATOM   8091  C CB  . LYS E  5  203 ? -36.307 -70.495 31.619  1.00 0.00 ? 203 LYS E CB  1 
ATOM   8092  C CG  . LYS E  5  203 ? -36.280 -69.416 32.696  1.00 0.00 ? 203 LYS E CG  1 
ATOM   8093  C CD  . LYS E  5  203 ? -37.298 -69.673 33.812  1.00 0.00 ? 203 LYS E CD  1 
ATOM   8094  C CE  . LYS E  5  203 ? -37.206 -68.671 34.974  1.00 0.00 ? 203 LYS E CE  1 
ATOM   8095  N NZ  . LYS E  5  203 ? -35.898 -68.751 35.663  1.00 0.00 ? 203 LYS E NZ  1 
ATOM   8096  N N   . GLN E  5  204 ? -35.972 -71.626 28.588  1.00 0.00 ? 204 GLN E N   1 
ATOM   8097  C CA  . GLN E  5  204 ? -36.085 -72.838 27.812  1.00 0.00 ? 204 GLN E CA  1 
ATOM   8098  C C   . GLN E  5  204 ? -34.876 -73.031 26.949  1.00 0.00 ? 204 GLN E C   1 
ATOM   8099  O O   . GLN E  5  204 ? -34.334 -74.129 26.853  1.00 0.00 ? 204 GLN E O   1 
ATOM   8100  C CB  . GLN E  5  204 ? -37.237 -72.780 26.776  1.00 0.00 ? 204 GLN E CB  1 
ATOM   8101  C CG  . GLN E  5  204 ? -38.615 -72.376 27.316  1.00 0.00 ? 204 GLN E CG  1 
ATOM   8102  C CD  . GLN E  5  204 ? -39.574 -72.249 26.119  1.00 0.00 ? 204 GLN E CD  1 
ATOM   8103  O OE1 . GLN E  5  204 ? -39.145 -71.942 25.001  1.00 0.00 ? 204 GLN E OE1 1 
ATOM   8104  N NE2 . GLN E  5  204 ? -40.898 -72.485 26.372  1.00 0.00 ? 204 GLN E NE2 1 
ATOM   8105  N N   . VAL E  5  205 ? -34.480 -71.946 26.251  1.00 0.00 ? 205 VAL E N   1 
ATOM   8106  C CA  . VAL E  5  205 ? -33.402 -71.926 25.292  1.00 0.00 ? 205 VAL E CA  1 
ATOM   8107  C C   . VAL E  5  205 ? -32.054 -72.084 25.941  1.00 0.00 ? 205 VAL E C   1 
ATOM   8108  O O   . VAL E  5  205 ? -31.121 -72.616 25.347  1.00 0.00 ? 205 VAL E O   1 
ATOM   8109  C CB  . VAL E  5  205 ? -33.447 -70.694 24.425  1.00 0.00 ? 205 VAL E CB  1 
ATOM   8110  C CG1 . VAL E  5  205 ? -34.835 -70.626 23.765  1.00 0.00 ? 205 VAL E CG1 1 
ATOM   8111  C CG2 . VAL E  5  205 ? -33.148 -69.434 25.238  1.00 0.00 ? 205 VAL E CG2 1 
ATOM   8112  N N   . MET E  5  206 ? -31.939 -71.647 27.211  1.00 0.00 ? 206 MET E N   1 
ATOM   8113  C CA  . MET E  5  206 ? -30.732 -71.704 27.969  1.00 0.00 ? 206 MET E CA  1 
ATOM   8114  C C   . MET E  5  206 ? -30.631 -73.103 28.518  1.00 0.00 ? 206 MET E C   1 
ATOM   8115  O O   . MET E  5  206 ? -31.644 -73.786 28.666  1.00 0.00 ? 206 MET E O   1 
ATOM   8116  C CB  . MET E  5  206 ? -30.767 -70.635 29.092  1.00 0.00 ? 206 MET E CB  1 
ATOM   8117  C CG  . MET E  5  206 ? -29.505 -70.501 29.949  1.00 0.00 ? 206 MET E CG  1 
ATOM   8118  S SD  . MET E  5  206 ? -27.997 -70.458 28.965  1.00 0.00 ? 206 MET E SD  1 
ATOM   8119  C CE  . MET E  5  206 ? -26.874 -71.066 30.237  1.00 0.00 ? 206 MET E CE  1 
ATOM   8120  N N   . GLU E  5  207 ? -29.391 -73.554 28.836  1.00 0.00 ? 207 GLU E N   1 
ATOM   8121  C CA  . GLU E  5  207 ? -29.124 -74.828 29.454  1.00 0.00 ? 207 GLU E CA  1 
ATOM   8122  C C   . GLU E  5  207 ? -29.364 -74.743 30.945  1.00 0.00 ? 207 GLU E C   1 
ATOM   8123  O O   . GLU E  5  207 ? -29.916 -75.665 31.541  1.00 0.00 ? 207 GLU E O   1 
ATOM   8124  C CB  . GLU E  5  207 ? -27.673 -75.287 29.210  1.00 0.00 ? 207 GLU E CB  1 
ATOM   8125  C CG  . GLU E  5  207 ? -27.390 -76.708 29.745  1.00 0.00 ? 207 GLU E CG  1 
ATOM   8126  C CD  . GLU E  5  207 ? -25.982 -77.170 29.373  1.00 0.00 ? 207 GLU E CD  1 
ATOM   8127  O OE1 . GLU E  5  207 ? -25.001 -76.524 29.830  1.00 0.00 ? 207 GLU E OE1 1 
ATOM   8128  O OE2 . GLU E  5  207 ? -25.871 -78.183 28.632  1.00 0.00 ? 207 GLU E OE2 1 
ATOM   8129  N N   . GLU E  5  208 ? -28.951 -73.616 31.578  1.00 0.00 ? 208 GLU E N   1 
ATOM   8130  C CA  . GLU E  5  208 ? -29.079 -73.368 32.998  1.00 0.00 ? 208 GLU E CA  1 
ATOM   8131  C C   . GLU E  5  208 ? -30.349 -72.655 33.281  1.00 0.00 ? 208 GLU E C   1 
ATOM   8132  O O   . GLU E  5  208 ? -31.020 -72.142 32.386  1.00 0.00 ? 208 GLU E O   1 
ATOM   8133  C CB  . GLU E  5  208 ? -27.967 -72.480 33.612  1.00 0.00 ? 208 GLU E CB  1 
ATOM   8134  C CG  . GLU E  5  208 ? -26.537 -72.946 33.326  1.00 0.00 ? 208 GLU E CG  1 
ATOM   8135  C CD  . GLU E  5  208 ? -26.403 -74.442 33.539  1.00 0.00 ? 208 GLU E CD  1 
ATOM   8136  O OE1 . GLU E  5  208 ? -26.769 -74.926 34.642  1.00 0.00 ? 208 GLU E OE1 1 
ATOM   8137  O OE2 . GLU E  5  208 ? -25.934 -75.120 32.589  1.00 0.00 ? 208 GLU E OE2 1 
ATOM   8138  N N   . LYS E  5  209 ? -30.695 -72.601 34.588  1.00 0.00 ? 209 LYS E N   1 
ATOM   8139  C CA  . LYS E  5  209 ? -31.835 -71.867 35.056  1.00 0.00 ? 209 LYS E CA  1 
ATOM   8140  C C   . LYS E  5  209 ? -31.468 -70.420 35.070  1.00 0.00 ? 209 LYS E C   1 
ATOM   8141  O O   . LYS E  5  209 ? -30.506 -70.030 35.734  1.00 0.00 ? 209 LYS E O   1 
ATOM   8142  C CB  . LYS E  5  209 ? -32.308 -72.289 36.460  1.00 0.00 ? 209 LYS E CB  1 
ATOM   8143  C CG  . LYS E  5  209 ? -33.761 -71.891 36.774  1.00 0.00 ? 209 LYS E CG  1 
ATOM   8144  C CD  . LYS E  5  209 ? -34.800 -72.725 36.013  1.00 0.00 ? 209 LYS E CD  1 
ATOM   8145  C CE  . LYS E  5  209 ? -36.252 -72.456 36.425  1.00 0.00 ? 209 LYS E CE  1 
ATOM   8146  N NZ  . LYS E  5  209 ? -36.539 -72.915 37.802  1.00 0.00 ? 209 LYS E NZ  1 
ATOM   8147  N N   . LEU E  5  210 ? -32.233 -69.616 34.282  1.00 0.00 ? 210 LEU E N   1 
ATOM   8148  C CA  . LEU E  5  210 ? -32.028 -68.214 34.042  1.00 0.00 ? 210 LEU E CA  1 
ATOM   8149  C C   . LEU E  5  210 ? -32.103 -67.460 35.321  1.00 0.00 ? 210 LEU E C   1 
ATOM   8150  O O   . LEU E  5  210 ? -32.970 -67.703 36.155  1.00 0.00 ? 210 LEU E O   1 
ATOM   8151  C CB  . LEU E  5  210 ? -33.087 -67.616 33.101  1.00 0.00 ? 210 LEU E CB  1 
ATOM   8152  C CG  . LEU E  5  210 ? -32.735 -66.259 32.464  1.00 0.00 ? 210 LEU E CG  1 
ATOM   8153  C CD1 . LEU E  5  210 ? -31.780 -66.452 31.273  1.00 0.00 ? 210 LEU E CD1 1 
ATOM   8154  C CD2 . LEU E  5  210 ? -34.008 -65.506 32.064  1.00 0.00 ? 210 LEU E CD2 1 
ATOM   8155  N N   . ASN E  5  211 ? -31.139 -66.555 35.464  1.00 0.00 ? 211 ASN E N   1 
ATOM   8156  C CA  . ASN E  5  211 ? -31.019 -65.647 36.589  1.00 0.00 ? 211 ASN E CA  1 
ATOM   8157  C C   . ASN E  5  211 ? -30.750 -64.254 36.037  1.00 0.00 ? 211 ASN E C   1 
ATOM   8158  O O   . ASN E  5  211 ? -30.246 -64.103 34.924  1.00 0.00 ? 211 ASN E O   1 
ATOM   8159  C CB  . ASN E  5  211 ? -29.883 -66.080 37.516  1.00 0.00 ? 211 ASN E CB  1 
ATOM   8160  C CG  . ASN E  5  211 ? -30.116 -65.663 38.955  1.00 0.00 ? 211 ASN E CG  1 
ATOM   8161  O OD1 . ASN E  5  211 ? -29.469 -64.744 39.459  1.00 0.00 ? 211 ASN E OD1 1 
ATOM   8162  N ND2 . ASN E  5  211 ? -31.041 -66.339 39.626  1.00 0.00 ? 211 ASN E ND2 1 
ATOM   8163  N N   . ALA E  5  212 ? -31.101 -63.238 36.812  1.00 0.00 ? 212 ALA E N   1 
ATOM   8164  C CA  . ALA E  5  212 ? -31.084 -61.883 36.353  1.00 0.00 ? 212 ALA E CA  1 
ATOM   8165  C C   . ALA E  5  212 ? -29.699 -61.468 35.960  1.00 0.00 ? 212 ALA E C   1 
ATOM   8166  O O   . ALA E  5  212 ? -29.529 -60.492 35.236  1.00 0.00 ? 212 ALA E O   1 
ATOM   8167  C CB  . ALA E  5  212 ? -31.581 -60.936 37.431  1.00 0.00 ? 212 ALA E CB  1 
ATOM   8168  N N   . THR E  5  213 ? -28.689 -62.250 36.404  1.00 0.00 ? 213 THR E N   1 
ATOM   8169  C CA  . THR E  5  213 ? -27.302 -62.125 36.055  1.00 0.00 ? 213 THR E CA  1 
ATOM   8170  C C   . THR E  5  213 ? -26.998 -63.132 34.972  1.00 0.00 ? 213 THR E C   1 
ATOM   8171  O O   . THR E  5  213 ? -25.847 -63.367 34.630  1.00 0.00 ? 213 THR E O   1 
ATOM   8172  C CB  . THR E  5  213 ? -26.433 -62.283 37.315  1.00 0.00 ? 213 THR E CB  1 
ATOM   8173  O OG1 . THR E  5  213 ? -25.055 -62.025 37.074  1.00 0.00 ? 213 THR E OG1 1 
ATOM   8174  C CG2 . THR E  5  213 ? -26.580 -63.675 37.965  1.00 0.00 ? 213 THR E CG2 1 
ATOM   8175  N N   . ASN E  5  214 ? -28.038 -63.731 34.366  1.00 0.00 ? 214 ASN E N   1 
ATOM   8176  C CA  . ASN E  5  214 ? -27.892 -64.666 33.282  1.00 0.00 ? 214 ASN E CA  1 
ATOM   8177  C C   . ASN E  5  214 ? -28.725 -64.168 32.117  1.00 0.00 ? 214 ASN E C   1 
ATOM   8178  O O   . ASN E  5  214 ? -28.969 -64.888 31.151  1.00 0.00 ? 214 ASN E O   1 
ATOM   8179  C CB  . ASN E  5  214 ? -28.290 -66.102 33.711  1.00 0.00 ? 214 ASN E CB  1 
ATOM   8180  C CG  . ASN E  5  214 ? -27.504 -67.125 32.895  1.00 0.00 ? 214 ASN E CG  1 
ATOM   8181  O OD1 . ASN E  5  214 ? -26.981 -66.800 31.826  1.00 0.00 ? 214 ASN E OD1 1 
ATOM   8182  N ND2 . ASN E  5  214 ? -27.410 -68.377 33.426  1.00 0.00 ? 214 ASN E ND2 1 
ATOM   8183  N N   . ILE E  5  215 ? -29.118 -62.877 32.162  1.00 0.00 ? 215 ILE E N   1 
ATOM   8184  C CA  . ILE E  5  215 ? -29.826 -62.216 31.100  1.00 0.00 ? 215 ILE E CA  1 
ATOM   8185  C C   . ILE E  5  215 ? -29.388 -60.799 31.223  1.00 0.00 ? 215 ILE E C   1 
ATOM   8186  O O   . ILE E  5  215 ? -29.101 -60.332 32.321  1.00 0.00 ? 215 ILE E O   1 
ATOM   8187  C CB  . ILE E  5  215 ? -31.356 -62.288 31.236  1.00 0.00 ? 215 ILE E CB  1 
ATOM   8188  C CG1 . ILE E  5  215 ? -32.138 -61.606 30.080  1.00 0.00 ? 215 ILE E CG1 1 
ATOM   8189  C CG2 . ILE E  5  215 ? -31.797 -61.735 32.609  1.00 0.00 ? 215 ILE E CG2 1 
ATOM   8190  C CD1 . ILE E  5  215 ? -33.659 -61.639 30.226  1.00 0.00 ? 215 ILE E CD1 1 
ATOM   8191  N N   . GLU E  5  216 ? -29.448 -60.063 30.093  1.00 0.00 ? 216 GLU E N   1 
ATOM   8192  C CA  . GLU E  5  216 ? -29.360 -58.631 30.061  1.00 0.00 ? 216 GLU E CA  1 
ATOM   8193  C C   . GLU E  5  216 ? -30.468 -58.216 29.147  1.00 0.00 ? 216 GLU E C   1 
ATOM   8194  O O   . GLU E  5  216 ? -30.388 -58.405 27.937  1.00 0.00 ? 216 GLU E O   1 
ATOM   8195  C CB  . GLU E  5  216 ? -28.007 -58.119 29.544  1.00 0.00 ? 216 GLU E CB  1 
ATOM   8196  C CG  . GLU E  5  216 ? -26.961 -58.326 30.636  1.00 0.00 ? 216 GLU E CG  1 
ATOM   8197  C CD  . GLU E  5  216 ? -25.577 -57.942 30.168  1.00 0.00 ? 216 GLU E CD  1 
ATOM   8198  O OE1 . GLU E  5  216 ? -25.092 -58.550 29.179  1.00 0.00 ? 216 GLU E OE1 1 
ATOM   8199  O OE2 . GLU E  5  216 ? -24.969 -57.054 30.822  1.00 0.00 ? 216 GLU E OE2 1 
ATOM   8200  N N   . LEU E  5  217 ? -31.550 -57.667 29.735  1.00 0.00 ? 217 LEU E N   1 
ATOM   8201  C CA  . LEU E  5  217 ? -32.740 -57.255 29.037  1.00 0.00 ? 217 LEU E CA  1 
ATOM   8202  C C   . LEU E  5  217 ? -32.627 -55.781 28.753  1.00 0.00 ? 217 LEU E C   1 
ATOM   8203  O O   . LEU E  5  217 ? -32.028 -55.061 29.543  1.00 0.00 ? 217 LEU E O   1 
ATOM   8204  C CB  . LEU E  5  217 ? -33.977 -57.480 29.935  1.00 0.00 ? 217 LEU E CB  1 
ATOM   8205  C CG  . LEU E  5  217 ? -35.348 -57.385 29.232  1.00 0.00 ? 217 LEU E CG  1 
ATOM   8206  C CD1 . LEU E  5  217 ? -35.598 -58.644 28.392  1.00 0.00 ? 217 LEU E CD1 1 
ATOM   8207  C CD2 . LEU E  5  217 ? -36.494 -57.156 30.228  1.00 0.00 ? 217 LEU E CD2 1 
ATOM   8208  N N   . ALA E  5  218 ? -33.179 -55.273 27.627  1.00 0.00 ? 218 ALA E N   1 
ATOM   8209  C CA  . ALA E  5  218 ? -33.307 -53.845 27.480  1.00 0.00 ? 218 ALA E CA  1 
ATOM   8210  C C   . ALA E  5  218 ? -34.572 -53.563 26.758  1.00 0.00 ? 218 ALA E C   1 
ATOM   8211  O O   . ALA E  5  218 ? -34.959 -54.321 25.881  1.00 0.00 ? 218 ALA E O   1 
ATOM   8212  C CB  . ALA E  5  218 ? -32.141 -53.163 26.777  1.00 0.00 ? 218 ALA E CB  1 
ATOM   8213  N N   . THR E  5  219 ? -35.312 -52.529 27.198  1.00 0.00 ? 219 THR E N   1 
ATOM   8214  C CA  . THR E  5  219 ? -36.666 -52.293 26.776  1.00 0.00 ? 219 THR E CA  1 
ATOM   8215  C C   . THR E  5  219 ? -36.834 -50.842 26.410  1.00 0.00 ? 219 THR E C   1 
ATOM   8216  O O   . THR E  5  219 ? -36.154 -49.992 26.972  1.00 0.00 ? 219 THR E O   1 
ATOM   8217  C CB  . THR E  5  219 ? -37.655 -52.645 27.897  1.00 0.00 ? 219 THR E CB  1 
ATOM   8218  O OG1 . THR E  5  219 ? -37.518 -51.810 29.041  1.00 0.00 ? 219 THR E OG1 1 
ATOM   8219  C CG2 . THR E  5  219 ? -37.450 -54.107 28.349  1.00 0.00 ? 219 THR E CG2 1 
ATOM   8220  N N   . VAL E  5  220 ? -37.779 -50.521 25.491  1.00 0.00 ? 220 VAL E N   1 
ATOM   8221  C CA  . VAL E  5  220 ? -38.071 -49.153 25.130  1.00 0.00 ? 220 VAL E CA  1 
ATOM   8222  C C   . VAL E  5  220 ? -39.574 -48.992 25.080  1.00 0.00 ? 220 VAL E C   1 
ATOM   8223  O O   . VAL E  5  220 ? -40.210 -49.326 24.087  1.00 0.00 ? 220 VAL E O   1 
ATOM   8224  C CB  . VAL E  5  220 ? -37.514 -48.682 23.784  1.00 0.00 ? 220 VAL E CB  1 
ATOM   8225  C CG1 . VAL E  5  220 ? -37.440 -47.143 23.799  1.00 0.00 ? 220 VAL E CG1 1 
ATOM   8226  C CG2 . VAL E  5  220 ? -36.129 -49.276 23.547  1.00 0.00 ? 220 VAL E CG2 1 
ATOM   8227  N N   . GLN E  5  221 ? -40.147 -48.374 26.112  1.00 0.00 ? 221 GLN E N   1 
ATOM   8228  C CA  . GLN E  5  221 ? -41.568 -48.007 26.131  1.00 0.00 ? 221 GLN E CA  1 
ATOM   8229  C C   . GLN E  5  221 ? -41.829 -46.879 25.128  1.00 0.00 ? 221 GLN E C   1 
ATOM   8230  O O   . GLN E  5  221 ? -40.905 -46.153 24.774  1.00 0.00 ? 221 GLN E O   1 
ATOM   8231  C CB  . GLN E  5  221 ? -41.990 -47.570 27.534  1.00 0.00 ? 221 GLN E CB  1 
ATOM   8232  C CG  . GLN E  5  221 ? -41.970 -48.680 28.575  1.00 0.00 ? 221 GLN E CG  1 
ATOM   8233  C CD  . GLN E  5  221 ? -42.326 -48.181 29.963  1.00 0.00 ? 221 GLN E CD  1 
ATOM   8234  O OE1 . GLN E  5  221 ? -42.151 -47.005 30.274  1.00 0.00 ? 221 GLN E OE1 1 
ATOM   8235  N NE2 . GLN E  5  221 ? -42.835 -49.074 30.802  1.00 0.00 ? 221 GLN E NE2 1 
ATOM   8236  N N   . PRO E  5  222 ? -43.070 -46.742 24.652  1.00 0.00 ? 222 PRO E N   1 
ATOM   8237  C CA  . PRO E  5  222 ? -43.351 -45.913 23.489  1.00 0.00 ? 222 PRO E CA  1 
ATOM   8238  C C   . PRO E  5  222 ? -42.839 -44.532 23.689  1.00 0.00 ? 222 PRO E C   1 
ATOM   8239  O O   . PRO E  5  222 ? -42.361 -43.953 22.720  1.00 0.00 ? 222 PRO E O   1 
ATOM   8240  C CB  . PRO E  5  222 ? -44.877 -45.886 23.363  1.00 0.00 ? 222 PRO E CB  1 
ATOM   8241  C CG  . PRO E  5  222 ? -45.416 -46.373 24.714  1.00 0.00 ? 222 PRO E CG  1 
ATOM   8242  C CD  . PRO E  5  222 ? -44.296 -47.258 25.257  1.00 0.00 ? 222 PRO E CD  1 
ATOM   8243  N N   . GLY E  5  223 ? -42.947 -44.028 24.948  1.00 0.00 ? 223 GLY E N   1 
ATOM   8244  C CA  . GLY E  5  223 ? -42.577 -42.699 25.357  1.00 0.00 ? 223 GLY E CA  1 
ATOM   8245  C C   . GLY E  5  223 ? -41.153 -42.584 25.821  1.00 0.00 ? 223 GLY E C   1 
ATOM   8246  O O   . GLY E  5  223 ? -40.578 -41.511 25.681  1.00 0.00 ? 223 GLY E O   1 
ATOM   8247  N N   . GLN E  5  224 ? -40.525 -43.652 26.379  1.00 0.00 ? 224 GLN E N   1 
ATOM   8248  C CA  . GLN E  5  224 ? -39.210 -43.508 26.961  1.00 0.00 ? 224 GLN E CA  1 
ATOM   8249  C C   . GLN E  5  224 ? -38.122 -43.636 25.944  1.00 0.00 ? 224 GLN E C   1 
ATOM   8250  O O   . GLN E  5  224 ? -38.337 -44.080 24.816  1.00 0.00 ? 224 GLN E O   1 
ATOM   8251  C CB  . GLN E  5  224 ? -38.860 -44.511 28.101  1.00 0.00 ? 224 GLN E CB  1 
ATOM   8252  C CG  . GLN E  5  224 ? -38.339 -45.900 27.660  1.00 0.00 ? 224 GLN E CG  1 
ATOM   8253  C CD  . GLN E  5  224 ? -37.958 -46.760 28.866  1.00 0.00 ? 224 GLN E CD  1 
ATOM   8254  O OE1 . GLN E  5  224 ? -37.536 -46.233 29.902  1.00 0.00 ? 224 GLN E OE1 1 
ATOM   8255  N NE2 . GLN E  5  224 ? -38.083 -48.112 28.695  1.00 0.00 ? 224 GLN E NE2 1 
ATOM   8256  N N   . ASN E  5  225 ? -36.898 -43.260 26.396  1.00 0.00 ? 225 ASN E N   1 
ATOM   8257  C CA  . ASN E  5  225 ? -35.643 -43.484 25.725  1.00 0.00 ? 225 ASN E CA  1 
ATOM   8258  C C   . ASN E  5  225 ? -35.066 -44.739 26.299  1.00 0.00 ? 225 ASN E C   1 
ATOM   8259  O O   . ASN E  5  225 ? -35.183 -44.977 27.499  1.00 0.00 ? 225 ASN E O   1 
ATOM   8260  C CB  . ASN E  5  225 ? -34.610 -42.370 25.962  1.00 0.00 ? 225 ASN E CB  1 
ATOM   8261  C CG  . ASN E  5  225 ? -35.272 -41.029 25.656  1.00 0.00 ? 225 ASN E CG  1 
ATOM   8262  O OD1 . ASN E  5  225 ? -35.866 -40.415 26.551  1.00 0.00 ? 225 ASN E OD1 1 
ATOM   8263  N ND2 . ASN E  5  225 ? -35.173 -40.583 24.369  1.00 0.00 ? 225 ASN E ND2 1 
ATOM   8264  N N   . PHE E  5  226 ? -34.321 -45.460 25.466  1.00 0.00 ? 226 PHE E N   1 
ATOM   8265  C CA  . PHE E  5  226 ? -33.976 -46.861 25.669  1.00 0.00 ? 226 PHE E CA  1 
ATOM   8266  C C   . PHE E  5  226 ? -33.254 -47.086 26.988  1.00 0.00 ? 226 PHE E C   1 
ATOM   8267  O O   . PHE E  5  226 ? -32.471 -46.259 27.443  1.00 0.00 ? 226 PHE E O   1 
ATOM   8268  C CB  . PHE E  5  226 ? -33.128 -47.363 24.495  1.00 0.00 ? 226 PHE E CB  1 
ATOM   8269  C CG  . PHE E  5  226 ? -32.472 -48.691 24.741  1.00 0.00 ? 226 PHE E CG  1 
ATOM   8270  C CD1 . PHE E  5  226 ? -33.232 -49.825 24.969  1.00 0.00 ? 226 PHE E CD1 1 
ATOM   8271  C CD2 . PHE E  5  226 ? -31.093 -48.807 24.735  1.00 0.00 ? 226 PHE E CD2 1 
ATOM   8272  C CE1 . PHE E  5  226 ? -32.629 -51.047 25.192  1.00 0.00 ? 226 PHE E CE1 1 
ATOM   8273  C CE2 . PHE E  5  226 ? -30.485 -50.025 24.958  1.00 0.00 ? 226 PHE E CE2 1 
ATOM   8274  C CZ  . PHE E  5  226 ? -31.254 -51.147 25.188  1.00 0.00 ? 226 PHE E CZ  1 
ATOM   8275  N N   . HIS E  5  227 ? -33.723 -48.120 27.673  1.00 0.00 ? 227 HIS E N   1 
ATOM   8276  C CA  . HIS E  5  227 ? -33.284 -48.414 29.016  1.00 0.00 ? 227 HIS E CA  1 
ATOM   8277  C C   . HIS E  5  227 ? -32.824 -49.847 29.142  1.00 0.00 ? 227 HIS E C   1 
ATOM   8278  O O   . HIS E  5  227 ? -33.573 -50.787 28.891  1.00 0.00 ? 227 HIS E O   1 
ATOM   8279  C CB  . HIS E  5  227 ? -34.418 -48.149 30.016  1.00 0.00 ? 227 HIS E CB  1 
ATOM   8280  C CG  . HIS E  5  227 ? -35.451 -49.235 30.064  1.00 0.00 ? 227 HIS E CG  1 
ATOM   8281  N ND1 . HIS E  5  227 ? -36.603 -49.203 29.309  1.00 0.00 ? 227 HIS E ND1 1 
ATOM   8282  C CD2 . HIS E  5  227 ? -35.489 -50.396 30.759  1.00 0.00 ? 227 HIS E CD2 1 
ATOM   8283  C CE1 . HIS E  5  227 ? -37.314 -50.291 29.546  1.00 0.00 ? 227 HIS E CE1 1 
ATOM   8284  N NE2 . HIS E  5  227 ? -36.660 -51.031 30.422  1.00 0.00 ? 227 HIS E NE2 1 
ATOM   8285  N N   . MET E  5  228 ? -31.595 -49.993 29.586  1.00 0.00 ? 228 MET E N   1 
ATOM   8286  C CA  . MET E  5  228 ? -31.085 -51.253 30.089  1.00 0.00 ? 228 MET E CA  1 
ATOM   8287  C C   . MET E  5  228 ? -31.797 -51.558 31.366  1.00 0.00 ? 228 MET E C   1 
ATOM   8288  O O   . MET E  5  228 ? -31.916 -50.693 32.225  1.00 0.00 ? 228 MET E O   1 
ATOM   8289  C CB  . MET E  5  228 ? -29.559 -51.199 30.339  1.00 0.00 ? 228 MET E CB  1 
ATOM   8290  C CG  . MET E  5  228 ? -28.964 -52.203 31.357  1.00 0.00 ? 228 MET E CG  1 
ATOM   8291  S SD  . MET E  5  228 ? -29.234 -53.951 30.987  1.00 0.00 ? 228 MET E SD  1 
ATOM   8292  C CE  . MET E  5  228 ? -28.732 -54.720 32.549  1.00 0.00 ? 228 MET E CE  1 
ATOM   8293  N N   . PHE E  5  229 ? -32.332 -52.770 31.459  1.00 0.00 ? 229 PHE E N   1 
ATOM   8294  C CA  . PHE E  5  229 ? -33.181 -53.144 32.577  1.00 0.00 ? 229 PHE E CA  1 
ATOM   8295  C C   . PHE E  5  229 ? -32.371 -53.623 33.769  1.00 0.00 ? 229 PHE E C   1 
ATOM   8296  O O   . PHE E  5  229 ? -31.505 -54.489 33.644  1.00 0.00 ? 229 PHE E O   1 
ATOM   8297  C CB  . PHE E  5  229 ? -34.176 -54.226 32.152  1.00 0.00 ? 229 PHE E CB  1 
ATOM   8298  C CG  . PHE E  5  229 ? -35.515 -54.117 32.823  1.00 0.00 ? 229 PHE E CG  1 
ATOM   8299  C CD1 . PHE E  5  229 ? -36.522 -53.345 32.266  1.00 0.00 ? 229 PHE E CD1 1 
ATOM   8300  C CD2 . PHE E  5  229 ? -35.768 -54.784 34.010  1.00 0.00 ? 229 PHE E CD2 1 
ATOM   8301  C CE1 . PHE E  5  229 ? -37.755 -53.241 32.881  1.00 0.00 ? 229 PHE E CE1 1 
ATOM   8302  C CE2 . PHE E  5  229 ? -36.999 -54.684 34.630  1.00 0.00 ? 229 PHE E CE2 1 
ATOM   8303  C CZ  . PHE E  5  229 ? -37.994 -53.911 34.064  1.00 0.00 ? 229 PHE E CZ  1 
ATOM   8304  N N   . THR E  5  230 ? -32.671 -53.055 34.929  1.00 0.00 ? 230 THR E N   1 
ATOM   8305  C CA  . THR E  5  230 ? -32.069 -53.490 36.165  1.00 0.00 ? 230 THR E CA  1 
ATOM   8306  C C   . THR E  5  230 ? -32.613 -54.841 36.532  1.00 0.00 ? 230 THR E C   1 
ATOM   8307  O O   . THR E  5  230 ? -33.715 -55.209 36.129  1.00 0.00 ? 230 THR E O   1 
ATOM   8308  C CB  . THR E  5  230 ? -32.266 -52.527 37.324  1.00 0.00 ? 230 THR E CB  1 
ATOM   8309  O OG1 . THR E  5  230 ? -31.379 -52.833 38.396  1.00 0.00 ? 230 THR E OG1 1 
ATOM   8310  C CG2 . THR E  5  230 ? -33.728 -52.527 37.834  1.00 0.00 ? 230 THR E CG2 1 
ATOM   8311  N N   . LYS E  5  231 ? -31.740 -55.626 37.193  1.00 0.00 ? 231 LYS E N   1 
ATOM   8312  C CA  . LYS E  5  231 ? -31.874 -57.017 37.515  1.00 0.00 ? 231 LYS E CA  1 
ATOM   8313  C C   . LYS E  5  231 ? -32.988 -57.390 38.446  1.00 0.00 ? 231 LYS E C   1 
ATOM   8314  O O   . LYS E  5  231 ? -33.546 -58.478 38.349  1.00 0.00 ? 231 LYS E O   1 
ATOM   8315  C CB  . LYS E  5  231 ? -30.542 -57.497 38.088  1.00 0.00 ? 231 LYS E CB  1 
ATOM   8316  C CG  . LYS E  5  231 ? -29.435 -57.379 37.038  1.00 0.00 ? 231 LYS E CG  1 
ATOM   8317  C CD  . LYS E  5  231 ? -28.187 -58.184 37.404  1.00 0.00 ? 231 LYS E CD  1 
ATOM   8318  C CE  . LYS E  5  231 ? -27.169 -58.202 36.264  1.00 0.00 ? 231 LYS E CE  1 
ATOM   8319  N NZ  . LYS E  5  231 ? -26.014 -59.039 36.622  1.00 0.00 ? 231 LYS E NZ  1 
ATOM   8320  N N   . GLU E  5  232 ? -33.340 -56.521 39.398  1.00 0.00 ? 232 GLU E N   1 
ATOM   8321  C CA  . GLU E  5  232 ? -34.327 -56.821 40.401  1.00 0.00 ? 232 GLU E CA  1 
ATOM   8322  C C   . GLU E  5  232 ? -35.708 -57.049 39.823  1.00 0.00 ? 232 GLU E C   1 
ATOM   8323  O O   . GLU E  5  232 ? -36.482 -57.879 40.297  1.00 0.00 ? 232 GLU E O   1 
ATOM   8324  C CB  . GLU E  5  232 ? -34.338 -55.664 41.416  1.00 0.00 ? 232 GLU E CB  1 
ATOM   8325  C CG  . GLU E  5  232 ? -35.177 -55.947 42.674  1.00 0.00 ? 232 GLU E CG  1 
ATOM   8326  C CD  . GLU E  5  232 ? -34.877 -54.933 43.771  1.00 0.00 ? 232 GLU E CD  1 
ATOM   8327  O OE1 . GLU E  5  232 ? -34.019 -54.038 43.554  1.00 0.00 ? 232 GLU E OE1 1 
ATOM   8328  O OE2 . GLU E  5  232 ? -35.503 -55.050 44.855  1.00 0.00 ? 232 GLU E OE2 1 
ATOM   8329  N N   . GLU E  5  233 ? -36.022 -56.268 38.777  1.00 0.00 ? 233 GLU E N   1 
ATOM   8330  C CA  . GLU E  5  233 ? -37.226 -56.283 37.981  1.00 0.00 ? 233 GLU E CA  1 
ATOM   8331  C C   . GLU E  5  233 ? -37.380 -57.569 37.162  1.00 0.00 ? 233 GLU E C   1 
ATOM   8332  O O   . GLU E  5  233 ? -38.487 -58.038 36.900  1.00 0.00 ? 233 GLU E O   1 
ATOM   8333  C CB  . GLU E  5  233 ? -37.122 -55.037 37.069  1.00 0.00 ? 233 GLU E CB  1 
ATOM   8334  C CG  . GLU E  5  233 ? -38.383 -54.594 36.326  1.00 0.00 ? 233 GLU E CG  1 
ATOM   8335  C CD  . GLU E  5  233 ? -39.466 -54.080 37.262  1.00 0.00 ? 233 GLU E CD  1 
ATOM   8336  O OE1 . GLU E  5  233 ? -40.273 -54.905 37.764  1.00 0.00 ? 233 GLU E OE1 1 
ATOM   8337  O OE2 . GLU E  5  233 ? -39.523 -52.839 37.453  1.00 0.00 ? 233 GLU E OE2 1 
ATOM   8338  N N   . LEU E  5  234 ? -36.233 -58.141 36.731  1.00 0.00 ? 234 LEU E N   1 
ATOM   8339  C CA  . LEU E  5  234 ? -36.078 -59.364 35.977  1.00 0.00 ? 234 LEU E CA  1 
ATOM   8340  C C   . LEU E  5  234 ? -36.457 -60.645 36.688  1.00 0.00 ? 234 LEU E C   1 
ATOM   8341  O O   . LEU E  5  234 ? -36.764 -61.645 36.039  1.00 0.00 ? 234 LEU E O   1 
ATOM   8342  C CB  . LEU E  5  234 ? -34.655 -59.485 35.399  1.00 0.00 ? 234 LEU E CB  1 
ATOM   8343  C CG  . LEU E  5  234 ? -34.224 -58.227 34.602  1.00 0.00 ? 234 LEU E CG  1 
ATOM   8344  C CD1 . LEU E  5  234 ? -32.798 -58.349 34.039  1.00 0.00 ? 234 LEU E CD1 1 
ATOM   8345  C CD2 . LEU E  5  234 ? -35.198 -57.890 33.464  1.00 0.00 ? 234 LEU E CD2 1 
ATOM   8346  N N   . GLU E  5  235 ? -36.384 -60.666 38.045  1.00 0.00 ? 235 GLU E N   1 
ATOM   8347  C CA  . GLU E  5  235 ? -36.712 -61.829 38.863  1.00 0.00 ? 235 GLU E CA  1 
ATOM   8348  C C   . GLU E  5  235 ? -38.201 -62.037 38.952  1.00 0.00 ? 235 GLU E C   1 
ATOM   8349  O O   . GLU E  5  235 ? -38.672 -63.070 39.422  1.00 0.00 ? 235 GLU E O   1 
ATOM   8350  C CB  . GLU E  5  235 ? -36.292 -61.605 40.341  1.00 0.00 ? 235 GLU E CB  1 
ATOM   8351  C CG  . GLU E  5  235 ? -34.795 -61.338 40.574  1.00 0.00 ? 235 GLU E CG  1 
ATOM   8352  C CD  . GLU E  5  235 ? -33.993 -62.626 40.448  1.00 0.00 ? 235 GLU E CD  1 
ATOM   8353  O OE1 . GLU E  5  235 ? -34.368 -63.622 41.123  1.00 0.00 ? 235 GLU E OE1 1 
ATOM   8354  O OE2 . GLU E  5  235 ? -32.979 -62.628 39.699  1.00 0.00 ? 235 GLU E OE2 1 
ATOM   8355  N N   . GLU E  5  236 ? -38.958 -61.008 38.557  1.00 0.00 ? 236 GLU E N   1 
ATOM   8356  C CA  . GLU E  5  236 ? -40.379 -60.968 38.664  1.00 0.00 ? 236 GLU E CA  1 
ATOM   8357  C C   . GLU E  5  236 ? -41.010 -61.091 37.274  1.00 0.00 ? 236 GLU E C   1 
ATOM   8358  C CB  . GLU E  5  236 ? -40.730 -59.633 39.349  1.00 0.00 ? 236 GLU E CB  1 
ATOM   8359  C CG  . GLU E  5  236 ? -41.778 -59.727 40.470  1.00 0.00 ? 236 GLU E CG  1 
ATOM   8360  C CD  . GLU E  5  236 ? -41.684 -58.456 41.320  1.00 0.00 ? 236 GLU E CD  1 
ATOM   8361  O OE1 . GLU E  5  236 ? -41.640 -57.344 40.727  1.00 0.00 ? 236 GLU E OE1 1 
ATOM   8362  O OE2 . GLU E  5  236 ? -41.636 -58.580 42.573  1.00 0.00 ? 236 GLU E OE2 1 
ATOM   8363  N N   . TYR F  6  6   ? -11.208 -77.300 -13.639 1.00 0.00 ? 6   TYR F N   1 
ATOM   8364  C CA  . TYR F  6  6   ? -11.450 -76.616 -12.353 1.00 0.00 ? 6   TYR F CA  1 
ATOM   8365  C C   . TYR F  6  6   ? -11.577 -75.175 -12.666 1.00 0.00 ? 6   TYR F C   1 
ATOM   8366  O O   . TYR F  6  6   ? -10.630 -74.576 -13.169 1.00 0.00 ? 6   TYR F O   1 
ATOM   8367  C CB  . TYR F  6  6   ? -10.274 -76.870 -11.385 1.00 0.00 ? 6   TYR F CB  1 
ATOM   8368  C CG  . TYR F  6  6   ? -10.594 -76.432 -9.983  1.00 0.00 ? 6   TYR F CG  1 
ATOM   8369  C CD1 . TYR F  6  6   ? -11.615 -77.077 -9.270  1.00 0.00 ? 6   TYR F CD1 1 
ATOM   8370  C CD2 . TYR F  6  6   ? -9.821  -75.454 -9.343  1.00 0.00 ? 6   TYR F CD2 1 
ATOM   8371  C CE1 . TYR F  6  6   ? -11.821 -76.790 -7.917  1.00 0.00 ? 6   TYR F CE1 1 
ATOM   8372  C CE2 . TYR F  6  6   ? -10.032 -75.154 -7.993  1.00 0.00 ? 6   TYR F CE2 1 
ATOM   8373  C CZ  . TYR F  6  6   ? -11.023 -75.835 -7.269  1.00 0.00 ? 6   TYR F CZ  1 
ATOM   8374  O OH  . TYR F  6  6   ? -11.232 -75.562 -5.896  1.00 0.00 ? 6   TYR F OH  1 
ATOM   8375  N N   . ASP F  6  7   ? -12.803 -74.684 -12.528 1.00 0.00 ? 7   ASP F N   1 
ATOM   8376  C CA  . ASP F  6  7   ? -13.156 -73.324 -12.882 1.00 0.00 ? 7   ASP F CA  1 
ATOM   8377  C C   . ASP F  6  7   ? -13.936 -72.763 -11.718 1.00 0.00 ? 7   ASP F C   1 
ATOM   8378  O O   . ASP F  6  7   ? -15.134 -72.501 -11.817 1.00 0.00 ? 7   ASP F O   1 
ATOM   8379  C CB  . ASP F  6  7   ? -14.008 -73.293 -14.154 1.00 0.00 ? 7   ASP F CB  1 
ATOM   8380  C CG  . ASP F  6  7   ? -13.215 -73.641 -15.400 1.00 0.00 ? 7   ASP F CG  1 
ATOM   8381  O OD1 . ASP F  6  7   ? -11.970 -73.631 -15.340 1.00 0.00 ? 7   ASP F OD1 1 
ATOM   8382  O OD2 . ASP F  6  7   ? -13.842 -73.926 -16.440 1.00 0.00 ? 7   ASP F OD2 1 
ATOM   8383  N N   . ASN F  6  8   ? -13.228 -72.586 -10.611 1.00 0.00 ? 8   ASN F N   1 
ATOM   8384  C CA  . ASN F  6  8   ? -13.771 -71.990 -9.420  1.00 0.00 ? 8   ASN F CA  1 
ATOM   8385  C C   . ASN F  6  8   ? -13.310 -70.575 -9.277  1.00 0.00 ? 8   ASN F C   1 
ATOM   8386  O O   . ASN F  6  8   ? -13.507 -69.966 -8.224  1.00 0.00 ? 8   ASN F O   1 
ATOM   8387  C CB  . ASN F  6  8   ? -13.387 -72.766 -8.146  1.00 0.00 ? 8   ASN F CB  1 
ATOM   8388  C CG  . ASN F  6  8   ? -14.306 -73.983 -8.033  1.00 0.00 ? 8   ASN F CG  1 
ATOM   8389  O OD1 . ASN F  6  8   ? -14.694 -74.577 -9.044  1.00 0.00 ? 8   ASN F OD1 1 
ATOM   8390  N ND2 . ASN F  6  8   ? -14.666 -74.342 -6.761  1.00 0.00 ? 8   ASN F ND2 1 
ATOM   8391  N N   . ASP F  6  9   ? -12.740 -69.994 -10.354 1.00 0.00 ? 9   ASP F N   1 
ATOM   8392  C CA  . ASP F  6  9   ? -12.401 -68.599 -10.383 1.00 0.00 ? 9   ASP F CA  1 
ATOM   8393  C C   . ASP F  6  9   ? -13.161 -67.966 -11.500 1.00 0.00 ? 9   ASP F C   1 
ATOM   8394  O O   . ASP F  6  9   ? -13.501 -68.593 -12.494 1.00 0.00 ? 9   ASP F O   1 
ATOM   8395  C CB  . ASP F  6  9   ? -10.892 -68.344 -10.554 1.00 0.00 ? 9   ASP F CB  1 
ATOM   8396  C CG  . ASP F  6  9   ? -10.188 -68.709 -9.249  1.00 0.00 ? 9   ASP F CG  1 
ATOM   8397  O OD1 . ASP F  6  9   ? -10.386 -67.976 -8.243  1.00 0.00 ? 9   ASP F OD1 1 
ATOM   8398  O OD2 . ASP F  6  9   ? -9.448  -69.726 -9.236  1.00 0.00 ? 9   ASP F OD2 1 
ATOM   8399  N N   . VAL F  6  10  ? -13.511 -66.688 -11.272 1.00 0.00 ? 10  VAL F N   1 
ATOM   8400  C CA  . VAL F  6  10  ? -14.291 -65.803 -12.094 1.00 0.00 ? 10  VAL F CA  1 
ATOM   8401  C C   . VAL F  6  10  ? -13.645 -65.542 -13.422 1.00 0.00 ? 10  VAL F C   1 
ATOM   8402  O O   . VAL F  6  10  ? -14.312 -65.475 -14.448 1.00 0.00 ? 10  VAL F O   1 
ATOM   8403  C CB  . VAL F  6  10  ? -14.512 -64.466 -11.409 1.00 0.00 ? 10  VAL F CB  1 
ATOM   8404  C CG1 . VAL F  6  10  ? -15.686 -63.768 -12.119 1.00 0.00 ? 10  VAL F CG1 1 
ATOM   8405  C CG2 . VAL F  6  10  ? -14.790 -64.682 -9.904  1.00 0.00 ? 10  VAL F CG2 1 
ATOM   8406  N N   . THR F  6  11  ? -12.300 -65.441 -13.434 1.00 0.00 ? 11  THR F N   1 
ATOM   8407  C CA  . THR F  6  11  ? -11.520 -65.134 -14.602 1.00 0.00 ? 11  THR F CA  1 
ATOM   8408  C C   . THR F  6  11  ? -11.507 -66.328 -15.503 1.00 0.00 ? 11  THR F C   1 
ATOM   8409  O O   . THR F  6  11  ? -11.697 -66.211 -16.705 1.00 0.00 ? 11  THR F O   1 
ATOM   8410  C CB  . THR F  6  11  ? -10.120 -64.794 -14.177 1.00 0.00 ? 11  THR F CB  1 
ATOM   8411  O OG1 . THR F  6  11  ? -10.173 -63.590 -13.442 1.00 0.00 ? 11  THR F OG1 1 
ATOM   8412  C CG2 . THR F  6  11  ? -9.153  -64.593 -15.352 1.00 0.00 ? 11  THR F CG2 1 
ATOM   8413  N N   . VAL F  6  12  ? -11.336 -67.533 -14.923 1.00 0.00 ? 12  VAL F N   1 
ATOM   8414  C CA  . VAL F  6  12  ? -11.093 -68.748 -15.643 1.00 0.00 ? 12  VAL F CA  1 
ATOM   8415  C C   . VAL F  6  12  ? -12.253 -69.070 -16.537 1.00 0.00 ? 12  VAL F C   1 
ATOM   8416  O O   . VAL F  6  12  ? -13.394 -68.784 -16.204 1.00 0.00 ? 12  VAL F O   1 
ATOM   8417  C CB  . VAL F  6  12  ? -10.757 -69.895 -14.700 1.00 0.00 ? 12  VAL F CB  1 
ATOM   8418  C CG1 . VAL F  6  12  ? -10.462 -71.199 -15.462 1.00 0.00 ? 12  VAL F CG1 1 
ATOM   8419  C CG2 . VAL F  6  12  ? -9.508  -69.506 -13.889 1.00 0.00 ? 12  VAL F CG2 1 
ATOM   8420  N N   . TRP F  6  13  ? -11.936 -69.602 -17.732 1.00 0.00 ? 13  TRP F N   1 
ATOM   8421  C CA  . TRP F  6  13  ? -12.839 -70.068 -18.724 1.00 0.00 ? 13  TRP F CA  1 
ATOM   8422  C C   . TRP F  6  13  ? -12.724 -71.527 -18.670 1.00 0.00 ? 13  TRP F C   1 
ATOM   8423  O O   . TRP F  6  13  ? -11.621 -72.053 -18.587 1.00 0.00 ? 13  TRP F O   1 
ATOM   8424  C CB  . TRP F  6  13  ? -12.409 -69.704 -20.126 1.00 0.00 ? 13  TRP F CB  1 
ATOM   8425  C CG  . TRP F  6  13  ? -12.614 -68.266 -20.420 1.00 0.00 ? 13  TRP F CG  1 
ATOM   8426  C CD1 . TRP F  6  13  ? -11.828 -67.190 -20.145 1.00 0.00 ? 13  TRP F CD1 1 
ATOM   8427  C CD2 . TRP F  6  13  ? -13.756 -67.774 -21.115 1.00 0.00 ? 13  TRP F CD2 1 
ATOM   8428  N NE1 . TRP F  6  13  ? -12.390 -66.058 -20.662 1.00 0.00 ? 13  TRP F NE1 1 
ATOM   8429  C CE2 . TRP F  6  13  ? -13.572 -66.393 -21.264 1.00 0.00 ? 13  TRP F CE2 1 
ATOM   8430  C CE3 . TRP F  6  13  ? -14.868 -68.418 -21.629 1.00 0.00 ? 13  TRP F CE3 1 
ATOM   8431  C CZ2 . TRP F  6  13  ? -14.481 -65.637 -21.986 1.00 0.00 ? 13  TRP F CZ2 1 
ATOM   8432  C CZ3 . TRP F  6  13  ? -15.803 -67.649 -22.319 1.00 0.00 ? 13  TRP F CZ3 1 
ATOM   8433  C CH2 . TRP F  6  13  ? -15.605 -66.279 -22.512 1.00 0.00 ? 13  TRP F CH2 1 
ATOM   8434  N N   . SER F  6  14  ? -13.858 -72.166 -18.958 1.00 0.00 ? 14  SER F N   1 
ATOM   8435  C CA  . SER F  6  14  ? -13.946 -73.614 -19.072 1.00 0.00 ? 14  SER F CA  1 
ATOM   8436  C C   . SER F  6  14  ? -13.419 -74.212 -20.356 1.00 0.00 ? 14  SER F C   1 
ATOM   8437  O O   . SER F  6  14  ? -13.677 -73.726 -21.459 1.00 0.00 ? 14  SER F O   1 
ATOM   8438  C CB  . SER F  6  14  ? -15.372 -74.133 -18.778 1.00 0.00 ? 14  SER F CB  1 
ATOM   8439  O OG  . SER F  6  14  ? -15.953 -73.477 -17.665 1.00 0.00 ? 14  SER F OG  1 
ATOM   8440  N N   . PRO F  6  15  ? -12.644 -75.352 -20.190 1.00 0.00 ? 15  PRO F N   1 
ATOM   8441  C CA  . PRO F  6  15  ? -12.186 -75.960 -21.454 1.00 0.00 ? 15  PRO F CA  1 
ATOM   8442  C C   . PRO F  6  15  ? -13.456 -76.375 -22.182 1.00 0.00 ? 15  PRO F C   1 
ATOM   8443  O O   . PRO F  6  15  ? -13.596 -76.252 -23.398 1.00 0.00 ? 15  PRO F O   1 
ATOM   8444  C CB  . PRO F  6  15  ? -11.408 -77.195 -21.011 1.00 0.00 ? 15  PRO F CB  1 
ATOM   8445  C CG  . PRO F  6  15  ? -10.925 -76.873 -19.648 1.00 0.00 ? 15  PRO F CG  1 
ATOM   8446  C CD  . PRO F  6  15  ? -12.109 -76.208 -19.039 1.00 0.00 ? 15  PRO F CD  1 
ATOM   8447  N N   . GLN F  6  16  ? -14.392 -76.861 -21.375 1.00 0.00 ? 16  GLN F N   1 
ATOM   8448  C CA  . GLN F  6  16  ? -15.697 -77.268 -21.845 1.00 0.00 ? 16  GLN F CA  1 
ATOM   8449  C C   . GLN F  6  16  ? -16.451 -76.065 -22.408 1.00 0.00 ? 16  GLN F C   1 
ATOM   8450  O O   . GLN F  6  16  ? -17.110 -76.171 -23.429 1.00 0.00 ? 16  GLN F O   1 
ATOM   8451  C CB  . GLN F  6  16  ? -16.504 -77.890 -20.702 1.00 0.00 ? 16  GLN F CB  1 
ATOM   8452  C CG  . GLN F  6  16  ? -15.941 -79.192 -20.152 1.00 0.00 ? 16  GLN F CG  1 
ATOM   8453  C CD  . GLN F  6  16  ? -14.695 -78.992 -19.311 1.00 0.00 ? 16  GLN F CD  1 
ATOM   8454  O OE1 . GLN F  6  16  ? -14.243 -77.867 -19.108 1.00 0.00 ? 16  GLN F OE1 1 
ATOM   8455  N NE2 . GLN F  6  16  ? -14.134 -80.089 -18.817 1.00 0.00 ? 16  GLN F NE2 1 
ATOM   8456  N N   . GLY F  6  17  ? -16.351 -74.916 -21.751 1.00 0.00 ? 17  GLY F N   1 
ATOM   8457  C CA  . GLY F  6  17  ? -17.068 -73.733 -22.202 1.00 0.00 ? 17  GLY F CA  1 
ATOM   8458  C C   . GLY F  6  17  ? -16.771 -72.639 -21.198 1.00 0.00 ? 17  GLY F C   1 
ATOM   8459  O O   . GLY F  6  17  ? -15.686 -72.365 -20.751 1.00 0.00 ? 17  GLY F O   1 
ATOM   8460  N N   . ARG F  6  18  ? -17.784 -71.791 -21.119 1.00 0.00 ? 18  ARG F N   1 
ATOM   8461  C CA  . ARG F  6  18  ? -17.811 -70.528 -20.385 1.00 0.00 ? 18  ARG F CA  1 
ATOM   8462  C C   . ARG F  6  18  ? -17.492 -70.480 -18.883 1.00 0.00 ? 18  ARG F C   1 
ATOM   8463  O O   . ARG F  6  18  ? -17.412 -71.513 -18.229 1.00 0.00 ? 18  ARG F O   1 
ATOM   8464  C CB  . ARG F  6  18  ? -19.197 -69.943 -20.626 1.00 0.00 ? 18  ARG F CB  1 
ATOM   8465  C CG  . ARG F  6  18  ? -19.604 -69.968 -22.095 1.00 0.00 ? 18  ARG F CG  1 
ATOM   8466  C CD  . ARG F  6  18  ? -21.015 -69.438 -22.299 1.00 0.00 ? 18  ARG F CD  1 
ATOM   8467  N NE  . ARG F  6  18  ? -21.440 -69.491 -23.698 1.00 0.00 ? 18  ARG F NE  1 
ATOM   8468  C CZ  . ARG F  6  18  ? -21.951 -70.569 -24.287 1.00 0.00 ? 18  ARG F CZ  1 
ATOM   8469  N NH1 . ARG F  6  18  ? -22.096 -71.693 -23.600 1.00 0.00 ? 18  ARG F NH1 1 
ATOM   8470  N NH2 . ARG F  6  18  ? -22.312 -70.526 -25.563 1.00 0.00 ? 18  ARG F NH2 1 
ATOM   8471  N N   . ILE F  6  19  ? -17.330 -69.258 -18.356 1.00 0.00 ? 19  ILE F N   1 
ATOM   8472  C CA  . ILE F  6  19  ? -17.032 -69.010 -16.967 1.00 0.00 ? 19  ILE F CA  1 
ATOM   8473  C C   . ILE F  6  19  ? -18.108 -69.585 -16.093 1.00 0.00 ? 19  ILE F C   1 
ATOM   8474  O O   . ILE F  6  19  ? -19.292 -69.372 -16.354 1.00 0.00 ? 19  ILE F O   1 
ATOM   8475  C CB  . ILE F  6  19  ? -16.922 -67.534 -16.670 1.00 0.00 ? 19  ILE F CB  1 
ATOM   8476  C CG1 . ILE F  6  19  ? -15.878 -66.845 -17.571 1.00 0.00 ? 19  ILE F CG1 1 
ATOM   8477  C CG2 . ILE F  6  19  ? -16.591 -67.332 -15.174 1.00 0.00 ? 19  ILE F CG2 1 
ATOM   8478  C CD1 . ILE F  6  19  ? -16.435 -66.317 -18.890 1.00 0.00 ? 19  ILE F CD1 1 
ATOM   8479  N N   . HIS F  6  20  ? -17.715 -70.387 -15.076 1.00 0.00 ? 20  HIS F N   1 
ATOM   8480  C CA  . HIS F  6  20  ? -18.671 -71.104 -14.300 1.00 0.00 ? 20  HIS F CA  1 
ATOM   8481  C C   . HIS F  6  20  ? -19.273 -70.272 -13.253 1.00 0.00 ? 20  HIS F C   1 
ATOM   8482  O O   . HIS F  6  20  ? -20.368 -70.595 -12.818 1.00 0.00 ? 20  HIS F O   1 
ATOM   8483  C CB  . HIS F  6  20  ? -18.066 -72.331 -13.613 1.00 0.00 ? 20  HIS F CB  1 
ATOM   8484  C CG  . HIS F  6  20  ? -18.058 -73.542 -14.496 1.00 0.00 ? 20  HIS F CG  1 
ATOM   8485  N ND1 . HIS F  6  20  ? -17.553 -74.763 -14.108 1.00 0.00 ? 20  HIS F ND1 1 
ATOM   8486  C CD2 . HIS F  6  20  ? -18.555 -73.727 -15.747 1.00 0.00 ? 20  HIS F CD2 1 
ATOM   8487  C CE1 . HIS F  6  20  ? -17.761 -75.612 -15.142 1.00 0.00 ? 20  HIS F CE1 1 
ATOM   8488  N NE2 . HIS F  6  20  ? -18.370 -75.032 -16.152 1.00 0.00 ? 20  HIS F NE2 1 
ATOM   8489  N N   . GLN F  6  21  ? -18.614 -69.197 -12.788 1.00 0.00 ? 21  GLN F N   1 
ATOM   8490  C CA  . GLN F  6  21  ? -19.158 -68.345 -11.749 1.00 0.00 ? 21  GLN F CA  1 
ATOM   8491  C C   . GLN F  6  21  ? -20.362 -67.590 -12.167 1.00 0.00 ? 21  GLN F C   1 
ATOM   8492  O O   . GLN F  6  21  ? -21.239 -67.325 -11.362 1.00 0.00 ? 21  GLN F O   1 
ATOM   8493  C CB  . GLN F  6  21  ? -18.141 -67.393 -11.107 1.00 0.00 ? 21  GLN F CB  1 
ATOM   8494  C CG  . GLN F  6  21  ? -16.964 -68.158 -10.492 1.00 0.00 ? 21  GLN F CG  1 
ATOM   8495  C CD  . GLN F  6  21  ? -17.523 -69.198 -9.537  1.00 0.00 ? 21  GLN F CD  1 
ATOM   8496  O OE1 . GLN F  6  21  ? -18.240 -68.849 -8.603  1.00 0.00 ? 21  GLN F OE1 1 
ATOM   8497  N NE2 . GLN F  6  21  ? -17.223 -70.499 -9.802  1.00 0.00 ? 21  GLN F NE2 1 
ATOM   8498  N N   . ILE F  6  22  ? -20.441 -67.230 -13.452 1.00 0.00 ? 22  ILE F N   1 
ATOM   8499  C CA  . ILE F  6  22  ? -21.552 -66.530 -14.035 1.00 0.00 ? 22  ILE F CA  1 
ATOM   8500  C C   . ILE F  6  22  ? -22.719 -67.484 -14.052 1.00 0.00 ? 22  ILE F C   1 
ATOM   8501  O O   . ILE F  6  22  ? -23.833 -67.090 -13.727 1.00 0.00 ? 22  ILE F O   1 
ATOM   8502  C CB  . ILE F  6  22  ? -21.229 -66.038 -15.440 1.00 0.00 ? 22  ILE F CB  1 
ATOM   8503  C CG1 . ILE F  6  22  ? -19.942 -65.174 -15.427 1.00 0.00 ? 22  ILE F CG1 1 
ATOM   8504  C CG2 . ILE F  6  22  ? -22.424 -65.242 -15.995 1.00 0.00 ? 22  ILE F CG2 1 
ATOM   8505  C CD1 . ILE F  6  22  ? -19.511 -64.658 -16.806 1.00 0.00 ? 22  ILE F CD1 1 
ATOM   8506  N N   . GLU F  6  23  ? -22.486 -68.770 -14.406 1.00 0.00 ? 23  GLU F N   1 
ATOM   8507  C CA  . GLU F  6  23  ? -23.493 -69.801 -14.461 1.00 0.00 ? 23  GLU F CA  1 
ATOM   8508  C C   . GLU F  6  23  ? -24.040 -70.137 -13.099 1.00 0.00 ? 23  GLU F C   1 
ATOM   8509  O O   . GLU F  6  23  ? -25.164 -70.599 -12.963 1.00 0.00 ? 23  GLU F O   1 
ATOM   8510  C CB  . GLU F  6  23  ? -22.939 -71.118 -15.023 1.00 0.00 ? 23  GLU F CB  1 
ATOM   8511  C CG  . GLU F  6  23  ? -22.433 -70.998 -16.472 1.00 0.00 ? 23  GLU F CG  1 
ATOM   8512  C CD  . GLU F  6  23  ? -21.690 -72.271 -16.892 1.00 0.00 ? 23  GLU F CD  1 
ATOM   8513  O OE1 . GLU F  6  23  ? -21.556 -73.206 -16.062 1.00 0.00 ? 23  GLU F OE1 1 
ATOM   8514  O OE2 . GLU F  6  23  ? -21.230 -72.310 -18.063 1.00 0.00 ? 23  GLU F OE2 1 
ATOM   8515  N N   . TYR F  6  24  ? -23.228 -69.972 -12.052 1.00 0.00 ? 24  TYR F N   1 
ATOM   8516  C CA  . TYR F  6  24  ? -23.578 -70.229 -10.682 1.00 0.00 ? 24  TYR F CA  1 
ATOM   8517  C C   . TYR F  6  24  ? -24.303 -69.084 -10.106 1.00 0.00 ? 24  TYR F C   1 
ATOM   8518  O O   . TYR F  6  24  ? -25.148 -69.246 -9.236  1.00 0.00 ? 24  TYR F O   1 
ATOM   8519  C CB  . TYR F  6  24  ? -22.364 -70.645 -9.842  1.00 0.00 ? 24  TYR F CB  1 
ATOM   8520  C CG  . TYR F  6  24  ? -21.801 -71.951 -10.353 1.00 0.00 ? 24  TYR F CG  1 
ATOM   8521  C CD1 . TYR F  6  24  ? -22.555 -72.910 -11.067 1.00 0.00 ? 24  TYR F CD1 1 
ATOM   8522  C CD2 . TYR F  6  24  ? -20.462 -72.239 -10.098 1.00 0.00 ? 24  TYR F CD2 1 
ATOM   8523  C CE1 . TYR F  6  24  ? -21.989 -74.108 -11.497 1.00 0.00 ? 24  TYR F CE1 1 
ATOM   8524  C CE2 . TYR F  6  24  ? -19.892 -73.446 -10.511 1.00 0.00 ? 24  TYR F CE2 1 
ATOM   8525  C CZ  . TYR F  6  24  ? -20.664 -74.386 -11.202 1.00 0.00 ? 24  TYR F CZ  1 
ATOM   8526  O OH  . TYR F  6  24  ? -20.139 -75.638 -11.571 1.00 0.00 ? 24  TYR F OH  1 
ATOM   8527  N N   . ALA F  6  25  ? -24.024 -67.884 -10.621 1.00 0.00 ? 25  ALA F N   1 
ATOM   8528  C CA  . ALA F  6  25  ? -24.774 -66.693 -10.351 1.00 0.00 ? 25  ALA F CA  1 
ATOM   8529  C C   . ALA F  6  25  ? -26.192 -66.787 -10.877 1.00 0.00 ? 25  ALA F C   1 
ATOM   8530  O O   . ALA F  6  25  ? -27.084 -66.168 -10.322 1.00 0.00 ? 25  ALA F O   1 
ATOM   8531  C CB  . ALA F  6  25  ? -24.084 -65.453 -10.936 1.00 0.00 ? 25  ALA F CB  1 
ATOM   8532  N N   . MET F  6  26  ? -26.463 -67.554 -11.961 1.00 0.00 ? 26  MET F N   1 
ATOM   8533  C CA  . MET F  6  26  ? -27.811 -67.791 -12.441 1.00 0.00 ? 26  MET F CA  1 
ATOM   8534  C C   . MET F  6  26  ? -28.621 -68.554 -11.452 1.00 0.00 ? 26  MET F C   1 
ATOM   8535  O O   . MET F  6  26  ? -29.827 -68.378 -11.383 1.00 0.00 ? 26  MET F O   1 
ATOM   8536  C CB  . MET F  6  26  ? -27.935 -68.657 -13.724 1.00 0.00 ? 26  MET F CB  1 
ATOM   8537  C CG  . MET F  6  26  ? -26.983 -68.303 -14.868 1.00 0.00 ? 26  MET F CG  1 
ATOM   8538  S SD  . MET F  6  26  ? -26.963 -66.583 -15.367 1.00 0.00 ? 26  MET F SD  1 
ATOM   8539  C CE  . MET F  6  26  ? -25.794 -66.838 -16.725 1.00 0.00 ? 26  MET F CE  1 
ATOM   8540  N N   . GLU F  6  27  ? -27.977 -69.471 -10.709 1.00 0.00 ? 27  GLU F N   1 
ATOM   8541  C CA  . GLU F  6  27  ? -28.634 -70.323 -9.754  1.00 0.00 ? 27  GLU F CA  1 
ATOM   8542  C C   . GLU F  6  27  ? -28.825 -69.601 -8.469  1.00 0.00 ? 27  GLU F C   1 
ATOM   8543  O O   . GLU F  6  27  ? -29.684 -69.963 -7.676  1.00 0.00 ? 27  GLU F O   1 
ATOM   8544  C CB  . GLU F  6  27  ? -27.851 -71.627 -9.482  1.00 0.00 ? 27  GLU F CB  1 
ATOM   8545  C CG  . GLU F  6  27  ? -27.455 -72.409 -10.741 1.00 0.00 ? 27  GLU F CG  1 
ATOM   8546  C CD  . GLU F  6  27  ? -28.651 -72.529 -11.674 1.00 0.00 ? 27  GLU F CD  1 
ATOM   8547  O OE1 . GLU F  6  27  ? -29.706 -73.065 -11.242 1.00 0.00 ? 27  GLU F OE1 1 
ATOM   8548  O OE2 . GLU F  6  27  ? -28.530 -72.068 -12.842 1.00 0.00 ? 27  GLU F OE2 1 
ATOM   8549  N N   . ALA F  6  28  ? -28.066 -68.512 -8.257  1.00 0.00 ? 28  ALA F N   1 
ATOM   8550  C CA  . ALA F  6  28  ? -28.232 -67.642 -7.131  1.00 0.00 ? 28  ALA F CA  1 
ATOM   8551  C C   . ALA F  6  28  ? -29.552 -66.944 -7.207  1.00 0.00 ? 28  ALA F C   1 
ATOM   8552  O O   . ALA F  6  28  ? -30.119 -66.608 -6.172  1.00 0.00 ? 28  ALA F O   1 
ATOM   8553  C CB  . ALA F  6  28  ? -27.127 -66.576 -7.031  1.00 0.00 ? 28  ALA F CB  1 
ATOM   8554  N N   . VAL F  6  29  ? -30.067 -66.720 -8.451  1.00 0.00 ? 29  VAL F N   1 
ATOM   8555  C CA  . VAL F  6  29  ? -31.344 -66.095 -8.730  1.00 0.00 ? 29  VAL F CA  1 
ATOM   8556  C C   . VAL F  6  29  ? -32.492 -66.943 -8.239  1.00 0.00 ? 29  VAL F C   1 
ATOM   8557  O O   . VAL F  6  29  ? -33.548 -66.430 -7.886  1.00 0.00 ? 29  VAL F O   1 
ATOM   8558  C CB  . VAL F  6  29  ? -31.557 -65.808 -10.223 1.00 0.00 ? 29  VAL F CB  1 
ATOM   8559  C CG1 . VAL F  6  29  ? -32.841 -65.001 -10.465 1.00 0.00 ? 29  VAL F CG1 1 
ATOM   8560  C CG2 . VAL F  6  29  ? -30.383 -64.993 -10.777 1.00 0.00 ? 29  VAL F CG2 1 
ATOM   8561  N N   . LYS F  6  30  ? -32.334 -68.279 -8.258  1.00 0.00 ? 30  LYS F N   1 
ATOM   8562  C CA  . LYS F  6  30  ? -33.439 -69.168 -8.056  1.00 0.00 ? 30  LYS F CA  1 
ATOM   8563  C C   . LYS F  6  30  ? -33.900 -69.311 -6.647  1.00 0.00 ? 30  LYS F C   1 
ATOM   8564  O O   . LYS F  6  30  ? -35.018 -69.762 -6.429  1.00 0.00 ? 30  LYS F O   1 
ATOM   8565  C CB  . LYS F  6  30  ? -33.136 -70.574 -8.604  1.00 0.00 ? 30  LYS F CB  1 
ATOM   8566  C CG  . LYS F  6  30  ? -32.712 -70.580 -10.083 1.00 0.00 ? 30  LYS F CG  1 
ATOM   8567  C CD  . LYS F  6  30  ? -33.663 -69.814 -11.019 1.00 0.00 ? 30  LYS F CD  1 
ATOM   8568  C CE  . LYS F  6  30  ? -33.419 -70.098 -12.498 1.00 0.00 ? 30  LYS F CE  1 
ATOM   8569  N NZ  . LYS F  6  30  ? -32.029 -69.780 -12.872 1.00 0.00 ? 30  LYS F NZ  1 
ATOM   8570  N N   . GLN F  6  31  ? -33.091 -68.934 -5.639  1.00 0.00 ? 31  GLN F N   1 
ATOM   8571  C CA  . GLN F  6  31  ? -33.520 -69.054 -4.259  1.00 0.00 ? 31  GLN F CA  1 
ATOM   8572  C C   . GLN F  6  31  ? -34.361 -67.873 -3.870  1.00 0.00 ? 31  GLN F C   1 
ATOM   8573  O O   . GLN F  6  31  ? -35.150 -67.959 -2.931  1.00 0.00 ? 31  GLN F O   1 
ATOM   8574  C CB  . GLN F  6  31  ? -32.355 -69.170 -3.239  1.00 0.00 ? 31  GLN F CB  1 
ATOM   8575  C CG  . GLN F  6  31  ? -31.699 -70.565 -3.178  1.00 0.00 ? 31  GLN F CG  1 
ATOM   8576  C CD  . GLN F  6  31  ? -30.740 -70.776 -4.346  1.00 0.00 ? 31  GLN F CD  1 
ATOM   8577  O OE1 . GLN F  6  31  ? -29.653 -70.188 -4.359  1.00 0.00 ? 31  GLN F OE1 1 
ATOM   8578  N NE2 . GLN F  6  31  ? -31.146 -71.634 -5.332  1.00 0.00 ? 31  GLN F NE2 1 
ATOM   8579  N N   . GLY F  6  32  ? -34.278 -66.753 -4.620  1.00 0.00 ? 32  GLY F N   1 
ATOM   8580  C CA  . GLY F  6  32  ? -35.137 -65.622 -4.387  1.00 0.00 ? 32  GLY F CA  1 
ATOM   8581  C C   . GLY F  6  32  ? -36.489 -65.932 -4.937  1.00 0.00 ? 32  GLY F C   1 
ATOM   8582  O O   . GLY F  6  32  ? -36.638 -66.706 -5.882  1.00 0.00 ? 32  GLY F O   1 
ATOM   8583  N N   . SER F  6  33  ? -37.526 -65.327 -4.339  1.00 0.00 ? 33  SER F N   1 
ATOM   8584  C CA  . SER F  6  33  ? -38.896 -65.505 -4.745  1.00 0.00 ? 33  SER F CA  1 
ATOM   8585  C C   . SER F  6  33  ? -39.178 -64.931 -6.124  1.00 0.00 ? 33  SER F C   1 
ATOM   8586  O O   . SER F  6  33  ? -38.460 -64.070 -6.620  1.00 0.00 ? 33  SER F O   1 
ATOM   8587  C CB  . SER F  6  33  ? -39.853 -64.924 -3.684  1.00 0.00 ? 33  SER F CB  1 
ATOM   8588  O OG  . SER F  6  33  ? -39.622 -65.564 -2.433  1.00 0.00 ? 33  SER F OG  1 
ATOM   8589  N N   . ALA F  6  34  ? -40.212 -65.462 -6.805  1.00 0.00 ? 34  ALA F N   1 
ATOM   8590  C CA  . ALA F  6  34  ? -40.560 -65.120 -8.151  1.00 0.00 ? 34  ALA F CA  1 
ATOM   8591  C C   . ALA F  6  34  ? -41.037 -63.719 -8.297  1.00 0.00 ? 34  ALA F C   1 
ATOM   8592  O O   . ALA F  6  34  ? -41.607 -63.145 -7.375  1.00 0.00 ? 34  ALA F O   1 
ATOM   8593  C CB  . ALA F  6  34  ? -41.667 -65.995 -8.714  1.00 0.00 ? 34  ALA F CB  1 
ATOM   8594  N N   . THR F  6  35  ? -40.856 -63.149 -9.503  1.00 0.00 ? 35  THR F N   1 
ATOM   8595  C CA  . THR F  6  35  ? -41.455 -61.899 -9.837  1.00 0.00 ? 35  THR F CA  1 
ATOM   8596  C C   . THR F  6  35  ? -41.706 -61.924 -11.336 1.00 0.00 ? 35  THR F C   1 
ATOM   8597  O O   . THR F  6  35  ? -40.994 -62.575 -12.094 1.00 0.00 ? 35  THR F O   1 
ATOM   8598  C CB  . THR F  6  35  ? -40.643 -60.734 -9.275  1.00 0.00 ? 35  THR F CB  1 
ATOM   8599  O OG1 . THR F  6  35  ? -41.203 -59.482 -9.638  1.00 0.00 ? 35  THR F OG1 1 
ATOM   8600  C CG2 . THR F  6  35  ? -39.166 -60.804 -9.697  1.00 0.00 ? 35  THR F CG2 1 
ATOM   8601  N N   . VAL F  6  36  ? -42.833 -61.298 -11.750 1.00 0.00 ? 36  VAL F N   1 
ATOM   8602  C CA  . VAL F  6  36  ? -43.428 -61.306 -13.070 1.00 0.00 ? 36  VAL F CA  1 
ATOM   8603  C C   . VAL F  6  36  ? -43.512 -59.885 -13.584 1.00 0.00 ? 36  VAL F C   1 
ATOM   8604  O O   . VAL F  6  36  ? -43.892 -58.974 -12.856 1.00 0.00 ? 36  VAL F O   1 
ATOM   8605  C CB  . VAL F  6  36  ? -44.837 -61.923 -13.096 1.00 0.00 ? 36  VAL F CB  1 
ATOM   8606  C CG1 . VAL F  6  36  ? -45.302 -62.157 -14.553 1.00 0.00 ? 36  VAL F CG1 1 
ATOM   8607  C CG2 . VAL F  6  36  ? -44.859 -63.253 -12.314 1.00 0.00 ? 36  VAL F CG2 1 
ATOM   8608  N N   . GLY F  6  37  ? -43.141 -59.667 -14.861 1.00 0.00 ? 37  GLY F N   1 
ATOM   8609  C CA  . GLY F  6  37  ? -43.221 -58.388 -15.499 1.00 0.00 ? 37  GLY F CA  1 
ATOM   8610  C C   . GLY F  6  37  ? -43.953 -58.534 -16.796 1.00 0.00 ? 37  GLY F C   1 
ATOM   8611  O O   . GLY F  6  37  ? -43.513 -59.260 -17.674 1.00 0.00 ? 37  GLY F O   1 
ATOM   8612  N N   . LEU F  6  38  ? -45.063 -57.795 -16.984 1.00 0.00 ? 38  LEU F N   1 
ATOM   8613  C CA  . LEU F  6  38  ? -45.812 -57.726 -18.221 1.00 0.00 ? 38  LEU F CA  1 
ATOM   8614  C C   . LEU F  6  38  ? -46.091 -56.267 -18.428 1.00 0.00 ? 38  LEU F C   1 
ATOM   8615  O O   . LEU F  6  38  ? -45.792 -55.448 -17.562 1.00 0.00 ? 38  LEU F O   1 
ATOM   8616  C CB  . LEU F  6  38  ? -47.134 -58.526 -18.284 1.00 0.00 ? 38  LEU F CB  1 
ATOM   8617  C CG  . LEU F  6  38  ? -48.261 -58.100 -17.317 1.00 0.00 ? 38  LEU F CG  1 
ATOM   8618  C CD1 . LEU F  6  38  ? -49.621 -58.625 -17.805 1.00 0.00 ? 38  LEU F CD1 1 
ATOM   8619  C CD2 . LEU F  6  38  ? -48.009 -58.487 -15.842 1.00 0.00 ? 38  LEU F CD2 1 
ATOM   8620  N N   . LYS F  6  39  ? -46.663 -55.878 -19.584 1.00 0.00 ? 39  LYS F N   1 
ATOM   8621  C CA  . LYS F  6  39  ? -46.882 -54.491 -19.842 1.00 0.00 ? 39  LYS F CA  1 
ATOM   8622  C C   . LYS F  6  39  ? -47.984 -54.333 -20.855 1.00 0.00 ? 39  LYS F C   1 
ATOM   8623  O O   . LYS F  6  39  ? -48.309 -55.269 -21.577 1.00 0.00 ? 39  LYS F O   1 
ATOM   8624  C CB  . LYS F  6  39  ? -45.603 -53.789 -20.338 1.00 0.00 ? 39  LYS F CB  1 
ATOM   8625  C CG  . LYS F  6  39  ? -44.939 -54.443 -21.560 1.00 0.00 ? 39  LYS F CG  1 
ATOM   8626  C CD  . LYS F  6  39  ? -44.345 -53.390 -22.504 1.00 0.00 ? 39  LYS F CD  1 
ATOM   8627  C CE  . LYS F  6  39  ? -43.679 -53.956 -23.761 1.00 0.00 ? 39  LYS F CE  1 
ATOM   8628  N NZ  . LYS F  6  39  ? -42.388 -54.589 -23.428 1.00 0.00 ? 39  LYS F NZ  1 
ATOM   8629  N N   . SER F  6  40  ? -48.585 -53.119 -20.905 1.00 0.00 ? 40  SER F N   1 
ATOM   8630  C CA  . SER F  6  40  ? -49.531 -52.641 -21.891 1.00 0.00 ? 40  SER F CA  1 
ATOM   8631  C C   . SER F  6  40  ? -49.050 -51.260 -22.172 1.00 0.00 ? 40  SER F C   1 
ATOM   8632  O O   . SER F  6  40  ? -48.163 -50.762 -21.489 1.00 0.00 ? 40  SER F O   1 
ATOM   8633  C CB  . SER F  6  40  ? -50.993 -52.519 -21.398 1.00 0.00 ? 40  SER F CB  1 
ATOM   8634  O OG  . SER F  6  40  ? -51.924 -52.110 -22.398 1.00 0.00 ? 40  SER F OG  1 
ATOM   8635  N N   . LYS F  6  41  ? -49.650 -50.596 -23.185 1.00 0.00 ? 41  LYS F N   1 
ATOM   8636  C CA  . LYS F  6  41  ? -49.256 -49.298 -23.656 1.00 0.00 ? 41  LYS F CA  1 
ATOM   8637  C C   . LYS F  6  41  ? -49.591 -48.238 -22.667 1.00 0.00 ? 41  LYS F C   1 
ATOM   8638  O O   . LYS F  6  41  ? -49.017 -47.158 -22.727 1.00 0.00 ? 41  LYS F O   1 
ATOM   8639  C CB  . LYS F  6  41  ? -49.936 -48.922 -24.977 1.00 0.00 ? 41  LYS F CB  1 
ATOM   8640  C CG  . LYS F  6  41  ? -49.497 -49.852 -26.112 1.00 0.00 ? 41  LYS F CG  1 
ATOM   8641  C CD  . LYS F  6  41  ? -49.806 -49.309 -27.513 1.00 0.00 ? 41  LYS F CD  1 
ATOM   8642  C CE  . LYS F  6  41  ? -49.133 -50.144 -28.607 1.00 0.00 ? 41  LYS F CE  1 
ATOM   8643  N NZ  . LYS F  6  41  ? -49.429 -49.597 -29.951 1.00 0.00 ? 41  LYS F NZ  1 
ATOM   8644  N N   . THR F  6  42  ? -50.485 -48.549 -21.705 1.00 0.00 ? 42  THR F N   1 
ATOM   8645  C CA  . THR F  6  42  ? -50.907 -47.642 -20.682 1.00 0.00 ? 42  THR F CA  1 
ATOM   8646  C C   . THR F  6  42  ? -50.044 -47.792 -19.474 1.00 0.00 ? 42  THR F C   1 
ATOM   8647  O O   . THR F  6  42  ? -49.684 -46.782 -18.889 1.00 0.00 ? 42  THR F O   1 
ATOM   8648  C CB  . THR F  6  42  ? -52.381 -47.803 -20.343 1.00 0.00 ? 42  THR F CB  1 
ATOM   8649  O OG1 . THR F  6  42  ? -52.832 -46.791 -19.453 1.00 0.00 ? 42  THR F OG1 1 
ATOM   8650  C CG2 . THR F  6  42  ? -52.733 -49.200 -19.784 1.00 0.00 ? 42  THR F CG2 1 
ATOM   8651  N N   . HIS F  6  43  ? -49.687 -49.015 -19.037 1.00 0.00 ? 43  HIS F N   1 
ATOM   8652  C CA  . HIS F  6  43  ? -48.932 -49.124 -17.824 1.00 0.00 ? 43  HIS F CA  1 
ATOM   8653  C C   . HIS F  6  43  ? -48.150 -50.388 -17.879 1.00 0.00 ? 43  HIS F C   1 
ATOM   8654  O O   . HIS F  6  43  ? -48.595 -51.392 -18.418 1.00 0.00 ? 43  HIS F O   1 
ATOM   8655  C CB  . HIS F  6  43  ? -49.831 -49.218 -16.552 1.00 0.00 ? 43  HIS F CB  1 
ATOM   8656  C CG  . HIS F  6  43  ? -50.586 -47.956 -16.167 1.00 0.00 ? 43  HIS F CG  1 
ATOM   8657  N ND1 . HIS F  6  43  ? -51.681 -47.472 -16.848 1.00 0.00 ? 43  HIS F ND1 1 
ATOM   8658  C CD2 . HIS F  6  43  ? -50.354 -47.048 -15.189 1.00 0.00 ? 43  HIS F CD2 1 
ATOM   8659  C CE1 . HIS F  6  43  ? -52.028 -46.298 -16.274 1.00 0.00 ? 43  HIS F CE1 1 
ATOM   8660  N NE2 . HIS F  6  43  ? -51.253 -46.001 -15.265 1.00 0.00 ? 43  HIS F NE2 1 
ATOM   8661  N N   . ALA F  6  44  ? -46.920 -50.305 -17.319 1.00 0.00 ? 44  ALA F N   1 
ATOM   8662  C CA  . ALA F  6  44  ? -46.006 -51.370 -17.019 1.00 0.00 ? 44  ALA F CA  1 
ATOM   8663  C C   . ALA F  6  44  ? -46.451 -52.016 -15.760 1.00 0.00 ? 44  ALA F C   1 
ATOM   8664  O O   . ALA F  6  44  ? -47.079 -51.380 -14.924 1.00 0.00 ? 44  ALA F O   1 
ATOM   8665  C CB  . ALA F  6  44  ? -44.571 -50.861 -16.840 1.00 0.00 ? 44  ALA F CB  1 
ATOM   8666  N N   . VAL F  6  45  ? -46.184 -53.320 -15.616 1.00 0.00 ? 45  VAL F N   1 
ATOM   8667  C CA  . VAL F  6  45  ? -46.713 -54.075 -14.527 1.00 0.00 ? 45  VAL F CA  1 
ATOM   8668  C C   . VAL F  6  45  ? -45.630 -54.939 -13.965 1.00 0.00 ? 45  VAL F C   1 
ATOM   8669  O O   . VAL F  6  45  ? -45.272 -55.949 -14.562 1.00 0.00 ? 45  VAL F O   1 
ATOM   8670  C CB  . VAL F  6  45  ? -47.893 -54.946 -14.926 1.00 0.00 ? 45  VAL F CB  1 
ATOM   8671  C CG1 . VAL F  6  45  ? -48.498 -55.598 -13.674 1.00 0.00 ? 45  VAL F CG1 1 
ATOM   8672  C CG2 . VAL F  6  45  ? -48.962 -54.099 -15.619 1.00 0.00 ? 45  VAL F CG2 1 
ATOM   8673  N N   . LEU F  6  46  ? -45.141 -54.585 -12.751 1.00 0.00 ? 46  LEU F N   1 
ATOM   8674  C CA  . LEU F  6  46  ? -44.361 -55.466 -11.923 1.00 0.00 ? 46  LEU F CA  1 
ATOM   8675  C C   . LEU F  6  46  ? -45.358 -56.084 -11.006 1.00 0.00 ? 46  LEU F C   1 
ATOM   8676  O O   . LEU F  6  46  ? -46.272 -55.403 -10.556 1.00 0.00 ? 46  LEU F O   1 
ATOM   8677  C CB  . LEU F  6  46  ? -43.338 -54.815 -10.964 1.00 0.00 ? 46  LEU F CB  1 
ATOM   8678  C CG  . LEU F  6  46  ? -42.068 -54.213 -11.592 1.00 0.00 ? 46  LEU F CG  1 
ATOM   8679  C CD1 . LEU F  6  46  ? -41.187 -53.650 -10.474 1.00 0.00 ? 46  LEU F CD1 1 
ATOM   8680  C CD2 . LEU F  6  46  ? -41.289 -55.223 -12.456 1.00 0.00 ? 46  LEU F CD2 1 
ATOM   8681  N N   . VAL F  6  47  ? -45.189 -57.393 -10.719 1.00 0.00 ? 47  VAL F N   1 
ATOM   8682  C CA  . VAL F  6  47  ? -45.958 -58.114 -9.743  1.00 0.00 ? 47  VAL F CA  1 
ATOM   8683  C C   . VAL F  6  47  ? -44.878 -58.912 -9.113  1.00 0.00 ? 47  VAL F C   1 
ATOM   8684  O O   . VAL F  6  47  ? -44.120 -59.510 -9.855  1.00 0.00 ? 47  VAL F O   1 
ATOM   8685  C CB  . VAL F  6  47  ? -46.983 -59.086 -10.330 1.00 0.00 ? 47  VAL F CB  1 
ATOM   8686  C CG1 . VAL F  6  47  ? -47.923 -59.558 -9.209  1.00 0.00 ? 47  VAL F CG1 1 
ATOM   8687  C CG2 . VAL F  6  47  ? -47.785 -58.433 -11.471 1.00 0.00 ? 47  VAL F CG2 1 
ATOM   8688  N N   . ALA F  6  48  ? -44.782 -58.994 -7.766  1.00 0.00 ? 48  ALA F N   1 
ATOM   8689  C CA  . ALA F  6  48  ? -43.685 -59.700 -7.122  1.00 0.00 ? 48  ALA F CA  1 
ATOM   8690  C C   . ALA F  6  48  ? -44.220 -60.503 -5.993  1.00 0.00 ? 48  ALA F C   1 
ATOM   8691  O O   . ALA F  6  48  ? -44.930 -59.978 -5.141  1.00 0.00 ? 48  ALA F O   1 
ATOM   8692  C CB  . ALA F  6  48  ? -42.612 -58.786 -6.512  1.00 0.00 ? 48  ALA F CB  1 
ATOM   8693  N N   . LEU F  6  49  ? -43.817 -61.767 -5.918  1.00 0.00 ? 49  LEU F N   1 
ATOM   8694  C CA  . LEU F  6  49  ? -44.282 -62.606 -4.827  1.00 0.00 ? 49  LEU F CA  1 
ATOM   8695  C C   . LEU F  6  49  ? -43.387 -62.333 -3.637  1.00 0.00 ? 49  LEU F C   1 
ATOM   8696  O O   . LEU F  6  49  ? -42.269 -62.836 -3.536  1.00 0.00 ? 49  LEU F O   1 
ATOM   8697  C CB  . LEU F  6  49  ? -44.221 -64.084 -5.199  1.00 0.00 ? 49  LEU F CB  1 
ATOM   8698  C CG  . LEU F  6  49  ? -44.855 -64.993 -4.150  1.00 0.00 ? 49  LEU F CG  1 
ATOM   8699  C CD1 . LEU F  6  49  ? -46.370 -64.913 -4.232  1.00 0.00 ? 49  LEU F CD1 1 
ATOM   8700  C CD2 . LEU F  6  49  ? -44.370 -66.427 -4.288  1.00 0.00 ? 49  LEU F CD2 1 
ATOM   8701  N N   . LYS F  6  50  ? -43.929 -61.539 -2.728  1.00 0.00 ? 50  LYS F N   1 
ATOM   8702  C CA  . LYS F  6  50  ? -43.228 -61.013 -1.604  1.00 0.00 ? 50  LYS F CA  1 
ATOM   8703  C C   . LYS F  6  50  ? -42.864 -62.169 -0.756  1.00 0.00 ? 50  LYS F C   1 
ATOM   8704  O O   . LYS F  6  50  ? -43.650 -63.103 -0.616  1.00 0.00 ? 50  LYS F O   1 
ATOM   8705  C CB  . LYS F  6  50  ? -44.063 -60.009 -0.813  1.00 0.00 ? 50  LYS F CB  1 
ATOM   8706  C CG  . LYS F  6  50  ? -43.241 -59.059 0.057   1.00 0.00 ? 50  LYS F CG  1 
ATOM   8707  C CD  . LYS F  6  50  ? -44.092 -58.262 1.054   1.00 0.00 ? 50  LYS F CD  1 
ATOM   8708  C CE  . LYS F  6  50  ? -44.992 -57.167 0.469   1.00 0.00 ? 50  LYS F CE  1 
ATOM   8709  N NZ  . LYS F  6  50  ? -44.192 -56.012 0.001   1.00 0.00 ? 50  LYS F NZ  1 
ATOM   8710  N N   . LYS F  6  62  ? -39.615 -56.358 -2.702  1.00 0.00 ? 62  LYS F N   1 
ATOM   8711  C CA  . LYS F  6  62  ? -38.812 -56.872 -3.781  1.00 0.00 ? 62  LYS F CA  1 
ATOM   8712  C C   . LYS F  6  62  ? -38.869 -55.930 -4.922  1.00 0.00 ? 62  LYS F C   1 
ATOM   8713  O O   . LYS F  6  62  ? -37.855 -55.734 -5.573  1.00 0.00 ? 62  LYS F O   1 
ATOM   8714  C CB  . LYS F  6  62  ? -39.315 -58.229 -4.281  1.00 0.00 ? 62  LYS F CB  1 
ATOM   8715  C CG  . LYS F  6  62  ? -39.058 -59.348 -3.273  1.00 0.00 ? 62  LYS F CG  1 
ATOM   8716  C CD  . LYS F  6  62  ? -39.665 -60.678 -3.706  1.00 0.00 ? 62  LYS F CD  1 
ATOM   8717  C CE  . LYS F  6  62  ? -39.082 -61.272 -4.985  1.00 0.00 ? 62  LYS F CE  1 
ATOM   8718  N NZ  . LYS F  6  62  ? -37.667 -61.631 -4.800  1.00 0.00 ? 62  LYS F NZ  1 
ATOM   8719  N N   . ILE F  6  63  ? -40.015 -55.238 -5.110  1.00 0.00 ? 63  ILE F N   1 
ATOM   8720  C CA  . ILE F  6  63  ? -40.193 -54.085 -5.974  1.00 0.00 ? 63  ILE F CA  1 
ATOM   8721  C C   . ILE F  6  63  ? -39.476 -52.911 -5.348  1.00 0.00 ? 63  ILE F C   1 
ATOM   8722  O O   . ILE F  6  63  ? -39.623 -52.723 -4.148  1.00 0.00 ? 63  ILE F O   1 
ATOM   8723  C CB  . ILE F  6  63  ? -41.673 -53.815 -6.155  1.00 0.00 ? 63  ILE F CB  1 
ATOM   8724  C CG1 . ILE F  6  63  ? -42.305 -55.057 -6.839  1.00 0.00 ? 63  ILE F CG1 1 
ATOM   8725  C CG2 . ILE F  6  63  ? -41.865 -52.517 -6.959  1.00 0.00 ? 63  ILE F CG2 1 
ATOM   8726  C CD1 . ILE F  6  63  ? -43.784 -54.947 -7.201  1.00 0.00 ? 63  ILE F CD1 1 
ATOM   8727  N N   . LEU F  6  64  ? -38.764 -52.044 -6.106  1.00 0.00 ? 64  LEU F N   1 
ATOM   8728  C CA  . LEU F  6  64  ? -38.081 -50.920 -5.516  1.00 0.00 ? 64  LEU F CA  1 
ATOM   8729  C C   . LEU F  6  64  ? -38.304 -49.732 -6.376  1.00 0.00 ? 64  LEU F C   1 
ATOM   8730  O O   . LEU F  6  64  ? -38.472 -49.863 -7.575  1.00 0.00 ? 64  LEU F O   1 
ATOM   8731  C CB  . LEU F  6  64  ? -36.567 -51.143 -5.354  1.00 0.00 ? 64  LEU F CB  1 
ATOM   8732  C CG  . LEU F  6  64  ? -36.196 -52.158 -4.245  1.00 0.00 ? 64  LEU F CG  1 
ATOM   8733  C CD1 . LEU F  6  64  ? -34.696 -52.487 -4.258  1.00 0.00 ? 64  LEU F CD1 1 
ATOM   8734  C CD2 . LEU F  6  64  ? -36.618 -51.693 -2.841  1.00 0.00 ? 64  LEU F CD2 1 
ATOM   8735  N N   . HIS F  6  65  ? -38.263 -48.558 -5.753  1.00 0.00 ? 65  HIS F N   1 
ATOM   8736  C CA  . HIS F  6  65  ? -38.338 -47.310 -6.485  1.00 0.00 ? 65  HIS F CA  1 
ATOM   8737  C C   . HIS F  6  65  ? -36.930 -46.877 -6.867  1.00 0.00 ? 65  HIS F C   1 
ATOM   8738  O O   . HIS F  6  65  ? -36.225 -46.223 -6.100  1.00 0.00 ? 65  HIS F O   1 
ATOM   8739  C CB  . HIS F  6  65  ? -39.014 -46.230 -5.639  1.00 0.00 ? 65  HIS F CB  1 
ATOM   8740  C CG  . HIS F  6  65  ? -40.410 -46.572 -5.225  1.00 0.00 ? 65  HIS F CG  1 
ATOM   8741  N ND1 . HIS F  6  65  ? -41.455 -46.645 -6.120  1.00 0.00 ? 65  HIS F ND1 1 
ATOM   8742  C CD2 . HIS F  6  65  ? -40.935 -46.860 -4.010  1.00 0.00 ? 65  HIS F CD2 1 
ATOM   8743  C CE1 . HIS F  6  65  ? -42.564 -46.964 -5.476  1.00 0.00 ? 65  HIS F CE1 1 
ATOM   8744  N NE2 . HIS F  6  65  ? -42.275 -47.100 -4.194  1.00 0.00 ? 65  HIS F NE2 1 
ATOM   8745  N N   . VAL F  6  66  ? -36.549 -47.255 -8.079  1.00 0.00 ? 66  VAL F N   1 
ATOM   8746  C CA  . VAL F  6  66  ? -35.331 -46.831 -8.716  1.00 0.00 ? 66  VAL F CA  1 
ATOM   8747  C C   . VAL F  6  66  ? -35.431 -45.426 -9.169  1.00 0.00 ? 66  VAL F C   1 
ATOM   8748  O O   . VAL F  6  66  ? -34.448 -44.693 -9.161  1.00 0.00 ? 66  VAL F O   1 
ATOM   8749  C CB  . VAL F  6  66  ? -34.980 -47.759 -9.859  1.00 0.00 ? 66  VAL F CB  1 
ATOM   8750  C CG1 . VAL F  6  66  ? -34.188 -47.093 -10.992 1.00 0.00 ? 66  VAL F CG1 1 
ATOM   8751  C CG2 . VAL F  6  66  ? -34.172 -48.903 -9.236  1.00 0.00 ? 66  VAL F CG2 1 
ATOM   8752  N N   . ASP F  6  67  ? -36.628 -45.015 -9.596  1.00 0.00 ? 67  ASP F N   1 
ATOM   8753  C CA  . ASP F  6  67  ? -36.815 -43.741 -10.219 1.00 0.00 ? 67  ASP F CA  1 
ATOM   8754  C C   . ASP F  6  67  ? -38.270 -43.496 -10.101 1.00 0.00 ? 67  ASP F C   1 
ATOM   8755  O O   . ASP F  6  67  ? -39.045 -44.350 -9.672  1.00 0.00 ? 67  ASP F O   1 
ATOM   8756  C CB  . ASP F  6  67  ? -36.473 -43.743 -11.716 1.00 0.00 ? 67  ASP F CB  1 
ATOM   8757  C CG  . ASP F  6  67  ? -36.165 -42.369 -12.281 1.00 0.00 ? 67  ASP F CG  1 
ATOM   8758  O OD1 . ASP F  6  67  ? -35.955 -41.414 -11.489 1.00 0.00 ? 67  ASP F OD1 1 
ATOM   8759  O OD2 . ASP F  6  67  ? -36.108 -42.269 -13.536 1.00 0.00 ? 67  ASP F OD2 1 
ATOM   8760  N N   . ASN F  6  68  ? -38.676 -42.271 -10.440 1.00 0.00 ? 68  ASN F N   1 
ATOM   8761  C CA  . ASN F  6  68  ? -40.020 -41.807 -10.338 1.00 0.00 ? 68  ASN F CA  1 
ATOM   8762  C C   . ASN F  6  68  ? -40.856 -42.507 -11.361 1.00 0.00 ? 68  ASN F C   1 
ATOM   8763  O O   . ASN F  6  68  ? -42.075 -42.488 -11.249 1.00 0.00 ? 68  ASN F O   1 
ATOM   8764  C CB  . ASN F  6  68  ? -40.064 -40.276 -10.574 1.00 0.00 ? 68  ASN F CB  1 
ATOM   8765  C CG  . ASN F  6  68  ? -41.339 -39.606 -10.054 1.00 0.00 ? 68  ASN F CG  1 
ATOM   8766  O OD1 . ASN F  6  68  ? -42.134 -40.199 -9.319  1.00 0.00 ? 68  ASN F OD1 1 
ATOM   8767  N ND2 . ASN F  6  68  ? -41.508 -38.305 -10.433 1.00 0.00 ? 68  ASN F ND2 1 
ATOM   8768  N N   . HIS F  6  69  ? -40.231 -43.167 -12.367 1.00 0.00 ? 69  HIS F N   1 
ATOM   8769  C CA  . HIS F  6  69  ? -40.979 -43.889 -13.350 1.00 0.00 ? 69  HIS F CA  1 
ATOM   8770  C C   . HIS F  6  69  ? -40.344 -45.196 -13.680 1.00 0.00 ? 69  HIS F C   1 
ATOM   8771  O O   . HIS F  6  69  ? -40.735 -45.806 -14.664 1.00 0.00 ? 69  HIS F O   1 
ATOM   8772  C CB  . HIS F  6  69  ? -41.204 -43.054 -14.637 1.00 0.00 ? 69  HIS F CB  1 
ATOM   8773  C CG  . HIS F  6  69  ? -40.000 -42.586 -15.388 1.00 0.00 ? 69  HIS F CG  1 
ATOM   8774  N ND1 . HIS F  6  69  ? -39.172 -41.557 -15.008 1.00 0.00 ? 69  HIS F ND1 1 
ATOM   8775  C CD2 . HIS F  6  69  ? -39.487 -43.066 -16.545 1.00 0.00 ? 69  HIS F CD2 1 
ATOM   8776  C CE1 . HIS F  6  69  ? -38.191 -41.479 -15.934 1.00 0.00 ? 69  HIS F CE1 1 
ATOM   8777  N NE2 . HIS F  6  69  ? -38.342 -42.374 -16.884 1.00 0.00 ? 69  HIS F NE2 1 
ATOM   8778  N N   . ILE F  6  70  ? -39.389 -45.689 -12.863 1.00 0.00 ? 70  ILE F N   1 
ATOM   8779  C CA  . ILE F  6  70  ? -38.706 -46.940 -13.097 1.00 0.00 ? 70  ILE F CA  1 
ATOM   8780  C C   . ILE F  6  70  ? -38.664 -47.636 -11.776 1.00 0.00 ? 70  ILE F C   1 
ATOM   8781  O O   . ILE F  6  70  ? -38.478 -47.008 -10.735 1.00 0.00 ? 70  ILE F O   1 
ATOM   8782  C CB  . ILE F  6  70  ? -37.292 -46.779 -13.657 1.00 0.00 ? 70  ILE F CB  1 
ATOM   8783  C CG1 . ILE F  6  70  ? -37.344 -46.222 -15.095 1.00 0.00 ? 70  ILE F CG1 1 
ATOM   8784  C CG2 . ILE F  6  70  ? -36.496 -48.100 -13.660 1.00 0.00 ? 70  ILE F CG2 1 
ATOM   8785  C CD1 . ILE F  6  70  ? -36.007 -45.667 -15.571 1.00 0.00 ? 70  ILE F CD1 1 
ATOM   8786  N N   . GLY F  6  71  ? -38.811 -48.985 -11.799 1.00 0.00 ? 71  GLY F N   1 
ATOM   8787  C CA  . GLY F  6  71  ? -38.713 -49.782 -10.613 1.00 0.00 ? 71  GLY F CA  1 
ATOM   8788  C C   . GLY F  6  71  ? -38.247 -51.122 -11.041 1.00 0.00 ? 71  GLY F C   1 
ATOM   8789  O O   . GLY F  6  71  ? -38.618 -51.629 -12.088 1.00 0.00 ? 71  GLY F O   1 
ATOM   8790  N N   . ILE F  6  72  ? -37.356 -51.710 -10.231 1.00 0.00 ? 72  ILE F N   1 
ATOM   8791  C CA  . ILE F  6  72  ? -36.759 -53.006 -10.423 1.00 0.00 ? 72  ILE F CA  1 
ATOM   8792  C C   . ILE F  6  72  ? -37.435 -54.032 -9.586  1.00 0.00 ? 72  ILE F C   1 
ATOM   8793  O O   . ILE F  6  72  ? -37.947 -53.709 -8.531  1.00 0.00 ? 72  ILE F O   1 
ATOM   8794  C CB  . ILE F  6  72  ? -35.297 -53.007 -10.037 1.00 0.00 ? 72  ILE F CB  1 
ATOM   8795  C CG1 . ILE F  6  72  ? -35.049 -52.706 -8.531  1.00 0.00 ? 72  ILE F CG1 1 
ATOM   8796  C CG2 . ILE F  6  72  ? -34.622 -52.006 -10.999 1.00 0.00 ? 72  ILE F CG2 1 
ATOM   8797  C CD1 . ILE F  6  72  ? -33.593 -52.852 -8.115  1.00 0.00 ? 72  ILE F CD1 1 
ATOM   8798  N N   . SER F  6  73  ? -37.454 -55.303 -9.995  1.00 0.00 ? 73  SER F N   1 
ATOM   8799  C CA  . SER F  6  73  ? -37.802 -56.363 -9.089  1.00 0.00 ? 73  SER F CA  1 
ATOM   8800  C C   . SER F  6  73  ? -36.667 -57.322 -8.973  1.00 0.00 ? 73  SER F C   1 
ATOM   8801  O O   . SER F  6  73  ? -36.222 -57.911 -9.950  1.00 0.00 ? 73  SER F O   1 
ATOM   8802  C CB  . SER F  6  73  ? -39.146 -57.071 -9.335  1.00 0.00 ? 73  SER F CB  1 
ATOM   8803  O OG  . SER F  6  73  ? -39.250 -57.608 -10.633 1.00 0.00 ? 73  SER F OG  1 
ATOM   8804  N N   . ILE F  6  74  ? -36.142 -57.473 -7.741  1.00 0.00 ? 74  ILE F N   1 
ATOM   8805  C CA  . ILE F  6  74  ? -35.010 -58.293 -7.431  1.00 0.00 ? 74  ILE F CA  1 
ATOM   8806  C C   . ILE F  6  74  ? -35.441 -59.722 -7.456  1.00 0.00 ? 74  ILE F C   1 
ATOM   8807  O O   . ILE F  6  74  ? -36.603 -60.031 -7.198  1.00 0.00 ? 74  ILE F O   1 
ATOM   8808  C CB  . ILE F  6  74  ? -34.428 -57.987 -6.050  1.00 0.00 ? 74  ILE F CB  1 
ATOM   8809  C CG1 . ILE F  6  74  ? -35.140 -58.685 -4.852  1.00 0.00 ? 74  ILE F CG1 1 
ATOM   8810  C CG2 . ILE F  6  74  ? -34.434 -56.452 -5.876  1.00 0.00 ? 74  ILE F CG2 1 
ATOM   8811  C CD1 . ILE F  6  74  ? -34.584 -58.310 -3.473  1.00 0.00 ? 74  ILE F CD1 1 
ATOM   8812  N N   . ALA F  6  75  ? -34.499 -60.638 -7.727  1.00 0.00 ? 75  ALA F N   1 
ATOM   8813  C CA  . ALA F  6  75  ? -34.660 -62.043 -7.480  1.00 0.00 ? 75  ALA F CA  1 
ATOM   8814  C C   . ALA F  6  75  ? -33.263 -62.523 -7.290  1.00 0.00 ? 75  ALA F C   1 
ATOM   8815  O O   . ALA F  6  75  ? -32.356 -62.106 -8.004  1.00 0.00 ? 75  ALA F O   1 
ATOM   8816  C CB  . ALA F  6  75  ? -35.337 -62.849 -8.585  1.00 0.00 ? 75  ALA F CB  1 
ATOM   8817  N N   . GLY F  6  76  ? -33.049 -63.444 -6.341  1.00 0.00 ? 76  GLY F N   1 
ATOM   8818  C CA  . GLY F  6  76  ? -31.743 -63.883 -5.966  1.00 0.00 ? 76  GLY F CA  1 
ATOM   8819  C C   . GLY F  6  76  ? -31.398 -63.216 -4.711  1.00 0.00 ? 76  GLY F C   1 
ATOM   8820  O O   . GLY F  6  76  ? -32.271 -62.758 -3.975  1.00 0.00 ? 76  GLY F O   1 
ATOM   8821  N N   . LEU F  6  77  ? -30.080 -63.136 -4.447  1.00 0.00 ? 77  LEU F N   1 
ATOM   8822  C CA  . LEU F  6  77  ? -29.541 -62.512 -3.277  1.00 0.00 ? 77  LEU F CA  1 
ATOM   8823  C C   . LEU F  6  77  ? -29.851 -61.048 -3.277  1.00 0.00 ? 77  LEU F C   1 
ATOM   8824  O O   . LEU F  6  77  ? -29.825 -60.355 -4.291  1.00 0.00 ? 77  LEU F O   1 
ATOM   8825  C CB  . LEU F  6  77  ? -28.033 -62.754 -3.070  1.00 0.00 ? 77  LEU F CB  1 
ATOM   8826  C CG  . LEU F  6  77  ? -27.102 -62.213 -4.174  1.00 0.00 ? 77  LEU F CG  1 
ATOM   8827  C CD1 . LEU F  6  77  ? -26.826 -60.714 -4.061  1.00 0.00 ? 77  LEU F CD1 1 
ATOM   8828  C CD2 . LEU F  6  77  ? -25.779 -63.001 -4.196  1.00 0.00 ? 77  LEU F CD2 1 
ATOM   8829  N N   . THR F  6  78  ? -30.188 -60.556 -2.080  1.00 0.00 ? 78  THR F N   1 
ATOM   8830  C CA  . THR F  6  78  ? -30.708 -59.243 -1.869  1.00 0.00 ? 78  THR F CA  1 
ATOM   8831  C C   . THR F  6  78  ? -29.557 -58.292 -1.954  1.00 0.00 ? 78  THR F C   1 
ATOM   8832  O O   . THR F  6  78  ? -29.721 -57.154 -2.378  1.00 0.00 ? 78  THR F O   1 
ATOM   8833  C CB  . THR F  6  78  ? -31.350 -59.154 -0.501  1.00 0.00 ? 78  THR F CB  1 
ATOM   8834  O OG1 . THR F  6  78  ? -32.337 -60.172 -0.389  1.00 0.00 ? 78  THR F OG1 1 
ATOM   8835  C CG2 . THR F  6  78  ? -32.006 -57.770 -0.284  1.00 0.00 ? 78  THR F CG2 1 
ATOM   8836  N N   . ALA F  6  79  ? -28.339 -58.745 -1.572  1.00 0.00 ? 79  ALA F N   1 
ATOM   8837  C CA  . ALA F  6  79  ? -27.235 -57.845 -1.404  1.00 0.00 ? 79  ALA F CA  1 
ATOM   8838  C C   . ALA F  6  79  ? -26.839 -57.176 -2.669  1.00 0.00 ? 79  ALA F C   1 
ATOM   8839  O O   . ALA F  6  79  ? -26.745 -55.957 -2.726  1.00 0.00 ? 79  ALA F O   1 
ATOM   8840  C CB  . ALA F  6  79  ? -26.002 -58.549 -0.820  1.00 0.00 ? 79  ALA F CB  1 
ATOM   8841  N N   . ASP F  6  80  ? -26.644 -57.967 -3.737  1.00 0.00 ? 80  ASP F N   1 
ATOM   8842  C CA  . ASP F  6  80  ? -26.308 -57.453 -5.040  1.00 0.00 ? 80  ASP F CA  1 
ATOM   8843  C C   . ASP F  6  80  ? -27.396 -56.595 -5.591  1.00 0.00 ? 80  ASP F C   1 
ATOM   8844  O O   . ASP F  6  80  ? -27.104 -55.690 -6.364  1.00 0.00 ? 80  ASP F O   1 
ATOM   8845  C CB  . ASP F  6  80  ? -25.956 -58.535 -6.093  1.00 0.00 ? 80  ASP F CB  1 
ATOM   8846  C CG  . ASP F  6  80  ? -24.638 -59.248 -5.745  1.00 0.00 ? 80  ASP F CG  1 
ATOM   8847  O OD1 . ASP F  6  80  ? -23.645 -58.533 -5.434  1.00 0.00 ? 80  ASP F OD1 1 
ATOM   8848  O OD2 . ASP F  6  80  ? -24.591 -60.506 -5.816  1.00 0.00 ? 80  ASP F OD2 1 
ATOM   8849  N N   . ALA F  6  81  ? -28.680 -56.879 -5.246  1.00 0.00 ? 81  ALA F N   1 
ATOM   8850  C CA  . ALA F  6  81  ? -29.795 -56.084 -5.702  1.00 0.00 ? 81  ALA F CA  1 
ATOM   8851  C C   . ALA F  6  81  ? -29.814 -54.688 -5.188  1.00 0.00 ? 81  ALA F C   1 
ATOM   8852  O O   . ALA F  6  81  ? -30.158 -53.762 -5.903  1.00 0.00 ? 81  ALA F O   1 
ATOM   8853  C CB  . ALA F  6  81  ? -31.121 -56.687 -5.272  1.00 0.00 ? 81  ALA F CB  1 
ATOM   8854  N N   . ARG F  6  82  ? -29.381 -54.495 -3.944  1.00 0.00 ? 82  ARG F N   1 
ATOM   8855  C CA  . ARG F  6  82  ? -29.276 -53.211 -3.323  1.00 0.00 ? 82  ARG F CA  1 
ATOM   8856  C C   . ARG F  6  82  ? -28.088 -52.463 -3.827  1.00 0.00 ? 82  ARG F C   1 
ATOM   8857  O O   . ARG F  6  82  ? -28.127 -51.248 -3.940  1.00 0.00 ? 82  ARG F O   1 
ATOM   8858  C CB  . ARG F  6  82  ? -29.216 -53.322 -1.799  1.00 0.00 ? 82  ARG F CB  1 
ATOM   8859  C CG  . ARG F  6  82  ? -30.487 -53.966 -1.219  1.00 0.00 ? 82  ARG F CG  1 
ATOM   8860  C CD  . ARG F  6  82  ? -30.416 -54.231 0.288   1.00 0.00 ? 82  ARG F CD  1 
ATOM   8861  N NE  . ARG F  6  82  ? -29.218 -55.098 0.556   1.00 0.00 ? 82  ARG F NE  1 
ATOM   8862  C CZ  . ARG F  6  82  ? -28.044 -54.613 1.065   1.00 0.00 ? 82  ARG F CZ  1 
ATOM   8863  N NH1 . ARG F  6  82  ? -27.936 -53.317 1.469   1.00 0.00 ? 82  ARG F NH1 1 
ATOM   8864  N NH2 . ARG F  6  82  ? -26.966 -55.444 1.154   1.00 0.00 ? 82  ARG F NH2 1 
ATOM   8865  N N   . LEU F  6  83  ? -26.972 -53.165 -4.094  1.00 0.00 ? 83  LEU F N   1 
ATOM   8866  C CA  . LEU F  6  83  ? -25.771 -52.564 -4.616  1.00 0.00 ? 83  LEU F CA  1 
ATOM   8867  C C   . LEU F  6  83  ? -26.022 -52.018 -5.989  1.00 0.00 ? 83  LEU F C   1 
ATOM   8868  O O   . LEU F  6  83  ? -25.706 -50.863 -6.259  1.00 0.00 ? 83  LEU F O   1 
ATOM   8869  C CB  . LEU F  6  83  ? -24.598 -53.565 -4.633  1.00 0.00 ? 83  LEU F CB  1 
ATOM   8870  C CG  . LEU F  6  83  ? -24.114 -54.052 -3.237  1.00 0.00 ? 83  LEU F CG  1 
ATOM   8871  C CD1 . LEU F  6  83  ? -23.038 -55.162 -3.240  1.00 0.00 ? 83  LEU F CD1 1 
ATOM   8872  C CD2 . LEU F  6  83  ? -23.666 -52.850 -2.380  1.00 0.00 ? 83  LEU F CD2 1 
ATOM   8873  N N   . LEU F  6  84  ? -26.683 -52.798 -6.868  1.00 0.00 ? 84  LEU F N   1 
ATOM   8874  C CA  . LEU F  6  84  ? -27.045 -52.331 -8.183  1.00 0.00 ? 84  LEU F CA  1 
ATOM   8875  C C   . LEU F  6  84  ? -28.016 -51.202 -8.110  1.00 0.00 ? 84  LEU F C   1 
ATOM   8876  O O   . LEU F  6  84  ? -27.888 -50.270 -8.882  1.00 0.00 ? 84  LEU F O   1 
ATOM   8877  C CB  . LEU F  6  84  ? -27.714 -53.401 -9.067  1.00 0.00 ? 84  LEU F CB  1 
ATOM   8878  C CG  . LEU F  6  84  ? -26.787 -54.534 -9.543  1.00 0.00 ? 84  LEU F CG  1 
ATOM   8879  C CD1 . LEU F  6  84  ? -27.609 -55.546 -10.357 1.00 0.00 ? 84  LEU F CD1 1 
ATOM   8880  C CD2 . LEU F  6  84  ? -25.592 -54.021 -10.370 1.00 0.00 ? 84  LEU F CD2 1 
ATOM   8881  N N   . CYS F  6  85  ? -28.992 -51.268 -7.177  1.00 0.00 ? 85  CYS F N   1 
ATOM   8882  C CA  . CYS F  6  85  ? -30.040 -50.288 -6.978  1.00 0.00 ? 85  CYS F CA  1 
ATOM   8883  C C   . CYS F  6  85  ? -29.569 -48.955 -6.445  1.00 0.00 ? 85  CYS F C   1 
ATOM   8884  O O   . CYS F  6  85  ? -30.055 -47.913 -6.866  1.00 0.00 ? 85  CYS F O   1 
ATOM   8885  C CB  . CYS F  6  85  ? -31.141 -50.816 -6.063  1.00 0.00 ? 85  CYS F CB  1 
ATOM   8886  S SG  . CYS F  6  85  ? -32.609 -49.806 -6.173  1.00 0.00 ? 85  CYS F SG  1 
ATOM   8887  N N   . ASN F  6  86  ? -28.591 -48.933 -5.526  1.00 0.00 ? 86  ASN F N   1 
ATOM   8888  C CA  . ASN F  6  86  ? -28.010 -47.729 -4.995  1.00 0.00 ? 86  ASN F CA  1 
ATOM   8889  C C   . ASN F  6  86  ? -27.327 -46.972 -6.106  1.00 0.00 ? 86  ASN F C   1 
ATOM   8890  O O   . ASN F  6  86  ? -27.278 -45.748 -6.116  1.00 0.00 ? 86  ASN F O   1 
ATOM   8891  C CB  . ASN F  6  86  ? -26.978 -48.046 -3.886  1.00 0.00 ? 86  ASN F CB  1 
ATOM   8892  C CG  . ASN F  6  86  ? -26.637 -46.810 -3.042  1.00 0.00 ? 86  ASN F CG  1 
ATOM   8893  O OD1 . ASN F  6  86  ? -27.231 -45.737 -3.196  1.00 0.00 ? 86  ASN F OD1 1 
ATOM   8894  N ND2 . ASN F  6  86  ? -25.659 -46.985 -2.107  1.00 0.00 ? 86  ASN F ND2 1 
ATOM   8895  N N   . PHE F  6  87  ? -26.785 -47.715 -7.088  1.00 0.00 ? 87  PHE F N   1 
ATOM   8896  C CA  . PHE F  6  87  ? -26.205 -47.157 -8.265  1.00 0.00 ? 87  PHE F CA  1 
ATOM   8897  C C   . PHE F  6  87  ? -27.286 -46.639 -9.161  1.00 0.00 ? 87  PHE F C   1 
ATOM   8898  O O   . PHE F  6  87  ? -27.102 -45.588 -9.758  1.00 0.00 ? 87  PHE F O   1 
ATOM   8899  C CB  . PHE F  6  87  ? -25.338 -48.212 -8.984  1.00 0.00 ? 87  PHE F CB  1 
ATOM   8900  C CG  . PHE F  6  87  ? -24.705 -47.725 -10.254 1.00 0.00 ? 87  PHE F CG  1 
ATOM   8901  C CD1 . PHE F  6  87  ? -23.774 -46.673 -10.247 1.00 0.00 ? 87  PHE F CD1 1 
ATOM   8902  C CD2 . PHE F  6  87  ? -24.996 -48.359 -11.469 1.00 0.00 ? 87  PHE F CD2 1 
ATOM   8903  C CE1 . PHE F  6  87  ? -23.141 -46.278 -11.433 1.00 0.00 ? 87  PHE F CE1 1 
ATOM   8904  C CE2 . PHE F  6  87  ? -24.383 -47.959 -12.659 1.00 0.00 ? 87  PHE F CE2 1 
ATOM   8905  C CZ  . PHE F  6  87  ? -23.448 -46.918 -12.641 1.00 0.00 ? 87  PHE F CZ  1 
ATOM   8906  N N   . MET F  6  88  ? -28.436 -47.344 -9.283  1.00 0.00 ? 88  MET F N   1 
ATOM   8907  C CA  . MET F  6  88  ? -29.499 -47.000 -10.201 1.00 0.00 ? 88  MET F CA  1 
ATOM   8908  C C   . MET F  6  88  ? -30.093 -45.681 -9.908  1.00 0.00 ? 88  MET F C   1 
ATOM   8909  O O   . MET F  6  88  ? -30.446 -44.931 -10.806 1.00 0.00 ? 88  MET F O   1 
ATOM   8910  C CB  . MET F  6  88  ? -30.702 -47.951 -10.166 1.00 0.00 ? 88  MET F CB  1 
ATOM   8911  C CG  . MET F  6  88  ? -30.479 -49.364 -10.677 1.00 0.00 ? 88  MET F CG  1 
ATOM   8912  S SD  . MET F  6  88  ? -30.004 -49.435 -12.407 1.00 0.00 ? 88  MET F SD  1 
ATOM   8913  C CE  . MET F  6  88  ? -28.196 -49.404 -12.260 1.00 0.00 ? 88  MET F CE  1 
ATOM   8914  N N   . ARG F  6  89  ? -30.210 -45.355 -8.632  1.00 0.00 ? 89  ARG F N   1 
ATOM   8915  C CA  . ARG F  6  89  ? -30.821 -44.143 -8.208  1.00 0.00 ? 89  ARG F CA  1 
ATOM   8916  C C   . ARG F  6  89  ? -29.969 -42.964 -8.599  1.00 0.00 ? 89  ARG F C   1 
ATOM   8917  O O   . ARG F  6  89  ? -30.470 -41.996 -9.159  1.00 0.00 ? 89  ARG F O   1 
ATOM   8918  C CB  . ARG F  6  89  ? -31.086 -44.268 -6.701  1.00 0.00 ? 89  ARG F CB  1 
ATOM   8919  C CG  . ARG F  6  89  ? -32.220 -45.275 -6.485  1.00 0.00 ? 89  ARG F CG  1 
ATOM   8920  C CD  . ARG F  6  89  ? -32.354 -45.824 -5.076  1.00 0.00 ? 89  ARG F CD  1 
ATOM   8921  N NE  . ARG F  6  89  ? -33.641 -46.587 -5.080  1.00 0.00 ? 89  ARG F NE  1 
ATOM   8922  C CZ  . ARG F  6  89  ? -34.230 -47.077 -3.954  1.00 0.00 ? 89  ARG F CZ  1 
ATOM   8923  N NH1 . ARG F  6  89  ? -33.643 -46.929 -2.733  1.00 0.00 ? 89  ARG F NH1 1 
ATOM   8924  N NH2 . ARG F  6  89  ? -35.425 -47.725 -4.055  1.00 0.00 ? 89  ARG F NH2 1 
ATOM   8925  N N   . GLN F  6  90  ? -28.648 -43.037 -8.356  1.00 0.00 ? 90  GLN F N   1 
ATOM   8926  C CA  . GLN F  6  90  ? -27.701 -42.016 -8.699  1.00 0.00 ? 90  GLN F CA  1 
ATOM   8927  C C   . GLN F  6  90  ? -27.617 -41.789 -10.173 1.00 0.00 ? 90  GLN F C   1 
ATOM   8928  O O   . GLN F  6  90  ? -27.473 -40.657 -10.614 1.00 0.00 ? 90  GLN F O   1 
ATOM   8929  C CB  . GLN F  6  90  ? -26.307 -42.366 -8.147  1.00 0.00 ? 90  GLN F CB  1 
ATOM   8930  C CG  . GLN F  6  90  ? -25.228 -41.276 -8.336  1.00 0.00 ? 90  GLN F CG  1 
ATOM   8931  C CD  . GLN F  6  90  ? -25.665 -39.969 -7.657  1.00 0.00 ? 90  GLN F CD  1 
ATOM   8932  O OE1 . GLN F  6  90  ? -25.786 -39.916 -6.427  1.00 0.00 ? 90  GLN F OE1 1 
ATOM   8933  N NE2 . GLN F  6  90  ? -25.905 -38.902 -8.480  1.00 0.00 ? 90  GLN F NE2 1 
ATOM   8934  N N   . GLU F  6  91  ? -27.729 -42.866 -10.972 1.00 0.00 ? 91  GLU F N   1 
ATOM   8935  C CA  . GLU F  6  91  ? -27.726 -42.810 -12.420 1.00 0.00 ? 91  GLU F CA  1 
ATOM   8936  C C   . GLU F  6  91  ? -28.970 -42.219 -13.004 1.00 0.00 ? 91  GLU F C   1 
ATOM   8937  O O   . GLU F  6  91  ? -28.907 -41.567 -14.044 1.00 0.00 ? 91  GLU F O   1 
ATOM   8938  C CB  . GLU F  6  91  ? -27.486 -44.173 -13.084 1.00 0.00 ? 91  GLU F CB  1 
ATOM   8939  C CG  . GLU F  6  91  ? -26.077 -44.723 -12.827 1.00 0.00 ? 91  GLU F CG  1 
ATOM   8940  C CD  . GLU F  6  91  ? -25.015 -43.677 -13.179 1.00 0.00 ? 91  GLU F CD  1 
ATOM   8941  O OE1 . GLU F  6  91  ? -25.034 -43.165 -14.330 1.00 0.00 ? 91  GLU F OE1 1 
ATOM   8942  O OE2 . GLU F  6  91  ? -24.181 -43.359 -12.289 1.00 0.00 ? 91  GLU F OE2 1 
ATOM   8943  N N   . CYS F  6  92  ? -30.139 -42.435 -12.360 1.00 0.00 ? 92  CYS F N   1 
ATOM   8944  C CA  . CYS F  6  92  ? -31.372 -41.790 -12.746 1.00 0.00 ? 92  CYS F CA  1 
ATOM   8945  C C   . CYS F  6  92  ? -31.313 -40.315 -12.534 1.00 0.00 ? 92  CYS F C   1 
ATOM   8946  O O   . CYS F  6  92  ? -31.773 -39.543 -13.377 1.00 0.00 ? 92  CYS F O   1 
ATOM   8947  C CB  . CYS F  6  92  ? -32.565 -42.328 -11.954 1.00 0.00 ? 92  CYS F CB  1 
ATOM   8948  S SG  . CYS F  6  92  ? -32.941 -44.033 -12.444 1.00 0.00 ? 92  CYS F SG  1 
ATOM   8949  N N   . LEU F  6  93  ? -30.682 -39.884 -11.422 1.00 0.00 ? 93  LEU F N   1 
ATOM   8950  C CA  . LEU F  6  93  ? -30.499 -38.488 -11.159 1.00 0.00 ? 93  LEU F CA  1 
ATOM   8951  C C   . LEU F  6  93  ? -29.521 -37.831 -12.068 1.00 0.00 ? 93  LEU F C   1 
ATOM   8952  O O   . LEU F  6  93  ? -29.582 -36.631 -12.277 1.00 0.00 ? 93  LEU F O   1 
ATOM   8953  C CB  . LEU F  6  93  ? -30.079 -38.219 -9.717  1.00 0.00 ? 93  LEU F CB  1 
ATOM   8954  C CG  . LEU F  6  93  ? -31.131 -38.652 -8.684  1.00 0.00 ? 93  LEU F CG  1 
ATOM   8955  C CD1 . LEU F  6  93  ? -30.617 -38.311 -7.286  1.00 0.00 ? 93  LEU F CD1 1 
ATOM   8956  C CD2 . LEU F  6  93  ? -32.549 -38.094 -8.934  1.00 0.00 ? 93  LEU F CD2 1 
ATOM   8957  N N   . ASP F  6  94  ? -28.583 -38.583 -12.639 1.00 0.00 ? 94  ASP F N   1 
ATOM   8958  C CA  . ASP F  6  94  ? -27.618 -38.052 -13.559 1.00 0.00 ? 94  ASP F CA  1 
ATOM   8959  C C   . ASP F  6  94  ? -28.276 -37.521 -14.804 1.00 0.00 ? 94  ASP F C   1 
ATOM   8960  O O   . ASP F  6  94  ? -28.015 -36.400 -15.215 1.00 0.00 ? 94  ASP F O   1 
ATOM   8961  C CB  . ASP F  6  94  ? -26.596 -39.165 -13.927 1.00 0.00 ? 94  ASP F CB  1 
ATOM   8962  C CG  . ASP F  6  94  ? -25.357 -38.652 -14.656 1.00 0.00 ? 94  ASP F CG  1 
ATOM   8963  O OD1 . ASP F  6  94  ? -24.613 -37.834 -14.058 1.00 0.00 ? 94  ASP F OD1 1 
ATOM   8964  O OD2 . ASP F  6  94  ? -25.134 -39.089 -15.814 1.00 0.00 ? 94  ASP F OD2 1 
ATOM   8965  N N   . SER F  6  95  ? -29.140 -38.317 -15.460 1.00 0.00 ? 95  SER F N   1 
ATOM   8966  C CA  . SER F  6  95  ? -29.831 -37.844 -16.626 1.00 0.00 ? 95  SER F CA  1 
ATOM   8967  C C   . SER F  6  95  ? -30.843 -36.771 -16.315 1.00 0.00 ? 95  SER F C   1 
ATOM   8968  O O   . SER F  6  95  ? -31.037 -35.848 -17.106 1.00 0.00 ? 95  SER F O   1 
ATOM   8969  C CB  . SER F  6  95  ? -30.502 -38.998 -17.365 1.00 0.00 ? 95  SER F CB  1 
ATOM   8970  O OG  . SER F  6  95  ? -31.079 -38.583 -18.592 1.00 0.00 ? 95  SER F OG  1 
ATOM   8971  N N   . ARG F  6  96  ? -31.510 -36.848 -15.141 1.00 0.00 ? 96  ARG F N   1 
ATOM   8972  C CA  . ARG F  6  96  ? -32.481 -35.851 -14.758 1.00 0.00 ? 96  ARG F CA  1 
ATOM   8973  C C   . ARG F  6  96  ? -31.872 -34.536 -14.440 1.00 0.00 ? 96  ARG F C   1 
ATOM   8974  O O   . ARG F  6  96  ? -32.586 -33.542 -14.416 1.00 0.00 ? 96  ARG F O   1 
ATOM   8975  C CB  . ARG F  6  96  ? -33.363 -36.305 -13.593 1.00 0.00 ? 96  ARG F CB  1 
ATOM   8976  C CG  . ARG F  6  96  ? -34.393 -37.337 -14.075 1.00 0.00 ? 96  ARG F CG  1 
ATOM   8977  C CD  . ARG F  6  96  ? -34.944 -38.222 -12.952 1.00 0.00 ? 96  ARG F CD  1 
ATOM   8978  N NE  . ARG F  6  96  ? -36.018 -39.122 -13.488 1.00 0.00 ? 96  ARG F NE  1 
ATOM   8979  C CZ  . ARG F  6  96  ? -37.350 -38.833 -13.384 1.00 0.00 ? 96  ARG F CZ  1 
ATOM   8980  N NH1 . ARG F  6  96  ? -37.779 -37.632 -12.897 1.00 0.00 ? 96  ARG F NH1 1 
ATOM   8981  N NH2 . ARG F  6  96  ? -38.277 -39.755 -13.766 1.00 0.00 ? 96  ARG F NH2 1 
ATOM   8982  N N   . PHE F  6  97  ? -30.565 -34.487 -14.129 1.00 0.00 ? 97  PHE F N   1 
ATOM   8983  C CA  . PHE F  6  97  ? -29.942 -33.257 -13.731 1.00 0.00 ? 97  PHE F CA  1 
ATOM   8984  C C   . PHE F  6  97  ? -29.218 -32.700 -14.885 1.00 0.00 ? 97  PHE F C   1 
ATOM   8985  O O   . PHE F  6  97  ? -29.388 -31.537 -15.209 1.00 0.00 ? 97  PHE F O   1 
ATOM   8986  C CB  . PHE F  6  97  ? -28.929 -33.557 -12.599 1.00 0.00 ? 97  PHE F CB  1 
ATOM   8987  C CG  . PHE F  6  97  ? -28.081 -32.418 -12.136 1.00 0.00 ? 97  PHE F CG  1 
ATOM   8988  C CD1 . PHE F  6  97  ? -26.829 -32.185 -12.714 1.00 0.00 ? 97  PHE F CD1 1 
ATOM   8989  C CD2 . PHE F  6  97  ? -28.467 -31.657 -11.038 1.00 0.00 ? 97  PHE F CD2 1 
ATOM   8990  C CE1 . PHE F  6  97  ? -25.986 -31.184 -12.218 1.00 0.00 ? 97  PHE F CE1 1 
ATOM   8991  C CE2 . PHE F  6  97  ? -27.635 -30.644 -10.542 1.00 0.00 ? 97  PHE F CE2 1 
ATOM   8992  C CZ  . PHE F  6  97  ? -26.394 -30.400 -11.137 1.00 0.00 ? 97  PHE F CZ  1 
ATOM   8993  N N   . VAL F  6  98  ? -28.341 -33.492 -15.512 1.00 0.00 ? 98  VAL F N   1 
ATOM   8994  C CA  . VAL F  6  98  ? -27.452 -32.986 -16.519 1.00 0.00 ? 98  VAL F CA  1 
ATOM   8995  C C   . VAL F  6  98  ? -28.181 -32.481 -17.727 1.00 0.00 ? 98  VAL F C   1 
ATOM   8996  O O   . VAL F  6  98  ? -27.778 -31.486 -18.314 1.00 0.00 ? 98  VAL F O   1 
ATOM   8997  C CB  . VAL F  6  98  ? -26.462 -34.062 -16.918 1.00 0.00 ? 98  VAL F CB  1 
ATOM   8998  C CG1 . VAL F  6  98  ? -25.546 -33.588 -18.053 1.00 0.00 ? 98  VAL F CG1 1 
ATOM   8999  C CG2 . VAL F  6  98  ? -25.619 -34.398 -15.679 1.00 0.00 ? 98  VAL F CG2 1 
ATOM   9000  N N   . PHE F  6  99  ? -29.281 -33.148 -18.116 1.00 0.00 ? 99  PHE F N   1 
ATOM   9001  C CA  . PHE F  6  99  ? -29.955 -32.820 -19.338 1.00 0.00 ? 99  PHE F CA  1 
ATOM   9002  C C   . PHE F  6  99  ? -31.336 -32.329 -19.074 1.00 0.00 ? 99  PHE F C   1 
ATOM   9003  O O   . PHE F  6  99  ? -32.027 -31.983 -20.026 1.00 0.00 ? 99  PHE F O   1 
ATOM   9004  C CB  . PHE F  6  99  ? -30.092 -34.072 -20.219 1.00 0.00 ? 99  PHE F CB  1 
ATOM   9005  C CG  . PHE F  6  99  ? -28.733 -34.640 -20.418 1.00 0.00 ? 99  PHE F CG  1 
ATOM   9006  C CD1 . PHE F  6  99  ? -27.819 -34.002 -21.262 1.00 0.00 ? 99  PHE F CD1 1 
ATOM   9007  C CD2 . PHE F  6  99  ? -28.335 -35.782 -19.718 1.00 0.00 ? 99  PHE F CD2 1 
ATOM   9008  C CE1 . PHE F  6  99  ? -26.513 -34.499 -21.400 1.00 0.00 ? 99  PHE F CE1 1 
ATOM   9009  C CE2 . PHE F  6  99  ? -27.048 -36.302 -19.864 1.00 0.00 ? 99  PHE F CE2 1 
ATOM   9010  C CZ  . PHE F  6  99  ? -26.134 -35.660 -20.711 1.00 0.00 ? 99  PHE F CZ  1 
ATOM   9011  N N   . ASP F  6  100 ? -31.779 -32.298 -17.820 1.00 0.00 ? 100 ASP F N   1 
ATOM   9012  C CA  . ASP F  6  100 ? -33.153 -31.872 -17.505 1.00 0.00 ? 100 ASP F CA  1 
ATOM   9013  C C   . ASP F  6  100 ? -34.346 -32.626 -18.155 1.00 0.00 ? 100 ASP F C   1 
ATOM   9014  O O   . ASP F  6  100 ? -35.208 -31.999 -18.770 1.00 0.00 ? 100 ASP F O   1 
ATOM   9015  C CB  . ASP F  6  100 ? -33.298 -30.367 -17.768 1.00 0.00 ? 100 ASP F CB  1 
ATOM   9016  C CG  . ASP F  6  100 ? -32.682 -29.518 -16.669 1.00 0.00 ? 100 ASP F CG  1 
ATOM   9017  O OD1 . ASP F  6  100 ? -31.481 -29.191 -16.769 1.00 0.00 ? 100 ASP F OD1 1 
ATOM   9018  O OD2 . ASP F  6  100 ? -33.401 -29.177 -15.707 1.00 0.00 ? 100 ASP F OD2 1 
ATOM   9019  N N   . ARG F  6  101 ? -34.384 -33.956 -18.041 1.00 0.00 ? 101 ARG F N   1 
ATOM   9020  C CA  . ARG F  6  101 ? -35.486 -34.744 -18.531 1.00 0.00 ? 101 ARG F CA  1 
ATOM   9021  C C   . ARG F  6  101 ? -35.429 -36.003 -17.691 1.00 0.00 ? 101 ARG F C   1 
ATOM   9022  O O   . ARG F  6  101 ? -34.411 -36.274 -17.058 1.00 0.00 ? 101 ARG F O   1 
ATOM   9023  C CB  . ARG F  6  101 ? -35.315 -35.069 -20.012 1.00 0.00 ? 101 ARG F CB  1 
ATOM   9024  C CG  . ARG F  6  101 ? -33.882 -35.337 -20.435 1.00 0.00 ? 101 ARG F CG  1 
ATOM   9025  C CD  . ARG F  6  101 ? -33.845 -36.096 -21.747 1.00 0.00 ? 101 ARG F CD  1 
ATOM   9026  N NE  . ARG F  6  101 ? -32.482 -36.346 -22.196 1.00 0.00 ? 101 ARG F NE  1 
ATOM   9027  C CZ  . ARG F  6  101 ? -31.808 -37.462 -21.946 1.00 0.00 ? 101 ARG F CZ  1 
ATOM   9028  N NH1 . ARG F  6  101 ? -32.371 -38.436 -21.244 1.00 0.00 ? 101 ARG F NH1 1 
ATOM   9029  N NH2 . ARG F  6  101 ? -30.571 -37.604 -22.398 1.00 0.00 ? 101 ARG F NH2 1 
ATOM   9030  N N   . PRO F  6  102 ? -36.495 -36.785 -17.688 1.00 0.00 ? 102 PRO F N   1 
ATOM   9031  C CA  . PRO F  6  102 ? -36.418 -38.104 -17.116 1.00 0.00 ? 102 PRO F CA  1 
ATOM   9032  C C   . PRO F  6  102 ? -35.435 -38.941 -17.842 1.00 0.00 ? 102 PRO F C   1 
ATOM   9033  O O   . PRO F  6  102 ? -35.360 -38.858 -19.056 1.00 0.00 ? 102 PRO F O   1 
ATOM   9034  C CB  . PRO F  6  102 ? -37.811 -38.701 -17.264 1.00 0.00 ? 102 PRO F CB  1 
ATOM   9035  C CG  . PRO F  6  102 ? -38.415 -37.958 -18.442 1.00 0.00 ? 102 PRO F CG  1 
ATOM   9036  C CD  . PRO F  6  102 ? -37.821 -36.557 -18.265 1.00 0.00 ? 102 PRO F CD  1 
ATOM   9037  N N   . LEU F  6  103 ? -34.725 -39.805 -17.120 1.00 0.00 ? 103 LEU F N   1 
ATOM   9038  C CA  . LEU F  6  103 ? -33.812 -40.748 -17.660 1.00 0.00 ? 103 LEU F CA  1 
ATOM   9039  C C   . LEU F  6  103 ? -34.619 -41.678 -18.523 1.00 0.00 ? 103 LEU F C   1 
ATOM   9040  O O   . LEU F  6  103 ? -35.675 -42.082 -18.043 1.00 0.00 ? 103 LEU F O   1 
ATOM   9041  C CB  . LEU F  6  103 ? -33.144 -41.518 -16.507 1.00 0.00 ? 103 LEU F CB  1 
ATOM   9042  C CG  . LEU F  6  103 ? -32.001 -42.426 -16.959 1.00 0.00 ? 103 LEU F CG  1 
ATOM   9043  C CD1 . LEU F  6  103 ? -30.857 -42.575 -15.947 1.00 0.00 ? 103 LEU F CD1 1 
ATOM   9044  C CD2 . LEU F  6  103 ? -32.617 -43.764 -17.378 1.00 0.00 ? 103 LEU F CD2 1 
ATOM   9045  N N   . PRO F  6  104 ? -34.254 -42.024 -19.766 1.00 0.00 ? 104 PRO F N   1 
ATOM   9046  C CA  . PRO F  6  104 ? -34.937 -43.026 -20.558 1.00 0.00 ? 104 PRO F CA  1 
ATOM   9047  C C   . PRO F  6  104 ? -34.441 -44.283 -20.010 1.00 0.00 ? 104 PRO F C   1 
ATOM   9048  O O   . PRO F  6  104 ? -33.311 -44.255 -19.552 1.00 0.00 ? 104 PRO F O   1 
ATOM   9049  C CB  . PRO F  6  104 ? -34.457 -42.814 -21.983 1.00 0.00 ? 104 PRO F CB  1 
ATOM   9050  C CG  . PRO F  6  104 ? -33.159 -42.022 -21.846 1.00 0.00 ? 104 PRO F CG  1 
ATOM   9051  C CD  . PRO F  6  104 ? -33.362 -41.215 -20.582 1.00 0.00 ? 104 PRO F CD  1 
ATOM   9052  N N   . VAL F  6  105 ? -35.304 -45.317 -19.925 1.00 0.00 ? 105 VAL F N   1 
ATOM   9053  C CA  . VAL F  6  105 ? -35.116 -46.529 -19.150 1.00 0.00 ? 105 VAL F CA  1 
ATOM   9054  C C   . VAL F  6  105 ? -34.021 -47.367 -19.707 1.00 0.00 ? 105 VAL F C   1 
ATOM   9055  O O   . VAL F  6  105 ? -33.209 -47.921 -18.974 1.00 0.00 ? 105 VAL F O   1 
ATOM   9056  C CB  . VAL F  6  105 ? -36.373 -47.388 -19.174 1.00 0.00 ? 105 VAL F CB  1 
ATOM   9057  C CG1 . VAL F  6  105 ? -36.261 -48.559 -18.172 1.00 0.00 ? 105 VAL F CG1 1 
ATOM   9058  C CG2 . VAL F  6  105 ? -37.600 -46.504 -18.887 1.00 0.00 ? 105 VAL F CG2 1 
ATOM   9059  N N   . SER F  6  106 ? -33.984 -47.441 -21.047 1.00 0.00 ? 106 SER F N   1 
ATOM   9060  C CA  . SER F  6  106 ? -33.131 -48.282 -21.816 1.00 0.00 ? 106 SER F CA  1 
ATOM   9061  C C   . SER F  6  106 ? -31.692 -47.946 -21.609 1.00 0.00 ? 106 SER F C   1 
ATOM   9062  O O   . SER F  6  106 ? -30.841 -48.824 -21.557 1.00 0.00 ? 106 SER F O   1 
ATOM   9063  C CB  . SER F  6  106 ? -33.520 -48.190 -23.303 1.00 0.00 ? 106 SER F CB  1 
ATOM   9064  O OG  . SER F  6  106 ? -33.756 -46.849 -23.712 1.00 0.00 ? 106 SER F OG  1 
ATOM   9065  N N   . ARG F  6  107 ? -31.375 -46.663 -21.430 1.00 0.00 ? 107 ARG F N   1 
ATOM   9066  C CA  . ARG F  6  107 ? -30.038 -46.242 -21.151 1.00 0.00 ? 107 ARG F CA  1 
ATOM   9067  C C   . ARG F  6  107 ? -29.553 -46.693 -19.813 1.00 0.00 ? 107 ARG F C   1 
ATOM   9068  O O   . ARG F  6  107 ? -28.388 -47.043 -19.681 1.00 0.00 ? 107 ARG F O   1 
ATOM   9069  C CB  . ARG F  6  107 ? -29.872 -44.728 -21.203 1.00 0.00 ? 107 ARG F CB  1 
ATOM   9070  C CG  . ARG F  6  107 ? -30.342 -44.122 -22.525 1.00 0.00 ? 107 ARG F CG  1 
ATOM   9071  C CD  . ARG F  6  107 ? -29.527 -44.474 -23.765 1.00 0.00 ? 107 ARG F CD  1 
ATOM   9072  N NE  . ARG F  6  107 ? -30.065 -43.630 -24.883 1.00 0.00 ? 107 ARG F NE  1 
ATOM   9073  C CZ  . ARG F  6  107 ? -29.850 -42.281 -24.981 1.00 0.00 ? 107 ARG F CZ  1 
ATOM   9074  N NH1 . ARG F  6  107 ? -28.909 -41.649 -24.225 1.00 0.00 ? 107 ARG F NH1 1 
ATOM   9075  N NH2 . ARG F  6  107 ? -30.599 -41.551 -25.854 1.00 0.00 ? 107 ARG F NH2 1 
ATOM   9076  N N   . LEU F  6  108 ? -30.410 -46.678 -18.778 1.00 0.00 ? 108 LEU F N   1 
ATOM   9077  C CA  . LEU F  6  108 ? -30.070 -47.080 -17.435 1.00 0.00 ? 108 LEU F CA  1 
ATOM   9078  C C   . LEU F  6  108 ? -29.807 -48.548 -17.371 1.00 0.00 ? 108 LEU F C   1 
ATOM   9079  O O   . LEU F  6  108 ? -28.937 -48.980 -16.627 1.00 0.00 ? 108 LEU F O   1 
ATOM   9080  C CB  . LEU F  6  108 ? -31.206 -46.767 -16.466 1.00 0.00 ? 108 LEU F CB  1 
ATOM   9081  C CG  . LEU F  6  108 ? -31.031 -47.133 -14.984 1.00 0.00 ? 108 LEU F CG  1 
ATOM   9082  C CD1 . LEU F  6  108 ? -30.054 -46.194 -14.263 1.00 0.00 ? 108 LEU F CD1 1 
ATOM   9083  C CD2 . LEU F  6  108 ? -32.401 -47.145 -14.290 1.00 0.00 ? 108 LEU F CD2 1 
ATOM   9084  N N   . VAL F  6  109 ? -30.544 -49.353 -18.169 1.00 0.00 ? 109 VAL F N   1 
ATOM   9085  C CA  . VAL F  6  109 ? -30.367 -50.776 -18.297 1.00 0.00 ? 109 VAL F CA  1 
ATOM   9086  C C   . VAL F  6  109 ? -29.055 -51.066 -18.958 1.00 0.00 ? 109 VAL F C   1 
ATOM   9087  O O   . VAL F  6  109 ? -28.364 -52.005 -18.576 1.00 0.00 ? 109 VAL F O   1 
ATOM   9088  C CB  . VAL F  6  109 ? -31.493 -51.362 -19.085 1.00 0.00 ? 109 VAL F CB  1 
ATOM   9089  C CG1 . VAL F  6  109 ? -31.263 -52.857 -19.362 1.00 0.00 ? 109 VAL F CG1 1 
ATOM   9090  C CG2 . VAL F  6  109 ? -32.791 -51.153 -18.294 1.00 0.00 ? 109 VAL F CG2 1 
ATOM   9091  N N   . SER F  6  110 ? -28.641 -50.221 -19.931 1.00 0.00 ? 110 SER F N   1 
ATOM   9092  C CA  . SER F  6  110 ? -27.336 -50.280 -20.548 1.00 0.00 ? 110 SER F CA  1 
ATOM   9093  C C   . SER F  6  110 ? -26.212 -49.995 -19.592 1.00 0.00 ? 110 SER F C   1 
ATOM   9094  O O   . SER F  6  110 ? -25.138 -50.556 -19.726 1.00 0.00 ? 110 SER F O   1 
ATOM   9095  C CB  . SER F  6  110 ? -27.199 -49.355 -21.755 1.00 0.00 ? 110 SER F CB  1 
ATOM   9096  O OG  . SER F  6  110 ? -28.210 -49.655 -22.702 1.00 0.00 ? 110 SER F OG  1 
ATOM   9097  N N   . LEU F  6  111 ? -26.429 -49.138 -18.578 1.00 0.00 ? 111 LEU F N   1 
ATOM   9098  C CA  . LEU F  6  111 ? -25.520 -48.927 -17.479 1.00 0.00 ? 111 LEU F CA  1 
ATOM   9099  C C   . LEU F  6  111 ? -25.447 -50.116 -16.556 1.00 0.00 ? 111 LEU F C   1 
ATOM   9100  O O   . LEU F  6  111 ? -24.402 -50.384 -15.982 1.00 0.00 ? 111 LEU F O   1 
ATOM   9101  C CB  . LEU F  6  111 ? -25.840 -47.680 -16.636 1.00 0.00 ? 111 LEU F CB  1 
ATOM   9102  C CG  . LEU F  6  111 ? -25.776 -46.367 -17.442 1.00 0.00 ? 111 LEU F CG  1 
ATOM   9103  C CD1 . LEU F  6  111 ? -26.287 -45.198 -16.602 1.00 0.00 ? 111 LEU F CD1 1 
ATOM   9104  C CD2 . LEU F  6  111 ? -24.366 -46.063 -17.982 1.00 0.00 ? 111 LEU F CD2 1 
ATOM   9105  N N   . ILE F  6  112 ? -26.548 -50.871 -16.351 1.00 0.00 ? 112 ILE F N   1 
ATOM   9106  C CA  . ILE F  6  112 ? -26.547 -52.077 -15.550 1.00 0.00 ? 112 ILE F CA  1 
ATOM   9107  C C   . ILE F  6  112 ? -25.656 -53.070 -16.180 1.00 0.00 ? 112 ILE F C   1 
ATOM   9108  O O   . ILE F  6  112 ? -24.902 -53.729 -15.479 1.00 0.00 ? 112 ILE F O   1 
ATOM   9109  C CB  . ILE F  6  112 ? -27.910 -52.744 -15.371 1.00 0.00 ? 112 ILE F CB  1 
ATOM   9110  C CG1 . ILE F  6  112 ? -28.862 -51.791 -14.635 1.00 0.00 ? 112 ILE F CG1 1 
ATOM   9111  C CG2 . ILE F  6  112 ? -27.793 -54.073 -14.573 1.00 0.00 ? 112 ILE F CG2 1 
ATOM   9112  C CD1 . ILE F  6  112 ? -30.313 -52.264 -14.609 1.00 0.00 ? 112 ILE F CD1 1 
ATOM   9113  N N   . GLY F  6  113 ? -25.680 -53.183 -17.518 1.00 0.00 ? 113 GLY F N   1 
ATOM   9114  C CA  . GLY F  6  113 ? -24.832 -54.145 -18.185 1.00 0.00 ? 113 GLY F CA  1 
ATOM   9115  C C   . GLY F  6  113 ? -23.376 -53.790 -18.023 1.00 0.00 ? 113 GLY F C   1 
ATOM   9116  O O   . GLY F  6  113 ? -22.551 -54.667 -17.807 1.00 0.00 ? 113 GLY F O   1 
ATOM   9117  N N   . SER F  6  114 ? -23.049 -52.485 -18.024 1.00 0.00 ? 114 SER F N   1 
ATOM   9118  C CA  . SER F  6  114 ? -21.725 -51.975 -17.817 1.00 0.00 ? 114 SER F CA  1 
ATOM   9119  C C   . SER F  6  114 ? -21.188 -52.163 -16.436 1.00 0.00 ? 114 SER F C   1 
ATOM   9120  O O   . SER F  6  114 ? -19.979 -52.231 -16.278 1.00 0.00 ? 114 SER F O   1 
ATOM   9121  C CB  . SER F  6  114 ? -21.626 -50.483 -18.134 1.00 0.00 ? 114 SER F CB  1 
ATOM   9122  O OG  . SER F  6  114 ? -21.905 -50.268 -19.506 1.00 0.00 ? 114 SER F OG  1 
ATOM   9123  N N   . LYS F  6  115 ? -22.030 -52.167 -15.385 1.00 0.00 ? 115 LYS F N   1 
ATOM   9124  C CA  . LYS F  6  115 ? -21.567 -52.266 -14.015 1.00 0.00 ? 115 LYS F CA  1 
ATOM   9125  C C   . LYS F  6  115 ? -21.460 -53.703 -13.628 1.00 0.00 ? 115 LYS F C   1 
ATOM   9126  O O   . LYS F  6  115 ? -20.532 -54.102 -12.930 1.00 0.00 ? 115 LYS F O   1 
ATOM   9127  C CB  . LYS F  6  115 ? -22.418 -51.507 -12.976 1.00 0.00 ? 115 LYS F CB  1 
ATOM   9128  C CG  . LYS F  6  115 ? -21.828 -51.636 -11.562 1.00 0.00 ? 115 LYS F CG  1 
ATOM   9129  C CD  . LYS F  6  115 ? -22.274 -50.551 -10.589 1.00 0.00 ? 115 LYS F CD  1 
ATOM   9130  C CE  . LYS F  6  115 ? -21.895 -50.846 -9.133  1.00 0.00 ? 115 LYS F CE  1 
ATOM   9131  N NZ  . LYS F  6  115 ? -22.736 -51.926 -8.573  1.00 0.00 ? 115 LYS F NZ  1 
ATOM   9132  N N   . THR F  6  116 ? -22.363 -54.538 -14.149 1.00 0.00 ? 116 THR F N   1 
ATOM   9133  C CA  . THR F  6  116 ? -22.308 -55.959 -13.976 1.00 0.00 ? 116 THR F CA  1 
ATOM   9134  C C   . THR F  6  116 ? -21.139 -56.544 -14.756 1.00 0.00 ? 116 THR F C   1 
ATOM   9135  O O   . THR F  6  116 ? -20.660 -57.623 -14.435 1.00 0.00 ? 116 THR F O   1 
ATOM   9136  C CB  . THR F  6  116 ? -23.614 -56.541 -14.459 1.00 0.00 ? 116 THR F CB  1 
ATOM   9137  O OG1 . THR F  6  116 ? -24.658 -56.001 -13.665 1.00 0.00 ? 116 THR F OG1 1 
ATOM   9138  C CG2 . THR F  6  116 ? -23.662 -58.080 -14.366 1.00 0.00 ? 116 THR F CG2 1 
ATOM   9139  N N   . GLN F  6  117 ? -20.631 -55.845 -15.795 1.00 0.00 ? 117 GLN F N   1 
ATOM   9140  C CA  . GLN F  6  117 ? -19.560 -56.309 -16.641 1.00 0.00 ? 117 GLN F CA  1 
ATOM   9141  C C   . GLN F  6  117 ? -18.252 -56.512 -15.965 1.00 0.00 ? 117 GLN F C   1 
ATOM   9142  O O   . GLN F  6  117 ? -17.525 -57.428 -16.317 1.00 0.00 ? 117 GLN F O   1 
ATOM   9143  C CB  . GLN F  6  117 ? -19.284 -55.328 -17.802 1.00 0.00 ? 117 GLN F CB  1 
ATOM   9144  C CG  . GLN F  6  117 ? -18.201 -55.750 -18.821 1.00 0.00 ? 117 GLN F CG  1 
ATOM   9145  C CD  . GLN F  6  117 ? -18.472 -57.148 -19.385 1.00 0.00 ? 117 GLN F CD  1 
ATOM   9146  O OE1 . GLN F  6  117 ? -17.575 -57.992 -19.431 1.00 0.00 ? 117 GLN F OE1 1 
ATOM   9147  N NE2 . GLN F  6  117 ? -19.742 -57.393 -19.808 1.00 0.00 ? 117 GLN F NE2 1 
ATOM   9148  N N   . ILE F  6  118 ? -17.880 -55.648 -15.010 1.00 0.00 ? 118 ILE F N   1 
ATOM   9149  C CA  . ILE F  6  118 ? -16.563 -55.666 -14.423 1.00 0.00 ? 118 ILE F CA  1 
ATOM   9150  C C   . ILE F  6  118 ? -16.231 -56.955 -13.728 1.00 0.00 ? 118 ILE F C   1 
ATOM   9151  O O   . ILE F  6  118 ? -15.163 -57.460 -14.043 1.00 0.00 ? 118 ILE F O   1 
ATOM   9152  C CB  . ILE F  6  118 ? -16.238 -54.457 -13.564 1.00 0.00 ? 118 ILE F CB  1 
ATOM   9153  C CG1 . ILE F  6  118 ? -16.457 -53.148 -14.357 1.00 0.00 ? 118 ILE F CG1 1 
ATOM   9154  C CG2 . ILE F  6  118 ? -14.770 -54.518 -13.106 1.00 0.00 ? 118 ILE F CG2 1 
ATOM   9155  C CD1 . ILE F  6  118 ? -17.790 -52.468 -14.053 1.00 0.00 ? 118 ILE F CD1 1 
ATOM   9156  N N   . PRO F  6  119 ? -16.992 -57.575 -12.851 1.00 0.00 ? 119 PRO F N   1 
ATOM   9157  C CA  . PRO F  6  119 ? -16.613 -58.826 -12.227 1.00 0.00 ? 119 PRO F CA  1 
ATOM   9158  C C   . PRO F  6  119 ? -16.357 -59.978 -13.144 1.00 0.00 ? 119 PRO F C   1 
ATOM   9159  O O   . PRO F  6  119 ? -15.528 -60.820 -12.824 1.00 0.00 ? 119 PRO F O   1 
ATOM   9160  C CB  . PRO F  6  119 ? -17.790 -59.187 -11.358 1.00 0.00 ? 119 PRO F CB  1 
ATOM   9161  C CG  . PRO F  6  119 ? -18.431 -57.861 -10.974 1.00 0.00 ? 119 PRO F CG  1 
ATOM   9162  C CD  . PRO F  6  119 ? -18.132 -56.973 -12.173 1.00 0.00 ? 119 PRO F CD  1 
ATOM   9163  N N   . THR F  6  120 ? -17.097 -60.081 -14.253 1.00 0.00 ? 120 THR F N   1 
ATOM   9164  C CA  . THR F  6  120 ? -16.955 -61.184 -15.149 1.00 0.00 ? 120 THR F CA  1 
ATOM   9165  C C   . THR F  6  120 ? -15.625 -61.152 -15.852 1.00 0.00 ? 120 THR F C   1 
ATOM   9166  O O   . THR F  6  120 ? -15.062 -62.213 -16.098 1.00 0.00 ? 120 THR F O   1 
ATOM   9167  C CB  . THR F  6  120 ? -18.082 -61.206 -16.179 1.00 0.00 ? 120 THR F CB  1 
ATOM   9168  O OG1 . THR F  6  120 ? -18.047 -60.101 -17.071 1.00 0.00 ? 120 THR F OG1 1 
ATOM   9169  C CG2 . THR F  6  120 ? -19.452 -61.207 -15.469 1.00 0.00 ? 120 THR F CG2 1 
ATOM   9170  N N   . GLN F  6  121 ? -15.094 -59.929 -16.136 1.00 0.00 ? 121 GLN F N   1 
ATOM   9171  C CA  . GLN F  6  121 ? -13.880 -59.708 -16.885 1.00 0.00 ? 121 GLN F CA  1 
ATOM   9172  C C   . GLN F  6  121 ? -12.658 -59.698 -16.015 1.00 0.00 ? 121 GLN F C   1 
ATOM   9173  O O   . GLN F  6  121 ? -11.558 -59.654 -16.541 1.00 0.00 ? 121 GLN F O   1 
ATOM   9174  C CB  . GLN F  6  121 ? -13.964 -58.366 -17.648 1.00 0.00 ? 121 GLN F CB  1 
ATOM   9175  C CG  . GLN F  6  121 ? -12.941 -58.126 -18.788 1.00 0.00 ? 121 GLN F CG  1 
ATOM   9176  C CD  . GLN F  6  121 ? -13.094 -59.114 -19.954 1.00 0.00 ? 121 GLN F CD  1 
ATOM   9177  O OE1 . GLN F  6  121 ? -14.097 -59.813 -20.066 1.00 0.00 ? 121 GLN F OE1 1 
ATOM   9178  N NE2 . GLN F  6  121 ? -12.098 -59.145 -20.876 1.00 0.00 ? 121 GLN F NE2 1 
ATOM   9179  N N   . ARG F  6  122 ? -12.796 -59.748 -14.671 1.00 0.00 ? 122 ARG F N   1 
ATOM   9180  C CA  . ARG F  6  122 ? -11.716 -59.491 -13.752 1.00 0.00 ? 122 ARG F CA  1 
ATOM   9181  C C   . ARG F  6  122 ? -11.711 -60.575 -12.731 1.00 0.00 ? 122 ARG F C   1 
ATOM   9182  O O   . ARG F  6  122 ? -12.623 -61.391 -12.699 1.00 0.00 ? 122 ARG F O   1 
ATOM   9183  C CB  . ARG F  6  122 ? -11.911 -58.120 -13.081 1.00 0.00 ? 122 ARG F CB  1 
ATOM   9184  C CG  . ARG F  6  122 ? -10.647 -57.488 -12.495 1.00 0.00 ? 122 ARG F CG  1 
ATOM   9185  C CD  . ARG F  6  122 ? -10.914 -56.167 -11.771 1.00 0.00 ? 122 ARG F CD  1 
ATOM   9186  N NE  . ARG F  6  122 ? -11.360 -55.148 -12.766 1.00 0.00 ? 122 ARG F NE  1 
ATOM   9187  C CZ  . ARG F  6  122 ? -11.478 -53.825 -12.442 1.00 0.00 ? 122 ARG F CZ  1 
ATOM   9188  N NH1 . ARG F  6  122 ? -11.319 -53.397 -11.156 1.00 0.00 ? 122 ARG F NH1 1 
ATOM   9189  N NH2 . ARG F  6  122 ? -11.754 -52.916 -13.423 1.00 0.00 ? 122 ARG F NH2 1 
ATOM   9190  N N   . TYR F  6  123 ? -10.639 -60.623 -11.906 1.00 0.00 ? 123 TYR F N   1 
ATOM   9191  C CA  . TYR F  6  123 ? -10.300 -61.627 -10.916 1.00 0.00 ? 123 TYR F CA  1 
ATOM   9192  C C   . TYR F  6  123 ? -10.633 -61.084 -9.576  1.00 0.00 ? 123 TYR F C   1 
ATOM   9193  O O   . TYR F  6  123 ? -10.579 -59.881 -9.357  1.00 0.00 ? 123 TYR F O   1 
ATOM   9194  C CB  . TYR F  6  123 ? -8.775  -61.911 -10.924 1.00 0.00 ? 123 TYR F CB  1 
ATOM   9195  C CG  . TYR F  6  123 ? -8.311  -63.044 -10.060 1.00 0.00 ? 123 TYR F CG  1 
ATOM   9196  C CD1 . TYR F  6  123 ? -8.559  -64.374 -10.438 1.00 0.00 ? 123 TYR F CD1 1 
ATOM   9197  C CD2 . TYR F  6  123 ? -7.533  -62.793 -8.918  1.00 0.00 ? 123 TYR F CD2 1 
ATOM   9198  C CE1 . TYR F  6  123 ? -8.007  -65.431 -9.711  1.00 0.00 ? 123 TYR F CE1 1 
ATOM   9199  C CE2 . TYR F  6  123 ? -7.017  -63.846 -8.171  1.00 0.00 ? 123 TYR F CE2 1 
ATOM   9200  C CZ  . TYR F  6  123 ? -7.245  -65.163 -8.575  1.00 0.00 ? 123 TYR F CZ  1 
ATOM   9201  O OH  . TYR F  6  123 ? -6.712  -66.239 -7.851  1.00 0.00 ? 123 TYR F OH  1 
ATOM   9202  N N   . GLY F  6  124 ? -10.993 -61.976 -8.635  1.00 0.00 ? 124 GLY F N   1 
ATOM   9203  C CA  . GLY F  6  124 ? -11.110 -61.648 -7.233  1.00 0.00 ? 124 GLY F CA  1 
ATOM   9204  C C   . GLY F  6  124 ? -12.352 -60.861 -6.954  1.00 0.00 ? 124 GLY F C   1 
ATOM   9205  O O   . GLY F  6  124 ? -12.511 -60.297 -5.873  1.00 0.00 ? 124 GLY F O   1 
ATOM   9206  N N   . ARG F  6  125 ? -13.230 -60.790 -7.976  1.00 0.00 ? 125 ARG F N   1 
ATOM   9207  C CA  . ARG F  6  125 ? -14.379 -59.959 -8.016  1.00 0.00 ? 125 ARG F CA  1 
ATOM   9208  C C   . ARG F  6  125 ? -15.490 -60.844 -8.504  1.00 0.00 ? 125 ARG F C   1 
ATOM   9209  O O   . ARG F  6  125 ? -15.424 -61.323 -9.628  1.00 0.00 ? 125 ARG F O   1 
ATOM   9210  C CB  . ARG F  6  125 ? -14.088 -58.810 -8.992  1.00 0.00 ? 125 ARG F CB  1 
ATOM   9211  C CG  . ARG F  6  125 ? -15.151 -57.732 -8.943  1.00 0.00 ? 125 ARG F CG  1 
ATOM   9212  C CD  . ARG F  6  125 ? -14.803 -56.538 -9.824  1.00 0.00 ? 125 ARG F CD  1 
ATOM   9213  N NE  . ARG F  6  125 ? -15.926 -55.550 -9.744  1.00 0.00 ? 125 ARG F NE  1 
ATOM   9214  C CZ  . ARG F  6  125 ? -16.052 -54.653 -8.724  1.00 0.00 ? 125 ARG F CZ  1 
ATOM   9215  N NH1 . ARG F  6  125 ? -15.115 -54.564 -7.737  1.00 0.00 ? 125 ARG F NH1 1 
ATOM   9216  N NH2 . ARG F  6  125 ? -17.138 -53.829 -8.695  1.00 0.00 ? 125 ARG F NH2 1 
ATOM   9217  N N   . ARG F  6  126 ? -16.520 -61.122 -7.669  1.00 0.00 ? 126 ARG F N   1 
ATOM   9218  C CA  . ARG F  6  126 ? -17.593 -62.023 -8.016  1.00 0.00 ? 126 ARG F CA  1 
ATOM   9219  C C   . ARG F  6  126 ? -18.700 -61.317 -8.752  1.00 0.00 ? 126 ARG F C   1 
ATOM   9220  O O   . ARG F  6  126 ? -18.924 -60.145 -8.465  1.00 0.00 ? 126 ARG F O   1 
ATOM   9221  C CB  . ARG F  6  126 ? -18.221 -62.692 -6.788  1.00 0.00 ? 126 ARG F CB  1 
ATOM   9222  C CG  . ARG F  6  126 ? -18.952 -61.766 -5.817  1.00 0.00 ? 126 ARG F CG  1 
ATOM   9223  C CD  . ARG F  6  126 ? -19.606 -62.554 -4.688  1.00 0.00 ? 126 ARG F CD  1 
ATOM   9224  N NE  . ARG F  6  126 ? -20.291 -61.607 -3.764  1.00 0.00 ? 126 ARG F NE  1 
ATOM   9225  C CZ  . ARG F  6  126 ? -19.640 -60.862 -2.820  1.00 0.00 ? 126 ARG F CZ  1 
ATOM   9226  N NH1 . ARG F  6  126 ? -18.285 -60.891 -2.688  1.00 0.00 ? 126 ARG F NH1 1 
ATOM   9227  N NH2 . ARG F  6  126 ? -20.368 -60.063 -1.990  1.00 0.00 ? 126 ARG F NH2 1 
ATOM   9228  N N   . PRO F  6  127 ? -19.475 -62.020 -9.582  1.00 0.00 ? 127 PRO F N   1 
ATOM   9229  C CA  . PRO F  6  127 ? -20.579 -61.417 -10.361 1.00 0.00 ? 127 PRO F CA  1 
ATOM   9230  C C   . PRO F  6  127 ? -21.828 -60.978 -9.558  1.00 0.00 ? 127 PRO F C   1 
ATOM   9231  O O   . PRO F  6  127 ? -22.039 -61.478 -8.456  1.00 0.00 ? 127 PRO F O   1 
ATOM   9232  C CB  . PRO F  6  127 ? -20.958 -62.530 -11.346 1.00 0.00 ? 127 PRO F CB  1 
ATOM   9233  C CG  . PRO F  6  127 ? -19.737 -63.377 -11.455 1.00 0.00 ? 127 PRO F CG  1 
ATOM   9234  C CD  . PRO F  6  127 ? -19.097 -63.346 -10.098 1.00 0.00 ? 127 PRO F CD  1 
ATOM   9235  N N   . TYR F  6  128 ? -22.622 -60.045 -10.102 1.00 0.00 ? 128 TYR F N   1 
ATOM   9236  C CA  . TYR F  6  128 ? -23.800 -59.544 -9.437  1.00 0.00 ? 128 TYR F CA  1 
ATOM   9237  C C   . TYR F  6  128 ? -24.848 -60.556 -9.717  1.00 0.00 ? 128 TYR F C   1 
ATOM   9238  O O   . TYR F  6  128 ? -25.451 -60.540 -10.786 1.00 0.00 ? 128 TYR F O   1 
ATOM   9239  C CB  . TYR F  6  128 ? -24.326 -58.204 -9.993  1.00 0.00 ? 128 TYR F CB  1 
ATOM   9240  C CG  . TYR F  6  128 ? -23.390 -57.108 -9.606  1.00 0.00 ? 128 TYR F CG  1 
ATOM   9241  C CD1 . TYR F  6  128 ? -22.248 -56.856 -10.380 1.00 0.00 ? 128 TYR F CD1 1 
ATOM   9242  C CD2 . TYR F  6  128 ? -23.600 -56.348 -8.446  1.00 0.00 ? 128 TYR F CD2 1 
ATOM   9243  C CE1 . TYR F  6  128 ? -21.326 -55.877 -10.001 1.00 0.00 ? 128 TYR F CE1 1 
ATOM   9244  C CE2 . TYR F  6  128 ? -22.669 -55.383 -8.050  1.00 0.00 ? 128 TYR F CE2 1 
ATOM   9245  C CZ  . TYR F  6  128 ? -21.525 -55.154 -8.824  1.00 0.00 ? 128 TYR F CZ  1 
ATOM   9246  O OH  . TYR F  6  128 ? -20.549 -54.227 -8.402  1.00 0.00 ? 128 TYR F OH  1 
ATOM   9247  N N   . GLY F  6  129 ? -25.108 -61.463 -8.759  1.00 0.00 ? 129 GLY F N   1 
ATOM   9248  C CA  . GLY F  6  129 ? -25.886 -62.647 -9.015  1.00 0.00 ? 129 GLY F CA  1 
ATOM   9249  C C   . GLY F  6  129 ? -27.359 -62.429 -8.991  1.00 0.00 ? 129 GLY F C   1 
ATOM   9250  O O   . GLY F  6  129 ? -28.122 -63.350 -9.242  1.00 0.00 ? 129 GLY F O   1 
ATOM   9251  N N   . VAL F  6  130 ? -27.802 -61.202 -8.679  1.00 0.00 ? 130 VAL F N   1 
ATOM   9252  C CA  . VAL F  6  130 ? -29.172 -60.799 -8.763  1.00 0.00 ? 130 VAL F CA  1 
ATOM   9253  C C   . VAL F  6  130 ? -29.605 -60.742 -10.213 1.00 0.00 ? 130 VAL F C   1 
ATOM   9254  O O   . VAL F  6  130 ? -28.889 -60.231 -11.077 1.00 0.00 ? 130 VAL F O   1 
ATOM   9255  C CB  . VAL F  6  130 ? -29.386 -59.490 -8.037  1.00 0.00 ? 130 VAL F CB  1 
ATOM   9256  C CG1 . VAL F  6  130 ? -28.645 -58.331 -8.703  1.00 0.00 ? 130 VAL F CG1 1 
ATOM   9257  C CG2 . VAL F  6  130 ? -30.877 -59.204 -7.897  1.00 0.00 ? 130 VAL F CG2 1 
ATOM   9258  N N   . GLY F  6  131 ? -30.821 -61.269 -10.501 1.00 0.00 ? 131 GLY F N   1 
ATOM   9259  C CA  . GLY F  6  131 ? -31.431 -61.153 -11.792 1.00 0.00 ? 131 GLY F CA  1 
ATOM   9260  C C   . GLY F  6  131 ? -32.423 -60.103 -11.516 1.00 0.00 ? 131 GLY F C   1 
ATOM   9261  O O   . GLY F  6  131 ? -32.990 -60.112 -10.433 1.00 0.00 ? 131 GLY F O   1 
ATOM   9262  N N   . LEU F  6  132 ? -32.659 -59.169 -12.452 1.00 0.00 ? 132 LEU F N   1 
ATOM   9263  C CA  . LEU F  6  132 ? -33.476 -58.018 -12.178 1.00 0.00 ? 132 LEU F CA  1 
ATOM   9264  C C   . LEU F  6  132 ? -34.498 -57.936 -13.250 1.00 0.00 ? 132 LEU F C   1 
ATOM   9265  O O   . LEU F  6  132 ? -34.242 -58.392 -14.349 1.00 0.00 ? 132 LEU F O   1 
ATOM   9266  C CB  . LEU F  6  132 ? -32.595 -56.759 -12.183 1.00 0.00 ? 132 LEU F CB  1 
ATOM   9267  C CG  . LEU F  6  132 ? -32.734 -55.861 -10.946 1.00 0.00 ? 132 LEU F CG  1 
ATOM   9268  C CD1 . LEU F  6  132 ? -32.304 -56.554 -9.653  1.00 0.00 ? 132 LEU F CD1 1 
ATOM   9269  C CD2 . LEU F  6  132 ? -31.934 -54.557 -11.145 1.00 0.00 ? 132 LEU F CD2 1 
ATOM   9270  N N   . LEU F  6  133 ? -35.692 -57.381 -12.969 1.00 0.00 ? 133 LEU F N   1 
ATOM   9271  C CA  . LEU F  6  133 ? -36.641 -56.999 -13.985 1.00 0.00 ? 133 LEU F CA  1 
ATOM   9272  C C   . LEU F  6  133 ? -36.814 -55.533 -13.863 1.00 0.00 ? 133 LEU F C   1 
ATOM   9273  O O   . LEU F  6  133 ? -37.534 -55.077 -12.990 1.00 0.00 ? 133 LEU F O   1 
ATOM   9274  C CB  . LEU F  6  133 ? -38.028 -57.673 -13.836 1.00 0.00 ? 133 LEU F CB  1 
ATOM   9275  C CG  . LEU F  6  133 ? -38.168 -59.063 -14.498 1.00 0.00 ? 133 LEU F CG  1 
ATOM   9276  C CD1 . LEU F  6  133 ? -39.329 -59.864 -13.898 1.00 0.00 ? 133 LEU F CD1 1 
ATOM   9277  C CD2 . LEU F  6  133 ? -38.357 -58.949 -16.020 1.00 0.00 ? 133 LEU F CD2 1 
ATOM   9278  N N   . ILE F  6  134 ? -36.204 -54.742 -14.755 1.00 0.00 ? 134 ILE F N   1 
ATOM   9279  C CA  . ILE F  6  134 ? -36.316 -53.301 -14.754 1.00 0.00 ? 134 ILE F CA  1 
ATOM   9280  C C   . ILE F  6  134 ? -37.482 -52.901 -15.612 1.00 0.00 ? 134 ILE F C   1 
ATOM   9281  O O   . ILE F  6  134 ? -37.314 -52.676 -16.808 1.00 0.00 ? 134 ILE F O   1 
ATOM   9282  C CB  . ILE F  6  134 ? -35.071 -52.589 -15.254 1.00 0.00 ? 134 ILE F CB  1 
ATOM   9283  C CG1 . ILE F  6  134 ? -33.831 -53.063 -14.473 1.00 0.00 ? 134 ILE F CG1 1 
ATOM   9284  C CG2 . ILE F  6  134 ? -35.248 -51.068 -15.078 1.00 0.00 ? 134 ILE F CG2 1 
ATOM   9285  C CD1 . ILE F  6  134 ? -33.040 -54.169 -15.159 1.00 0.00 ? 134 ILE F CD1 1 
ATOM   9286  N N   . ALA F  6  135 ? -38.698 -52.802 -15.026 1.00 0.00 ? 135 ALA F N   1 
ATOM   9287  C CA  . ALA F  6  135 ? -39.836 -52.208 -15.682 1.00 0.00 ? 135 ALA F CA  1 
ATOM   9288  C C   . ALA F  6  135 ? -39.738 -50.726 -15.564 1.00 0.00 ? 135 ALA F C   1 
ATOM   9289  O O   . ALA F  6  135 ? -39.153 -50.209 -14.617 1.00 0.00 ? 135 ALA F O   1 
ATOM   9290  C CB  . ALA F  6  135 ? -41.183 -52.672 -15.105 1.00 0.00 ? 135 ALA F CB  1 
ATOM   9291  N N   . GLY F  6  136 ? -40.166 -50.061 -16.619 1.00 0.00 ? 136 GLY F N   1 
ATOM   9292  C CA  . GLY F  6  136 ? -40.180 -48.627 -16.638 1.00 0.00 ? 136 GLY F CA  1 
ATOM   9293  C C   . GLY F  6  136 ? -41.193 -48.161 -17.643 1.00 0.00 ? 136 GLY F C   1 
ATOM   9294  O O   . GLY F  6  136 ? -41.525 -48.852 -18.606 1.00 0.00 ? 136 GLY F O   1 
ATOM   9295  N N   . TYR F  6  137 ? -41.667 -46.956 -17.409 1.00 0.00 ? 137 TYR F N   1 
ATOM   9296  C CA  . TYR F  6  137 ? -42.391 -46.204 -18.382 1.00 0.00 ? 137 TYR F CA  1 
ATOM   9297  C C   . TYR F  6  137 ? -41.424 -45.447 -19.251 1.00 0.00 ? 137 TYR F C   1 
ATOM   9298  O O   . TYR F  6  137 ? -40.337 -45.082 -18.808 1.00 0.00 ? 137 TYR F O   1 
ATOM   9299  C CB  . TYR F  6  137 ? -43.409 -45.253 -17.734 1.00 0.00 ? 137 TYR F CB  1 
ATOM   9300  C CG  . TYR F  6  137 ? -44.507 -45.000 -18.707 1.00 0.00 ? 137 TYR F CG  1 
ATOM   9301  C CD1 . TYR F  6  137 ? -45.426 -46.020 -18.950 1.00 0.00 ? 137 TYR F CD1 1 
ATOM   9302  C CD2 . TYR F  6  137 ? -44.568 -43.825 -19.459 1.00 0.00 ? 137 TYR F CD2 1 
ATOM   9303  C CE1 . TYR F  6  137 ? -46.387 -45.890 -19.950 1.00 0.00 ? 137 TYR F CE1 1 
ATOM   9304  C CE2 . TYR F  6  137 ? -45.510 -43.704 -20.487 1.00 0.00 ? 137 TYR F CE2 1 
ATOM   9305  C CZ  . TYR F  6  137 ? -46.416 -44.743 -20.740 1.00 0.00 ? 137 TYR F CZ  1 
ATOM   9306  O OH  . TYR F  6  137 ? -47.348 -44.660 -21.793 1.00 0.00 ? 137 TYR F OH  1 
ATOM   9307  N N   . ASP F  6  138 ? -41.747 -45.334 -20.554 1.00 0.00 ? 138 ASP F N   1 
ATOM   9308  C CA  . ASP F  6  138 ? -40.782 -44.928 -21.520 1.00 0.00 ? 138 ASP F CA  1 
ATOM   9309  C C   . ASP F  6  138 ? -41.570 -44.255 -22.574 1.00 0.00 ? 138 ASP F C   1 
ATOM   9310  O O   . ASP F  6  138 ? -42.779 -44.449 -22.675 1.00 0.00 ? 138 ASP F O   1 
ATOM   9311  C CB  . ASP F  6  138 ? -40.073 -46.206 -22.039 1.00 0.00 ? 138 ASP F CB  1 
ATOM   9312  C CG  . ASP F  6  138 ? -38.792 -45.995 -22.837 1.00 0.00 ? 138 ASP F CG  1 
ATOM   9313  O OD1 . ASP F  6  138 ? -37.858 -45.362 -22.286 1.00 0.00 ? 138 ASP F OD1 1 
ATOM   9314  O OD2 . ASP F  6  138 ? -38.717 -46.516 -23.979 1.00 0.00 ? 138 ASP F OD2 1 
ATOM   9315  N N   . ASP F  6  139 ? -40.873 -43.381 -23.331 1.00 0.00 ? 139 ASP F N   1 
ATOM   9316  C CA  . ASP F  6  139 ? -41.400 -42.507 -24.350 1.00 0.00 ? 139 ASP F CA  1 
ATOM   9317  C C   . ASP F  6  139 ? -41.565 -43.206 -25.667 1.00 0.00 ? 139 ASP F C   1 
ATOM   9318  O O   . ASP F  6  139 ? -42.228 -42.690 -26.564 1.00 0.00 ? 139 ASP F O   1 
ATOM   9319  C CB  . ASP F  6  139 ? -40.465 -41.310 -24.593 1.00 0.00 ? 139 ASP F CB  1 
ATOM   9320  C CG  . ASP F  6  139 ? -40.329 -40.425 -23.351 1.00 0.00 ? 139 ASP F CG  1 
ATOM   9321  O OD1 . ASP F  6  139 ? -41.061 -40.640 -22.349 1.00 0.00 ? 139 ASP F OD1 1 
ATOM   9322  O OD2 . ASP F  6  139 ? -39.483 -39.493 -23.410 1.00 0.00 ? 139 ASP F OD2 1 
ATOM   9323  N N   . MET F  6  140 ? -41.013 -44.430 -25.792 1.00 0.00 ? 140 MET F N   1 
ATOM   9324  C CA  . MET F  6  140 ? -41.201 -45.291 -26.931 1.00 0.00 ? 140 MET F CA  1 
ATOM   9325  C C   . MET F  6  140 ? -42.320 -46.238 -26.606 1.00 0.00 ? 140 MET F C   1 
ATOM   9326  O O   . MET F  6  140 ? -42.576 -47.180 -27.347 1.00 0.00 ? 140 MET F O   1 
ATOM   9327  C CB  . MET F  6  140 ? -39.955 -46.148 -27.231 1.00 0.00 ? 140 MET F CB  1 
ATOM   9328  C CG  . MET F  6  140 ? -38.671 -45.335 -27.506 1.00 0.00 ? 140 MET F CG  1 
ATOM   9329  S SD  . MET F  6  140 ? -38.695 -44.359 -29.044 1.00 0.00 ? 140 MET F SD  1 
ATOM   9330  C CE  . MET F  6  140 ? -38.680 -42.715 -28.275 1.00 0.00 ? 140 MET F CE  1 
ATOM   9331  N N   . GLY F  6  141 ? -43.021 -46.000 -25.477 1.00 0.00 ? 141 GLY F N   1 
ATOM   9332  C CA  . GLY F  6  141 ? -44.035 -46.854 -24.925 1.00 0.00 ? 141 GLY F CA  1 
ATOM   9333  C C   . GLY F  6  141 ? -43.328 -47.662 -23.895 1.00 0.00 ? 141 GLY F C   1 
ATOM   9334  O O   . GLY F  6  141 ? -42.172 -47.995 -24.132 1.00 0.00 ? 141 GLY F O   1 
ATOM   9335  N N   . PRO F  6  142 ? -43.929 -47.976 -22.749 1.00 0.00 ? 142 PRO F N   1 
ATOM   9336  C CA  . PRO F  6  142 ? -43.289 -48.626 -21.618 1.00 0.00 ? 142 PRO F CA  1 
ATOM   9337  C C   . PRO F  6  142 ? -42.544 -49.851 -22.000 1.00 0.00 ? 142 PRO F C   1 
ATOM   9338  O O   . PRO F  6  142 ? -43.007 -50.548 -22.895 1.00 0.00 ? 142 PRO F O   1 
ATOM   9339  C CB  . PRO F  6  142 ? -44.424 -48.984 -20.664 1.00 0.00 ? 142 PRO F CB  1 
ATOM   9340  C CG  . PRO F  6  142 ? -45.657 -49.059 -21.551 1.00 0.00 ? 142 PRO F CG  1 
ATOM   9341  C CD  . PRO F  6  142 ? -45.382 -48.015 -22.626 1.00 0.00 ? 142 PRO F CD  1 
ATOM   9342  N N   . HIS F  6  143 ? -41.432 -50.141 -21.300 1.00 0.00 ? 143 HIS F N   1 
ATOM   9343  C CA  . HIS F  6  143 ? -40.625 -51.284 -21.612 1.00 0.00 ? 143 HIS F CA  1 
ATOM   9344  C C   . HIS F  6  143 ? -40.286 -51.926 -20.313 1.00 0.00 ? 143 HIS F C   1 
ATOM   9345  O O   . HIS F  6  143 ? -40.241 -51.269 -19.278 1.00 0.00 ? 143 HIS F O   1 
ATOM   9346  C CB  . HIS F  6  143 ? -39.333 -50.947 -22.382 1.00 0.00 ? 143 HIS F CB  1 
ATOM   9347  C CG  . HIS F  6  143 ? -39.598 -50.612 -23.828 1.00 0.00 ? 143 HIS F CG  1 
ATOM   9348  N ND1 . HIS F  6  143 ? -38.809 -49.780 -24.595 1.00 0.00 ? 143 HIS F ND1 1 
ATOM   9349  C CD2 . HIS F  6  143 ? -40.548 -51.098 -24.671 1.00 0.00 ? 143 HIS F CD2 1 
ATOM   9350  C CE1 . HIS F  6  143 ? -39.329 -49.798 -25.845 1.00 0.00 ? 143 HIS F CE1 1 
ATOM   9351  N NE2 . HIS F  6  143 ? -40.382 -50.585 -25.940 1.00 0.00 ? 143 HIS F NE2 1 
ATOM   9352  N N   . ILE F  6  144 ? -40.006 -53.247 -20.365 1.00 0.00 ? 144 ILE F N   1 
ATOM   9353  C CA  . ILE F  6  144 ? -39.477 -53.991 -19.257 1.00 0.00 ? 144 ILE F CA  1 
ATOM   9354  C C   . ILE F  6  144 ? -38.244 -54.615 -19.806 1.00 0.00 ? 144 ILE F C   1 
ATOM   9355  O O   . ILE F  6  144 ? -38.169 -54.886 -21.002 1.00 0.00 ? 144 ILE F O   1 
ATOM   9356  C CB  . ILE F  6  144 ? -40.402 -55.045 -18.642 1.00 0.00 ? 144 ILE F CB  1 
ATOM   9357  C CG1 . ILE F  6  144 ? -40.537 -56.329 -19.480 1.00 0.00 ? 144 ILE F CG1 1 
ATOM   9358  C CG2 . ILE F  6  144 ? -41.771 -54.392 -18.359 1.00 0.00 ? 144 ILE F CG2 1 
ATOM   9359  C CD1 . ILE F  6  144 ? -41.520 -57.323 -18.896 1.00 0.00 ? 144 ILE F CD1 1 
ATOM   9360  N N   . PHE F  6  145 ? -37.231 -54.818 -18.945 1.00 0.00 ? 145 PHE F N   1 
ATOM   9361  C CA  . PHE F  6  145 ? -35.953 -55.330 -19.339 1.00 0.00 ? 145 PHE F CA  1 
ATOM   9362  C C   . PHE F  6  145 ? -35.482 -56.245 -18.264 1.00 0.00 ? 145 PHE F C   1 
ATOM   9363  O O   . PHE F  6  145 ? -35.075 -55.774 -17.220 1.00 0.00 ? 145 PHE F O   1 
ATOM   9364  C CB  . PHE F  6  145 ? -34.859 -54.243 -19.441 1.00 0.00 ? 145 PHE F CB  1 
ATOM   9365  C CG  . PHE F  6  145 ? -35.018 -53.407 -20.673 1.00 0.00 ? 145 PHE F CG  1 
ATOM   9366  C CD1 . PHE F  6  145 ? -34.519 -53.869 -21.899 1.00 0.00 ? 145 PHE F CD1 1 
ATOM   9367  C CD2 . PHE F  6  145 ? -35.590 -52.126 -20.611 1.00 0.00 ? 145 PHE F CD2 1 
ATOM   9368  C CE1 . PHE F  6  145 ? -34.609 -53.072 -23.044 1.00 0.00 ? 145 PHE F CE1 1 
ATOM   9369  C CE2 . PHE F  6  145 ? -35.689 -51.331 -21.758 1.00 0.00 ? 145 PHE F CE2 1 
ATOM   9370  C CZ  . PHE F  6  145 ? -35.208 -51.810 -22.978 1.00 0.00 ? 145 PHE F CZ  1 
ATOM   9371  N N   . GLN F  6  146 ? -35.438 -57.572 -18.486 1.00 0.00 ? 146 GLN F N   1 
ATOM   9372  C CA  . GLN F  6  146 ? -34.711 -58.454 -17.613 1.00 0.00 ? 146 GLN F CA  1 
ATOM   9373  C C   . GLN F  6  146 ? -33.246 -58.238 -17.760 1.00 0.00 ? 146 GLN F C   1 
ATOM   9374  O O   . GLN F  6  146 ? -32.784 -58.040 -18.876 1.00 0.00 ? 146 GLN F O   1 
ATOM   9375  C CB  . GLN F  6  146 ? -34.988 -59.962 -17.754 1.00 0.00 ? 146 GLN F CB  1 
ATOM   9376  C CG  . GLN F  6  146 ? -34.463 -60.664 -19.017 1.00 0.00 ? 146 GLN F CG  1 
ATOM   9377  C CD  . GLN F  6  146 ? -34.557 -62.188 -18.831 1.00 0.00 ? 146 GLN F CD  1 
ATOM   9378  O OE1 . GLN F  6  146 ? -35.172 -62.691 -17.882 1.00 0.00 ? 146 GLN F OE1 1 
ATOM   9379  N NE2 . GLN F  6  146 ? -33.905 -62.936 -19.773 1.00 0.00 ? 146 GLN F NE2 1 
ATOM   9380  N N   . THR F  6  147 ? -32.479 -58.241 -16.660 1.00 0.00 ? 147 THR F N   1 
ATOM   9381  C CA  . THR F  6  147 ? -31.047 -58.255 -16.722 1.00 0.00 ? 147 THR F CA  1 
ATOM   9382  C C   . THR F  6  147 ? -30.637 -59.499 -16.005 1.00 0.00 ? 147 THR F C   1 
ATOM   9383  O O   . THR F  6  147 ? -30.999 -59.746 -14.863 1.00 0.00 ? 147 THR F O   1 
ATOM   9384  C CB  . THR F  6  147 ? -30.366 -57.061 -16.093 1.00 0.00 ? 147 THR F CB  1 
ATOM   9385  O OG1 . THR F  6  147 ? -30.719 -56.878 -14.736 1.00 0.00 ? 147 THR F OG1 1 
ATOM   9386  C CG2 . THR F  6  147 ? -30.744 -55.790 -16.856 1.00 0.00 ? 147 THR F CG2 1 
ATOM   9387  N N   . CYS F  6  148 ? -29.910 -60.364 -16.725 1.00 0.00 ? 148 CYS F N   1 
ATOM   9388  C CA  . CYS F  6  148 ? -29.432 -61.642 -16.278 1.00 0.00 ? 148 CYS F CA  1 
ATOM   9389  C C   . CYS F  6  148 ? -28.208 -61.397 -15.424 1.00 0.00 ? 148 CYS F C   1 
ATOM   9390  O O   . CYS F  6  148 ? -27.807 -60.242 -15.335 1.00 0.00 ? 148 CYS F O   1 
ATOM   9391  C CB  . CYS F  6  148 ? -29.125 -62.525 -17.516 1.00 0.00 ? 148 CYS F CB  1 
ATOM   9392  S SG  . CYS F  6  148 ? -30.519 -62.504 -18.726 1.00 0.00 ? 148 CYS F SG  1 
ATOM   9393  N N   . PRO F  6  149 ? -27.631 -62.350 -14.695 1.00 0.00 ? 149 PRO F N   1 
ATOM   9394  C CA  . PRO F  6  149 ? -26.379 -62.172 -13.961 1.00 0.00 ? 149 PRO F CA  1 
ATOM   9395  C C   . PRO F  6  149 ? -25.174 -61.844 -14.771 1.00 0.00 ? 149 PRO F C   1 
ATOM   9396  O O   . PRO F  6  149 ? -24.271 -61.234 -14.219 1.00 0.00 ? 149 PRO F O   1 
ATOM   9397  C CB  . PRO F  6  149 ? -26.189 -63.465 -13.207 1.00 0.00 ? 149 PRO F CB  1 
ATOM   9398  C CG  . PRO F  6  149 ? -27.633 -63.814 -12.853 1.00 0.00 ? 149 PRO F CG  1 
ATOM   9399  C CD  . PRO F  6  149 ? -28.419 -63.425 -14.108 1.00 0.00 ? 149 PRO F CD  1 
ATOM   9400  N N   . SER F  6  150 ? -25.121 -62.200 -16.072 1.00 0.00 ? 150 SER F N   1 
ATOM   9401  C CA  . SER F  6  150 ? -24.142 -61.620 -16.965 1.00 0.00 ? 150 SER F CA  1 
ATOM   9402  C C   . SER F  6  150 ? -24.687 -60.272 -17.344 1.00 0.00 ? 150 SER F C   1 
ATOM   9403  O O   . SER F  6  150 ? -25.825 -59.948 -17.023 1.00 0.00 ? 150 SER F O   1 
ATOM   9404  C CB  . SER F  6  150 ? -23.855 -62.451 -18.243 1.00 0.00 ? 150 SER F CB  1 
ATOM   9405  O OG  . SER F  6  150 ? -25.039 -62.806 -18.937 1.00 0.00 ? 150 SER F OG  1 
ATOM   9406  N N   . ALA F  6  151 ? -23.898 -59.433 -18.047 1.00 0.00 ? 151 ALA F N   1 
ATOM   9407  C CA  . ALA F  6  151 ? -24.293 -58.082 -18.377 1.00 0.00 ? 151 ALA F CA  1 
ATOM   9408  C C   . ALA F  6  151 ? -25.561 -58.074 -19.185 1.00 0.00 ? 151 ALA F C   1 
ATOM   9409  O O   . ALA F  6  151 ? -26.420 -57.227 -18.953 1.00 0.00 ? 151 ALA F O   1 
ATOM   9410  C CB  . ALA F  6  151 ? -23.214 -57.333 -19.171 1.00 0.00 ? 151 ALA F CB  1 
ATOM   9411  N N   . ASN F  6  152 ? -25.734 -59.134 -19.967 1.00 0.00 ? 152 ASN F N   1 
ATOM   9412  C CA  . ASN F  6  152 ? -26.769 -59.233 -20.979 1.00 0.00 ? 152 ASN F CA  1 
ATOM   9413  C C   . ASN F  6  152 ? -28.174 -59.056 -20.430 1.00 0.00 ? 152 ASN F C   1 
ATOM   9414  O O   . ASN F  6  152 ? -28.528 -59.572 -19.375 1.00 0.00 ? 152 ASN F O   1 
ATOM   9415  C CB  . ASN F  6  152 ? -26.669 -60.586 -21.681 1.00 0.00 ? 152 ASN F CB  1 
ATOM   9416  C CG  . ASN F  6  152 ? -27.615 -60.703 -22.852 1.00 0.00 ? 152 ASN F CG  1 
ATOM   9417  O OD1 . ASN F  6  152 ? -28.746 -60.232 -22.798 1.00 0.00 ? 152 ASN F OD1 1 
ATOM   9418  N ND2 . ASN F  6  152 ? -27.152 -61.334 -23.922 1.00 0.00 ? 152 ASN F ND2 1 
ATOM   9419  N N   . TYR F  6  153 ? -28.957 -58.309 -21.193 1.00 0.00 ? 153 TYR F N   1 
ATOM   9420  C CA  . TYR F  6  153 ? -30.243 -57.822 -20.821 1.00 0.00 ? 153 TYR F CA  1 
ATOM   9421  C C   . TYR F  6  153 ? -31.070 -58.011 -22.030 1.00 0.00 ? 153 TYR F C   1 
ATOM   9422  O O   . TYR F  6  153 ? -30.535 -58.220 -23.110 1.00 0.00 ? 153 TYR F O   1 
ATOM   9423  C CB  . TYR F  6  153 ? -30.210 -56.321 -20.450 1.00 0.00 ? 153 TYR F CB  1 
ATOM   9424  C CG  . TYR F  6  153 ? -29.630 -55.424 -21.518 1.00 0.00 ? 153 TYR F CG  1 
ATOM   9425  C CD1 . TYR F  6  153 ? -30.410 -55.014 -22.613 1.00 0.00 ? 153 TYR F CD1 1 
ATOM   9426  C CD2 . TYR F  6  153 ? -28.290 -55.024 -21.454 1.00 0.00 ? 153 TYR F CD2 1 
ATOM   9427  C CE1 . TYR F  6  153 ? -29.835 -54.308 -23.672 1.00 0.00 ? 153 TYR F CE1 1 
ATOM   9428  C CE2 . TYR F  6  153 ? -27.720 -54.290 -22.497 1.00 0.00 ? 153 TYR F CE2 1 
ATOM   9429  C CZ  . TYR F  6  153 ? -28.482 -53.963 -23.627 1.00 0.00 ? 153 TYR F CZ  1 
ATOM   9430  O OH  . TYR F  6  153 ? -27.888 -53.294 -24.721 1.00 0.00 ? 153 TYR F OH  1 
ATOM   9431  N N   . PHE F  6  154 ? -32.399 -57.992 -21.884 1.00 0.00 ? 154 PHE F N   1 
ATOM   9432  C CA  . PHE F  6  154 ? -33.254 -58.330 -22.982 1.00 0.00 ? 154 PHE F CA  1 
ATOM   9433  C C   . PHE F  6  154 ? -34.431 -57.439 -23.027 1.00 0.00 ? 154 PHE F C   1 
ATOM   9434  O O   . PHE F  6  154 ? -35.176 -57.367 -22.053 1.00 0.00 ? 154 PHE F O   1 
ATOM   9435  C CB  . PHE F  6  154 ? -33.784 -59.781 -22.916 1.00 0.00 ? 154 PHE F CB  1 
ATOM   9436  C CG  . PHE F  6  154 ? -32.701 -60.731 -23.308 1.00 0.00 ? 154 PHE F CG  1 
ATOM   9437  C CD1 . PHE F  6  154 ? -32.317 -60.836 -24.655 1.00 0.00 ? 154 PHE F CD1 1 
ATOM   9438  C CD2 . PHE F  6  154 ? -32.028 -61.492 -22.346 1.00 0.00 ? 154 PHE F CD2 1 
ATOM   9439  C CE1 . PHE F  6  154 ? -31.266 -61.681 -25.028 1.00 0.00 ? 154 PHE F CE1 1 
ATOM   9440  C CE2 . PHE F  6  154 ? -30.989 -62.349 -22.719 1.00 0.00 ? 154 PHE F CE2 1 
ATOM   9441  C CZ  . PHE F  6  154 ? -30.605 -62.442 -24.061 1.00 0.00 ? 154 PHE F CZ  1 
ATOM   9442  N N   . ASP F  6  155 ? -34.680 -56.813 -24.218 1.00 0.00 ? 155 ASP F N   1 
ATOM   9443  C CA  . ASP F  6  155 ? -35.963 -56.215 -24.503 1.00 0.00 ? 155 ASP F CA  1 
ATOM   9444  C C   . ASP F  6  155 ? -36.894 -57.379 -24.726 1.00 0.00 ? 155 ASP F C   1 
ATOM   9445  O O   . ASP F  6  155 ? -36.474 -58.433 -25.193 1.00 0.00 ? 155 ASP F O   1 
ATOM   9446  C CB  . ASP F  6  155 ? -35.959 -55.312 -25.757 1.00 0.00 ? 155 ASP F CB  1 
ATOM   9447  C CG  . ASP F  6  155 ? -37.158 -54.356 -25.828 1.00 0.00 ? 155 ASP F CG  1 
ATOM   9448  O OD1 . ASP F  6  155 ? -37.870 -54.201 -24.803 1.00 0.00 ? 155 ASP F OD1 1 
ATOM   9449  O OD2 . ASP F  6  155 ? -37.361 -53.748 -26.913 1.00 0.00 ? 155 ASP F OD2 1 
ATOM   9450  N N   . CYS F  6  156 ? -38.148 -57.250 -24.281 1.00 0.00 ? 156 CYS F N   1 
ATOM   9451  C CA  . CYS F  6  156 ? -39.039 -58.360 -24.267 1.00 0.00 ? 156 CYS F CA  1 
ATOM   9452  C C   . CYS F  6  156 ? -40.396 -57.797 -24.097 1.00 0.00 ? 156 CYS F C   1 
ATOM   9453  O O   . CYS F  6  156 ? -40.568 -56.784 -23.429 1.00 0.00 ? 156 CYS F O   1 
ATOM   9454  C CB  . CYS F  6  156 ? -38.759 -59.312 -23.079 1.00 0.00 ? 156 CYS F CB  1 
ATOM   9455  S SG  . CYS F  6  156 ? -38.504 -58.409 -21.527 1.00 0.00 ? 156 CYS F SG  1 
ATOM   9456  N N   . ARG F  6  157 ? -41.403 -58.469 -24.685 1.00 0.00 ? 157 ARG F N   1 
ATOM   9457  C CA  . ARG F  6  157 ? -42.800 -58.164 -24.518 1.00 0.00 ? 157 ARG F CA  1 
ATOM   9458  C C   . ARG F  6  157 ? -43.297 -58.509 -23.122 1.00 0.00 ? 157 ARG F C   1 
ATOM   9459  O O   . ARG F  6  157 ? -44.104 -57.779 -22.560 1.00 0.00 ? 157 ARG F O   1 
ATOM   9460  C CB  . ARG F  6  157 ? -43.630 -58.876 -25.607 1.00 0.00 ? 157 ARG F CB  1 
ATOM   9461  C CG  . ARG F  6  157 ? -43.161 -58.481 -27.010 1.00 0.00 ? 157 ARG F CG  1 
ATOM   9462  C CD  . ARG F  6  157 ? -43.952 -59.136 -28.150 1.00 0.00 ? 157 ARG F CD  1 
ATOM   9463  N NE  . ARG F  6  157 ? -43.588 -60.589 -28.276 1.00 0.00 ? 157 ARG F NE  1 
ATOM   9464  C CZ  . ARG F  6  157 ? -43.968 -61.338 -29.358 1.00 0.00 ? 157 ARG F CZ  1 
ATOM   9465  N NH1 . ARG F  6  157 ? -44.844 -60.849 -30.282 1.00 0.00 ? 157 ARG F NH1 1 
ATOM   9466  N NH2 . ARG F  6  157 ? -43.459 -62.592 -29.527 1.00 0.00 ? 157 ARG F NH2 1 
ATOM   9467  N N   . ALA F  6  158 ? -42.839 -59.630 -22.531 1.00 0.00 ? 158 ALA F N   1 
ATOM   9468  C CA  . ALA F  6  158 ? -43.232 -60.004 -21.205 1.00 0.00 ? 158 ALA F CA  1 
ATOM   9469  C C   . ALA F  6  158 ? -42.172 -60.958 -20.739 1.00 0.00 ? 158 ALA F C   1 
ATOM   9470  O O   . ALA F  6  158 ? -41.429 -61.467 -21.571 1.00 0.00 ? 158 ALA F O   1 
ATOM   9471  C CB  . ALA F  6  158 ? -44.589 -60.703 -21.196 1.00 0.00 ? 158 ALA F CB  1 
ATOM   9472  N N   . MET F  6  159 ? -41.980 -61.125 -19.400 1.00 0.00 ? 159 MET F N   1 
ATOM   9473  C CA  . MET F  6  159 ? -40.903 -61.915 -18.852 1.00 0.00 ? 159 MET F CA  1 
ATOM   9474  C C   . MET F  6  159 ? -41.201 -62.222 -17.414 1.00 0.00 ? 159 MET F C   1 
ATOM   9475  O O   . MET F  6  159 ? -42.062 -61.576 -16.830 1.00 0.00 ? 159 MET F O   1 
ATOM   9476  C CB  . MET F  6  159 ? -39.529 -61.232 -18.998 1.00 0.00 ? 159 MET F CB  1 
ATOM   9477  C CG  . MET F  6  159 ? -38.296 -62.053 -18.572 1.00 0.00 ? 159 MET F CG  1 
ATOM   9478  S SD  . MET F  6  159 ? -38.294 -63.817 -19.034 1.00 0.00 ? 159 MET F SD  1 
ATOM   9479  C CE  . MET F  6  159 ? -37.617 -63.594 -20.703 1.00 0.00 ? 159 MET F CE  1 
ATOM   9480  N N   . SER F  6  160 ? -40.521 -63.245 -16.821 1.00 0.00 ? 160 SER F N   1 
ATOM   9481  C CA  . SER F  6  160 ? -40.609 -63.652 -15.439 1.00 0.00 ? 160 SER F CA  1 
ATOM   9482  C C   . SER F  6  160 ? -39.228 -64.145 -15.009 1.00 0.00 ? 160 SER F C   1 
ATOM   9483  O O   . SER F  6  160 ? -38.514 -64.731 -15.814 1.00 0.00 ? 160 SER F O   1 
ATOM   9484  C CB  . SER F  6  160 ? -41.639 -64.790 -15.315 1.00 0.00 ? 160 SER F CB  1 
ATOM   9485  O OG  . SER F  6  160 ? -41.776 -65.245 -13.984 1.00 0.00 ? 160 SER F OG  1 
ATOM   9486  N N   . ILE F  6  161 ? -38.826 -63.920 -13.720 1.00 0.00 ? 161 ILE F N   1 
ATOM   9487  C CA  . ILE F  6  161 ? -37.552 -64.329 -13.133 1.00 0.00 ? 161 ILE F CA  1 
ATOM   9488  C C   . ILE F  6  161 ? -37.844 -64.787 -11.745 1.00 0.00 ? 161 ILE F C   1 
ATOM   9489  O O   . ILE F  6  161 ? -38.909 -64.496 -11.222 1.00 0.00 ? 161 ILE F O   1 
ATOM   9490  C CB  . ILE F  6  161 ? -36.481 -63.245 -12.967 1.00 0.00 ? 161 ILE F CB  1 
ATOM   9491  C CG1 . ILE F  6  161 ? -36.879 -62.127 -11.969 1.00 0.00 ? 161 ILE F CG1 1 
ATOM   9492  C CG2 . ILE F  6  161 ? -36.109 -62.696 -14.367 1.00 0.00 ? 161 ILE F CG2 1 
ATOM   9493  C CD1 . ILE F  6  161 ? -35.798 -61.079 -11.744 1.00 0.00 ? 161 ILE F CD1 1 
ATOM   9494  N N   . GLY F  6  162 ? -36.862 -65.441 -11.083 1.00 0.00 ? 162 GLY F N   1 
ATOM   9495  C CA  . GLY F  6  162 ? -36.992 -65.986 -9.745  1.00 0.00 ? 162 GLY F CA  1 
ATOM   9496  C C   . GLY F  6  162 ? -37.378 -67.424 -9.777  1.00 0.00 ? 162 GLY F C   1 
ATOM   9497  O O   . GLY F  6  162 ? -37.302 -68.081 -10.810 1.00 0.00 ? 162 GLY F O   1 
ATOM   9498  N N   . ALA F  6  163 ? -37.828 -67.960 -8.629  1.00 0.00 ? 163 ALA F N   1 
ATOM   9499  C CA  . ALA F  6  163 ? -38.166 -69.359 -8.487  1.00 0.00 ? 163 ALA F CA  1 
ATOM   9500  C C   . ALA F  6  163 ? -39.369 -69.725 -9.320  1.00 0.00 ? 163 ALA F C   1 
ATOM   9501  O O   . ALA F  6  163 ? -40.346 -68.993 -9.350  1.00 0.00 ? 163 ALA F O   1 
ATOM   9502  C CB  . ALA F  6  163 ? -38.475 -69.730 -7.024  1.00 0.00 ? 163 ALA F CB  1 
ATOM   9503  N N   . ARG F  6  164 ? -39.347 -70.900 -9.982  1.00 0.00 ? 164 ARG F N   1 
ATOM   9504  C CA  . ARG F  6  164 ? -40.455 -71.459 -10.734 1.00 0.00 ? 164 ARG F CA  1 
ATOM   9505  C C   . ARG F  6  164 ? -41.013 -70.534 -11.787 1.00 0.00 ? 164 ARG F C   1 
ATOM   9506  O O   . ARG F  6  164 ? -42.220 -70.366 -11.877 1.00 0.00 ? 164 ARG F O   1 
ATOM   9507  C CB  . ARG F  6  164 ? -41.647 -71.874 -9.828  1.00 0.00 ? 164 ARG F CB  1 
ATOM   9508  C CG  . ARG F  6  164 ? -41.320 -72.848 -8.684  1.00 0.00 ? 164 ARG F CG  1 
ATOM   9509  C CD  . ARG F  6  164 ? -42.480 -73.019 -7.697  1.00 0.00 ? 164 ARG F CD  1 
ATOM   9510  N NE  . ARG F  6  164 ? -43.731 -73.382 -8.444  1.00 0.00 ? 164 ARG F NE  1 
ATOM   9511  C CZ  . ARG F  6  164 ? -44.089 -74.661 -8.771  1.00 0.00 ? 164 ARG F CZ  1 
ATOM   9512  N NH1 . ARG F  6  164 ? -43.321 -75.726 -8.404  1.00 0.00 ? 164 ARG F NH1 1 
ATOM   9513  N NH2 . ARG F  6  164 ? -45.241 -74.874 -9.473  1.00 0.00 ? 164 ARG F NH2 1 
ATOM   9514  N N   . SER F  6  165 ? -40.168 -69.843 -12.575 1.00 0.00 ? 165 SER F N   1 
ATOM   9515  C CA  . SER F  6  165 ? -40.684 -68.914 -13.551 1.00 0.00 ? 165 SER F CA  1 
ATOM   9516  C C   . SER F  6  165 ? -41.111 -69.610 -14.788 1.00 0.00 ? 165 SER F C   1 
ATOM   9517  O O   . SER F  6  165 ? -41.713 -69.016 -15.665 1.00 0.00 ? 165 SER F O   1 
ATOM   9518  C CB  . SER F  6  165 ? -39.584 -67.989 -14.116 1.00 0.00 ? 165 SER F CB  1 
ATOM   9519  O OG  . SER F  6  165 ? -38.837 -67.396 -13.089 1.00 0.00 ? 165 SER F OG  1 
ATOM   9520  N N   . GLN F  6  166 ? -40.685 -70.854 -14.959 1.00 0.00 ? 166 GLN F N   1 
ATOM   9521  C CA  . GLN F  6  166 ? -40.919 -71.559 -16.172 1.00 0.00 ? 166 GLN F CA  1 
ATOM   9522  C C   . GLN F  6  166 ? -42.360 -71.863 -16.429 1.00 0.00 ? 166 GLN F C   1 
ATOM   9523  O O   . GLN F  6  166 ? -42.791 -71.836 -17.575 1.00 0.00 ? 166 GLN F O   1 
ATOM   9524  C CB  . GLN F  6  166 ? -39.954 -72.758 -16.212 1.00 0.00 ? 166 GLN F CB  1 
ATOM   9525  C CG  . GLN F  6  166 ? -38.520 -72.240 -15.943 1.00 0.00 ? 166 GLN F CG  1 
ATOM   9526  C CD  . GLN F  6  166 ? -37.466 -73.322 -16.149 1.00 0.00 ? 166 GLN F CD  1 
ATOM   9527  O OE1 . GLN F  6  166 ? -37.783 -74.502 -16.318 1.00 0.00 ? 166 GLN F OE1 1 
ATOM   9528  N NE2 . GLN F  6  166 ? -36.168 -72.888 -16.128 1.00 0.00 ? 166 GLN F NE2 1 
ATOM   9529  N N   . SER F  6  167 ? -43.139 -72.094 -15.348 1.00 0.00 ? 167 SER F N   1 
ATOM   9530  C CA  . SER F  6  167 ? -44.580 -72.242 -15.363 1.00 0.00 ? 167 SER F CA  1 
ATOM   9531  C C   . SER F  6  167 ? -45.271 -70.951 -15.721 1.00 0.00 ? 167 SER F C   1 
ATOM   9532  O O   . SER F  6  167 ? -46.273 -70.940 -16.433 1.00 0.00 ? 167 SER F O   1 
ATOM   9533  C CB  . SER F  6  167 ? -45.119 -72.676 -13.980 1.00 0.00 ? 167 SER F CB  1 
ATOM   9534  O OG  . SER F  6  167 ? -44.514 -73.881 -13.534 1.00 0.00 ? 167 SER F OG  1 
ATOM   9535  N N   . ALA F  6  168 ? -44.724 -69.824 -15.216 1.00 0.00 ? 168 ALA F N   1 
ATOM   9536  C CA  . ALA F  6  168 ? -45.195 -68.499 -15.498 1.00 0.00 ? 168 ALA F CA  1 
ATOM   9537  C C   . ALA F  6  168 ? -44.978 -68.069 -16.920 1.00 0.00 ? 168 ALA F C   1 
ATOM   9538  O O   . ALA F  6  168 ? -45.787 -67.339 -17.486 1.00 0.00 ? 168 ALA F O   1 
ATOM   9539  C CB  . ALA F  6  168 ? -44.545 -67.470 -14.583 1.00 0.00 ? 168 ALA F CB  1 
ATOM   9540  N N   . ARG F  6  169 ? -43.864 -68.491 -17.537 1.00 0.00 ? 169 ARG F N   1 
ATOM   9541  C CA  . ARG F  6  169 ? -43.591 -68.240 -18.922 1.00 0.00 ? 169 ARG F CA  1 
ATOM   9542  C C   . ARG F  6  169 ? -44.496 -68.982 -19.842 1.00 0.00 ? 169 ARG F C   1 
ATOM   9543  O O   . ARG F  6  169 ? -44.737 -68.544 -20.961 1.00 0.00 ? 169 ARG F O   1 
ATOM   9544  C CB  . ARG F  6  169 ? -42.156 -68.627 -19.289 1.00 0.00 ? 169 ARG F CB  1 
ATOM   9545  C CG  . ARG F  6  169 ? -41.124 -67.725 -18.614 1.00 0.00 ? 169 ARG F CG  1 
ATOM   9546  C CD  . ARG F  6  169 ? -39.745 -68.364 -18.657 1.00 0.00 ? 169 ARG F CD  1 
ATOM   9547  N NE  . ARG F  6  169 ? -38.827 -67.554 -17.814 1.00 0.00 ? 169 ARG F NE  1 
ATOM   9548  C CZ  . ARG F  6  169 ? -37.483 -67.771 -17.853 1.00 0.00 ? 169 ARG F CZ  1 
ATOM   9549  N NH1 . ARG F  6  169 ? -36.969 -68.760 -18.642 1.00 0.00 ? 169 ARG F NH1 1 
ATOM   9550  N NH2 . ARG F  6  169 ? -36.647 -66.997 -17.103 1.00 0.00 ? 169 ARG F NH2 1 
ATOM   9551  N N   . THR F  6  170 ? -44.883 -70.208 -19.422 1.00 0.00 ? 170 THR F N   1 
ATOM   9552  C CA  . THR F  6  170 ? -45.687 -71.125 -20.189 1.00 0.00 ? 170 THR F CA  1 
ATOM   9553  C C   . THR F  6  170 ? -47.053 -70.588 -20.385 1.00 0.00 ? 170 THR F C   1 
ATOM   9554  O O   . THR F  6  170 ? -47.691 -70.847 -21.399 1.00 0.00 ? 170 THR F O   1 
ATOM   9555  C CB  . THR F  6  170 ? -45.745 -72.504 -19.582 1.00 0.00 ? 170 THR F CB  1 
ATOM   9556  O OG1 . THR F  6  170 ? -44.421 -72.993 -19.457 1.00 0.00 ? 170 THR F OG1 1 
ATOM   9557  C CG2 . THR F  6  170 ? -46.525 -73.477 -20.485 1.00 0.00 ? 170 THR F CG2 1 
ATOM   9558  N N   . TYR F  6  171 ? -47.539 -69.819 -19.403 1.00 0.00 ? 171 TYR F N   1 
ATOM   9559  C CA  . TYR F  6  171 ? -48.832 -69.203 -19.444 1.00 0.00 ? 171 TYR F CA  1 
ATOM   9560  C C   . TYR F  6  171 ? -48.902 -68.138 -20.544 1.00 0.00 ? 171 TYR F C   1 
ATOM   9561  O O   . TYR F  6  171 ? -49.960 -67.903 -21.112 1.00 0.00 ? 171 TYR F O   1 
ATOM   9562  C CB  . TYR F  6  171 ? -49.013 -68.659 -17.982 1.00 0.00 ? 171 TYR F CB  1 
ATOM   9563  C CG  . TYR F  6  171 ? -50.087 -67.636 -17.718 1.00 0.00 ? 171 TYR F CG  1 
ATOM   9564  C CD1 . TYR F  6  171 ? -51.400 -68.024 -17.402 1.00 0.00 ? 171 TYR F CD1 1 
ATOM   9565  C CD2 . TYR F  6  171 ? -49.759 -66.263 -17.701 1.00 0.00 ? 171 TYR F CD2 1 
ATOM   9566  C CE1 . TYR F  6  171 ? -52.372 -67.054 -17.113 1.00 0.00 ? 171 TYR F CE1 1 
ATOM   9567  C CE2 . TYR F  6  171 ? -50.739 -65.296 -17.437 1.00 0.00 ? 171 TYR F CE2 1 
ATOM   9568  C CZ  . TYR F  6  171 ? -52.043 -65.691 -17.142 1.00 0.00 ? 171 TYR F CZ  1 
ATOM   9569  O OH  . TYR F  6  171 ? -53.026 -64.724 -16.885 1.00 0.00 ? 171 TYR F OH  1 
ATOM   9570  N N   . LEU F  6  172 ? -47.762 -67.481 -20.851 1.00 0.00 ? 172 LEU F N   1 
ATOM   9571  C CA  . LEU F  6  172 ? -47.641 -66.281 -21.652 1.00 0.00 ? 172 LEU F CA  1 
ATOM   9572  C C   . LEU F  6  172 ? -47.573 -66.419 -23.154 1.00 0.00 ? 172 LEU F C   1 
ATOM   9573  O O   . LEU F  6  172 ? -47.749 -65.431 -23.865 1.00 0.00 ? 172 LEU F O   1 
ATOM   9574  C CB  . LEU F  6  172 ? -46.428 -65.451 -21.196 1.00 0.00 ? 172 LEU F CB  1 
ATOM   9575  C CG  . LEU F  6  172 ? -46.545 -64.942 -19.748 1.00 0.00 ? 172 LEU F CG  1 
ATOM   9576  C CD1 . LEU F  6  172 ? -45.205 -64.377 -19.248 1.00 0.00 ? 172 LEU F CD1 1 
ATOM   9577  C CD2 . LEU F  6  172 ? -47.655 -63.896 -19.612 1.00 0.00 ? 172 LEU F CD2 1 
ATOM   9578  N N   . GLU F  6  173 ? -47.364 -67.627 -23.703 1.00 0.00 ? 173 GLU F N   1 
ATOM   9579  C CA  . GLU F  6  173 ? -47.402 -67.841 -25.140 1.00 0.00 ? 173 GLU F CA  1 
ATOM   9580  C C   . GLU F  6  173 ? -48.808 -67.643 -25.658 1.00 0.00 ? 173 GLU F C   1 
ATOM   9581  O O   . GLU F  6  173 ? -49.026 -67.295 -26.813 1.00 0.00 ? 173 GLU F O   1 
ATOM   9582  C CB  . GLU F  6  173 ? -46.932 -69.249 -25.580 1.00 0.00 ? 173 GLU F CB  1 
ATOM   9583  C CG  . GLU F  6  173 ? -45.409 -69.466 -25.498 1.00 0.00 ? 173 GLU F CG  1 
ATOM   9584  C CD  . GLU F  6  173 ? -44.928 -69.582 -24.053 1.00 0.00 ? 173 GLU F CD  1 
ATOM   9585  O OE1 . GLU F  6  173 ? -45.474 -70.463 -23.343 1.00 0.00 ? 173 GLU F OE1 1 
ATOM   9586  O OE2 . GLU F  6  173 ? -44.014 -68.813 -23.647 1.00 0.00 ? 173 GLU F OE2 1 
ATOM   9587  N N   . ARG F  6  174 ? -49.792 -67.885 -24.800 1.00 0.00 ? 174 ARG F N   1 
ATOM   9588  C CA  . ARG F  6  174 ? -51.195 -67.766 -25.193 1.00 0.00 ? 174 ARG F CA  1 
ATOM   9589  C C   . ARG F  6  174 ? -51.729 -66.362 -24.926 1.00 0.00 ? 174 ARG F C   1 
ATOM   9590  O O   . ARG F  6  174 ? -52.900 -66.071 -25.164 1.00 0.00 ? 174 ARG F O   1 
ATOM   9591  C CB  . ARG F  6  174 ? -52.048 -68.801 -24.456 1.00 0.00 ? 174 ARG F CB  1 
ATOM   9592  C CG  . ARG F  6  174 ? -51.409 -70.177 -24.361 1.00 0.00 ? 174 ARG F CG  1 
ATOM   9593  C CD  . ARG F  6  174 ? -51.979 -70.972 -23.198 1.00 0.00 ? 174 ARG F CD  1 
ATOM   9594  N NE  . ARG F  6  174 ? -53.382 -70.647 -22.949 1.00 0.00 ? 174 ARG F NE  1 
ATOM   9595  C CZ  . ARG F  6  174 ? -53.814 -69.967 -21.892 1.00 0.00 ? 174 ARG F CZ  1 
ATOM   9596  N NH1 . ARG F  6  174 ? -52.953 -69.538 -20.980 1.00 0.00 ? 174 ARG F NH1 1 
ATOM   9597  N NH2 . ARG F  6  174 ? -55.108 -69.716 -21.747 1.00 0.00 ? 174 ARG F NH2 1 
ATOM   9598  N N   . HIS F  6  175 ? -50.854 -65.507 -24.414 1.00 0.00 ? 175 HIS F N   1 
ATOM   9599  C CA  . HIS F  6  175 ? -51.225 -64.215 -23.891 1.00 0.00 ? 175 HIS F CA  1 
ATOM   9600  C C   . HIS F  6  175 ? -50.359 -63.179 -24.503 1.00 0.00 ? 175 HIS F C   1 
ATOM   9601  O O   . HIS F  6  175 ? -50.279 -62.054 -24.015 1.00 0.00 ? 175 HIS F O   1 
ATOM   9602  C CB  . HIS F  6  175 ? -51.063 -64.080 -22.384 1.00 0.00 ? 175 HIS F CB  1 
ATOM   9603  C CG  . HIS F  6  175 ? -51.993 -64.978 -21.689 1.00 0.00 ? 175 HIS F CG  1 
ATOM   9604  N ND1 . HIS F  6  175 ? -53.323 -65.107 -21.999 1.00 0.00 ? 175 HIS F ND1 1 
ATOM   9605  C CD2 . HIS F  6  175 ? -51.763 -65.814 -20.658 1.00 0.00 ? 175 HIS F CD2 1 
ATOM   9606  C CE1 . HIS F  6  175 ? -53.822 -66.037 -21.153 1.00 0.00 ? 175 HIS F CE1 1 
ATOM   9607  N NE2 . HIS F  6  175 ? -52.912 -66.493 -20.320 1.00 0.00 ? 175 HIS F NE2 1 
ATOM   9608  N N   . GLU F  6  178 ? -52.692 -60.054 -26.026 1.00 0.00 ? 178 GLU F N   1 
ATOM   9609  C CA  . GLU F  6  178 ? -53.812 -59.776 -25.147 1.00 0.00 ? 178 GLU F CA  1 
ATOM   9610  C C   . GLU F  6  178 ? -53.418 -58.834 -24.079 1.00 0.00 ? 178 GLU F C   1 
ATOM   9611  O O   . GLU F  6  178 ? -54.215 -58.002 -23.655 1.00 0.00 ? 178 GLU F O   1 
ATOM   9612  C CB  . GLU F  6  178 ? -54.384 -60.995 -24.383 1.00 0.00 ? 178 GLU F CB  1 
ATOM   9613  C CG  . GLU F  6  178 ? -55.264 -61.934 -25.220 1.00 0.00 ? 178 GLU F CG  1 
ATOM   9614  C CD  . GLU F  6  178 ? -54.452 -62.933 -26.045 1.00 0.00 ? 178 GLU F CD  1 
ATOM   9615  O OE1 . GLU F  6  178 ? -54.060 -62.589 -27.188 1.00 0.00 ? 178 GLU F OE1 1 
ATOM   9616  O OE2 . GLU F  6  178 ? -54.253 -64.072 -25.553 1.00 0.00 ? 178 GLU F OE2 1 
ATOM   9617  N N   . PHE F  6  179 ? -52.176 -58.970 -23.601 1.00 0.00 ? 179 PHE F N   1 
ATOM   9618  C CA  . PHE F  6  179 ? -51.667 -58.068 -22.625 1.00 0.00 ? 179 PHE F CA  1 
ATOM   9619  C C   . PHE F  6  179 ? -51.222 -56.741 -23.169 1.00 0.00 ? 179 PHE F C   1 
ATOM   9620  O O   . PHE F  6  179 ? -51.167 -55.775 -22.418 1.00 0.00 ? 179 PHE F O   1 
ATOM   9621  C CB  . PHE F  6  179 ? -50.566 -58.775 -21.816 1.00 0.00 ? 179 PHE F CB  1 
ATOM   9622  C CG  . PHE F  6  179 ? -51.116 -59.955 -21.010 1.00 0.00 ? 179 PHE F CG  1 
ATOM   9623  C CD1 . PHE F  6  179 ? -52.492 -60.251 -20.818 1.00 0.00 ? 179 PHE F CD1 1 
ATOM   9624  C CD2 . PHE F  6  179 ? -50.179 -60.760 -20.337 1.00 0.00 ? 179 PHE F CD2 1 
ATOM   9625  C CE1 . PHE F  6  179 ? -52.894 -61.311 -20.004 1.00 0.00 ? 179 PHE F CE1 1 
ATOM   9626  C CE2 . PHE F  6  179 ? -50.584 -61.776 -19.476 1.00 0.00 ? 179 PHE F CE2 1 
ATOM   9627  C CZ  . PHE F  6  179 ? -51.937 -62.063 -19.332 1.00 0.00 ? 179 PHE F CZ  1 
ATOM   9628  N N   . MET F  6  180 ? -50.963 -56.594 -24.487 1.00 0.00 ? 180 MET F N   1 
ATOM   9629  C CA  . MET F  6  180 ? -50.657 -55.294 -25.032 1.00 0.00 ? 180 MET F CA  1 
ATOM   9630  C C   . MET F  6  180 ? -51.872 -54.501 -25.374 1.00 0.00 ? 180 MET F C   1 
ATOM   9631  O O   . MET F  6  180 ? -51.767 -53.310 -25.654 1.00 0.00 ? 180 MET F O   1 
ATOM   9632  C CB  . MET F  6  180 ? -49.710 -55.368 -26.227 1.00 0.00 ? 180 MET F CB  1 
ATOM   9633  C CG  . MET F  6  180 ? -48.263 -55.699 -25.794 1.00 0.00 ? 180 MET F CG  1 
ATOM   9634  S SD  . MET F  6  180 ? -47.536 -54.596 -24.522 1.00 0.00 ? 180 MET F SD  1 
ATOM   9635  C CE  . MET F  6  180 ? -47.759 -52.990 -25.330 1.00 0.00 ? 180 MET F CE  1 
ATOM   9636  N N   . GLU F  6  181 ? -53.060 -55.134 -25.291 1.00 0.00 ? 181 GLU F N   1 
ATOM   9637  C CA  . GLU F  6  181 ? -54.322 -54.515 -25.594 1.00 0.00 ? 181 GLU F CA  1 
ATOM   9638  C C   . GLU F  6  181 ? -55.007 -54.115 -24.306 1.00 0.00 ? 181 GLU F C   1 
ATOM   9639  O O   . GLU F  6  181 ? -55.467 -52.977 -24.186 1.00 0.00 ? 181 GLU F O   1 
ATOM   9640  C CB  . GLU F  6  181 ? -55.256 -55.479 -26.366 1.00 0.00 ? 181 GLU F CB  1 
ATOM   9641  C CG  . GLU F  6  181 ? -54.814 -55.752 -27.813 1.00 0.00 ? 181 GLU F CG  1 
ATOM   9642  C CD  . GLU F  6  181 ? -55.554 -56.977 -28.359 1.00 0.00 ? 181 GLU F CD  1 
ATOM   9643  O OE1 . GLU F  6  181 ? -55.178 -58.118 -27.986 1.00 0.00 ? 181 GLU F OE1 1 
ATOM   9644  O OE2 . GLU F  6  181 ? -56.496 -56.795 -29.170 1.00 0.00 ? 181 GLU F OE2 1 
ATOM   9645  N N   . CYS F  6  182 ? -55.183 -55.068 -23.350 1.00 0.00 ? 182 CYS F N   1 
ATOM   9646  C CA  . CYS F  6  182 ? -55.989 -54.793 -22.182 1.00 0.00 ? 182 CYS F CA  1 
ATOM   9647  C C   . CYS F  6  182 ? -55.227 -54.048 -21.141 1.00 0.00 ? 182 CYS F C   1 
ATOM   9648  O O   . CYS F  6  182 ? -54.039 -54.281 -20.959 1.00 0.00 ? 182 CYS F O   1 
ATOM   9649  C CB  . CYS F  6  182 ? -56.645 -56.048 -21.564 1.00 0.00 ? 182 CYS F CB  1 
ATOM   9650  S SG  . CYS F  6  182 ? -58.265 -55.630 -20.834 1.00 0.00 ? 182 CYS F SG  1 
ATOM   9651  N N   . ASN F  6  183 ? -55.908 -53.055 -20.526 1.00 0.00 ? 183 ASN F N   1 
ATOM   9652  C CA  . ASN F  6  183 ? -55.331 -52.054 -19.675 1.00 0.00 ? 183 ASN F CA  1 
ATOM   9653  C C   . ASN F  6  183 ? -55.076 -52.530 -18.286 1.00 0.00 ? 183 ASN F C   1 
ATOM   9654  O O   . ASN F  6  183 ? -55.514 -53.607 -17.904 1.00 0.00 ? 183 ASN F O   1 
ATOM   9655  C CB  . ASN F  6  183 ? -56.196 -50.767 -19.632 1.00 0.00 ? 183 ASN F CB  1 
ATOM   9656  C CG  . ASN F  6  183 ? -57.609 -50.988 -19.062 1.00 0.00 ? 183 ASN F CG  1 
ATOM   9657  O OD1 . ASN F  6  183 ? -57.789 -51.063 -17.838 1.00 0.00 ? 183 ASN F OD1 1 
ATOM   9658  N ND2 . ASN F  6  183 ? -58.620 -51.063 -19.983 1.00 0.00 ? 183 ASN F ND2 1 
ATOM   9659  N N   . LEU F  6  184 ? -54.543 -51.639 -17.462 1.00 0.00 ? 184 LEU F N   1 
ATOM   9660  C CA  . LEU F  6  184 ? -53.795 -51.960 -16.254 1.00 0.00 ? 184 LEU F CA  1 
ATOM   9661  C C   . LEU F  6  184 ? -54.548 -52.792 -15.202 1.00 0.00 ? 184 LEU F C   1 
ATOM   9662  O O   . LEU F  6  184 ? -53.949 -53.657 -14.568 1.00 0.00 ? 184 LEU F O   1 
ATOM   9663  C CB  . LEU F  6  184 ? -53.263 -50.656 -15.650 1.00 0.00 ? 184 LEU F CB  1 
ATOM   9664  C CG  . LEU F  6  184 ? -52.487 -50.608 -14.337 1.00 0.00 ? 184 LEU F CG  1 
ATOM   9665  C CD1 . LEU F  6  184 ? -51.195 -51.394 -14.509 1.00 0.00 ? 184 LEU F CD1 1 
ATOM   9666  C CD2 . LEU F  6  184 ? -52.190 -49.175 -13.915 1.00 0.00 ? 184 LEU F CD2 1 
ATOM   9667  N N   . ASN F  6  185 ? -55.836 -52.537 -15.004 1.00 0.00 ? 185 ASN F N   1 
ATOM   9668  C CA  . ASN F  6  185 ? -56.631 -53.336 -14.103 1.00 0.00 ? 185 ASN F CA  1 
ATOM   9669  C C   . ASN F  6  185 ? -56.651 -54.796 -14.506 1.00 0.00 ? 185 ASN F C   1 
ATOM   9670  O O   . ASN F  6  185 ? -56.287 -55.659 -13.709 1.00 0.00 ? 185 ASN F O   1 
ATOM   9671  C CB  . ASN F  6  185 ? -58.073 -52.787 -13.964 1.00 0.00 ? 185 ASN F CB  1 
ATOM   9672  C CG  . ASN F  6  185 ? -58.073 -51.533 -13.067 1.00 0.00 ? 185 ASN F CG  1 
ATOM   9673  O OD1 . ASN F  6  185 ? -57.034 -51.085 -12.576 1.00 0.00 ? 185 ASN F OD1 1 
ATOM   9674  N ND2 . ASN F  6  185 ? -59.299 -50.980 -12.823 1.00 0.00 ? 185 ASN F ND2 1 
ATOM   9675  N N   . GLU F  6  186 ? -57.033 -55.090 -15.777 1.00 0.00 ? 186 GLU F N   1 
ATOM   9676  C CA  . GLU F  6  186 ? -57.093 -56.433 -16.302 1.00 0.00 ? 186 GLU F CA  1 
ATOM   9677  C C   . GLU F  6  186 ? -55.739 -57.081 -16.451 1.00 0.00 ? 186 GLU F C   1 
ATOM   9678  O O   . GLU F  6  186 ? -55.603 -58.302 -16.346 1.00 0.00 ? 186 GLU F O   1 
ATOM   9679  C CB  . GLU F  6  186 ? -57.816 -56.499 -17.641 1.00 0.00 ? 186 GLU F CB  1 
ATOM   9680  C CG  . GLU F  6  186 ? -58.191 -57.918 -18.114 1.00 0.00 ? 186 GLU F CG  1 
ATOM   9681  C CD  . GLU F  6  186 ? -59.274 -58.541 -17.247 1.00 0.00 ? 186 GLU F CD  1 
ATOM   9682  O OE1 . GLU F  6  186 ? -60.470 -58.189 -17.414 1.00 0.00 ? 186 GLU F OE1 1 
ATOM   9683  O OE2 . GLU F  6  186 ? -58.914 -59.415 -16.424 1.00 0.00 ? 186 GLU F OE2 1 
ATOM   9684  N N   . LEU F  6  187 ? -54.670 -56.277 -16.660 1.00 0.00 ? 187 LEU F N   1 
ATOM   9685  C CA  . LEU F  6  187 ? -53.332 -56.810 -16.744 1.00 0.00 ? 187 LEU F CA  1 
ATOM   9686  C C   . LEU F  6  187 ? -52.942 -57.449 -15.459 1.00 0.00 ? 187 LEU F C   1 
ATOM   9687  O O   . LEU F  6  187 ? -52.396 -58.545 -15.465 1.00 0.00 ? 187 LEU F O   1 
ATOM   9688  C CB  . LEU F  6  187 ? -52.230 -55.754 -16.916 1.00 0.00 ? 187 LEU F CB  1 
ATOM   9689  C CG  . LEU F  6  187 ? -52.235 -55.029 -18.246 1.00 0.00 ? 187 LEU F CG  1 
ATOM   9690  C CD1 . LEU F  6  187 ? -51.251 -53.853 -18.174 1.00 0.00 ? 187 LEU F CD1 1 
ATOM   9691  C CD2 . LEU F  6  187 ? -51.885 -55.978 -19.389 1.00 0.00 ? 187 LEU F CD2 1 
ATOM   9692  N N   . VAL F  6  188 ? -53.171 -56.698 -14.358 1.00 0.00 ? 188 VAL F N   1 
ATOM   9693  C CA  . VAL F  6  188 ? -52.889 -57.059 -13.008 1.00 0.00 ? 188 VAL F CA  1 
ATOM   9694  C C   . VAL F  6  188 ? -53.751 -58.187 -12.546 1.00 0.00 ? 188 VAL F C   1 
ATOM   9695  O O   . VAL F  6  188 ? -53.274 -59.063 -11.831 1.00 0.00 ? 188 VAL F O   1 
ATOM   9696  C CB  . VAL F  6  188 ? -53.037 -55.867 -12.116 1.00 0.00 ? 188 VAL F CB  1 
ATOM   9697  C CG1 . VAL F  6  188 ? -52.829 -56.282 -10.663 1.00 0.00 ? 188 VAL F CG1 1 
ATOM   9698  C CG2 . VAL F  6  188 ? -51.961 -54.849 -12.518 1.00 0.00 ? 188 VAL F CG2 1 
ATOM   9699  N N   . LYS F  6  189 ? -55.013 -58.273 -13.019 1.00 0.00 ? 189 LYS F N   1 
ATOM   9700  C CA  . LYS F  6  189 ? -55.875 -59.375 -12.681 1.00 0.00 ? 189 LYS F CA  1 
ATOM   9701  C C   . LYS F  6  189 ? -55.290 -60.647 -13.219 1.00 0.00 ? 189 LYS F C   1 
ATOM   9702  O O   . LYS F  6  189 ? -55.394 -61.703 -12.602 1.00 0.00 ? 189 LYS F O   1 
ATOM   9703  C CB  . LYS F  6  189 ? -57.284 -59.230 -13.278 1.00 0.00 ? 189 LYS F CB  1 
ATOM   9704  C CG  . LYS F  6  189 ? -58.152 -58.216 -12.523 1.00 0.00 ? 189 LYS F CG  1 
ATOM   9705  C CD  . LYS F  6  189 ? -59.497 -57.918 -13.204 1.00 0.00 ? 189 LYS F CD  1 
ATOM   9706  C CE  . LYS F  6  189 ? -60.381 -59.149 -13.489 1.00 0.00 ? 189 LYS F CE  1 
ATOM   9707  N NZ  . LYS F  6  189 ? -60.782 -59.856 -12.255 1.00 0.00 ? 189 LYS F NZ  1 
ATOM   9708  N N   . HIS F  6  190 ? -54.672 -60.554 -14.414 1.00 0.00 ? 190 HIS F N   1 
ATOM   9709  C CA  . HIS F  6  190 ? -53.980 -61.655 -15.028 1.00 0.00 ? 190 HIS F CA  1 
ATOM   9710  C C   . HIS F  6  190 ? -52.562 -61.823 -14.571 1.00 0.00 ? 190 HIS F C   1 
ATOM   9711  O O   . HIS F  6  190 ? -51.978 -62.889 -14.717 1.00 0.00 ? 190 HIS F O   1 
ATOM   9712  C CB  . HIS F  6  190 ? -54.028 -61.478 -16.542 1.00 0.00 ? 190 HIS F CB  1 
ATOM   9713  C CG  . HIS F  6  190 ? -55.439 -61.611 -17.011 1.00 0.00 ? 190 HIS F CG  1 
ATOM   9714  N ND1 . HIS F  6  190 ? -56.343 -62.515 -16.493 1.00 0.00 ? 190 HIS F ND1 1 
ATOM   9715  C CD2 . HIS F  6  190 ? -56.075 -61.002 -18.042 1.00 0.00 ? 190 HIS F CD2 1 
ATOM   9716  C CE1 . HIS F  6  190 ? -57.474 -62.402 -17.224 1.00 0.00 ? 190 HIS F CE1 1 
ATOM   9717  N NE2 . HIS F  6  190 ? -57.357 -61.505 -18.184 1.00 0.00 ? 190 HIS F NE2 1 
ATOM   9718  N N   . GLY F  6  191 ? -51.963 -60.806 -13.955 1.00 0.00 ? 191 GLY F N   1 
ATOM   9719  C CA  . GLY F  6  191 ? -50.629 -60.886 -13.456 1.00 0.00 ? 191 GLY F CA  1 
ATOM   9720  C C   . GLY F  6  191 ? -50.621 -61.708 -12.224 1.00 0.00 ? 191 GLY F C   1 
ATOM   9721  O O   . GLY F  6  191 ? -49.648 -62.397 -11.939 1.00 0.00 ? 191 GLY F O   1 
ATOM   9722  N N   . LEU F  6  192 ? -51.710 -61.617 -11.437 1.00 0.00 ? 192 LEU F N   1 
ATOM   9723  C CA  . LEU F  6  192 ? -51.921 -62.441 -10.274 1.00 0.00 ? 192 LEU F CA  1 
ATOM   9724  C C   . LEU F  6  192 ? -52.134 -63.900 -10.609 1.00 0.00 ? 192 LEU F C   1 
ATOM   9725  O O   . LEU F  6  192 ? -51.719 -64.771 -9.852  1.00 0.00 ? 192 LEU F O   1 
ATOM   9726  C CB  . LEU F  6  192 ? -53.149 -61.936 -9.504  1.00 0.00 ? 192 LEU F CB  1 
ATOM   9727  C CG  . LEU F  6  192 ? -53.023 -60.492 -8.987  1.00 0.00 ? 192 LEU F CG  1 
ATOM   9728  C CD1 . LEU F  6  192 ? -54.405 -59.971 -8.567  1.00 0.00 ? 192 LEU F CD1 1 
ATOM   9729  C CD2 . LEU F  6  192 ? -52.013 -60.382 -7.838  1.00 0.00 ? 192 LEU F CD2 1 
ATOM   9730  N N   . ARG F  6  193 ? -52.800 -64.175 -11.761 1.00 0.00 ? 193 ARG F N   1 
ATOM   9731  C CA  . ARG F  6  193 ? -53.046 -65.490 -12.305 1.00 0.00 ? 193 ARG F CA  1 
ATOM   9732  C C   . ARG F  6  193 ? -51.790 -66.173 -12.764 1.00 0.00 ? 193 ARG F C   1 
ATOM   9733  O O   . ARG F  6  193 ? -51.651 -67.381 -12.633 1.00 0.00 ? 193 ARG F O   1 
ATOM   9734  C CB  . ARG F  6  193 ? -54.056 -65.417 -13.469 1.00 0.00 ? 193 ARG F CB  1 
ATOM   9735  C CG  . ARG F  6  193 ? -54.650 -66.781 -13.851 1.00 0.00 ? 193 ARG F CG  1 
ATOM   9736  C CD  . ARG F  6  193 ? -55.728 -66.724 -14.941 1.00 0.00 ? 193 ARG F CD  1 
ATOM   9737  N NE  . ARG F  6  193 ? -56.855 -65.858 -14.468 1.00 0.00 ? 193 ARG F NE  1 
ATOM   9738  C CZ  . ARG F  6  193 ? -58.147 -66.281 -14.348 1.00 0.00 ? 193 ARG F CZ  1 
ATOM   9739  N NH1 . ARG F  6  193 ? -58.529 -67.527 -14.737 1.00 0.00 ? 193 ARG F NH1 1 
ATOM   9740  N NH2 . ARG F  6  193 ? -59.076 -65.435 -13.811 1.00 0.00 ? 193 ARG F NH2 1 
ATOM   9741  N N   . ALA F  6  194 ? -50.839 -65.370 -13.295 1.00 0.00 ? 194 ALA F N   1 
ATOM   9742  C CA  . ALA F  6  194 ? -49.524 -65.757 -13.742 1.00 0.00 ? 194 ALA F CA  1 
ATOM   9743  C C   . ALA F  6  194 ? -48.653 -66.042 -12.571 1.00 0.00 ? 194 ALA F C   1 
ATOM   9744  O O   . ALA F  6  194 ? -47.830 -66.946 -12.603 1.00 0.00 ? 194 ALA F O   1 
ATOM   9745  C CB  . ALA F  6  194 ? -48.820 -64.654 -14.547 1.00 0.00 ? 194 ALA F CB  1 
ATOM   9746  N N   . LEU F  6  195 ? -48.807 -65.243 -11.496 1.00 0.00 ? 195 LEU F N   1 
ATOM   9747  C CA  . LEU F  6  195 ? -48.056 -65.397 -10.285 1.00 0.00 ? 195 LEU F CA  1 
ATOM   9748  C C   . LEU F  6  195 ? -48.425 -66.640 -9.529  1.00 0.00 ? 195 LEU F C   1 
ATOM   9749  O O   . LEU F  6  195 ? -47.605 -67.177 -8.802  1.00 0.00 ? 195 LEU F O   1 
ATOM   9750  C CB  . LEU F  6  195 ? -48.159 -64.170 -9.362  1.00 0.00 ? 195 LEU F CB  1 
ATOM   9751  C CG  . LEU F  6  195 ? -47.409 -64.372 -8.027  1.00 0.00 ? 195 LEU F CG  1 
ATOM   9752  C CD1 . LEU F  6  195 ? -45.901 -64.560 -8.238  1.00 0.00 ? 195 LEU F CD1 1 
ATOM   9753  C CD2 . LEU F  6  195 ? -47.714 -63.272 -7.007  1.00 0.00 ? 195 LEU F CD2 1 
ATOM   9754  N N   . ARG F  6  196 ? -49.657 -67.170 -9.682  1.00 0.00 ? 196 ARG F N   1 
ATOM   9755  C CA  . ARG F  6  196 ? -50.045 -68.398 -9.039  1.00 0.00 ? 196 ARG F CA  1 
ATOM   9756  C C   . ARG F  6  196 ? -49.272 -69.573 -9.570  1.00 0.00 ? 196 ARG F C   1 
ATOM   9757  O O   . ARG F  6  196 ? -49.064 -70.570 -8.894  1.00 0.00 ? 196 ARG F O   1 
ATOM   9758  C CB  . ARG F  6  196 ? -51.560 -68.659 -9.075  1.00 0.00 ? 196 ARG F CB  1 
ATOM   9759  C CG  . ARG F  6  196 ? -51.968 -69.685 -7.997  1.00 0.00 ? 196 ARG F CG  1 
ATOM   9760  C CD  . ARG F  6  196 ? -53.463 -69.772 -7.678  1.00 0.00 ? 196 ARG F CD  1 
ATOM   9761  N NE  . ARG F  6  196 ? -53.875 -68.572 -6.878  1.00 0.00 ? 196 ARG F NE  1 
ATOM   9762  C CZ  . ARG F  6  196 ? -54.733 -67.610 -7.327  1.00 0.00 ? 196 ARG F CZ  1 
ATOM   9763  N NH1 . ARG F  6  196 ? -55.211 -67.631 -8.605  1.00 0.00 ? 196 ARG F NH1 1 
ATOM   9764  N NH2 . ARG F  6  196 ? -55.105 -66.608 -6.478  1.00 0.00 ? 196 ARG F NH2 1 
ATOM   9765  N N   . GLU F  6  197 ? -48.815 -69.496 -10.825 1.00 0.00 ? 197 GLU F N   1 
ATOM   9766  C CA  . GLU F  6  197 ? -48.046 -70.536 -11.451 1.00 0.00 ? 197 GLU F CA  1 
ATOM   9767  C C   . GLU F  6  197 ? -46.632 -70.613 -10.905 1.00 0.00 ? 197 GLU F C   1 
ATOM   9768  O O   . GLU F  6  197 ? -45.951 -71.629 -11.014 1.00 0.00 ? 197 GLU F O   1 
ATOM   9769  C CB  . GLU F  6  197 ? -48.012 -70.314 -12.975 1.00 0.00 ? 197 GLU F CB  1 
ATOM   9770  C CG  . GLU F  6  197 ? -49.400 -70.065 -13.590 1.00 0.00 ? 197 GLU F CG  1 
ATOM   9771  C CD  . GLU F  6  197 ? -50.365 -71.197 -13.238 1.00 0.00 ? 197 GLU F CD  1 
ATOM   9772  O OE1 . GLU F  6  197 ? -50.034 -72.372 -13.548 1.00 0.00 ? 197 GLU F OE1 1 
ATOM   9773  O OE2 . GLU F  6  197 ? -51.447 -70.908 -12.660 1.00 0.00 ? 197 GLU F OE2 1 
ATOM   9774  N N   . ASN F  6  209 ? -48.955 -61.220 -0.168  1.00 0.00 ? 209 ASN F N   1 
ATOM   9775  C CA  . ASN F  6  209 ? -47.801 -61.783 -0.824  1.00 0.00 ? 209 ASN F CA  1 
ATOM   9776  C C   . ASN F  6  209 ? -47.673 -61.326 -2.243  1.00 0.00 ? 209 ASN F C   1 
ATOM   9777  O O   . ASN F  6  209 ? -46.732 -61.717 -2.916  1.00 0.00 ? 209 ASN F O   1 
ATOM   9778  C CB  . ASN F  6  209 ? -47.768 -63.336 -0.793  1.00 0.00 ? 209 ASN F CB  1 
ATOM   9779  C CG  . ASN F  6  209 ? -48.881 -64.049 -1.589  1.00 0.00 ? 209 ASN F CG  1 
ATOM   9780  O OD1 . ASN F  6  209 ? -49.505 -63.503 -2.504  1.00 0.00 ? 209 ASN F OD1 1 
ATOM   9781  N ND2 . ASN F  6  209 ? -49.100 -65.353 -1.218  1.00 0.00 ? 209 ASN F ND2 1 
ATOM   9782  N N   . VAL F  6  210 ? -48.548 -60.431 -2.730  1.00 0.00 ? 210 VAL F N   1 
ATOM   9783  C CA  . VAL F  6  210 ? -48.393 -59.861 -4.036  1.00 0.00 ? 210 VAL F CA  1 
ATOM   9784  C C   . VAL F  6  210 ? -48.182 -58.413 -3.790  1.00 0.00 ? 210 VAL F C   1 
ATOM   9785  O O   . VAL F  6  210 ? -49.146 -57.688 -3.569  1.00 0.00 ? 210 VAL F O   1 
ATOM   9786  C CB  . VAL F  6  210 ? -49.522 -60.079 -5.042  1.00 0.00 ? 210 VAL F CB  1 
ATOM   9787  C CG1 . VAL F  6  210 ? -49.590 -61.588 -5.306  1.00 0.00 ? 210 VAL F CG1 1 
ATOM   9788  C CG2 . VAL F  6  210 ? -50.852 -59.496 -4.526  1.00 0.00 ? 210 VAL F CG2 1 
ATOM   9789  N N   . SER F  6  211 ? -46.916 -57.950 -3.940  1.00 0.00 ? 211 SER F N   1 
ATOM   9790  C CA  . SER F  6  211 ? -46.567 -56.560 -4.134  1.00 0.00 ? 211 SER F CA  1 
ATOM   9791  C C   . SER F  6  211 ? -46.924 -56.213 -5.565  1.00 0.00 ? 211 SER F C   1 
ATOM   9792  O O   . SER F  6  211 ? -46.748 -57.071 -6.425  1.00 0.00 ? 211 SER F O   1 
ATOM   9793  C CB  . SER F  6  211 ? -45.056 -56.367 -3.981  1.00 0.00 ? 211 SER F CB  1 
ATOM   9794  O OG  . SER F  6  211 ? -44.574 -57.069 -2.848  1.00 0.00 ? 211 SER F OG  1 
ATOM   9795  N N   . ILE F  6  212 ? -47.356 -54.969 -5.893  1.00 0.00 ? 212 ILE F N   1 
ATOM   9796  C CA  . ILE F  6  212 ? -47.596 -54.582 -7.273  1.00 0.00 ? 212 ILE F CA  1 
ATOM   9797  C C   . ILE F  6  212 ? -46.948 -53.259 -7.571  1.00 0.00 ? 212 ILE F C   1 
ATOM   9798  O O   . ILE F  6  212 ? -47.024 -52.357 -6.762  1.00 0.00 ? 212 ILE F O   1 
ATOM   9799  C CB  . ILE F  6  212 ? -49.072 -54.650 -7.623  1.00 0.00 ? 212 ILE F CB  1 
ATOM   9800  C CG1 . ILE F  6  212 ? -49.513 -56.128 -7.464  1.00 0.00 ? 212 ILE F CG1 1 
ATOM   9801  C CG2 . ILE F  6  212 ? -49.306 -54.112 -9.057  1.00 0.00 ? 212 ILE F CG2 1 
ATOM   9802  C CD1 . ILE F  6  212 ? -50.788 -56.499 -8.186  1.00 0.00 ? 212 ILE F CD1 1 
ATOM   9803  N N   . GLY F  6  213 ? -46.263 -53.111 -8.720  1.00 0.00 ? 213 GLY F N   1 
ATOM   9804  C CA  . GLY F  6  213 ? -45.539 -51.918 -9.088  1.00 0.00 ? 213 GLY F CA  1 
ATOM   9805  C C   . GLY F  6  213 ? -46.018 -51.406 -10.410 1.00 0.00 ? 213 GLY F C   1 
ATOM   9806  O O   . GLY F  6  213 ? -45.769 -52.007 -11.455 1.00 0.00 ? 213 GLY F O   1 
ATOM   9807  N N   . ILE F  6  214 ? -46.737 -50.271 -10.392 1.00 0.00 ? 214 ILE F N   1 
ATOM   9808  C CA  . ILE F  6  214 ? -47.403 -49.766 -11.571 1.00 0.00 ? 214 ILE F CA  1 
ATOM   9809  C C   . ILE F  6  214 ? -46.844 -48.419 -11.842 1.00 0.00 ? 214 ILE F C   1 
ATOM   9810  O O   . ILE F  6  214 ? -46.614 -47.638 -10.929 1.00 0.00 ? 214 ILE F O   1 
ATOM   9811  C CB  . ILE F  6  214 ? -48.922 -49.666 -11.407 1.00 0.00 ? 214 ILE F CB  1 
ATOM   9812  C CG1 . ILE F  6  214 ? -49.583 -51.045 -11.239 1.00 0.00 ? 214 ILE F CG1 1 
ATOM   9813  C CG2 . ILE F  6  214 ? -49.596 -48.955 -12.585 1.00 0.00 ? 214 ILE F CG2 1 
ATOM   9814  C CD1 . ILE F  6  214 ? -49.653 -51.887 -12.512 1.00 0.00 ? 214 ILE F CD1 1 
ATOM   9815  N N   . VAL F  6  215 ? -46.668 -48.130 -13.144 1.00 0.00 ? 215 VAL F N   1 
ATOM   9816  C CA  . VAL F  6  215 ? -46.253 -46.873 -13.683 1.00 0.00 ? 215 VAL F CA  1 
ATOM   9817  C C   . VAL F  6  215 ? -46.892 -46.871 -15.021 1.00 0.00 ? 215 VAL F C   1 
ATOM   9818  O O   . VAL F  6  215 ? -47.218 -47.926 -15.539 1.00 0.00 ? 215 VAL F O   1 
ATOM   9819  C CB  . VAL F  6  215 ? -44.763 -46.666 -13.789 1.00 0.00 ? 215 VAL F CB  1 
ATOM   9820  C CG1 . VAL F  6  215 ? -44.107 -47.714 -14.708 1.00 0.00 ? 215 VAL F CG1 1 
ATOM   9821  C CG2 . VAL F  6  215 ? -44.439 -45.193 -14.152 1.00 0.00 ? 215 VAL F CG2 1 
ATOM   9822  N N   . GLY F  6  216 ? -47.192 -45.678 -15.559 1.00 0.00 ? 216 GLY F N   1 
ATOM   9823  C CA  . GLY F  6  216 ? -47.920 -45.496 -16.774 1.00 0.00 ? 216 GLY F CA  1 
ATOM   9824  C C   . GLY F  6  216 ? -47.862 -44.044 -17.070 1.00 0.00 ? 216 GLY F C   1 
ATOM   9825  O O   . GLY F  6  216 ? -47.130 -43.304 -16.420 1.00 0.00 ? 216 GLY F O   1 
ATOM   9826  N N   . LYS F  6  217 ? -48.550 -43.600 -18.142 1.00 0.00 ? 217 LYS F N   1 
ATOM   9827  C CA  . LYS F  6  217 ? -48.458 -42.220 -18.572 1.00 0.00 ? 217 LYS F CA  1 
ATOM   9828  C C   . LYS F  6  217 ? -49.246 -41.314 -17.682 1.00 0.00 ? 217 LYS F C   1 
ATOM   9829  O O   . LYS F  6  217 ? -48.987 -40.114 -17.602 1.00 0.00 ? 217 LYS F O   1 
ATOM   9830  C CB  . LYS F  6  217 ? -48.953 -42.021 -20.027 1.00 0.00 ? 217 LYS F CB  1 
ATOM   9831  C CG  . LYS F  6  217 ? -48.351 -40.774 -20.703 1.00 0.00 ? 217 LYS F CG  1 
ATOM   9832  C CD  . LYS F  6  217 ? -48.799 -40.568 -22.156 1.00 0.00 ? 217 LYS F CD  1 
ATOM   9833  C CE  . LYS F  6  217 ? -48.341 -41.656 -23.139 1.00 0.00 ? 217 LYS F CE  1 
ATOM   9834  N NZ  . LYS F  6  217 ? -46.865 -41.806 -23.147 1.00 0.00 ? 217 LYS F NZ  1 
ATOM   9835  N N   . ASP F  6  218 ? -50.189 -41.913 -16.935 1.00 0.00 ? 218 ASP F N   1 
ATOM   9836  C CA  . ASP F  6  218 ? -51.050 -41.189 -16.057 1.00 0.00 ? 218 ASP F CA  1 
ATOM   9837  C C   . ASP F  6  218 ? -50.445 -41.147 -14.674 1.00 0.00 ? 218 ASP F C   1 
ATOM   9838  O O   . ASP F  6  218 ? -50.793 -40.264 -13.896 1.00 0.00 ? 218 ASP F O   1 
ATOM   9839  C CB  . ASP F  6  218 ? -52.432 -41.888 -16.010 1.00 0.00 ? 218 ASP F CB  1 
ATOM   9840  C CG  . ASP F  6  218 ? -53.474 -41.084 -15.237 1.00 0.00 ? 218 ASP F CG  1 
ATOM   9841  O OD1 . ASP F  6  218 ? -53.646 -39.879 -15.550 1.00 0.00 ? 218 ASP F OD1 1 
ATOM   9842  O OD2 . ASP F  6  218 ? -54.110 -41.672 -14.327 1.00 0.00 ? 218 ASP F OD2 1 
ATOM   9843  N N   . LEU F  6  219 ? -49.556 -42.096 -14.298 1.00 0.00 ? 219 LEU F N   1 
ATOM   9844  C CA  . LEU F  6  219 ? -49.164 -42.130 -12.921 1.00 0.00 ? 219 LEU F CA  1 
ATOM   9845  C C   . LEU F  6  219 ? -47.798 -42.643 -12.736 1.00 0.00 ? 219 LEU F C   1 
ATOM   9846  O O   . LEU F  6  219 ? -47.306 -43.464 -13.497 1.00 0.00 ? 219 LEU F O   1 
ATOM   9847  C CB  . LEU F  6  219 ? -50.147 -42.930 -12.035 1.00 0.00 ? 219 LEU F CB  1 
ATOM   9848  C CG  . LEU F  6  219 ? -50.295 -44.441 -12.319 1.00 0.00 ? 219 LEU F CG  1 
ATOM   9849  C CD1 . LEU F  6  219 ? -49.379 -45.296 -11.427 1.00 0.00 ? 219 LEU F CD1 1 
ATOM   9850  C CD2 . LEU F  6  219 ? -51.763 -44.862 -12.122 1.00 0.00 ? 219 LEU F CD2 1 
ATOM   9851  N N   . GLU F  6  220 ? -47.149 -42.085 -11.692 1.00 0.00 ? 220 GLU F N   1 
ATOM   9852  C CA  . GLU F  6  220 ? -45.797 -42.329 -11.292 1.00 0.00 ? 220 GLU F CA  1 
ATOM   9853  C C   . GLU F  6  220 ? -45.692 -43.660 -10.670 1.00 0.00 ? 220 GLU F C   1 
ATOM   9854  O O   . GLU F  6  220 ? -46.698 -44.215 -10.241 1.00 0.00 ? 220 GLU F O   1 
ATOM   9855  C CB  . GLU F  6  220 ? -45.278 -41.279 -10.300 1.00 0.00 ? 220 GLU F CB  1 
ATOM   9856  C CG  . GLU F  6  220 ? -45.422 -39.839 -10.820 1.00 0.00 ? 220 GLU F CG  1 
ATOM   9857  C CD  . GLU F  6  220 ? -44.803 -39.691 -12.213 1.00 0.00 ? 220 GLU F CD  1 
ATOM   9858  O OE1 . GLU F  6  220 ? -43.571 -39.915 -12.344 1.00 0.00 ? 220 GLU F OE1 1 
ATOM   9859  O OE2 . GLU F  6  220 ? -45.560 -39.359 -13.166 1.00 0.00 ? 220 GLU F OE2 1 
ATOM   9860  N N   . PHE F  6  221 ? -44.460 -44.232 -10.656 1.00 0.00 ? 221 PHE F N   1 
ATOM   9861  C CA  . PHE F  6  221 ? -44.226 -45.556 -10.150 1.00 0.00 ? 221 PHE F CA  1 
ATOM   9862  C C   . PHE F  6  221 ? -44.648 -45.591 -8.723  1.00 0.00 ? 221 PHE F C   1 
ATOM   9863  O O   . PHE F  6  221 ? -44.366 -44.666 -7.963  1.00 0.00 ? 221 PHE F O   1 
ATOM   9864  C CB  . PHE F  6  221 ? -42.738 -45.946 -10.222 1.00 0.00 ? 221 PHE F CB  1 
ATOM   9865  C CG  . PHE F  6  221 ? -42.579 -47.412 -10.482 1.00 0.00 ? 221 PHE F CG  1 
ATOM   9866  C CD1 . PHE F  6  221 ? -42.686 -48.360 -9.451  1.00 0.00 ? 221 PHE F CD1 1 
ATOM   9867  C CD2 . PHE F  6  221 ? -42.278 -47.844 -11.778 1.00 0.00 ? 221 PHE F CD2 1 
ATOM   9868  C CE1 . PHE F  6  221 ? -42.538 -49.720 -9.719  1.00 0.00 ? 221 PHE F CE1 1 
ATOM   9869  C CE2 . PHE F  6  221 ? -42.124 -49.195 -12.054 1.00 0.00 ? 221 PHE F CE2 1 
ATOM   9870  C CZ  . PHE F  6  221 ? -42.262 -50.134 -11.026 1.00 0.00 ? 221 PHE F CZ  1 
ATOM   9871  N N   . THR F  6  222 ? -45.327 -46.672 -8.320  1.00 0.00 ? 222 THR F N   1 
ATOM   9872  C CA  . THR F  6  222 ? -45.844 -46.701 -6.993  1.00 0.00 ? 222 THR F CA  1 
ATOM   9873  C C   . THR F  6  222 ? -45.918 -48.133 -6.661  1.00 0.00 ? 222 THR F C   1 
ATOM   9874  O O   . THR F  6  222 ? -46.027 -49.000 -7.526  1.00 0.00 ? 222 THR F O   1 
ATOM   9875  C CB  . THR F  6  222 ? -47.213 -46.010 -6.941  1.00 0.00 ? 222 THR F CB  1 
ATOM   9876  O OG1 . THR F  6  222 ? -47.870 -46.139 -5.682  1.00 0.00 ? 222 THR F OG1 1 
ATOM   9877  C CG2 . THR F  6  222 ? -48.125 -46.521 -8.081  1.00 0.00 ? 222 THR F CG2 1 
ATOM   9878  N N   . ILE F  6  223 ? -45.791 -48.370 -5.347  1.00 0.00 ? 223 ILE F N   1 
ATOM   9879  C CA  . ILE F  6  223 ? -45.864 -49.660 -4.765  1.00 0.00 ? 223 ILE F CA  1 
ATOM   9880  C C   . ILE F  6  223 ? -47.241 -49.711 -4.261  1.00 0.00 ? 223 ILE F C   1 
ATOM   9881  O O   . ILE F  6  223 ? -47.576 -49.260 -3.168  1.00 0.00 ? 223 ILE F O   1 
ATOM   9882  C CB  . ILE F  6  223 ? -44.842 -49.890 -3.640  1.00 0.00 ? 223 ILE F CB  1 
ATOM   9883  C CG1 . ILE F  6  223 ? -45.033 -51.225 -2.884  1.00 0.00 ? 223 ILE F CG1 1 
ATOM   9884  C CG2 . ILE F  6  223 ? -44.740 -48.696 -2.660  1.00 0.00 ? 223 ILE F CG2 1 
ATOM   9885  C CD1 . ILE F  6  223 ? -44.791 -52.465 -3.745  1.00 0.00 ? 223 ILE F CD1 1 
ATOM   9886  N N   . TYR F  6  224 ? -48.121 -50.336 -5.078  1.00 0.00 ? 224 TYR F N   1 
ATOM   9887  C CA  . TYR F  6  224 ? -49.352 -50.846 -4.576  1.00 0.00 ? 224 TYR F CA  1 
ATOM   9888  C C   . TYR F  6  224 ? -48.935 -51.921 -3.625  1.00 0.00 ? 224 TYR F C   1 
ATOM   9889  O O   . TYR F  6  224 ? -48.018 -52.694 -3.898  1.00 0.00 ? 224 TYR F O   1 
ATOM   9890  C CB  . TYR F  6  224 ? -50.243 -51.355 -5.708  1.00 0.00 ? 224 TYR F CB  1 
ATOM   9891  C CG  . TYR F  6  224 ? -50.628 -50.276 -6.696  1.00 0.00 ? 224 TYR F CG  1 
ATOM   9892  C CD1 . TYR F  6  224 ? -50.446 -48.899 -6.496  1.00 0.00 ? 224 TYR F CD1 1 
ATOM   9893  C CD2 . TYR F  6  224 ? -51.298 -50.691 -7.859  1.00 0.00 ? 224 TYR F CD2 1 
ATOM   9894  C CE1 . TYR F  6  224 ? -50.949 -47.971 -7.406  1.00 0.00 ? 224 TYR F CE1 1 
ATOM   9895  C CE2 . TYR F  6  224 ? -51.790 -49.759 -8.782  1.00 0.00 ? 224 TYR F CE2 1 
ATOM   9896  C CZ  . TYR F  6  224 ? -51.606 -48.395 -8.555  1.00 0.00 ? 224 TYR F CZ  1 
ATOM   9897  O OH  . TYR F  6  224 ? -52.120 -47.446 -9.460  1.00 0.00 ? 224 TYR F OH  1 
ATOM   9898  N N   . ASP G  7  9   ? -2.047  -72.671 -18.489 1.00 0.00 ? 8   ASP G N   1 
ATOM   9899  C CA  . ASP G  7  9   ? -2.879  -73.834 -18.887 1.00 0.00 ? 8   ASP G CA  1 
ATOM   9900  C C   . ASP G  7  9   ? -4.318  -73.684 -18.500 1.00 0.00 ? 8   ASP G C   1 
ATOM   9901  O O   . ASP G  7  9   ? -5.192  -74.068 -19.275 1.00 0.00 ? 8   ASP G O   1 
ATOM   9902  C CB  . ASP G  7  9   ? -2.264  -75.182 -18.386 1.00 0.00 ? 8   ASP G CB  1 
ATOM   9903  C CG  . ASP G  7  9   ? -1.893  -75.316 -16.900 1.00 0.00 ? 8   ASP G CG  1 
ATOM   9904  O OD1 . ASP G  7  9   ? -2.093  -74.367 -16.102 1.00 0.00 ? 8   ASP G OD1 1 
ATOM   9905  O OD2 . ASP G  7  9   ? -1.375  -76.413 -16.560 1.00 0.00 ? 8   ASP G OD2 1 
ATOM   9906  N N   . LEU G  7  10  ? -4.578  -73.076 -17.310 1.00 0.00 ? 9   LEU G N   1 
ATOM   9907  C CA  . LEU G  7  10  ? -5.879  -72.693 -16.842 1.00 0.00 ? 9   LEU G CA  1 
ATOM   9908  C C   . LEU G  7  10  ? -5.808  -71.256 -16.436 1.00 0.00 ? 9   LEU G C   1 
ATOM   9909  O O   . LEU G  7  10  ? -6.807  -70.559 -16.558 1.00 0.00 ? 9   LEU G O   1 
ATOM   9910  C CB  . LEU G  7  10  ? -6.374  -73.559 -15.655 1.00 0.00 ? 9   LEU G CB  1 
ATOM   9911  C CG  . LEU G  7  10  ? -5.613  -73.467 -14.310 1.00 0.00 ? 9   LEU G CG  1 
ATOM   9912  C CD1 . LEU G  7  10  ? -6.150  -72.388 -13.348 1.00 0.00 ? 9   LEU G CD1 1 
ATOM   9913  C CD2 . LEU G  7  10  ? -5.649  -74.823 -13.588 1.00 0.00 ? 9   LEU G CD2 1 
ATOM   9914  N N   . SER G  7  11  ? -4.624  -70.756 -15.984 1.00 0.00 ? 10  SER G N   1 
ATOM   9915  C CA  . SER G  7  11  ? -4.361  -69.347 -15.731 1.00 0.00 ? 10  SER G CA  1 
ATOM   9916  C C   . SER G  7  11  ? -3.717  -68.779 -16.975 1.00 0.00 ? 10  SER G C   1 
ATOM   9917  O O   . SER G  7  11  ? -2.991  -69.480 -17.675 1.00 0.00 ? 10  SER G O   1 
ATOM   9918  C CB  . SER G  7  11  ? -3.435  -69.125 -14.515 1.00 0.00 ? 10  SER G CB  1 
ATOM   9919  O OG  . SER G  7  11  ? -3.322  -67.748 -14.176 1.00 0.00 ? 10  SER G OG  1 
ATOM   9920  N N   . ALA G  7  12  ? -4.096  -67.537 -17.353 1.00 0.00 ? 11  ALA G N   1 
ATOM   9921  C CA  . ALA G  7  12  ? -3.686  -66.922 -18.594 1.00 0.00 ? 11  ALA G CA  1 
ATOM   9922  C C   . ALA G  7  12  ? -2.220  -66.641 -18.727 1.00 0.00 ? 11  ALA G C   1 
ATOM   9923  O O   . ALA G  7  12  ? -1.673  -66.809 -19.812 1.00 0.00 ? 11  ALA G O   1 
ATOM   9924  C CB  . ALA G  7  12  ? -4.443  -65.624 -18.897 1.00 0.00 ? 11  ALA G CB  1 
ATOM   9925  N N   . SER G  7  13  ? -1.516  -66.213 -17.653 1.00 0.00 ? 12  SER G N   1 
ATOM   9926  C CA  . SER G  7  13  ? -0.114  -65.885 -17.764 1.00 0.00 ? 12  SER G CA  1 
ATOM   9927  C C   . SER G  7  13  ? 0.712   -67.089 -18.131 1.00 0.00 ? 12  SER G C   1 
ATOM   9928  O O   . SER G  7  13  ? 1.581   -67.006 -18.981 1.00 0.00 ? 12  SER G O   1 
ATOM   9929  C CB  . SER G  7  13  ? 0.467   -65.201 -16.498 1.00 0.00 ? 12  SER G CB  1 
ATOM   9930  O OG  . SER G  7  13  ? 0.333   -65.955 -15.304 1.00 0.00 ? 12  SER G OG  1 
ATOM   9931  N N   . THR G  7  14  ? 0.423   -68.271 -17.550 1.00 0.00 ? 13  THR G N   1 
ATOM   9932  C CA  . THR G  7  14  ? 1.140   -69.502 -17.799 1.00 0.00 ? 13  THR G CA  1 
ATOM   9933  C C   . THR G  7  14  ? 1.017   -69.893 -19.242 1.00 0.00 ? 13  THR G C   1 
ATOM   9934  O O   . THR G  7  14  ? -0.009  -69.667 -19.870 1.00 0.00 ? 13  THR G O   1 
ATOM   9935  C CB  . THR G  7  14  ? 0.634   -70.623 -16.895 1.00 0.00 ? 13  THR G CB  1 
ATOM   9936  O OG1 . THR G  7  14  ? 0.854   -70.278 -15.540 1.00 0.00 ? 13  THR G OG1 1 
ATOM   9937  C CG2 . THR G  7  14  ? 1.334   -71.970 -17.138 1.00 0.00 ? 13  THR G CG2 1 
ATOM   9938  N N   . PHE G  7  15  ? 2.088   -70.492 -19.791 1.00 0.00 ? 14  PHE G N   1 
ATOM   9939  C CA  . PHE G  7  15  ? 2.088   -71.111 -21.078 1.00 0.00 ? 14  PHE G CA  1 
ATOM   9940  C C   . PHE G  7  15  ? 2.044   -72.555 -20.758 1.00 0.00 ? 14  PHE G C   1 
ATOM   9941  O O   . PHE G  7  15  ? 2.790   -73.034 -19.910 1.00 0.00 ? 14  PHE G O   1 
ATOM   9942  C CB  . PHE G  7  15  ? 3.394   -70.969 -21.885 1.00 0.00 ? 14  PHE G CB  1 
ATOM   9943  C CG  . PHE G  7  15  ? 3.435   -69.738 -22.699 1.00 0.00 ? 14  PHE G CG  1 
ATOM   9944  C CD1 . PHE G  7  15  ? 2.979   -69.768 -24.021 1.00 0.00 ? 14  PHE G CD1 1 
ATOM   9945  C CD2 . PHE G  7  15  ? 4.046   -68.586 -22.204 1.00 0.00 ? 14  PHE G CD2 1 
ATOM   9946  C CE1 . PHE G  7  15  ? 3.155   -68.660 -24.854 1.00 0.00 ? 14  PHE G CE1 1 
ATOM   9947  C CE2 . PHE G  7  15  ? 4.221   -67.481 -23.031 1.00 0.00 ? 14  PHE G CE2 1 
ATOM   9948  C CZ  . PHE G  7  15  ? 3.791   -67.517 -24.362 1.00 0.00 ? 14  PHE G CZ  1 
ATOM   9949  N N   . SER G  7  16  ? 1.225   -73.297 -21.525 1.00 0.00 ? 15  SER G N   1 
ATOM   9950  C CA  . SER G  7  16  ? 1.328   -74.721 -21.654 1.00 0.00 ? 15  SER G CA  1 
ATOM   9951  C C   . SER G  7  16  ? 2.645   -75.004 -22.335 1.00 0.00 ? 15  SER G C   1 
ATOM   9952  O O   . SER G  7  16  ? 3.050   -74.194 -23.172 1.00 0.00 ? 15  SER G O   1 
ATOM   9953  C CB  . SER G  7  16  ? 0.211   -75.328 -22.516 1.00 0.00 ? 15  SER G CB  1 
ATOM   9954  O OG  . SER G  7  16  ? -1.048  -75.002 -21.957 1.00 0.00 ? 15  SER G OG  1 
ATOM   9955  N N   . PRO G  7  17  ? 3.350   -76.083 -22.006 1.00 0.00 ? 16  PRO G N   1 
ATOM   9956  C CA  . PRO G  7  17  ? 4.623   -76.430 -22.589 1.00 0.00 ? 16  PRO G CA  1 
ATOM   9957  C C   . PRO G  7  17  ? 4.703   -76.395 -24.088 1.00 0.00 ? 16  PRO G C   1 
ATOM   9958  O O   . PRO G  7  17  ? 5.743   -75.991 -24.588 1.00 0.00 ? 16  PRO G O   1 
ATOM   9959  C CB  . PRO G  7  17  ? 4.911   -77.818 -22.044 1.00 0.00 ? 16  PRO G CB  1 
ATOM   9960  C CG  . PRO G  7  17  ? 4.324   -77.758 -20.638 1.00 0.00 ? 16  PRO G CG  1 
ATOM   9961  C CD  . PRO G  7  17  ? 3.075   -76.911 -20.830 1.00 0.00 ? 16  PRO G CD  1 
ATOM   9962  N N   . ASP G  7  18  ? 3.683   -76.879 -24.824 1.00 0.00 ? 17  ASP G N   1 
ATOM   9963  C CA  . ASP G  7  18  ? 3.740   -76.987 -26.264 1.00 0.00 ? 17  ASP G CA  1 
ATOM   9964  C C   . ASP G  7  18  ? 3.929   -75.690 -27.005 1.00 0.00 ? 17  ASP G C   1 
ATOM   9965  O O   . ASP G  7  18  ? 4.752   -75.650 -27.913 1.00 0.00 ? 17  ASP G O   1 
ATOM   9966  C CB  . ASP G  7  18  ? 2.535   -77.762 -26.863 1.00 0.00 ? 17  ASP G CB  1 
ATOM   9967  C CG  . ASP G  7  18  ? 1.198   -77.086 -26.564 1.00 0.00 ? 17  ASP G CG  1 
ATOM   9968  O OD1 . ASP G  7  18  ? 1.196   -76.066 -25.833 1.00 0.00 ? 17  ASP G OD1 1 
ATOM   9969  O OD2 . ASP G  7  18  ? 0.156   -77.589 -27.060 1.00 0.00 ? 17  ASP G OD2 1 
ATOM   9970  N N   . GLY G  7  19  ? 3.277   -74.602 -26.586 1.00 0.00 ? 18  GLY G N   1 
ATOM   9971  C CA  . GLY G  7  19  ? 3.500   -73.314 -27.239 1.00 0.00 ? 18  GLY G CA  1 
ATOM   9972  C C   . GLY G  7  19  ? 2.378   -72.282 -27.281 1.00 0.00 ? 18  GLY G C   1 
ATOM   9973  O O   . GLY G  7  19  ? 2.478   -71.276 -27.983 1.00 0.00 ? 18  GLY G O   1 
ATOM   9974  N N   . ARG G  7  20  ? 1.311   -72.535 -26.532 1.00 0.00 ? 19  ARG G N   1 
ATOM   9975  C CA  . ARG G  7  20  ? 0.139   -71.700 -26.490 1.00 0.00 ? 19  ARG G CA  1 
ATOM   9976  C C   . ARG G  7  20  ? -0.332  -71.540 -25.087 1.00 0.00 ? 19  ARG G C   1 
ATOM   9977  O O   . ARG G  7  20  ? 0.131   -72.256 -24.209 1.00 0.00 ? 19  ARG G O   1 
ATOM   9978  C CB  . ARG G  7  20  ? -0.968  -72.386 -27.306 1.00 0.00 ? 19  ARG G CB  1 
ATOM   9979  C CG  . ARG G  7  20  ? -1.100  -73.881 -27.018 1.00 0.00 ? 19  ARG G CG  1 
ATOM   9980  C CD  . ARG G  7  20  ? -2.083  -74.600 -27.946 1.00 0.00 ? 19  ARG G CD  1 
ATOM   9981  N NE  . ARG G  7  20  ? -1.644  -74.446 -29.369 1.00 0.00 ? 19  ARG G NE  1 
ATOM   9982  C CZ  . ARG G  7  20  ? -0.656  -75.200 -29.943 1.00 0.00 ? 19  ARG G CZ  1 
ATOM   9983  N NH1 . ARG G  7  20  ? -0.085  -76.250 -29.289 1.00 0.00 ? 19  ARG G NH1 1 
ATOM   9984  N NH2 . ARG G  7  20  ? -0.223  -74.887 -31.200 1.00 0.00 ? 19  ARG G NH2 1 
ATOM   9985  N N   . VAL G  7  21  ? -1.308  -70.623 -24.854 1.00 0.00 ? 20  VAL G N   1 
ATOM   9986  C CA  . VAL G  7  21  ? -1.981  -70.441 -23.583 1.00 0.00 ? 20  VAL G CA  1 
ATOM   9987  C C   . VAL G  7  21  ? -3.353  -70.931 -23.878 1.00 0.00 ? 20  VAL G C   1 
ATOM   9988  O O   . VAL G  7  21  ? -4.019  -70.394 -24.758 1.00 0.00 ? 20  VAL G O   1 
ATOM   9989  C CB  . VAL G  7  21  ? -2.141  -68.997 -23.119 1.00 0.00 ? 20  VAL G CB  1 
ATOM   9990  C CG1 . VAL G  7  21  ? -2.906  -68.968 -21.781 1.00 0.00 ? 20  VAL G CG1 1 
ATOM   9991  C CG2 . VAL G  7  21  ? -0.772  -68.303 -22.997 1.00 0.00 ? 20  VAL G CG2 1 
ATOM   9992  N N   . PHE G  7  22  ? -3.784  -72.007 -23.188 1.00 0.00 ? 21  PHE G N   1 
ATOM   9993  C CA  . PHE G  7  22  ? -5.071  -72.638 -23.371 1.00 0.00 ? 21  PHE G CA  1 
ATOM   9994  C C   . PHE G  7  22  ? -6.257  -71.826 -22.945 1.00 0.00 ? 21  PHE G C   1 
ATOM   9995  O O   . PHE G  7  22  ? -7.348  -72.044 -23.452 1.00 0.00 ? 21  PHE G O   1 
ATOM   9996  C CB  . PHE G  7  22  ? -5.126  -74.006 -22.667 1.00 0.00 ? 21  PHE G CB  1 
ATOM   9997  C CG  . PHE G  7  22  ? -4.691  -75.088 -23.618 1.00 0.00 ? 21  PHE G CG  1 
ATOM   9998  C CD1 . PHE G  7  22  ? -3.400  -75.114 -24.166 1.00 0.00 ? 21  PHE G CD1 1 
ATOM   9999  C CD2 . PHE G  7  22  ? -5.590  -76.101 -23.981 1.00 0.00 ? 21  PHE G CD2 1 
ATOM   10000 C CE1 . PHE G  7  22  ? -3.020  -76.124 -25.051 1.00 0.00 ? 21  PHE G CE1 1 
ATOM   10001 C CE2 . PHE G  7  22  ? -5.223  -77.096 -24.889 1.00 0.00 ? 21  PHE G CE2 1 
ATOM   10002 C CZ  . PHE G  7  22  ? -3.937  -77.104 -25.432 1.00 0.00 ? 21  PHE G CZ  1 
ATOM   10003 N N   . GLN G  7  23  ? -6.090  -70.851 -22.028 1.00 0.00 ? 22  GLN G N   1 
ATOM   10004 C CA  . GLN G  7  23  ? -7.124  -69.950 -21.590 1.00 0.00 ? 22  GLN G CA  1 
ATOM   10005 C C   . GLN G  7  23  ? -7.662  -69.171 -22.720 1.00 0.00 ? 22  GLN G C   1 
ATOM   10006 O O   . GLN G  7  23  ? -8.857  -68.980 -22.828 1.00 0.00 ? 22  GLN G O   1 
ATOM   10007 C CB  . GLN G  7  23  ? -6.636  -68.956 -20.536 1.00 0.00 ? 22  GLN G CB  1 
ATOM   10008 C CG  . GLN G  7  23  ? -7.722  -68.047 -19.942 1.00 0.00 ? 22  GLN G CG  1 
ATOM   10009 C CD  . GLN G  7  23  ? -8.761  -68.848 -19.175 1.00 0.00 ? 22  GLN G CD  1 
ATOM   10010 O OE1 . GLN G  7  23  ? -8.406  -69.528 -18.208 1.00 0.00 ? 22  GLN G OE1 1 
ATOM   10011 N NE2 . GLN G  7  23  ? -10.050 -68.766 -19.613 1.00 0.00 ? 22  GLN G NE2 1 
ATOM   10012 N N   . VAL G  7  24  ? -6.793  -68.676 -23.600 1.00 0.00 ? 23  VAL G N   1 
ATOM   10013 C CA  . VAL G  7  24  ? -7.165  -67.847 -24.712 1.00 0.00 ? 23  VAL G CA  1 
ATOM   10014 C C   . VAL G  7  24  ? -8.025  -68.620 -25.663 1.00 0.00 ? 23  VAL G C   1 
ATOM   10015 O O   . VAL G  7  24  ? -8.966  -68.084 -26.229 1.00 0.00 ? 23  VAL G O   1 
ATOM   10016 C CB  . VAL G  7  24  ? -5.938  -67.335 -25.451 1.00 0.00 ? 23  VAL G CB  1 
ATOM   10017 C CG1 . VAL G  7  24  ? -6.340  -66.434 -26.637 1.00 0.00 ? 23  VAL G CG1 1 
ATOM   10018 C CG2 . VAL G  7  24  ? -5.042  -66.576 -24.449 1.00 0.00 ? 23  VAL G CG2 1 
ATOM   10019 N N   . GLU G  7  25  ? -7.720  -69.906 -25.859 1.00 0.00 ? 24  GLU G N   1 
ATOM   10020 C CA  . GLU G  7  25  ? -8.482  -70.784 -26.687 1.00 0.00 ? 24  GLU G CA  1 
ATOM   10021 C C   . GLU G  7  25  ? -9.847  -71.106 -26.156 1.00 0.00 ? 24  GLU G C   1 
ATOM   10022 O O   . GLU G  7  25  ? -10.774 -71.269 -26.935 1.00 0.00 ? 24  GLU G O   1 
ATOM   10023 C CB  . GLU G  7  25  ? -7.739  -72.100 -26.886 1.00 0.00 ? 24  GLU G CB  1 
ATOM   10024 C CG  . GLU G  7  25  ? -6.291  -71.892 -27.348 1.00 0.00 ? 24  GLU G CG  1 
ATOM   10025 C CD  . GLU G  7  25  ? -5.675  -73.272 -27.486 1.00 0.00 ? 24  GLU G CD  1 
ATOM   10026 O OE1 . GLU G  7  25  ? -5.513  -73.945 -26.434 1.00 0.00 ? 24  GLU G OE1 1 
ATOM   10027 O OE2 . GLU G  7  25  ? -5.378  -73.683 -28.640 1.00 0.00 ? 24  GLU G OE2 1 
ATOM   10028 N N   . TYR G  7  26  ? -10.003 -71.216 -24.814 1.00 0.00 ? 25  TYR G N   1 
ATOM   10029 C CA  . TYR G  7  26  ? -11.260 -71.471 -24.134 1.00 0.00 ? 25  TYR G CA  1 
ATOM   10030 C C   . TYR G  7  26  ? -12.182 -70.316 -24.247 1.00 0.00 ? 25  TYR G C   1 
ATOM   10031 O O   . TYR G  7  26  ? -13.391 -70.479 -24.335 1.00 0.00 ? 25  TYR G O   1 
ATOM   10032 C CB  . TYR G  7  26  ? -11.114 -71.714 -22.635 1.00 0.00 ? 25  TYR G CB  1 
ATOM   10033 C CG  . TYR G  7  26  ? -10.254 -72.882 -22.287 1.00 0.00 ? 25  TYR G CG  1 
ATOM   10034 C CD1 . TYR G  7  26  ? -10.005 -73.972 -23.142 1.00 0.00 ? 25  TYR G CD1 1 
ATOM   10035 C CD2 . TYR G  7  26  ? -9.709  -72.891 -20.999 1.00 0.00 ? 25  TYR G CD2 1 
ATOM   10036 C CE1 . TYR G  7  26  ? -9.242  -75.056 -22.696 1.00 0.00 ? 25  TYR G CE1 1 
ATOM   10037 C CE2 . TYR G  7  26  ? -8.975  -73.980 -20.538 1.00 0.00 ? 25  TYR G CE2 1 
ATOM   10038 C CZ  . TYR G  7  26  ? -8.743  -75.069 -21.382 1.00 0.00 ? 25  TYR G CZ  1 
ATOM   10039 O OH  . TYR G  7  26  ? -8.038  -76.188 -20.893 1.00 0.00 ? 25  TYR G OH  1 
ATOM   10040 N N   . ALA G  7  27  ? -11.600 -69.105 -24.240 1.00 0.00 ? 26  ALA G N   1 
ATOM   10041 C CA  . ALA G  7  27  ? -12.272 -67.868 -24.511 1.00 0.00 ? 26  ALA G CA  1 
ATOM   10042 C C   . ALA G  7  27  ? -12.662 -67.739 -25.971 1.00 0.00 ? 26  ALA G C   1 
ATOM   10043 O O   . ALA G  7  27  ? -13.714 -67.208 -26.297 1.00 0.00 ? 26  ALA G O   1 
ATOM   10044 C CB  . ALA G  7  27  ? -11.404 -66.702 -24.060 1.00 0.00 ? 26  ALA G CB  1 
ATOM   10045 N N   . MET G  7  28  ? -11.857 -68.304 -26.893 1.00 0.00 ? 27  MET G N   1 
ATOM   10046 C CA  . MET G  7  28  ? -12.130 -68.405 -28.308 1.00 0.00 ? 27  MET G CA  1 
ATOM   10047 C C   . MET G  7  28  ? -13.263 -69.297 -28.597 1.00 0.00 ? 27  MET G C   1 
ATOM   10048 O O   . MET G  7  28  ? -13.935 -69.068 -29.586 1.00 0.00 ? 27  MET G O   1 
ATOM   10049 C CB  . MET G  7  28  ? -10.956 -68.850 -29.189 1.00 0.00 ? 27  MET G CB  1 
ATOM   10050 C CG  . MET G  7  28  ? -10.098 -67.639 -29.545 1.00 0.00 ? 27  MET G CG  1 
ATOM   10051 S SD  . MET G  7  28  ? -8.611  -68.023 -30.449 1.00 0.00 ? 27  MET G SD  1 
ATOM   10052 C CE  . MET G  7  28  ? -8.415  -66.358 -31.136 1.00 0.00 ? 27  MET G CE  1 
ATOM   10053 N N   . LYS G  7  29  ? -13.460 -70.332 -27.787 1.00 0.00 ? 28  LYS G N   1 
ATOM   10054 C CA  . LYS G  7  29  ? -14.531 -71.304 -28.004 1.00 0.00 ? 28  LYS G CA  1 
ATOM   10055 C C   . LYS G  7  29  ? -15.918 -70.694 -27.865 1.00 0.00 ? 28  LYS G C   1 
ATOM   10056 O O   . LYS G  7  29  ? -16.877 -71.143 -28.492 1.00 0.00 ? 28  LYS G O   1 
ATOM   10057 C CB  . LYS G  7  29  ? -14.381 -72.474 -27.031 1.00 0.00 ? 28  LYS G CB  1 
ATOM   10058 C CG  . LYS G  7  29  ? -15.275 -73.661 -27.340 1.00 0.00 ? 28  LYS G CG  1 
ATOM   10059 C CD  . LYS G  7  29  ? -15.119 -74.749 -26.291 1.00 0.00 ? 28  LYS G CD  1 
ATOM   10060 C CE  . LYS G  7  29  ? -13.657 -75.114 -26.094 1.00 0.00 ? 28  LYS G CE  1 
ATOM   10061 N NZ  . LYS G  7  29  ? -13.029 -75.562 -27.366 1.00 0.00 ? 28  LYS G NZ  1 
ATOM   10062 N N   . ALA G  7  30  ? -16.010 -69.667 -27.033 1.00 0.00 ? 29  ALA G N   1 
ATOM   10063 C CA  . ALA G  7  30  ? -17.249 -68.982 -26.787 1.00 0.00 ? 29  ALA G CA  1 
ATOM   10064 C C   . ALA G  7  30  ? -17.882 -68.435 -28.028 1.00 0.00 ? 29  ALA G C   1 
ATOM   10065 O O   . ALA G  7  30  ? -19.102 -68.454 -28.126 1.00 0.00 ? 29  ALA G O   1 
ATOM   10066 C CB  . ALA G  7  30  ? -17.057 -67.807 -25.827 1.00 0.00 ? 29  ALA G CB  1 
ATOM   10067 N N   . VAL G  7  31  ? -17.100 -67.940 -29.011 1.00 0.00 ? 30  VAL G N   1 
ATOM   10068 C CA  . VAL G  7  31  ? -17.651 -67.439 -30.243 1.00 0.00 ? 30  VAL G CA  1 
ATOM   10069 C C   . VAL G  7  31  ? -17.890 -68.545 -31.216 1.00 0.00 ? 30  VAL G C   1 
ATOM   10070 O O   . VAL G  7  31  ? -18.666 -68.393 -32.155 1.00 0.00 ? 30  VAL G O   1 
ATOM   10071 C CB  . VAL G  7  31  ? -16.810 -66.313 -30.847 1.00 0.00 ? 30  VAL G CB  1 
ATOM   10072 C CG1 . VAL G  7  31  ? -15.346 -66.715 -31.094 1.00 0.00 ? 30  VAL G CG1 1 
ATOM   10073 C CG2 . VAL G  7  31  ? -17.473 -65.725 -32.117 1.00 0.00 ? 30  VAL G CG2 1 
ATOM   10074 N N   . GLU G  7  32  ? -17.306 -69.737 -30.975 1.00 0.00 ? 31  GLU G N   1 
ATOM   10075 C CA  . GLU G  7  32  ? -17.510 -70.888 -31.823 1.00 0.00 ? 31  GLU G CA  1 
ATOM   10076 C C   . GLU G  7  32  ? -18.849 -71.506 -31.561 1.00 0.00 ? 31  GLU G C   1 
ATOM   10077 O O   . GLU G  7  32  ? -19.310 -72.335 -32.339 1.00 0.00 ? 31  GLU G O   1 
ATOM   10078 C CB  . GLU G  7  32  ? -16.435 -71.970 -31.629 1.00 0.00 ? 31  GLU G CB  1 
ATOM   10079 C CG  . GLU G  7  32  ? -14.995 -71.469 -31.807 1.00 0.00 ? 31  GLU G CG  1 
ATOM   10080 C CD  . GLU G  7  32  ? -14.760 -70.882 -33.195 1.00 0.00 ? 31  GLU G CD  1 
ATOM   10081 O OE1 . GLU G  7  32  ? -15.275 -69.767 -33.473 1.00 0.00 ? 31  GLU G OE1 1 
ATOM   10082 O OE2 . GLU G  7  32  ? -14.035 -71.539 -33.992 1.00 0.00 ? 31  GLU G OE2 1 
ATOM   10083 N N   . ASN G  7  33  ? -19.508 -71.069 -30.465 1.00 0.00 ? 32  ASN G N   1 
ATOM   10084 C CA  . ASN G  7  33  ? -20.800 -71.529 -30.061 1.00 0.00 ? 32  ASN G CA  1 
ATOM   10085 C C   . ASN G  7  33  ? -21.862 -70.661 -30.655 1.00 0.00 ? 32  ASN G C   1 
ATOM   10086 O O   . ASN G  7  33  ? -22.766 -71.183 -31.290 1.00 0.00 ? 32  ASN G O   1 
ATOM   10087 C CB  . ASN G  7  33  ? -20.986 -71.467 -28.532 1.00 0.00 ? 32  ASN G CB  1 
ATOM   10088 C CG  . ASN G  7  33  ? -19.929 -72.328 -27.855 1.00 0.00 ? 32  ASN G CG  1 
ATOM   10089 O OD1 . ASN G  7  33  ? -19.373 -73.246 -28.467 1.00 0.00 ? 32  ASN G OD1 1 
ATOM   10090 N ND2 . ASN G  7  33  ? -19.652 -72.017 -26.553 1.00 0.00 ? 32  ASN G ND2 1 
ATOM   10091 N N   . SER G  7  34  ? -21.808 -69.324 -30.412 1.00 0.00 ? 33  SER G N   1 
ATOM   10092 C CA  . SER G  7  34  ? -22.816 -68.360 -30.821 1.00 0.00 ? 33  SER G CA  1 
ATOM   10093 C C   . SER G  7  34  ? -22.993 -68.333 -32.321 1.00 0.00 ? 33  SER G C   1 
ATOM   10094 O O   . SER G  7  34  ? -22.029 -68.492 -33.055 1.00 0.00 ? 33  SER G O   1 
ATOM   10095 C CB  . SER G  7  34  ? -22.466 -66.938 -30.311 1.00 0.00 ? 33  SER G CB  1 
ATOM   10096 O OG  . SER G  7  34  ? -23.463 -65.967 -30.616 1.00 0.00 ? 33  SER G OG  1 
ATOM   10097 N N   . SER G  7  35  ? -24.215 -68.018 -32.755 1.00 0.00 ? 34  SER G N   1 
ATOM   10098 C CA  . SER G  7  35  ? -24.685 -68.128 -34.143 1.00 0.00 ? 34  SER G CA  1 
ATOM   10099 C C   . SER G  7  35  ? -24.046 -67.130 -35.100 1.00 0.00 ? 34  SER G C   1 
ATOM   10100 O O   . SER G  7  35  ? -23.467 -66.138 -34.667 1.00 0.00 ? 34  SER G O   1 
ATOM   10101 C CB  . SER G  7  35  ? -26.207 -67.975 -34.196 1.00 0.00 ? 34  SER G CB  1 
ATOM   10102 O OG  . SER G  7  35  ? -26.595 -66.628 -33.979 1.00 0.00 ? 34  SER G OG  1 
ATOM   10103 N N   . THR G  7  36  ? -24.120 -67.414 -36.400 1.00 0.00 ? 35  THR G N   1 
ATOM   10104 C CA  . THR G  7  36  ? -23.296 -66.729 -37.358 1.00 0.00 ? 35  THR G CA  1 
ATOM   10105 C C   . THR G  7  36  ? -23.752 -65.334 -37.611 1.00 0.00 ? 35  THR G C   1 
ATOM   10106 O O   . THR G  7  36  ? -24.900 -65.068 -37.961 1.00 0.00 ? 35  THR G O   1 
ATOM   10107 C CB  . THR G  7  36  ? -23.187 -67.378 -38.723 1.00 0.00 ? 35  THR G CB  1 
ATOM   10108 O OG1 . THR G  7  36  ? -24.425 -67.934 -39.154 1.00 0.00 ? 35  THR G OG1 1 
ATOM   10109 C CG2 . THR G  7  36  ? -22.085 -68.442 -38.615 1.00 0.00 ? 35  THR G CG2 1 
ATOM   10110 N N   . ALA G  7  37  ? -22.759 -64.438 -37.483 1.00 0.00 ? 36  ALA G N   1 
ATOM   10111 C CA  . ALA G  7  37  ? -22.696 -63.145 -38.068 1.00 0.00 ? 36  ALA G CA  1 
ATOM   10112 C C   . ALA G  7  37  ? -22.067 -63.329 -39.404 1.00 0.00 ? 36  ALA G C   1 
ATOM   10113 O O   . ALA G  7  37  ? -21.294 -64.254 -39.591 1.00 0.00 ? 36  ALA G O   1 
ATOM   10114 C CB  . ALA G  7  37  ? -21.852 -62.199 -37.216 1.00 0.00 ? 36  ALA G CB  1 
ATOM   10115 N N   . ILE G  7  38  ? -22.402 -62.474 -40.383 1.00 0.00 ? 37  ILE G N   1 
ATOM   10116 C CA  . ILE G  7  38  ? -21.763 -62.524 -41.661 1.00 0.00 ? 37  ILE G CA  1 
ATOM   10117 C C   . ILE G  7  38  ? -21.782 -61.147 -42.241 1.00 0.00 ? 37  ILE G C   1 
ATOM   10118 O O   . ILE G  7  38  ? -22.843 -60.632 -42.575 1.00 0.00 ? 37  ILE G O   1 
ATOM   10119 C CB  . ILE G  7  38  ? -22.361 -63.543 -42.624 1.00 0.00 ? 37  ILE G CB  1 
ATOM   10120 C CG1 . ILE G  7  38  ? -21.848 -63.346 -44.066 1.00 0.00 ? 37  ILE G CG1 1 
ATOM   10121 C CG2 . ILE G  7  38  ? -23.893 -63.596 -42.522 1.00 0.00 ? 37  ILE G CG2 1 
ATOM   10122 C CD1 . ILE G  7  38  ? -22.017 -64.589 -44.923 1.00 0.00 ? 37  ILE G CD1 1 
ATOM   10123 N N   . GLY G  7  39  ? -20.592 -60.506 -42.364 1.00 0.00 ? 38  GLY G N   1 
ATOM   10124 C CA  . GLY G  7  39  ? -20.417 -59.275 -43.088 1.00 0.00 ? 38  GLY G CA  1 
ATOM   10125 C C   . GLY G  7  39  ? -19.805 -59.629 -44.383 1.00 0.00 ? 38  GLY G C   1 
ATOM   10126 O O   . GLY G  7  39  ? -19.213 -60.687 -44.495 1.00 0.00 ? 38  GLY G O   1 
ATOM   10127 N N   . ILE G  7  40  ? -19.937 -58.768 -45.404 1.00 0.00 ? 39  ILE G N   1 
ATOM   10128 C CA  . ILE G  7  40  ? -19.421 -59.026 -46.722 1.00 0.00 ? 39  ILE G CA  1 
ATOM   10129 C C   . ILE G  7  40  ? -18.891 -57.734 -47.256 1.00 0.00 ? 39  ILE G C   1 
ATOM   10130 O O   . ILE G  7  40  ? -19.671 -56.825 -47.529 1.00 0.00 ? 39  ILE G O   1 
ATOM   10131 C CB  . ILE G  7  40  ? -20.465 -59.559 -47.692 1.00 0.00 ? 39  ILE G CB  1 
ATOM   10132 C CG1 . ILE G  7  40  ? -21.018 -60.909 -47.196 1.00 0.00 ? 39  ILE G CG1 1 
ATOM   10133 C CG2 . ILE G  7  40  ? -19.832 -59.693 -49.091 1.00 0.00 ? 39  ILE G CG2 1 
ATOM   10134 C CD1 . ILE G  7  40  ? -22.110 -61.513 -48.077 1.00 0.00 ? 39  ILE G CD1 1 
ATOM   10135 N N   . ARG G  7  41  ? -17.556 -57.604 -47.468 1.00 0.00 ? 40  ARG G N   1 
ATOM   10136 C CA  . ARG G  7  41  ? -16.997 -56.485 -48.185 1.00 0.00 ? 40  ARG G CA  1 
ATOM   10137 C C   . ARG G  7  41  ? -17.423 -56.592 -49.606 1.00 0.00 ? 40  ARG G C   1 
ATOM   10138 O O   . ARG G  7  41  ? -17.549 -57.705 -50.106 1.00 0.00 ? 40  ARG G O   1 
ATOM   10139 C CB  . ARG G  7  41  ? -15.462 -56.403 -48.148 1.00 0.00 ? 40  ARG G CB  1 
ATOM   10140 C CG  . ARG G  7  41  ? -14.949 -54.957 -48.232 1.00 0.00 ? 40  ARG G CG  1 
ATOM   10141 C CD  . ARG G  7  41  ? -13.438 -54.842 -48.383 1.00 0.00 ? 40  ARG G CD  1 
ATOM   10142 N NE  . ARG G  7  41  ? -13.094 -55.163 -49.794 1.00 0.00 ? 40  ARG G NE  1 
ATOM   10143 C CZ  . ARG G  7  41  ? -11.799 -55.212 -50.213 1.00 0.00 ? 40  ARG G CZ  1 
ATOM   10144 N NH1 . ARG G  7  41  ? -10.783 -55.116 -49.309 1.00 0.00 ? 40  ARG G NH1 1 
ATOM   10145 N NH2 . ARG G  7  41  ? -11.516 -55.350 -51.540 1.00 0.00 ? 40  ARG G NH2 1 
ATOM   10146 N N   . CYS G  7  42  ? -17.720 -55.434 -50.191 1.00 0.00 ? 41  CYS G N   1 
ATOM   10147 C CA  . CYS G  7  42  ? -18.427 -55.304 -51.454 1.00 0.00 ? 41  CYS G CA  1 
ATOM   10148 C C   . CYS G  7  42  ? -17.987 -54.054 -52.212 1.00 0.00 ? 41  CYS G C   1 
ATOM   10149 O O   . CYS G  7  42  ? -17.354 -53.155 -51.657 1.00 0.00 ? 41  CYS G O   1 
ATOM   10150 C CB  . CYS G  7  42  ? -19.939 -55.272 -51.220 1.00 0.00 ? 41  CYS G CB  1 
ATOM   10151 S SG  . CYS G  7  42  ? -20.926 -55.166 -52.731 1.00 0.00 ? 41  CYS G SG  1 
ATOM   10152 N N   . LYS G  7  43  ? -18.328 -54.025 -53.493 1.00 0.00 ? 42  LYS G N   1 
ATOM   10153 C CA  . LYS G  7  43  ? -17.876 -53.022 -54.439 1.00 0.00 ? 42  LYS G CA  1 
ATOM   10154 C C   . LYS G  7  43  ? -18.041 -51.635 -53.861 1.00 0.00 ? 42  LYS G C   1 
ATOM   10155 O O   . LYS G  7  43  ? -17.452 -50.680 -54.361 1.00 0.00 ? 42  LYS G O   1 
ATOM   10156 C CB  . LYS G  7  43  ? -18.651 -53.104 -55.770 1.00 0.00 ? 42  LYS G CB  1 
ATOM   10157 C CG  . LYS G  7  43  ? -17.978 -52.407 -56.960 1.00 0.00 ? 42  LYS G CG  1 
ATOM   10158 C CD  . LYS G  7  43  ? -18.956 -52.107 -58.105 1.00 0.00 ? 42  LYS G CD  1 
ATOM   10159 C CE  . LYS G  7  43  ? -19.652 -53.347 -58.670 1.00 0.00 ? 42  LYS G CE  1 
ATOM   10160 N NZ  . LYS G  7  43  ? -20.617 -52.989 -59.730 1.00 0.00 ? 42  LYS G NZ  1 
ATOM   10161 N N   . ASP G  7  44  ? -18.996 -51.515 -52.956 1.00 0.00 ? 43  ASP G N   1 
ATOM   10162 C CA  . ASP G  7  44  ? -19.055 -50.436 -52.012 1.00 0.00 ? 43  ASP G CA  1 
ATOM   10163 C C   . ASP G  7  44  ? -19.800 -50.969 -50.810 1.00 0.00 ? 43  ASP G C   1 
ATOM   10164 O O   . ASP G  7  44  ? -20.903 -51.493 -50.941 1.00 0.00 ? 43  ASP G O   1 
ATOM   10165 C CB  . ASP G  7  44  ? -19.789 -49.238 -52.607 1.00 0.00 ? 43  ASP G CB  1 
ATOM   10166 C CG  . ASP G  7  44  ? -21.210 -49.569 -53.002 1.00 0.00 ? 43  ASP G CG  1 
ATOM   10167 O OD1 . ASP G  7  44  ? -21.475 -50.748 -53.315 1.00 0.00 ? 43  ASP G OD1 1 
ATOM   10168 O OD2 . ASP G  7  44  ? -22.060 -48.653 -52.997 1.00 0.00 ? 43  ASP G OD2 1 
ATOM   10169 N N   . GLY G  7  45  ? -19.225 -50.799 -49.634 1.00 0.00 ? 44  GLY G N   1 
ATOM   10170 C CA  . GLY G  7  45  ? -19.953 -51.037 -48.430 1.00 0.00 ? 44  GLY G CA  1 
ATOM   10171 C C   . GLY G  7  45  ? -19.781 -52.415 -47.959 1.00 0.00 ? 44  GLY G C   1 
ATOM   10172 O O   . GLY G  7  45  ? -19.443 -53.323 -48.716 1.00 0.00 ? 44  GLY G O   1 
ATOM   10173 N N   . VAL G  7  46  ? -20.085 -52.581 -46.657 1.00 0.00 ? 45  VAL G N   1 
ATOM   10174 C CA  . VAL G  7  46  ? -20.025 -53.841 -45.999 1.00 0.00 ? 45  VAL G CA  1 
ATOM   10175 C C   . VAL G  7  46  ? -21.378 -54.058 -45.414 1.00 0.00 ? 45  VAL G C   1 
ATOM   10176 O O   . VAL G  7  46  ? -21.749 -53.410 -44.440 1.00 0.00 ? 45  VAL G O   1 
ATOM   10177 C CB  . VAL G  7  46  ? -19.000 -53.857 -44.901 1.00 0.00 ? 45  VAL G CB  1 
ATOM   10178 C CG1 . VAL G  7  46  ? -18.898 -55.265 -44.286 1.00 0.00 ? 45  VAL G CG1 1 
ATOM   10179 C CG2 . VAL G  7  46  ? -17.654 -53.399 -45.495 1.00 0.00 ? 45  VAL G CG2 1 
ATOM   10180 N N   . VAL G  7  47  ? -22.107 -55.070 -45.934 1.00 0.00 ? 46  VAL G N   1 
ATOM   10181 C CA  . VAL G  7  47  ? -23.407 -55.419 -45.428 1.00 0.00 ? 46  VAL G CA  1 
ATOM   10182 C C   . VAL G  7  47  ? -23.147 -56.375 -44.324 1.00 0.00 ? 46  VAL G C   1 
ATOM   10183 O O   . VAL G  7  47  ? -22.854 -57.533 -44.572 1.00 0.00 ? 46  VAL G O   1 
ATOM   10184 C CB  . VAL G  7  47  ? -24.296 -56.086 -46.464 1.00 0.00 ? 46  VAL G CB  1 
ATOM   10185 C CG1 . VAL G  7  47  ? -25.618 -56.638 -45.889 1.00 0.00 ? 46  VAL G CG1 1 
ATOM   10186 C CG2 . VAL G  7  47  ? -24.597 -55.060 -47.569 1.00 0.00 ? 46  VAL G CG2 1 
ATOM   10187 N N   . PHE G  7  48  ? -23.259 -55.920 -43.069 1.00 0.00 ? 47  PHE G N   1 
ATOM   10188 C CA  . PHE G  7  48  ? -23.206 -56.752 -41.902 1.00 0.00 ? 47  PHE G CA  1 
ATOM   10189 C C   . PHE G  7  48  ? -24.512 -57.434 -41.879 1.00 0.00 ? 47  PHE G C   1 
ATOM   10190 O O   . PHE G  7  48  ? -25.457 -56.897 -42.421 1.00 0.00 ? 47  PHE G O   1 
ATOM   10191 C CB  . PHE G  7  48  ? -23.103 -55.995 -40.565 1.00 0.00 ? 47  PHE G CB  1 
ATOM   10192 C CG  . PHE G  7  48  ? -22.033 -54.938 -40.570 1.00 0.00 ? 47  PHE G CG  1 
ATOM   10193 C CD1 . PHE G  7  48  ? -22.173 -53.758 -41.324 1.00 0.00 ? 47  PHE G CD1 1 
ATOM   10194 C CD2 . PHE G  7  48  ? -20.918 -55.060 -39.728 1.00 0.00 ? 47  PHE G CD2 1 
ATOM   10195 C CE1 . PHE G  7  48  ? -21.233 -52.734 -41.247 1.00 0.00 ? 47  PHE G CE1 1 
ATOM   10196 C CE2 . PHE G  7  48  ? -19.977 -54.034 -39.645 1.00 0.00 ? 47  PHE G CE2 1 
ATOM   10197 C CZ  . PHE G  7  48  ? -20.133 -52.877 -40.407 1.00 0.00 ? 47  PHE G CZ  1 
ATOM   10198 N N   . GLY G  7  49  ? -24.551 -58.667 -41.428 1.00 0.00 ? 48  GLY G N   1 
ATOM   10199 C CA  . GLY G  7  49  ? -25.811 -59.324 -41.212 1.00 0.00 ? 48  GLY G CA  1 
ATOM   10200 C C   . GLY G  7  49  ? -25.521 -60.183 -40.026 1.00 0.00 ? 48  GLY G C   1 
ATOM   10201 O O   . GLY G  7  49  ? -24.435 -60.743 -39.939 1.00 0.00 ? 48  GLY G O   1 
ATOM   10202 N N   . VAL G  7  50  ? -26.463 -60.322 -39.115 1.00 0.00 ? 49  VAL G N   1 
ATOM   10203 C CA  . VAL G  7  50  ? -26.254 -61.342 -38.138 1.00 0.00 ? 49  VAL G CA  1 
ATOM   10204 C C   . VAL G  7  50  ? -27.535 -61.966 -37.788 1.00 0.00 ? 49  VAL G C   1 
ATOM   10205 O O   . VAL G  7  50  ? -28.345 -61.391 -37.071 1.00 0.00 ? 49  VAL G O   1 
ATOM   10206 C CB  . VAL G  7  50  ? -25.707 -60.802 -36.851 1.00 0.00 ? 49  VAL G CB  1 
ATOM   10207 C CG1 . VAL G  7  50  ? -25.375 -61.983 -35.913 1.00 0.00 ? 49  VAL G CG1 1 
ATOM   10208 C CG2 . VAL G  7  50  ? -24.494 -59.917 -37.189 1.00 0.00 ? 49  VAL G CG2 1 
ATOM   10209 N N   . GLU G  7  51  ? -27.700 -63.241 -38.187 1.00 0.00 ? 50  GLU G N   1 
ATOM   10210 C CA  . GLU G  7  51  ? -28.790 -64.052 -37.735 1.00 0.00 ? 50  GLU G CA  1 
ATOM   10211 C C   . GLU G  7  51  ? -28.524 -64.360 -36.314 1.00 0.00 ? 50  GLU G C   1 
ATOM   10212 O O   . GLU G  7  51  ? -27.381 -64.539 -35.904 1.00 0.00 ? 50  GLU G O   1 
ATOM   10213 C CB  . GLU G  7  51  ? -28.925 -65.332 -38.550 1.00 0.00 ? 50  GLU G CB  1 
ATOM   10214 C CG  . GLU G  7  51  ? -29.793 -66.468 -37.989 1.00 0.00 ? 50  GLU G CG  1 
ATOM   10215 C CD  . GLU G  7  51  ? -28.977 -67.406 -37.122 1.00 0.00 ? 50  GLU G CD  1 
ATOM   10216 O OE1 . GLU G  7  51  ? -27.976 -67.965 -37.632 1.00 0.00 ? 50  GLU G OE1 1 
ATOM   10217 O OE2 . GLU G  7  51  ? -29.344 -67.586 -35.936 1.00 0.00 ? 50  GLU G OE2 1 
ATOM   10218 N N   . LEU G  7  67  ? -25.651 -55.642 -34.210 1.00 0.00 ? 66  LEU G N   1 
ATOM   10219 C CA  . LEU G  7  67  ? -25.219 -54.450 -34.869 1.00 0.00 ? 66  LEU G CA  1 
ATOM   10220 C C   . LEU G  7  67  ? -24.984 -53.410 -33.829 1.00 0.00 ? 66  LEU G C   1 
ATOM   10221 O O   . LEU G  7  67  ? -25.763 -53.309 -32.894 1.00 0.00 ? 66  LEU G O   1 
ATOM   10222 C CB  . LEU G  7  67  ? -26.317 -53.954 -35.822 1.00 0.00 ? 66  LEU G CB  1 
ATOM   10223 C CG  . LEU G  7  67  ? -26.522 -54.765 -37.128 1.00 0.00 ? 66  LEU G CG  1 
ATOM   10224 C CD1 . LEU G  7  67  ? -26.537 -56.301 -37.004 1.00 0.00 ? 66  LEU G CD1 1 
ATOM   10225 C CD2 . LEU G  7  67  ? -27.814 -54.302 -37.822 1.00 0.00 ? 66  LEU G CD2 1 
ATOM   10226 N N   . PHE G  7  68  ? -23.931 -52.596 -33.958 1.00 0.00 ? 67  PHE G N   1 
ATOM   10227 C CA  . PHE G  7  68  ? -23.714 -51.489 -33.074 1.00 0.00 ? 67  PHE G CA  1 
ATOM   10228 C C   . PHE G  7  68  ? -23.205 -50.387 -33.915 1.00 0.00 ? 67  PHE G C   1 
ATOM   10229 O O   . PHE G  7  68  ? -22.331 -50.598 -34.738 1.00 0.00 ? 67  PHE G O   1 
ATOM   10230 C CB  . PHE G  7  68  ? -22.696 -51.717 -31.932 1.00 0.00 ? 67  PHE G CB  1 
ATOM   10231 C CG  . PHE G  7  68  ? -23.233 -52.721 -30.964 1.00 0.00 ? 67  PHE G CG  1 
ATOM   10232 C CD1 . PHE G  7  68  ? -24.360 -52.420 -30.184 1.00 0.00 ? 67  PHE G CD1 1 
ATOM   10233 C CD2 . PHE G  7  68  ? -22.668 -53.999 -30.866 1.00 0.00 ? 67  PHE G CD2 1 
ATOM   10234 C CE1 . PHE G  7  68  ? -24.945 -53.395 -29.363 1.00 0.00 ? 67  PHE G CE1 1 
ATOM   10235 C CE2 . PHE G  7  68  ? -23.246 -54.973 -30.040 1.00 0.00 ? 67  PHE G CE2 1 
ATOM   10236 C CZ  . PHE G  7  68  ? -24.396 -54.683 -29.300 1.00 0.00 ? 67  PHE G CZ  1 
ATOM   10237 N N   . ASN G  7  69  ? -23.659 -49.158 -33.632 1.00 0.00 ? 68  ASN G N   1 
ATOM   10238 C CA  . ASN G  7  69  ? -23.207 -47.935 -34.222 1.00 0.00 ? 68  ASN G CA  1 
ATOM   10239 C C   . ASN G  7  69  ? -22.047 -47.540 -33.389 1.00 0.00 ? 68  ASN G C   1 
ATOM   10240 O O   . ASN G  7  69  ? -22.180 -46.764 -32.447 1.00 0.00 ? 68  ASN G O   1 
ATOM   10241 C CB  . ASN G  7  69  ? -24.192 -46.756 -34.194 1.00 0.00 ? 68  ASN G CB  1 
ATOM   10242 C CG  . ASN G  7  69  ? -24.903 -46.639 -35.533 1.00 0.00 ? 68  ASN G CG  1 
ATOM   10243 O OD1 . ASN G  7  69  ? -25.667 -47.528 -35.914 1.00 0.00 ? 68  ASN G OD1 1 
ATOM   10244 N ND2 . ASN G  7  69  ? -24.641 -45.504 -36.253 1.00 0.00 ? 68  ASN G ND2 1 
ATOM   10245 N N   . VAL G  7  70  ? -20.863 -48.093 -33.723 1.00 0.00 ? 69  VAL G N   1 
ATOM   10246 C CA  . VAL G  7  70  ? -19.583 -47.835 -33.105 1.00 0.00 ? 69  VAL G CA  1 
ATOM   10247 C C   . VAL G  7  70  ? -19.253 -46.383 -33.213 1.00 0.00 ? 69  VAL G C   1 
ATOM   10248 O O   . VAL G  7  70  ? -18.701 -45.769 -32.316 1.00 0.00 ? 69  VAL G O   1 
ATOM   10249 C CB  . VAL G  7  70  ? -18.539 -48.665 -33.801 1.00 0.00 ? 69  VAL G CB  1 
ATOM   10250 C CG1 . VAL G  7  70  ? -17.099 -48.160 -33.626 1.00 0.00 ? 69  VAL G CG1 1 
ATOM   10251 C CG2 . VAL G  7  70  ? -18.703 -50.067 -33.224 1.00 0.00 ? 69  VAL G CG2 1 
ATOM   10252 N N   . ASP G  7  71  ? -19.647 -45.796 -34.332 1.00 0.00 ? 70  ASP G N   1 
ATOM   10253 C CA  . ASP G  7  71  ? -19.458 -44.426 -34.626 1.00 0.00 ? 70  ASP G CA  1 
ATOM   10254 C C   . ASP G  7  71  ? -20.536 -44.279 -35.633 1.00 0.00 ? 70  ASP G C   1 
ATOM   10255 O O   . ASP G  7  71  ? -21.152 -45.250 -36.054 1.00 0.00 ? 70  ASP G O   1 
ATOM   10256 C CB  . ASP G  7  71  ? -18.062 -44.205 -35.246 1.00 0.00 ? 70  ASP G CB  1 
ATOM   10257 C CG  . ASP G  7  71  ? -17.656 -42.751 -35.440 1.00 0.00 ? 70  ASP G CG  1 
ATOM   10258 O OD1 . ASP G  7  71  ? -18.261 -41.857 -34.795 1.00 0.00 ? 70  ASP G OD1 1 
ATOM   10259 O OD2 . ASP G  7  71  ? -16.708 -42.531 -36.242 1.00 0.00 ? 70  ASP G OD2 1 
ATOM   10260 N N   . ARG G  7  72  ? -20.793 -43.074 -36.116 1.00 0.00 ? 71  ARG G N   1 
ATOM   10261 C CA  . ARG G  7  72  ? -21.666 -42.903 -37.236 1.00 0.00 ? 71  ARG G CA  1 
ATOM   10262 C C   . ARG G  7  72  ? -21.049 -43.522 -38.476 1.00 0.00 ? 71  ARG G C   1 
ATOM   10263 O O   . ARG G  7  72  ? -21.761 -43.995 -39.344 1.00 0.00 ? 71  ARG G O   1 
ATOM   10264 C CB  . ARG G  7  72  ? -21.960 -41.413 -37.467 1.00 0.00 ? 71  ARG G CB  1 
ATOM   10265 C CG  . ARG G  7  72  ? -20.727 -40.509 -37.316 1.00 0.00 ? 71  ARG G CG  1 
ATOM   10266 C CD  . ARG G  7  72  ? -20.987 -39.088 -37.816 1.00 0.00 ? 71  ARG G CD  1 
ATOM   10267 N NE  . ARG G  7  72  ? -19.699 -38.322 -37.862 1.00 0.00 ? 71  ARG G NE  1 
ATOM   10268 C CZ  . ARG G  7  72  ? -18.784 -38.451 -38.871 1.00 0.00 ? 71  ARG G CZ  1 
ATOM   10269 N NH1 . ARG G  7  72  ? -18.951 -39.362 -39.871 1.00 0.00 ? 71  ARG G NH1 1 
ATOM   10270 N NH2 . ARG G  7  72  ? -17.681 -37.646 -38.875 1.00 0.00 ? 71  ARG G NH2 1 
ATOM   10271 N N   . HIS G  7  73  ? -19.708 -43.450 -38.594 1.00 0.00 ? 72  HIS G N   1 
ATOM   10272 C CA  . HIS G  7  73  ? -18.850 -43.972 -39.624 1.00 0.00 ? 72  HIS G CA  1 
ATOM   10273 C C   . HIS G  7  73  ? -18.755 -45.468 -39.689 1.00 0.00 ? 72  HIS G C   1 
ATOM   10274 O O   . HIS G  7  73  ? -18.617 -46.031 -40.772 1.00 0.00 ? 72  HIS G O   1 
ATOM   10275 C CB  . HIS G  7  73  ? -17.449 -43.395 -39.377 1.00 0.00 ? 72  HIS G CB  1 
ATOM   10276 C CG  . HIS G  7  73  ? -16.423 -43.637 -40.442 1.00 0.00 ? 72  HIS G CG  1 
ATOM   10277 N ND1 . HIS G  7  73  ? -15.077 -43.780 -40.189 1.00 0.00 ? 72  HIS G ND1 1 
ATOM   10278 C CD2 . HIS G  7  73  ? -16.549 -43.636 -41.791 1.00 0.00 ? 72  HIS G CD2 1 
ATOM   10279 C CE1 . HIS G  7  73  ? -14.465 -43.859 -41.391 1.00 0.00 ? 72  HIS G CE1 1 
ATOM   10280 N NE2 . HIS G  7  73  ? -15.314 -43.769 -42.387 1.00 0.00 ? 72  HIS G NE2 1 
ATOM   10281 N N   . VAL G  7  74  ? -18.783 -46.130 -38.514 1.00 0.00 ? 73  VAL G N   1 
ATOM   10282 C CA  . VAL G  7  74  ? -18.340 -47.488 -38.345 1.00 0.00 ? 73  VAL G CA  1 
ATOM   10283 C C   . VAL G  7  74  ? -19.487 -48.285 -37.809 1.00 0.00 ? 73  VAL G C   1 
ATOM   10284 O O   . VAL G  7  74  ? -20.193 -47.833 -36.914 1.00 0.00 ? 73  VAL G O   1 
ATOM   10285 C CB  . VAL G  7  74  ? -17.212 -47.615 -37.335 1.00 0.00 ? 73  VAL G CB  1 
ATOM   10286 C CG1 . VAL G  7  74  ? -16.653 -49.057 -37.325 1.00 0.00 ? 73  VAL G CG1 1 
ATOM   10287 C CG2 . VAL G  7  74  ? -16.113 -46.564 -37.591 1.00 0.00 ? 73  VAL G CG2 1 
ATOM   10288 N N   . GLY G  7  75  ? -19.657 -49.520 -38.324 1.00 0.00 ? 74  GLY G N   1 
ATOM   10289 C CA  . GLY G  7  75  ? -20.609 -50.472 -37.817 1.00 0.00 ? 74  GLY G CA  1 
ATOM   10290 C C   . GLY G  7  75  ? -19.846 -51.614 -37.260 1.00 0.00 ? 74  GLY G C   1 
ATOM   10291 O O   . GLY G  7  75  ? -18.697 -51.793 -37.632 1.00 0.00 ? 74  GLY G O   1 
ATOM   10292 N N   . MET G  7  76  ? -20.472 -52.413 -36.369 1.00 0.00 ? 75  MET G N   1 
ATOM   10293 C CA  . MET G  7  76  ? -19.875 -53.553 -35.720 1.00 0.00 ? 75  MET G CA  1 
ATOM   10294 C C   . MET G  7  76  ? -20.893 -54.642 -35.728 1.00 0.00 ? 75  MET G C   1 
ATOM   10295 O O   . MET G  7  76  ? -22.050 -54.357 -35.483 1.00 0.00 ? 75  MET G O   1 
ATOM   10296 C CB  . MET G  7  76  ? -19.466 -53.233 -34.276 1.00 0.00 ? 75  MET G CB  1 
ATOM   10297 C CG  . MET G  7  76  ? -18.835 -54.380 -33.491 1.00 0.00 ? 75  MET G CG  1 
ATOM   10298 S SD  . MET G  7  76  ? -18.512 -54.035 -31.733 1.00 0.00 ? 75  MET G SD  1 
ATOM   10299 C CE  . MET G  7  76  ? -16.998 -53.042 -31.875 1.00 0.00 ? 75  MET G CE  1 
ATOM   10300 N N   . ALA G  7  77  ? -20.520 -55.913 -35.989 1.00 0.00 ? 76  ALA G N   1 
ATOM   10301 C CA  . ALA G  7  77  ? -21.392 -57.052 -35.839 1.00 0.00 ? 76  ALA G CA  1 
ATOM   10302 C C   . ALA G  7  77  ? -20.759 -58.059 -34.936 1.00 0.00 ? 76  ALA G C   1 
ATOM   10303 O O   . ALA G  7  77  ? -19.869 -58.783 -35.358 1.00 0.00 ? 76  ALA G O   1 
ATOM   10304 C CB  . ALA G  7  77  ? -21.750 -57.726 -37.158 1.00 0.00 ? 76  ALA G CB  1 
ATOM   10305 N N   . VAL G  7  78  ? -21.192 -58.127 -33.662 1.00 0.00 ? 77  VAL G N   1 
ATOM   10306 C CA  . VAL G  7  78  ? -20.642 -59.007 -32.661 1.00 0.00 ? 77  VAL G CA  1 
ATOM   10307 C C   . VAL G  7  78  ? -21.080 -60.442 -32.757 1.00 0.00 ? 77  VAL G C   1 
ATOM   10308 O O   . VAL G  7  78  ? -22.107 -60.795 -33.328 1.00 0.00 ? 77  VAL G O   1 
ATOM   10309 C CB  . VAL G  7  78  ? -20.873 -58.519 -31.246 1.00 0.00 ? 77  VAL G CB  1 
ATOM   10310 C CG1 . VAL G  7  78  ? -20.472 -57.038 -31.192 1.00 0.00 ? 77  VAL G CG1 1 
ATOM   10311 C CG2 . VAL G  7  78  ? -22.329 -58.717 -30.781 1.00 0.00 ? 77  VAL G CG2 1 
ATOM   10312 N N   . ALA G  7  79  ? -20.225 -61.322 -32.228 1.00 0.00 ? 78  ALA G N   1 
ATOM   10313 C CA  . ALA G  7  79  ? -20.446 -62.732 -32.119 1.00 0.00 ? 78  ALA G CA  1 
ATOM   10314 C C   . ALA G  7  79  ? -19.650 -63.123 -30.920 1.00 0.00 ? 78  ALA G C   1 
ATOM   10315 O O   . ALA G  7  79  ? -18.715 -62.422 -30.562 1.00 0.00 ? 78  ALA G O   1 
ATOM   10316 C CB  . ALA G  7  79  ? -19.977 -63.544 -33.337 1.00 0.00 ? 78  ALA G CB  1 
ATOM   10317 N N   . GLY G  7  80  ? -19.976 -64.254 -30.267 1.00 0.00 ? 79  GLY G N   1 
ATOM   10318 C CA  . GLY G  7  80  ? -19.474 -64.580 -28.958 1.00 0.00 ? 79  GLY G CA  1 
ATOM   10319 C C   . GLY G  7  80  ? -20.319 -63.922 -27.965 1.00 0.00 ? 79  GLY G C   1 
ATOM   10320 O O   . GLY G  7  80  ? -21.189 -63.152 -28.341 1.00 0.00 ? 79  GLY G O   1 
ATOM   10321 N N   . LEU G  7  81  ? -20.195 -64.326 -26.683 1.00 0.00 ? 80  LEU G N   1 
ATOM   10322 C CA  . LEU G  7  81  ? -21.139 -63.919 -25.680 1.00 0.00 ? 80  LEU G CA  1 
ATOM   10323 C C   . LEU G  7  81  ? -21.312 -62.438 -25.567 1.00 0.00 ? 80  LEU G C   1 
ATOM   10324 O O   . LEU G  7  81  ? -20.359 -61.666 -25.632 1.00 0.00 ? 80  LEU G O   1 
ATOM   10325 C CB  . LEU G  7  81  ? -20.907 -64.596 -24.317 1.00 0.00 ? 80  LEU G CB  1 
ATOM   10326 C CG  . LEU G  7  81  ? -19.594 -64.292 -23.570 1.00 0.00 ? 80  LEU G CG  1 
ATOM   10327 C CD1 . LEU G  7  81  ? -19.703 -63.076 -22.631 1.00 0.00 ? 80  LEU G CD1 1 
ATOM   10328 C CD2 . LEU G  7  81  ? -19.168 -65.526 -22.753 1.00 0.00 ? 80  LEU G CD2 1 
ATOM   10329 N N   . LEU G  7  82  ? -22.606 -62.038 -25.554 1.00 0.00 ? 81  LEU G N   1 
ATOM   10330 C CA  . LEU G  7  82  ? -23.052 -60.699 -25.844 1.00 0.00 ? 81  LEU G CA  1 
ATOM   10331 C C   . LEU G  7  82  ? -22.709 -59.748 -24.769 1.00 0.00 ? 81  LEU G C   1 
ATOM   10332 O O   . LEU G  7  82  ? -22.644 -58.557 -25.027 1.00 0.00 ? 81  LEU G O   1 
ATOM   10333 C CB  . LEU G  7  82  ? -24.586 -60.588 -26.040 1.00 0.00 ? 81  LEU G CB  1 
ATOM   10334 C CG  . LEU G  7  82  ? -25.217 -61.660 -26.957 1.00 0.00 ? 81  LEU G CG  1 
ATOM   10335 C CD1 . LEU G  7  82  ? -26.736 -61.428 -27.093 1.00 0.00 ? 81  LEU G CD1 1 
ATOM   10336 C CD2 . LEU G  7  82  ? -24.563 -61.742 -28.345 1.00 0.00 ? 81  LEU G CD2 1 
ATOM   10337 N N   . ALA G  7  83  ? -22.503 -60.241 -23.538 1.00 0.00 ? 82  ALA G N   1 
ATOM   10338 C CA  . ALA G  7  83  ? -22.358 -59.424 -22.367 1.00 0.00 ? 82  ALA G CA  1 
ATOM   10339 C C   . ALA G  7  83  ? -21.133 -58.559 -22.465 1.00 0.00 ? 82  ALA G C   1 
ATOM   10340 O O   . ALA G  7  83  ? -21.167 -57.338 -22.305 1.00 0.00 ? 82  ALA G O   1 
ATOM   10341 C CB  . ALA G  7  83  ? -22.236 -60.323 -21.133 1.00 0.00 ? 82  ALA G CB  1 
ATOM   10342 N N   . ASP G  7  84  ? -20.016 -59.243 -22.756 1.00 0.00 ? 83  ASP G N   1 
ATOM   10343 C CA  . ASP G  7  84  ? -18.686 -58.757 -22.992 1.00 0.00 ? 83  ASP G CA  1 
ATOM   10344 C C   . ASP G  7  84  ? -18.583 -57.943 -24.266 1.00 0.00 ? 83  ASP G C   1 
ATOM   10345 O O   . ASP G  7  84  ? -17.733 -57.063 -24.396 1.00 0.00 ? 83  ASP G O   1 
ATOM   10346 C CB  . ASP G  7  84  ? -17.817 -60.035 -23.024 1.00 0.00 ? 83  ASP G CB  1 
ATOM   10347 C CG  . ASP G  7  84  ? -16.323 -59.808 -23.135 1.00 0.00 ? 83  ASP G CG  1 
ATOM   10348 O OD1 . ASP G  7  84  ? -15.778 -58.963 -22.377 1.00 0.00 ? 83  ASP G OD1 1 
ATOM   10349 O OD2 . ASP G  7  84  ? -15.707 -60.511 -23.976 1.00 0.00 ? 83  ASP G OD2 1 
ATOM   10350 N N   . ALA G  7  85  ? -19.419 -58.276 -25.270 1.00 0.00 ? 84  ALA G N   1 
ATOM   10351 C CA  . ALA G  7  85  ? -19.388 -57.686 -26.581 1.00 0.00 ? 84  ALA G CA  1 
ATOM   10352 C C   . ALA G  7  85  ? -19.756 -56.239 -26.595 1.00 0.00 ? 84  ALA G C   1 
ATOM   10353 O O   . ALA G  7  85  ? -19.181 -55.439 -27.331 1.00 0.00 ? 84  ALA G O   1 
ATOM   10354 C CB  . ALA G  7  85  ? -20.339 -58.443 -27.513 1.00 0.00 ? 84  ALA G CB  1 
ATOM   10355 N N   . ARG G  7  86  ? -20.713 -55.872 -25.732 1.00 0.00 ? 85  ARG G N   1 
ATOM   10356 C CA  . ARG G  7  86  ? -21.147 -54.522 -25.537 1.00 0.00 ? 85  ARG G CA  1 
ATOM   10357 C C   . ARG G  7  86  ? -20.061 -53.647 -24.966 1.00 0.00 ? 85  ARG G C   1 
ATOM   10358 O O   . ARG G  7  86  ? -19.958 -52.488 -25.348 1.00 0.00 ? 85  ARG G O   1 
ATOM   10359 C CB  . ARG G  7  86  ? -22.440 -54.446 -24.720 1.00 0.00 ? 85  ARG G CB  1 
ATOM   10360 C CG  . ARG G  7  86  ? -23.564 -55.185 -25.459 1.00 0.00 ? 85  ARG G CG  1 
ATOM   10361 C CD  . ARG G  7  86  ? -24.951 -54.892 -24.880 1.00 0.00 ? 85  ARG G CD  1 
ATOM   10362 N NE  . ARG G  7  86  ? -25.859 -56.055 -25.177 1.00 0.00 ? 85  ARG G NE  1 
ATOM   10363 C CZ  . ARG G  7  86  ? -26.083 -57.060 -24.278 1.00 0.00 ? 85  ARG G CZ  1 
ATOM   10364 N NH1 . ARG G  7  86  ? -25.654 -56.958 -22.990 1.00 0.00 ? 85  ARG G NH1 1 
ATOM   10365 N NH2 . ARG G  7  86  ? -26.742 -58.182 -24.677 1.00 0.00 ? 85  ARG G NH2 1 
ATOM   10366 N N   . SER G  7  87  ? -19.195 -54.174 -24.063 1.00 0.00 ? 86  SER G N   1 
ATOM   10367 C CA  . SER G  7  87  ? -18.126 -53.388 -23.492 1.00 0.00 ? 86  SER G CA  1 
ATOM   10368 C C   . SER G  7  87  ? -17.114 -53.010 -24.540 1.00 0.00 ? 86  SER G C   1 
ATOM   10369 O O   . SER G  7  87  ? -16.664 -51.873 -24.587 1.00 0.00 ? 86  SER G O   1 
ATOM   10370 C CB  . SER G  7  87  ? -17.406 -54.081 -22.315 1.00 0.00 ? 86  SER G CB  1 
ATOM   10371 O OG  . SER G  7  87  ? -16.656 -55.230 -22.683 1.00 0.00 ? 86  SER G OG  1 
ATOM   10372 N N   . LEU G  7  88  ? -16.791 -53.947 -25.455 1.00 0.00 ? 87  LEU G N   1 
ATOM   10373 C CA  . LEU G  7  88  ? -15.932 -53.671 -26.582 1.00 0.00 ? 87  LEU G CA  1 
ATOM   10374 C C   . LEU G  7  88  ? -16.554 -52.718 -27.547 1.00 0.00 ? 87  LEU G C   1 
ATOM   10375 O O   . LEU G  7  88  ? -15.839 -51.951 -28.185 1.00 0.00 ? 87  LEU G O   1 
ATOM   10376 C CB  . LEU G  7  88  ? -15.595 -54.930 -27.384 1.00 0.00 ? 87  LEU G CB  1 
ATOM   10377 C CG  . LEU G  7  88  ? -14.687 -55.900 -26.618 1.00 0.00 ? 87  LEU G CG  1 
ATOM   10378 C CD1 . LEU G  7  88  ? -14.736 -57.290 -27.257 1.00 0.00 ? 87  LEU G CD1 1 
ATOM   10379 C CD2 . LEU G  7  88  ? -13.252 -55.347 -26.554 1.00 0.00 ? 87  LEU G CD2 1 
ATOM   10380 N N   . ALA G  7  89  ? -17.897 -52.721 -27.682 1.00 0.00 ? 88  ALA G N   1 
ATOM   10381 C CA  . ALA G  7  89  ? -18.612 -51.765 -28.506 1.00 0.00 ? 88  ALA G CA  1 
ATOM   10382 C C   . ALA G  7  89  ? -18.444 -50.375 -27.969 1.00 0.00 ? 88  ALA G C   1 
ATOM   10383 O O   . ALA G  7  89  ? -18.117 -49.477 -28.729 1.00 0.00 ? 88  ALA G O   1 
ATOM   10384 C CB  . ALA G  7  89  ? -20.118 -52.062 -28.645 1.00 0.00 ? 88  ALA G CB  1 
ATOM   10385 N N   . ASP G  7  90  ? -18.620 -50.193 -26.641 1.00 0.00 ? 89  ASP G N   1 
ATOM   10386 C CA  . ASP G  7  90  ? -18.508 -48.942 -25.932 1.00 0.00 ? 89  ASP G CA  1 
ATOM   10387 C C   . ASP G  7  90  ? -17.120 -48.395 -25.937 1.00 0.00 ? 89  ASP G C   1 
ATOM   10388 O O   . ASP G  7  90  ? -16.941 -47.180 -26.022 1.00 0.00 ? 89  ASP G O   1 
ATOM   10389 C CB  . ASP G  7  90  ? -19.031 -49.008 -24.484 1.00 0.00 ? 89  ASP G CB  1 
ATOM   10390 C CG  . ASP G  7  90  ? -20.566 -49.030 -24.523 1.00 0.00 ? 89  ASP G CG  1 
ATOM   10391 O OD1 . ASP G  7  90  ? -21.166 -48.066 -25.081 1.00 0.00 ? 89  ASP G OD1 1 
ATOM   10392 O OD2 . ASP G  7  90  ? -21.155 -50.010 -23.996 1.00 0.00 ? 89  ASP G OD2 1 
ATOM   10393 N N   . ILE G  7  91  ? -16.095 -49.275 -25.887 1.00 0.00 ? 90  ILE G N   1 
ATOM   10394 C CA  . ILE G  7  91  ? -14.707 -48.886 -25.960 1.00 0.00 ? 90  ILE G CA  1 
ATOM   10395 C C   . ILE G  7  91  ? -14.423 -48.420 -27.338 1.00 0.00 ? 90  ILE G C   1 
ATOM   10396 O O   . ILE G  7  91  ? -13.710 -47.448 -27.495 1.00 0.00 ? 90  ILE G O   1 
ATOM   10397 C CB  . ILE G  7  91  ? -13.772 -50.018 -25.568 1.00 0.00 ? 90  ILE G CB  1 
ATOM   10398 C CG1 . ILE G  7  91  ? -13.792 -50.222 -24.034 1.00 0.00 ? 90  ILE G CG1 1 
ATOM   10399 C CG2 . ILE G  7  91  ? -12.322 -49.810 -26.060 1.00 0.00 ? 90  ILE G CG2 1 
ATOM   10400 C CD1 . ILE G  7  91  ? -13.294 -49.039 -23.199 1.00 0.00 ? 90  ILE G CD1 1 
ATOM   10401 N N   . ALA G  7  92  ? -14.964 -49.079 -28.377 1.00 0.00 ? 91  ALA G N   1 
ATOM   10402 C CA  . ALA G  7  92  ? -14.804 -48.663 -29.745 1.00 0.00 ? 91  ALA G CA  1 
ATOM   10403 C C   . ALA G  7  92  ? -15.442 -47.325 -30.043 1.00 0.00 ? 91  ALA G C   1 
ATOM   10404 O O   . ALA G  7  92  ? -14.878 -46.536 -30.792 1.00 0.00 ? 91  ALA G O   1 
ATOM   10405 C CB  . ALA G  7  92  ? -15.360 -49.708 -30.712 1.00 0.00 ? 91  ALA G CB  1 
ATOM   10406 N N   . ARG G  7  93  ? -16.598 -47.001 -29.419 1.00 0.00 ? 92  ARG G N   1 
ATOM   10407 C CA  . ARG G  7  93  ? -17.246 -45.705 -29.486 1.00 0.00 ? 92  ARG G CA  1 
ATOM   10408 C C   . ARG G  7  93  ? -16.408 -44.626 -28.863 1.00 0.00 ? 92  ARG G C   1 
ATOM   10409 O O   . ARG G  7  93  ? -16.317 -43.518 -29.393 1.00 0.00 ? 92  ARG G O   1 
ATOM   10410 C CB  . ARG G  7  93  ? -18.621 -45.711 -28.794 1.00 0.00 ? 92  ARG G CB  1 
ATOM   10411 C CG  . ARG G  7  93  ? -19.680 -46.519 -29.549 1.00 0.00 ? 92  ARG G CG  1 
ATOM   10412 C CD  . ARG G  7  93  ? -20.833 -46.980 -28.662 1.00 0.00 ? 92  ARG G CD  1 
ATOM   10413 N NE  . ARG G  7  93  ? -21.858 -47.663 -29.511 1.00 0.00 ? 92  ARG G NE  1 
ATOM   10414 C CZ  . ARG G  7  93  ? -22.962 -48.249 -28.964 1.00 0.00 ? 92  ARG G CZ  1 
ATOM   10415 N NH1 . ARG G  7  93  ? -23.084 -48.379 -27.615 1.00 0.00 ? 92  ARG G NH1 1 
ATOM   10416 N NH2 . ARG G  7  93  ? -23.959 -48.706 -29.770 1.00 0.00 ? 92  ARG G NH2 1 
ATOM   10417 N N   . GLU G  7  94  ? -15.704 -44.962 -27.761 1.00 0.00 ? 93  GLU G N   1 
ATOM   10418 C CA  . GLU G  7  94  ? -14.802 -44.088 -27.038 1.00 0.00 ? 93  GLU G CA  1 
ATOM   10419 C C   . GLU G  7  94  ? -13.582 -43.790 -27.885 1.00 0.00 ? 93  GLU G C   1 
ATOM   10420 O O   . GLU G  7  94  ? -13.060 -42.680 -27.921 1.00 0.00 ? 93  GLU G O   1 
ATOM   10421 C CB  . GLU G  7  94  ? -14.344 -44.712 -25.698 1.00 0.00 ? 93  GLU G CB  1 
ATOM   10422 C CG  . GLU G  7  94  ? -13.440 -43.789 -24.862 1.00 0.00 ? 93  GLU G CG  1 
ATOM   10423 C CD  . GLU G  7  94  ? -13.087 -44.421 -23.513 1.00 0.00 ? 93  GLU G CD  1 
ATOM   10424 O OE1 . GLU G  7  94  ? -13.549 -45.558 -23.228 1.00 0.00 ? 93  GLU G OE1 1 
ATOM   10425 O OE2 . GLU G  7  94  ? -12.340 -43.759 -22.744 1.00 0.00 ? 93  GLU G OE2 1 
ATOM   10426 N N   . GLU G  7  95  ? -13.077 -44.823 -28.574 1.00 0.00 ? 94  GLU G N   1 
ATOM   10427 C CA  . GLU G  7  95  ? -11.905 -44.776 -29.383 1.00 0.00 ? 94  GLU G CA  1 
ATOM   10428 C C   . GLU G  7  95  ? -12.157 -43.921 -30.574 1.00 0.00 ? 94  GLU G C   1 
ATOM   10429 O O   . GLU G  7  95  ? -11.304 -43.126 -30.933 1.00 0.00 ? 94  GLU G O   1 
ATOM   10430 C CB  . GLU G  7  95  ? -11.487 -46.202 -29.791 1.00 0.00 ? 94  GLU G CB  1 
ATOM   10431 C CG  . GLU G  7  95  ? -11.007 -47.079 -28.629 1.00 0.00 ? 94  GLU G CG  1 
ATOM   10432 C CD  . GLU G  7  95  ? -10.678 -48.499 -29.085 1.00 0.00 ? 94  GLU G CD  1 
ATOM   10433 O OE1 . GLU G  7  95  ? -11.011 -48.824 -30.255 1.00 0.00 ? 94  GLU G OE1 1 
ATOM   10434 O OE2 . GLU G  7  95  ? -10.138 -49.288 -28.264 1.00 0.00 ? 94  GLU G OE2 1 
ATOM   10435 N N   . ALA G  7  96  ? -13.344 -44.027 -31.198 1.00 0.00 ? 95  ALA G N   1 
ATOM   10436 C CA  . ALA G  7  96  ? -13.703 -43.209 -32.331 1.00 0.00 ? 95  ALA G CA  1 
ATOM   10437 C C   . ALA G  7  96  ? -13.844 -41.744 -31.990 1.00 0.00 ? 95  ALA G C   1 
ATOM   10438 O O   . ALA G  7  96  ? -13.481 -40.878 -32.785 1.00 0.00 ? 95  ALA G O   1 
ATOM   10439 C CB  . ALA G  7  96  ? -15.023 -43.665 -32.959 1.00 0.00 ? 95  ALA G CB  1 
ATOM   10440 N N   . SER G  7  97  ? -14.387 -41.447 -30.780 1.00 0.00 ? 96  SER G N   1 
ATOM   10441 C CA  . SER G  7  97  ? -14.554 -40.109 -30.281 1.00 0.00 ? 96  SER G CA  1 
ATOM   10442 C C   . SER G  7  97  ? -13.292 -39.371 -29.925 1.00 0.00 ? 96  SER G C   1 
ATOM   10443 O O   . SER G  7  97  ? -13.189 -38.181 -30.207 1.00 0.00 ? 96  SER G O   1 
ATOM   10444 C CB  . SER G  7  97  ? -15.491 -40.067 -29.069 1.00 0.00 ? 96  SER G CB  1 
ATOM   10445 O OG  . SER G  7  97  ? -14.999 -40.795 -27.958 1.00 0.00 ? 96  SER G OG  1 
ATOM   10446 N N   . ASN G  7  98  ? -12.301 -40.068 -29.298 1.00 0.00 ? 97  ASN G N   1 
ATOM   10447 C CA  . ASN G  7  98  ? -10.992 -39.544 -28.924 1.00 0.00 ? 97  ASN G CA  1 
ATOM   10448 C C   . ASN G  7  98  ? -10.192 -39.253 -30.132 1.00 0.00 ? 97  ASN G C   1 
ATOM   10449 O O   . ASN G  7  98  ? -9.375  -38.340 -30.141 1.00 0.00 ? 97  ASN G O   1 
ATOM   10450 C CB  . ASN G  7  98  ? -10.130 -40.505 -28.082 1.00 0.00 ? 97  ASN G CB  1 
ATOM   10451 C CG  . ASN G  7  98  ? -10.619 -40.478 -26.635 1.00 0.00 ? 97  ASN G CG  1 
ATOM   10452 O OD1 . ASN G  7  98  ? -11.821 -40.568 -26.363 1.00 0.00 ? 97  ASN G OD1 1 
ATOM   10453 N ND2 . ASN G  7  98  ? -9.655  -40.343 -25.680 1.00 0.00 ? 97  ASN G ND2 1 
ATOM   10454 N N   . PHE G  7  99  ? -10.430 -40.003 -31.204 1.00 0.00 ? 98  PHE G N   1 
ATOM   10455 C CA  . PHE G  7  99  ? -9.758  -39.796 -32.431 1.00 0.00 ? 98  PHE G CA  1 
ATOM   10456 C C   . PHE G  7  99  ? -10.341 -38.620 -33.124 1.00 0.00 ? 98  PHE G C   1 
ATOM   10457 O O   . PHE G  7  99  ? -9.607  -37.829 -33.696 1.00 0.00 ? 98  PHE G O   1 
ATOM   10458 C CB  . PHE G  7  99  ? -9.874  -41.036 -33.314 1.00 0.00 ? 98  PHE G CB  1 
ATOM   10459 C CG  . PHE G  7  99  ? -8.917  -40.981 -34.464 1.00 0.00 ? 98  PHE G CG  1 
ATOM   10460 C CD1 . PHE G  7  99  ? -9.258  -40.265 -35.609 1.00 0.00 ? 98  PHE G CD1 1 
ATOM   10461 C CD2 . PHE G  7  99  ? -7.719  -41.697 -34.435 1.00 0.00 ? 98  PHE G CD2 1 
ATOM   10462 C CE1 . PHE G  7  99  ? -8.423  -40.273 -36.719 1.00 0.00 ? 98  PHE G CE1 1 
ATOM   10463 C CE2 . PHE G  7  99  ? -6.882  -41.701 -35.547 1.00 0.00 ? 98  PHE G CE2 1 
ATOM   10464 C CZ  . PHE G  7  99  ? -7.230  -40.987 -36.693 1.00 0.00 ? 98  PHE G CZ  1 
ATOM   10465 N N   . ARG G  7  100 ? -11.675 -38.457 -33.109 1.00 0.00 ? 99  ARG G N   1 
ATOM   10466 C CA  . ARG G  7  100 ? -12.306 -37.305 -33.703 1.00 0.00 ? 99  ARG G CA  1 
ATOM   10467 C C   . ARG G  7  100 ? -11.946 -36.042 -33.005 1.00 0.00 ? 9