data_5CYP
# 
_entry.id   5CYP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.325 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5CYP         
WWPDB D_1000212378 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4YQF unspecified 
PDB . 5CYO unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5CYP 
_pdbx_database_status.recvd_initial_deposition_date   2015-07-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Matos, S.S.'    1 
'Leonardo, D.A.' 2 
'Pereira, H.M.'  3 
'Horjales, E.'   4 
'Araujo, A.P.U.' 5 
'Garratt, R.C.'  6 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Iucrj 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2052-2525 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;A complete compendium of crystal structures for the human SEPT3 subgroup reveals functional plasticity at a specific septin interface
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S2052252520002973 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Castro, D.K.S.V.' 1  ? 
primary 'da Silva, S.M.O.' 2  ? 
primary 'Pereira, H.M.'    3  ? 
primary 'Macedo, J.N.A.'   4  ? 
primary 'Leonardo, D.A.'   5  ? 
primary 'Valadares, N.F.'  6  ? 
primary 'Kumagai, P.S.'    7  ? 
primary 'Brandao-Neto, J.' 8  ? 
primary 'Araujo, A.P.U.'   9  ? 
primary 'Garratt, R.C.'    10 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.380 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5CYP 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     74.587 
_cell.length_a_esd                 ? 
_cell.length_b                     79.156 
_cell.length_b_esd                 ? 
_cell.length_c                     108.217 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5CYP 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Septin-9                                     31976.834 4 ? ? ? ? 
2 non-polymer syn "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" 539.246   4 ? ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                              24.305    4 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'MLL septin-like fusion protein MSF-A,MLL septin-like fusion protein,Ovarian/Breast septin,Ov/Br septin,Septin D1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINN
ENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLE
ERVHFKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCE
FAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINN
ENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLE
ERVHFKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCE
FAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLN
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLN n 
1 4   GLY n 
1 5   PHE n 
1 6   GLU n 
1 7   PHE n 
1 8   ASN n 
1 9   ILE n 
1 10  MET n 
1 11  VAL n 
1 12  VAL n 
1 13  GLY n 
1 14  GLN n 
1 15  SER n 
1 16  GLY n 
1 17  LEU n 
1 18  GLY n 
1 19  LYS n 
1 20  SER n 
1 21  THR n 
1 22  LEU n 
1 23  ILE n 
1 24  ASN n 
1 25  THR n 
1 26  LEU n 
1 27  PHE n 
1 28  LYS n 
1 29  SER n 
1 30  LYS n 
1 31  ILE n 
1 32  SER n 
1 33  ARG n 
1 34  LYS n 
1 35  SER n 
1 36  VAL n 
1 37  GLN n 
1 38  PRO n 
1 39  THR n 
1 40  SER n 
1 41  GLU n 
1 42  GLU n 
1 43  ARG n 
1 44  ILE n 
1 45  PRO n 
1 46  LYS n 
1 47  THR n 
1 48  ILE n 
1 49  GLU n 
1 50  ILE n 
1 51  LYS n 
1 52  SER n 
1 53  ILE n 
1 54  THR n 
1 55  HIS n 
1 56  ASP n 
1 57  ILE n 
1 58  GLU n 
1 59  GLU n 
1 60  LYS n 
1 61  GLY n 
1 62  VAL n 
1 63  ARG n 
1 64  MET n 
1 65  LYS n 
1 66  LEU n 
1 67  THR n 
1 68  VAL n 
1 69  ILE n 
1 70  ASP n 
1 71  THR n 
1 72  PRO n 
1 73  GLY n 
1 74  PHE n 
1 75  GLY n 
1 76  ASP n 
1 77  HIS n 
1 78  ILE n 
1 79  ASN n 
1 80  ASN n 
1 81  GLU n 
1 82  ASN n 
1 83  CYS n 
1 84  TRP n 
1 85  GLN n 
1 86  PRO n 
1 87  ILE n 
1 88  MET n 
1 89  LYS n 
1 90  PHE n 
1 91  ILE n 
1 92  ASN n 
1 93  ASP n 
1 94  GLN n 
1 95  TYR n 
1 96  GLU n 
1 97  LYS n 
1 98  TYR n 
1 99  LEU n 
1 100 GLN n 
1 101 GLU n 
1 102 GLU n 
1 103 VAL n 
1 104 ASN n 
1 105 ILE n 
1 106 ASN n 
1 107 ARG n 
1 108 LYS n 
1 109 LYS n 
1 110 ARG n 
1 111 ILE n 
1 112 PRO n 
1 113 ASP n 
1 114 THR n 
1 115 ARG n 
1 116 VAL n 
1 117 HIS n 
1 118 CYS n 
1 119 CYS n 
1 120 LEU n 
1 121 TYR n 
1 122 PHE n 
1 123 ILE n 
1 124 PRO n 
1 125 ALA n 
1 126 THR n 
1 127 GLY n 
1 128 HIS n 
1 129 SER n 
1 130 LEU n 
1 131 ARG n 
1 132 PRO n 
1 133 LEU n 
1 134 ASP n 
1 135 ILE n 
1 136 GLU n 
1 137 PHE n 
1 138 MET n 
1 139 LYS n 
1 140 ARG n 
1 141 LEU n 
1 142 SER n 
1 143 LYS n 
1 144 VAL n 
1 145 VAL n 
1 146 ASN n 
1 147 ILE n 
1 148 VAL n 
1 149 PRO n 
1 150 VAL n 
1 151 ILE n 
1 152 ALA n 
1 153 LYS n 
1 154 ALA n 
1 155 ASP n 
1 156 THR n 
1 157 LEU n 
1 158 THR n 
1 159 LEU n 
1 160 GLU n 
1 161 GLU n 
1 162 ARG n 
1 163 VAL n 
1 164 HIS n 
1 165 PHE n 
1 166 LYS n 
1 167 GLN n 
1 168 ARG n 
1 169 ILE n 
1 170 THR n 
1 171 ALA n 
1 172 ASP n 
1 173 LEU n 
1 174 LEU n 
1 175 SER n 
1 176 ASN n 
1 177 GLY n 
1 178 ILE n 
1 179 ASP n 
1 180 VAL n 
1 181 TYR n 
1 182 PRO n 
1 183 GLN n 
1 184 LYS n 
1 185 GLU n 
1 186 PHE n 
1 187 ASP n 
1 188 GLU n 
1 189 ASP n 
1 190 SER n 
1 191 GLU n 
1 192 ASP n 
1 193 ARG n 
1 194 LEU n 
1 195 VAL n 
1 196 ASN n 
1 197 GLU n 
1 198 LYS n 
1 199 PHE n 
1 200 ARG n 
1 201 GLU n 
1 202 MET n 
1 203 ILE n 
1 204 PRO n 
1 205 PHE n 
1 206 ALA n 
1 207 VAL n 
1 208 VAL n 
1 209 GLY n 
1 210 SER n 
1 211 ASP n 
1 212 HIS n 
1 213 GLU n 
1 214 TYR n 
1 215 GLN n 
1 216 VAL n 
1 217 ASN n 
1 218 GLY n 
1 219 LYS n 
1 220 ARG n 
1 221 ILE n 
1 222 LEU n 
1 223 GLY n 
1 224 ARG n 
1 225 LYS n 
1 226 THR n 
1 227 LYS n 
1 228 TRP n 
1 229 GLY n 
1 230 THR n 
1 231 ILE n 
1 232 GLU n 
1 233 VAL n 
1 234 GLU n 
1 235 ASN n 
1 236 THR n 
1 237 THR n 
1 238 HIS n 
1 239 CYS n 
1 240 GLU n 
1 241 PHE n 
1 242 ALA n 
1 243 TYR n 
1 244 LEU n 
1 245 ARG n 
1 246 ASP n 
1 247 LEU n 
1 248 LEU n 
1 249 ILE n 
1 250 ARG n 
1 251 THR n 
1 252 HIS n 
1 253 MET n 
1 254 GLN n 
1 255 ASN n 
1 256 ILE n 
1 257 LYS n 
1 258 ASP n 
1 259 ILE n 
1 260 THR n 
1 261 SER n 
1 262 SER n 
1 263 ILE n 
1 264 HIS n 
1 265 PHE n 
1 266 GLU n 
1 267 ALA n 
1 268 TYR n 
1 269 ARG n 
1 270 VAL n 
1 271 LYS n 
1 272 ARG n 
1 273 LEU n 
1 274 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   274 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SEPT9, KIAA0991, MSF' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SEPT9_HUMAN 
_struct_ref.pdbx_db_accession          Q9UHD8 
_struct_ref.pdbx_db_isoform            Q9UHD8-8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINN
ENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLE
ERVHFKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCE
FAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLN
;
_struct_ref.pdbx_align_begin           181 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5CYP A 1 ? 274 ? Q9UHD8 181 ? 454 ? 18 291 
2 1 5CYP B 1 ? 274 ? Q9UHD8 181 ? 454 ? 18 291 
3 1 5CYP C 1 ? 274 ? Q9UHD8 181 ? 454 ? 18 291 
4 1 5CYP D 1 ? 274 ? Q9UHD8 181 ? 454 ? 18 291 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'          75.067  
GSP non-polymer         . "5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE" ? 'C10 H16 N5 O13 P3 S' 539.246 
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'      156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5CYP 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.48 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.32 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.9 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% PEG1500, 20% Glycerol' 
_exptl_crystal_grow.pdbx_pH_range   6.9 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9801 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9801 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5CYP 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.890 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       27269 
_reflns.number_obs                       27269 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             97.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     0.995 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.25 
_reflns.pdbx_Rmerge_I_obs                0.121 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.570 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.944 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.145 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         85852 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.890 3.070 ? 1.900  ? 13284 4483 ? 4266 95.200 ? ? 0.814 ? 0.652 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.789 ? 0 1 1 ? ? 
3.070 3.280 ? 2.990  ? 13113 4195 ? 4157 99.100 ? ? 0.921 ? 0.419 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.506 ? 0 2 1 ? ? 
3.280 3.540 ? 4.680  ? 12274 3926 ? 3876 98.700 ? ? 0.960 ? 0.260 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.313 ? 0 3 1 ? ? 
3.540 3.880 ? 7.420  ? 11240 3604 ? 3556 98.700 ? ? 0.987 ? 0.148 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.178 ? 0 4 1 ? ? 
3.880 4.330 ? 10.980 ? 10219 3292 ? 3229 98.100 ? ? 0.995 ? 0.090 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.109 ? 0 5 1 ? ? 
4.330 4.990 ? 14.360 ? 8961  2910 ? 2848 97.900 ? ? 0.997 ? 0.065 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.078 ? 0 6 1 ? ? 
4.990 6.100 ? 13.360 ? 7494  2454 ? 2388 97.300 ? ? 0.996 ? 0.070 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.085 ? 0 7 1 ? ? 
6.100 8.550 ? 16.020 ? 5909  1936 ? 1866 96.400 ? ? 0.998 ? 0.053 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.063 ? 0 8 1 ? ? 
8.550 ?     ? 28.220 ? 3358  1139 ? 1083 95.100 ? ? 0.999 ? 0.026 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.032 ? 0 9 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                171.720 
_refine.B_iso_mean                               60.8500 
_refine.B_iso_min                                20.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5CYP 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.8930 
_refine.ls_d_res_low                             45.6540 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     27181 
_refine.ls_number_reflns_R_free                  1362 
_refine.ls_number_reflns_R_work                  25819 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.3400 
_refine.ls_percent_reflns_R_free                 5.0100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2544 
_refine.ls_R_factor_R_free                       0.2974 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2522 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 37.1400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4000 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.6839 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.8930 
_refine_hist.d_res_low                        45.6540 
_refine_hist.pdbx_number_atoms_ligand         132 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7249 
_refine_hist.pdbx_number_residues_total       940 
_refine_hist.pdbx_B_iso_mean_ligand           42.45 
_refine_hist.pdbx_number_atoms_protein        7117 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 7376  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.594  ? 10043 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.023  ? 1192  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 1269  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 12.277 ? 2617  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8930 2.9964  2566 . 128 2438 92.0000 . . . 0.4033 . 0.3546 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.9964 3.1163  2747 . 138 2609 99.0000 . . . 0.3228 . 0.3313 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.1163 3.2581  2726 . 137 2589 99.0000 . . . 0.3757 . 0.3071 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.2581 3.4298  2739 . 137 2602 99.0000 . . . 0.3531 . 0.2910 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.4298 3.6446  2715 . 135 2580 98.0000 . . . 0.2807 . 0.2542 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.6446 3.9259  2742 . 138 2604 98.0000 . . . 0.3218 . 0.2491 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.9259 4.3207  2730 . 136 2594 98.0000 . . . 0.2498 . 0.2215 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 4.3207 4.9452  2751 . 138 2613 98.0000 . . . 0.2462 . 0.2042 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 4.9452 6.2280  2719 . 137 2582 97.0000 . . . 0.2918 . 0.2396 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 6.2280 45.6593 2746 . 138 2608 96.0000 . . . 0.2788 . 0.2322 . . . . . . 10 . . . 
# 
_struct.entry_id                     5CYP 
_struct.title                        'GTPase domain of Septin 9 in complex with GTP-gamma-S' 
_struct.pdbx_descriptor              Septin-9 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5CYP 
_struct_keywords.text            'Septin 9 GTPase domain, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'Monomer confirmed by gel filtration' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 18  ? LYS A 28  ? GLY A 35  LYS A 45  1 ? 11 
HELX_P HELX_P2  AA2 ASN A 80  ? VAL A 103 ? ASN A 97  VAL A 120 1 ? 24 
HELX_P HELX_P3  AA3 ARG A 131 ? LYS A 143 ? ARG A 148 LYS A 160 1 ? 13 
HELX_P HELX_P4  AA4 LYS A 153 ? LEU A 157 ? LYS A 170 LEU A 174 5 ? 5  
HELX_P HELX_P5  AA5 THR A 158 ? ASN A 176 ? THR A 175 ASN A 193 1 ? 19 
HELX_P HELX_P6  AA6 GLN A 183 ? ASP A 187 ? GLN A 200 ASP A 204 5 ? 5  
HELX_P HELX_P7  AA7 ASP A 189 ? GLU A 201 ? ASP A 206 GLU A 218 1 ? 13 
HELX_P HELX_P8  AA8 GLU A 240 ? ARG A 250 ? GLU A 257 ARG A 267 1 ? 11 
HELX_P HELX_P9  AA9 HIS A 252 ? ILE A 263 ? HIS A 269 ILE A 280 1 ? 12 
HELX_P HELX_P10 AB1 ILE A 263 ? ARG A 272 ? ILE A 280 ARG A 289 1 ? 10 
HELX_P HELX_P11 AB2 GLY B 18  ? LYS B 28  ? GLY B 35  LYS B 45  1 ? 11 
HELX_P HELX_P12 AB3 ASN B 80  ? VAL B 103 ? ASN B 97  VAL B 120 1 ? 24 
HELX_P HELX_P13 AB4 ARG B 131 ? LYS B 143 ? ARG B 148 LYS B 160 1 ? 13 
HELX_P HELX_P14 AB5 LYS B 153 ? LEU B 157 ? LYS B 170 LEU B 174 5 ? 5  
HELX_P HELX_P15 AB6 THR B 158 ? ASN B 176 ? THR B 175 ASN B 193 1 ? 19 
HELX_P HELX_P16 AB7 GLN B 183 ? ASP B 187 ? GLN B 200 ASP B 204 5 ? 5  
HELX_P HELX_P17 AB8 ASP B 189 ? GLU B 201 ? ASP B 206 GLU B 218 1 ? 13 
HELX_P HELX_P18 AB9 PHE B 241 ? ARG B 250 ? PHE B 258 ARG B 267 1 ? 10 
HELX_P HELX_P19 AC1 HIS B 252 ? ILE B 263 ? HIS B 269 ILE B 280 1 ? 12 
HELX_P HELX_P20 AC2 ILE B 263 ? LEU B 273 ? ILE B 280 LEU B 290 1 ? 11 
HELX_P HELX_P21 AC3 GLY C 18  ? LYS C 28  ? GLY C 35  LYS C 45  1 ? 11 
HELX_P HELX_P22 AC4 ASN C 80  ? VAL C 103 ? ASN C 97  VAL C 120 1 ? 24 
HELX_P HELX_P23 AC5 ARG C 131 ? LYS C 143 ? ARG C 148 LYS C 160 1 ? 13 
HELX_P HELX_P24 AC6 LYS C 153 ? LEU C 157 ? LYS C 170 LEU C 174 5 ? 5  
HELX_P HELX_P25 AC7 THR C 158 ? ASN C 176 ? THR C 175 ASN C 193 1 ? 19 
HELX_P HELX_P26 AC8 GLN C 183 ? ASP C 187 ? GLN C 200 ASP C 204 5 ? 5  
HELX_P HELX_P27 AC9 ASP C 189 ? GLU C 201 ? ASP C 206 GLU C 218 1 ? 13 
HELX_P HELX_P28 AD1 GLU C 240 ? ARG C 250 ? GLU C 257 ARG C 267 1 ? 11 
HELX_P HELX_P29 AD2 HIS C 252 ? ILE C 263 ? HIS C 269 ILE C 280 1 ? 12 
HELX_P HELX_P30 AD3 ILE C 263 ? ASN C 274 ? ILE C 280 ASN C 291 1 ? 12 
HELX_P HELX_P31 AD4 GLY D 18  ? LYS D 28  ? GLY D 35  LYS D 45  1 ? 11 
HELX_P HELX_P32 AD5 ASN D 80  ? VAL D 103 ? ASN D 97  VAL D 120 1 ? 24 
HELX_P HELX_P33 AD6 ARG D 131 ? LYS D 143 ? ARG D 148 LYS D 160 1 ? 13 
HELX_P HELX_P34 AD7 LYS D 153 ? LEU D 157 ? LYS D 170 LEU D 174 5 ? 5  
HELX_P HELX_P35 AD8 THR D 158 ? ASN D 176 ? THR D 175 ASN D 193 1 ? 19 
HELX_P HELX_P36 AD9 GLN D 183 ? ASP D 187 ? GLN D 200 ASP D 204 5 ? 5  
HELX_P HELX_P37 AE1 ASP D 189 ? GLU D 201 ? ASP D 206 GLU D 218 1 ? 13 
HELX_P HELX_P38 AE2 GLU D 240 ? ARG D 250 ? GLU D 257 ARG D 267 1 ? 11 
HELX_P HELX_P39 AE3 HIS D 252 ? ILE D 263 ? HIS D 269 ILE D 280 1 ? 12 
HELX_P HELX_P40 AE4 ILE D 263 ? ASN D 274 ? ILE D 280 ASN D 291 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 20 OG  ? ? ? 1_555 F MG . MG ? ? A SER 37  A MG 302 1_555 ? ? ? ? ? ? ? 1.963 ? 
metalc2  metalc ? ? A THR 47 OG1 ? ? ? 1_555 F MG . MG ? ? A THR 64  A MG 302 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc3  metalc ? ? B SER 20 OG  ? ? ? 1_555 H MG . MG ? ? B SER 37  B MG 302 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc4  metalc ? ? B THR 47 OG1 ? ? ? 1_555 H MG . MG ? ? B THR 64  B MG 302 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc5  metalc ? ? C SER 20 OG  ? ? ? 1_555 J MG . MG ? ? C SER 37  C MG 302 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc6  metalc ? ? C THR 47 OG1 ? ? ? 1_555 J MG . MG ? ? C THR 64  C MG 302 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc7  metalc ? ? D SER 20 OG  ? ? ? 1_555 L MG . MG ? ? D SER 37  D MG 302 1_555 ? ? ? ? ? ? ? 1.965 ? 
metalc8  metalc ? ? D THR 47 OG1 ? ? ? 1_555 L MG . MG ? ? D THR 64  D MG 302 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc9  metalc ? ? E GSP .  O2G ? ? ? 1_555 F MG . MG ? ? A GSP 301 A MG 302 1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc10 metalc ? ? E GSP .  O2B ? ? ? 1_555 F MG . MG ? ? A GSP 301 A MG 302 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc11 metalc ? ? G GSP .  O3G ? ? ? 1_555 H MG . MG ? ? B GSP 301 B MG 302 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc12 metalc ? ? G GSP .  O2B ? ? ? 1_555 H MG . MG ? ? B GSP 301 B MG 302 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc13 metalc ? ? I GSP .  O2G ? ? ? 1_555 J MG . MG ? ? C GSP 301 C MG 302 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc14 metalc ? ? I GSP .  O2B ? ? ? 1_555 J MG . MG ? ? C GSP 301 C MG 302 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc15 metalc ? ? K GSP .  O3G ? ? ? 1_555 L MG . MG ? ? D GSP 301 D MG 302 1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc16 metalc ? ? K GSP .  O2B ? ? ? 1_555 L MG . MG ? ? D GSP 301 D MG 302 1_555 ? ? ? ? ? ? ? 2.339 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 181 A . ? TYR 198 A PRO 182 A ? PRO 199 A 1 -2.50 
2 ILE 203 A . ? ILE 220 A PRO 204 A ? PRO 221 A 1 -0.93 
3 TYR 181 B . ? TYR 198 B PRO 182 B ? PRO 199 B 1 -2.40 
4 ILE 203 B . ? ILE 220 B PRO 204 B ? PRO 221 B 1 -0.15 
5 TYR 181 C . ? TYR 198 C PRO 182 C ? PRO 199 C 1 -2.31 
6 ILE 203 C . ? ILE 220 C PRO 204 C ? PRO 221 C 1 -0.52 
7 TYR 181 D . ? TYR 198 D PRO 182 D ? PRO 199 D 1 -2.08 
8 ILE 203 D . ? ILE 220 D PRO 204 D ? PRO 221 D 1 -0.68 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 6 ? 
AA4 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA4 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 51  ? GLU A 58  ? LYS A 68  GLU A 75  
AA1 2 ARG A 63  ? ASP A 70  ? ARG A 80  ASP A 87  
AA1 3 GLY A 4   ? GLY A 13  ? GLY A 21  GLY A 30  
AA1 4 CYS A 118 ? PRO A 124 ? CYS A 135 PRO A 141 
AA1 5 ASN A 146 ? ALA A 152 ? ASN A 163 ALA A 169 
AA1 6 PHE A 205 ? ALA A 206 ? PHE A 222 ALA A 223 
AA2 1 LYS B 51  ? ILE B 57  ? LYS B 68  ILE B 74  
AA2 2 MET B 64  ? ASP B 70  ? MET B 81  ASP B 87  
AA2 3 PHE B 5   ? GLY B 13  ? PHE B 22  GLY B 30  
AA2 4 CYS B 118 ? ILE B 123 ? CYS B 135 ILE B 140 
AA2 5 ASN B 146 ? ILE B 151 ? ASN B 163 ILE B 168 
AA2 6 PHE B 205 ? ALA B 206 ? PHE B 222 ALA B 223 
AA3 1 LYS C 51  ? GLU C 58  ? LYS C 68  GLU C 75  
AA3 2 ARG C 63  ? ASP C 70  ? ARG C 80  ASP C 87  
AA3 3 PHE C 5   ? GLY C 13  ? PHE C 22  GLY C 30  
AA3 4 CYS C 118 ? PRO C 124 ? CYS C 135 PRO C 141 
AA3 5 ASN C 146 ? ALA C 152 ? ASN C 163 ALA C 169 
AA3 6 PHE C 205 ? ALA C 206 ? PHE C 222 ALA C 223 
AA4 1 LYS D 51  ? ILE D 57  ? LYS D 68  ILE D 74  
AA4 2 ARG D 63  ? ASP D 70  ? ARG D 80  ASP D 87  
AA4 3 GLY D 4   ? GLY D 13  ? GLY D 21  GLY D 30  
AA4 4 CYS D 118 ? PRO D 124 ? CYS D 135 PRO D 141 
AA4 5 ASN D 146 ? ALA D 152 ? ASN D 163 ALA D 169 
AA4 6 PHE D 205 ? ALA D 206 ? PHE D 222 ALA D 223 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 53  ? N ILE A 70  O VAL A 68  ? O VAL A 85  
AA1 2 3 O ILE A 69  ? O ILE A 86  N ILE A 9   ? N ILE A 26  
AA1 3 4 N VAL A 12  ? N VAL A 29  O PHE A 122 ? O PHE A 139 
AA1 4 5 N ILE A 123 ? N ILE A 140 O VAL A 150 ? O VAL A 167 
AA1 5 6 N ILE A 151 ? N ILE A 168 O PHE A 205 ? O PHE A 222 
AA2 1 2 N ILE B 57  ? N ILE B 74  O MET B 64  ? O MET B 81  
AA2 2 3 O ILE B 69  ? O ILE B 86  N ILE B 9   ? N ILE B 26  
AA2 3 4 N VAL B 12  ? N VAL B 29  O PHE B 122 ? O PHE B 139 
AA2 4 5 N ILE B 123 ? N ILE B 140 O VAL B 150 ? O VAL B 167 
AA2 5 6 N ILE B 151 ? N ILE B 168 O PHE B 205 ? O PHE B 222 
AA3 1 2 N ILE C 57  ? N ILE C 74  O MET C 64  ? O MET C 81  
AA3 2 3 O THR C 67  ? O THR C 84  N ILE C 9   ? N ILE C 26  
AA3 3 4 N VAL C 12  ? N VAL C 29  O PHE C 122 ? O PHE C 139 
AA3 4 5 N ILE C 123 ? N ILE C 140 O VAL C 150 ? O VAL C 167 
AA3 5 6 N ILE C 151 ? N ILE C 168 O PHE C 205 ? O PHE C 222 
AA4 1 2 N ILE D 53  ? N ILE D 70  O VAL D 68  ? O VAL D 85  
AA4 2 3 O THR D 67  ? O THR D 84  N ILE D 9   ? N ILE D 26  
AA4 3 4 N VAL D 12  ? N VAL D 29  O PHE D 122 ? O PHE D 139 
AA4 4 5 N ILE D 123 ? N ILE D 140 O VAL D 150 ? O VAL D 167 
AA4 5 6 N ILE D 151 ? N ILE D 168 O PHE D 205 ? O PHE D 222 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GSP 301 ? 18 'binding site for residue GSP A 301' 
AC2 Software A MG  302 ? 4  'binding site for residue MG A 302'  
AC3 Software B GSP 301 ? 17 'binding site for residue GSP B 301' 
AC4 Software B MG  302 ? 4  'binding site for residue MG B 302'  
AC5 Software C GSP 301 ? 18 'binding site for residue GSP C 301' 
AC6 Software C MG  302 ? 4  'binding site for residue MG C 302'  
AC7 Software D GSP 301 ? 18 'binding site for residue GSP D 301' 
AC8 Software D MG  302 ? 4  'binding site for residue MG D 302'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 SER A 15  ? SER A 32  . ? 1_555 ? 
2  AC1 18 GLY A 16  ? GLY A 33  . ? 1_555 ? 
3  AC1 18 LEU A 17  ? LEU A 34  . ? 1_555 ? 
4  AC1 18 GLY A 18  ? GLY A 35  . ? 1_555 ? 
5  AC1 18 LYS A 19  ? LYS A 36  . ? 1_555 ? 
6  AC1 18 SER A 20  ? SER A 37  . ? 1_555 ? 
7  AC1 18 THR A 21  ? THR A 38  . ? 1_555 ? 
8  AC1 18 THR A 47  ? THR A 64  . ? 1_555 ? 
9  AC1 18 LYS A 153 ? LYS A 170 . ? 1_555 ? 
10 AC1 18 ASP A 155 ? ASP A 172 . ? 1_555 ? 
11 AC1 18 VAL A 208 ? VAL A 225 . ? 1_555 ? 
12 AC1 18 GLY A 209 ? GLY A 226 . ? 1_555 ? 
13 AC1 18 ARG A 224 ? ARG A 241 . ? 1_555 ? 
14 AC1 18 MG  F .   ? MG  A 302 . ? 1_555 ? 
15 AC1 18 THR B 126 ? THR B 143 . ? 1_555 ? 
16 AC1 18 HIS B 128 ? HIS B 145 . ? 1_555 ? 
17 AC1 18 THR B 156 ? THR B 173 . ? 1_555 ? 
18 AC1 18 GLU B 161 ? GLU B 178 . ? 1_555 ? 
19 AC2 4  SER A 20  ? SER A 37  . ? 1_555 ? 
20 AC2 4  THR A 47  ? THR A 64  . ? 1_555 ? 
21 AC2 4  ASP A 70  ? ASP A 87  . ? 1_555 ? 
22 AC2 4  GSP E .   ? GSP A 301 . ? 1_555 ? 
23 AC3 17 THR A 126 ? THR A 143 . ? 1_555 ? 
24 AC3 17 HIS A 128 ? HIS A 145 . ? 1_555 ? 
25 AC3 17 THR A 156 ? THR A 173 . ? 1_555 ? 
26 AC3 17 GLU A 161 ? GLU A 178 . ? 1_555 ? 
27 AC3 17 SER B 15  ? SER B 32  . ? 1_555 ? 
28 AC3 17 GLY B 16  ? GLY B 33  . ? 1_555 ? 
29 AC3 17 LEU B 17  ? LEU B 34  . ? 1_555 ? 
30 AC3 17 GLY B 18  ? GLY B 35  . ? 1_555 ? 
31 AC3 17 LYS B 19  ? LYS B 36  . ? 1_555 ? 
32 AC3 17 SER B 20  ? SER B 37  . ? 1_555 ? 
33 AC3 17 THR B 21  ? THR B 38  . ? 1_555 ? 
34 AC3 17 THR B 47  ? THR B 64  . ? 1_555 ? 
35 AC3 17 LYS B 153 ? LYS B 170 . ? 1_555 ? 
36 AC3 17 ASP B 155 ? ASP B 172 . ? 1_555 ? 
37 AC3 17 VAL B 208 ? VAL B 225 . ? 1_555 ? 
38 AC3 17 GLY B 209 ? GLY B 226 . ? 1_555 ? 
39 AC3 17 MG  H .   ? MG  B 302 . ? 1_555 ? 
40 AC4 4  SER B 20  ? SER B 37  . ? 1_555 ? 
41 AC4 4  THR B 47  ? THR B 64  . ? 1_555 ? 
42 AC4 4  ASP B 70  ? ASP B 87  . ? 1_555 ? 
43 AC4 4  GSP G .   ? GSP B 301 . ? 1_555 ? 
44 AC5 18 SER C 15  ? SER C 32  . ? 1_555 ? 
45 AC5 18 GLY C 16  ? GLY C 33  . ? 1_555 ? 
46 AC5 18 LEU C 17  ? LEU C 34  . ? 1_555 ? 
47 AC5 18 GLY C 18  ? GLY C 35  . ? 1_555 ? 
48 AC5 18 LYS C 19  ? LYS C 36  . ? 1_555 ? 
49 AC5 18 SER C 20  ? SER C 37  . ? 1_555 ? 
50 AC5 18 THR C 21  ? THR C 38  . ? 1_555 ? 
51 AC5 18 LYS C 46  ? LYS C 63  . ? 1_555 ? 
52 AC5 18 THR C 47  ? THR C 64  . ? 1_555 ? 
53 AC5 18 LYS C 153 ? LYS C 170 . ? 1_555 ? 
54 AC5 18 ASP C 155 ? ASP C 172 . ? 1_555 ? 
55 AC5 18 VAL C 208 ? VAL C 225 . ? 1_555 ? 
56 AC5 18 GLY C 209 ? GLY C 226 . ? 1_555 ? 
57 AC5 18 MG  J .   ? MG  C 302 . ? 1_555 ? 
58 AC5 18 THR D 126 ? THR D 143 . ? 1_555 ? 
59 AC5 18 HIS D 128 ? HIS D 145 . ? 1_555 ? 
60 AC5 18 THR D 156 ? THR D 173 . ? 1_555 ? 
61 AC5 18 GLU D 161 ? GLU D 178 . ? 1_555 ? 
62 AC6 4  SER C 20  ? SER C 37  . ? 1_555 ? 
63 AC6 4  THR C 47  ? THR C 64  . ? 1_555 ? 
64 AC6 4  ASP C 70  ? ASP C 87  . ? 1_555 ? 
65 AC6 4  GSP I .   ? GSP C 301 . ? 1_555 ? 
66 AC7 18 THR C 126 ? THR C 143 . ? 1_555 ? 
67 AC7 18 HIS C 128 ? HIS C 145 . ? 1_555 ? 
68 AC7 18 THR C 156 ? THR C 173 . ? 1_555 ? 
69 AC7 18 GLU C 161 ? GLU C 178 . ? 1_555 ? 
70 AC7 18 SER D 15  ? SER D 32  . ? 1_555 ? 
71 AC7 18 GLY D 16  ? GLY D 33  . ? 1_555 ? 
72 AC7 18 LEU D 17  ? LEU D 34  . ? 1_555 ? 
73 AC7 18 GLY D 18  ? GLY D 35  . ? 1_555 ? 
74 AC7 18 LYS D 19  ? LYS D 36  . ? 1_555 ? 
75 AC7 18 SER D 20  ? SER D 37  . ? 1_555 ? 
76 AC7 18 THR D 21  ? THR D 38  . ? 1_555 ? 
77 AC7 18 THR D 47  ? THR D 64  . ? 1_555 ? 
78 AC7 18 GLY D 73  ? GLY D 90  . ? 1_555 ? 
79 AC7 18 LYS D 153 ? LYS D 170 . ? 1_555 ? 
80 AC7 18 ASP D 155 ? ASP D 172 . ? 1_555 ? 
81 AC7 18 VAL D 208 ? VAL D 225 . ? 1_555 ? 
82 AC7 18 GLY D 209 ? GLY D 226 . ? 1_555 ? 
83 AC7 18 MG  L .   ? MG  D 302 . ? 1_555 ? 
84 AC8 4  SER D 20  ? SER D 37  . ? 1_555 ? 
85 AC8 4  THR D 47  ? THR D 64  . ? 1_555 ? 
86 AC8 4  ASP D 70  ? ASP D 87  . ? 1_555 ? 
87 AC8 4  GSP K .   ? GSP D 301 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5CYP 
_atom_sites.fract_transf_matrix[1][1]   0.013407 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002456 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012633 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009394 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -41.405 3.196  17.727  1.00 63.33  ?  18  MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -42.447 4.127  17.312  1.00 65.91  ?  18  MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -41.846 5.413  16.756  1.00 64.82  ?  18  MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -42.102 6.503  17.266  1.00 63.18  ?  18  MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -43.381 4.444  18.482  1.00 65.94  ?  18  MET A CB    1 
ATOM   6    N  N     . LYS A 1 2   ? -41.040 5.275  15.709  1.00 71.07  ?  19  LYS A N     1 
ATOM   7    C  CA    . LYS A 1 2   ? -40.438 6.421  15.041  1.00 70.68  ?  19  LYS A CA    1 
ATOM   8    C  C     . LYS A 1 2   ? -40.262 6.121  13.558  1.00 73.64  ?  19  LYS A C     1 
ATOM   9    O  O     . LYS A 1 2   ? -40.531 5.007  13.109  1.00 76.37  ?  19  LYS A O     1 
ATOM   10   C  CB    . LYS A 1 2   ? -39.096 6.782  15.679  1.00 67.13  ?  19  LYS A CB    1 
ATOM   11   N  N     . GLN A 1 3   ? -39.807 7.110  12.798  1.00 69.68  ?  20  GLN A N     1 
ATOM   12   C  CA    . GLN A 1 3   ? -39.630 6.927  11.365  1.00 71.80  ?  20  GLN A CA    1 
ATOM   13   C  C     . GLN A 1 3   ? -38.183 7.165  10.942  1.00 70.26  ?  20  GLN A C     1 
ATOM   14   O  O     . GLN A 1 3   ? -37.451 7.921  11.578  1.00 67.40  ?  20  GLN A O     1 
ATOM   15   C  CB    . GLN A 1 3   ? -40.580 7.847  10.598  1.00 71.63  ?  20  GLN A CB    1 
ATOM   16   C  CG    . GLN A 1 3   ? -41.533 8.618  11.499  1.00 72.10  ?  20  GLN A CG    1 
ATOM   17   C  CD    . GLN A 1 3   ? -42.775 9.090  10.773  1.00 77.88  ?  20  GLN A CD    1 
ATOM   18   O  OE1   . GLN A 1 3   ? -42.932 8.861  9.575   1.00 81.54  ?  20  GLN A OE1   1 
ATOM   19   N  NE2   . GLN A 1 3   ? -43.667 9.755  11.497  1.00 79.28  ?  20  GLN A NE2   1 
ATOM   20   N  N     . GLY A 1 4   ? -37.789 6.513  9.853   1.00 69.63  ?  21  GLY A N     1 
ATOM   21   C  CA    . GLY A 1 4   ? -36.420 6.545  9.369   1.00 68.46  ?  21  GLY A CA    1 
ATOM   22   C  C     . GLY A 1 4   ? -36.087 7.636  8.372   1.00 66.31  ?  21  GLY A C     1 
ATOM   23   O  O     . GLY A 1 4   ? -36.618 7.656  7.262   1.00 67.22  ?  21  GLY A O     1 
ATOM   24   N  N     . PHE A 1 5   ? -35.201 8.547  8.764   1.00 57.90  ?  22  PHE A N     1 
ATOM   25   C  CA    . PHE A 1 5   ? -34.755 9.600  7.861   1.00 53.74  ?  22  PHE A CA    1 
ATOM   26   C  C     . PHE A 1 5   ? -33.305 9.365  7.462   1.00 52.39  ?  22  PHE A C     1 
ATOM   27   O  O     . PHE A 1 5   ? -32.425 9.226  8.311   1.00 51.13  ?  22  PHE A O     1 
ATOM   28   C  CB    . PHE A 1 5   ? -34.906 10.978 8.506   1.00 50.51  ?  22  PHE A CB    1 
ATOM   29   C  CG    . PHE A 1 5   ? -36.329 11.368 8.773   1.00 52.52  ?  22  PHE A CG    1 
ATOM   30   C  CD1   . PHE A 1 5   ? -37.202 11.608 7.725   1.00 56.93  ?  22  PHE A CD1   1 
ATOM   31   C  CD2   . PHE A 1 5   ? -36.794 11.504 10.070  1.00 51.85  ?  22  PHE A CD2   1 
ATOM   32   C  CE1   . PHE A 1 5   ? -38.513 11.968 7.966   1.00 60.38  ?  22  PHE A CE1   1 
ATOM   33   C  CE2   . PHE A 1 5   ? -38.103 11.865 10.317  1.00 54.25  ?  22  PHE A CE2   1 
ATOM   34   C  CZ    . PHE A 1 5   ? -38.964 12.097 9.264   1.00 58.94  ?  22  PHE A CZ    1 
ATOM   35   N  N     . GLU A 1 6   ? -33.067 9.327  6.156   1.00 61.73  ?  23  GLU A N     1 
ATOM   36   C  CA    . GLU A 1 6   ? -31.742 9.051  5.619   1.00 60.57  ?  23  GLU A CA    1 
ATOM   37   C  C     . GLU A 1 6   ? -30.885 10.309 5.572   1.00 56.76  ?  23  GLU A C     1 
ATOM   38   O  O     . GLU A 1 6   ? -31.393 11.412 5.375   1.00 56.14  ?  23  GLU A O     1 
ATOM   39   C  CB    . GLU A 1 6   ? -31.859 8.438  4.223   1.00 63.57  ?  23  GLU A CB    1 
ATOM   40   C  CG    . GLU A 1 6   ? -32.760 7.214  4.166   1.00 69.75  ?  23  GLU A CG    1 
ATOM   41   C  CD    . GLU A 1 6   ? -32.976 6.712  2.752   1.00 72.42  ?  23  GLU A CD    1 
ATOM   42   O  OE1   . GLU A 1 6   ? -32.107 6.967  1.893   1.00 70.74  ?  23  GLU A OE1   1 
ATOM   43   O  OE2   . GLU A 1 6   ? -34.016 6.067  2.499   1.00 76.00  -1 23  GLU A OE2   1 
ATOM   44   N  N     . PHE A 1 7   ? -29.581 10.135 5.756   1.00 35.10  ?  24  PHE A N     1 
ATOM   45   C  CA    . PHE A 1 7   ? -28.643 11.248 5.689   1.00 33.44  ?  24  PHE A CA    1 
ATOM   46   C  C     . PHE A 1 7   ? -27.266 10.730 5.290   1.00 32.19  ?  24  PHE A C     1 
ATOM   47   O  O     . PHE A 1 7   ? -26.749 9.788  5.891   1.00 30.90  ?  24  PHE A O     1 
ATOM   48   C  CB    . PHE A 1 7   ? -28.583 11.979 7.033   1.00 31.23  ?  24  PHE A CB    1 
ATOM   49   C  CG    . PHE A 1 7   ? -27.867 13.297 6.977   1.00 30.66  ?  24  PHE A CG    1 
ATOM   50   C  CD1   . PHE A 1 7   ? -28.321 14.311 6.149   1.00 32.98  ?  24  PHE A CD1   1 
ATOM   51   C  CD2   . PHE A 1 7   ? -26.751 13.530 7.762   1.00 28.50  ?  24  PHE A CD2   1 
ATOM   52   C  CE1   . PHE A 1 7   ? -27.669 15.528 6.098   1.00 33.01  ?  24  PHE A CE1   1 
ATOM   53   C  CE2   . PHE A 1 7   ? -26.095 14.746 7.717   1.00 28.63  ?  24  PHE A CE2   1 
ATOM   54   C  CZ    . PHE A 1 7   ? -26.555 15.746 6.883   1.00 30.81  ?  24  PHE A CZ    1 
ATOM   55   N  N     . ASN A 1 8   ? -26.672 11.350 4.276   1.00 41.13  ?  25  ASN A N     1 
ATOM   56   C  CA    . ASN A 1 8   ? -25.409 10.868 3.731   1.00 40.92  ?  25  ASN A CA    1 
ATOM   57   C  C     . ASN A 1 8   ? -24.284 11.890 3.842   1.00 39.00  ?  25  ASN A C     1 
ATOM   58   O  O     . ASN A 1 8   ? -24.378 12.995 3.308   1.00 39.95  ?  25  ASN A O     1 
ATOM   59   C  CB    . ASN A 1 8   ? -25.592 10.461 2.267   1.00 43.94  ?  25  ASN A CB    1 
ATOM   60   C  CG    . ASN A 1 8   ? -26.644 9.386  2.089   1.00 47.93  ?  25  ASN A CG    1 
ATOM   61   O  OD1   . ASN A 1 8   ? -26.764 8.477  2.910   1.00 49.41  ?  25  ASN A OD1   1 
ATOM   62   N  ND2   . ASN A 1 8   ? -27.416 9.486  1.014   1.00 50.21  ?  25  ASN A ND2   1 
ATOM   63   N  N     . ILE A 1 9   ? -23.221 11.508 4.542   1.00 35.84  ?  26  ILE A N     1 
ATOM   64   C  CA    . ILE A 1 9   ? -22.048 12.359 4.691   1.00 34.96  ?  26  ILE A CA    1 
ATOM   65   C  C     . ILE A 1 9   ? -20.836 11.724 4.019   1.00 35.28  ?  26  ILE A C     1 
ATOM   66   O  O     . ILE A 1 9   ? -20.527 10.558 4.254   1.00 35.20  ?  26  ILE A O     1 
ATOM   67   C  CB    . ILE A 1 9   ? -21.723 12.624 6.174   1.00 33.39  ?  26  ILE A CB    1 
ATOM   68   C  CG1   . ILE A 1 9   ? -22.954 13.170 6.902   1.00 33.29  ?  26  ILE A CG1   1 
ATOM   69   C  CG2   . ILE A 1 9   ? -20.551 13.588 6.302   1.00 33.39  ?  26  ILE A CG2   1 
ATOM   70   C  CD1   . ILE A 1 9   ? -22.738 13.387 8.386   1.00 32.24  ?  26  ILE A CD1   1 
ATOM   71   N  N     . MET A 1 10  ? -20.155 12.494 3.180   1.00 37.56  ?  27  MET A N     1 
ATOM   72   C  CA    . MET A 1 10  ? -18.953 12.010 2.513   1.00 38.15  ?  27  MET A CA    1 
ATOM   73   C  C     . MET A 1 10  ? -17.722 12.760 3.005   1.00 37.64  ?  27  MET A C     1 
ATOM   74   O  O     . MET A 1 10  ? -17.694 13.989 3.003   1.00 37.91  ?  27  MET A O     1 
ATOM   75   C  CB    . MET A 1 10  ? -19.088 12.155 0.997   1.00 40.18  ?  27  MET A CB    1 
ATOM   76   C  CG    . MET A 1 10  ? -17.775 12.038 0.244   1.00 41.00  ?  27  MET A CG    1 
ATOM   77   S  SD    . MET A 1 10  ? -18.002 12.125 -1.540  1.00 43.93  ?  27  MET A SD    1 
ATOM   78   C  CE    . MET A 1 10  ? -18.706 10.512 -1.853  1.00 45.40  ?  27  MET A CE    1 
ATOM   79   N  N     . VAL A 1 11  ? -16.702 12.019 3.423   1.00 33.63  ?  28  VAL A N     1 
ATOM   80   C  CA    . VAL A 1 11  ? -15.449 12.636 3.838   1.00 33.99  ?  28  VAL A CA    1 
ATOM   81   C  C     . VAL A 1 11  ? -14.464 12.668 2.671   1.00 35.43  ?  28  VAL A C     1 
ATOM   82   O  O     . VAL A 1 11  ? -14.265 11.670 1.979   1.00 36.18  ?  28  VAL A O     1 
ATOM   83   C  CB    . VAL A 1 11  ? -14.825 11.903 5.045   1.00 33.93  ?  28  VAL A CB    1 
ATOM   84   C  CG1   . VAL A 1 11  ? -15.652 12.152 6.298   1.00 32.82  ?  28  VAL A CG1   1 
ATOM   85   C  CG2   . VAL A 1 11  ? -14.701 10.414 4.768   1.00 34.53  ?  28  VAL A CG2   1 
ATOM   86   N  N     . VAL A 1 12  ? -13.867 13.834 2.448   1.00 36.54  ?  29  VAL A N     1 
ATOM   87   C  CA    . VAL A 1 12  ? -12.944 14.031 1.337   1.00 38.11  ?  29  VAL A CA    1 
ATOM   88   C  C     . VAL A 1 12  ? -11.727 14.827 1.806   1.00 39.32  ?  29  VAL A C     1 
ATOM   89   O  O     . VAL A 1 12  ? -11.861 15.770 2.586   1.00 39.38  ?  29  VAL A O     1 
ATOM   90   C  CB    . VAL A 1 12  ? -13.645 14.760 0.159   1.00 38.84  ?  29  VAL A CB    1 
ATOM   91   C  CG1   . VAL A 1 12  ? -12.637 15.323 -0.828  1.00 40.71  ?  29  VAL A CG1   1 
ATOM   92   C  CG2   . VAL A 1 12  ? -14.615 13.825 -0.547  1.00 38.86  ?  29  VAL A CG2   1 
ATOM   93   N  N     . GLY A 1 13  ? -10.543 14.448 1.332   1.00 44.97  ?  30  GLY A N     1 
ATOM   94   C  CA    . GLY A 1 13  ? -9.322  15.136 1.711   1.00 46.87  ?  30  GLY A CA    1 
ATOM   95   C  C     . GLY A 1 13  ? -8.062  14.379 1.339   1.00 48.73  ?  30  GLY A C     1 
ATOM   96   O  O     . GLY A 1 13  ? -8.125  13.262 0.826   1.00 48.54  ?  30  GLY A O     1 
ATOM   97   N  N     . GLN A 1 14  ? -6.911  14.995 1.598   1.00 77.99  ?  31  GLN A N     1 
ATOM   98   C  CA    . GLN A 1 14  ? -5.621  14.384 1.290   1.00 75.96  ?  31  GLN A CA    1 
ATOM   99   C  C     . GLN A 1 14  ? -5.315  13.190 2.186   1.00 70.33  ?  31  GLN A C     1 
ATOM   100  O  O     . GLN A 1 14  ? -5.978  12.970 3.199   1.00 67.79  ?  31  GLN A O     1 
ATOM   101  C  CB    . GLN A 1 14  ? -4.492  15.409 1.406   1.00 77.42  ?  31  GLN A CB    1 
ATOM   102  C  CG    . GLN A 1 14  ? -4.306  16.276 0.175   1.00 82.67  ?  31  GLN A CG    1 
ATOM   103  C  CD    . GLN A 1 14  ? -2.944  16.937 0.142   1.00 83.35  ?  31  GLN A CD    1 
ATOM   104  O  OE1   . GLN A 1 14  ? -2.350  17.213 1.185   1.00 81.28  ?  31  GLN A OE1   1 
ATOM   105  N  NE2   . GLN A 1 14  ? -2.438  17.194 -1.058  1.00 86.66  ?  31  GLN A NE2   1 
ATOM   106  N  N     . SER A 1 15  ? -4.302  12.424 1.794   1.00 61.77  ?  32  SER A N     1 
ATOM   107  C  CA    . SER A 1 15  ? -3.935  11.196 2.490   1.00 60.54  ?  32  SER A CA    1 
ATOM   108  C  C     . SER A 1 15  ? -3.428  11.450 3.906   1.00 59.61  ?  32  SER A C     1 
ATOM   109  O  O     . SER A 1 15  ? -2.529  12.264 4.119   1.00 62.10  ?  32  SER A O     1 
ATOM   110  C  CB    . SER A 1 15  ? -2.870  10.442 1.692   1.00 64.22  ?  32  SER A CB    1 
ATOM   111  O  OG    . SER A 1 15  ? -3.220  10.368 0.322   1.00 66.06  ?  32  SER A OG    1 
ATOM   112  N  N     . GLY A 1 16  ? -4.014  10.749 4.871   1.00 56.51  ?  33  GLY A N     1 
ATOM   113  C  CA    . GLY A 1 16  ? -3.541  10.788 6.242   1.00 56.02  ?  33  GLY A CA    1 
ATOM   114  C  C     . GLY A 1 16  ? -3.995  11.997 7.035   1.00 54.78  ?  33  GLY A C     1 
ATOM   115  O  O     . GLY A 1 16  ? -3.311  12.421 7.965   1.00 55.83  ?  33  GLY A O     1 
ATOM   116  N  N     . LEU A 1 17  ? -5.145  12.556 6.673   1.00 52.93  ?  34  LEU A N     1 
ATOM   117  C  CA    . LEU A 1 17  ? -5.667  13.729 7.367   1.00 52.03  ?  34  LEU A CA    1 
ATOM   118  C  C     . LEU A 1 17  ? -6.650  13.361 8.477   1.00 48.99  ?  34  LEU A C     1 
ATOM   119  O  O     . LEU A 1 17  ? -7.192  14.237 9.150   1.00 48.24  ?  34  LEU A O     1 
ATOM   120  C  CB    . LEU A 1 17  ? -6.335  14.682 6.374   1.00 52.46  ?  34  LEU A CB    1 
ATOM   121  C  CG    . LEU A 1 17  ? -5.385  15.452 5.454   1.00 56.37  ?  34  LEU A CG    1 
ATOM   122  C  CD1   . LEU A 1 17  ? -6.157  16.427 4.580   1.00 57.08  ?  34  LEU A CD1   1 
ATOM   123  C  CD2   . LEU A 1 17  ? -4.324  16.179 6.267   1.00 58.69  ?  34  LEU A CD2   1 
ATOM   124  N  N     . GLY A 1 18  ? -6.876  12.065 8.667   1.00 47.74  ?  35  GLY A N     1 
ATOM   125  C  CA    . GLY A 1 18  ? -7.745  11.600 9.733   1.00 45.62  ?  35  GLY A CA    1 
ATOM   126  C  C     . GLY A 1 18  ? -9.195  11.469 9.308   1.00 43.52  ?  35  GLY A C     1 
ATOM   127  O  O     . GLY A 1 18  ? -10.103 11.595 10.129  1.00 42.13  ?  35  GLY A O     1 
ATOM   128  N  N     . LYS A 1 19  ? -9.412  11.218 8.021   1.00 45.68  ?  36  LYS A N     1 
ATOM   129  C  CA    . LYS A 1 19  ? -10.762 11.082 7.485   1.00 44.21  ?  36  LYS A CA    1 
ATOM   130  C  C     . LYS A 1 19  ? -11.463 9.850  8.047   1.00 43.02  ?  36  LYS A C     1 
ATOM   131  O  O     . LYS A 1 19  ? -12.576 9.943  8.564   1.00 41.74  ?  36  LYS A O     1 
ATOM   132  C  CB    . LYS A 1 19  ? -10.729 11.017 5.958   1.00 45.41  ?  36  LYS A CB    1 
ATOM   133  C  CG    . LYS A 1 19  ? -10.221 12.286 5.300   1.00 47.20  ?  36  LYS A CG    1 
ATOM   134  C  CD    . LYS A 1 19  ? -10.384 12.230 3.793   1.00 48.78  ?  36  LYS A CD    1 
ATOM   135  C  CE    . LYS A 1 19  ? -9.677  11.023 3.204   1.00 50.11  ?  36  LYS A CE    1 
ATOM   136  N  NZ    . LYS A 1 19  ? -9.220  11.278 1.811   1.00 53.14  1  36  LYS A NZ    1 
ATOM   137  N  N     . SER A 1 20  ? -10.809 8.697  7.940   1.00 44.47  ?  37  SER A N     1 
ATOM   138  C  CA    . SER A 1 20  ? -11.370 7.450  8.450   1.00 44.09  ?  37  SER A CA    1 
ATOM   139  C  C     . SER A 1 20  ? -11.498 7.494  9.968   1.00 43.67  ?  37  SER A C     1 
ATOM   140  O  O     . SER A 1 20  ? -12.453 6.964  10.536  1.00 43.20  ?  37  SER A O     1 
ATOM   141  C  CB    . SER A 1 20  ? -10.510 6.257  8.029   1.00 45.75  ?  37  SER A CB    1 
ATOM   142  O  OG    . SER A 1 20  ? -10.259 6.275  6.636   1.00 46.75  ?  37  SER A OG    1 
ATOM   143  N  N     . THR A 1 21  ? -10.524 8.125  10.617  1.00 41.87  ?  38  THR A N     1 
ATOM   144  C  CA    . THR A 1 21  ? -10.507 8.232  12.071  1.00 42.09  ?  38  THR A CA    1 
ATOM   145  C  C     . THR A 1 21  ? -11.692 9.055  12.577  1.00 40.86  ?  38  THR A C     1 
ATOM   146  O  O     . THR A 1 21  ? -12.227 8.793  13.654  1.00 41.08  ?  38  THR A O     1 
ATOM   147  C  CB    . THR A 1 21  ? -9.189  8.864  12.568  1.00 43.54  ?  38  THR A CB    1 
ATOM   148  O  OG1   . THR A 1 21  ? -8.078  8.089  12.099  1.00 45.10  ?  38  THR A OG1   1 
ATOM   149  C  CG2   . THR A 1 21  ? -9.152  8.927  14.088  1.00 44.29  ?  38  THR A CG2   1 
ATOM   150  N  N     . LEU A 1 22  ? -12.117 10.035 11.784  1.00 47.79  ?  39  LEU A N     1 
ATOM   151  C  CA    . LEU A 1 22  ? -13.230 10.890 12.178  1.00 46.96  ?  39  LEU A CA    1 
ATOM   152  C  C     . LEU A 1 22  ? -14.551 10.145 12.032  1.00 46.24  ?  39  LEU A C     1 
ATOM   153  O  O     . LEU A 1 22  ? -15.508 10.408 12.760  1.00 46.11  ?  39  LEU A O     1 
ATOM   154  C  CB    . LEU A 1 22  ? -13.258 12.174 11.347  1.00 46.84  ?  39  LEU A CB    1 
ATOM   155  C  CG    . LEU A 1 22  ? -14.128 13.291 11.930  1.00 46.67  ?  39  LEU A CG    1 
ATOM   156  C  CD1   . LEU A 1 22  ? -13.392 14.009 13.052  1.00 47.75  ?  39  LEU A CD1   1 
ATOM   157  C  CD2   . LEU A 1 22  ? -14.575 14.272 10.856  1.00 48.31  ?  39  LEU A CD2   1 
ATOM   158  N  N     . ILE A 1 23  ? -14.593 9.214  11.084  1.00 41.76  ?  40  ILE A N     1 
ATOM   159  C  CA    . ILE A 1 23  ? -15.800 8.442  10.819  1.00 41.58  ?  40  ILE A CA    1 
ATOM   160  C  C     . ILE A 1 23  ? -16.129 7.554  12.011  1.00 42.44  ?  40  ILE A C     1 
ATOM   161  O  O     . ILE A 1 23  ? -17.251 7.570  12.519  1.00 42.63  ?  40  ILE A O     1 
ATOM   162  C  CB    . ILE A 1 23  ? -15.657 7.570  9.563   1.00 41.96  ?  40  ILE A CB    1 
ATOM   163  C  CG1   . ILE A 1 23  ? -15.426 8.447  8.333   1.00 41.77  ?  40  ILE A CG1   1 
ATOM   164  C  CG2   . ILE A 1 23  ? -16.889 6.698  9.376   1.00 42.32  ?  40  ILE A CG2   1 
ATOM   165  C  CD1   . ILE A 1 23  ? -15.287 7.662  7.055   1.00 42.65  ?  40  ILE A CD1   1 
ATOM   166  N  N     . ASN A 1 24  ? -15.143 6.780  12.453  1.00 50.17  ?  41  ASN A N     1 
ATOM   167  C  CA    . ASN A 1 24  ? -15.323 5.912  13.608  1.00 51.81  ?  41  ASN A CA    1 
ATOM   168  C  C     . ASN A 1 24  ? -15.547 6.730  14.871  1.00 52.16  ?  41  ASN A C     1 
ATOM   169  O  O     . ASN A 1 24  ? -16.223 6.285  15.794  1.00 54.10  ?  41  ASN A O     1 
ATOM   170  C  CB    . ASN A 1 24  ? -14.113 4.993  13.790  1.00 52.87  ?  41  ASN A CB    1 
ATOM   171  C  CG    . ASN A 1 24  ? -13.792 4.194  12.542  1.00 52.85  ?  41  ASN A CG    1 
ATOM   172  O  OD1   . ASN A 1 24  ? -14.587 4.137  11.605  1.00 52.25  ?  41  ASN A OD1   1 
ATOM   173  N  ND2   . ASN A 1 24  ? -12.621 3.568  12.527  1.00 53.96  ?  41  ASN A ND2   1 
ATOM   174  N  N     . THR A 1 25  ? -14.981 7.933  14.903  1.00 48.76  ?  42  THR A N     1 
ATOM   175  C  CA    . THR A 1 25  ? -15.212 8.859  16.004  1.00 49.29  ?  42  THR A CA    1 
ATOM   176  C  C     . THR A 1 25  ? -16.669 9.303  16.023  1.00 48.90  ?  42  THR A C     1 
ATOM   177  O  O     . THR A 1 25  ? -17.308 9.340  17.075  1.00 50.25  ?  42  THR A O     1 
ATOM   178  C  CB    . THR A 1 25  ? -14.302 10.100 15.905  1.00 48.92  ?  42  THR A CB    1 
ATOM   179  O  OG1   . THR A 1 25  ? -12.928 9.694  15.947  1.00 49.78  ?  42  THR A OG1   1 
ATOM   180  C  CG2   . THR A 1 25  ? -14.577 11.061 17.052  1.00 49.88  ?  42  THR A CG2   1 
ATOM   181  N  N     . LEU A 1 26  ? -17.182 9.636  14.844  1.00 55.03  ?  43  LEU A N     1 
ATOM   182  C  CA    . LEU A 1 26  ? -18.553 10.109 14.693  1.00 54.94  ?  43  LEU A CA    1 
ATOM   183  C  C     . LEU A 1 26  ? -19.582 9.035  15.045  1.00 56.39  ?  43  LEU A C     1 
ATOM   184  O  O     . LEU A 1 26  ? -20.610 9.331  15.655  1.00 57.67  ?  43  LEU A O     1 
ATOM   185  C  CB    . LEU A 1 26  ? -18.771 10.612 13.262  1.00 54.25  ?  43  LEU A CB    1 
ATOM   186  C  CG    . LEU A 1 26  ? -20.168 11.066 12.847  1.00 54.33  ?  43  LEU A CG    1 
ATOM   187  C  CD1   . LEU A 1 26  ? -20.096 12.387 12.099  1.00 54.84  ?  43  LEU A CD1   1 
ATOM   188  C  CD2   . LEU A 1 26  ? -20.809 10.004 11.978  1.00 54.75  ?  43  LEU A CD2   1 
ATOM   189  N  N     . PHE A 1 27  ? -19.306 7.792  14.662  1.00 52.74  ?  44  PHE A N     1 
ATOM   190  C  CA    . PHE A 1 27  ? -20.229 6.693  14.933  1.00 55.17  ?  44  PHE A CA    1 
ATOM   191  C  C     . PHE A 1 27  ? -20.134 6.220  16.381  1.00 59.05  ?  44  PHE A C     1 
ATOM   192  O  O     . PHE A 1 27  ? -21.131 5.802  16.970  1.00 62.84  ?  44  PHE A O     1 
ATOM   193  C  CB    . PHE A 1 27  ? -19.965 5.523  13.984  1.00 55.03  ?  44  PHE A CB    1 
ATOM   194  C  CG    . PHE A 1 27  ? -20.683 5.634  12.669  1.00 53.59  ?  44  PHE A CG    1 
ATOM   195  C  CD1   . PHE A 1 27  ? -22.006 6.042  12.619  1.00 53.97  ?  44  PHE A CD1   1 
ATOM   196  C  CD2   . PHE A 1 27  ? -20.038 5.322  11.483  1.00 52.56  ?  44  PHE A CD2   1 
ATOM   197  C  CE1   . PHE A 1 27  ? -22.670 6.142  11.410  1.00 53.30  ?  44  PHE A CE1   1 
ATOM   198  C  CE2   . PHE A 1 27  ? -20.696 5.421  10.272  1.00 52.36  ?  44  PHE A CE2   1 
ATOM   199  C  CZ    . PHE A 1 27  ? -22.014 5.831  10.236  1.00 52.69  ?  44  PHE A CZ    1 
ATOM   200  N  N     . LYS A 1 28  ? -18.935 6.291  16.953  1.00 64.87  ?  45  LYS A N     1 
ATOM   201  C  CA    . LYS A 1 28  ? -18.717 5.880  18.339  1.00 68.93  ?  45  LYS A CA    1 
ATOM   202  C  C     . LYS A 1 28  ? -19.083 7.002  19.304  1.00 69.79  ?  45  LYS A C     1 
ATOM   203  O  O     . LYS A 1 28  ? -18.571 7.067  20.421  1.00 71.78  ?  45  LYS A O     1 
ATOM   204  C  CB    . LYS A 1 28  ? -17.266 5.449  18.561  1.00 68.00  ?  45  LYS A CB    1 
ATOM   205  N  N     . SER A 1 29  ? -19.972 7.884  18.862  1.00 89.63  ?  46  SER A N     1 
ATOM   206  C  CA    . SER A 1 29  ? -20.435 8.993  19.682  1.00 90.35  ?  46  SER A CA    1 
ATOM   207  C  C     . SER A 1 29  ? -21.945 8.922  19.847  1.00 93.85  ?  46  SER A C     1 
ATOM   208  O  O     . SER A 1 29  ? -22.572 9.853  20.353  1.00 94.62  ?  46  SER A O     1 
ATOM   209  C  CB    . SER A 1 29  ? -20.033 10.328 19.056  1.00 86.16  ?  46  SER A CB    1 
ATOM   210  O  OG    . SER A 1 29  ? -20.722 11.401 19.671  1.00 87.25  ?  46  SER A OG    1 
ATOM   211  N  N     . LYS A 1 30  ? -22.519 7.802  19.422  1.00 90.89  ?  47  LYS A N     1 
ATOM   212  C  CA    . LYS A 1 30  ? -23.961 7.607  19.467  1.00 93.79  ?  47  LYS A CA    1 
ATOM   213  C  C     . LYS A 1 30  ? -24.335 6.471  20.414  1.00 101.16 ?  47  LYS A C     1 
ATOM   214  O  O     . LYS A 1 30  ? -23.971 5.317  20.187  1.00 102.20 ?  47  LYS A O     1 
ATOM   215  C  CB    . LYS A 1 30  ? -24.499 7.323  18.064  1.00 89.68  ?  47  LYS A CB    1 
ATOM   216  C  CG    . LYS A 1 30  ? -24.022 8.298  16.989  1.00 83.93  ?  47  LYS A CG    1 
ATOM   217  C  CD    . LYS A 1 30  ? -24.881 9.556  16.929  1.00 82.88  ?  47  LYS A CD    1 
ATOM   218  C  CE    . LYS A 1 30  ? -24.317 10.678 17.787  1.00 83.14  ?  47  LYS A CE    1 
ATOM   219  N  NZ    . LYS A 1 30  ? -25.207 11.871 17.795  1.00 82.98  1  47  LYS A NZ    1 
ATOM   220  N  N     . ARG A 1 43  ? -4.693  -0.038 14.461  1.00 73.11  ?  60  ARG A N     1 
ATOM   221  C  CA    . ARG A 1 43  ? -4.380  0.749  13.274  1.00 71.66  ?  60  ARG A CA    1 
ATOM   222  C  C     . ARG A 1 43  ? -5.501  0.693  12.244  1.00 69.47  ?  60  ARG A C     1 
ATOM   223  O  O     . ARG A 1 43  ? -5.894  -0.386 11.800  1.00 70.41  ?  60  ARG A O     1 
ATOM   224  C  CB    . ARG A 1 43  ? -3.078  0.262  12.632  1.00 74.46  ?  60  ARG A CB    1 
ATOM   225  C  CG    . ARG A 1 43  ? -2.640  1.086  11.428  1.00 73.85  ?  60  ARG A CG    1 
ATOM   226  C  CD    . ARG A 1 43  ? -2.007  0.214  10.353  1.00 76.28  ?  60  ARG A CD    1 
ATOM   227  N  NE    . ARG A 1 43  ? -1.545  1.002  9.213   1.00 76.58  ?  60  ARG A NE    1 
ATOM   228  C  CZ    . ARG A 1 43  ? -1.464  0.541  7.968   1.00 78.06  ?  60  ARG A CZ    1 
ATOM   229  N  NH1   . ARG A 1 43  ? -1.820  -0.706 7.694   1.00 79.14  1  60  ARG A NH1   1 
ATOM   230  N  NH2   . ARG A 1 43  ? -1.030  1.330  6.993   1.00 78.59  ?  60  ARG A NH2   1 
ATOM   231  N  N     . ILE A 1 44  ? -6.015  1.859  11.866  1.00 53.18  ?  61  ILE A N     1 
ATOM   232  C  CA    . ILE A 1 44  ? -6.957  1.942  10.759  1.00 51.42  ?  61  ILE A CA    1 
ATOM   233  C  C     . ILE A 1 44  ? -6.179  1.815  9.458   1.00 52.71  ?  61  ILE A C     1 
ATOM   234  O  O     . ILE A 1 44  ? -5.290  2.621  9.186   1.00 53.29  ?  61  ILE A O     1 
ATOM   235  C  CB    . ILE A 1 44  ? -7.753  3.260  10.766  1.00 48.77  ?  61  ILE A CB    1 
ATOM   236  C  CG1   . ILE A 1 44  ? -8.565  3.388  12.055  1.00 47.94  ?  61  ILE A CG1   1 
ATOM   237  C  CG2   . ILE A 1 44  ? -8.669  3.332  9.553   1.00 47.47  ?  61  ILE A CG2   1 
ATOM   238  C  CD1   . ILE A 1 44  ? -9.441  4.622  12.103  1.00 45.68  ?  61  ILE A CD1   1 
ATOM   239  N  N     . PRO A 1 45  ? -6.505  0.796  8.649   1.00 59.17  ?  62  PRO A N     1 
ATOM   240  C  CA    . PRO A 1 45  ? -5.749  0.551  7.417   1.00 61.12  ?  62  PRO A CA    1 
ATOM   241  C  C     . PRO A 1 45  ? -5.893  1.681  6.402   1.00 60.03  ?  62  PRO A C     1 
ATOM   242  O  O     . PRO A 1 45  ? -6.775  2.531  6.532   1.00 57.56  ?  62  PRO A O     1 
ATOM   243  C  CB    . PRO A 1 45  ? -6.364  -0.746 6.881   1.00 62.32  ?  62  PRO A CB    1 
ATOM   244  C  CG    . PRO A 1 45  ? -7.736  -0.780 7.463   1.00 60.18  ?  62  PRO A CG    1 
ATOM   245  C  CD    . PRO A 1 45  ? -7.606  -0.167 8.825   1.00 59.03  ?  62  PRO A CD    1 
ATOM   246  N  N     . LYS A 1 46  ? -5.025  1.677  5.398   1.00 56.88  ?  63  LYS A N     1 
ATOM   247  C  CA    . LYS A 1 46  ? -5.056  2.678  4.342   1.00 56.87  ?  63  LYS A CA    1 
ATOM   248  C  C     . LYS A 1 46  ? -6.286  2.503  3.456   1.00 55.84  ?  63  LYS A C     1 
ATOM   249  O  O     . LYS A 1 46  ? -6.530  1.420  2.925   1.00 57.22  ?  63  LYS A O     1 
ATOM   250  C  CB    . LYS A 1 46  ? -3.774  2.596  3.512   1.00 60.53  ?  63  LYS A CB    1 
ATOM   251  C  CG    . LYS A 1 46  ? -3.684  3.582  2.364   1.00 61.62  ?  63  LYS A CG    1 
ATOM   252  C  CD    . LYS A 1 46  ? -2.254  3.697  1.843   1.00 65.70  ?  63  LYS A CD    1 
ATOM   253  C  CE    . LYS A 1 46  ? -1.636  2.334  1.543   1.00 68.66  ?  63  LYS A CE    1 
ATOM   254  N  NZ    . LYS A 1 46  ? -1.150  1.629  2.767   1.00 68.50  1  63  LYS A NZ    1 
ATOM   255  N  N     . THR A 1 47  ? -7.056  3.575  3.301   1.00 53.80  ?  64  THR A N     1 
ATOM   256  C  CA    . THR A 1 47  ? -8.283  3.527  2.513   1.00 52.96  ?  64  THR A CA    1 
ATOM   257  C  C     . THR A 1 47  ? -7.970  3.510  1.021   1.00 55.74  ?  64  THR A C     1 
ATOM   258  O  O     . THR A 1 47  ? -7.547  4.518  0.456   1.00 56.75  ?  64  THR A O     1 
ATOM   259  C  CB    . THR A 1 47  ? -9.203  4.723  2.823   1.00 50.34  ?  64  THR A CB    1 
ATOM   260  O  OG1   . THR A 1 47  ? -9.333  4.874  4.242   1.00 48.34  ?  64  THR A OG1   1 
ATOM   261  C  CG2   . THR A 1 47  ? -10.580 4.509  2.212   1.00 49.57  ?  64  THR A CG2   1 
ATOM   262  N  N     . ILE A 1 48  ? -8.179  2.360  0.389   1.00 57.48  ?  65  ILE A N     1 
ATOM   263  C  CA    . ILE A 1 48  ? -7.839  2.189  -1.018  1.00 60.83  ?  65  ILE A CA    1 
ATOM   264  C  C     . ILE A 1 48  ? -9.072  2.263  -1.915  1.00 60.74  ?  65  ILE A C     1 
ATOM   265  O  O     . ILE A 1 48  ? -8.965  2.571  -3.102  1.00 63.33  ?  65  ILE A O     1 
ATOM   266  C  CB    . ILE A 1 48  ? -7.110  0.851  -1.264  1.00 63.88  ?  65  ILE A CB    1 
ATOM   267  C  CG1   . ILE A 1 48  ? -8.013  -0.332 -0.910  1.00 63.18  ?  65  ILE A CG1   1 
ATOM   268  C  CG2   . ILE A 1 48  ? -5.822  0.793  -0.460  1.00 64.63  ?  65  ILE A CG2   1 
ATOM   269  C  CD1   . ILE A 1 48  ? -7.375  -1.682 -1.164  1.00 66.58  ?  65  ILE A CD1   1 
ATOM   270  N  N     . GLU A 1 49  ? -10.240 1.979  -1.347  1.00 58.25  ?  66  GLU A N     1 
ATOM   271  C  CA    . GLU A 1 49  ? -11.483 2.010  -2.110  1.00 58.35  ?  66  GLU A CA    1 
ATOM   272  C  C     . GLU A 1 49  ? -12.559 2.832  -1.408  1.00 55.02  ?  66  GLU A C     1 
ATOM   273  O  O     . GLU A 1 49  ? -12.543 2.983  -0.187  1.00 52.61  ?  66  GLU A O     1 
ATOM   274  C  CB    . GLU A 1 49  ? -11.992 0.588  -2.358  1.00 59.97  ?  66  GLU A CB    1 
ATOM   275  N  N     . ILE A 1 50  ? -13.491 3.362  -2.193  1.00 63.26  ?  67  ILE A N     1 
ATOM   276  C  CA    . ILE A 1 50  ? -14.630 4.094  -1.653  1.00 62.56  ?  67  ILE A CA    1 
ATOM   277  C  C     . ILE A 1 50  ? -15.581 3.153  -0.919  1.00 59.12  ?  67  ILE A C     1 
ATOM   278  O  O     . ILE A 1 50  ? -16.100 2.202  -1.503  1.00 61.75  ?  67  ILE A O     1 
ATOM   279  C  CB    . ILE A 1 50  ? -15.398 4.838  -2.762  1.00 69.97  ?  67  ILE A CB    1 
ATOM   280  C  CG1   . ILE A 1 50  ? -14.503 5.895  -3.410  1.00 73.45  ?  67  ILE A CG1   1 
ATOM   281  C  CG2   . ILE A 1 50  ? -16.653 5.481  -2.202  1.00 69.43  ?  67  ILE A CG2   1 
ATOM   282  C  CD1   . ILE A 1 50  ? -15.131 6.579  -4.605  1.00 81.33  ?  67  ILE A CD1   1 
ATOM   283  N  N     . LYS A 1 51  ? -15.807 3.425  0.363   1.00 91.64  ?  68  LYS A N     1 
ATOM   284  C  CA    . LYS A 1 51  ? -16.637 2.559  1.192   1.00 88.02  ?  68  LYS A CA    1 
ATOM   285  C  C     . LYS A 1 51  ? -17.750 3.330  1.886   1.00 86.02  ?  68  LYS A C     1 
ATOM   286  O  O     . LYS A 1 51  ? -17.500 4.337  2.547   1.00 84.14  ?  68  LYS A O     1 
ATOM   287  C  CB    . LYS A 1 51  ? -15.782 1.849  2.245   1.00 83.69  ?  68  LYS A CB    1 
ATOM   288  C  CG    . LYS A 1 51  ? -14.761 0.874  1.688   1.00 85.45  ?  68  LYS A CG    1 
ATOM   289  C  CD    . LYS A 1 51  ? -13.821 0.387  2.782   1.00 81.88  ?  68  LYS A CD    1 
ATOM   290  C  CE    . LYS A 1 51  ? -14.592 -0.189 3.962   1.00 79.77  ?  68  LYS A CE    1 
ATOM   291  N  NZ    . LYS A 1 51  ? -13.685 -0.635 5.058   1.00 78.74  1  68  LYS A NZ    1 
ATOM   292  N  N     . SER A 1 52  ? -18.980 2.852  1.731   1.00 56.40  ?  69  SER A N     1 
ATOM   293  C  CA    . SER A 1 52  ? -20.113 3.429  2.440   1.00 54.07  ?  69  SER A CA    1 
ATOM   294  C  C     . SER A 1 52  ? -20.331 2.674  3.746   1.00 50.56  ?  69  SER A C     1 
ATOM   295  O  O     . SER A 1 52  ? -20.321 1.443  3.766   1.00 52.34  ?  69  SER A O     1 
ATOM   296  C  CB    . SER A 1 52  ? -21.377 3.388  1.578   1.00 57.52  ?  69  SER A CB    1 
ATOM   297  O  OG    . SER A 1 52  ? -21.246 4.220  0.439   1.00 63.32  ?  69  SER A OG    1 
ATOM   298  N  N     . ILE A 1 53  ? -20.525 3.409  4.835   1.00 56.01  ?  70  ILE A N     1 
ATOM   299  C  CA    . ILE A 1 53  ? -20.776 2.790  6.131   1.00 53.63  ?  70  ILE A CA    1 
ATOM   300  C  C     . ILE A 1 53  ? -22.072 3.319  6.729   1.00 53.02  ?  70  ILE A C     1 
ATOM   301  O  O     . ILE A 1 53  ? -22.224 4.523  6.933   1.00 52.45  ?  70  ILE A O     1 
ATOM   302  C  CB    . ILE A 1 53  ? -19.615 3.038  7.114   1.00 51.72  ?  70  ILE A CB    1 
ATOM   303  C  CG1   . ILE A 1 53  ? -18.298 2.524  6.526   1.00 52.49  ?  70  ILE A CG1   1 
ATOM   304  C  CG2   . ILE A 1 53  ? -19.895 2.367  8.448   1.00 51.80  ?  70  ILE A CG2   1 
ATOM   305  C  CD1   . ILE A 1 53  ? -17.072 2.942  7.309   1.00 50.98  ?  70  ILE A CD1   1 
ATOM   306  N  N     . THR A 1 54  ? -22.999 2.412  7.017   1.00 46.68  ?  71  THR A N     1 
ATOM   307  C  CA    . THR A 1 54  ? -24.332 2.797  7.466   1.00 47.40  ?  71  THR A CA    1 
ATOM   308  C  C     . THR A 1 54  ? -24.672 2.218  8.837   1.00 48.94  ?  71  THR A C     1 
ATOM   309  O  O     . THR A 1 54  ? -24.450 1.036  9.097   1.00 50.91  ?  71  THR A O     1 
ATOM   310  C  CB    . THR A 1 54  ? -25.407 2.352  6.452   1.00 49.48  ?  71  THR A CB    1 
ATOM   311  O  OG1   . THR A 1 54  ? -25.138 2.948  5.177   1.00 48.57  ?  71  THR A OG1   1 
ATOM   312  C  CG2   . THR A 1 54  ? -26.796 2.767  6.917   1.00 50.66  ?  71  THR A CG2   1 
ATOM   313  N  N     . HIS A 1 55  ? -25.210 3.065  9.709   1.00 55.86  ?  72  HIS A N     1 
ATOM   314  C  CA    . HIS A 1 55  ? -25.664 2.639  11.027  1.00 57.95  ?  72  HIS A CA    1 
ATOM   315  C  C     . HIS A 1 55  ? -26.911 3.421  11.425  1.00 58.59  ?  72  HIS A C     1 
ATOM   316  O  O     . HIS A 1 55  ? -26.987 4.631  11.215  1.00 56.71  ?  72  HIS A O     1 
ATOM   317  C  CB    . HIS A 1 55  ? -24.563 2.823  12.073  1.00 57.66  ?  72  HIS A CB    1 
ATOM   318  C  CG    . HIS A 1 55  ? -23.451 1.827  11.962  1.00 58.46  ?  72  HIS A CG    1 
ATOM   319  N  ND1   . HIS A 1 55  ? -22.246 2.119  11.361  1.00 56.34  ?  72  HIS A ND1   1 
ATOM   320  C  CD2   . HIS A 1 55  ? -23.364 0.540  12.375  1.00 61.74  ?  72  HIS A CD2   1 
ATOM   321  C  CE1   . HIS A 1 55  ? -21.463 1.056  11.409  1.00 57.88  ?  72  HIS A CE1   1 
ATOM   322  N  NE2   . HIS A 1 55  ? -22.117 0.084  12.019  1.00 61.24  ?  72  HIS A NE2   1 
ATOM   323  N  N     . ASP A 1 56  ? -27.886 2.725  12.001  1.00 75.66  ?  73  ASP A N     1 
ATOM   324  C  CA    . ASP A 1 56  ? -29.113 3.370  12.450  1.00 77.18  ?  73  ASP A CA    1 
ATOM   325  C  C     . ASP A 1 56  ? -28.943 3.962  13.843  1.00 77.75  ?  73  ASP A C     1 
ATOM   326  O  O     . ASP A 1 56  ? -28.607 3.256  14.794  1.00 80.32  ?  73  ASP A O     1 
ATOM   327  C  CB    . ASP A 1 56  ? -30.276 2.376  12.436  1.00 81.33  ?  73  ASP A CB    1 
ATOM   328  C  CG    . ASP A 1 56  ? -30.662 1.950  11.033  1.00 81.65  ?  73  ASP A CG    1 
ATOM   329  O  OD1   . ASP A 1 56  ? -30.204 2.598  10.068  1.00 78.72  ?  73  ASP A OD1   1 
ATOM   330  O  OD2   . ASP A 1 56  ? -31.422 0.969  10.894  1.00 85.13  -1 73  ASP A OD2   1 
ATOM   331  N  N     . ILE A 1 57  ? -29.179 5.265  13.953  1.00 72.57  ?  74  ILE A N     1 
ATOM   332  C  CA    . ILE A 1 57  ? -29.028 5.969  15.219  1.00 73.79  ?  74  ILE A CA    1 
ATOM   333  C  C     . ILE A 1 57  ? -30.306 6.715  15.593  1.00 75.48  ?  74  ILE A C     1 
ATOM   334  O  O     . ILE A 1 57  ? -30.949 7.327  14.740  1.00 74.62  ?  74  ILE A O     1 
ATOM   335  C  CB    . ILE A 1 57  ? -27.851 6.959  15.168  1.00 70.83  ?  74  ILE A CB    1 
ATOM   336  C  CG1   . ILE A 1 57  ? -27.881 7.758  13.864  1.00 67.74  ?  74  ILE A CG1   1 
ATOM   337  C  CG2   . ILE A 1 57  ? -26.533 6.216  15.296  1.00 70.65  ?  74  ILE A CG2   1 
ATOM   338  C  CD1   . ILE A 1 57  ? -26.942 8.943  13.853  1.00 65.30  ?  74  ILE A CD1   1 
ATOM   339  N  N     . GLU A 1 58  ? -30.672 6.656  16.869  1.00 127.64 ?  75  GLU A N     1 
ATOM   340  C  CA    . GLU A 1 58  ? -31.875 7.327  17.348  1.00 130.12 ?  75  GLU A CA    1 
ATOM   341  C  C     . GLU A 1 58  ? -31.532 8.574  18.158  1.00 129.74 ?  75  GLU A C     1 
ATOM   342  O  O     . GLU A 1 58  ? -31.374 8.510  19.377  1.00 132.88 ?  75  GLU A O     1 
ATOM   343  C  CB    . GLU A 1 58  ? -32.721 6.371  18.192  1.00 135.02 ?  75  GLU A CB    1 
ATOM   344  N  N     . GLU A 1 59  ? -31.420 9.706  17.471  1.00 87.74  ?  76  GLU A N     1 
ATOM   345  C  CA    . GLU A 1 59  ? -31.099 10.970 18.123  1.00 87.32  ?  76  GLU A CA    1 
ATOM   346  C  C     . GLU A 1 59  ? -32.282 11.488 18.934  1.00 91.20  ?  76  GLU A C     1 
ATOM   347  O  O     . GLU A 1 59  ? -33.361 11.728 18.392  1.00 92.04  ?  76  GLU A O     1 
ATOM   348  C  CB    . GLU A 1 59  ? -30.672 12.014 17.088  1.00 83.29  ?  76  GLU A CB    1 
ATOM   349  N  N     . GLY A 1 61  ? -35.235 10.558 19.817  1.00 108.65 ?  78  GLY A N     1 
ATOM   350  C  CA    . GLY A 1 61  ? -36.641 10.707 19.493  1.00 106.99 ?  78  GLY A CA    1 
ATOM   351  C  C     . GLY A 1 61  ? -36.986 10.132 18.134  1.00 103.47 ?  78  GLY A C     1 
ATOM   352  O  O     . GLY A 1 61  ? -37.996 9.445  17.978  1.00 102.63 ?  78  GLY A O     1 
ATOM   353  N  N     . VAL A 1 62  ? -36.142 10.411 17.145  1.00 70.75  ?  79  VAL A N     1 
ATOM   354  C  CA    . VAL A 1 62  ? -36.377 9.934  15.788  1.00 67.70  ?  79  VAL A CA    1 
ATOM   355  C  C     . VAL A 1 62  ? -35.161 9.165  15.273  1.00 66.07  ?  79  VAL A C     1 
ATOM   356  O  O     . VAL A 1 62  ? -34.016 9.533  15.540  1.00 66.47  ?  79  VAL A O     1 
ATOM   357  C  CB    . VAL A 1 62  ? -36.697 11.101 14.827  1.00 66.58  ?  79  VAL A CB    1 
ATOM   358  C  CG1   . VAL A 1 62  ? -37.114 10.575 13.465  1.00 65.03  ?  79  VAL A CG1   1 
ATOM   359  C  CG2   . VAL A 1 62  ? -37.792 11.985 15.405  1.00 68.28  ?  79  VAL A CG2   1 
ATOM   360  N  N     . ARG A 1 63  ? -35.426 8.096  14.530  1.00 55.56  ?  80  ARG A N     1 
ATOM   361  C  CA    . ARG A 1 63  ? -34.383 7.250  13.962  1.00 53.60  ?  80  ARG A CA    1 
ATOM   362  C  C     . ARG A 1 63  ? -33.819 7.815  12.663  1.00 53.73  ?  80  ARG A C     1 
ATOM   363  O  O     . ARG A 1 63  ? -34.568 8.235  11.780  1.00 56.15  ?  80  ARG A O     1 
ATOM   364  C  CB    . ARG A 1 63  ? -34.924 5.839  13.728  1.00 54.50  ?  80  ARG A CB    1 
ATOM   365  C  CG    . ARG A 1 63  ? -35.243 5.087  15.010  1.00 54.06  ?  80  ARG A CG    1 
ATOM   366  C  CD    . ARG A 1 63  ? -36.538 4.295  14.899  1.00 56.64  ?  80  ARG A CD    1 
ATOM   367  N  NE    . ARG A 1 63  ? -36.522 3.355  13.782  1.00 57.76  ?  80  ARG A NE    1 
ATOM   368  C  CZ    . ARG A 1 63  ? -37.157 3.553  12.631  1.00 60.36  ?  80  ARG A CZ    1 
ATOM   369  N  NH1   . ARG A 1 63  ? -37.863 4.658  12.443  1.00 62.12  1  80  ARG A NH1   1 
ATOM   370  N  NH2   . ARG A 1 63  ? -37.085 2.645  11.670  1.00 61.68  ?  80  ARG A NH2   1 
ATOM   371  N  N     . MET A 1 64  ? -32.495 7.825  12.553  1.00 51.46  ?  81  MET A N     1 
ATOM   372  C  CA    . MET A 1 64  ? -31.838 8.310  11.347  1.00 51.44  ?  81  MET A CA    1 
ATOM   373  C  C     . MET A 1 64  ? -30.931 7.231  10.769  1.00 50.23  ?  81  MET A C     1 
ATOM   374  O  O     . MET A 1 64  ? -30.210 6.552  11.500  1.00 48.58  ?  81  MET A O     1 
ATOM   375  C  CB    . MET A 1 64  ? -31.034 9.578  11.642  1.00 50.42  ?  81  MET A CB    1 
ATOM   376  N  N     . LYS A 1 65  ? -30.968 7.083  9.448   1.00 54.25  ?  82  LYS A N     1 
ATOM   377  C  CA    . LYS A 1 65  ? -30.143 6.094  8.767   1.00 53.97  ?  82  LYS A CA    1 
ATOM   378  C  C     . LYS A 1 65  ? -28.877 6.750  8.231   1.00 53.10  ?  82  LYS A C     1 
ATOM   379  O  O     . LYS A 1 65  ? -28.765 7.037  7.039   1.00 54.39  ?  82  LYS A O     1 
ATOM   380  C  CB    . LYS A 1 65  ? -30.929 5.429  7.635   1.00 56.34  ?  82  LYS A CB    1 
ATOM   381  C  CG    . LYS A 1 65  ? -30.318 4.136  7.122   1.00 57.36  ?  82  LYS A CG    1 
ATOM   382  C  CD    . LYS A 1 65  ? -31.250 3.440  6.143   1.00 60.63  ?  82  LYS A CD    1 
ATOM   383  C  CE    . LYS A 1 65  ? -30.796 2.017  5.863   1.00 63.52  ?  82  LYS A CE    1 
ATOM   384  N  NZ    . LYS A 1 65  ? -30.925 1.150  7.068   1.00 63.39  1  82  LYS A NZ    1 
ATOM   385  N  N     . LEU A 1 66  ? -27.927 6.983  9.129   1.00 47.51  ?  83  LEU A N     1 
ATOM   386  C  CA    . LEU A 1 66  ? -26.695 7.685  8.796   1.00 46.37  ?  83  LEU A CA    1 
ATOM   387  C  C     . LEU A 1 66  ? -25.754 6.834  7.952   1.00 46.22  ?  83  LEU A C     1 
ATOM   388  O  O     . LEU A 1 66  ? -25.385 5.726  8.341   1.00 45.92  ?  83  LEU A O     1 
ATOM   389  C  CB    . LEU A 1 66  ? -25.989 8.130  10.077  1.00 44.86  ?  83  LEU A CB    1 
ATOM   390  C  CG    . LEU A 1 66  ? -24.717 8.963  9.936   1.00 44.03  ?  83  LEU A CG    1 
ATOM   391  C  CD1   . LEU A 1 66  ? -24.957 10.170 9.046   1.00 44.91  ?  83  LEU A CD1   1 
ATOM   392  C  CD2   . LEU A 1 66  ? -24.240 9.394  11.309  1.00 43.36  ?  83  LEU A CD2   1 
ATOM   393  N  N     . THR A 1 67  ? -25.369 7.361  6.795   1.00 59.91  ?  84  THR A N     1 
ATOM   394  C  CA    . THR A 1 67  ? -24.387 6.705  5.942   1.00 60.77  ?  84  THR A CA    1 
ATOM   395  C  C     . THR A 1 67  ? -23.173 7.605  5.750   1.00 59.37  ?  84  THR A C     1 
ATOM   396  O  O     . THR A 1 67  ? -23.298 8.737  5.285   1.00 59.88  ?  84  THR A O     1 
ATOM   397  C  CB    . THR A 1 67  ? -24.974 6.344  4.565   1.00 64.69  ?  84  THR A CB    1 
ATOM   398  O  OG1   . THR A 1 67  ? -26.068 5.434  4.732   1.00 66.42  ?  84  THR A OG1   1 
ATOM   399  C  CG2   . THR A 1 67  ? -23.914 5.698  3.685   1.00 66.99  ?  84  THR A CG2   1 
ATOM   400  N  N     . VAL A 1 68  ? -21.999 7.098  6.110   1.00 44.96  ?  85  VAL A N     1 
ATOM   401  C  CA    . VAL A 1 68  ? -20.765 7.846  5.916   1.00 44.36  ?  85  VAL A CA    1 
ATOM   402  C  C     . VAL A 1 68  ? -19.901 7.190  4.845   1.00 45.13  ?  85  VAL A C     1 
ATOM   403  O  O     . VAL A 1 68  ? -19.567 6.009  4.938   1.00 45.64  ?  85  VAL A O     1 
ATOM   404  C  CB    . VAL A 1 68  ? -19.963 7.970  7.220   1.00 43.40  ?  85  VAL A CB    1 
ATOM   405  C  CG1   . VAL A 1 68  ? -18.741 8.836  6.994   1.00 43.26  ?  85  VAL A CG1   1 
ATOM   406  C  CG2   . VAL A 1 68  ? -20.828 8.568  8.316   1.00 42.97  ?  85  VAL A CG2   1 
ATOM   407  N  N     . ILE A 1 69  ? -19.545 7.966  3.827   1.00 45.53  ?  86  ILE A N     1 
ATOM   408  C  CA    . ILE A 1 69  ? -18.774 7.454  2.702   1.00 46.56  ?  86  ILE A CA    1 
ATOM   409  C  C     . ILE A 1 69  ? -17.300 7.834  2.804   1.00 46.08  ?  86  ILE A C     1 
ATOM   410  O  O     . ILE A 1 69  ? -16.939 9.004  2.673   1.00 45.69  ?  86  ILE A O     1 
ATOM   411  C  CB    . ILE A 1 69  ? -19.336 7.967  1.364   1.00 47.91  ?  86  ILE A CB    1 
ATOM   412  C  CG1   . ILE A 1 69  ? -20.827 7.640  1.253   1.00 49.04  ?  86  ILE A CG1   1 
ATOM   413  C  CG2   . ILE A 1 69  ? -18.574 7.361  0.203   1.00 49.30  ?  86  ILE A CG2   1 
ATOM   414  C  CD1   . ILE A 1 69  ? -21.675 8.797  0.775   1.00 49.92  ?  86  ILE A CD1   1 
ATOM   415  N  N     . ASP A 1 70  ? -16.453 6.837  3.041   1.00 46.55  ?  87  ASP A N     1 
ATOM   416  C  CA    . ASP A 1 70  ? -15.017 7.060  3.155   1.00 46.71  ?  87  ASP A CA    1 
ATOM   417  C  C     . ASP A 1 70  ? -14.368 7.075  1.777   1.00 47.90  ?  87  ASP A C     1 
ATOM   418  O  O     . ASP A 1 70  ? -14.735 6.293  0.901   1.00 49.14  ?  87  ASP A O     1 
ATOM   419  C  CB    . ASP A 1 70  ? -14.373 5.983  4.029   1.00 47.37  ?  87  ASP A CB    1 
ATOM   420  C  CG    . ASP A 1 70  ? -13.016 6.398  4.563   1.00 47.77  ?  87  ASP A CG    1 
ATOM   421  O  OD1   . ASP A 1 70  ? -12.695 7.604  4.502   1.00 47.18  ?  87  ASP A OD1   1 
ATOM   422  O  OD2   . ASP A 1 70  ? -12.271 5.520  5.045   1.00 49.11  -1 87  ASP A OD2   1 
ATOM   423  N  N     . THR A 1 71  ? -13.401 7.967  1.588   1.00 47.84  ?  88  THR A N     1 
ATOM   424  C  CA    . THR A 1 71  ? -12.726 8.095  0.302   1.00 49.02  ?  88  THR A CA    1 
ATOM   425  C  C     . THR A 1 71  ? -11.212 7.983  0.446   1.00 49.95  ?  88  THR A C     1 
ATOM   426  O  O     . THR A 1 71  ? -10.649 8.403  1.457   1.00 49.55  ?  88  THR A O     1 
ATOM   427  C  CB    . THR A 1 71  ? -13.060 9.440  -0.376  1.00 48.64  ?  88  THR A CB    1 
ATOM   428  O  OG1   . THR A 1 71  ? -12.634 10.521 0.465   1.00 47.73  ?  88  THR A OG1   1 
ATOM   429  C  CG2   . THR A 1 71  ? -14.555 9.558  -0.628  1.00 48.48  ?  88  THR A CG2   1 
ATOM   430  N  N     . PRO A 1 72  ? -10.546 7.409  -0.568  1.00 51.66  ?  89  PRO A N     1 
ATOM   431  C  CA    . PRO A 1 72  ? -9.081  7.363  -0.595  1.00 53.06  ?  89  PRO A CA    1 
ATOM   432  C  C     . PRO A 1 72  ? -8.486  8.759  -0.743  1.00 52.58  ?  89  PRO A C     1 
ATOM   433  O  O     . PRO A 1 72  ? -8.998  9.560  -1.526  1.00 52.01  ?  89  PRO A O     1 
ATOM   434  C  CB    . PRO A 1 72  ? -8.775  6.497  -1.821  1.00 55.16  ?  89  PRO A CB    1 
ATOM   435  C  CG    . PRO A 1 72  ? -9.987  6.611  -2.680  1.00 54.73  ?  89  PRO A CG    1 
ATOM   436  C  CD    . PRO A 1 72  ? -11.140 6.726  -1.731  1.00 52.87  ?  89  PRO A CD    1 
ATOM   437  N  N     . GLY A 1 73  ? -7.425  9.045  0.005   1.00 55.95  ?  90  GLY A N     1 
ATOM   438  C  CA    . GLY A 1 73  ? -6.793  10.351 -0.040  1.00 55.95  ?  90  GLY A CA    1 
ATOM   439  C  C     . GLY A 1 73  ? -6.184  10.685 -1.389  1.00 57.07  ?  90  GLY A C     1 
ATOM   440  O  O     . GLY A 1 73  ? -5.741  9.800  -2.120  1.00 58.58  ?  90  GLY A O     1 
ATOM   441  N  N     . PHE A 1 74  ? -6.161  11.973 -1.715  1.00 62.64  ?  91  PHE A N     1 
ATOM   442  C  CA    . PHE A 1 74  ? -5.549  12.444 -2.951  1.00 62.85  ?  91  PHE A CA    1 
ATOM   443  C  C     . PHE A 1 74  ? -4.372  13.364 -2.647  1.00 63.28  ?  91  PHE A C     1 
ATOM   444  O  O     . PHE A 1 74  ? -3.994  13.538 -1.490  1.00 63.83  ?  91  PHE A O     1 
ATOM   445  C  CB    . PHE A 1 74  ? -6.578  13.165 -3.825  1.00 62.44  ?  91  PHE A CB    1 
ATOM   446  C  CG    . PHE A 1 74  ? -7.394  14.189 -3.089  1.00 61.29  ?  91  PHE A CG    1 
ATOM   447  C  CD1   . PHE A 1 74  ? -6.920  15.479 -2.911  1.00 60.66  ?  91  PHE A CD1   1 
ATOM   448  C  CD2   . PHE A 1 74  ? -8.638  13.862 -2.576  1.00 61.16  ?  91  PHE A CD2   1 
ATOM   449  C  CE1   . PHE A 1 74  ? -7.671  16.422 -2.236  1.00 59.97  ?  91  PHE A CE1   1 
ATOM   450  C  CE2   . PHE A 1 74  ? -9.391  14.800 -1.899  1.00 60.37  ?  91  PHE A CE2   1 
ATOM   451  C  CZ    . PHE A 1 74  ? -8.908  16.081 -1.729  1.00 59.82  ?  91  PHE A CZ    1 
ATOM   452  N  N     . GLY A 1 75  ? -3.788  13.944 -3.691  1.00 88.40  ?  92  GLY A N     1 
ATOM   453  C  CA    . GLY A 1 75  ? -2.662  14.845 -3.528  1.00 89.95  ?  92  GLY A CA    1 
ATOM   454  C  C     . GLY A 1 75  ? -1.367  14.103 -3.276  1.00 92.19  ?  92  GLY A C     1 
ATOM   455  O  O     . GLY A 1 75  ? -0.352  14.701 -2.919  1.00 94.15  ?  92  GLY A O     1 
ATOM   456  N  N     . ASP A 1 76  ? -1.406  12.789 -3.465  1.00 75.15  ?  93  ASP A N     1 
ATOM   457  C  CA    . ASP A 1 76  ? -0.254  11.935 -3.209  1.00 77.87  ?  93  ASP A CA    1 
ATOM   458  C  C     . ASP A 1 76  ? 0.566   11.668 -4.469  1.00 79.91  ?  93  ASP A C     1 
ATOM   459  O  O     . ASP A 1 76  ? 1.719   11.251 -4.388  1.00 82.52  ?  93  ASP A O     1 
ATOM   460  C  CB    . ASP A 1 76  ? -0.705  10.612 -2.585  1.00 78.15  ?  93  ASP A CB    1 
ATOM   461  C  CG    . ASP A 1 76  ? -1.830  9.953  -3.358  1.00 76.74  ?  93  ASP A CG    1 
ATOM   462  O  OD1   . ASP A 1 76  ? -2.121  10.394 -4.490  1.00 76.53  ?  93  ASP A OD1   1 
ATOM   463  O  OD2   . ASP A 1 76  ? -2.424  8.987  -2.834  1.00 76.95  -1 93  ASP A OD2   1 
ATOM   464  N  N     . HIS A 1 77  ? -0.039  11.894 -5.632  1.00 65.45  ?  94  HIS A N     1 
ATOM   465  C  CA    . HIS A 1 77  ? 0.623   11.609 -6.901  1.00 67.60  ?  94  HIS A CA    1 
ATOM   466  C  C     . HIS A 1 77  ? 1.213   12.865 -7.537  1.00 68.20  ?  94  HIS A C     1 
ATOM   467  O  O     . HIS A 1 77  ? 1.154   13.951 -6.961  1.00 67.17  ?  94  HIS A O     1 
ATOM   468  C  CB    . HIS A 1 77  ? -0.357  10.950 -7.875  1.00 67.04  ?  94  HIS A CB    1 
ATOM   469  C  CG    . HIS A 1 77  ? -0.793  9.580  -7.459  1.00 67.32  ?  94  HIS A CG    1 
ATOM   470  N  ND1   . HIS A 1 77  ? -1.843  9.364  -6.593  1.00 65.07  ?  94  HIS A ND1   1 
ATOM   471  C  CD2   . HIS A 1 77  ? -0.320  8.355  -7.790  1.00 69.91  ?  94  HIS A CD2   1 
ATOM   472  C  CE1   . HIS A 1 77  ? -1.999  8.065  -6.409  1.00 66.17  ?  94  HIS A CE1   1 
ATOM   473  N  NE2   . HIS A 1 77  ? -1.087  7.431  -7.124  1.00 69.20  ?  94  HIS A NE2   1 
ATOM   474  N  N     . ILE A 1 78  ? 1.782   12.704 -8.728  1.00 104.12 ?  95  ILE A N     1 
ATOM   475  C  CA    . ILE A 1 78  ? 2.331   13.830 -9.476  1.00 105.12 ?  95  ILE A CA    1 
ATOM   476  C  C     . ILE A 1 78  ? 1.227   14.526 -10.262 1.00 103.59 ?  95  ILE A C     1 
ATOM   477  O  O     . ILE A 1 78  ? 1.272   15.735 -10.482 1.00 103.48 ?  95  ILE A O     1 
ATOM   478  C  CB    . ILE A 1 78  ? 3.444   13.384 -10.441 1.00 108.37 ?  95  ILE A CB    1 
ATOM   479  N  N     . ASN A 1 79  ? 0.236   13.747 -10.684 1.00 108.01 ?  96  ASN A N     1 
ATOM   480  C  CA    . ASN A 1 79  ? -0.954  14.284 -11.330 1.00 106.82 ?  96  ASN A CA    1 
ATOM   481  C  C     . ASN A 1 79  ? -2.199  13.826 -10.580 1.00 104.75 ?  96  ASN A C     1 
ATOM   482  O  O     . ASN A 1 79  ? -2.380  12.634 -10.336 1.00 105.23 ?  96  ASN A O     1 
ATOM   483  C  CB    . ASN A 1 79  ? -1.021  13.859 -12.797 1.00 108.83 ?  96  ASN A CB    1 
ATOM   484  C  CG    . ASN A 1 79  ? -0.266  14.805 -13.712 1.00 110.49 ?  96  ASN A CG    1 
ATOM   485  O  OD1   . ASN A 1 79  ? 0.570   15.588 -13.261 1.00 110.25 ?  96  ASN A OD1   1 
ATOM   486  N  ND2   . ASN A 1 79  ? -0.561  14.738 -15.005 1.00 112.30 ?  96  ASN A ND2   1 
ATOM   487  N  N     . ASN A 1 80  ? -3.055  14.775 -10.217 1.00 107.72 ?  97  ASN A N     1 
ATOM   488  C  CA    . ASN A 1 80  ? -4.157  14.486 -9.308  1.00 106.55 ?  97  ASN A CA    1 
ATOM   489  C  C     . ASN A 1 80  ? -5.538  14.634 -9.939  1.00 108.97 ?  97  ASN A C     1 
ATOM   490  O  O     . ASN A 1 80  ? -6.552  14.582 -9.242  1.00 108.46 ?  97  ASN A O     1 
ATOM   491  C  CB    . ASN A 1 80  ? -4.055  15.380 -8.073  1.00 104.51 ?  97  ASN A CB    1 
ATOM   492  C  CG    . ASN A 1 80  ? -2.766  15.159 -7.306  1.00 105.22 ?  97  ASN A CG    1 
ATOM   493  O  OD1   . ASN A 1 80  ? -2.611  14.158 -6.608  1.00 105.13 ?  97  ASN A OD1   1 
ATOM   494  N  ND2   . ASN A 1 80  ? -1.833  16.095 -7.433  1.00 106.38 ?  97  ASN A ND2   1 
ATOM   495  N  N     . GLU A 1 81  ? -5.577  14.822 -11.254 1.00 77.04  ?  98  GLU A N     1 
ATOM   496  C  CA    . GLU A 1 81  ? -6.844  14.828 -11.974 1.00 74.87  ?  98  GLU A CA    1 
ATOM   497  C  C     . GLU A 1 81  ? -7.463  13.435 -11.925 1.00 76.87  ?  98  GLU A C     1 
ATOM   498  O  O     . GLU A 1 81  ? -8.683  13.286 -11.865 1.00 75.72  ?  98  GLU A O     1 
ATOM   499  C  CB    . GLU A 1 81  ? -6.648  15.279 -13.423 1.00 75.27  ?  98  GLU A CB    1 
ATOM   500  N  N     . ASN A 1 82  ? -6.605  12.419 -11.949 1.00 111.87 ?  99  ASN A N     1 
ATOM   501  C  CA    . ASN A 1 82  ? -7.038  11.028 -11.853 1.00 113.09 ?  99  ASN A CA    1 
ATOM   502  C  C     . ASN A 1 82  ? -7.482  10.648 -10.443 1.00 111.54 ?  99  ASN A C     1 
ATOM   503  O  O     . ASN A 1 82  ? -7.931  9.526  -10.206 1.00 111.41 ?  99  ASN A O     1 
ATOM   504  C  CB    . ASN A 1 82  ? -5.918  10.092 -12.312 1.00 116.84 ?  99  ASN A CB    1 
ATOM   505  C  CG    . ASN A 1 82  ? -5.675  10.161 -13.806 1.00 118.92 ?  99  ASN A CG    1 
ATOM   506  O  OD1   . ASN A 1 82  ? -6.615  10.270 -14.594 1.00 118.22 ?  99  ASN A OD1   1 
ATOM   507  N  ND2   . ASN A 1 82  ? -4.410  10.100 -14.204 1.00 121.72 ?  99  ASN A ND2   1 
ATOM   508  N  N     . CYS A 1 83  ? -7.350  11.585 -9.511  1.00 149.88 ?  100 CYS A N     1 
ATOM   509  C  CA    . CYS A 1 83  ? -7.792  11.374 -8.139  1.00 148.04 ?  100 CYS A CA    1 
ATOM   510  C  C     . CYS A 1 83  ? -9.095  12.119 -7.877  1.00 145.87 ?  100 CYS A C     1 
ATOM   511  O  O     . CYS A 1 83  ? -9.906  11.703 -7.049  1.00 145.01 ?  100 CYS A O     1 
ATOM   512  C  CB    . CYS A 1 83  ? -6.717  11.826 -7.150  1.00 148.66 ?  100 CYS A CB    1 
ATOM   513  S  SG    . CYS A 1 83  ? -5.204  10.836 -7.181  1.00 152.03 ?  100 CYS A SG    1 
ATOM   514  N  N     . TRP A 1 84  ? -9.287  13.224 -8.589  1.00 77.98  ?  101 TRP A N     1 
ATOM   515  C  CA    . TRP A 1 84  ? -10.493 14.029 -8.445  1.00 76.82  ?  101 TRP A CA    1 
ATOM   516  C  C     . TRP A 1 84  ? -11.655 13.440 -9.237  1.00 76.58  ?  101 TRP A C     1 
ATOM   517  O  O     . TRP A 1 84  ? -12.796 13.861 -9.077  1.00 75.04  ?  101 TRP A O     1 
ATOM   518  C  CB    . TRP A 1 84  ? -10.230 15.468 -8.894  1.00 73.12  ?  101 TRP A CB    1 
ATOM   519  N  N     . GLN A 1 85  ? -11.357 12.464 -10.088 1.00 62.58  ?  102 GLN A N     1 
ATOM   520  C  CA    . GLN A 1 85  ? -12.368 11.859 -10.955 1.00 62.99  ?  102 GLN A CA    1 
ATOM   521  C  C     . GLN A 1 85  ? -13.220 10.755 -10.299 1.00 63.72  ?  102 GLN A C     1 
ATOM   522  O  O     . GLN A 1 85  ? -14.439 10.750 -10.477 1.00 62.66  ?  102 GLN A O     1 
ATOM   523  C  CB    . GLN A 1 85  ? -11.704 11.306 -12.221 1.00 65.77  ?  102 GLN A CB    1 
ATOM   524  N  N     . PRO A 1 86  ? -12.598 9.813  -9.556  1.00 65.82  ?  103 PRO A N     1 
ATOM   525  C  CA    . PRO A 1 86  ? -13.433 8.749  -8.978  1.00 66.69  ?  103 PRO A CA    1 
ATOM   526  C  C     . PRO A 1 86  ? -14.479 9.244  -7.978  1.00 63.99  ?  103 PRO A C     1 
ATOM   527  O  O     . PRO A 1 86  ? -15.521 8.607  -7.827  1.00 64.21  ?  103 PRO A O     1 
ATOM   528  C  CB    . PRO A 1 86  ? -12.412 7.847  -8.274  1.00 69.49  ?  103 PRO A CB    1 
ATOM   529  C  CG    . PRO A 1 86  ? -11.134 8.104  -8.975  1.00 71.13  ?  103 PRO A CG    1 
ATOM   530  C  CD    . PRO A 1 86  ? -11.165 9.558  -9.318  1.00 68.12  ?  103 PRO A CD    1 
ATOM   531  N  N     . ILE A 1 87  ? -14.205 10.359 -7.309  1.00 61.78  ?  104 ILE A N     1 
ATOM   532  C  CA    . ILE A 1 87  ? -15.141 10.906 -6.334  1.00 59.49  ?  104 ILE A CA    1 
ATOM   533  C  C     . ILE A 1 87  ? -16.301 11.611 -7.033  1.00 57.65  ?  104 ILE A C     1 
ATOM   534  O  O     . ILE A 1 87  ? -17.455 11.488 -6.617  1.00 56.99  ?  104 ILE A O     1 
ATOM   535  C  CB    . ILE A 1 87  ? -14.441 11.886 -5.368  1.00 58.18  ?  104 ILE A CB    1 
ATOM   536  C  CG1   . ILE A 1 87  ? -13.424 11.138 -4.503  1.00 60.41  ?  104 ILE A CG1   1 
ATOM   537  C  CG2   . ILE A 1 87  ? -15.457 12.597 -4.485  1.00 55.92  ?  104 ILE A CG2   1 
ATOM   538  C  CD1   . ILE A 1 87  ? -12.807 11.985 -3.411  1.00 59.67  ?  104 ILE A CD1   1 
ATOM   539  N  N     . MET A 1 88  ? -15.994 12.334 -8.105  1.00 71.59  ?  105 MET A N     1 
ATOM   540  C  CA    . MET A 1 88  ? -17.026 12.998 -8.895  1.00 70.98  ?  105 MET A CA    1 
ATOM   541  C  C     . MET A 1 88  ? -17.969 11.988 -9.543  1.00 72.10  ?  105 MET A C     1 
ATOM   542  O  O     . MET A 1 88  ? -19.156 12.265 -9.720  1.00 71.98  ?  105 MET A O     1 
ATOM   543  C  CB    . MET A 1 88  ? -16.397 13.887 -9.970  1.00 68.01  ?  105 MET A CB    1 
ATOM   544  C  CG    . MET A 1 88  ? -15.612 15.068 -9.423  1.00 64.65  ?  105 MET A CG    1 
ATOM   545  S  SD    . MET A 1 88  ? -16.614 16.220 -8.466  1.00 61.81  ?  105 MET A SD    1 
ATOM   546  C  CE    . MET A 1 88  ? -17.861 16.662 -9.671  1.00 58.54  ?  105 MET A CE    1 
ATOM   547  N  N     . LYS A 1 89  ? -17.440 10.821 -9.897  1.00 60.13  ?  106 LYS A N     1 
ATOM   548  C  CA    . LYS A 1 89  ? -18.256 9.779  -10.511 1.00 62.24  ?  106 LYS A CA    1 
ATOM   549  C  C     . LYS A 1 89  ? -19.216 9.161  -9.502  1.00 62.30  ?  106 LYS A C     1 
ATOM   550  O  O     . LYS A 1 89  ? -20.374 8.898  -9.823  1.00 62.91  ?  106 LYS A O     1 
ATOM   551  C  CB    . LYS A 1 89  ? -17.383 8.687  -11.129 1.00 65.29  ?  106 LYS A CB    1 
ATOM   552  C  CG    . LYS A 1 89  ? -18.185 7.649  -11.902 1.00 67.90  ?  106 LYS A CG    1 
ATOM   553  C  CD    . LYS A 1 89  ? -17.298 6.600  -12.550 1.00 71.30  ?  106 LYS A CD    1 
ATOM   554  C  CE    . LYS A 1 89  ? -18.139 5.523  -13.221 1.00 74.22  ?  106 LYS A CE    1 
ATOM   555  N  NZ    . LYS A 1 89  ? -17.317 4.376  -13.694 1.00 78.01  1  106 LYS A NZ    1 
ATOM   556  N  N     . PHE A 1 90  ? -18.732 8.932  -8.285  1.00 61.94  ?  107 PHE A N     1 
ATOM   557  C  CA    . PHE A 1 90  ? -19.562 8.355  -7.233  1.00 62.07  ?  107 PHE A CA    1 
ATOM   558  C  C     . PHE A 1 90  ? -20.738 9.269  -6.912  1.00 59.98  ?  107 PHE A C     1 
ATOM   559  O  O     . PHE A 1 90  ? -21.866 8.807  -6.760  1.00 60.70  ?  107 PHE A O     1 
ATOM   560  C  CB    . PHE A 1 90  ? -18.736 8.095  -5.970  1.00 62.12  ?  107 PHE A CB    1 
ATOM   561  C  CG    . PHE A 1 90  ? -19.507 7.423  -4.866  1.00 62.56  ?  107 PHE A CG    1 
ATOM   562  C  CD1   . PHE A 1 90  ? -19.578 6.042  -4.791  1.00 65.27  ?  107 PHE A CD1   1 
ATOM   563  C  CD2   . PHE A 1 90  ? -20.157 8.174  -3.900  1.00 60.52  ?  107 PHE A CD2   1 
ATOM   564  C  CE1   . PHE A 1 90  ? -20.285 5.424  -3.775  1.00 65.81  ?  107 PHE A CE1   1 
ATOM   565  C  CE2   . PHE A 1 90  ? -20.864 7.562  -2.882  1.00 61.11  ?  107 PHE A CE2   1 
ATOM   566  C  CZ    . PHE A 1 90  ? -20.928 6.186  -2.820  1.00 63.69  ?  107 PHE A CZ    1 
ATOM   567  N  N     . ILE A 1 91  ? -20.464 10.566 -6.813  1.00 57.72  ?  108 ILE A N     1 
ATOM   568  C  CA    . ILE A 1 91  ? -21.499 11.556 -6.534  1.00 56.01  ?  108 ILE A CA    1 
ATOM   569  C  C     . ILE A 1 91  ? -22.580 11.557 -7.612  1.00 56.91  ?  108 ILE A C     1 
ATOM   570  O  O     . ILE A 1 91  ? -23.772 11.483 -7.309  1.00 57.26  ?  108 ILE A O     1 
ATOM   571  C  CB    . ILE A 1 91  ? -20.899 12.970 -6.410  1.00 53.85  ?  108 ILE A CB    1 
ATOM   572  C  CG1   . ILE A 1 91  ? -20.049 13.075 -5.142  1.00 53.18  ?  108 ILE A CG1   1 
ATOM   573  C  CG2   . ILE A 1 91  ? -21.996 14.023 -6.405  1.00 52.62  ?  108 ILE A CG2   1 
ATOM   574  C  CD1   . ILE A 1 91  ? -19.226 14.338 -5.062  1.00 51.63  ?  108 ILE A CD1   1 
ATOM   575  N  N     . ASN A 1 92  ? -22.159 11.640 -8.871  1.00 59.20  ?  109 ASN A N     1 
ATOM   576  C  CA    . ASN A 1 92  ? -23.094 11.677 -9.991  1.00 60.45  ?  109 ASN A CA    1 
ATOM   577  C  C     . ASN A 1 92  ? -23.840 10.361 -10.196 1.00 63.12  ?  109 ASN A C     1 
ATOM   578  O  O     . ASN A 1 92  ? -24.972 10.356 -10.679 1.00 64.35  ?  109 ASN A O     1 
ATOM   579  C  CB    . ASN A 1 92  ? -22.362 12.059 -11.279 1.00 60.80  ?  109 ASN A CB    1 
ATOM   580  C  CG    . ASN A 1 92  ? -21.895 13.502 -11.278 1.00 58.47  ?  109 ASN A CG    1 
ATOM   581  O  OD1   . ASN A 1 92  ? -22.632 14.405 -10.884 1.00 57.18  ?  109 ASN A OD1   1 
ATOM   582  N  ND2   . ASN A 1 92  ? -20.665 13.726 -11.725 1.00 58.22  ?  109 ASN A ND2   1 
ATOM   583  N  N     . ASP A 1 93  ? -23.207 9.250  -9.833  1.00 64.10  ?  110 ASP A N     1 
ATOM   584  C  CA    . ASP A 1 93  ? -23.847 7.943  -9.953  1.00 66.88  ?  110 ASP A CA    1 
ATOM   585  C  C     . ASP A 1 93  ? -25.018 7.818  -8.987  1.00 66.76  ?  110 ASP A C     1 
ATOM   586  O  O     . ASP A 1 93  ? -26.029 7.196  -9.308  1.00 68.93  ?  110 ASP A O     1 
ATOM   587  C  CB    . ASP A 1 93  ? -22.840 6.817  -9.714  1.00 68.48  ?  110 ASP A CB    1 
ATOM   588  C  CG    . ASP A 1 93  ? -21.945 6.570  -10.914 1.00 70.08  ?  110 ASP A CG    1 
ATOM   589  O  OD1   . ASP A 1 93  ? -22.283 7.051  -12.016 1.00 70.41  ?  110 ASP A OD1   1 
ATOM   590  O  OD2   . ASP A 1 93  ? -20.904 5.897  -10.755 1.00 71.29  -1 110 ASP A OD2   1 
ATOM   591  N  N     . GLN A 1 94  ? -24.884 8.418  -7.809  1.00 63.17  ?  111 GLN A N     1 
ATOM   592  C  CA    . GLN A 1 94  ? -25.978 8.438  -6.847  1.00 63.02  ?  111 GLN A CA    1 
ATOM   593  C  C     . GLN A 1 94  ? -27.080 9.348  -7.374  1.00 62.86  ?  111 GLN A C     1 
ATOM   594  O  O     . GLN A 1 94  ? -28.266 9.071  -7.198  1.00 64.33  ?  111 GLN A O     1 
ATOM   595  C  CB    . GLN A 1 94  ? -25.500 8.902  -5.471  1.00 60.92  ?  111 GLN A CB    1 
ATOM   596  C  CG    . GLN A 1 94  ? -24.294 8.144  -4.932  1.00 61.26  ?  111 GLN A CG    1 
ATOM   597  C  CD    . GLN A 1 94  ? -24.394 6.644  -5.139  1.00 64.13  ?  111 GLN A CD    1 
ATOM   598  O  OE1   . GLN A 1 94  ? -25.404 6.023  -4.807  1.00 65.50  ?  111 GLN A OE1   1 
ATOM   599  N  NE2   . GLN A 1 94  ? -23.340 6.053  -5.690  1.00 65.36  ?  111 GLN A NE2   1 
ATOM   600  N  N     . TYR A 1 95  ? -26.676 10.439 -8.019  1.00 68.01  ?  112 TYR A N     1 
ATOM   601  C  CA    . TYR A 1 95  ? -27.618 11.325 -8.690  1.00 69.18  ?  112 TYR A CA    1 
ATOM   602  C  C     . TYR A 1 95  ? -28.269 10.610 -9.871  1.00 71.53  ?  112 TYR A C     1 
ATOM   603  O  O     . TYR A 1 95  ? -29.393 10.926 -10.259 1.00 73.12  ?  112 TYR A O     1 
ATOM   604  C  CB    . TYR A 1 95  ? -26.919 12.600 -9.172  1.00 69.43  ?  112 TYR A CB    1 
ATOM   605  C  CG    . TYR A 1 95  ? -26.610 13.607 -8.086  1.00 69.96  ?  112 TYR A CG    1 
ATOM   606  C  CD1   . TYR A 1 95  ? -27.284 13.584 -6.872  1.00 69.52  ?  112 TYR A CD1   1 
ATOM   607  C  CD2   . TYR A 1 95  ? -25.648 14.591 -8.282  1.00 70.72  ?  112 TYR A CD2   1 
ATOM   608  C  CE1   . TYR A 1 95  ? -27.004 14.509 -5.882  1.00 70.83  ?  112 TYR A CE1   1 
ATOM   609  C  CE2   . TYR A 1 95  ? -25.362 15.519 -7.299  1.00 70.36  ?  112 TYR A CE2   1 
ATOM   610  C  CZ    . TYR A 1 95  ? -26.042 15.473 -6.101  1.00 71.39  ?  112 TYR A CZ    1 
ATOM   611  O  OH    . TYR A 1 95  ? -25.760 16.396 -5.119  1.00 69.94  ?  112 TYR A OH    1 
ATOM   612  N  N     . GLU A 1 96  ? -27.550 9.645  -10.438 1.00 65.97  ?  113 GLU A N     1 
ATOM   613  C  CA    . GLU A 1 96  ? -28.055 8.860  -11.560 1.00 69.22  ?  113 GLU A CA    1 
ATOM   614  C  C     . GLU A 1 96  ? -28.999 7.756  -11.095 1.00 71.70  ?  113 GLU A C     1 
ATOM   615  O  O     . GLU A 1 96  ? -30.035 7.513  -11.713 1.00 74.37  ?  113 GLU A O     1 
ATOM   616  C  CB    . GLU A 1 96  ? -26.893 8.254  -12.352 1.00 70.07  ?  113 GLU A CB    1 
ATOM   617  C  CG    . GLU A 1 96  ? -27.315 7.374  -13.524 1.00 73.81  ?  113 GLU A CG    1 
ATOM   618  C  CD    . GLU A 1 96  ? -27.856 8.162  -14.704 1.00 74.75  ?  113 GLU A CD    1 
ATOM   619  O  OE1   . GLU A 1 96  ? -27.852 9.411  -14.653 1.00 72.42  ?  113 GLU A OE1   1 
ATOM   620  O  OE2   . GLU A 1 96  ? -28.290 7.527  -15.688 1.00 78.13  -1 113 GLU A OE2   1 
ATOM   621  N  N     . LYS A 1 97  ? -28.631 7.090  -10.005 1.00 79.85  ?  114 LYS A N     1 
ATOM   622  C  CA    . LYS A 1 97  ? -29.446 6.020  -9.441  1.00 80.63  ?  114 LYS A CA    1 
ATOM   623  C  C     . LYS A 1 97  ? -30.790 6.543  -8.945  1.00 80.78  ?  114 LYS A C     1 
ATOM   624  O  O     . LYS A 1 97  ? -31.794 5.832  -8.983  1.00 82.79  ?  114 LYS A O     1 
ATOM   625  C  CB    . LYS A 1 97  ? -28.696 5.320  -8.304  1.00 78.86  ?  114 LYS A CB    1 
ATOM   626  C  CG    . LYS A 1 97  ? -27.523 4.470  -8.771  1.00 79.97  ?  114 LYS A CG    1 
ATOM   627  C  CD    . LYS A 1 97  ? -26.656 4.011  -7.608  1.00 79.33  ?  114 LYS A CD    1 
ATOM   628  C  CE    . LYS A 1 97  ? -27.399 3.043  -6.703  1.00 81.16  ?  114 LYS A CE    1 
ATOM   629  N  NZ    . LYS A 1 97  ? -26.526 2.528  -5.609  1.00 81.35  1  114 LYS A NZ    1 
ATOM   630  N  N     . TYR A 1 98  ? -30.802 7.787  -8.479  1.00 70.93  ?  115 TYR A N     1 
ATOM   631  C  CA    . TYR A 1 98  ? -32.025 8.405  -7.979  1.00 71.29  ?  115 TYR A CA    1 
ATOM   632  C  C     . TYR A 1 98  ? -32.910 8.876  -9.129  1.00 73.47  ?  115 TYR A C     1 
ATOM   633  O  O     . TYR A 1 98  ? -34.136 8.875  -9.022  1.00 75.71  ?  115 TYR A O     1 
ATOM   634  C  CB    . TYR A 1 98  ? -31.692 9.581  -7.057  1.00 68.05  ?  115 TYR A CB    1 
ATOM   635  C  CG    . TYR A 1 98  ? -32.796 9.933  -6.084  1.00 68.51  ?  115 TYR A CG    1 
ATOM   636  C  CD1   . TYR A 1 98  ? -33.879 10.708 -6.480  1.00 69.92  ?  115 TYR A CD1   1 
ATOM   637  C  CD2   . TYR A 1 98  ? -32.751 9.496  -4.767  1.00 67.87  ?  115 TYR A CD2   1 
ATOM   638  C  CE1   . TYR A 1 98  ? -34.888 11.032 -5.592  1.00 70.76  ?  115 TYR A CE1   1 
ATOM   639  C  CE2   . TYR A 1 98  ? -33.754 9.816  -3.872  1.00 68.54  ?  115 TYR A CE2   1 
ATOM   640  C  CZ    . TYR A 1 98  ? -34.820 10.583 -4.290  1.00 70.02  ?  115 TYR A CZ    1 
ATOM   641  O  OH    . TYR A 1 98  ? -35.821 10.903 -3.402  1.00 71.08  ?  115 TYR A OH    1 
ATOM   642  N  N     . LEU A 1 99  ? -32.281 9.270  -10.232 1.00 73.12  ?  116 LEU A N     1 
ATOM   643  C  CA    . LEU A 1 99  ? -33.009 9.771  -11.391 1.00 75.31  ?  116 LEU A CA    1 
ATOM   644  C  C     . LEU A 1 99  ? -33.626 8.641  -12.208 1.00 79.46  ?  116 LEU A C     1 
ATOM   645  O  O     . LEU A 1 99  ? -34.669 8.816  -12.839 1.00 82.40  ?  116 LEU A O     1 
ATOM   646  C  CB    . LEU A 1 99  ? -32.091 10.618 -12.275 1.00 73.58  ?  116 LEU A CB    1 
ATOM   647  C  CG    . LEU A 1 99  ? -32.781 11.260 -13.478 1.00 75.83  ?  116 LEU A CG    1 
ATOM   648  C  CD1   . LEU A 1 99  ? -33.804 12.261 -12.999 1.00 75.96  ?  116 LEU A CD1   1 
ATOM   649  C  CD2   . LEU A 1 99  ? -31.770 11.928 -14.392 1.00 74.35  ?  116 LEU A CD2   1 
ATOM   650  N  N     . GLN A 1 100 ? -32.987 7.477  -12.184 1.00 80.07  ?  117 GLN A N     1 
ATOM   651  C  CA    . GLN A 1 100 ? -33.487 6.328  -12.926 1.00 84.26  ?  117 GLN A CA    1 
ATOM   652  C  C     . GLN A 1 100 ? -34.697 5.724  -12.225 1.00 86.69  ?  117 GLN A C     1 
ATOM   653  O  O     . GLN A 1 100 ? -35.437 4.936  -12.813 1.00 90.76  ?  117 GLN A O     1 
ATOM   654  C  CB    . GLN A 1 100 ? -32.390 5.275  -13.094 1.00 84.48  ?  117 GLN A CB    1 
ATOM   655  N  N     . GLU A 1 101 ? -34.895 6.097  -10.964 1.00 84.44  ?  118 GLU A N     1 
ATOM   656  C  CA    . GLU A 1 101 ? -36.054 5.640  -10.208 1.00 86.64  ?  118 GLU A CA    1 
ATOM   657  C  C     . GLU A 1 101 ? -37.183 6.670  -10.244 1.00 87.63  ?  118 GLU A C     1 
ATOM   658  O  O     . GLU A 1 101 ? -38.339 6.338  -9.984  1.00 90.70  ?  118 GLU A O     1 
ATOM   659  C  CB    . GLU A 1 101 ? -35.664 5.316  -8.765  1.00 84.28  ?  118 GLU A CB    1 
ATOM   660  C  CG    . GLU A 1 101 ? -34.833 4.046  -8.635  1.00 84.72  ?  118 GLU A CG    1 
ATOM   661  C  CD    . GLU A 1 101 ? -34.992 3.372  -7.285  1.00 84.55  ?  118 GLU A CD    1 
ATOM   662  O  OE1   . GLU A 1 101 ? -36.139 3.272  -6.800  1.00 86.44  ?  118 GLU A OE1   1 
ATOM   663  O  OE2   . GLU A 1 101 ? -33.971 2.934  -6.713  1.00 82.83  -1 118 GLU A OE2   1 
ATOM   664  N  N     . GLU A 1 102 ? -36.847 7.917  -10.564 1.00 101.50 ?  119 GLU A N     1 
ATOM   665  C  CA    . GLU A 1 102 ? -37.857 8.964  -10.693 1.00 103.16 ?  119 GLU A CA    1 
ATOM   666  C  C     . GLU A 1 102 ? -38.545 8.894  -12.051 1.00 107.58 ?  119 GLU A C     1 
ATOM   667  O  O     . GLU A 1 102 ? -39.743 9.153  -12.165 1.00 109.65 ?  119 GLU A O     1 
ATOM   668  C  CB    . GLU A 1 102 ? -37.243 10.355 -10.507 1.00 100.76 ?  119 GLU A CB    1 
ATOM   669  C  CG    . GLU A 1 102 ? -37.343 10.915 -9.099  1.00 97.82  ?  119 GLU A CG    1 
ATOM   670  C  CD    . GLU A 1 102 ? -36.970 12.384 -9.029  1.00 96.69  ?  119 GLU A CD    1 
ATOM   671  O  OE1   . GLU A 1 102 ? -36.475 12.922 -10.041 1.00 97.81  ?  119 GLU A OE1   1 
ATOM   672  O  OE2   . GLU A 1 102 ? -37.177 13.002 -7.963  1.00 95.11  -1 119 GLU A OE2   1 
ATOM   673  N  N     . VAL A 1 103 ? -37.779 8.535  -13.076 1.00 76.18  ?  120 VAL A N     1 
ATOM   674  C  CA    . VAL A 1 103 ? -38.325 8.324  -14.413 1.00 79.43  ?  120 VAL A CA    1 
ATOM   675  C  C     . VAL A 1 103 ? -39.024 6.966  -14.518 1.00 81.85  ?  120 VAL A C     1 
ATOM   676  O  O     . VAL A 1 103 ? -39.729 6.689  -15.490 1.00 85.11  ?  120 VAL A O     1 
ATOM   677  C  CB    . VAL A 1 103 ? -37.220 8.430  -15.486 1.00 78.83  ?  120 VAL A CB    1 
ATOM   678  C  CG1   . VAL A 1 103 ? -36.490 7.103  -15.641 1.00 78.39  ?  120 VAL A CG1   1 
ATOM   679  C  CG2   . VAL A 1 103 ? -37.806 8.885  -16.815 1.00 81.94  ?  120 VAL A CG2   1 
ATOM   680  N  N     . ASN A 1 104 ? -38.823 6.127  -13.507 1.00 87.82  ?  121 ASN A N     1 
ATOM   681  C  CA    . ASN A 1 104 ? -39.352 4.767  -13.493 1.00 89.37  ?  121 ASN A CA    1 
ATOM   682  C  C     . ASN A 1 104 ? -40.847 4.794  -13.184 1.00 89.42  ?  121 ASN A C     1 
ATOM   683  O  O     . ASN A 1 104 ? -41.249 4.687  -12.026 1.00 87.91  ?  121 ASN A O     1 
ATOM   684  C  CB    . ASN A 1 104 ? -38.606 3.903  -12.474 1.00 88.44  ?  121 ASN A CB    1 
ATOM   685  C  CG    . ASN A 1 104 ? -39.057 2.450  -12.491 1.00 90.17  ?  121 ASN A CG    1 
ATOM   686  O  OD1   . ASN A 1 104 ? -39.889 2.051  -13.306 1.00 92.01  ?  121 ASN A OD1   1 
ATOM   687  N  ND2   . ASN A 1 104 ? -38.506 1.653  -11.583 1.00 89.58  ?  121 ASN A ND2   1 
ATOM   688  N  N     . ILE A 1 105 ? -41.666 4.939  -14.222 1.00 88.74  ?  122 ILE A N     1 
ATOM   689  C  CA    . ILE A 1 105 ? -43.105 5.143  -14.054 1.00 91.84  ?  122 ILE A CA    1 
ATOM   690  C  C     . ILE A 1 105 ? -43.833 3.957  -13.419 1.00 93.60  ?  122 ILE A C     1 
ATOM   691  O  O     . ILE A 1 105 ? -44.988 4.082  -13.012 1.00 95.89  ?  122 ILE A O     1 
ATOM   692  C  CB    . ILE A 1 105 ? -43.777 5.450  -15.405 1.00 95.53  ?  122 ILE A CB    1 
ATOM   693  N  N     . ASN A 1 106 ? -43.167 2.810  -13.342 1.00 92.74  ?  123 ASN A N     1 
ATOM   694  C  CA    . ASN A 1 106 ? -43.775 1.623  -12.749 1.00 94.43  ?  123 ASN A CA    1 
ATOM   695  C  C     . ASN A 1 106 ? -43.580 1.564  -11.232 1.00 91.71  ?  123 ASN A C     1 
ATOM   696  O  O     . ASN A 1 106 ? -44.268 0.815  -10.539 1.00 93.19  ?  123 ASN A O     1 
ATOM   697  C  CB    . ASN A 1 106 ? -43.213 0.356  -13.395 1.00 95.19  ?  123 ASN A CB    1 
ATOM   698  C  CG    . ASN A 1 106 ? -43.589 0.234  -14.861 1.00 98.64  ?  123 ASN A CG    1 
ATOM   699  O  OD1   . ASN A 1 106 ? -44.736 -0.063 -15.196 1.00 102.55 ?  123 ASN A OD1   1 
ATOM   700  N  ND2   . ASN A 1 106 ? -42.621 0.459  -15.742 1.00 97.41  ?  123 ASN A ND2   1 
ATOM   701  N  N     . ARG A 1 107 ? -42.641 2.358  -10.724 1.00 98.74  ?  124 ARG A N     1 
ATOM   702  C  CA    . ARG A 1 107 ? -42.277 2.336  -9.303  1.00 96.95  ?  124 ARG A CA    1 
ATOM   703  C  C     . ARG A 1 107 ? -43.361 2.844  -8.344  1.00 95.17  ?  124 ARG A C     1 
ATOM   704  O  O     . ARG A 1 107 ? -43.761 4.010  -8.393  1.00 93.91  ?  124 ARG A O     1 
ATOM   705  C  CB    . ARG A 1 107 ? -41.003 3.154  -9.092  1.00 95.75  ?  124 ARG A CB    1 
ATOM   706  C  CG    . ARG A 1 107 ? -40.714 3.505  -7.641  1.00 93.68  ?  124 ARG A CG    1 
ATOM   707  C  CD    . ARG A 1 107 ? -39.592 4.520  -7.536  1.00 92.22  ?  124 ARG A CD    1 
ATOM   708  N  NE    . ARG A 1 107 ? -39.916 5.763  -8.232  1.00 91.58  ?  124 ARG A NE    1 
ATOM   709  C  CZ    . ARG A 1 107 ? -40.872 6.606  -7.854  1.00 90.08  ?  124 ARG A CZ    1 
ATOM   710  N  NH1   . ARG A 1 107 ? -41.602 6.343  -6.780  1.00 89.16  1  124 ARG A NH1   1 
ATOM   711  N  NH2   . ARG A 1 107 ? -41.097 7.715  -8.547  1.00 89.54  ?  124 ARG A NH2   1 
ATOM   712  N  N     . LYS A 1 108 ? -43.830 1.950  -7.477  1.00 115.67 ?  125 LYS A N     1 
ATOM   713  C  CA    . LYS A 1 108 ? -44.835 2.281  -6.470  1.00 114.14 ?  125 LYS A CA    1 
ATOM   714  C  C     . LYS A 1 108 ? -44.225 2.639  -5.107  1.00 111.79 ?  125 LYS A C     1 
ATOM   715  O  O     . LYS A 1 108 ? -44.934 3.084  -4.198  1.00 110.75 ?  125 LYS A O     1 
ATOM   716  C  CB    . LYS A 1 108 ? -45.804 1.114  -6.296  1.00 116.34 ?  125 LYS A CB    1 
ATOM   717  N  N     . LYS A 1 109 ? -42.911 2.468  -4.979  1.00 81.18  ?  126 LYS A N     1 
ATOM   718  C  CA    . LYS A 1 109 ? -42.230 2.575  -3.688  1.00 78.08  ?  126 LYS A CA    1 
ATOM   719  C  C     . LYS A 1 109 ? -41.423 3.860  -3.517  1.00 75.01  ?  126 LYS A C     1 
ATOM   720  O  O     . LYS A 1 109 ? -41.153 4.575  -4.484  1.00 74.87  ?  126 LYS A O     1 
ATOM   721  C  CB    . LYS A 1 109 ? -41.311 1.374  -3.491  1.00 76.81  ?  126 LYS A CB    1 
ATOM   722  N  N     . ARG A 1 110 ? -41.061 4.160  -2.271  1.00 72.74  ?  127 ARG A N     1 
ATOM   723  C  CA    . ARG A 1 110 ? -40.236 5.328  -1.977  1.00 69.83  ?  127 ARG A CA    1 
ATOM   724  C  C     . ARG A 1 110 ? -38.863 5.124  -2.591  1.00 67.72  ?  127 ARG A C     1 
ATOM   725  O  O     . ARG A 1 110 ? -38.385 3.995  -2.693  1.00 67.68  ?  127 ARG A O     1 
ATOM   726  C  CB    . ARG A 1 110 ? -40.058 5.533  -0.465  1.00 67.98  ?  127 ARG A CB    1 
ATOM   727  C  CG    . ARG A 1 110 ? -41.289 5.384  0.407   1.00 69.98  ?  127 ARG A CG    1 
ATOM   728  C  CD    . ARG A 1 110 ? -40.870 5.347  1.880   1.00 67.96  ?  127 ARG A CD    1 
ATOM   729  N  NE    . ARG A 1 110 ? -41.440 6.425  2.686   1.00 67.89  ?  127 ARG A NE    1 
ATOM   730  C  CZ    . ARG A 1 110 ? -40.782 7.522  3.050   1.00 65.57  ?  127 ARG A CZ    1 
ATOM   731  N  NH1   . ARG A 1 110 ? -39.521 7.701  2.677   1.00 63.16  1  127 ARG A NH1   1 
ATOM   732  N  NH2   . ARG A 1 110 ? -41.385 8.443  3.789   1.00 65.84  ?  127 ARG A NH2   1 
ATOM   733  N  N     . ILE A 1 111 ? -38.225 6.212  -3.000  1.00 66.13  ?  128 ILE A N     1 
ATOM   734  C  CA    . ILE A 1 111 ? -36.898 6.111  -3.583  1.00 64.25  ?  128 ILE A CA    1 
ATOM   735  C  C     . ILE A 1 111 ? -35.867 6.144  -2.463  1.00 61.35  ?  128 ILE A C     1 
ATOM   736  O  O     . ILE A 1 111 ? -35.878 7.056  -1.636  1.00 60.10  ?  128 ILE A O     1 
ATOM   737  C  CB    . ILE A 1 111 ? -36.624 7.240  -4.587  1.00 64.08  ?  128 ILE A CB    1 
ATOM   738  C  CG1   . ILE A 1 111 ? -37.793 7.370  -5.563  1.00 67.21  ?  128 ILE A CG1   1 
ATOM   739  C  CG2   . ILE A 1 111 ? -35.327 6.979  -5.336  1.00 62.72  ?  128 ILE A CG2   1 
ATOM   740  C  CD1   . ILE A 1 111 ? -37.632 8.489  -6.553  1.00 67.39  ?  128 ILE A CD1   1 
ATOM   741  N  N     . PRO A 1 112 ? -34.971 5.148  -2.428  1.00 67.94  ?  129 PRO A N     1 
ATOM   742  C  CA    . PRO A 1 112 ? -33.921 5.185  -1.407  1.00 66.52  ?  129 PRO A CA    1 
ATOM   743  C  C     . PRO A 1 112 ? -32.869 6.233  -1.749  1.00 65.27  ?  129 PRO A C     1 
ATOM   744  O  O     . PRO A 1 112 ? -32.310 6.217  -2.846  1.00 66.75  ?  129 PRO A O     1 
ATOM   745  C  CB    . PRO A 1 112 ? -33.337 3.771  -1.447  1.00 68.51  ?  129 PRO A CB    1 
ATOM   746  C  CG    . PRO A 1 112 ? -33.640 3.269  -2.817  1.00 70.97  ?  129 PRO A CG    1 
ATOM   747  C  CD    . PRO A 1 112 ? -34.917 3.929  -3.254  1.00 70.69  ?  129 PRO A CD    1 
ATOM   748  N  N     . ASP A 1 113 ? -32.608 7.139  -0.813  1.00 54.26  ?  130 ASP A N     1 
ATOM   749  C  CA    . ASP A 1 113 ? -31.713 8.258  -1.072  1.00 52.67  ?  130 ASP A CA    1 
ATOM   750  C  C     . ASP A 1 113 ? -30.269 7.905  -0.737  1.00 50.75  ?  130 ASP A C     1 
ATOM   751  O  O     . ASP A 1 113 ? -29.881 7.868  0.430   1.00 49.48  ?  130 ASP A O     1 
ATOM   752  C  CB    . ASP A 1 113 ? -32.155 9.486  -0.272  1.00 52.12  ?  130 ASP A CB    1 
ATOM   753  C  CG    . ASP A 1 113 ? -31.639 10.784 -0.863  1.00 51.38  ?  130 ASP A CG    1 
ATOM   754  O  OD1   . ASP A 1 113 ? -30.756 10.729 -1.745  1.00 50.97  -1 130 ASP A OD1   1 
ATOM   755  O  OD2   . ASP A 1 113 ? -32.120 11.860 -0.447  1.00 51.35  -1 130 ASP A OD2   1 
ATOM   756  N  N     . THR A 1 114 ? -29.476 7.654  -1.772  1.00 50.73  ?  131 THR A N     1 
ATOM   757  C  CA    . THR A 1 114 ? -28.067 7.325  -1.597  1.00 49.23  ?  131 THR A CA    1 
ATOM   758  C  C     . THR A 1 114 ? -27.224 8.504  -2.055  1.00 48.21  ?  131 THR A C     1 
ATOM   759  O  O     . THR A 1 114 ? -25.994 8.437  -2.075  1.00 47.16  ?  131 THR A O     1 
ATOM   760  C  CB    . THR A 1 114 ? -27.665 6.063  -2.379  1.00 50.08  ?  131 THR A CB    1 
ATOM   761  O  OG1   . THR A 1 114 ? -27.873 6.278  -3.780  1.00 51.35  ?  131 THR A OG1   1 
ATOM   762  C  CG2   . THR A 1 114 ? -28.487 4.869  -1.922  1.00 51.26  ?  131 THR A CG2   1 
ATOM   763  N  N     . ARG A 1 115 ? -27.905 9.585  -2.422  1.00 48.74  ?  132 ARG A N     1 
ATOM   764  C  CA    . ARG A 1 115 ? -27.244 10.803 -2.868  1.00 48.04  ?  132 ARG A CA    1 
ATOM   765  C  C     . ARG A 1 115 ? -26.447 11.414 -1.727  1.00 46.26  ?  132 ARG A C     1 
ATOM   766  O  O     . ARG A 1 115 ? -26.882 11.394 -0.576  1.00 45.82  ?  132 ARG A O     1 
ATOM   767  C  CB    . ARG A 1 115 ? -28.268 11.813 -3.389  1.00 49.19  ?  132 ARG A CB    1 
ATOM   768  C  CG    . ARG A 1 115 ? -29.128 11.308 -4.534  1.00 51.27  ?  132 ARG A CG    1 
ATOM   769  C  CD    . ARG A 1 115 ? -30.246 12.291 -4.841  1.00 52.59  ?  132 ARG A CD    1 
ATOM   770  N  NE    . ARG A 1 115 ? -31.068 12.561 -3.665  1.00 52.44  ?  132 ARG A NE    1 
ATOM   771  C  CZ    . ARG A 1 115 ? -32.166 13.310 -3.675  1.00 53.71  ?  132 ARG A CZ    1 
ATOM   772  N  NH1   . ARG A 1 115 ? -32.581 13.868 -4.804  1.00 55.22  1  132 ARG A NH1   1 
ATOM   773  N  NH2   . ARG A 1 115 ? -32.850 13.501 -2.555  1.00 53.61  ?  132 ARG A NH2   1 
ATOM   774  N  N     . VAL A 1 116 ? -25.281 11.960 -2.049  1.00 50.11  ?  133 VAL A N     1 
ATOM   775  C  CA    . VAL A 1 116 ? -24.471 12.643 -1.053  1.00 47.05  ?  133 VAL A CA    1 
ATOM   776  C  C     . VAL A 1 116 ? -25.101 13.986 -0.709  1.00 46.89  ?  133 VAL A C     1 
ATOM   777  O  O     . VAL A 1 116 ? -25.117 14.901 -1.531  1.00 47.37  ?  133 VAL A O     1 
ATOM   778  C  CB    . VAL A 1 116 ? -23.027 12.859 -1.543  1.00 47.30  ?  133 VAL A CB    1 
ATOM   779  C  CG1   . VAL A 1 116 ? -22.213 13.591 -0.488  1.00 45.15  ?  133 VAL A CG1   1 
ATOM   780  C  CG2   . VAL A 1 116 ? -22.382 11.527 -1.891  1.00 49.99  ?  133 VAL A CG2   1 
ATOM   781  N  N     . HIS A 1 117 ? -25.638 14.094 0.502   1.00 47.08  ?  134 HIS A N     1 
ATOM   782  C  CA    . HIS A 1 117 ? -26.265 15.332 0.945   1.00 46.68  ?  134 HIS A CA    1 
ATOM   783  C  C     . HIS A 1 117 ? -25.201 16.328 1.387   1.00 45.62  ?  134 HIS A C     1 
ATOM   784  O  O     . HIS A 1 117 ? -25.227 17.499 1.005   1.00 45.88  ?  134 HIS A O     1 
ATOM   785  C  CB    . HIS A 1 117 ? -27.241 15.071 2.095   1.00 46.83  ?  134 HIS A CB    1 
ATOM   786  C  CG    . HIS A 1 117 ? -28.281 14.038 1.791   1.00 48.05  ?  134 HIS A CG    1 
ATOM   787  N  ND1   . HIS A 1 117 ? -28.609 13.032 2.674   1.00 48.05  ?  134 HIS A ND1   1 
ATOM   788  C  CD2   . HIS A 1 117 ? -29.069 13.855 0.704   1.00 49.52  ?  134 HIS A CD2   1 
ATOM   789  C  CE1   . HIS A 1 117 ? -29.552 12.273 2.145   1.00 49.48  ?  134 HIS A CE1   1 
ATOM   790  N  NE2   . HIS A 1 117 ? -29.849 12.751 0.950   1.00 50.42  ?  134 HIS A NE2   1 
ATOM   791  N  N     . CYS A 1 118 ? -24.262 15.843 2.192   1.00 51.97  ?  135 CYS A N     1 
ATOM   792  C  CA    . CYS A 1 118 ? -23.225 16.682 2.778   1.00 49.95  ?  135 CYS A CA    1 
ATOM   793  C  C     . CYS A 1 118 ? -21.850 16.066 2.554   1.00 50.83  ?  135 CYS A C     1 
ATOM   794  O  O     . CYS A 1 118 ? -21.697 14.845 2.581   1.00 52.33  ?  135 CYS A O     1 
ATOM   795  C  CB    . CYS A 1 118 ? -23.482 16.880 4.273   1.00 47.81  ?  135 CYS A CB    1 
ATOM   796  S  SG    . CYS A 1 118 ? -22.254 17.896 5.120   1.00 45.80  ?  135 CYS A SG    1 
ATOM   797  N  N     . CYS A 1 119 ? -20.850 16.912 2.328   1.00 54.93  ?  136 CYS A N     1 
ATOM   798  C  CA    . CYS A 1 119 ? -19.496 16.432 2.079   1.00 55.86  ?  136 CYS A CA    1 
ATOM   799  C  C     . CYS A 1 119 ? -18.456 17.226 2.864   1.00 53.87  ?  136 CYS A C     1 
ATOM   800  O  O     . CYS A 1 119 ? -18.198 18.391 2.566   1.00 53.58  ?  136 CYS A O     1 
ATOM   801  C  CB    . CYS A 1 119 ? -19.178 16.493 0.584   1.00 58.57  ?  136 CYS A CB    1 
ATOM   802  S  SG    . CYS A 1 119 ? -17.468 16.085 0.174   1.00 59.90  ?  136 CYS A SG    1 
ATOM   803  N  N     . LEU A 1 120 ? -17.859 16.590 3.867   1.00 43.32  ?  137 LEU A N     1 
ATOM   804  C  CA    . LEU A 1 120 ? -16.782 17.211 4.629   1.00 43.21  ?  137 LEU A CA    1 
ATOM   805  C  C     . LEU A 1 120 ? -15.494 17.245 3.817   1.00 43.69  ?  137 LEU A C     1 
ATOM   806  O  O     . LEU A 1 120 ? -15.073 16.228 3.267   1.00 43.87  ?  137 LEU A O     1 
ATOM   807  C  CB    . LEU A 1 120 ? -16.547 16.468 5.946   1.00 42.83  ?  137 LEU A CB    1 
ATOM   808  C  CG    . LEU A 1 120 ? -17.713 16.399 6.933   1.00 42.50  ?  137 LEU A CG    1 
ATOM   809  C  CD1   . LEU A 1 120 ? -17.267 15.754 8.235   1.00 42.32  ?  137 LEU A CD1   1 
ATOM   810  C  CD2   . LEU A 1 120 ? -18.283 17.784 7.187   1.00 42.56  ?  137 LEU A CD2   1 
ATOM   811  N  N     . TYR A 1 121 ? -14.874 18.418 3.739   1.00 39.85  ?  138 TYR A N     1 
ATOM   812  C  CA    . TYR A 1 121 ? -13.597 18.552 3.050   1.00 40.54  ?  138 TYR A CA    1 
ATOM   813  C  C     . TYR A 1 121 ? -12.484 18.826 4.058   1.00 40.80  ?  138 TYR A C     1 
ATOM   814  O  O     . TYR A 1 121 ? -12.530 19.811 4.796   1.00 40.84  ?  138 TYR A O     1 
ATOM   815  C  CB    . TYR A 1 121 ? -13.656 19.661 1.997   1.00 41.16  ?  138 TYR A CB    1 
ATOM   816  C  CG    . TYR A 1 121 ? -12.521 19.598 0.998   1.00 42.04  ?  138 TYR A CG    1 
ATOM   817  C  CD1   . TYR A 1 121 ? -11.273 20.128 1.298   1.00 42.74  ?  138 TYR A CD1   1 
ATOM   818  C  CD2   . TYR A 1 121 ? -12.694 18.993 -0.241  1.00 42.39  ?  138 TYR A CD2   1 
ATOM   819  C  CE1   . TYR A 1 121 ? -10.232 20.064 0.391   1.00 43.76  ?  138 TYR A CE1   1 
ATOM   820  C  CE2   . TYR A 1 121 ? -11.659 18.926 -1.154  1.00 43.35  ?  138 TYR A CE2   1 
ATOM   821  C  CZ    . TYR A 1 121 ? -10.431 19.463 -0.832  1.00 44.03  ?  138 TYR A CZ    1 
ATOM   822  O  OH    . TYR A 1 121 ? -9.396  19.399 -1.735  1.00 45.18  ?  138 TYR A OH    1 
ATOM   823  N  N     . PHE A 1 122 ? -11.487 17.948 4.080   1.00 41.16  ?  139 PHE A N     1 
ATOM   824  C  CA    . PHE A 1 122 ? -10.400 18.039 5.049   1.00 41.66  ?  139 PHE A CA    1 
ATOM   825  C  C     . PHE A 1 122 ? -9.242  18.903 4.562   1.00 42.83  ?  139 PHE A C     1 
ATOM   826  O  O     . PHE A 1 122 ? -8.610  18.604 3.549   1.00 43.50  ?  139 PHE A O     1 
ATOM   827  C  CB    . PHE A 1 122 ? -9.887  16.642 5.402   1.00 41.71  ?  139 PHE A CB    1 
ATOM   828  C  CG    . PHE A 1 122 ? -10.776 15.891 6.350   1.00 40.86  ?  139 PHE A CG    1 
ATOM   829  C  CD1   . PHE A 1 122 ? -11.998 15.390 5.930   1.00 40.14  ?  139 PHE A CD1   1 
ATOM   830  C  CD2   . PHE A 1 122 ? -10.389 15.689 7.664   1.00 40.97  ?  139 PHE A CD2   1 
ATOM   831  C  CE1   . PHE A 1 122 ? -12.815 14.700 6.805   1.00 39.56  ?  139 PHE A CE1   1 
ATOM   832  C  CE2   . PHE A 1 122 ? -11.202 15.002 8.542   1.00 40.34  ?  139 PHE A CE2   1 
ATOM   833  C  CZ    . PHE A 1 122 ? -12.415 14.506 8.112   1.00 39.63  ?  139 PHE A CZ    1 
ATOM   834  N  N     . ILE A 1 123 ? -8.976  19.978 5.296   1.00 44.46  ?  140 ILE A N     1 
ATOM   835  C  CA    . ILE A 1 123 ? -7.874  20.880 4.985   1.00 45.80  ?  140 ILE A CA    1 
ATOM   836  C  C     . ILE A 1 123 ? -6.673  20.607 5.885   1.00 46.78  ?  140 ILE A C     1 
ATOM   837  O  O     . ILE A 1 123 ? -6.792  20.642 7.109   1.00 46.58  ?  140 ILE A O     1 
ATOM   838  C  CB    . ILE A 1 123 ? -8.293  22.354 5.136   1.00 45.98  ?  140 ILE A CB    1 
ATOM   839  C  CG1   . ILE A 1 123 ? -9.447  22.677 4.184   1.00 45.31  ?  140 ILE A CG1   1 
ATOM   840  C  CG2   . ILE A 1 123 ? -7.109  23.278 4.886   1.00 47.61  ?  140 ILE A CG2   1 
ATOM   841  C  CD1   . ILE A 1 123 ? -9.970  24.086 4.320   1.00 45.53  ?  140 ILE A CD1   1 
ATOM   842  N  N     . PRO A 1 124 ? -5.510  20.330 5.279   1.00 46.79  ?  141 PRO A N     1 
ATOM   843  C  CA    . PRO A 1 124 ? -4.277  20.085 6.035   1.00 48.12  ?  141 PRO A CA    1 
ATOM   844  C  C     . PRO A 1 124 ? -3.811  21.333 6.778   1.00 49.18  ?  141 PRO A C     1 
ATOM   845  O  O     . PRO A 1 124 ? -3.789  22.420 6.201   1.00 49.73  ?  141 PRO A O     1 
ATOM   846  C  CB    . PRO A 1 124 ? -3.273  19.682 4.952   1.00 49.38  ?  141 PRO A CB    1 
ATOM   847  C  CG    . PRO A 1 124 ? -3.798  20.305 3.707   1.00 49.10  ?  141 PRO A CG    1 
ATOM   848  C  CD    . PRO A 1 124 ? -5.291  20.241 3.825   1.00 47.24  ?  141 PRO A CD    1 
ATOM   849  N  N     . ALA A 1 125 ? -3.446  21.173 8.046   1.00 49.62  ?  142 ALA A N     1 
ATOM   850  C  CA    . ALA A 1 125 ? -3.046  22.302 8.879   1.00 50.76  ?  142 ALA A CA    1 
ATOM   851  C  C     . ALA A 1 125 ? -1.653  22.814 8.522   1.00 53.06  ?  142 ALA A C     1 
ATOM   852  O  O     . ALA A 1 125 ? -0.706  22.655 9.293   1.00 54.57  ?  142 ALA A O     1 
ATOM   853  C  CB    . ALA A 1 125 ? -3.103  21.915 10.349  1.00 50.69  ?  142 ALA A CB    1 
ATOM   854  N  N     . THR A 1 126 ? -1.534  23.429 7.349   1.00 53.49  ?  143 THR A N     1 
ATOM   855  C  CA    . THR A 1 126 ? -0.265  23.994 6.905   1.00 55.84  ?  143 THR A CA    1 
ATOM   856  C  C     . THR A 1 126 ? 0.011   25.322 7.602   1.00 57.18  ?  143 THR A C     1 
ATOM   857  O  O     . THR A 1 126 ? 1.161   25.745 7.719   1.00 59.49  ?  143 THR A O     1 
ATOM   858  C  CB    . THR A 1 126 ? -0.240  24.207 5.379   1.00 56.03  ?  143 THR A CB    1 
ATOM   859  O  OG1   . THR A 1 126 ? -1.203  25.204 5.016   1.00 55.12  ?  143 THR A OG1   1 
ATOM   860  C  CG2   . THR A 1 126 ? -0.559  22.910 4.654   1.00 54.82  ?  143 THR A CG2   1 
ATOM   861  N  N     . GLY A 1 127 ? -1.052  25.974 8.062   1.00 55.88  ?  144 GLY A N     1 
ATOM   862  C  CA    . GLY A 1 127 ? -0.933  27.260 8.725   1.00 57.07  ?  144 GLY A CA    1 
ATOM   863  C  C     . GLY A 1 127 ? -0.782  28.414 7.754   1.00 58.13  ?  144 GLY A C     1 
ATOM   864  O  O     . GLY A 1 127 ? -0.478  29.538 8.154   1.00 59.61  ?  144 GLY A O     1 
ATOM   865  N  N     . HIS A 1 128 ? -0.997  28.138 6.472   1.00 57.50  ?  145 HIS A N     1 
ATOM   866  C  CA    . HIS A 1 128 ? -0.911  29.167 5.442   1.00 58.50  ?  145 HIS A CA    1 
ATOM   867  C  C     . HIS A 1 128 ? -2.132  29.144 4.533   1.00 56.64  ?  145 HIS A C     1 
ATOM   868  O  O     . HIS A 1 128 ? -3.113  28.456 4.814   1.00 54.61  ?  145 HIS A O     1 
ATOM   869  C  CB    . HIS A 1 128 ? 0.360   28.993 4.611   1.00 60.55  ?  145 HIS A CB    1 
ATOM   870  C  CG    . HIS A 1 128 ? 1.621   29.085 5.411   1.00 62.85  ?  145 HIS A CG    1 
ATOM   871  N  ND1   . HIS A 1 128 ? 1.940   30.191 6.170   1.00 64.43  ?  145 HIS A ND1   1 
ATOM   872  C  CD2   . HIS A 1 128 ? 2.641   28.211 5.572   1.00 64.05  ?  145 HIS A CD2   1 
ATOM   873  C  CE1   . HIS A 1 128 ? 3.104   29.993 6.763   1.00 66.55  ?  145 HIS A CE1   1 
ATOM   874  N  NE2   . HIS A 1 128 ? 3.550   28.799 6.417   1.00 66.37  ?  145 HIS A NE2   1 
ATOM   875  N  N     . SER A 1 129 ? -2.063  29.908 3.448   1.00 82.07  ?  146 SER A N     1 
ATOM   876  C  CA    . SER A 1 129 ? -3.150  29.977 2.479   1.00 81.82  ?  146 SER A CA    1 
ATOM   877  C  C     . SER A 1 129 ? -3.432  28.615 1.857   1.00 80.29  ?  146 SER A C     1 
ATOM   878  O  O     . SER A 1 129 ? -2.565  27.739 1.840   1.00 80.11  ?  146 SER A O     1 
ATOM   879  C  CB    . SER A 1 129 ? -2.824  30.989 1.380   1.00 84.28  ?  146 SER A CB    1 
ATOM   880  O  OG    . SER A 1 129 ? -1.664  30.604 0.662   1.00 85.32  ?  146 SER A OG    1 
ATOM   881  N  N     . LEU A 1 130 ? -4.650  28.444 1.351   1.00 67.03  ?  147 LEU A N     1 
ATOM   882  C  CA    . LEU A 1 130 ? -5.031  27.205 0.687   1.00 66.18  ?  147 LEU A CA    1 
ATOM   883  C  C     . LEU A 1 130 ? -4.175  26.947 -0.543  1.00 67.74  ?  147 LEU A C     1 
ATOM   884  O  O     . LEU A 1 130 ? -3.877  27.860 -1.314  1.00 69.76  ?  147 LEU A O     1 
ATOM   885  C  CB    . LEU A 1 130 ? -6.508  27.235 0.292   1.00 66.36  ?  147 LEU A CB    1 
ATOM   886  C  CG    . LEU A 1 130 ? -7.519  26.930 1.397   1.00 64.21  ?  147 LEU A CG    1 
ATOM   887  C  CD1   . LEU A 1 130 ? -8.934  27.108 0.887   1.00 64.86  ?  147 LEU A CD1   1 
ATOM   888  C  CD2   . LEU A 1 130 ? -7.316  25.514 1.908   1.00 62.00  ?  147 LEU A CD2   1 
ATOM   889  N  N     . ARG A 1 131 ? -3.787  25.690 -0.718  1.00 105.07 ?  148 ARG A N     1 
ATOM   890  C  CA    . ARG A 1 131 ? -3.000  25.277 -1.868  1.00 106.74 ?  148 ARG A CA    1 
ATOM   891  C  C     . ARG A 1 131 ? -3.908  25.133 -3.087  1.00 108.20 ?  148 ARG A C     1 
ATOM   892  O  O     . ARG A 1 131 ? -5.082  24.793 -2.945  1.00 107.53 ?  148 ARG A O     1 
ATOM   893  C  CB    . ARG A 1 131 ? -2.272  23.970 -1.559  1.00 105.70 ?  148 ARG A CB    1 
ATOM   894  C  CG    . ARG A 1 131 ? -1.308  24.076 -0.383  1.00 105.30 ?  148 ARG A CG    1 
ATOM   895  C  CD    . ARG A 1 131 ? -0.889  22.701 0.088   1.00 104.43 ?  148 ARG A CD    1 
ATOM   896  N  NE    . ARG A 1 131 ? -2.060  21.856 0.284   1.00 102.67 ?  148 ARG A NE    1 
ATOM   897  C  CZ    . ARG A 1 131 ? -2.027  20.534 0.394   1.00 101.82 ?  148 ARG A CZ    1 
ATOM   898  N  NH1   . ARG A 1 131 ? -0.872  19.884 0.332   1.00 102.66 1  148 ARG A NH1   1 
ATOM   899  N  NH2   . ARG A 1 131 ? -3.156  19.864 0.566   1.00 100.71 ?  148 ARG A NH2   1 
ATOM   900  N  N     . PRO A 1 132 ? -3.368  25.406 -4.288  1.00 55.31  ?  149 PRO A N     1 
ATOM   901  C  CA    . PRO A 1 132 ? -4.102  25.316 -5.558  1.00 55.16  ?  149 PRO A CA    1 
ATOM   902  C  C     . PRO A 1 132 ? -4.900  24.022 -5.731  1.00 53.62  ?  149 PRO A C     1 
ATOM   903  O  O     . PRO A 1 132 ? -5.929  24.029 -6.408  1.00 53.01  ?  149 PRO A O     1 
ATOM   904  C  CB    . PRO A 1 132 ? -2.988  25.403 -6.602  1.00 57.30  ?  149 PRO A CB    1 
ATOM   905  C  CG    . PRO A 1 132 ? -1.954  26.245 -5.953  1.00 58.78  ?  149 PRO A CG    1 
ATOM   906  C  CD    . PRO A 1 132 ? -1.989  25.889 -4.490  1.00 57.58  ?  149 PRO A CD    1 
ATOM   907  N  N     . LEU A 1 133 ? -4.429  22.934 -5.132  1.00 53.19  ?  150 LEU A N     1 
ATOM   908  C  CA    . LEU A 1 133 ? -5.113  21.648 -5.221  1.00 51.90  ?  150 LEU A CA    1 
ATOM   909  C  C     . LEU A 1 133 ? -6.477  21.676 -4.535  1.00 50.07  ?  150 LEU A C     1 
ATOM   910  O  O     . LEU A 1 133 ? -7.495  21.357 -5.149  1.00 49.43  ?  150 LEU A O     1 
ATOM   911  C  CB    . LEU A 1 133 ? -4.248  20.545 -4.611  1.00 52.03  ?  150 LEU A CB    1 
ATOM   912  C  CG    . LEU A 1 133 ? -4.864  19.147 -4.552  1.00 50.83  ?  150 LEU A CG    1 
ATOM   913  C  CD1   . LEU A 1 133 ? -5.142  18.615 -5.948  1.00 51.32  ?  150 LEU A CD1   1 
ATOM   914  C  CD2   . LEU A 1 133 ? -3.954  18.205 -3.791  1.00 51.12  ?  150 LEU A CD2   1 
ATOM   915  N  N     . ASP A 1 134 ? -6.489  22.057 -3.261  1.00 73.28  ?  151 ASP A N     1 
ATOM   916  C  CA    . ASP A 1 134 ? -7.722  22.091 -2.480  1.00 71.65  ?  151 ASP A CA    1 
ATOM   917  C  C     . ASP A 1 134 ? -8.701  23.128 -3.020  1.00 73.27  ?  151 ASP A C     1 
ATOM   918  O  O     . ASP A 1 134 ? -9.915  22.928 -2.977  1.00 73.13  ?  151 ASP A O     1 
ATOM   919  C  CB    . ASP A 1 134 ? -7.417  22.381 -1.009  1.00 69.10  ?  151 ASP A CB    1 
ATOM   920  C  CG    . ASP A 1 134 ? -6.679  21.244 -0.331  1.00 67.77  ?  151 ASP A CG    1 
ATOM   921  O  OD1   . ASP A 1 134 ? -6.883  20.079 -0.730  1.00 68.19  ?  151 ASP A OD1   1 
ATOM   922  O  OD2   . ASP A 1 134 ? -5.895  21.517 0.602   1.00 66.87  -1 151 ASP A OD2   1 
ATOM   923  N  N     . ILE A 1 135 ? -8.165  24.235 -3.523  1.00 53.97  ?  152 ILE A N     1 
ATOM   924  C  CA    . ILE A 1 135 ? -8.980  25.290 -4.114  1.00 54.25  ?  152 ILE A CA    1 
ATOM   925  C  C     . ILE A 1 135 ? -9.766  24.772 -5.314  1.00 56.02  ?  152 ILE A C     1 
ATOM   926  O  O     . ILE A 1 135 ? -10.984 24.938 -5.393  1.00 56.57  ?  152 ILE A O     1 
ATOM   927  C  CB    . ILE A 1 135 ? -8.117  26.484 -4.558  1.00 56.00  ?  152 ILE A CB    1 
ATOM   928  C  CG1   . ILE A 1 135 ? -7.480  27.164 -3.345  1.00 56.22  ?  152 ILE A CG1   1 
ATOM   929  C  CG2   . ILE A 1 135 ? -8.948  27.476 -5.355  1.00 58.70  ?  152 ILE A CG2   1 
ATOM   930  C  CD1   . ILE A 1 135 ? -6.474  28.234 -3.705  1.00 58.18  ?  152 ILE A CD1   1 
ATOM   931  N  N     . GLU A 1 136 ? -9.057  24.141 -6.244  1.00 55.05  ?  153 GLU A N     1 
ATOM   932  C  CA    . GLU A 1 136 ? -9.670  23.603 -7.451  1.00 55.32  ?  153 GLU A CA    1 
ATOM   933  C  C     . GLU A 1 136 ? -10.624 22.459 -7.126  1.00 54.10  ?  153 GLU A C     1 
ATOM   934  O  O     . GLU A 1 136 ? -11.658 22.299 -7.775  1.00 55.90  ?  153 GLU A O     1 
ATOM   935  C  CB    . GLU A 1 136 ? -8.594  23.127 -8.429  1.00 56.70  ?  153 GLU A CB    1 
ATOM   936  N  N     . PHE A 1 137 ? -10.269 21.663 -6.123  1.00 62.04  ?  154 PHE A N     1 
ATOM   937  C  CA    . PHE A 1 137 ? -11.078 20.514 -5.736  1.00 60.90  ?  154 PHE A CA    1 
ATOM   938  C  C     . PHE A 1 137 ? -12.408 20.946 -5.120  1.00 59.36  ?  154 PHE A C     1 
ATOM   939  O  O     . PHE A 1 137 ? -13.462 20.418 -5.474  1.00 60.42  ?  154 PHE A O     1 
ATOM   940  C  CB    . PHE A 1 137 ? -10.306 19.625 -4.759  1.00 58.16  ?  154 PHE A CB    1 
ATOM   941  C  CG    . PHE A 1 137 ? -10.623 18.161 -4.889  1.00 58.95  ?  154 PHE A CG    1 
ATOM   942  C  CD1   . PHE A 1 137 ? -11.903 17.687 -4.648  1.00 58.87  ?  154 PHE A CD1   1 
ATOM   943  C  CD2   . PHE A 1 137 ? -9.638  17.258 -5.255  1.00 59.80  ?  154 PHE A CD2   1 
ATOM   944  C  CE1   . PHE A 1 137 ? -12.193 16.340 -4.769  1.00 59.89  ?  154 PHE A CE1   1 
ATOM   945  C  CE2   . PHE A 1 137 ? -9.922  15.911 -5.376  1.00 60.71  ?  154 PHE A CE2   1 
ATOM   946  C  CZ    . PHE A 1 137 ? -11.201 15.451 -5.134  1.00 60.97  ?  154 PHE A CZ    1 
ATOM   947  N  N     . MET A 1 138 ? -12.357 21.901 -4.195  1.00 61.48  ?  155 MET A N     1 
ATOM   948  C  CA    . MET A 1 138 ? -13.571 22.401 -3.553  1.00 59.75  ?  155 MET A CA    1 
ATOM   949  C  C     . MET A 1 138 ? -14.471 23.167 -4.517  1.00 62.76  ?  155 MET A C     1 
ATOM   950  O  O     . MET A 1 138 ? -15.690 23.176 -4.352  1.00 62.11  ?  155 MET A O     1 
ATOM   951  C  CB    . MET A 1 138 ? -13.226 23.284 -2.352  1.00 57.18  ?  155 MET A CB    1 
ATOM   952  C  CG    . MET A 1 138 ? -12.724 22.512 -1.145  1.00 54.18  ?  155 MET A CG    1 
ATOM   953  S  SD    . MET A 1 138 ? -12.434 23.559 0.292   1.00 51.98  ?  155 MET A SD    1 
ATOM   954  C  CE    . MET A 1 138 ? -10.839 24.252 -0.123  1.00 53.90  ?  155 MET A CE    1 
ATOM   955  N  N     . LYS A 1 139 ? -13.876 23.811 -5.516  1.00 56.63  ?  156 LYS A N     1 
ATOM   956  C  CA    . LYS A 1 139 ? -14.660 24.543 -6.506  1.00 57.55  ?  156 LYS A CA    1 
ATOM   957  C  C     . LYS A 1 139 ? -15.504 23.576 -7.329  1.00 58.16  ?  156 LYS A C     1 
ATOM   958  O  O     . LYS A 1 139 ? -16.635 23.891 -7.703  1.00 59.36  ?  156 LYS A O     1 
ATOM   959  C  CB    . LYS A 1 139 ? -13.761 25.376 -7.420  1.00 60.28  ?  156 LYS A CB    1 
ATOM   960  C  CG    . LYS A 1 139 ? -13.674 26.843 -7.022  1.00 60.90  ?  156 LYS A CG    1 
ATOM   961  C  CD    . LYS A 1 139 ? -13.152 27.707 -8.161  1.00 65.40  ?  156 LYS A CD    1 
ATOM   962  C  CE    . LYS A 1 139 ? -11.773 27.264 -8.618  1.00 64.89  ?  156 LYS A CE    1 
ATOM   963  N  NZ    . LYS A 1 139 ? -11.217 28.187 -9.645  1.00 67.22  1  156 LYS A NZ    1 
ATOM   964  N  N     . ARG A 1 140 ? -14.949 22.402 -7.610  1.00 59.40  ?  157 ARG A N     1 
ATOM   965  C  CA    . ARG A 1 140 ? -15.685 21.365 -8.323  1.00 61.90  ?  157 ARG A CA    1 
ATOM   966  C  C     . ARG A 1 140 ? -16.795 20.787 -7.452  1.00 58.45  ?  157 ARG A C     1 
ATOM   967  O  O     . ARG A 1 140 ? -17.927 20.615 -7.904  1.00 59.82  ?  157 ARG A O     1 
ATOM   968  C  CB    . ARG A 1 140 ? -14.751 20.239 -8.773  1.00 63.36  ?  157 ARG A CB    1 
ATOM   969  C  CG    . ARG A 1 140 ? -13.694 20.636 -9.789  1.00 65.64  ?  157 ARG A CG    1 
ATOM   970  C  CD    . ARG A 1 140 ? -13.287 19.427 -10.619 1.00 66.77  ?  157 ARG A CD    1 
ATOM   971  N  NE    . ARG A 1 140 ? -11.960 19.565 -11.211 1.00 66.29  ?  157 ARG A NE    1 
ATOM   972  C  CZ    . ARG A 1 140 ? -11.130 18.548 -11.419 1.00 65.52  ?  157 ARG A CZ    1 
ATOM   973  N  NH1   . ARG A 1 140 ? -11.493 17.317 -11.086 1.00 65.11  1  157 ARG A NH1   1 
ATOM   974  N  NH2   . ARG A 1 140 ? -9.940  18.760 -11.962 1.00 65.05  ?  157 ARG A NH2   1 
ATOM   975  N  N     . LEU A 1 141 ? -16.458 20.488 -6.201  1.00 64.79  ?  158 LEU A N     1 
ATOM   976  C  CA    . LEU A 1 141 ? -17.390 19.844 -5.281  1.00 61.71  ?  158 LEU A CA    1 
ATOM   977  C  C     . LEU A 1 141 ? -18.572 20.738 -4.916  1.00 60.09  ?  158 LEU A C     1 
ATOM   978  O  O     . LEU A 1 141 ? -19.706 20.268 -4.834  1.00 59.67  ?  158 LEU A O     1 
ATOM   979  C  CB    . LEU A 1 141 ? -16.662 19.409 -4.008  1.00 58.06  ?  158 LEU A CB    1 
ATOM   980  C  CG    . LEU A 1 141 ? -15.834 18.125 -4.096  1.00 58.99  ?  158 LEU A CG    1 
ATOM   981  C  CD1   . LEU A 1 141 ? -15.140 17.841 -2.773  1.00 55.47  ?  158 LEU A CD1   1 
ATOM   982  C  CD2   . LEU A 1 141 ? -16.708 16.954 -4.509  1.00 60.97  ?  158 LEU A CD2   1 
ATOM   983  N  N     . SER A 1 142 ? -18.305 22.022 -4.700  1.00 57.78  ?  159 SER A N     1 
ATOM   984  C  CA    . SER A 1 142 ? -19.350 22.966 -4.313  1.00 56.49  ?  159 SER A CA    1 
ATOM   985  C  C     . SER A 1 142 ? -20.399 23.113 -5.408  1.00 59.42  ?  159 SER A C     1 
ATOM   986  O  O     . SER A 1 142 ? -21.547 23.470 -5.141  1.00 58.21  ?  159 SER A O     1 
ATOM   987  C  CB    . SER A 1 142 ? -18.747 24.332 -3.983  1.00 56.56  ?  159 SER A CB    1 
ATOM   988  O  OG    . SER A 1 142 ? -18.341 25.010 -5.159  1.00 60.93  ?  159 SER A OG    1 
ATOM   989  N  N     . LYS A 1 143 ? -19.996 22.831 -6.642  1.00 54.82  ?  160 LYS A N     1 
ATOM   990  C  CA    . LYS A 1 143 ? -20.888 22.950 -7.788  1.00 57.97  ?  160 LYS A CA    1 
ATOM   991  C  C     . LYS A 1 143 ? -21.846 21.769 -7.919  1.00 58.91  ?  160 LYS A C     1 
ATOM   992  O  O     . LYS A 1 143 ? -22.802 21.828 -8.692  1.00 62.03  ?  160 LYS A O     1 
ATOM   993  C  CB    . LYS A 1 143 ? -20.074 23.097 -9.077  1.00 60.35  ?  160 LYS A CB    1 
ATOM   994  C  CG    . LYS A 1 143 ? -19.976 24.522 -9.611  1.00 61.02  ?  160 LYS A CG    1 
ATOM   995  C  CD    . LYS A 1 143 ? -21.009 24.785 -10.705 1.00 64.01  ?  160 LYS A CD    1 
ATOM   996  C  CE    . LYS A 1 143 ? -22.406 25.007 -10.136 1.00 64.03  ?  160 LYS A CE    1 
ATOM   997  N  NZ    . LYS A 1 143 ? -23.463 24.879 -11.177 1.00 66.94  1  160 LYS A NZ    1 
ATOM   998  N  N     . VAL A 1 144 ? -21.593 20.699 -7.171  1.00 47.66  ?  161 VAL A N     1 
ATOM   999  C  CA    . VAL A 1 144 ? -22.406 19.492 -7.290  1.00 47.91  ?  161 VAL A CA    1 
ATOM   1000 C  C     . VAL A 1 144 ? -22.870 18.934 -5.947  1.00 46.79  ?  161 VAL A C     1 
ATOM   1001 O  O     . VAL A 1 144 ? -23.659 17.990 -5.906  1.00 47.10  ?  161 VAL A O     1 
ATOM   1002 C  CB    . VAL A 1 144 ? -21.641 18.375 -8.030  1.00 48.15  ?  161 VAL A CB    1 
ATOM   1003 C  CG1   . VAL A 1 144 ? -21.350 18.782 -9.467  1.00 49.58  ?  161 VAL A CG1   1 
ATOM   1004 C  CG2   . VAL A 1 144 ? -20.356 18.035 -7.291  1.00 46.90  ?  161 VAL A CG2   1 
ATOM   1005 N  N     . VAL A 1 145 ? -22.389 19.516 -4.853  1.00 45.67  ?  162 VAL A N     1 
ATOM   1006 C  CA    . VAL A 1 145 ? -22.729 19.019 -3.523  1.00 44.67  ?  162 VAL A CA    1 
ATOM   1007 C  C     . VAL A 1 145 ? -22.425 20.056 -2.444  1.00 43.88  ?  162 VAL A C     1 
ATOM   1008 O  O     . VAL A 1 145 ? -21.624 20.968 -2.656  1.00 43.92  ?  162 VAL A O     1 
ATOM   1009 C  CB    . VAL A 1 145 ? -21.972 17.703 -3.207  1.00 43.95  ?  162 VAL A CB    1 
ATOM   1010 C  CG1   . VAL A 1 145 ? -20.565 17.991 -2.708  1.00 43.11  ?  162 VAL A CG1   1 
ATOM   1011 C  CG2   . VAL A 1 145 ? -22.740 16.872 -2.194  1.00 43.49  ?  162 VAL A CG2   1 
ATOM   1012 N  N     . ASN A 1 146 ? -23.079 19.925 -1.294  1.00 52.20  ?  163 ASN A N     1 
ATOM   1013 C  CA    . ASN A 1 146 ? -22.817 20.809 -0.166  1.00 51.00  ?  163 ASN A CA    1 
ATOM   1014 C  C     . ASN A 1 146 ? -21.534 20.423 0.558   1.00 50.28  ?  163 ASN A C     1 
ATOM   1015 O  O     . ASN A 1 146 ? -21.422 19.319 1.094   1.00 49.81  ?  163 ASN A O     1 
ATOM   1016 C  CB    . ASN A 1 146 ? -23.989 20.793 0.817   1.00 50.12  ?  163 ASN A CB    1 
ATOM   1017 C  CG    . ASN A 1 146 ? -25.269 21.325 0.208   1.00 51.30  ?  163 ASN A CG    1 
ATOM   1018 O  OD1   . ASN A 1 146 ? -25.264 22.341 -0.488  1.00 52.46  ?  163 ASN A OD1   1 
ATOM   1019 N  ND2   . ASN A 1 146 ? -26.378 20.644 0.473   1.00 51.66  ?  163 ASN A ND2   1 
ATOM   1020 N  N     . ILE A 1 147 ? -20.568 21.334 0.575   1.00 44.34  ?  164 ILE A N     1 
ATOM   1021 C  CA    . ILE A 1 147 ? -19.291 21.066 1.222   1.00 43.73  ?  164 ILE A CA    1 
ATOM   1022 C  C     . ILE A 1 147 ? -19.173 21.812 2.546   1.00 43.33  ?  164 ILE A C     1 
ATOM   1023 O  O     . ILE A 1 147 ? -19.581 22.967 2.665   1.00 43.70  ?  164 ILE A O     1 
ATOM   1024 C  CB    . ILE A 1 147 ? -18.094 21.436 0.323   1.00 44.23  ?  164 ILE A CB    1 
ATOM   1025 C  CG1   . ILE A 1 147 ? -18.169 22.897 -0.121  1.00 44.96  ?  164 ILE A CG1   1 
ATOM   1026 C  CG2   . ILE A 1 147 ? -18.031 20.509 -0.878  1.00 44.65  ?  164 ILE A CG2   1 
ATOM   1027 C  CD1   . ILE A 1 147 ? -17.004 23.323 -0.985  1.00 45.67  ?  164 ILE A CD1   1 
ATOM   1028 N  N     . VAL A 1 148 ? -18.621 21.131 3.543   1.00 40.03  ?  165 VAL A N     1 
ATOM   1029 C  CA    . VAL A 1 148 ? -18.292 21.763 4.811   1.00 39.81  ?  165 VAL A CA    1 
ATOM   1030 C  C     . VAL A 1 148 ? -16.809 21.561 5.086   1.00 39.82  ?  165 VAL A C     1 
ATOM   1031 O  O     . VAL A 1 148 ? -16.384 20.467 5.463   1.00 39.48  ?  165 VAL A O     1 
ATOM   1032 C  CB    . VAL A 1 148 ? -19.125 21.193 5.974   1.00 39.32  ?  165 VAL A CB    1 
ATOM   1033 C  CG1   . VAL A 1 148 ? -18.687 21.811 7.293   1.00 39.24  ?  165 VAL A CG1   1 
ATOM   1034 C  CG2   . VAL A 1 148 ? -20.605 21.438 5.735   1.00 39.59  ?  165 VAL A CG2   1 
ATOM   1035 N  N     . PRO A 1 149 ? -16.013 22.623 4.888   1.00 40.41  ?  166 PRO A N     1 
ATOM   1036 C  CA    . PRO A 1 149 ? -14.556 22.563 5.040   1.00 40.80  ?  166 PRO A CA    1 
ATOM   1037 C  C     . PRO A 1 149 ? -14.151 22.345 6.489   1.00 40.59  ?  166 PRO A C     1 
ATOM   1038 O  O     . PRO A 1 149 ? -14.743 22.932 7.396   1.00 40.46  ?  166 PRO A O     1 
ATOM   1039 C  CB    . PRO A 1 149 ? -14.082 23.935 4.535   1.00 41.70  ?  166 PRO A CB    1 
ATOM   1040 C  CG    . PRO A 1 149 ? -15.276 24.571 3.886   1.00 41.74  ?  166 PRO A CG    1 
ATOM   1041 C  CD    . PRO A 1 149 ? -16.474 23.974 4.536   1.00 40.96  ?  166 PRO A CD    1 
ATOM   1042 N  N     . VAL A 1 150 ? -13.146 21.503 6.697   1.00 44.28  ?  167 VAL A N     1 
ATOM   1043 C  CA    . VAL A 1 150 ? -12.709 21.154 8.039   1.00 44.26  ?  167 VAL A CA    1 
ATOM   1044 C  C     . VAL A 1 150 ? -11.188 21.232 8.176   1.00 45.23  ?  167 VAL A C     1 
ATOM   1045 O  O     . VAL A 1 150 ? -10.453 20.900 7.245   1.00 45.69  ?  167 VAL A O     1 
ATOM   1046 C  CB    . VAL A 1 150 ? -13.213 19.732 8.408   1.00 43.53  ?  167 VAL A CB    1 
ATOM   1047 C  CG1   . VAL A 1 150 ? -12.112 18.881 9.020   1.00 43.91  ?  167 VAL A CG1   1 
ATOM   1048 C  CG2   . VAL A 1 150 ? -14.428 19.813 9.321   1.00 42.97  ?  167 VAL A CG2   1 
ATOM   1049 N  N     . ILE A 1 151 ? -10.723 21.685 9.337   1.00 42.17  ?  168 ILE A N     1 
ATOM   1050 C  CA    . ILE A 1 151 ? -9.295  21.700 9.631   1.00 43.35  ?  168 ILE A CA    1 
ATOM   1051 C  C     . ILE A 1 151 ? -8.874  20.344 10.179  1.00 43.27  ?  168 ILE A C     1 
ATOM   1052 O  O     . ILE A 1 151 ? -9.109  20.037 11.349  1.00 43.10  ?  168 ILE A O     1 
ATOM   1053 C  CB    . ILE A 1 151 ? -8.921  22.802 10.639  1.00 44.26  ?  168 ILE A CB    1 
ATOM   1054 C  CG1   . ILE A 1 151 ? -9.274  24.179 10.081  1.00 44.56  ?  168 ILE A CG1   1 
ATOM   1055 C  CG2   . ILE A 1 151 ? -7.438  22.742 10.966  1.00 45.77  ?  168 ILE A CG2   1 
ATOM   1056 C  CD1   . ILE A 1 151 ? -9.007  25.314 11.045  1.00 45.56  ?  168 ILE A CD1   1 
ATOM   1057 N  N     . ALA A 1 152 ? -8.266  19.530 9.323   1.00 46.60  ?  169 ALA A N     1 
ATOM   1058 C  CA    . ALA A 1 152 ? -7.824  18.198 9.715   1.00 46.69  ?  169 ALA A CA    1 
ATOM   1059 C  C     . ALA A 1 152 ? -6.751  18.270 10.794  1.00 47.94  ?  169 ALA A C     1 
ATOM   1060 O  O     . ALA A 1 152 ? -5.824  19.076 10.700  1.00 49.20  ?  169 ALA A O     1 
ATOM   1061 C  CB    . ALA A 1 152 ? -7.308  17.440 8.506   1.00 46.96  ?  169 ALA A CB    1 
ATOM   1062 N  N     . LYS A 1 153 ? -6.882  17.414 11.807  1.00 44.67  ?  170 LYS A N     1 
ATOM   1063 C  CA    . LYS A 1 153 ? -5.930  17.349 12.914  1.00 45.99  ?  170 LYS A CA    1 
ATOM   1064 C  C     . LYS A 1 153 ? -5.704  18.721 13.542  1.00 46.79  ?  170 LYS A C     1 
ATOM   1065 O  O     . LYS A 1 153 ? -4.598  19.254 13.503  1.00 48.35  ?  170 LYS A O     1 
ATOM   1066 C  CB    . LYS A 1 153 ? -4.601  16.759 12.438  1.00 47.36  ?  170 LYS A CB    1 
ATOM   1067 C  CG    . LYS A 1 153 ? -4.721  15.347 11.889  1.00 46.83  ?  170 LYS A CG    1 
ATOM   1068 C  CD    . LYS A 1 153 ? -3.403  14.862 11.311  1.00 48.36  ?  170 LYS A CD    1 
ATOM   1069 C  CE    . LYS A 1 153 ? -3.462  13.380 10.985  1.00 48.08  ?  170 LYS A CE    1 
ATOM   1070 N  NZ    . LYS A 1 153 ? -2.153  12.860 10.498  1.00 49.78  1  170 LYS A NZ    1 
ATOM   1071 N  N     . ALA A 1 154 ? -6.761  19.286 14.118  1.00 45.91  ?  171 ALA A N     1 
ATOM   1072 C  CA    . ALA A 1 154 ? -6.711  20.637 14.670  1.00 46.63  ?  171 ALA A CA    1 
ATOM   1073 C  C     . ALA A 1 154 ? -5.846  20.729 15.925  1.00 48.20  ?  171 ALA A C     1 
ATOM   1074 O  O     . ALA A 1 154 ? -5.547  21.824 16.401  1.00 49.26  ?  171 ALA A O     1 
ATOM   1075 C  CB    . ALA A 1 154 ? -8.115  21.127 14.969  1.00 45.38  ?  171 ALA A CB    1 
ATOM   1076 N  N     . ASP A 1 155 ? -5.447  19.578 16.456  1.00 50.75  ?  172 ASP A N     1 
ATOM   1077 C  CA    . ASP A 1 155 ? -4.554  19.533 17.609  1.00 52.50  ?  172 ASP A CA    1 
ATOM   1078 C  C     . ASP A 1 155 ? -3.119  19.875 17.209  1.00 54.46  ?  172 ASP A C     1 
ATOM   1079 O  O     . ASP A 1 155 ? -2.268  20.120 18.063  1.00 56.34  ?  172 ASP A O     1 
ATOM   1080 C  CB    . ASP A 1 155 ? -4.609  18.155 18.272  1.00 52.35  ?  172 ASP A CB    1 
ATOM   1081 C  CG    . ASP A 1 155 ? -4.398  17.024 17.286  1.00 51.81  ?  172 ASP A CG    1 
ATOM   1082 O  OD1   . ASP A 1 155 ? -4.863  17.146 16.132  1.00 50.66  ?  172 ASP A OD1   1 
ATOM   1083 O  OD2   . ASP A 1 155 ? -3.768  16.013 17.663  1.00 52.67  -1 172 ASP A OD2   1 
ATOM   1084 N  N     . THR A 1 156 ? -2.864  19.886 15.904  1.00 63.54  ?  173 THR A N     1 
ATOM   1085 C  CA    . THR A 1 156 ? -1.563  20.264 15.363  1.00 64.00  ?  173 THR A CA    1 
ATOM   1086 C  C     . THR A 1 156 ? -1.237  21.725 15.667  1.00 65.07  ?  173 THR A C     1 
ATOM   1087 O  O     . THR A 1 156 ? -0.085  22.078 15.926  1.00 65.73  ?  173 THR A O     1 
ATOM   1088 C  CB    . THR A 1 156 ? -1.512  20.041 13.835  1.00 63.64  ?  173 THR A CB    1 
ATOM   1089 O  OG1   . THR A 1 156 ? -1.851  18.681 13.536  1.00 63.10  ?  173 THR A OG1   1 
ATOM   1090 C  CG2   . THR A 1 156 ? -0.129  20.352 13.282  1.00 64.00  ?  173 THR A CG2   1 
ATOM   1091 N  N     . LEU A 1 157 ? -2.264  22.567 15.645  1.00 53.96  ?  174 LEU A N     1 
ATOM   1092 C  CA    . LEU A 1 157 ? -2.091  24.008 15.786  1.00 55.10  ?  174 LEU A CA    1 
ATOM   1093 C  C     . LEU A 1 157 ? -2.316  24.487 17.217  1.00 55.76  ?  174 LEU A C     1 
ATOM   1094 O  O     . LEU A 1 157 ? -2.998  23.829 18.003  1.00 54.74  ?  174 LEU A O     1 
ATOM   1095 C  CB    . LEU A 1 157 ? -3.044  24.743 14.841  1.00 53.64  ?  174 LEU A CB    1 
ATOM   1096 C  CG    . LEU A 1 157 ? -2.931  24.374 13.362  1.00 53.03  ?  174 LEU A CG    1 
ATOM   1097 C  CD1   . LEU A 1 157 ? -4.081  24.975 12.570  1.00 51.48  ?  174 LEU A CD1   1 
ATOM   1098 C  CD2   . LEU A 1 157 ? -1.592  24.822 12.797  1.00 55.21  ?  174 LEU A CD2   1 
ATOM   1099 N  N     . THR A 1 158 ? -1.733  25.634 17.549  1.00 60.96  ?  175 THR A N     1 
ATOM   1100 C  CA    . THR A 1 158 ? -1.973  26.266 18.840  1.00 61.78  ?  175 THR A CA    1 
ATOM   1101 C  C     . THR A 1 158 ? -3.278  27.052 18.785  1.00 60.20  ?  175 THR A C     1 
ATOM   1102 O  O     . THR A 1 158 ? -3.915  27.134 17.734  1.00 58.67  ?  175 THR A O     1 
ATOM   1103 C  CB    . THR A 1 158 ? -0.824  27.210 19.243  1.00 64.72  ?  175 THR A CB    1 
ATOM   1104 O  OG1   . THR A 1 158 ? -0.842  28.374 18.408  1.00 65.07  ?  175 THR A OG1   1 
ATOM   1105 C  CG2   . THR A 1 158 ? 0.520   26.509 19.108  1.00 66.58  ?  175 THR A CG2   1 
ATOM   1106 N  N     . LEU A 1 159 ? -3.678  27.624 19.916  1.00 65.24  ?  176 LEU A N     1 
ATOM   1107 C  CA    . LEU A 1 159 ? -4.908  28.406 19.980  1.00 65.18  ?  176 LEU A CA    1 
ATOM   1108 C  C     . LEU A 1 159 ? -4.828  29.642 19.089  1.00 66.98  ?  176 LEU A C     1 
ATOM   1109 O  O     . LEU A 1 159 ? -5.781  29.974 18.384  1.00 66.42  ?  176 LEU A O     1 
ATOM   1110 C  CB    . LEU A 1 159 ? -5.205  28.818 21.424  1.00 66.06  ?  176 LEU A CB    1 
ATOM   1111 N  N     . GLU A 1 160 ? -3.685  30.318 19.129  1.00 58.90  ?  177 GLU A N     1 
ATOM   1112 C  CA    . GLU A 1 160 ? -3.455  31.499 18.303  1.00 61.01  ?  177 GLU A CA    1 
ATOM   1113 C  C     . GLU A 1 160 ? -3.437  31.160 16.814  1.00 59.07  ?  177 GLU A C     1 
ATOM   1114 O  O     . GLU A 1 160 ? -4.042  31.858 16.000  1.00 59.34  ?  177 GLU A O     1 
ATOM   1115 C  CB    . GLU A 1 160 ? -2.142  32.177 18.700  1.00 63.66  ?  177 GLU A CB    1 
ATOM   1116 N  N     . GLU A 1 161 ? -2.736  30.085 16.470  1.00 78.03  ?  178 GLU A N     1 
ATOM   1117 C  CA    . GLU A 1 161 ? -2.593  29.661 15.080  1.00 76.25  ?  178 GLU A CA    1 
ATOM   1118 C  C     . GLU A 1 161 ? -3.919  29.225 14.461  1.00 74.05  ?  178 GLU A C     1 
ATOM   1119 O  O     . GLU A 1 161 ? -4.153  29.439 13.272  1.00 73.20  ?  178 GLU A O     1 
ATOM   1120 C  CB    . GLU A 1 161 ? -1.568  28.530 14.974  1.00 75.25  ?  178 GLU A CB    1 
ATOM   1121 C  CG    . GLU A 1 161 ? -0.147  28.967 15.290  1.00 77.10  ?  178 GLU A CG    1 
ATOM   1122 C  CD    . GLU A 1 161 ? 0.846   27.825 15.223  1.00 76.51  ?  178 GLU A CD    1 
ATOM   1123 O  OE1   . GLU A 1 161 ? 0.410   26.655 15.233  1.00 75.13  ?  178 GLU A OE1   1 
ATOM   1124 O  OE2   . GLU A 1 161 ? 2.063   28.098 15.161  1.00 77.70  -1 178 GLU A OE2   1 
ATOM   1125 N  N     . ARG A 1 162 ? -4.779  28.611 15.268  1.00 49.54  ?  179 ARG A N     1 
ATOM   1126 C  CA    . ARG A 1 162 ? -6.075  28.143 14.789  1.00 47.07  ?  179 ARG A CA    1 
ATOM   1127 C  C     . ARG A 1 162 ? -6.938  29.325 14.361  1.00 45.59  ?  179 ARG A C     1 
ATOM   1128 O  O     . ARG A 1 162 ? -7.652  29.256 13.360  1.00 44.06  ?  179 ARG A O     1 
ATOM   1129 C  CB    . ARG A 1 162 ? -6.790  27.328 15.868  1.00 46.68  ?  179 ARG A CB    1 
ATOM   1130 N  N     . VAL A 1 163 ? -6.866  30.406 15.130  1.00 67.76  ?  180 VAL A N     1 
ATOM   1131 C  CA    . VAL A 1 163 ? -7.616  31.618 14.830  1.00 69.19  ?  180 VAL A CA    1 
ATOM   1132 C  C     . VAL A 1 163 ? -7.116  32.247 13.532  1.00 69.81  ?  180 VAL A C     1 
ATOM   1133 O  O     . VAL A 1 163 ? -7.909  32.658 12.685  1.00 69.17  ?  180 VAL A O     1 
ATOM   1134 C  CB    . VAL A 1 163 ? -7.507  32.646 15.975  1.00 72.47  ?  180 VAL A CB    1 
ATOM   1135 C  CG1   . VAL A 1 163 ? -8.185  33.952 15.591  1.00 74.67  ?  180 VAL A CG1   1 
ATOM   1136 C  CG2   . VAL A 1 163 ? -8.110  32.082 17.252  1.00 71.07  ?  180 VAL A CG2   1 
ATOM   1137 N  N     . HIS A 1 164 ? -5.797  32.306 13.379  1.00 57.07  ?  181 HIS A N     1 
ATOM   1138 C  CA    . HIS A 1 164 ? -5.187  32.866 12.177  1.00 57.21  ?  181 HIS A CA    1 
ATOM   1139 C  C     . HIS A 1 164 ? -5.466  32.009 10.945  1.00 53.80  ?  181 HIS A C     1 
ATOM   1140 O  O     . HIS A 1 164 ? -5.657  32.532 9.847   1.00 53.18  ?  181 HIS A O     1 
ATOM   1141 C  CB    . HIS A 1 164 ? -3.678  33.025 12.370  1.00 58.55  ?  181 HIS A CB    1 
ATOM   1142 C  CG    . HIS A 1 164 ? -2.954  33.464 11.134  1.00 58.43  ?  181 HIS A CG    1 
ATOM   1143 N  ND1   . HIS A 1 164 ? -3.030  34.750 10.645  1.00 60.54  ?  181 HIS A ND1   1 
ATOM   1144 C  CD2   . HIS A 1 164 ? -2.143  32.786 10.288  1.00 56.54  ?  181 HIS A CD2   1 
ATOM   1145 C  CE1   . HIS A 1 164 ? -2.295  34.846 9.550   1.00 59.64  ?  181 HIS A CE1   1 
ATOM   1146 N  NE2   . HIS A 1 164 ? -1.747  33.669 9.312   1.00 57.37  ?  181 HIS A NE2   1 
ATOM   1147 N  N     . PHE A 1 165 ? -5.486  30.693 11.132  1.00 61.15  ?  182 PHE A N     1 
ATOM   1148 C  CA    . PHE A 1 165 ? -5.721  29.768 10.029  1.00 58.54  ?  182 PHE A CA    1 
ATOM   1149 C  C     . PHE A 1 165 ? -7.164  29.850 9.544   1.00 56.90  ?  182 PHE A C     1 
ATOM   1150 O  O     . PHE A 1 165 ? -7.424  29.872 8.342   1.00 55.43  ?  182 PHE A O     1 
ATOM   1151 C  CB    . PHE A 1 165 ? -5.385  28.335 10.445  1.00 57.43  ?  182 PHE A CB    1 
ATOM   1152 C  CG    . PHE A 1 165 ? -5.308  27.371 9.294   1.00 55.66  ?  182 PHE A CG    1 
ATOM   1153 C  CD1   . PHE A 1 165 ? -4.627  27.707 8.135   1.00 55.55  ?  182 PHE A CD1   1 
ATOM   1154 C  CD2   . PHE A 1 165 ? -5.914  26.128 9.372   1.00 54.50  ?  182 PHE A CD2   1 
ATOM   1155 C  CE1   . PHE A 1 165 ? -4.554  26.822 7.076   1.00 54.46  ?  182 PHE A CE1   1 
ATOM   1156 C  CE2   . PHE A 1 165 ? -5.844  25.238 8.316   1.00 53.60  ?  182 PHE A CE2   1 
ATOM   1157 C  CZ    . PHE A 1 165 ? -5.163  25.586 7.166   1.00 53.60  ?  182 PHE A CZ    1 
ATOM   1158 N  N     . LYS A 1 166 ? -8.097  29.897 10.491  1.00 67.95  ?  183 LYS A N     1 
ATOM   1159 C  CA    . LYS A 1 166 ? -9.516  30.040 10.181  1.00 66.35  ?  183 LYS A CA    1 
ATOM   1160 C  C     . LYS A 1 166 ? -9.792  31.312 9.389   1.00 67.02  ?  183 LYS A C     1 
ATOM   1161 O  O     . LYS A 1 166 ? -10.553 31.298 8.421   1.00 64.83  ?  183 LYS A O     1 
ATOM   1162 C  CB    . LYS A 1 166 ? -10.346 30.040 11.465  1.00 66.71  ?  183 LYS A CB    1 
ATOM   1163 C  CG    . LYS A 1 166 ? -10.628 28.658 12.026  1.00 64.94  ?  183 LYS A CG    1 
ATOM   1164 C  CD    . LYS A 1 166 ? -11.617 28.734 13.175  1.00 64.57  ?  183 LYS A CD    1 
ATOM   1165 C  CE    . LYS A 1 166 ? -12.201 27.372 13.497  1.00 62.78  ?  183 LYS A CE    1 
ATOM   1166 N  NZ    . LYS A 1 166 ? -13.291 27.468 14.505  1.00 61.88  1  183 LYS A NZ    1 
ATOM   1167 N  N     . GLN A 1 167 ? -9.173  32.409 9.812   1.00 59.89  ?  184 GLN A N     1 
ATOM   1168 C  CA    . GLN A 1 167 ? -9.336  33.696 9.147   1.00 61.08  ?  184 GLN A CA    1 
ATOM   1169 C  C     . GLN A 1 167 ? -8.872  33.635 7.695   1.00 59.35  ?  184 GLN A C     1 
ATOM   1170 O  O     . GLN A 1 167 ? -9.455  34.277 6.818   1.00 58.41  ?  184 GLN A O     1 
ATOM   1171 C  CB    . GLN A 1 167 ? -8.568  34.785 9.898   1.00 65.49  ?  184 GLN A CB    1 
ATOM   1172 C  CG    . GLN A 1 167 ? -9.215  35.213 11.206  1.00 68.13  ?  184 GLN A CG    1 
ATOM   1173 C  CD    . GLN A 1 167 ? -8.428  36.292 11.927  1.00 73.27  ?  184 GLN A CD    1 
ATOM   1174 O  OE1   . GLN A 1 167 ? -7.384  36.739 11.452  1.00 74.54  ?  184 GLN A OE1   1 
ATOM   1175 N  NE2   . GLN A 1 167 ? -8.931  36.719 13.081  1.00 76.15  ?  184 GLN A NE2   1 
ATOM   1176 N  N     . ARG A 1 168 ? -7.822  32.856 7.454   1.00 64.97  ?  185 ARG A N     1 
ATOM   1177 C  CA    . ARG A 1 168 ? -7.217  32.759 6.132   1.00 64.51  ?  185 ARG A CA    1 
ATOM   1178 C  C     . ARG A 1 168 ? -8.026  31.854 5.198   1.00 61.92  ?  185 ARG A C     1 
ATOM   1179 O  O     . ARG A 1 168 ? -8.252  32.191 4.034   1.00 61.51  ?  185 ARG A O     1 
ATOM   1180 C  CB    . ARG A 1 168 ? -5.772  32.249 6.239   1.00 70.01  ?  185 ARG A CB    1 
ATOM   1181 C  CG    . ARG A 1 168 ? -5.119  32.153 4.882   1.00 69.91  ?  185 ARG A CG    1 
ATOM   1182 C  CD    . ARG A 1 168 ? -5.083  33.509 4.228   1.00 71.02  ?  185 ARG A CD    1 
ATOM   1183 N  NE    . ARG A 1 168 ? -4.628  33.450 2.843   1.00 70.95  ?  185 ARG A NE    1 
ATOM   1184 C  CZ    . ARG A 1 168 ? -5.465  33.421 1.810   1.00 69.97  ?  185 ARG A CZ    1 
ATOM   1185 N  NH1   . ARG A 1 168 ? -6.766  33.521 2.036   1.00 68.71  ?  185 ARG A NH1   1 
ATOM   1186 N  NH2   . ARG A 1 168 ? -5.020  33.346 0.560   1.00 70.31  ?  185 ARG A NH2   1 
ATOM   1187 N  N     . ILE A 1 169 ? -8.481  30.720 5.723   1.00 43.05  ?  186 ILE A N     1 
ATOM   1188 C  CA    . ILE A 1 169 ? -9.314  29.792 4.964   1.00 42.14  ?  186 ILE A CA    1 
ATOM   1189 C  C     . ILE A 1 169 ? -10.593 30.488 4.504   1.00 41.01  ?  186 ILE A C     1 
ATOM   1190 O  O     . ILE A 1 169 ? -11.025 30.331 3.362   1.00 41.17  ?  186 ILE A O     1 
ATOM   1191 C  CB    . ILE A 1 169 ? -9.675  28.543 5.793   1.00 41.31  ?  186 ILE A CB    1 
ATOM   1192 C  CG1   . ILE A 1 169 ? -8.411  27.793 6.214   1.00 42.73  ?  186 ILE A CG1   1 
ATOM   1193 C  CG2   . ILE A 1 169 ? -10.602 27.630 5.010   1.00 40.65  ?  186 ILE A CG2   1 
ATOM   1194 C  CD1   . ILE A 1 169 ? -7.536  27.375 5.057   1.00 44.38  ?  186 ILE A CD1   1 
ATOM   1195 N  N     . THR A 1 170 ? -11.191 31.254 5.413   1.00 38.79  ?  187 THR A N     1 
ATOM   1196 C  CA    . THR A 1 170 ? -12.389 32.033 5.121   1.00 38.02  ?  187 THR A CA    1 
ATOM   1197 C  C     . THR A 1 170 ? -12.183 32.954 3.921   1.00 39.09  ?  187 THR A C     1 
ATOM   1198 O  O     . THR A 1 170 ? -13.039 33.026 3.031   1.00 38.93  ?  187 THR A O     1 
ATOM   1199 C  CB    . THR A 1 170 ? -12.812 32.878 6.331   1.00 37.53  ?  187 THR A CB    1 
ATOM   1200 O  OG1   . THR A 1 170 ? -12.999 32.028 7.469   1.00 36.83  ?  187 THR A OG1   1 
ATOM   1201 C  CG2   . THR A 1 170 ? -14.103 33.621 6.039   1.00 36.98  ?  187 THR A CG2   1 
ATOM   1202 N  N     . ALA A 1 171 ? -11.045 33.645 3.897   1.00 41.29  ?  188 ALA A N     1 
ATOM   1203 C  CA    . ALA A 1 171 ? -10.717 34.564 2.814   1.00 42.76  ?  188 ALA A CA    1 
ATOM   1204 C  C     . ALA A 1 171 ? -10.591 33.846 1.479   1.00 43.50  ?  188 ALA A C     1 
ATOM   1205 O  O     . ALA A 1 171 ? -10.971 34.395 0.453   1.00 44.25  ?  188 ALA A O     1 
ATOM   1206 C  CB    . ALA A 1 171 ? -9.440  35.307 3.124   1.00 44.51  ?  188 ALA A CB    1 
ATOM   1207 N  N     . ASP A 1 172 ? -10.048 32.629 1.485   1.00 74.55  ?  189 ASP A N     1 
ATOM   1208 C  CA    . ASP A 1 172 ? -9.906  31.839 0.250   1.00 74.29  ?  189 ASP A CA    1 
ATOM   1209 C  C     . ASP A 1 172 ? -11.233 31.395 -0.346  1.00 72.50  ?  189 ASP A C     1 
ATOM   1210 O  O     . ASP A 1 172 ? -11.415 31.472 -1.557  1.00 73.14  ?  189 ASP A O     1 
ATOM   1211 C  CB    . ASP A 1 172 ? -9.041  30.582 0.488   1.00 74.70  ?  189 ASP A CB    1 
ATOM   1212 C  CG    . ASP A 1 172 ? -7.551  30.839 0.378   1.00 77.02  ?  189 ASP A CG    1 
ATOM   1213 O  OD1   . ASP A 1 172 ? -7.136  31.775 -0.339  1.00 78.75  ?  189 ASP A OD1   1 
ATOM   1214 O  OD2   . ASP A 1 172 ? -6.787  30.090 1.020   1.00 77.40  -1 189 ASP A OD2   1 
ATOM   1215 N  N     . LEU A 1 173 ? -12.133 30.898 0.497   1.00 47.21  ?  190 LEU A N     1 
ATOM   1216 C  CA    . LEU A 1 173 ? -13.446 30.453 0.051   1.00 46.51  ?  190 LEU A CA    1 
ATOM   1217 C  C     . LEU A 1 173 ? -14.158 31.639 -0.590  1.00 46.88  ?  190 LEU A C     1 
ATOM   1218 O  O     . LEU A 1 173 ? -14.805 31.514 -1.630  1.00 47.59  ?  190 LEU A O     1 
ATOM   1219 C  CB    . LEU A 1 173 ? -14.229 29.889 1.227   1.00 44.90  ?  190 LEU A CB    1 
ATOM   1220 C  CG    . LEU A 1 173 ? -13.515 28.690 1.864   1.00 44.82  ?  190 LEU A CG    1 
ATOM   1221 C  CD1   . LEU A 1 173 ? -14.292 28.186 3.064   1.00 43.53  ?  190 LEU A CD1   1 
ATOM   1222 C  CD2   . LEU A 1 173 ? -13.268 27.561 0.862   1.00 45.91  ?  190 LEU A CD2   1 
ATOM   1223 N  N     . LEU A 1 174 ? -14.038 32.791 0.059   1.00 49.24  ?  191 LEU A N     1 
ATOM   1224 C  CA    . LEU A 1 174 ? -14.633 34.021 -0.448  1.00 49.29  ?  191 LEU A CA    1 
ATOM   1225 C  C     . LEU A 1 174 ? -13.969 34.516 -1.739  1.00 50.99  ?  191 LEU A C     1 
ATOM   1226 O  O     . LEU A 1 174 ? -14.655 34.833 -2.713  1.00 51.14  ?  191 LEU A O     1 
ATOM   1227 C  CB    . LEU A 1 174 ? -14.563 35.110 0.623   1.00 49.33  ?  191 LEU A CB    1 
ATOM   1228 C  CG    . LEU A 1 174 ? -15.425 34.848 1.862   1.00 47.91  ?  191 LEU A CG    1 
ATOM   1229 C  CD1   . LEU A 1 174 ? -15.244 35.937 2.907   1.00 48.83  ?  191 LEU A CD1   1 
ATOM   1230 C  CD2   . LEU A 1 174 ? -16.896 34.690 1.494   1.00 46.23  ?  191 LEU A CD2   1 
ATOM   1231 N  N     . SER A 1 175 ? -12.639 34.584 -1.744  1.00 44.19  ?  192 SER A N     1 
ATOM   1232 C  CA    . SER A 1 175 ? -11.906 35.106 -2.898  1.00 46.52  ?  192 SER A CA    1 
ATOM   1233 C  C     . SER A 1 175 ? -11.971 34.171 -4.105  1.00 47.55  ?  192 SER A C     1 
ATOM   1234 O  O     . SER A 1 175 ? -11.941 34.625 -5.249  1.00 49.47  ?  192 SER A O     1 
ATOM   1235 C  CB    . SER A 1 175 ? -10.443 35.374 -2.533  1.00 47.77  ?  192 SER A CB    1 
ATOM   1236 O  OG    . SER A 1 175 ? -9.808  34.199 -2.061  1.00 47.28  ?  192 SER A OG    1 
ATOM   1237 N  N     . ASN A 1 176 ? -12.063 32.870 -3.851  1.00 75.00  ?  193 ASN A N     1 
ATOM   1238 C  CA    . ASN A 1 176 ? -12.134 31.892 -4.934  1.00 72.82  ?  193 ASN A CA    1 
ATOM   1239 C  C     . ASN A 1 176 ? -13.572 31.571 -5.324  1.00 74.73  ?  193 ASN A C     1 
ATOM   1240 O  O     . ASN A 1 176 ? -13.817 30.740 -6.199  1.00 72.97  ?  193 ASN A O     1 
ATOM   1241 C  CB    . ASN A 1 176 ? -11.401 30.605 -4.550  1.00 67.57  ?  193 ASN A CB    1 
ATOM   1242 C  CG    . ASN A 1 176 ? -9.896  30.731 -4.680  1.00 64.88  ?  193 ASN A CG    1 
ATOM   1243 O  OD1   . ASN A 1 176 ? -9.353  30.701 -5.785  1.00 63.53  ?  193 ASN A OD1   1 
ATOM   1244 N  ND2   . ASN A 1 176 ? -9.214  30.870 -3.550  1.00 63.05  ?  193 ASN A ND2   1 
ATOM   1245 N  N     . GLY A 1 177 ? -14.517 32.238 -4.670  1.00 49.44  ?  194 GLY A N     1 
ATOM   1246 C  CA    . GLY A 1 177 ? -15.926 32.060 -4.967  1.00 51.38  ?  194 GLY A CA    1 
ATOM   1247 C  C     . GLY A 1 177 ? -16.433 30.666 -4.650  1.00 50.03  ?  194 GLY A C     1 
ATOM   1248 O  O     . GLY A 1 177 ? -17.385 30.188 -5.267  1.00 51.04  ?  194 GLY A O     1 
ATOM   1249 N  N     . ILE A 1 178 ? -15.797 30.013 -3.684  1.00 47.57  ?  195 ILE A N     1 
ATOM   1250 C  CA    . ILE A 1 178 ? -16.217 28.683 -3.262  1.00 46.17  ?  195 ILE A CA    1 
ATOM   1251 C  C     . ILE A 1 178 ? -17.413 28.776 -2.319  1.00 47.66  ?  195 ILE A C     1 
ATOM   1252 O  O     . ILE A 1 178 ? -17.271 29.148 -1.154  1.00 47.46  ?  195 ILE A O     1 
ATOM   1253 C  CB    . ILE A 1 178 ? -15.075 27.921 -2.563  1.00 43.16  ?  195 ILE A CB    1 
ATOM   1254 C  CG1   . ILE A 1 178 ? -13.863 27.808 -3.488  1.00 41.65  ?  195 ILE A CG1   1 
ATOM   1255 C  CG2   . ILE A 1 178 ? -15.544 26.541 -2.128  1.00 41.80  ?  195 ILE A CG2   1 
ATOM   1256 C  CD1   . ILE A 1 178 ? -12.641 27.213 -2.822  1.00 38.80  ?  195 ILE A CD1   1 
ATOM   1257 N  N     . ASP A 1 179 ? -18.591 28.437 -2.832  1.00 103.97 ?  196 ASP A N     1 
ATOM   1258 C  CA    . ASP A 1 179 ? -19.812 28.508 -2.042  1.00 105.13 ?  196 ASP A CA    1 
ATOM   1259 C  C     . ASP A 1 179 ? -19.966 27.265 -1.174  1.00 100.69 ?  196 ASP A C     1 
ATOM   1260 O  O     . ASP A 1 179 ? -20.246 26.176 -1.674  1.00 98.39  ?  196 ASP A O     1 
ATOM   1261 C  CB    . ASP A 1 179 ? -21.033 28.675 -2.950  1.00 107.92 ?  196 ASP A CB    1 
ATOM   1262 C  CG    . ASP A 1 179 ? -21.005 29.976 -3.729  1.00 113.44 ?  196 ASP A CG    1 
ATOM   1263 O  OD1   . ASP A 1 179 ? -20.208 30.868 -3.371  1.00 115.67 ?  196 ASP A OD1   1 
ATOM   1264 O  OD2   . ASP A 1 179 ? -21.781 30.106 -4.700  1.00 115.85 -1 196 ASP A OD2   1 
ATOM   1265 N  N     . VAL A 1 180 ? -19.782 27.437 0.131   1.00 57.76  ?  197 VAL A N     1 
ATOM   1266 C  CA    . VAL A 1 180 ? -19.907 26.336 1.077   1.00 53.99  ?  197 VAL A CA    1 
ATOM   1267 C  C     . VAL A 1 180 ? -21.225 26.423 1.836   1.00 54.89  ?  197 VAL A C     1 
ATOM   1268 O  O     . VAL A 1 180 ? -21.829 27.493 1.923   1.00 57.80  ?  197 VAL A O     1 
ATOM   1269 C  CB    . VAL A 1 180 ? -18.740 26.321 2.084   1.00 51.90  ?  197 VAL A CB    1 
ATOM   1270 C  CG1   . VAL A 1 180 ? -17.410 26.244 1.351   1.00 51.14  ?  197 VAL A CG1   1 
ATOM   1271 C  CG2   . VAL A 1 180 ? -18.788 27.554 2.974   1.00 53.66  ?  197 VAL A CG2   1 
ATOM   1272 N  N     . TYR A 1 181 ? -21.677 25.296 2.377   1.00 43.99  ?  198 TYR A N     1 
ATOM   1273 C  CA    . TYR A 1 181 ? -22.887 25.289 3.188   1.00 45.51  ?  198 TYR A CA    1 
ATOM   1274 C  C     . TYR A 1 181 ? -22.615 25.936 4.541   1.00 45.40  ?  198 TYR A C     1 
ATOM   1275 O  O     . TYR A 1 181 ? -21.589 25.666 5.165   1.00 43.22  ?  198 TYR A O     1 
ATOM   1276 C  CB    . TYR A 1 181 ? -23.416 23.865 3.383   1.00 44.38  ?  198 TYR A CB    1 
ATOM   1277 C  CG    . TYR A 1 181 ? -24.662 23.808 4.241   1.00 45.90  ?  198 TYR A CG    1 
ATOM   1278 C  CD1   . TYR A 1 181 ? -25.921 23.972 3.678   1.00 48.31  ?  198 TYR A CD1   1 
ATOM   1279 C  CD2   . TYR A 1 181 ? -24.579 23.613 5.615   1.00 44.98  ?  198 TYR A CD2   1 
ATOM   1280 C  CE1   . TYR A 1 181 ? -27.061 23.935 4.456   1.00 49.76  ?  198 TYR A CE1   1 
ATOM   1281 C  CE2   . TYR A 1 181 ? -25.714 23.575 6.400   1.00 46.41  ?  198 TYR A CE2   1 
ATOM   1282 C  CZ    . TYR A 1 181 ? -26.952 23.737 5.815   1.00 48.80  ?  198 TYR A CZ    1 
ATOM   1283 O  OH    . TYR A 1 181 ? -28.087 23.697 6.590   1.00 50.26  ?  198 TYR A OH    1 
ATOM   1284 N  N     . PRO A 1 182 ? -23.538 26.795 5.002   1.00 47.78  ?  199 PRO A N     1 
ATOM   1285 C  CA    . PRO A 1 182 ? -24.748 27.186 4.275   1.00 50.48  ?  199 PRO A CA    1 
ATOM   1286 C  C     . PRO A 1 182 ? -24.511 28.367 3.343   1.00 52.07  ?  199 PRO A C     1 
ATOM   1287 O  O     . PRO A 1 182 ? -24.056 29.422 3.784   1.00 52.61  ?  199 PRO A O     1 
ATOM   1288 C  CB    . PRO A 1 182 ? -25.725 27.552 5.396   1.00 52.05  ?  199 PRO A CB    1 
ATOM   1289 C  CG    . PRO A 1 182 ? -24.866 27.855 6.603   1.00 50.62  ?  199 PRO A CG    1 
ATOM   1290 C  CD    . PRO A 1 182 ? -23.442 27.475 6.302   1.00 48.01  ?  199 PRO A CD    1 
ATOM   1291 N  N     . GLN A 1 183 ? -24.812 28.174 2.062   1.00 56.48  ?  200 GLN A N     1 
ATOM   1292 C  CA    . GLN A 1 183 ? -24.648 29.222 1.064   1.00 58.06  ?  200 GLN A CA    1 
ATOM   1293 C  C     . GLN A 1 183 ? -25.501 30.435 1.426   1.00 60.90  ?  200 GLN A C     1 
ATOM   1294 O  O     . GLN A 1 183 ? -26.678 30.299 1.762   1.00 62.43  ?  200 GLN A O     1 
ATOM   1295 C  CB    . GLN A 1 183 ? -25.017 28.706 -0.330  1.00 58.51  ?  200 GLN A CB    1 
ATOM   1296 C  CG    . GLN A 1 183 ? -24.220 27.491 -0.799  1.00 55.81  ?  200 GLN A CG    1 
ATOM   1297 C  CD    . GLN A 1 183 ? -24.741 26.182 -0.233  1.00 54.62  ?  200 GLN A CD    1 
ATOM   1298 O  OE1   . GLN A 1 183 ? -25.630 26.168 0.619   1.00 55.65  ?  200 GLN A OE1   1 
ATOM   1299 N  NE2   . GLN A 1 183 ? -24.188 25.071 -0.707  1.00 52.47  ?  200 GLN A NE2   1 
ATOM   1300 N  N     . LYS A 1 184 ? -24.896 31.617 1.360   1.00 57.94  ?  201 LYS A N     1 
ATOM   1301 C  CA    . LYS A 1 184 ? -25.566 32.858 1.739   1.00 60.56  ?  201 LYS A CA    1 
ATOM   1302 C  C     . LYS A 1 184 ? -26.791 33.158 0.880   1.00 63.27  ?  201 LYS A C     1 
ATOM   1303 O  O     . LYS A 1 184 ? -27.737 33.797 1.339   1.00 65.47  ?  201 LYS A O     1 
ATOM   1304 C  CB    . LYS A 1 184 ? -24.585 34.031 1.663   1.00 60.69  ?  201 LYS A CB    1 
ATOM   1305 N  N     . GLU A 1 185 ? -26.771 32.698 -0.367  1.00 110.16 ?  202 GLU A N     1 
ATOM   1306 C  CA    . GLU A 1 185 ? -27.865 32.957 -1.298  1.00 112.52 ?  202 GLU A CA    1 
ATOM   1307 C  C     . GLU A 1 185 ? -29.135 32.173 -0.956  1.00 110.27 ?  202 GLU A C     1 
ATOM   1308 O  O     . GLU A 1 185 ? -30.163 32.333 -1.615  1.00 112.21 ?  202 GLU A O     1 
ATOM   1309 C  CB    . GLU A 1 185 ? -27.430 32.644 -2.734  1.00 113.62 ?  202 GLU A CB    1 
ATOM   1310 C  CG    . GLU A 1 185 ? -26.908 31.232 -2.956  1.00 109.71 ?  202 GLU A CG    1 
ATOM   1311 C  CD    . GLU A 1 185 ? -25.419 31.107 -2.696  1.00 109.04 ?  202 GLU A CD    1 
ATOM   1312 O  OE1   . GLU A 1 185 ? -24.849 31.996 -2.029  1.00 110.77 ?  202 GLU A OE1   1 
ATOM   1313 O  OE2   . GLU A 1 185 ? -24.815 30.118 -3.163  1.00 106.56 -1 202 GLU A OE2   1 
ATOM   1314 N  N     . PHE A 1 186 ? -29.066 31.330 0.071   1.00 64.85  ?  203 PHE A N     1 
ATOM   1315 C  CA    . PHE A 1 186 ? -30.204 30.497 0.449   1.00 65.37  ?  203 PHE A CA    1 
ATOM   1316 C  C     . PHE A 1 186 ? -30.772 30.841 1.827   1.00 66.20  ?  203 PHE A C     1 
ATOM   1317 O  O     . PHE A 1 186 ? -31.579 30.089 2.372   1.00 66.26  ?  203 PHE A O     1 
ATOM   1318 C  CB    . PHE A 1 186 ? -29.807 29.018 0.417   1.00 62.72  ?  203 PHE A CB    1 
ATOM   1319 C  CG    . PHE A 1 186 ? -29.376 28.533 -0.939  1.00 61.91  ?  203 PHE A CG    1 
ATOM   1320 C  CD1   . PHE A 1 186 ? -29.966 29.032 -2.089  1.00 64.02  ?  203 PHE A CD1   1 
ATOM   1321 C  CD2   . PHE A 1 186 ? -28.382 27.576 -1.064  1.00 59.07  ?  203 PHE A CD2   1 
ATOM   1322 C  CE1   . PHE A 1 186 ? -29.574 28.586 -3.337  1.00 63.29  ?  203 PHE A CE1   1 
ATOM   1323 C  CE2   . PHE A 1 186 ? -27.984 27.127 -2.310  1.00 58.34  ?  203 PHE A CE2   1 
ATOM   1324 C  CZ    . PHE A 1 186 ? -28.581 27.633 -3.447  1.00 60.44  ?  203 PHE A CZ    1 
ATOM   1325 N  N     . ASP A 1 187 ? -30.354 31.972 2.387   1.00 80.89  ?  204 ASP A N     1 
ATOM   1326 C  CA    . ASP A 1 187 ? -30.878 32.420 3.676   1.00 81.71  ?  204 ASP A CA    1 
ATOM   1327 C  C     . ASP A 1 187 ? -32.245 33.085 3.519   1.00 84.89  ?  204 ASP A C     1 
ATOM   1328 O  O     . ASP A 1 187 ? -32.399 34.030 2.746   1.00 86.71  ?  204 ASP A O     1 
ATOM   1329 C  CB    . ASP A 1 187 ? -29.895 33.379 4.351   1.00 81.38  ?  204 ASP A CB    1 
ATOM   1330 C  CG    . ASP A 1 187 ? -28.572 32.715 4.686   1.00 78.24  ?  204 ASP A CG    1 
ATOM   1331 O  OD1   . ASP A 1 187 ? -28.553 31.477 4.850   1.00 76.34  ?  204 ASP A OD1   1 
ATOM   1332 O  OD2   . ASP A 1 187 ? -27.553 33.430 4.786   1.00 77.62  -1 204 ASP A OD2   1 
ATOM   1333 N  N     . GLU A 1 188 ? -33.232 32.587 4.259   1.00 71.48  ?  205 GLU A N     1 
ATOM   1334 C  CA    . GLU A 1 188 ? -34.604 33.073 4.137   1.00 74.48  ?  205 GLU A CA    1 
ATOM   1335 C  C     . GLU A 1 188 ? -34.840 34.389 4.877   1.00 76.41  ?  205 GLU A C     1 
ATOM   1336 O  O     . GLU A 1 188 ? -34.929 35.449 4.258   1.00 78.31  ?  205 GLU A O     1 
ATOM   1337 C  CB    . GLU A 1 188 ? -35.586 32.015 4.646   1.00 74.44  ?  205 GLU A CB    1 
ATOM   1338 N  N     . ASP A 1 189 ? -34.941 34.319 6.202   1.00 80.38  ?  206 ASP A N     1 
ATOM   1339 C  CA    . ASP A 1 189 ? -35.198 35.511 7.007   1.00 82.16  ?  206 ASP A CA    1 
ATOM   1340 C  C     . ASP A 1 189 ? -34.109 35.746 8.051   1.00 80.24  ?  206 ASP A C     1 
ATOM   1341 O  O     . ASP A 1 189 ? -33.049 35.122 8.006   1.00 77.62  ?  206 ASP A O     1 
ATOM   1342 C  CB    . ASP A 1 189 ? -36.570 35.414 7.683   1.00 84.05  ?  206 ASP A CB    1 
ATOM   1343 C  CG    . ASP A 1 189 ? -36.765 34.110 8.432   1.00 82.26  ?  206 ASP A CG    1 
ATOM   1344 O  OD1   . ASP A 1 189 ? -36.177 33.953 9.523   1.00 80.61  -1 206 ASP A OD1   1 
ATOM   1345 O  OD2   . ASP A 1 189 ? -37.512 33.244 7.931   1.00 82.52  -1 206 ASP A OD2   1 
ATOM   1346 N  N     . SER A 1 190 ? -34.382 36.646 8.991   1.00 67.42  ?  207 SER A N     1 
ATOM   1347 C  CA    . SER A 1 190 ? -33.398 37.036 9.998   1.00 65.59  ?  207 SER A CA    1 
ATOM   1348 C  C     . SER A 1 190 ? -33.094 35.922 10.996  1.00 64.45  ?  207 SER A C     1 
ATOM   1349 O  O     . SER A 1 190 ? -31.963 35.793 11.462  1.00 62.43  ?  207 SER A O     1 
ATOM   1350 C  CB    . SER A 1 190 ? -33.878 38.281 10.748  1.00 67.39  ?  207 SER A CB    1 
ATOM   1351 O  OG    . SER A 1 190 ? -35.029 37.997 11.524  1.00 69.52  ?  207 SER A OG    1 
ATOM   1352 N  N     . GLU A 1 191 ? -34.101 35.118 11.320  1.00 66.21  ?  208 GLU A N     1 
ATOM   1353 C  CA    . GLU A 1 191 ? -33.918 34.028 12.270  1.00 65.87  ?  208 GLU A CA    1 
ATOM   1354 C  C     . GLU A 1 191 ? -33.166 32.884 11.604  1.00 63.65  ?  208 GLU A C     1 
ATOM   1355 O  O     . GLU A 1 191 ? -32.408 32.161 12.250  1.00 62.27  ?  208 GLU A O     1 
ATOM   1356 C  CB    . GLU A 1 191 ? -35.265 33.543 12.807  1.00 69.13  ?  208 GLU A CB    1 
ATOM   1357 N  N     . ASP A 1 192 ? -33.384 32.730 10.302  1.00 91.89  ?  209 ASP A N     1 
ATOM   1358 C  CA    . ASP A 1 192 ? -32.669 31.737 9.512   1.00 90.04  ?  209 ASP A CA    1 
ATOM   1359 C  C     . ASP A 1 192 ? -31.218 32.148 9.296   1.00 87.08  ?  209 ASP A C     1 
ATOM   1360 O  O     . ASP A 1 192 ? -30.323 31.305 9.247   1.00 85.19  ?  209 ASP A O     1 
ATOM   1361 C  CB    . ASP A 1 192 ? -33.362 31.530 8.164   1.00 91.53  ?  209 ASP A CB    1 
ATOM   1362 C  CG    . ASP A 1 192 ? -32.661 30.502 7.299   1.00 89.94  ?  209 ASP A CG    1 
ATOM   1363 O  OD1   . ASP A 1 192 ? -32.155 29.502 7.851   1.00 88.57  ?  209 ASP A OD1   1 
ATOM   1364 O  OD2   . ASP A 1 192 ? -32.612 30.697 6.066   1.00 90.31  -1 209 ASP A OD2   1 
ATOM   1365 N  N     . ARG A 1 193 ? -30.992 33.452 9.167   1.00 69.70  ?  210 ARG A N     1 
ATOM   1366 C  CA    . ARG A 1 193 ? -29.655 33.977 8.922   1.00 68.75  ?  210 ARG A CA    1 
ATOM   1367 C  C     . ARG A 1 193 ? -28.759 33.883 10.153  1.00 68.59  ?  210 ARG A C     1 
ATOM   1368 O  O     . ARG A 1 193 ? -27.568 33.597 10.039  1.00 68.42  ?  210 ARG A O     1 
ATOM   1369 C  CB    . ARG A 1 193 ? -29.731 35.430 8.455   1.00 70.88  ?  210 ARG A CB    1 
ATOM   1370 C  CG    . ARG A 1 193 ? -28.427 35.951 7.881   1.00 71.97  ?  210 ARG A CG    1 
ATOM   1371 C  CD    . ARG A 1 193 ? -28.477 37.451 7.686   1.00 74.41  ?  210 ARG A CD    1 
ATOM   1372 N  NE    . ARG A 1 193 ? -28.728 38.150 8.942   1.00 75.65  ?  210 ARG A NE    1 
ATOM   1373 C  CZ    . ARG A 1 193 ? -27.802 38.373 9.868   1.00 76.63  ?  210 ARG A CZ    1 
ATOM   1374 N  NH1   . ARG A 1 193 ? -26.559 37.949 9.681   1.00 76.44  1  210 ARG A NH1   1 
ATOM   1375 N  NH2   . ARG A 1 193 ? -28.117 39.019 10.983  1.00 77.96  ?  210 ARG A NH2   1 
ATOM   1376 N  N     . LEU A 1 194 ? -29.336 34.125 11.326  1.00 57.00  ?  211 LEU A N     1 
ATOM   1377 C  CA    . LEU A 1 194 ? -28.577 34.115 12.573  1.00 56.69  ?  211 LEU A CA    1 
ATOM   1378 C  C     . LEU A 1 194 ? -27.990 32.737 12.848  1.00 55.28  ?  211 LEU A C     1 
ATOM   1379 O  O     . LEU A 1 194 ? -26.818 32.611 13.205  1.00 54.01  ?  211 LEU A O     1 
ATOM   1380 C  CB    . LEU A 1 194 ? -29.454 34.554 13.746  1.00 59.16  ?  211 LEU A CB    1 
ATOM   1381 C  CG    . LEU A 1 194 ? -29.686 36.057 13.910  1.00 60.54  ?  211 LEU A CG    1 
ATOM   1382 C  CD1   . LEU A 1 194 ? -30.618 36.324 15.082  1.00 63.04  ?  211 LEU A CD1   1 
ATOM   1383 C  CD2   . LEU A 1 194 ? -28.365 36.790 14.089  1.00 59.65  ?  211 LEU A CD2   1 
ATOM   1384 N  N     . VAL A 1 195 ? -28.813 31.708 12.680  1.00 78.25  ?  212 VAL A N     1 
ATOM   1385 C  CA    . VAL A 1 195 ? -28.377 30.337 12.903  1.00 76.84  ?  212 VAL A CA    1 
ATOM   1386 C  C     . VAL A 1 195 ? -27.355 29.930 11.843  1.00 74.60  ?  212 VAL A C     1 
ATOM   1387 O  O     . VAL A 1 195 ? -26.418 29.180 12.123  1.00 73.51  ?  212 VAL A O     1 
ATOM   1388 C  CB    . VAL A 1 195 ? -29.588 29.366 12.893  1.00 78.61  ?  212 VAL A CB    1 
ATOM   1389 C  CG1   . VAL A 1 195 ? -29.199 27.983 12.381  1.00 77.29  ?  212 VAL A CG1   1 
ATOM   1390 C  CG2   . VAL A 1 195 ? -30.212 29.281 14.279  1.00 81.36  ?  212 VAL A CG2   1 
ATOM   1391 N  N     . ASN A 1 196 ? -27.512 30.466 10.637  1.00 54.18  ?  213 ASN A N     1 
ATOM   1392 C  CA    . ASN A 1 196 ? -26.574 30.188 9.557   1.00 51.91  ?  213 ASN A CA    1 
ATOM   1393 C  C     . ASN A 1 196 ? -25.242 30.907 9.752   1.00 50.66  ?  213 ASN A C     1 
ATOM   1394 O  O     . ASN A 1 196 ? -24.187 30.372 9.411   1.00 48.74  ?  213 ASN A O     1 
ATOM   1395 C  CB    . ASN A 1 196 ? -27.184 30.572 8.209   1.00 52.55  ?  213 ASN A CB    1 
ATOM   1396 C  CG    . ASN A 1 196 ? -28.128 29.512 7.676   1.00 53.43  ?  213 ASN A CG    1 
ATOM   1397 O  OD1   . ASN A 1 196 ? -28.426 28.531 8.358   1.00 53.76  ?  213 ASN A OD1   1 
ATOM   1398 N  ND2   . ASN A 1 196 ? -28.602 29.702 6.450   1.00 54.30  ?  213 ASN A ND2   1 
ATOM   1399 N  N     . GLU A 1 197 ? -25.296 32.120 10.294  1.00 72.68  ?  214 GLU A N     1 
ATOM   1400 C  CA    . GLU A 1 197 ? -24.084 32.873 10.601  1.00 75.18  ?  214 GLU A CA    1 
ATOM   1401 C  C     . GLU A 1 197 ? -23.243 32.154 11.647  1.00 75.01  ?  214 GLU A C     1 
ATOM   1402 O  O     . GLU A 1 197 ? -22.021 32.082 11.530  1.00 75.93  ?  214 GLU A O     1 
ATOM   1403 C  CB    . GLU A 1 197 ? -24.424 34.286 11.082  1.00 78.03  ?  214 GLU A CB    1 
ATOM   1404 C  CG    . GLU A 1 197 ? -24.857 35.236 9.978   1.00 79.17  ?  214 GLU A CG    1 
ATOM   1405 C  CD    . GLU A 1 197 ? -23.791 35.414 8.913   1.00 79.96  ?  214 GLU A CD    1 
ATOM   1406 O  OE1   . GLU A 1 197 ? -22.592 35.414 9.264   1.00 80.77  ?  214 GLU A OE1   1 
ATOM   1407 O  OE2   . GLU A 1 197 ? -24.151 35.553 7.725   1.00 79.64  -1 214 GLU A OE2   1 
ATOM   1408 N  N     . LYS A 1 198 ? -23.909 31.616 12.665  1.00 69.63  ?  215 LYS A N     1 
ATOM   1409 C  CA    . LYS A 1 198 ? -23.231 30.890 13.733  1.00 69.63  ?  215 LYS A CA    1 
ATOM   1410 C  C     . LYS A 1 198 ? -22.523 29.652 13.186  1.00 67.13  ?  215 LYS A C     1 
ATOM   1411 O  O     . LYS A 1 198 ? -21.534 29.191 13.754  1.00 67.62  ?  215 LYS A O     1 
ATOM   1412 C  CB    . LYS A 1 198 ? -24.226 30.505 14.831  1.00 69.32  ?  215 LYS A CB    1 
ATOM   1413 C  CG    . LYS A 1 198 ? -23.579 30.086 16.142  1.00 70.12  ?  215 LYS A CG    1 
ATOM   1414 C  CD    . LYS A 1 198 ? -24.520 30.300 17.318  1.00 70.96  ?  215 LYS A CD    1 
ATOM   1415 C  CE    . LYS A 1 198 ? -25.818 29.527 17.146  1.00 70.62  ?  215 LYS A CE    1 
ATOM   1416 N  NZ    . LYS A 1 198 ? -26.756 29.765 18.279  1.00 73.83  1  215 LYS A NZ    1 
ATOM   1417 N  N     . PHE A 1 199 ? -23.037 29.121 12.081  1.00 63.10  ?  216 PHE A N     1 
ATOM   1418 C  CA    . PHE A 1 199 ? -22.416 27.985 11.409  1.00 60.19  ?  216 PHE A CA    1 
ATOM   1419 C  C     . PHE A 1 199 ? -21.209 28.430 10.587  1.00 60.88  ?  216 PHE A C     1 
ATOM   1420 O  O     . PHE A 1 199 ? -20.146 27.814 10.649  1.00 60.26  ?  216 PHE A O     1 
ATOM   1421 C  CB    . PHE A 1 199 ? -23.432 27.272 10.510  1.00 57.22  ?  216 PHE A CB    1 
ATOM   1422 C  CG    . PHE A 1 199 ? -22.990 25.908 10.048  1.00 54.78  ?  216 PHE A CG    1 
ATOM   1423 C  CD1   . PHE A 1 199 ? -22.080 25.768 9.012   1.00 52.98  ?  216 PHE A CD1   1 
ATOM   1424 C  CD2   . PHE A 1 199 ? -23.496 24.765 10.644  1.00 54.49  ?  216 PHE A CD2   1 
ATOM   1425 C  CE1   . PHE A 1 199 ? -21.676 24.517 8.586   1.00 50.29  ?  216 PHE A CE1   1 
ATOM   1426 C  CE2   . PHE A 1 199 ? -23.096 23.510 10.222  1.00 53.02  ?  216 PHE A CE2   1 
ATOM   1427 C  CZ    . PHE A 1 199 ? -22.185 23.386 9.192   1.00 50.53  ?  216 PHE A CZ    1 
ATOM   1428 N  N     . ARG A 1 200 ? -21.383 29.500 9.816   1.00 43.52  ?  217 ARG A N     1 
ATOM   1429 C  CA    . ARG A 1 200 ? -20.334 29.991 8.925   1.00 42.55  ?  217 ARG A CA    1 
ATOM   1430 C  C     . ARG A 1 200 ? -19.126 30.517 9.695   1.00 43.07  ?  217 ARG A C     1 
ATOM   1431 O  O     . ARG A 1 200 ? -17.999 30.476 9.202   1.00 42.19  ?  217 ARG A O     1 
ATOM   1432 C  CB    . ARG A 1 200 ? -20.887 31.079 8.000   1.00 43.66  ?  217 ARG A CB    1 
ATOM   1433 C  CG    . ARG A 1 200 ? -21.791 30.540 6.903   1.00 43.36  ?  217 ARG A CG    1 
ATOM   1434 C  CD    . ARG A 1 200 ? -22.175 31.610 5.895   1.00 44.85  ?  217 ARG A CD    1 
ATOM   1435 N  NE    . ARG A 1 200 ? -23.193 32.519 6.414   1.00 46.98  ?  217 ARG A NE    1 
ATOM   1436 C  CZ    . ARG A 1 200 ? -24.497 32.380 6.195   1.00 48.22  ?  217 ARG A CZ    1 
ATOM   1437 N  NH1   . ARG A 1 200 ? -24.944 31.366 5.466   1.00 47.73  1  217 ARG A NH1   1 
ATOM   1438 N  NH2   . ARG A 1 200 ? -25.355 33.253 6.705   1.00 50.22  ?  217 ARG A NH2   1 
ATOM   1439 N  N     . GLU A 1 201 ? -19.368 31.014 10.904  1.00 68.06  ?  218 GLU A N     1 
ATOM   1440 C  CA    . GLU A 1 201 ? -18.296 31.521 11.754  1.00 70.47  ?  218 GLU A CA    1 
ATOM   1441 C  C     . GLU A 1 201 ? -17.401 30.385 12.245  1.00 69.11  ?  218 GLU A C     1 
ATOM   1442 O  O     . GLU A 1 201 ? -16.271 30.616 12.675  1.00 69.51  ?  218 GLU A O     1 
ATOM   1443 C  CB    . GLU A 1 201 ? -18.867 32.305 12.937  1.00 72.81  ?  218 GLU A CB    1 
ATOM   1444 C  CG    . GLU A 1 201 ? -19.486 33.638 12.544  1.00 74.42  ?  218 GLU A CG    1 
ATOM   1445 C  CD    . GLU A 1 201 ? -20.276 34.275 13.670  1.00 76.04  ?  218 GLU A CD    1 
ATOM   1446 O  OE1   . GLU A 1 201 ? -20.303 33.703 14.780  1.00 75.92  ?  218 GLU A OE1   1 
ATOM   1447 O  OE2   . GLU A 1 201 ? -20.870 35.351 13.444  1.00 77.25  -1 218 GLU A OE2   1 
ATOM   1448 N  N     . MET A 1 202 ? -17.914 29.161 12.179  1.00 64.39  ?  219 MET A N     1 
ATOM   1449 C  CA    . MET A 1 202 ? -17.169 27.990 12.627  1.00 63.22  ?  219 MET A CA    1 
ATOM   1450 C  C     . MET A 1 202 ? -16.307 27.417 11.508  1.00 60.14  ?  219 MET A C     1 
ATOM   1451 O  O     . MET A 1 202 ? -15.305 26.753 11.766  1.00 59.53  ?  219 MET A O     1 
ATOM   1452 C  CB    . MET A 1 202 ? -18.125 26.912 13.138  1.00 60.82  ?  219 MET A CB    1 
ATOM   1453 C  CG    . MET A 1 202 ? -18.991 27.331 14.309  1.00 62.62  ?  219 MET A CG    1 
ATOM   1454 S  SD    . MET A 1 202 ? -18.088 27.257 15.864  1.00 64.58  ?  219 MET A SD    1 
ATOM   1455 C  CE    . MET A 1 202 ? -17.787 25.495 15.971  1.00 62.60  ?  219 MET A CE    1 
ATOM   1456 N  N     . ILE A 1 203 ? -16.703 27.680 10.266  1.00 38.85  ?  220 ILE A N     1 
ATOM   1457 C  CA    . ILE A 1 203 ? -15.952 27.225 9.101   1.00 36.83  ?  220 ILE A CA    1 
ATOM   1458 C  C     . ILE A 1 203 ? -14.609 27.944 8.998   1.00 37.43  ?  220 ILE A C     1 
ATOM   1459 O  O     . ILE A 1 203 ? -14.558 29.173 9.061   1.00 39.23  ?  220 ILE A O     1 
ATOM   1460 C  CB    . ILE A 1 203 ? -16.757 27.445 7.802   1.00 36.20  ?  220 ILE A CB    1 
ATOM   1461 C  CG1   . ILE A 1 203 ? -18.040 26.613 7.828   1.00 35.98  ?  220 ILE A CG1   1 
ATOM   1462 C  CG2   . ILE A 1 203 ? -15.924 27.100 6.577   1.00 34.58  ?  220 ILE A CG2   1 
ATOM   1463 C  CD1   . ILE A 1 203 ? -18.943 26.850 6.641   1.00 36.12  ?  220 ILE A CD1   1 
ATOM   1464 N  N     . PRO A 1 204 ? -13.512 27.182 8.842   1.00 39.73  ?  221 PRO A N     1 
ATOM   1465 C  CA    . PRO A 1 204 ? -13.472 25.716 8.779   1.00 37.73  ?  221 PRO A CA    1 
ATOM   1466 C  C     . PRO A 1 204 ? -13.469 25.065 10.160  1.00 38.72  ?  221 PRO A C     1 
ATOM   1467 O  O     . PRO A 1 204 ? -12.677 25.453 11.018  1.00 40.47  ?  221 PRO A O     1 
ATOM   1468 C  CB    . PRO A 1 204 ? -12.161 25.439 8.044   1.00 36.56  ?  221 PRO A CB    1 
ATOM   1469 C  CG    . PRO A 1 204 ? -11.290 26.584 8.419   1.00 38.79  ?  221 PRO A CG    1 
ATOM   1470 C  CD    . PRO A 1 204 ? -12.190 27.779 8.578   1.00 40.55  ?  221 PRO A CD    1 
ATOM   1471 N  N     . PHE A 1 205 ? -14.354 24.093 10.366  1.00 53.11  ?  222 PHE A N     1 
ATOM   1472 C  CA    . PHE A 1 205 ? -14.477 23.418 11.655  1.00 55.45  ?  222 PHE A CA    1 
ATOM   1473 C  C     . PHE A 1 205 ? -13.171 22.751 12.076  1.00 55.45  ?  222 PHE A C     1 
ATOM   1474 O  O     . PHE A 1 205 ? -12.552 22.026 11.297  1.00 50.95  ?  222 PHE A O     1 
ATOM   1475 C  CB    . PHE A 1 205 ? -15.595 22.374 11.607  1.00 52.20  ?  222 PHE A CB    1 
ATOM   1476 C  CG    . PHE A 1 205 ? -16.979 22.959 11.633  1.00 53.00  ?  222 PHE A CG    1 
ATOM   1477 C  CD1   . PHE A 1 205 ? -17.559 23.453 10.476  1.00 50.78  ?  222 PHE A CD1   1 
ATOM   1478 C  CD2   . PHE A 1 205 ? -17.705 23.002 12.812  1.00 56.07  ?  222 PHE A CD2   1 
ATOM   1479 C  CE1   . PHE A 1 205 ? -18.834 23.988 10.497  1.00 51.96  ?  222 PHE A CE1   1 
ATOM   1480 C  CE2   . PHE A 1 205 ? -18.980 23.533 12.839  1.00 56.49  ?  222 PHE A CE2   1 
ATOM   1481 C  CZ    . PHE A 1 205 ? -19.545 24.027 11.680  1.00 54.36  ?  222 PHE A CZ    1 
ATOM   1482 N  N     . ALA A 1 206 ? -12.758 23.004 13.313  1.00 41.72  ?  223 ALA A N     1 
ATOM   1483 C  CA    . ALA A 1 206 ? -11.539 22.415 13.851  1.00 42.48  ?  223 ALA A CA    1 
ATOM   1484 C  C     . ALA A 1 206 ? -11.839 21.081 14.528  1.00 43.03  ?  223 ALA A C     1 
ATOM   1485 O  O     . ALA A 1 206 ? -12.241 21.046 15.691  1.00 45.90  ?  223 ALA A O     1 
ATOM   1486 C  CB    . ALA A 1 206 ? -10.877 23.373 14.828  1.00 45.72  ?  223 ALA A CB    1 
ATOM   1487 N  N     . VAL A 1 207 ? -11.641 19.987 13.799  1.00 40.01  ?  224 VAL A N     1 
ATOM   1488 C  CA    . VAL A 1 207 ? -11.966 18.660 14.313  1.00 40.61  ?  224 VAL A CA    1 
ATOM   1489 C  C     . VAL A 1 207 ? -10.727 17.886 14.747  1.00 41.23  ?  224 VAL A C     1 
ATOM   1490 O  O     . VAL A 1 207 ? -9.611  18.179 14.317  1.00 40.27  ?  224 VAL A O     1 
ATOM   1491 C  CB    . VAL A 1 207 ? -12.726 17.815 13.273  1.00 38.00  ?  224 VAL A CB    1 
ATOM   1492 C  CG1   . VAL A 1 207 ? -13.900 18.599 12.713  1.00 37.57  ?  224 VAL A CG1   1 
ATOM   1493 C  CG2   . VAL A 1 207 ? -11.791 17.376 12.162  1.00 34.95  ?  224 VAL A CG2   1 
ATOM   1494 N  N     . VAL A 1 208 ? -10.938 16.898 15.610  1.00 40.82  ?  225 VAL A N     1 
ATOM   1495 C  CA    . VAL A 1 208 ? -9.866  16.027 16.077  1.00 41.86  ?  225 VAL A CA    1 
ATOM   1496 C  C     . VAL A 1 208 ? -10.362 14.587 16.163  1.00 41.94  ?  225 VAL A C     1 
ATOM   1497 O  O     . VAL A 1 208 ? -11.367 14.308 16.817  1.00 44.25  ?  225 VAL A O     1 
ATOM   1498 C  CB    . VAL A 1 208 ? -9.326  16.460 17.459  1.00 46.29  ?  225 VAL A CB    1 
ATOM   1499 C  CG1   . VAL A 1 208 ? -8.380  15.405 18.016  1.00 48.03  ?  225 VAL A CG1   1 
ATOM   1500 C  CG2   . VAL A 1 208 ? -8.630  17.810 17.373  1.00 46.65  ?  225 VAL A CG2   1 
ATOM   1501 N  N     . GLY A 1 209 ? -9.665  13.677 15.488  1.00 46.76  ?  226 GLY A N     1 
ATOM   1502 C  CA    . GLY A 1 209 ? -10.012 12.268 15.541  1.00 46.78  ?  226 GLY A CA    1 
ATOM   1503 C  C     . GLY A 1 209 ? -9.719  11.687 16.911  1.00 51.12  ?  226 GLY A C     1 
ATOM   1504 O  O     . GLY A 1 209 ? -8.838  12.171 17.621  1.00 52.74  ?  226 GLY A O     1 
ATOM   1505 N  N     . SER A 1 210 ? -10.452 10.644 17.282  1.00 90.71  ?  227 SER A N     1 
ATOM   1506 C  CA    . SER A 1 210 ? -10.308 10.050 18.607  1.00 94.78  ?  227 SER A CA    1 
ATOM   1507 C  C     . SER A 1 210 ? -9.342  8.871  18.607  1.00 95.11  ?  227 SER A C     1 
ATOM   1508 O  O     . SER A 1 210 ? -9.593  7.849  17.968  1.00 93.20  ?  227 SER A O     1 
ATOM   1509 C  CB    . SER A 1 210 ? -11.670 9.604  19.142  1.00 97.09  ?  227 SER A CB    1 
ATOM   1510 O  OG    . SER A 1 210 ? -12.193 8.533  18.376  1.00 94.41  ?  227 SER A OG    1 
ATOM   1511 N  N     . ASP A 1 211 ? -8.236  9.020  19.330  1.00 168.93 ?  228 ASP A N     1 
ATOM   1512 C  CA    . ASP A 1 211 ? -7.284  7.931  19.501  1.00 170.66 ?  228 ASP A CA    1 
ATOM   1513 C  C     . ASP A 1 211 ? -7.664  7.090  20.714  1.00 171.60 ?  228 ASP A C     1 
ATOM   1514 O  O     . ASP A 1 211 ? -7.526  7.537  21.854  1.00 171.72 ?  228 ASP A O     1 
ATOM   1515 C  CB    . ASP A 1 211 ? -5.861  8.470  19.654  1.00 170.57 ?  228 ASP A CB    1 
ATOM   1516 N  N     . HIS A 1 212 ? -8.152  5.880  20.451  1.00 96.71  ?  229 HIS A N     1 
ATOM   1517 C  CA    . HIS A 1 212 ? -8.564  4.940  21.493  1.00 98.17  ?  229 HIS A CA    1 
ATOM   1518 C  C     . HIS A 1 212 ? -9.674  5.508  22.375  1.00 96.96  ?  229 HIS A C     1 
ATOM   1519 O  O     . HIS A 1 212 ? -10.455 6.355  21.941  1.00 95.49  ?  229 HIS A O     1 
ATOM   1520 C  CB    . HIS A 1 212 ? -7.366  4.534  22.356  1.00 99.11  ?  229 HIS A CB    1 
ATOM   1521 C  CG    . HIS A 1 212 ? -6.176  4.089  21.566  1.00 100.14 ?  229 HIS A CG    1 
ATOM   1522 N  ND1   . HIS A 1 212 ? -5.984  2.777  21.185  1.00 102.33 ?  229 HIS A ND1   1 
ATOM   1523 C  CD2   . HIS A 1 212 ? -5.118  4.779  21.082  1.00 99.33  ?  229 HIS A CD2   1 
ATOM   1524 C  CE1   . HIS A 1 212 ? -4.858  2.681  20.502  1.00 102.39 ?  229 HIS A CE1   1 
ATOM   1525 N  NE2   . HIS A 1 212 ? -4.312  3.881  20.425  1.00 100.73 ?  229 HIS A NE2   1 
ATOM   1526 N  N     . GLU A 1 213 ? -9.736  5.031  23.614  1.00 96.96  ?  230 GLU A N     1 
ATOM   1527 C  CA    . GLU A 1 213 ? -10.763 5.460  24.556  1.00 96.06  ?  230 GLU A CA    1 
ATOM   1528 C  C     . GLU A 1 213 ? -10.282 5.321  25.996  1.00 96.84  ?  230 GLU A C     1 
ATOM   1529 O  O     . GLU A 1 213 ? -10.348 6.271  26.777  1.00 95.38  ?  230 GLU A O     1 
ATOM   1530 C  CB    . GLU A 1 213 ? -12.046 4.653  24.349  1.00 97.44  ?  230 GLU A CB    1 
ATOM   1531 C  CG    . GLU A 1 213 ? -13.109 4.893  25.408  1.00 97.45  ?  230 GLU A CG    1 
ATOM   1532 C  CD    . GLU A 1 213 ? -14.355 4.059  25.181  1.00 99.68  ?  230 GLU A CD    1 
ATOM   1533 O  OE1   . GLU A 1 213 ? -14.536 3.553  24.053  1.00 100.69 ?  230 GLU A OE1   1 
ATOM   1534 O  OE2   . GLU A 1 213 ? -15.152 3.905  26.131  1.00 100.82 -1 230 GLU A OE2   1 
ATOM   1535 N  N     . ILE A 1 221 ? -13.943 8.285  27.736  1.00 75.00  ?  238 ILE A N     1 
ATOM   1536 C  CA    . ILE A 1 221 ? -14.055 9.449  26.867  1.00 73.12  ?  238 ILE A CA    1 
ATOM   1537 C  C     . ILE A 1 221 ? -13.224 9.276  25.600  1.00 73.23  ?  238 ILE A C     1 
ATOM   1538 O  O     . ILE A 1 221 ? -12.095 8.789  25.650  1.00 74.50  ?  238 ILE A O     1 
ATOM   1539 C  CB    . ILE A 1 221 ? -13.622 10.716 27.608  1.00 72.30  ?  238 ILE A CB    1 
ATOM   1540 N  N     . LEU A 1 222 ? -13.792 9.671  24.464  1.00 71.36  ?  239 LEU A N     1 
ATOM   1541 C  CA    . LEU A 1 222 ? -13.072 9.635  23.197  1.00 71.45  ?  239 LEU A CA    1 
ATOM   1542 C  C     . LEU A 1 222 ? -11.973 10.690 23.190  1.00 71.05  ?  239 LEU A C     1 
ATOM   1543 O  O     . LEU A 1 222 ? -12.229 11.863 22.920  1.00 70.39  ?  239 LEU A O     1 
ATOM   1544 C  CB    . LEU A 1 222 ? -14.029 9.853  22.024  1.00 70.96  ?  239 LEU A CB    1 
ATOM   1545 C  CG    . LEU A 1 222 ? -15.066 8.758  21.772  1.00 71.99  ?  239 LEU A CG    1 
ATOM   1546 C  CD1   . LEU A 1 222 ? -16.002 9.160  20.643  1.00 71.45  ?  239 LEU A CD1   1 
ATOM   1547 C  CD2   . LEU A 1 222 ? -14.381 7.437  21.460  1.00 74.18  ?  239 LEU A CD2   1 
ATOM   1548 N  N     . GLY A 1 223 ? -10.748 10.269 23.487  1.00 71.81  ?  240 GLY A N     1 
ATOM   1549 C  CA    . GLY A 1 223 ? -9.652  11.203 23.662  1.00 72.06  ?  240 GLY A CA    1 
ATOM   1550 C  C     . GLY A 1 223 ? -8.556  11.137 22.617  1.00 72.66  ?  240 GLY A C     1 
ATOM   1551 O  O     . GLY A 1 223 ? -8.589  10.311 21.705  1.00 73.14  ?  240 GLY A O     1 
ATOM   1552 N  N     . ARG A 1 224 ? -7.580  12.027 22.764  1.00 76.30  ?  241 ARG A N     1 
ATOM   1553 C  CA    . ARG A 1 224 ? -6.434  12.094 21.868  1.00 76.90  ?  241 ARG A CA    1 
ATOM   1554 C  C     . ARG A 1 224 ? -5.180  12.447 22.662  1.00 77.69  ?  241 ARG A C     1 
ATOM   1555 O  O     . ARG A 1 224 ? -5.074  13.546 23.208  1.00 77.98  ?  241 ARG A O     1 
ATOM   1556 C  CB    . ARG A 1 224 ? -6.670  13.125 20.762  1.00 77.00  ?  241 ARG A CB    1 
ATOM   1557 C  CG    . ARG A 1 224 ? -5.582  13.159 19.703  1.00 77.56  ?  241 ARG A CG    1 
ATOM   1558 C  CD    . ARG A 1 224 ? -5.700  11.976 18.759  1.00 77.64  ?  241 ARG A CD    1 
ATOM   1559 N  NE    . ARG A 1 224 ? -4.476  11.757 17.994  1.00 78.46  ?  241 ARG A NE    1 
ATOM   1560 C  CZ    . ARG A 1 224 ? -4.345  10.839 17.042  1.00 79.30  ?  241 ARG A CZ    1 
ATOM   1561 N  NH1   . ARG A 1 224 ? -3.192  10.708 16.400  1.00 80.20  1  241 ARG A NH1   1 
ATOM   1562 N  NH2   . ARG A 1 224 ? -5.368  10.056 16.729  1.00 79.42  ?  241 ARG A NH2   1 
ATOM   1563 N  N     . LYS A 1 225 ? -4.236  11.514 22.725  1.00 51.87  ?  242 LYS A N     1 
ATOM   1564 C  CA    . LYS A 1 225 ? -3.014  11.705 23.502  1.00 53.66  ?  242 LYS A CA    1 
ATOM   1565 C  C     . LYS A 1 225 ? -2.133  12.810 22.924  1.00 54.59  ?  242 LYS A C     1 
ATOM   1566 O  O     . LYS A 1 225 ? -2.377  13.303 21.823  1.00 53.97  ?  242 LYS A O     1 
ATOM   1567 C  CB    . LYS A 1 225 ? -2.223  10.397 23.580  1.00 55.39  ?  242 LYS A CB    1 
ATOM   1568 N  N     . THR A 1 230 ? -3.987  15.010 27.182  1.00 81.15  ?  247 THR A N     1 
ATOM   1569 C  CA    . THR A 1 230 ? -5.082  14.334 26.496  1.00 79.87  ?  247 THR A CA    1 
ATOM   1570 C  C     . THR A 1 230 ? -6.093  15.341 25.954  1.00 79.40  ?  247 THR A C     1 
ATOM   1571 O  O     . THR A 1 230 ? -6.234  16.442 26.487  1.00 80.35  ?  247 THR A O     1 
ATOM   1572 C  CB    . THR A 1 230 ? -5.796  13.334 27.426  1.00 79.66  ?  247 THR A CB    1 
ATOM   1573 O  OG1   . THR A 1 230 ? -6.937  12.784 26.756  1.00 78.14  ?  247 THR A OG1   1 
ATOM   1574 C  CG2   . THR A 1 230 ? -6.244  14.020 28.708  1.00 80.38  ?  247 THR A CG2   1 
ATOM   1575 N  N     . ILE A 1 231 ? -6.793  14.958 24.891  1.00 99.13  ?  248 ILE A N     1 
ATOM   1576 C  CA    . ILE A 1 231 ? -7.700  15.869 24.202  1.00 99.09  ?  248 ILE A CA    1 
ATOM   1577 C  C     . ILE A 1 231 ? -9.065  15.226 23.967  1.00 97.82  ?  248 ILE A C     1 
ATOM   1578 O  O     . ILE A 1 231 ? -9.210  14.354 23.111  1.00 97.29  ?  248 ILE A O     1 
ATOM   1579 C  CB    . ILE A 1 231 ? -7.093  16.321 22.860  1.00 20.00  ?  248 ILE A CB    1 
ATOM   1580 C  CG1   . ILE A 1 231 ? -5.841  17.169 23.100  1.00 20.00  ?  248 ILE A CG1   1 
ATOM   1581 C  CG2   . ILE A 1 231 ? -8.117  17.095 22.045  1.00 20.00  ?  248 ILE A CG2   1 
ATOM   1582 C  CD1   . ILE A 1 231 ? -5.036  17.434 21.849  1.00 20.00  ?  248 ILE A CD1   1 
ATOM   1583 N  N     . GLU A 1 232 ? -10.064 15.665 24.728  1.00 95.13  ?  249 GLU A N     1 
ATOM   1584 C  CA    . GLU A 1 232 ? -11.426 15.170 24.564  1.00 93.92  ?  249 GLU A CA    1 
ATOM   1585 C  C     . GLU A 1 232 ? -12.056 15.734 23.294  1.00 94.32  ?  249 GLU A C     1 
ATOM   1586 O  O     . GLU A 1 232 ? -12.331 16.930 23.205  1.00 96.11  ?  249 GLU A O     1 
ATOM   1587 C  CB    . GLU A 1 232 ? -12.280 15.527 25.782  1.00 93.73  ?  249 GLU A CB    1 
ATOM   1588 N  N     . VAL A 1 233 ? -12.281 14.863 22.314  1.00 62.82  ?  250 VAL A N     1 
ATOM   1589 C  CA    . VAL A 1 233 ? -12.817 15.275 21.021  1.00 63.20  ?  250 VAL A CA    1 
ATOM   1590 C  C     . VAL A 1 233 ? -14.262 15.763 21.137  1.00 63.17  ?  250 VAL A C     1 
ATOM   1591 O  O     . VAL A 1 233 ? -14.707 16.598 20.350  1.00 64.64  ?  250 VAL A O     1 
ATOM   1592 C  CB    . VAL A 1 233 ? -12.730 14.131 19.980  1.00 62.50  ?  250 VAL A CB    1 
ATOM   1593 C  CG1   . VAL A 1 233 ? -11.321 13.561 19.943  1.00 62.89  ?  250 VAL A CG1   1 
ATOM   1594 C  CG2   . VAL A 1 233 ? -13.735 13.031 20.282  1.00 61.41  ?  250 VAL A CG2   1 
ATOM   1595 N  N     . GLU A 1 234 ? -14.994 15.236 22.114  1.00 64.02  ?  251 GLU A N     1 
ATOM   1596 C  CA    . GLU A 1 234 ? -16.391 15.605 22.307  1.00 63.85  ?  251 GLU A CA    1 
ATOM   1597 C  C     . GLU A 1 234 ? -16.539 16.905 23.094  1.00 65.47  ?  251 GLU A C     1 
ATOM   1598 O  O     . GLU A 1 234 ? -17.653 17.376 23.324  1.00 65.75  ?  251 GLU A O     1 
ATOM   1599 C  CB    . GLU A 1 234 ? -17.145 14.478 23.016  1.00 62.13  ?  251 GLU A CB    1 
ATOM   1600 N  N     . ASN A 1 235 ? -15.416 17.485 23.505  1.00 72.44  ?  252 ASN A N     1 
ATOM   1601 C  CA    . ASN A 1 235 ? -15.440 18.746 24.236  1.00 75.30  ?  252 ASN A CA    1 
ATOM   1602 C  C     . ASN A 1 235 ? -15.487 19.929 23.272  1.00 78.67  ?  252 ASN A C     1 
ATOM   1603 O  O     . ASN A 1 235 ? -14.754 19.965 22.284  1.00 79.36  ?  252 ASN A O     1 
ATOM   1604 C  CB    . ASN A 1 235 ? -14.225 18.855 25.159  1.00 76.05  ?  252 ASN A CB    1 
ATOM   1605 C  CG    . ASN A 1 235 ? -14.418 19.878 26.265  1.00 78.74  ?  252 ASN A CG    1 
ATOM   1606 O  OD1   . ASN A 1 235 ? -15.089 20.893 26.081  1.00 81.85  ?  252 ASN A OD1   1 
ATOM   1607 N  ND2   . ASN A 1 235 ? -13.828 19.610 27.424  1.00 78.20  ?  252 ASN A ND2   1 
ATOM   1608 N  N     . THR A 1 236 ? -16.354 20.892 23.566  1.00 67.01  ?  253 THR A N     1 
ATOM   1609 C  CA    . THR A 1 236 ? -16.554 22.044 22.692  1.00 71.15  ?  253 THR A CA    1 
ATOM   1610 C  C     . THR A 1 236 ? -15.436 23.076 22.809  1.00 75.23  ?  253 THR A C     1 
ATOM   1611 O  O     . THR A 1 236 ? -15.273 23.925 21.932  1.00 78.56  ?  253 THR A O     1 
ATOM   1612 C  CB    . THR A 1 236 ? -17.895 22.740 22.987  1.00 72.57  ?  253 THR A CB    1 
ATOM   1613 O  OG1   . THR A 1 236 ? -17.872 23.290 24.311  1.00 74.25  ?  253 THR A OG1   1 
ATOM   1614 C  CG2   . THR A 1 236 ? -19.045 21.751 22.873  1.00 68.24  ?  253 THR A CG2   1 
ATOM   1615 N  N     . THR A 1 237 ? -14.669 23.002 23.892  1.00 77.82  ?  254 THR A N     1 
ATOM   1616 C  CA    . THR A 1 237 ? -13.597 23.962 24.131  1.00 80.22  ?  254 THR A CA    1 
ATOM   1617 C  C     . THR A 1 237 ? -12.264 23.465 23.580  1.00 78.05  ?  254 THR A C     1 
ATOM   1618 O  O     . THR A 1 237 ? -11.423 24.258 23.156  1.00 79.34  ?  254 THR A O     1 
ATOM   1619 C  CB    . THR A 1 237 ? -13.439 24.267 25.633  1.00 80.16  ?  254 THR A CB    1 
ATOM   1620 O  OG1   . THR A 1 237 ? -13.062 23.073 26.329  1.00 76.67  ?  254 THR A OG1   1 
ATOM   1621 C  CG2   . THR A 1 237 ? -14.744 24.795 26.209  1.00 82.07  ?  254 THR A CG2   1 
ATOM   1622 N  N     . HIS A 1 238 ? -12.079 22.150 23.589  1.00 84.04  ?  255 HIS A N     1 
ATOM   1623 C  CA    . HIS A 1 238 ? -10.851 21.547 23.085  1.00 82.11  ?  255 HIS A CA    1 
ATOM   1624 C  C     . HIS A 1 238 ? -10.823 21.575 21.560  1.00 82.27  ?  255 HIS A C     1 
ATOM   1625 O  O     . HIS A 1 238 ? -9.849  22.025 20.956  1.00 82.84  ?  255 HIS A O     1 
ATOM   1626 C  CB    . HIS A 1 238 ? -10.707 20.116 23.602  1.00 78.66  ?  255 HIS A CB    1 
ATOM   1627 C  CG    . HIS A 1 238 ? -10.321 20.035 25.046  1.00 78.46  ?  255 HIS A CG    1 
ATOM   1628 N  ND1   . HIS A 1 238 ? -10.050 18.840 25.680  1.00 76.09  ?  255 HIS A ND1   1 
ATOM   1629 C  CD2   . HIS A 1 238 ? -10.155 21.001 25.980  1.00 80.55  ?  255 HIS A CD2   1 
ATOM   1630 C  CE1   . HIS A 1 238 ? -9.737  19.075 26.941  1.00 76.66  ?  255 HIS A CE1   1 
ATOM   1631 N  NE2   . HIS A 1 238 ? -9.793  20.378 27.150  1.00 79.17  ?  255 HIS A NE2   1 
ATOM   1632 N  N     . CYS A 1 239 ? -11.897 21.092 20.945  1.00 60.73  ?  256 CYS A N     1 
ATOM   1633 C  CA    . CYS A 1 239 ? -12.050 21.175 19.498  1.00 61.13  ?  256 CYS A CA    1 
ATOM   1634 C  C     . CYS A 1 239 ? -13.510 21.451 19.149  1.00 62.39  ?  256 CYS A C     1 
ATOM   1635 O  O     . CYS A 1 239 ? -14.330 21.691 20.034  1.00 63.21  ?  256 CYS A O     1 
ATOM   1636 C  CB    . CYS A 1 239 ? -11.559 19.894 18.819  1.00 57.94  ?  256 CYS A CB    1 
ATOM   1637 S  SG    . CYS A 1 239 ? -12.684 18.492 18.939  1.00 54.52  ?  256 CYS A SG    1 
ATOM   1638 N  N     . GLU A 1 240 ? -13.833 21.416 17.861  1.00 47.05  ?  257 GLU A N     1 
ATOM   1639 C  CA    . GLU A 1 240 ? -15.172 21.778 17.404  1.00 48.59  ?  257 GLU A CA    1 
ATOM   1640 C  C     . GLU A 1 240 ? -15.941 20.626 16.760  1.00 44.94  ?  257 GLU A C     1 
ATOM   1641 O  O     . GLU A 1 240 ? -16.898 20.854 16.019  1.00 45.72  ?  257 GLU A O     1 
ATOM   1642 C  CB    . GLU A 1 240 ? -15.088 22.952 16.429  1.00 53.10  ?  257 GLU A CB    1 
ATOM   1643 C  CG    . GLU A 1 240 ? -14.439 24.190 17.025  1.00 56.91  ?  257 GLU A CG    1 
ATOM   1644 C  CD    . GLU A 1 240 ? -14.326 25.326 16.031  1.00 60.61  ?  257 GLU A CD    1 
ATOM   1645 O  OE1   . GLU A 1 240 ? -14.286 25.050 14.814  1.00 59.96  ?  257 GLU A OE1   1 
ATOM   1646 O  OE2   . GLU A 1 240 ? -14.278 26.496 16.466  1.00 63.76  -1 257 GLU A OE2   1 
ATOM   1647 N  N     . PHE A 1 241 ? -15.526 19.394 17.036  1.00 54.84  ?  258 PHE A N     1 
ATOM   1648 C  CA    . PHE A 1 241 ? -16.174 18.231 16.440  1.00 52.11  ?  258 PHE A CA    1 
ATOM   1649 C  C     . PHE A 1 241 ? -17.572 18.028 17.014  1.00 51.00  ?  258 PHE A C     1 
ATOM   1650 O  O     . PHE A 1 241 ? -18.490 17.621 16.301  1.00 50.36  ?  258 PHE A O     1 
ATOM   1651 C  CB    . PHE A 1 241 ? -15.335 16.970 16.654  1.00 49.65  ?  258 PHE A CB    1 
ATOM   1652 C  CG    . PHE A 1 241 ? -16.030 15.705 16.235  1.00 47.88  ?  258 PHE A CG    1 
ATOM   1653 C  CD1   . PHE A 1 241 ? -16.160 15.381 14.895  1.00 48.32  ?  258 PHE A CD1   1 
ATOM   1654 C  CD2   . PHE A 1 241 ? -16.558 14.842 17.182  1.00 46.41  ?  258 PHE A CD2   1 
ATOM   1655 C  CE1   . PHE A 1 241 ? -16.801 14.219 14.507  1.00 47.50  ?  258 PHE A CE1   1 
ATOM   1656 C  CE2   . PHE A 1 241 ? -17.199 13.679 16.801  1.00 45.78  ?  258 PHE A CE2   1 
ATOM   1657 C  CZ    . PHE A 1 241 ? -17.321 13.367 15.461  1.00 46.42  ?  258 PHE A CZ    1 
ATOM   1658 N  N     . ALA A 1 242 ? -17.723 18.306 18.306  1.00 59.42  ?  259 ALA A N     1 
ATOM   1659 C  CA    . ALA A 1 242 ? -19.013 18.182 18.975  1.00 58.38  ?  259 ALA A CA    1 
ATOM   1660 C  C     . ALA A 1 242 ? -20.043 19.110 18.341  1.00 60.38  ?  259 ALA A C     1 
ATOM   1661 O  O     . ALA A 1 242 ? -21.191 18.723 18.124  1.00 59.31  ?  259 ALA A O     1 
ATOM   1662 C  CB    . ALA A 1 242 ? -18.873 18.481 20.459  1.00 58.37  ?  259 ALA A CB    1 
ATOM   1663 N  N     . TYR A 1 243 ? -19.622 20.336 18.047  1.00 54.04  ?  260 TYR A N     1 
ATOM   1664 C  CA    . TYR A 1 243 ? -20.486 21.307 17.389  1.00 56.72  ?  260 TYR A CA    1 
ATOM   1665 C  C     . TYR A 1 243 ? -20.850 20.868 15.976  1.00 56.09  ?  260 TYR A C     1 
ATOM   1666 O  O     . TYR A 1 243 ? -22.015 20.903 15.591  1.00 55.74  ?  260 TYR A O     1 
ATOM   1667 C  CB    . TYR A 1 243 ? -19.812 22.680 17.341  1.00 61.58  ?  260 TYR A CB    1 
ATOM   1668 C  CG    . TYR A 1 243 ? -19.885 23.461 18.634  1.00 63.26  ?  260 TYR A CG    1 
ATOM   1669 C  CD1   . TYR A 1 243 ? -21.040 23.463 19.405  1.00 61.53  ?  260 TYR A CD1   1 
ATOM   1670 C  CD2   . TYR A 1 243 ? -18.797 24.199 19.081  1.00 66.69  ?  260 TYR A CD2   1 
ATOM   1671 C  CE1   . TYR A 1 243 ? -21.108 24.179 20.586  1.00 62.69  ?  260 TYR A CE1   1 
ATOM   1672 C  CE2   . TYR A 1 243 ? -18.855 24.917 20.259  1.00 68.02  ?  260 TYR A CE2   1 
ATOM   1673 C  CZ    . TYR A 1 243 ? -20.012 24.903 21.008  1.00 65.93  ?  260 TYR A CZ    1 
ATOM   1674 O  OH    . TYR A 1 243 ? -20.072 25.617 22.183  1.00 66.96  ?  260 TYR A OH    1 
ATOM   1675 N  N     . LEU A 1 244 ? -19.846 20.440 15.215  1.00 52.12  ?  261 LEU A N     1 
ATOM   1676 C  CA    . LEU A 1 244 ? -20.048 20.024 13.830  1.00 51.77  ?  261 LEU A CA    1 
ATOM   1677 C  C     . LEU A 1 244 ? -21.033 18.866 13.710  1.00 48.74  ?  261 LEU A C     1 
ATOM   1678 O  O     . LEU A 1 244 ? -21.900 18.866 12.836  1.00 49.19  ?  261 LEU A O     1 
ATOM   1679 C  CB    . LEU A 1 244 ? -18.714 19.627 13.194  1.00 51.58  ?  261 LEU A CB    1 
ATOM   1680 C  CG    . LEU A 1 244 ? -18.800 19.116 11.755  1.00 51.29  ?  261 LEU A CG    1 
ATOM   1681 C  CD1   . LEU A 1 244 ? -19.335 20.206 10.838  1.00 54.74  ?  261 LEU A CD1   1 
ATOM   1682 C  CD2   . LEU A 1 244 ? -17.451 18.607 11.269  1.00 50.69  ?  261 LEU A CD2   1 
ATOM   1683 N  N     . ARG A 1 245 ? -20.886 17.878 14.587  1.00 63.26  ?  262 ARG A N     1 
ATOM   1684 C  CA    . ARG A 1 245 ? -21.761 16.714 14.589  1.00 61.11  ?  262 ARG A CA    1 
ATOM   1685 C  C     . ARG A 1 245 ? -23.221 17.097 14.815  1.00 61.43  ?  262 ARG A C     1 
ATOM   1686 O  O     . ARG A 1 245 ? -24.091 16.760 14.015  1.00 61.57  ?  262 ARG A O     1 
ATOM   1687 C  CB    . ARG A 1 245 ? -21.319 15.723 15.665  1.00 59.12  ?  262 ARG A CB    1 
ATOM   1688 C  CG    . ARG A 1 245 ? -22.204 14.494 15.785  1.00 57.88  ?  262 ARG A CG    1 
ATOM   1689 C  CD    . ARG A 1 245 ? -21.915 13.764 17.081  1.00 56.72  ?  262 ARG A CD    1 
ATOM   1690 N  NE    . ARG A 1 245 ? -22.123 14.642 18.229  1.00 56.77  ?  262 ARG A NE    1 
ATOM   1691 C  CZ    . ARG A 1 245 ? -21.614 14.431 19.438  1.00 56.10  ?  262 ARG A CZ    1 
ATOM   1692 N  NH1   . ARG A 1 245 ? -20.854 13.369 19.663  1.00 55.55  1  262 ARG A NH1   1 
ATOM   1693 N  NH2   . ARG A 1 245 ? -21.860 15.287 20.420  1.00 56.37  ?  262 ARG A NH2   1 
ATOM   1694 N  N     . ASP A 1 246 ? -23.477 17.813 15.906  1.00 64.14  ?  263 ASP A N     1 
ATOM   1695 C  CA    . ASP A 1 246 ? -24.832 18.221 16.263  1.00 64.44  ?  263 ASP A CA    1 
ATOM   1696 C  C     . ASP A 1 246 ? -25.464 19.129 15.215  1.00 66.73  ?  263 ASP A C     1 
ATOM   1697 O  O     . ASP A 1 246 ? -26.649 19.002 14.911  1.00 66.79  ?  263 ASP A O     1 
ATOM   1698 C  CB    . ASP A 1 246 ? -24.835 18.917 17.625  1.00 64.85  ?  263 ASP A CB    1 
ATOM   1699 C  CG    . ASP A 1 246 ? -24.555 17.961 18.767  1.00 62.65  ?  263 ASP A CG    1 
ATOM   1700 O  OD1   . ASP A 1 246 ? -24.771 16.743 18.589  1.00 61.02  ?  263 ASP A OD1   1 
ATOM   1701 O  OD2   . ASP A 1 246 ? -24.121 18.425 19.843  1.00 62.88  -1 263 ASP A OD2   1 
ATOM   1702 N  N     . LEU A 1 247 ? -24.675 20.047 14.668  1.00 43.66  ?  264 LEU A N     1 
ATOM   1703 C  CA    . LEU A 1 247 ? -25.173 20.955 13.642  1.00 44.93  ?  264 LEU A CA    1 
ATOM   1704 C  C     . LEU A 1 247 ? -25.598 20.194 12.387  1.00 45.13  ?  264 LEU A C     1 
ATOM   1705 O  O     . LEU A 1 247 ? -26.656 20.462 11.824  1.00 46.46  ?  264 LEU A O     1 
ATOM   1706 C  CB    . LEU A 1 247 ? -24.119 22.011 13.298  1.00 45.01  ?  264 LEU A CB    1 
ATOM   1707 C  CG    . LEU A 1 247 ? -23.872 23.072 14.376  1.00 45.41  ?  264 LEU A CG    1 
ATOM   1708 C  CD1   . LEU A 1 247 ? -22.748 24.016 13.976  1.00 45.65  ?  264 LEU A CD1   1 
ATOM   1709 C  CD2   . LEU A 1 247 ? -25.147 23.847 14.675  1.00 47.00  ?  264 LEU A CD2   1 
ATOM   1710 N  N     . LEU A 1 248 ? -24.777 19.238 11.961  1.00 51.78  ?  265 LEU A N     1 
ATOM   1711 C  CA    . LEU A 1 248 ? -25.056 18.481 10.743  1.00 51.55  ?  265 LEU A CA    1 
ATOM   1712 C  C     . LEU A 1 248 ? -26.156 17.435 10.922  1.00 50.64  ?  265 LEU A C     1 
ATOM   1713 O  O     . LEU A 1 248 ? -26.928 17.179 9.999   1.00 51.43  ?  265 LEU A O     1 
ATOM   1714 C  CB    . LEU A 1 248 ? -23.784 17.794 10.239  1.00 50.83  ?  265 LEU A CB    1 
ATOM   1715 C  CG    . LEU A 1 248 ? -22.686 18.682 9.653   1.00 52.96  ?  265 LEU A CG    1 
ATOM   1716 C  CD1   . LEU A 1 248 ? -21.519 17.831 9.175   1.00 51.97  ?  265 LEU A CD1   1 
ATOM   1717 C  CD2   . LEU A 1 248 ? -23.228 19.543 8.523   1.00 55.88  ?  265 LEU A CD2   1 
ATOM   1718 N  N     . ILE A 1 249 ? -26.226 16.832 12.104  1.00 62.30  ?  266 ILE A N     1 
ATOM   1719 C  CA    . ILE A 1 249 ? -27.160 15.735 12.340  1.00 60.96  ?  266 ILE A CA    1 
ATOM   1720 C  C     . ILE A 1 249 ? -28.510 16.236 12.849  1.00 61.49  ?  266 ILE A C     1 
ATOM   1721 O  O     . ILE A 1 249 ? -29.560 15.733 12.448  1.00 61.64  ?  266 ILE A O     1 
ATOM   1722 C  CB    . ILE A 1 249 ? -26.582 14.714 13.346  1.00 59.17  ?  266 ILE A CB    1 
ATOM   1723 C  CG1   . ILE A 1 249 ? -25.281 14.112 12.809  1.00 59.00  ?  266 ILE A CG1   1 
ATOM   1724 C  CG2   . ILE A 1 249 ? -27.588 13.611 13.640  1.00 58.37  ?  266 ILE A CG2   1 
ATOM   1725 C  CD1   . ILE A 1 249 ? -25.410 13.504 11.430  1.00 59.73  ?  266 ILE A CD1   1 
ATOM   1726 N  N     . ARG A 1 250 ? -28.481 17.229 13.730  1.00 46.90  ?  267 ARG A N     1 
ATOM   1727 C  CA    . ARG A 1 250 ? -29.707 17.748 14.329  1.00 48.43  ?  267 ARG A CA    1 
ATOM   1728 C  C     . ARG A 1 250 ? -30.178 19.046 13.674  1.00 49.89  ?  267 ARG A C     1 
ATOM   1729 O  O     . ARG A 1 250 ? -31.224 19.080 13.025  1.00 51.51  ?  267 ARG A O     1 
ATOM   1730 C  CB    . ARG A 1 250 ? -29.512 17.967 15.831  1.00 47.95  ?  267 ARG A CB    1 
ATOM   1731 N  N     . THR A 1 251 ? -29.400 20.109 13.852  1.00 52.26  ?  268 THR A N     1 
ATOM   1732 C  CA    . THR A 1 251 ? -29.815 21.454 13.459  1.00 54.26  ?  268 THR A CA    1 
ATOM   1733 C  C     . THR A 1 251 ? -29.967 21.661 11.949  1.00 55.48  ?  268 THR A C     1 
ATOM   1734 O  O     . THR A 1 251 ? -31.014 22.112 11.486  1.00 57.08  ?  268 THR A O     1 
ATOM   1735 C  CB    . THR A 1 251 ? -28.821 22.506 13.992  1.00 54.66  ?  268 THR A CB    1 
ATOM   1736 O  OG1   . THR A 1 251 ? -28.668 22.348 15.408  1.00 53.59  ?  268 THR A OG1   1 
ATOM   1737 C  CG2   . THR A 1 251 ? -29.321 23.911 13.695  1.00 57.34  ?  268 THR A CG2   1 
ATOM   1738 N  N     . HIS A 1 252 ? -28.929 21.334 11.186  1.00 49.79  ?  269 HIS A N     1 
ATOM   1739 C  CA    . HIS A 1 252 ? -28.904 21.653 9.759   1.00 50.57  ?  269 HIS A CA    1 
ATOM   1740 C  C     . HIS A 1 252 ? -29.233 20.471 8.851   1.00 50.39  ?  269 HIS A C     1 
ATOM   1741 O  O     . HIS A 1 252 ? -29.124 20.581 7.630   1.00 50.86  ?  269 HIS A O     1 
ATOM   1742 C  CB    . HIS A 1 252 ? -27.533 22.213 9.367   1.00 49.65  ?  269 HIS A CB    1 
ATOM   1743 C  CG    . HIS A 1 252 ? -27.245 23.566 9.935   1.00 50.37  ?  269 HIS A CG    1 
ATOM   1744 N  ND1   . HIS A 1 252 ? -27.332 24.721 9.187   1.00 51.98  ?  269 HIS A ND1   1 
ATOM   1745 C  CD2   . HIS A 1 252 ? -26.865 23.951 11.177  1.00 49.87  ?  269 HIS A CD2   1 
ATOM   1746 C  CE1   . HIS A 1 252 ? -27.022 25.758 9.943   1.00 52.49  ?  269 HIS A CE1   1 
ATOM   1747 N  NE2   . HIS A 1 252 ? -26.734 25.319 11.155  1.00 51.19  ?  269 HIS A NE2   1 
ATOM   1748 N  N     . MET A 1 253 ? -29.634 19.349 9.441   1.00 49.86  ?  270 MET A N     1 
ATOM   1749 C  CA    . MET A 1 253 ? -29.827 18.111 8.687   1.00 49.63  ?  270 MET A CA    1 
ATOM   1750 C  C     . MET A 1 253 ? -30.846 18.238 7.556   1.00 51.52  ?  270 MET A C     1 
ATOM   1751 O  O     . MET A 1 253 ? -30.538 17.944 6.400   1.00 51.43  ?  270 MET A O     1 
ATOM   1752 C  CB    . MET A 1 253 ? -30.248 16.982 9.630   1.00 49.23  ?  270 MET A CB    1 
ATOM   1753 C  CG    . MET A 1 253 ? -30.192 15.591 9.011   1.00 48.80  ?  270 MET A CG    1 
ATOM   1754 S  SD    . MET A 1 253 ? -31.748 15.071 8.263   1.00 51.02  ?  270 MET A SD    1 
ATOM   1755 C  CE    . MET A 1 253 ? -32.876 15.310 9.635   1.00 52.29  ?  270 MET A CE    1 
ATOM   1756 N  N     . GLN A 1 254 ? -32.057 18.673 7.888   1.00 53.39  ?  271 GLN A N     1 
ATOM   1757 C  CA    . GLN A 1 254 ? -33.130 18.741 6.902   1.00 55.54  ?  271 GLN A CA    1 
ATOM   1758 C  C     . GLN A 1 254 ? -32.899 19.837 5.862   1.00 56.45  ?  271 GLN A C     1 
ATOM   1759 O  O     . GLN A 1 254 ? -33.289 19.691 4.704   1.00 57.56  ?  271 GLN A O     1 
ATOM   1760 C  CB    . GLN A 1 254 ? -34.478 18.953 7.591   1.00 57.64  ?  271 GLN A CB    1 
ATOM   1761 C  CG    . GLN A 1 254 ? -35.665 18.756 6.663   1.00 60.07  ?  271 GLN A CG    1 
ATOM   1762 C  CD    . GLN A 1 254 ? -35.647 17.398 5.987   1.00 59.48  ?  271 GLN A CD    1 
ATOM   1763 O  OE1   . GLN A 1 254 ? -35.558 16.364 6.649   1.00 58.45  ?  271 GLN A OE1   1 
ATOM   1764 N  NE2   . GLN A 1 254 ? -35.722 17.395 4.662   1.00 60.27  ?  271 GLN A NE2   1 
ATOM   1765 N  N     . ASN A 1 255 ? -32.263 20.929 6.274   1.00 56.57  ?  272 ASN A N     1 
ATOM   1766 C  CA    . ASN A 1 255 ? -31.977 22.023 5.352   1.00 57.58  ?  272 ASN A CA    1 
ATOM   1767 C  C     . ASN A 1 255 ? -30.959 21.614 4.293   1.00 56.26  ?  272 ASN A C     1 
ATOM   1768 O  O     . ASN A 1 255 ? -31.060 22.022 3.137   1.00 57.44  ?  272 ASN A O     1 
ATOM   1769 C  CB    . ASN A 1 255 ? -31.475 23.253 6.109   1.00 57.65  ?  272 ASN A CB    1 
ATOM   1770 C  CG    . ASN A 1 255 ? -31.342 24.472 5.215   1.00 59.26  ?  272 ASN A CG    1 
ATOM   1771 O  OD1   . ASN A 1 255 ? -32.066 24.614 4.229   1.00 61.09  ?  272 ASN A OD1   1 
ATOM   1772 N  ND2   . ASN A 1 255 ? -30.414 25.358 5.555   1.00 58.78  ?  272 ASN A ND2   1 
ATOM   1773 N  N     . ILE A 1 256 ? -29.984 20.803 4.693   1.00 53.56  ?  273 ILE A N     1 
ATOM   1774 C  CA    . ILE A 1 256 ? -28.992 20.276 3.763   1.00 52.35  ?  273 ILE A CA    1 
ATOM   1775 C  C     . ILE A 1 256 ? -29.648 19.400 2.700   1.00 53.08  ?  273 ILE A C     1 
ATOM   1776 O  O     . ILE A 1 256 ? -29.374 19.544 1.508   1.00 53.51  ?  273 ILE A O     1 
ATOM   1777 C  CB    . ILE A 1 256 ? -27.908 19.456 4.493   1.00 50.08  ?  273 ILE A CB    1 
ATOM   1778 C  CG1   . ILE A 1 256 ? -26.996 20.376 5.302   1.00 49.39  ?  273 ILE A CG1   1 
ATOM   1779 C  CG2   . ILE A 1 256 ? -27.079 18.655 3.502   1.00 49.15  ?  273 ILE A CG2   1 
ATOM   1780 C  CD1   . ILE A 1 256 ? -26.036 19.636 6.200   1.00 47.49  ?  273 ILE A CD1   1 
ATOM   1781 N  N     . LYS A 1 257 ? -30.519 18.497 3.141   1.00 53.36  ?  274 LYS A N     1 
ATOM   1782 C  CA    . LYS A 1 257 ? -31.214 17.594 2.231   1.00 54.25  ?  274 LYS A CA    1 
ATOM   1783 C  C     . LYS A 1 257 ? -32.102 18.357 1.254   1.00 56.61  ?  274 LYS A C     1 
ATOM   1784 O  O     . LYS A 1 257 ? -32.199 17.996 0.082   1.00 57.22  ?  274 LYS A O     1 
ATOM   1785 C  CB    . LYS A 1 257 ? -32.049 16.579 3.015   1.00 54.47  ?  274 LYS A CB    1 
ATOM   1786 C  CG    . LYS A 1 257 ? -31.228 15.635 3.879   1.00 52.39  ?  274 LYS A CG    1 
ATOM   1787 C  CD    . LYS A 1 257 ? -32.071 14.475 4.380   1.00 52.92  ?  274 LYS A CD    1 
ATOM   1788 C  CE    . LYS A 1 257 ? -32.743 13.749 3.225   1.00 54.27  ?  274 LYS A CE    1 
ATOM   1789 N  NZ    . LYS A 1 257 ? -33.422 12.499 3.664   1.00 54.82  1  274 LYS A NZ    1 
ATOM   1790 N  N     . ASP A 1 258 ? -32.750 19.410 1.744   1.00 59.66  ?  275 ASP A N     1 
ATOM   1791 C  CA    . ASP A 1 258 ? -33.631 20.219 0.911   1.00 62.32  ?  275 ASP A CA    1 
ATOM   1792 C  C     . ASP A 1 258 ? -32.853 20.934 -0.190  1.00 64.01  ?  275 ASP A C     1 
ATOM   1793 O  O     . ASP A 1 258 ? -33.333 21.065 -1.316  1.00 66.22  ?  275 ASP A O     1 
ATOM   1794 C  CB    . ASP A 1 258 ? -34.390 21.237 1.765   1.00 63.57  ?  275 ASP A CB    1 
ATOM   1795 C  CG    . ASP A 1 258 ? -35.472 20.596 2.613   1.00 64.28  ?  275 ASP A CG    1 
ATOM   1796 O  OD1   . ASP A 1 258 ? -35.810 19.421 2.358   1.00 64.08  ?  275 ASP A OD1   1 
ATOM   1797 O  OD2   . ASP A 1 258 ? -35.984 21.268 3.533   1.00 65.32  -1 275 ASP A OD2   1 
ATOM   1798 N  N     . ILE A 1 259 ? -31.650 21.396 0.141   1.00 59.11  ?  276 ILE A N     1 
ATOM   1799 C  CA    . ILE A 1 259 ? -30.797 22.066 -0.833  1.00 59.15  ?  276 ILE A CA    1 
ATOM   1800 C  C     . ILE A 1 259 ? -30.160 21.048 -1.777  1.00 57.90  ?  276 ILE A C     1 
ATOM   1801 O  O     . ILE A 1 259 ? -29.956 21.323 -2.958  1.00 58.71  ?  276 ILE A O     1 
ATOM   1802 C  CB    . ILE A 1 259 ? -29.699 22.903 -0.138  1.00 58.03  ?  276 ILE A CB    1 
ATOM   1803 C  CG1   . ILE A 1 259 ? -30.334 23.987 0.735   1.00 59.52  ?  276 ILE A CG1   1 
ATOM   1804 C  CG2   . ILE A 1 259 ? -28.773 23.545 -1.157  1.00 58.22  ?  276 ILE A CG2   1 
ATOM   1805 C  CD1   . ILE A 1 259 ? -29.336 24.787 1.542   1.00 58.59  ?  276 ILE A CD1   1 
ATOM   1806 N  N     . THR A 1 260 ? -29.867 19.861 -1.255  1.00 56.11  ?  277 THR A N     1 
ATOM   1807 C  CA    . THR A 1 260 ? -29.303 18.791 -2.071  1.00 55.08  ?  277 THR A CA    1 
ATOM   1808 C  C     . THR A 1 260 ? -30.295 18.364 -3.150  1.00 56.80  ?  277 THR A C     1 
ATOM   1809 O  O     . THR A 1 260 ? -29.914 18.101 -4.291  1.00 56.89  ?  277 THR A O     1 
ATOM   1810 C  CB    . THR A 1 260 ? -28.916 17.568 -1.216  1.00 53.20  ?  277 THR A CB    1 
ATOM   1811 O  OG1   . THR A 1 260 ? -27.969 17.962 -0.214  1.00 51.73  ?  277 THR A OG1   1 
ATOM   1812 C  CG2   . THR A 1 260 ? -28.301 16.478 -2.083  1.00 52.38  ?  277 THR A CG2   1 
ATOM   1813 N  N     . SER A 1 261 ? -31.571 18.315 -2.783  1.00 63.75  ?  278 SER A N     1 
ATOM   1814 C  CA    . SER A 1 261 ? -32.620 17.882 -3.697  1.00 65.70  ?  278 SER A CA    1 
ATOM   1815 C  C     . SER A 1 261 ? -33.037 18.980 -4.673  1.00 67.92  ?  278 SER A C     1 
ATOM   1816 O  O     . SER A 1 261 ? -32.954 18.806 -5.888  1.00 71.24  ?  278 SER A O     1 
ATOM   1817 C  CB    . SER A 1 261 ? -33.841 17.404 -2.908  1.00 66.84  ?  278 SER A CB    1 
ATOM   1818 O  OG    . SER A 1 261 ? -33.506 16.329 -2.049  1.00 65.03  ?  278 SER A OG    1 
ATOM   1819 N  N     . SER A 1 262 ? -33.486 20.109 -4.134  1.00 63.84  ?  279 SER A N     1 
ATOM   1820 C  CA    . SER A 1 262 ? -34.071 21.171 -4.948  1.00 66.49  ?  279 SER A CA    1 
ATOM   1821 C  C     . SER A 1 262 ? -33.046 21.940 -5.782  1.00 69.03  ?  279 SER A C     1 
ATOM   1822 O  O     . SER A 1 262 ? -33.393 22.524 -6.808  1.00 73.49  ?  279 SER A O     1 
ATOM   1823 C  CB    . SER A 1 262 ? -34.842 22.149 -4.059  1.00 68.23  ?  279 SER A CB    1 
ATOM   1824 O  OG    . SER A 1 262 ? -33.984 22.772 -3.119  1.00 66.65  ?  279 SER A OG    1 
ATOM   1825 N  N     . ILE A 1 263 ? -31.790 21.943 -5.345  1.00 63.81  ?  280 ILE A N     1 
ATOM   1826 C  CA    . ILE A 1 263 ? -30.764 22.727 -6.026  1.00 63.65  ?  280 ILE A CA    1 
ATOM   1827 C  C     . ILE A 1 263 ? -29.723 21.863 -6.737  1.00 61.82  ?  280 ILE A C     1 
ATOM   1828 O  O     . ILE A 1 263 ? -29.601 21.909 -7.961  1.00 62.72  ?  280 ILE A O     1 
ATOM   1829 C  CB    . ILE A 1 263 ? -30.035 23.666 -5.041  1.00 62.91  ?  280 ILE A CB    1 
ATOM   1830 C  CG1   . ILE A 1 263 ? -31.042 24.532 -4.279  1.00 64.82  ?  280 ILE A CG1   1 
ATOM   1831 C  CG2   . ILE A 1 263 ? -29.010 24.519 -5.773  1.00 63.15  ?  280 ILE A CG2   1 
ATOM   1832 C  CD1   . ILE A 1 263 ? -31.937 25.364 -5.171  1.00 68.00  ?  280 ILE A CD1   1 
ATOM   1833 N  N     . HIS A 1 264 ? -28.977 21.076 -5.967  1.00 59.43  ?  281 HIS A N     1 
ATOM   1834 C  CA    . HIS A 1 264 ? -27.871 20.294 -6.515  1.00 57.77  ?  281 HIS A CA    1 
ATOM   1835 C  C     . HIS A 1 264 ? -28.333 19.143 -7.408  1.00 58.03  ?  281 HIS A C     1 
ATOM   1836 O  O     . HIS A 1 264 ? -27.738 18.890 -8.456  1.00 59.78  ?  281 HIS A O     1 
ATOM   1837 C  CB    . HIS A 1 264 ? -26.994 19.751 -5.385  1.00 55.46  ?  281 HIS A CB    1 
ATOM   1838 C  CG    . HIS A 1 264 ? -26.335 20.818 -4.567  1.00 55.11  ?  281 HIS A CG    1 
ATOM   1839 N  ND1   . HIS A 1 264 ? -25.365 21.654 -5.078  1.00 55.34  ?  281 HIS A ND1   1 
ATOM   1840 C  CD2   . HIS A 1 264 ? -26.504 21.185 -3.275  1.00 54.69  ?  281 HIS A CD2   1 
ATOM   1841 C  CE1   . HIS A 1 264 ? -24.966 22.490 -4.137  1.00 55.13  ?  281 HIS A CE1   1 
ATOM   1842 N  NE2   . HIS A 1 264 ? -25.641 22.227 -3.033  1.00 54.68  ?  281 HIS A NE2   1 
ATOM   1843 N  N     . PHE A 1 265 ? -29.386 18.445 -6.996  1.00 58.47  ?  282 PHE A N     1 
ATOM   1844 C  CA    . PHE A 1 265 ? -29.881 17.310 -7.768  1.00 58.90  ?  282 PHE A CA    1 
ATOM   1845 C  C     . PHE A 1 265 ? -30.595 17.767 -9.034  1.00 61.23  ?  282 PHE A C     1 
ATOM   1846 O  O     . PHE A 1 265 ? -30.504 17.119 -10.076 1.00 61.96  ?  282 PHE A O     1 
ATOM   1847 C  CB    . PHE A 1 265 ? -30.823 16.449 -6.926  1.00 58.99  ?  282 PHE A CB    1 
ATOM   1848 C  CG    . PHE A 1 265 ? -31.459 15.324 -7.693  1.00 59.85  ?  282 PHE A CG    1 
ATOM   1849 C  CD1   . PHE A 1 265 ? -30.732 14.192 -8.022  1.00 58.50  ?  282 PHE A CD1   1 
ATOM   1850 C  CD2   . PHE A 1 265 ? -32.784 15.402 -8.091  1.00 62.25  ?  282 PHE A CD2   1 
ATOM   1851 C  CE1   . PHE A 1 265 ? -31.315 13.158 -8.732  1.00 59.46  ?  282 PHE A CE1   1 
ATOM   1852 C  CE2   . PHE A 1 265 ? -33.372 14.372 -8.800  1.00 63.24  ?  282 PHE A CE2   1 
ATOM   1853 C  CZ    . PHE A 1 265 ? -32.637 13.249 -9.120  1.00 61.81  ?  282 PHE A CZ    1 
ATOM   1854 N  N     . GLU A 1 266 ? -31.304 18.887 -8.937  1.00 79.25  ?  283 GLU A N     1 
ATOM   1855 C  CA    . GLU A 1 266 ? -32.011 19.441 -10.084 1.00 85.86  ?  283 GLU A CA    1 
ATOM   1856 C  C     . GLU A 1 266 ? -31.031 19.952 -11.131 1.00 92.61  ?  283 GLU A C     1 
ATOM   1857 O  O     . GLU A 1 266 ? -31.322 19.935 -12.327 1.00 98.62  ?  283 GLU A O     1 
ATOM   1858 C  CB    . GLU A 1 266 ? -32.957 20.557 -9.644  1.00 85.38  ?  283 GLU A CB    1 
ATOM   1859 C  CG    . GLU A 1 266 ? -34.166 20.048 -8.882  1.00 80.47  ?  283 GLU A CG    1 
ATOM   1860 C  CD    . GLU A 1 266 ? -34.931 18.986 -9.651  1.00 81.80  ?  283 GLU A CD    1 
ATOM   1861 O  OE1   . GLU A 1 266 ? -35.199 19.195 -10.854 1.00 87.51  ?  283 GLU A OE1   1 
ATOM   1862 O  OE2   . GLU A 1 266 ? -35.260 17.940 -9.052  1.00 76.97  -1 283 GLU A OE2   1 
ATOM   1863 N  N     . ALA A 1 267 ? -29.870 20.410 -10.674 1.00 63.90  ?  284 ALA A N     1 
ATOM   1864 C  CA    . ALA A 1 267 ? -28.810 20.833 -11.578 1.00 63.73  ?  284 ALA A CA    1 
ATOM   1865 C  C     . ALA A 1 267 ? -28.325 19.640 -12.394 1.00 62.72  ?  284 ALA A C     1 
ATOM   1866 O  O     . ALA A 1 267 ? -28.002 19.770 -13.574 1.00 63.55  ?  284 ALA A O     1 
ATOM   1867 C  CB    . ALA A 1 267 ? -27.662 21.459 -10.803 1.00 62.27  ?  284 ALA A CB    1 
ATOM   1868 N  N     . TYR A 1 268 ? -28.277 18.476 -11.752 1.00 63.99  ?  285 TYR A N     1 
ATOM   1869 C  CA    . TYR A 1 268 ? -27.900 17.240 -12.428 1.00 61.26  ?  285 TYR A CA    1 
ATOM   1870 C  C     . TYR A 1 268 ? -28.992 16.760 -13.382 1.00 66.36  ?  285 TYR A C     1 
ATOM   1871 O  O     . TYR A 1 268 ? -28.697 16.299 -14.485 1.00 68.56  ?  285 TYR A O     1 
ATOM   1872 C  CB    . TYR A 1 268 ? -27.586 16.142 -11.409 1.00 58.29  ?  285 TYR A CB    1 
ATOM   1873 C  CG    . TYR A 1 268 ? -27.246 14.810 -12.041 1.00 57.71  ?  285 TYR A CG    1 
ATOM   1874 C  CD1   . TYR A 1 268 ? -25.960 14.542 -12.492 1.00 56.65  ?  285 TYR A CD1   1 
ATOM   1875 C  CD2   . TYR A 1 268 ? -28.212 13.821 -12.188 1.00 58.45  ?  285 TYR A CD2   1 
ATOM   1876 C  CE1   . TYR A 1 268 ? -25.647 13.327 -13.073 1.00 56.33  ?  285 TYR A CE1   1 
ATOM   1877 C  CE2   . TYR A 1 268 ? -27.907 12.605 -12.766 1.00 58.12  ?  285 TYR A CE2   1 
ATOM   1878 C  CZ    . TYR A 1 268 ? -26.623 12.364 -13.206 1.00 57.04  ?  285 TYR A CZ    1 
ATOM   1879 O  OH    . TYR A 1 268 ? -26.314 11.154 -13.783 1.00 56.90  ?  285 TYR A OH    1 
ATOM   1880 N  N     . ARG A 1 269 ? -30.246 16.861 -12.949 1.00 87.70  ?  286 ARG A N     1 
ATOM   1881 C  CA    . ARG A 1 269 ? -31.379 16.408 -13.754 1.00 91.47  ?  286 ARG A CA    1 
ATOM   1882 C  C     . ARG A 1 269 ? -31.449 17.163 -15.078 1.00 101.88 ?  286 ARG A C     1 
ATOM   1883 O  O     . ARG A 1 269 ? -31.683 16.568 -16.130 1.00 105.67 ?  286 ARG A O     1 
ATOM   1884 C  CB    . ARG A 1 269 ? -32.700 16.565 -12.990 1.00 88.70  ?  286 ARG A CB    1 
ATOM   1885 C  CG    . ARG A 1 269 ? -33.891 15.959 -13.726 1.00 90.88  ?  286 ARG A CG    1 
ATOM   1886 C  CD    . ARG A 1 269 ? -35.021 15.517 -12.798 1.00 84.40  ?  286 ARG A CD    1 
ATOM   1887 N  NE    . ARG A 1 269 ? -35.753 16.618 -12.180 1.00 84.10  ?  286 ARG A NE    1 
ATOM   1888 C  CZ    . ARG A 1 269 ? -36.869 16.457 -11.474 1.00 79.78  ?  286 ARG A CZ    1 
ATOM   1889 N  NH1   . ARG A 1 269 ? -37.369 15.242 -11.295 1.00 79.84  1  286 ARG A NH1   1 
ATOM   1890 N  NH2   . ARG A 1 269 ? -37.486 17.506 -10.947 1.00 81.38  ?  286 ARG A NH2   1 
ATOM   1891 N  N     . VAL A 1 270 ? -31.252 18.475 -15.015 1.00 81.52  ?  287 VAL A N     1 
ATOM   1892 C  CA    . VAL A 1 270 ? -31.336 19.330 -16.195 1.00 88.87  ?  287 VAL A CA    1 
ATOM   1893 C  C     . VAL A 1 270 ? -30.218 19.034 -17.197 1.00 90.58  ?  287 VAL A C     1 
ATOM   1894 O  O     . VAL A 1 270 ? -30.438 19.061 -18.410 1.00 92.64  ?  287 VAL A O     1 
ATOM   1895 C  CB    . VAL A 1 270 ? -31.288 20.825 -15.797 1.00 87.04  ?  287 VAL A CB    1 
ATOM   1896 C  CG1   . VAL A 1 270 ? -31.082 21.712 -17.017 1.00 90.09  ?  287 VAL A CG1   1 
ATOM   1897 C  CG2   . VAL A 1 270 ? -32.560 21.217 -15.062 1.00 82.60  ?  287 VAL A CG2   1 
ATOM   1898 N  N     . LYS A 1 271 ? -29.029 18.721 -16.690 1.00 91.81  ?  288 LYS A N     1 
ATOM   1899 C  CA    . LYS A 1 271 ? -27.888 18.416 -17.550 1.00 88.29  ?  288 LYS A CA    1 
ATOM   1900 C  C     . LYS A 1 271 ? -28.119 17.151 -18.371 1.00 85.45  ?  288 LYS A C     1 
ATOM   1901 O  O     . LYS A 1 271 ? -27.874 17.131 -19.577 1.00 86.56  ?  288 LYS A O     1 
ATOM   1902 C  CB    . LYS A 1 271 ? -26.615 18.271 -16.715 1.00 80.37  ?  288 LYS A CB    1 
ATOM   1903 N  N     . ARG A 1 272 ? -28.590 16.097 -17.711 1.00 72.32  ?  289 ARG A N     1 
ATOM   1904 C  CA    . ARG A 1 272 ? -28.799 14.813 -18.371 1.00 69.77  ?  289 ARG A CA    1 
ATOM   1905 C  C     . ARG A 1 272 ? -30.060 14.835 -19.229 1.00 75.58  ?  289 ARG A C     1 
ATOM   1906 O  O     . ARG A 1 272 ? -31.021 14.115 -18.958 1.00 76.30  ?  289 ARG A O     1 
ATOM   1907 C  CB    . ARG A 1 272 ? -28.882 13.687 -17.339 1.00 68.24  ?  289 ARG A CB    1 
ATOM   1908 N  N     . LYS B 1 2   ? 41.527  27.070 14.826  1.00 94.90  ?  19  LYS B N     1 
ATOM   1909 C  CA    . LYS B 1 2   ? 40.265  27.745 14.549  1.00 91.96  ?  19  LYS B CA    1 
ATOM   1910 C  C     . LYS B 1 2   ? 40.159  28.129 13.078  1.00 89.08  ?  19  LYS B C     1 
ATOM   1911 O  O     . LYS B 1 2   ? 40.548  29.229 12.684  1.00 91.65  ?  19  LYS B O     1 
ATOM   1912 C  CB    . LYS B 1 2   ? 40.116  28.988 15.429  1.00 96.34  ?  19  LYS B CB    1 
ATOM   1913 N  N     . GLN B 1 3   ? 39.631  27.217 12.269  1.00 99.05  ?  20  GLN B N     1 
ATOM   1914 C  CA    . GLN B 1 3   ? 39.490  27.458 10.839  1.00 96.01  ?  20  GLN B CA    1 
ATOM   1915 C  C     . GLN B 1 3   ? 38.030  27.360 10.411  1.00 92.39  ?  20  GLN B C     1 
ATOM   1916 O  O     . GLN B 1 3   ? 37.236  26.659 11.036  1.00 92.88  ?  20  GLN B O     1 
ATOM   1917 C  CB    . GLN B 1 3   ? 40.342  26.466 10.044  1.00 94.64  ?  20  GLN B CB    1 
ATOM   1918 C  CG    . GLN B 1 3   ? 41.761  26.309 10.570  1.00 98.87  ?  20  GLN B CG    1 
ATOM   1919 C  CD    . GLN B 1 3   ? 42.711  25.742 9.533   1.00 98.71  ?  20  GLN B CD    1 
ATOM   1920 O  OE1   . GLN B 1 3   ? 42.311  25.431 8.411   1.00 95.23  ?  20  GLN B OE1   1 
ATOM   1921 N  NE2   . GLN B 1 3   ? 43.978  25.602 9.905   1.00 102.87 ?  20  GLN B NE2   1 
ATOM   1922 N  N     . GLY B 1 4   ? 37.687  28.068 9.340   1.00 76.08  ?  21  GLY B N     1 
ATOM   1923 C  CA    . GLY B 1 4   ? 36.320  28.114 8.854   1.00 72.57  ?  21  GLY B CA    1 
ATOM   1924 C  C     . GLY B 1 4   ? 35.992  26.937 7.958   1.00 68.41  ?  21  GLY B C     1 
ATOM   1925 O  O     . GLY B 1 4   ? 36.543  26.810 6.865   1.00 68.06  ?  21  GLY B O     1 
ATOM   1926 N  N     . PHE B 1 5   ? 35.088  26.077 8.414   1.00 65.59  ?  22  PHE B N     1 
ATOM   1927 C  CA    . PHE B 1 5   ? 34.667  24.931 7.618   1.00 61.88  ?  22  PHE B CA    1 
ATOM   1928 C  C     . PHE B 1 5   ? 33.228  25.103 7.150   1.00 59.28  ?  22  PHE B C     1 
ATOM   1929 O  O     . PHE B 1 5   ? 32.322  25.330 7.952   1.00 59.09  ?  22  PHE B O     1 
ATOM   1930 C  CB    . PHE B 1 5   ? 34.811  23.637 8.421   1.00 60.99  ?  22  PHE B CB    1 
ATOM   1931 N  N     . GLU B 1 6   ? 33.028  24.989 5.841   1.00 79.04  ?  23  GLU B N     1 
ATOM   1932 C  CA    . GLU B 1 6   ? 31.716  25.188 5.239   1.00 78.17  ?  23  GLU B CA    1 
ATOM   1933 C  C     . GLU B 1 6   ? 30.852  23.932 5.298   1.00 77.18  ?  23  GLU B C     1 
ATOM   1934 O  O     . GLU B 1 6   ? 31.356  22.812 5.214   1.00 76.20  ?  23  GLU B O     1 
ATOM   1935 C  CB    . GLU B 1 6   ? 31.875  25.646 3.789   1.00 76.90  ?  23  GLU B CB    1 
ATOM   1936 C  CG    . GLU B 1 6   ? 32.766  26.868 3.630   1.00 78.36  ?  23  GLU B CG    1 
ATOM   1937 C  CD    . GLU B 1 6   ? 33.029  27.215 2.179   1.00 77.97  ?  23  GLU B CD    1 
ATOM   1938 O  OE1   . GLU B 1 6   ? 34.066  27.852 1.897   1.00 79.10  ?  23  GLU B OE1   1 
ATOM   1939 O  OE2   . GLU B 1 6   ? 32.195  26.857 1.321   1.00 76.87  -1 23  GLU B OE2   1 
ATOM   1940 N  N     . PHE B 1 7   ? 29.546  24.132 5.442   1.00 51.56  ?  24  PHE B N     1 
ATOM   1941 C  CA    . PHE B 1 7   ? 28.587  23.033 5.462   1.00 48.97  ?  24  PHE B CA    1 
ATOM   1942 C  C     . PHE B 1 7   ? 27.209  23.531 5.029   1.00 48.37  ?  24  PHE B C     1 
ATOM   1943 O  O     . PHE B 1 7   ? 26.710  24.528 5.550   1.00 49.81  ?  24  PHE B O     1 
ATOM   1944 C  CB    . PHE B 1 7   ? 28.525  22.404 6.855   1.00 48.93  ?  24  PHE B CB    1 
ATOM   1945 C  CG    . PHE B 1 7   ? 27.769  21.109 6.906   1.00 46.63  ?  24  PHE B CG    1 
ATOM   1946 C  CD1   . PHE B 1 7   ? 28.171  20.025 6.145   1.00 45.22  ?  24  PHE B CD1   1 
ATOM   1947 C  CD2   . PHE B 1 7   ? 26.664  20.970 7.730   1.00 46.26  ?  24  PHE B CD2   1 
ATOM   1948 C  CE1   . PHE B 1 7   ? 27.478  18.829 6.195   1.00 43.50  ?  24  PHE B CE1   1 
ATOM   1949 C  CE2   . PHE B 1 7   ? 25.969  19.777 7.786   1.00 44.53  ?  24  PHE B CE2   1 
ATOM   1950 C  CZ    . PHE B 1 7   ? 26.376  18.706 7.017   1.00 43.17  ?  24  PHE B CZ    1 
ATOM   1951 N  N     . ASN B 1 8   ? 26.599  22.834 4.076   1.00 60.61  ?  25  ASN B N     1 
ATOM   1952 C  CA    . ASN B 1 8   ? 25.332  23.275 3.502   1.00 60.62  ?  25  ASN B CA    1 
ATOM   1953 C  C     . ASN B 1 8   ? 24.201  22.272 3.703   1.00 60.23  ?  25  ASN B C     1 
ATOM   1954 O  O     . ASN B 1 8   ? 24.291  21.126 3.266   1.00 58.83  ?  25  ASN B O     1 
ATOM   1955 C  CB    . ASN B 1 8   ? 25.506  23.560 2.010   1.00 59.97  ?  25  ASN B CB    1 
ATOM   1956 C  CG    . ASN B 1 8   ? 26.560  24.613 1.739   1.00 61.14  ?  25  ASN B CG    1 
ATOM   1957 O  OD1   . ASN B 1 8   ? 26.687  25.587 2.481   1.00 62.57  ?  25  ASN B OD1   1 
ATOM   1958 N  ND2   . ASN B 1 8   ? 27.328  24.420 0.674   1.00 60.67  ?  25  ASN B ND2   1 
ATOM   1959 N  N     . ILE B 1 9   ? 23.136  22.713 4.367   1.00 45.17  ?  26  ILE B N     1 
ATOM   1960 C  CA    . ILE B 1 9   ? 21.964  21.873 4.589   1.00 43.96  ?  26  ILE B CA    1 
ATOM   1961 C  C     . ILE B 1 9   ? 20.737  22.428 3.868   1.00 44.72  ?  26  ILE B C     1 
ATOM   1962 O  O     . ILE B 1 9   ? 20.411  23.606 4.005   1.00 46.46  ?  26  ILE B O     1 
ATOM   1963 C  CB    . ILE B 1 9   ? 21.644  21.740 6.092   1.00 44.21  ?  26  ILE B CB    1 
ATOM   1964 C  CG1   . ILE B 1 9   ? 22.883  21.282 6.865   1.00 44.19  ?  26  ILE B CG1   1 
ATOM   1965 C  CG2   . ILE B 1 9   ? 20.481  20.782 6.312   1.00 43.20  ?  26  ILE B CG2   1 
ATOM   1966 C  CD1   . ILE B 1 9   ? 22.673  21.198 8.362   1.00 45.10  ?  26  ILE B CD1   1 
ATOM   1967 N  N     . MET B 1 10  ? 20.064  21.579 3.097   1.00 43.82  ?  27  MET B N     1 
ATOM   1968 C  CA    . MET B 1 10  ? 18.846  21.986 2.401   1.00 44.94  ?  27  MET B CA    1 
ATOM   1969 C  C     . MET B 1 10  ? 17.614  21.259 2.931   1.00 44.52  ?  27  MET B C     1 
ATOM   1970 O  O     . MET B 1 10  ? 17.592  20.031 3.002   1.00 43.14  ?  27  MET B O     1 
ATOM   1971 C  CB    . MET B 1 10  ? 18.978  21.736 0.898   1.00 45.22  ?  27  MET B CB    1 
ATOM   1972 C  CG    . MET B 1 10  ? 17.650  21.757 0.159   1.00 46.50  ?  27  MET B CG    1 
ATOM   1973 S  SD    . MET B 1 10  ? 17.829  21.553 -1.620  1.00 47.68  ?  27  MET B SD    1 
ATOM   1974 C  CE    . MET B 1 10  ? 18.459  23.165 -2.068  1.00 49.95  ?  27  MET B CE    1 
ATOM   1975 N  N     . VAL B 1 11  ? 16.588  22.020 3.297   1.00 46.05  ?  28  VAL B N     1 
ATOM   1976 C  CA    . VAL B 1 11  ? 15.328  21.430 3.732   1.00 46.20  ?  28  VAL B CA    1 
ATOM   1977 C  C     . VAL B 1 11  ? 14.316  21.358 2.587   1.00 47.44  ?  28  VAL B C     1 
ATOM   1978 O  O     . VAL B 1 11  ? 14.096  22.334 1.870   1.00 49.28  ?  28  VAL B O     1 
ATOM   1979 C  CB    . VAL B 1 11  ? 14.719  22.209 4.920   1.00 47.57  ?  28  VAL B CB    1 
ATOM   1980 C  CG1   . VAL B 1 11  ? 15.542  21.982 6.180   1.00 46.70  ?  28  VAL B CG1   1 
ATOM   1981 C  CG2   . VAL B 1 11  ? 14.614  23.693 4.601   1.00 49.75  ?  28  VAL B CG2   1 
ATOM   1982 N  N     . VAL B 1 12  ? 13.719  20.183 2.413   1.00 46.84  ?  29  VAL B N     1 
ATOM   1983 C  CA    . VAL B 1 12  ? 12.747  19.953 1.348   1.00 48.38  ?  29  VAL B CA    1 
ATOM   1984 C  C     . VAL B 1 12  ? 11.573  19.138 1.879   1.00 48.82  ?  29  VAL B C     1 
ATOM   1985 O  O     . VAL B 1 12  ? 11.747  18.258 2.722   1.00 47.35  ?  29  VAL B O     1 
ATOM   1986 C  CB    . VAL B 1 12  ? 13.367  19.230 0.133   1.00 47.82  ?  29  VAL B CB    1 
ATOM   1987 C  CG1   . VAL B 1 12  ? 14.386  20.121 -0.563  1.00 48.15  ?  29  VAL B CG1   1 
ATOM   1988 C  CG2   . VAL B 1 12  ? 13.998  17.921 0.556   1.00 45.58  ?  29  VAL B CG2   1 
ATOM   1989 N  N     . GLY B 1 13  ? 10.375  19.445 1.397   1.00 61.58  ?  30  GLY B N     1 
ATOM   1990 C  CA    . GLY B 1 13  ? 9.185   18.740 1.831   1.00 61.71  ?  30  GLY B CA    1 
ATOM   1991 C  C     . GLY B 1 13  ? 7.916   19.433 1.381   1.00 63.94  ?  30  GLY B C     1 
ATOM   1992 O  O     . GLY B 1 13  ? 7.964   20.504 0.777   1.00 65.21  ?  30  GLY B O     1 
ATOM   1993 N  N     . GLN B 1 14  ? 6.777   18.818 1.677   1.00 67.41  ?  31  GLN B N     1 
ATOM   1994 C  CA    . GLN B 1 14  ? 5.488   19.367 1.277   1.00 69.52  ?  31  GLN B CA    1 
ATOM   1995 C  C     . GLN B 1 14  ? 5.177   20.647 2.047   1.00 68.67  ?  31  GLN B C     1 
ATOM   1996 O  O     . GLN B 1 14  ? 5.820   20.952 3.052   1.00 66.77  ?  31  GLN B O     1 
ATOM   1997 C  CB    . GLN B 1 14  ? 4.381   18.333 1.492   1.00 69.60  ?  31  GLN B CB    1 
ATOM   1998 C  CG    . GLN B 1 14  ? 4.277   17.304 0.375   1.00 71.54  ?  31  GLN B CG    1 
ATOM   1999 C  CD    . GLN B 1 14  ? 2.952   16.569 0.373   1.00 72.28  ?  31  GLN B CD    1 
ATOM   2000 O  OE1   . GLN B 1 14  ? 1.891   17.176 0.521   1.00 73.57  ?  31  GLN B OE1   1 
ATOM   2001 N  NE2   . GLN B 1 14  ? 3.007   15.252 0.208   1.00 71.35  ?  31  GLN B NE2   1 
ATOM   2002 N  N     . SER B 1 15  ? 4.190   21.394 1.564   1.00 65.44  ?  32  SER B N     1 
ATOM   2003 C  CA    . SER B 1 15  ? 3.839   22.687 2.141   1.00 67.37  ?  32  SER B CA    1 
ATOM   2004 C  C     . SER B 1 15  ? 3.293   22.564 3.560   1.00 67.41  ?  32  SER B C     1 
ATOM   2005 O  O     . SER B 1 15  ? 2.384   21.775 3.818   1.00 68.49  ?  32  SER B O     1 
ATOM   2006 C  CB    . SER B 1 15  ? 2.819   23.403 1.255   1.00 71.75  ?  32  SER B CB    1 
ATOM   2007 O  OG    . SER B 1 15  ? 3.210   23.361 -0.106  1.00 72.31  ?  32  SER B OG    1 
ATOM   2008 N  N     . GLY B 1 16  ? 3.857   23.344 4.476   1.00 66.60  ?  33  GLY B N     1 
ATOM   2009 C  CA    . GLY B 1 16  ? 3.347   23.419 5.832   1.00 67.35  ?  33  GLY B CA    1 
ATOM   2010 C  C     . GLY B 1 16  ? 3.794   22.297 6.749   1.00 64.65  ?  33  GLY B C     1 
ATOM   2011 O  O     . GLY B 1 16  ? 3.082   21.936 7.684   1.00 65.79  ?  33  GLY B O     1 
ATOM   2012 N  N     . LEU B 1 17  ? 4.971   21.739 6.482   1.00 61.45  ?  34  LEU B N     1 
ATOM   2013 C  CA    . LEU B 1 17  ? 5.496   20.651 7.301   1.00 59.14  ?  34  LEU B CA    1 
ATOM   2014 C  C     . LEU B 1 17  ? 6.420   21.152 8.409   1.00 58.07  ?  34  LEU B C     1 
ATOM   2015 O  O     . LEU B 1 17  ? 6.954   20.361 9.187   1.00 56.55  ?  34  LEU B O     1 
ATOM   2016 C  CB    . LEU B 1 17  ? 6.235   19.636 6.426   1.00 56.68  ?  34  LEU B CB    1 
ATOM   2017 C  CG    . LEU B 1 17  ? 5.355   18.756 5.538   1.00 57.82  ?  34  LEU B CG    1 
ATOM   2018 C  CD1   . LEU B 1 17  ? 6.199   17.736 4.792   1.00 55.52  ?  34  LEU B CD1   1 
ATOM   2019 C  CD2   . LEU B 1 17  ? 4.278   18.067 6.364   1.00 59.46  ?  34  LEU B CD2   1 
ATOM   2020 N  N     . GLY B 1 18  ? 6.607   22.466 8.481   1.00 59.31  ?  35  GLY B N     1 
ATOM   2021 C  CA    . GLY B 1 18  ? 7.418   23.053 9.532   1.00 59.05  ?  35  GLY B CA    1 
ATOM   2022 C  C     . GLY B 1 18  ? 8.880   23.160 9.145   1.00 56.70  ?  35  GLY B C     1 
ATOM   2023 O  O     . GLY B 1 18  ? 9.759   23.139 10.006  1.00 55.89  ?  35  GLY B O     1 
ATOM   2024 N  N     . LYS B 1 19  ? 9.139   23.275 7.846   1.00 58.37  ?  36  LYS B N     1 
ATOM   2025 C  CA    . LYS B 1 19  ? 10.504  23.362 7.337   1.00 56.42  ?  36  LYS B CA    1 
ATOM   2026 C  C     . LYS B 1 19  ? 11.202  24.646 7.779   1.00 57.54  ?  36  LYS B C     1 
ATOM   2027 O  O     . LYS B 1 19  ? 12.309  24.605 8.316   1.00 56.70  ?  36  LYS B O     1 
ATOM   2028 C  CB    . LYS B 1 19  ? 10.517  23.267 5.810   1.00 56.14  ?  36  LYS B CB    1 
ATOM   2029 C  CG    . LYS B 1 19  ? 10.031  21.935 5.261   1.00 55.13  ?  36  LYS B CG    1 
ATOM   2030 C  CD    . LYS B 1 19  ? 10.257  21.843 3.759   1.00 55.08  ?  36  LYS B CD    1 
ATOM   2031 C  CE    . LYS B 1 19  ? 9.587   22.988 3.018   1.00 57.98  ?  36  LYS B CE    1 
ATOM   2032 N  NZ    . LYS B 1 19  ? 8.104   22.871 3.026   1.00 60.36  1  36  LYS B NZ    1 
ATOM   2033 N  N     . SER B 1 20  ? 10.552  25.782 7.544   1.00 57.81  ?  37  SER B N     1 
ATOM   2034 C  CA    . SER B 1 20  ? 11.114  27.080 7.906   1.00 59.51  ?  37  SER B CA    1 
ATOM   2035 C  C     . SER B 1 20  ? 11.270  27.226 9.418   1.00 60.24  ?  37  SER B C     1 
ATOM   2036 O  O     . SER B 1 20  ? 12.233  27.824 9.897   1.00 60.63  ?  37  SER B O     1 
ATOM   2037 C  CB    . SER B 1 20  ? 10.239  28.211 7.361   1.00 62.72  ?  37  SER B CB    1 
ATOM   2038 O  OG    . SER B 1 20  ? 9.967   28.028 5.983   1.00 62.67  ?  37  SER B OG    1 
ATOM   2039 N  N     . THR B 1 21  ? 10.312  26.677 10.158  1.00 70.78  ?  38  THR B N     1 
ATOM   2040 C  CA    . THR B 1 21  ? 10.314  26.750 11.616  1.00 73.09  ?  38  THR B CA    1 
ATOM   2041 C  C     . THR B 1 21  ? 11.513  26.007 12.206  1.00 74.32  ?  38  THR B C     1 
ATOM   2042 O  O     . THR B 1 21  ? 12.026  26.373 13.263  1.00 77.15  ?  38  THR B O     1 
ATOM   2043 C  CB    . THR B 1 21  ? 9.006   26.176 12.201  1.00 73.02  ?  38  THR B CB    1 
ATOM   2044 O  OG1   . THR B 1 21  ? 7.886   26.881 11.651  1.00 73.02  ?  38  THR B OG1   1 
ATOM   2045 C  CG2   . THR B 1 21  ? 8.982   26.302 13.719  1.00 75.43  ?  38  THR B CG2   1 
ATOM   2046 N  N     . LEU B 1 22  ? 11.961  24.962 11.521  1.00 67.07  ?  39  LEU B N     1 
ATOM   2047 C  CA    . LEU B 1 22  ? 13.086  24.173 12.007  1.00 68.16  ?  39  LEU B CA    1 
ATOM   2048 C  C     . LEU B 1 22  ? 14.413  24.901 11.804  1.00 69.06  ?  39  LEU B C     1 
ATOM   2049 O  O     . LEU B 1 22  ? 15.360  24.704 12.565  1.00 71.73  ?  39  LEU B O     1 
ATOM   2050 C  CB    . LEU B 1 22  ? 13.127  22.811 11.311  1.00 65.65  ?  39  LEU B CB    1 
ATOM   2051 C  CG    . LEU B 1 22  ? 14.002  21.753 11.988  1.00 66.73  ?  39  LEU B CG    1 
ATOM   2052 C  CD1   . LEU B 1 22  ? 13.276  21.141 13.177  1.00 67.76  ?  39  LEU B CD1   1 
ATOM   2053 C  CD2   . LEU B 1 22  ? 14.432  20.677 11.003  1.00 63.88  ?  39  LEU B CD2   1 
ATOM   2054 N  N     . ILE B 1 23  ? 14.475  25.741 10.775  1.00 55.58  ?  40  ILE B N     1 
ATOM   2055 C  CA    . ILE B 1 23  ? 15.709  26.444 10.430  1.00 55.71  ?  40  ILE B CA    1 
ATOM   2056 C  C     . ILE B 1 23  ? 16.163  27.455 11.484  1.00 58.38  ?  40  ILE B C     1 
ATOM   2057 O  O     . ILE B 1 23  ? 17.300  27.390 11.954  1.00 58.36  ?  40  ILE B O     1 
ATOM   2058 C  CB    . ILE B 1 23  ? 15.564  27.173 9.083   1.00 56.11  ?  40  ILE B CB    1 
ATOM   2059 C  CG1   . ILE B 1 23  ? 15.300  26.162 7.967   1.00 53.81  ?  40  ILE B CG1   1 
ATOM   2060 C  CG2   . ILE B 1 23  ? 16.810  27.991 8.781   1.00 56.83  ?  40  ILE B CG2   1 
ATOM   2061 C  CD1   . ILE B 1 23  ? 15.158  26.786 6.605   1.00 54.58  ?  40  ILE B CD1   1 
ATOM   2062 N  N     . ASN B 1 24  ? 15.289  28.386 11.856  1.00 76.22  ?  41  ASN B N     1 
ATOM   2063 C  CA    . ASN B 1 24  ? 15.639  29.363 12.886  1.00 80.51  ?  41  ASN B CA    1 
ATOM   2064 C  C     . ASN B 1 24  ? 15.798  28.675 14.239  1.00 84.48  ?  41  ASN B C     1 
ATOM   2065 O  O     . ASN B 1 24  ? 16.534  29.146 15.106  1.00 88.81  ?  41  ASN B O     1 
ATOM   2066 C  CB    . ASN B 1 24  ? 14.604  30.493 12.962  1.00 80.95  ?  41  ASN B CB    1 
ATOM   2067 C  CG    . ASN B 1 24  ? 13.266  30.037 13.506  1.00 80.98  ?  41  ASN B CG    1 
ATOM   2068 O  OD1   . ASN B 1 24  ? 12.938  28.855 13.471  1.00 80.05  ?  41  ASN B OD1   1 
ATOM   2069 N  ND2   . ASN B 1 24  ? 12.484  30.982 14.016  1.00 82.04  ?  41  ASN B ND2   1 
ATOM   2070 N  N     . THR B 1 25  ? 15.094  27.560 14.408  1.00 85.22  ?  42  THR B N     1 
ATOM   2071 C  CA    . THR B 1 25  ? 15.234  26.723 15.594  1.00 87.85  ?  42  THR B CA    1 
ATOM   2072 C  C     . THR B 1 25  ? 16.638  26.129 15.646  1.00 89.79  ?  42  THR B C     1 
ATOM   2073 O  O     . THR B 1 25  ? 17.277  26.102 16.698  1.00 92.90  ?  42  THR B O     1 
ATOM   2074 C  CB    . THR B 1 25  ? 14.192  25.586 15.613  1.00 85.40  ?  42  THR B CB    1 
ATOM   2075 O  OG1   . THR B 1 25  ? 12.871  26.142 15.614  1.00 84.29  ?  42  THR B OG1   1 
ATOM   2076 C  CG2   . THR B 1 25  ? 14.371  24.712 16.846  1.00 86.88  ?  42  THR B CG2   1 
ATOM   2077 N  N     . LEU B 1 26  ? 17.107  25.656 14.496  1.00 64.70  ?  43  LEU B N     1 
ATOM   2078 C  CA    . LEU B 1 26  ? 18.424  25.040 14.380  1.00 65.06  ?  43  LEU B CA    1 
ATOM   2079 C  C     . LEU B 1 26  ? 19.538  26.039 14.677  1.00 67.88  ?  43  LEU B C     1 
ATOM   2080 O  O     . LEU B 1 26  ? 20.548  25.693 15.289  1.00 70.26  ?  43  LEU B O     1 
ATOM   2081 C  CB    . LEU B 1 26  ? 18.606  24.445 12.980  1.00 59.57  ?  43  LEU B CB    1 
ATOM   2082 C  CG    . LEU B 1 26  ? 19.964  23.835 12.628  1.00 58.60  ?  43  LEU B CG    1 
ATOM   2083 C  CD1   . LEU B 1 26  ? 19.780  22.489 11.945  1.00 55.42  ?  43  LEU B CD1   1 
ATOM   2084 C  CD2   . LEU B 1 26  ? 20.753  24.778 11.736  1.00 56.67  ?  43  LEU B CD2   1 
ATOM   2085 N  N     . PHE B 1 27  ? 19.344  27.279 14.242  1.00 78.48  ?  44  PHE B N     1 
ATOM   2086 C  CA    . PHE B 1 27  ? 20.344  28.325 14.428  1.00 79.45  ?  44  PHE B CA    1 
ATOM   2087 C  C     . PHE B 1 27  ? 20.357  28.853 15.860  1.00 84.17  ?  44  PHE B C     1 
ATOM   2088 O  O     . PHE B 1 27  ? 21.400  29.261 16.369  1.00 84.53  ?  44  PHE B O     1 
ATOM   2089 C  CB    . PHE B 1 27  ? 20.097  29.473 13.449  1.00 76.50  ?  44  PHE B CB    1 
ATOM   2090 C  CG    . PHE B 1 27  ? 20.732  29.267 12.104  1.00 71.59  ?  44  PHE B CG    1 
ATOM   2091 C  CD1   . PHE B 1 27  ? 22.025  28.783 12.003  1.00 70.72  ?  44  PHE B CD1   1 
ATOM   2092 C  CD2   . PHE B 1 27  ? 20.035  29.554 10.942  1.00 68.26  ?  44  PHE B CD2   1 
ATOM   2093 C  CE1   . PHE B 1 27  ? 22.614  28.592 10.768  1.00 66.81  ?  44  PHE B CE1   1 
ATOM   2094 C  CE2   . PHE B 1 27  ? 20.618  29.364 9.704   1.00 64.70  ?  44  PHE B CE2   1 
ATOM   2095 C  CZ    . PHE B 1 27  ? 21.910  28.883 9.617   1.00 64.02  ?  44  PHE B CZ    1 
ATOM   2096 N  N     . LYS B 1 28  ? 19.195  28.845 16.504  1.00 95.61  ?  45  LYS B N     1 
ATOM   2097 C  CA    . LYS B 1 28  ? 19.082  29.329 17.875  1.00 97.28  ?  45  LYS B CA    1 
ATOM   2098 C  C     . LYS B 1 28  ? 19.513  28.258 18.872  1.00 98.26  ?  45  LYS B C     1 
ATOM   2099 O  O     . LYS B 1 28  ? 20.656  27.800 18.851  1.00 98.50  ?  45  LYS B O     1 
ATOM   2100 C  CB    . LYS B 1 28  ? 17.650  29.777 18.170  1.00 96.92  ?  45  LYS B CB    1 
ATOM   2101 N  N     . ARG B 1 43  ? 4.578   35.224 13.171  1.00 91.91  ?  60  ARG B N     1 
ATOM   2102 C  CA    . ARG B 1 43  ? 4.210   34.310 12.097  1.00 89.22  ?  60  ARG B CA    1 
ATOM   2103 C  C     . ARG B 1 43  ? 5.286   34.234 11.021  1.00 86.29  ?  60  ARG B C     1 
ATOM   2104 O  O     . ARG B 1 43  ? 5.663   35.249 10.436  1.00 88.14  ?  60  ARG B O     1 
ATOM   2105 C  CB    . ARG B 1 43  ? 2.883   34.735 11.462  1.00 92.71  ?  60  ARG B CB    1 
ATOM   2106 C  CG    . ARG B 1 43  ? 2.387   33.789 10.379  1.00 90.75  ?  60  ARG B CG    1 
ATOM   2107 C  CD    . ARG B 1 43  ? 1.710   34.548 9.249   1.00 94.10  ?  60  ARG B CD    1 
ATOM   2108 N  NE    . ARG B 1 43  ? 1.190   33.650 8.222   1.00 92.88  ?  60  ARG B NE    1 
ATOM   2109 C  CZ    . ARG B 1 43  ? 1.052   33.977 6.940   1.00 94.32  ?  60  ARG B CZ    1 
ATOM   2110 N  NH1   . ARG B 1 43  ? 1.401   35.185 6.520   1.00 96.94  1  60  ARG B NH1   1 
ATOM   2111 N  NH2   . ARG B 1 43  ? 0.569   33.093 6.077   1.00 93.52  ?  60  ARG B NH2   1 
ATOM   2112 N  N     . ILE B 1 44  ? 5.779   33.027 10.764  1.00 82.05  ?  61  ILE B N     1 
ATOM   2113 C  CA    . ILE B 1 44  ? 6.685   32.806 9.645   1.00 79.36  ?  61  ILE B CA    1 
ATOM   2114 C  C     . ILE B 1 44  ? 5.890   32.771 8.344   1.00 80.36  ?  61  ILE B C     1 
ATOM   2115 O  O     . ILE B 1 44  ? 5.008   31.929 8.178   1.00 79.93  ?  61  ILE B O     1 
ATOM   2116 C  CB    . ILE B 1 44  ? 7.481   31.497 9.799   1.00 74.85  ?  61  ILE B CB    1 
ATOM   2117 C  CG1   . ILE B 1 44  ? 8.324   31.533 11.075  1.00 74.36  ?  61  ILE B CG1   1 
ATOM   2118 C  CG2   . ILE B 1 44  ? 8.363   31.265 8.582   1.00 72.45  ?  61  ILE B CG2   1 
ATOM   2119 C  CD1   . ILE B 1 44  ? 9.200   30.314 11.262  1.00 70.43  ?  61  ILE B CD1   1 
ATOM   2120 N  N     . PRO B 1 45  ? 6.200   33.689 7.418   1.00 82.14  ?  62  PRO B N     1 
ATOM   2121 C  CA    . PRO B 1 45  ? 5.458   33.800 6.157   1.00 84.04  ?  62  PRO B CA    1 
ATOM   2122 C  C     . PRO B 1 45  ? 5.626   32.578 5.257   1.00 80.76  ?  62  PRO B C     1 
ATOM   2123 O  O     . PRO B 1 45  ? 6.502   31.746 5.490   1.00 76.87  ?  62  PRO B O     1 
ATOM   2124 C  CB    . PRO B 1 45  ? 6.064   35.045 5.502   1.00 86.53  ?  62  PRO B CB    1 
ATOM   2125 C  CG    . PRO B 1 45  ? 7.425   35.156 6.093   1.00 84.18  ?  62  PRO B CG    1 
ATOM   2126 C  CD    . PRO B 1 45  ? 7.286   34.680 7.508   1.00 82.94  ?  62  PRO B CD    1 
ATOM   2127 N  N     . LYS B 1 46  ? 4.779   32.482 4.238   1.00 85.70  ?  63  LYS B N     1 
ATOM   2128 C  CA    . LYS B 1 46  ? 4.841   31.388 3.277   1.00 83.47  ?  63  LYS B CA    1 
ATOM   2129 C  C     . LYS B 1 46  ? 6.090   31.489 2.404   1.00 81.75  ?  63  LYS B C     1 
ATOM   2130 O  O     . LYS B 1 46  ? 6.343   32.521 1.782   1.00 84.40  ?  63  LYS B O     1 
ATOM   2131 C  CB    . LYS B 1 46  ? 3.575   31.384 2.417   1.00 87.07  ?  63  LYS B CB    1 
ATOM   2132 C  CG    . LYS B 1 46  ? 3.517   30.304 1.353   1.00 85.72  ?  63  LYS B CG    1 
ATOM   2133 C  CD    . LYS B 1 46  ? 2.094   30.135 0.836   1.00 89.54  ?  63  LYS B CD    1 
ATOM   2134 C  CE    . LYS B 1 46  ? 1.479   31.472 0.443   1.00 94.86  ?  63  LYS B CE    1 
ATOM   2135 N  NZ    . LYS B 1 46  ? 2.115   32.060 -0.766  1.00 96.34  1  63  LYS B NZ    1 
ATOM   2136 N  N     . THR B 1 47  ? 6.868   30.411 2.366   1.00 74.78  ?  64  THR B N     1 
ATOM   2137 C  CA    . THR B 1 47  ? 8.119   30.383 1.613   1.00 72.99  ?  64  THR B CA    1 
ATOM   2138 C  C     . THR B 1 47  ? 7.866   30.254 0.114   1.00 74.70  ?  64  THR B C     1 
ATOM   2139 O  O     . THR B 1 47  ? 7.457   29.198 -0.367  1.00 73.68  ?  64  THR B O     1 
ATOM   2140 C  CB    . THR B 1 47  ? 9.024   29.223 2.071   1.00 68.39  ?  64  THR B CB    1 
ATOM   2141 O  OG1   . THR B 1 47  ? 9.099   29.207 3.502   1.00 67.29  ?  64  THR B OG1   1 
ATOM   2142 C  CG2   . THR B 1 47  ? 10.423  29.374 1.492   1.00 66.92  ?  64  THR B CG2   1 
ATOM   2143 N  N     . ILE B 1 48  ? 8.114   31.335 -0.621  1.00 77.65  ?  65  ILE B N     1 
ATOM   2144 C  CA    . ILE B 1 48  ? 7.825   31.371 -2.051  1.00 80.31  ?  65  ILE B CA    1 
ATOM   2145 C  C     . ILE B 1 48  ? 9.071   31.201 -2.919  1.00 78.86  ?  65  ILE B C     1 
ATOM   2146 O  O     . ILE B 1 48  ? 8.977   30.769 -4.068  1.00 79.96  ?  65  ILE B O     1 
ATOM   2147 C  CB    . ILE B 1 48  ? 7.134   32.690 -2.444  1.00 85.73  ?  65  ILE B CB    1 
ATOM   2148 N  N     . GLU B 1 49  ? 10.234  31.538 -2.372  1.00 80.86  ?  66  GLU B N     1 
ATOM   2149 C  CA    . GLU B 1 49  ? 11.482  31.427 -3.122  1.00 81.38  ?  66  GLU B CA    1 
ATOM   2150 C  C     . GLU B 1 49  ? 12.563  30.681 -2.350  1.00 79.23  ?  66  GLU B C     1 
ATOM   2151 O  O     . GLU B 1 49  ? 12.554  30.646 -1.120  1.00 77.68  ?  66  GLU B O     1 
ATOM   2152 C  CB    . GLU B 1 49  ? 12.000  32.814 -3.507  1.00 83.09  ?  66  GLU B CB    1 
ATOM   2153 C  CG    . GLU B 1 49  ? 11.493  33.328 -4.843  1.00 87.26  ?  66  GLU B CG    1 
ATOM   2154 C  CD    . GLU B 1 49  ? 12.244  34.560 -5.313  1.00 90.37  ?  66  GLU B CD    1 
ATOM   2155 O  OE1   . GLU B 1 49  ? 13.139  35.028 -4.578  1.00 89.03  ?  66  GLU B OE1   1 
ATOM   2156 O  OE2   . GLU B 1 49  ? 11.938  35.061 -6.416  1.00 94.49  -1 66  GLU B OE2   1 
ATOM   2157 N  N     . ILE B 1 50  ? 13.494  30.083 -3.088  1.00 69.43  ?  67  ILE B N     1 
ATOM   2158 C  CA    . ILE B 1 50  ? 14.645  29.424 -2.486  1.00 65.64  ?  67  ILE B CA    1 
ATOM   2159 C  C     . ILE B 1 50  ? 15.578  30.462 -1.872  1.00 66.29  ?  67  ILE B C     1 
ATOM   2160 O  O     . ILE B 1 50  ? 16.083  31.343 -2.569  1.00 68.86  ?  67  ILE B O     1 
ATOM   2161 C  CB    . ILE B 1 50  ? 15.419  28.581 -3.518  1.00 64.38  ?  67  ILE B CB    1 
ATOM   2162 C  CG1   . ILE B 1 50  ? 14.531  27.464 -4.070  1.00 63.89  ?  67  ILE B CG1   1 
ATOM   2163 C  CG2   . ILE B 1 50  ? 16.683  28.007 -2.901  1.00 61.04  ?  67  ILE B CG2   1 
ATOM   2164 C  CD1   . ILE B 1 50  ? 15.167  26.677 -5.196  1.00 63.46  ?  67  ILE B CD1   1 
ATOM   2165 N  N     . LYS B 1 51  ? 15.803  30.357 -0.567  1.00 64.38  ?  68  LYS B N     1 
ATOM   2166 C  CA    . LYS B 1 51  ? 16.614  31.334 0.147   1.00 65.42  ?  68  LYS B CA    1 
ATOM   2167 C  C     . LYS B 1 51  ? 17.724  30.670 0.953   1.00 62.40  ?  68  LYS B C     1 
ATOM   2168 O  O     . LYS B 1 51  ? 17.474  29.747 1.728   1.00 59.91  ?  68  LYS B O     1 
ATOM   2169 C  CB    . LYS B 1 51  ? 15.736  32.183 1.069   1.00 67.57  ?  68  LYS B CB    1 
ATOM   2170 N  N     . SER B 1 52  ? 18.951  31.144 0.762   1.00 63.03  ?  69  SER B N     1 
ATOM   2171 C  CA    . SER B 1 52  ? 20.087  30.661 1.536   1.00 60.97  ?  69  SER B CA    1 
ATOM   2172 C  C     . SER B 1 52  ? 20.295  31.524 2.776   1.00 62.56  ?  69  SER B C     1 
ATOM   2173 O  O     . SER B 1 52  ? 20.258  32.752 2.701   1.00 65.78  ?  69  SER B O     1 
ATOM   2174 C  CB    . SER B 1 52  ? 21.354  30.646 0.680   1.00 61.12  ?  69  SER B CB    1 
ATOM   2175 O  OG    . SER B 1 52  ? 21.245  29.704 -0.373  1.00 59.62  ?  69  SER B OG    1 
ATOM   2176 N  N     . ILE B 1 53  ? 20.517  30.875 3.915   1.00 81.20  ?  70  ILE B N     1 
ATOM   2177 C  CA    . ILE B 1 53  ? 20.755  31.582 5.168   1.00 83.22  ?  70  ILE B CA    1 
ATOM   2178 C  C     . ILE B 1 53  ? 22.080  31.138 5.778   1.00 83.27  ?  70  ILE B C     1 
ATOM   2179 O  O     . ILE B 1 53  ? 22.284  29.953 6.039   1.00 81.72  ?  70  ILE B O     1 
ATOM   2180 C  CB    . ILE B 1 53  ? 19.618  31.339 6.182   1.00 84.06  ?  70  ILE B CB    1 
ATOM   2181 C  CG1   . ILE B 1 53  ? 18.263  31.711 5.575   1.00 83.77  ?  70  ILE B CG1   1 
ATOM   2182 C  CG2   . ILE B 1 53  ? 19.873  32.113 7.466   1.00 87.48  ?  70  ILE B CG2   1 
ATOM   2183 C  CD1   . ILE B 1 53  ? 18.146  33.166 5.179   1.00 85.50  ?  70  ILE B CD1   1 
ATOM   2184 N  N     . THR B 1 54  ? 22.975  32.094 6.012   1.00 64.16  ?  71  THR B N     1 
ATOM   2185 C  CA    . THR B 1 54  ? 24.327  31.779 6.462   1.00 64.00  ?  71  THR B CA    1 
ATOM   2186 C  C     . THR B 1 54  ? 24.658  32.421 7.809   1.00 66.60  ?  71  THR B C     1 
ATOM   2187 O  O     . THR B 1 54  ? 24.397  33.605 8.027   1.00 69.79  ?  71  THR B O     1 
ATOM   2188 C  CB    . THR B 1 54  ? 25.373  32.230 5.421   1.00 65.24  ?  71  THR B CB    1 
ATOM   2189 O  OG1   . THR B 1 54  ? 25.114  31.582 4.169   1.00 63.17  ?  71  THR B OG1   1 
ATOM   2190 C  CG2   . THR B 1 54  ? 26.781  31.886 5.883   1.00 65.43  ?  71  THR B CG2   1 
ATOM   2191 N  N     . HIS B 1 55  ? 25.234  31.626 8.707   1.00 65.80  ?  72  HIS B N     1 
ATOM   2192 C  CA    . HIS B 1 55  ? 25.671  32.110 10.012  1.00 68.62  ?  72  HIS B CA    1 
ATOM   2193 C  C     . HIS B 1 55  ? 26.946  31.408 10.471  1.00 68.45  ?  72  HIS B C     1 
ATOM   2194 O  O     . HIS B 1 55  ? 27.095  30.198 10.301  1.00 65.49  ?  72  HIS B O     1 
ATOM   2195 C  CB    . HIS B 1 55  ? 24.571  31.920 11.058  1.00 68.63  ?  72  HIS B CB    1 
ATOM   2196 C  CG    . HIS B 1 55  ? 23.428  32.876 10.916  1.00 70.28  ?  72  HIS B CG    1 
ATOM   2197 N  ND1   . HIS B 1 55  ? 22.235  32.528 10.321  1.00 68.25  ?  72  HIS B ND1   1 
ATOM   2198 C  CD2   . HIS B 1 55  ? 23.296  34.170 11.295  1.00 74.18  ?  72  HIS B CD2   1 
ATOM   2199 C  CE1   . HIS B 1 55  ? 21.417  33.565 10.339  1.00 70.81  ?  72  HIS B CE1   1 
ATOM   2200 N  NE2   . HIS B 1 55  ? 22.037  34.574 10.924  1.00 74.39  ?  72  HIS B NE2   1 
ATOM   2201 N  N     . ASP B 1 56  ? 27.863  32.175 11.051  1.00 71.86  ?  73  ASP B N     1 
ATOM   2202 C  CA    . ASP B 1 56  ? 29.098  31.617 11.588  1.00 72.63  ?  73  ASP B CA    1 
ATOM   2203 C  C     . ASP B 1 56  ? 28.854  31.095 13.000  1.00 73.34  ?  73  ASP B C     1 
ATOM   2204 O  O     . ASP B 1 56  ? 28.404  31.835 13.875  1.00 76.17  ?  73  ASP B O     1 
ATOM   2205 C  CB    . ASP B 1 56  ? 30.214  32.664 11.594  1.00 76.76  ?  73  ASP B CB    1 
ATOM   2206 C  CG    . ASP B 1 56  ? 30.661  33.050 10.197  1.00 76.42  ?  73  ASP B CG    1 
ATOM   2207 O  OD1   . ASP B 1 56  ? 30.293  32.345 9.235   1.00 72.87  ?  73  ASP B OD1   1 
ATOM   2208 O  OD2   . ASP B 1 56  ? 31.384  34.060 10.062  1.00 80.05  -1 73  ASP B OD2   1 
ATOM   2209 N  N     . ILE B 1 57  ? 29.152  29.818 13.217  1.00 91.42  ?  74  ILE B N     1 
ATOM   2210 C  CA    . ILE B 1 57  ? 28.921  29.191 14.513  1.00 95.02  ?  74  ILE B CA    1 
ATOM   2211 C  C     . ILE B 1 57  ? 30.207  28.594 15.075  1.00 96.02  ?  74  ILE B C     1 
ATOM   2212 O  O     . ILE B 1 57  ? 30.979  27.966 14.351  1.00 93.71  ?  74  ILE B O     1 
ATOM   2213 C  CB    . ILE B 1 57  ? 27.848  28.082 14.416  1.00 94.91  ?  74  ILE B CB    1 
ATOM   2214 C  CG1   . ILE B 1 57  ? 26.585  28.612 13.734  1.00 93.48  ?  74  ILE B CG1   1 
ATOM   2215 C  CG2   . ILE B 1 57  ? 27.518  27.523 15.793  1.00 99.18  ?  74  ILE B CG2   1 
ATOM   2216 C  CD1   . ILE B 1 57  ? 25.897  29.721 14.497  1.00 96.60  ?  74  ILE B CD1   1 
ATOM   2217 N  N     . GLU B 1 58  ? 30.429  28.794 16.371  1.00 107.23 ?  75  GLU B N     1 
ATOM   2218 C  CA    . GLU B 1 58  ? 31.619  28.278 17.037  1.00 108.78 ?  75  GLU B CA    1 
ATOM   2219 C  C     . GLU B 1 58  ? 31.278  27.086 17.925  1.00 111.24 ?  75  GLU B C     1 
ATOM   2220 O  O     . GLU B 1 58  ? 30.445  27.189 18.825  1.00 113.93 ?  75  GLU B O     1 
ATOM   2221 C  CB    . GLU B 1 58  ? 32.287  29.377 17.866  1.00 110.64 ?  75  GLU B CB    1 
ATOM   2222 N  N     . LYS B 1 60  ? 30.398  24.372 19.369  1.00 107.13 ?  77  LYS B N     1 
ATOM   2223 C  CA    . LYS B 1 60  ? 31.090  24.405 20.651  1.00 110.63 ?  77  LYS B CA    1 
ATOM   2224 C  C     . LYS B 1 60  ? 32.535  23.938 20.515  1.00 110.69 ?  77  LYS B C     1 
ATOM   2225 O  O     . LYS B 1 60  ? 33.399  24.327 21.302  1.00 113.02 ?  77  LYS B O     1 
ATOM   2226 C  CB    . LYS B 1 60  ? 30.355  23.540 21.678  1.00 112.91 ?  77  LYS B CB    1 
ATOM   2227 N  N     . GLY B 1 61  ? 32.794  23.105 19.512  1.00 140.61 ?  78  GLY B N     1 
ATOM   2228 C  CA    . GLY B 1 61  ? 34.119  22.549 19.313  1.00 140.19 ?  78  GLY B CA    1 
ATOM   2229 C  C     . GLY B 1 61  ? 34.862  23.123 18.122  1.00 136.66 ?  78  GLY B C     1 
ATOM   2230 O  O     . GLY B 1 61  ? 36.048  23.437 18.217  1.00 136.70 ?  78  GLY B O     1 
ATOM   2231 N  N     . VAL B 1 62  ? 34.168  23.259 16.997  1.00 134.26 ?  79  VAL B N     1 
ATOM   2232 C  CA    . VAL B 1 62  ? 34.788  23.768 15.777  1.00 130.18 ?  79  VAL B CA    1 
ATOM   2233 C  C     . VAL B 1 62  ? 34.017  24.943 15.186  1.00 127.99 ?  79  VAL B C     1 
ATOM   2234 O  O     . VAL B 1 62  ? 32.787  24.975 15.235  1.00 128.30 ?  79  VAL B O     1 
ATOM   2235 C  CB    . VAL B 1 62  ? 34.904  22.665 14.708  1.00 127.06 ?  79  VAL B CB    1 
ATOM   2236 N  N     . ARG B 1 63  ? 34.742  25.910 14.630  1.00 75.46  ?  80  ARG B N     1 
ATOM   2237 C  CA    . ARG B 1 63  ? 34.102  27.064 14.013  1.00 74.95  ?  80  ARG B CA    1 
ATOM   2238 C  C     . ARG B 1 63  ? 33.670  26.675 12.600  1.00 70.57  ?  80  ARG B C     1 
ATOM   2239 O  O     . ARG B 1 63  ? 34.483  26.236 11.787  1.00 69.80  ?  80  ARG B O     1 
ATOM   2240 C  CB    . ARG B 1 63  ? 35.068  28.255 14.028  1.00 79.28  ?  80  ARG B CB    1 
ATOM   2241 C  CG    . ARG B 1 63  ? 34.572  29.549 13.407  1.00 79.75  ?  80  ARG B CG    1 
ATOM   2242 C  CD    . ARG B 1 63  ? 35.591  30.659 13.668  1.00 84.94  ?  80  ARG B CD    1 
ATOM   2243 N  NE    . ARG B 1 63  ? 36.782  30.566 12.827  1.00 85.62  ?  80  ARG B NE    1 
ATOM   2244 C  CZ    . ARG B 1 63  ? 36.924  31.171 11.652  1.00 85.18  ?  80  ARG B CZ    1 
ATOM   2245 N  NH1   . ARG B 1 63  ? 35.951  31.931 11.173  1.00 84.15  1  80  ARG B NH1   1 
ATOM   2246 N  NH2   . ARG B 1 63  ? 38.047  31.024 10.962  1.00 86.19  ?  80  ARG B NH2   1 
ATOM   2247 N  N     . MET B 1 64  ? 32.380  26.844 12.321  1.00 87.07  ?  81  MET B N     1 
ATOM   2248 C  CA    . MET B 1 64  ? 31.801  26.475 11.029  1.00 83.25  ?  81  MET B CA    1 
ATOM   2249 C  C     . MET B 1 64  ? 30.946  27.558 10.369  1.00 81.94  ?  81  MET B C     1 
ATOM   2250 O  O     . MET B 1 64  ? 30.234  28.300 11.046  1.00 84.05  ?  81  MET B O     1 
ATOM   2251 C  CB    . MET B 1 64  ? 30.974  25.198 11.174  1.00 83.53  ?  81  MET B CB    1 
ATOM   2252 C  CG    . MET B 1 64  ? 29.753  25.337 12.058  1.00 86.67  ?  81  MET B CG    1 
ATOM   2253 S  SD    . MET B 1 64  ? 28.630  23.954 11.819  1.00 86.42  ?  81  MET B SD    1 
ATOM   2254 C  CE    . MET B 1 64  ? 28.472  23.969 10.037  1.00 80.57  ?  81  MET B CE    1 
ATOM   2255 N  N     . LYS B 1 65  ? 31.028  27.647 9.045   1.00 62.80  ?  82  LYS B N     1 
ATOM   2256 C  CA    . LYS B 1 65  ? 30.212  28.588 8.285   1.00 62.85  ?  82  LYS B CA    1 
ATOM   2257 C  C     . LYS B 1 65  ? 28.956  27.887 7.760   1.00 59.44  ?  82  LYS B C     1 
ATOM   2258 O  O     . LYS B 1 65  ? 28.877  27.525 6.586   1.00 57.70  ?  82  LYS B O     1 
ATOM   2259 C  CB    . LYS B 1 65  ? 31.014  29.180 7.126   1.00 64.09  ?  82  LYS B CB    1 
ATOM   2260 C  CG    . LYS B 1 65  ? 30.399  30.421 6.505   1.00 65.69  ?  82  LYS B CG    1 
ATOM   2261 C  CD    . LYS B 1 65  ? 31.344  31.048 5.493   1.00 67.76  ?  82  LYS B CD    1 
ATOM   2262 C  CE    . LYS B 1 65  ? 30.880  32.436 5.089   1.00 70.52  ?  82  LYS B CE    1 
ATOM   2263 N  NZ    . LYS B 1 65  ? 30.970  33.398 6.222   1.00 73.87  1  82  LYS B NZ    1 
ATOM   2264 N  N     . LEU B 1 66  ? 27.981  27.700 8.646   1.00 66.25  ?  83  LEU B N     1 
ATOM   2265 C  CA    . LEU B 1 66  ? 26.754  26.963 8.336   1.00 64.15  ?  83  LEU B CA    1 
ATOM   2266 C  C     . LEU B 1 66  ? 25.784  27.710 7.423   1.00 63.56  ?  83  LEU B C     1 
ATOM   2267 O  O     . LEU B 1 66  ? 25.390  28.841 7.708   1.00 65.72  ?  83  LEU B O     1 
ATOM   2268 C  CB    . LEU B 1 66  ? 26.033  26.585 9.632   1.00 66.76  ?  83  LEU B CB    1 
ATOM   2269 C  CG    . LEU B 1 66  ? 24.771  25.732 9.481   1.00 65.77  ?  83  LEU B CG    1 
ATOM   2270 C  CD1   . LEU B 1 66  ? 25.051  24.489 8.649   1.00 62.73  ?  83  LEU B CD1   1 
ATOM   2271 C  CD2   . LEU B 1 66  ? 24.227  25.351 10.846  1.00 69.61  ?  83  LEU B CD2   1 
ATOM   2272 N  N     . THR B 1 67  ? 25.401  27.065 6.325   1.00 61.92  ?  84  THR B N     1 
ATOM   2273 C  CA    . THR B 1 67  ? 24.393  27.610 5.422   1.00 61.48  ?  84  THR B CA    1 
ATOM   2274 C  C     . THR B 1 67  ? 23.185  26.682 5.313   1.00 60.16  ?  84  THR B C     1 
ATOM   2275 O  O     . THR B 1 67  ? 23.323  25.509 4.967   1.00 58.59  ?  84  THR B O     1 
ATOM   2276 C  CB    . THR B 1 67  ? 24.964  27.850 4.013   1.00 60.77  ?  84  THR B CB    1 
ATOM   2277 O  OG1   . THR B 1 67  ? 26.034  28.801 4.082   1.00 62.87  ?  84  THR B OG1   1 
ATOM   2278 C  CG2   . THR B 1 67  ? 23.882  28.379 3.082   1.00 61.30  ?  84  THR B CG2   1 
ATOM   2279 N  N     . VAL B 1 68  ? 22.002  27.212 5.611   1.00 60.27  ?  85  VAL B N     1 
ATOM   2280 C  CA    . VAL B 1 68  ? 20.768  26.445 5.476   1.00 59.37  ?  85  VAL B CA    1 
ATOM   2281 C  C     . VAL B 1 68  ? 19.922  26.990 4.331   1.00 59.10  ?  85  VAL B C     1 
ATOM   2282 O  O     . VAL B 1 68  ? 19.583  28.173 4.305   1.00 60.60  ?  85  VAL B O     1 
ATOM   2283 C  CB    . VAL B 1 68  ? 19.939  26.459 6.773   1.00 61.33  ?  85  VAL B CB    1 
ATOM   2284 C  CG1   . VAL B 1 68  ? 18.693  25.605 6.611   1.00 60.49  ?  85  VAL B CG1   1 
ATOM   2285 C  CG2   . VAL B 1 68  ? 20.774  25.966 7.942   1.00 63.14  ?  85  VAL B CG2   1 
ATOM   2286 N  N     . ILE B 1 69  ? 19.583  26.118 3.386   1.00 55.74  ?  86  ILE B N     1 
ATOM   2287 C  CA    . ILE B 1 69  ? 18.832  26.525 2.205   1.00 56.64  ?  86  ILE B CA    1 
ATOM   2288 C  C     . ILE B 1 69  ? 17.357  26.155 2.317   1.00 56.70  ?  86  ILE B C     1 
ATOM   2289 O  O     . ILE B 1 69  ? 16.999  24.978 2.273   1.00 55.57  ?  86  ILE B O     1 
ATOM   2290 C  CB    . ILE B 1 69  ? 19.408  25.884 0.928   1.00 56.17  ?  86  ILE B CB    1 
ATOM   2291 C  CG1   . ILE B 1 69  ? 20.911  26.148 0.825   1.00 56.05  ?  86  ILE B CG1   1 
ATOM   2292 C  CG2   . ILE B 1 69  ? 18.677  26.397 -0.301  1.00 58.30  ?  86  ILE B CG2   1 
ATOM   2293 C  CD1   . ILE B 1 69  ? 21.720  24.921 0.466   1.00 54.51  ?  86  ILE B CD1   1 
ATOM   2294 N  N     . ASP B 1 70  ? 16.505  27.165 2.462   1.00 61.49  ?  87  ASP B N     1 
ATOM   2295 C  CA    . ASP B 1 70  ? 15.068  26.940 2.568   1.00 61.85  ?  87  ASP B CA    1 
ATOM   2296 C  C     . ASP B 1 70  ? 14.443  26.830 1.182   1.00 62.79  ?  87  ASP B C     1 
ATOM   2297 O  O     . ASP B 1 70  ? 14.821  27.556 0.263   1.00 64.02  ?  87  ASP B O     1 
ATOM   2298 C  CB    . ASP B 1 70  ? 14.400  28.064 3.361   1.00 63.02  ?  87  ASP B CB    1 
ATOM   2299 C  CG    . ASP B 1 70  ? 13.041  27.664 3.904   1.00 63.31  ?  87  ASP B CG    1 
ATOM   2300 O  OD1   . ASP B 1 70  ? 12.741  26.451 3.918   1.00 62.63  ?  87  ASP B OD1   1 
ATOM   2301 O  OD2   . ASP B 1 70  ? 12.275  28.560 4.319   1.00 64.58  -1 87  ASP B OD2   1 
ATOM   2302 N  N     . THR B 1 71  ? 13.484  25.922 1.036   1.00 56.15  ?  88  THR B N     1 
ATOM   2303 C  CA    . THR B 1 71  ? 12.832  25.701 -0.249  1.00 57.70  ?  88  THR B CA    1 
ATOM   2304 C  C     . THR B 1 71  ? 11.317  25.819 -0.129  1.00 59.90  ?  88  THR B C     1 
ATOM   2305 O  O     . THR B 1 71  ? 10.745  25.479 0.908   1.00 59.18  ?  88  THR B O     1 
ATOM   2306 C  CB    . THR B 1 71  ? 13.183  24.315 -0.828  1.00 55.50  ?  88  THR B CB    1 
ATOM   2307 O  OG1   . THR B 1 71  ? 12.744  23.292 0.076   1.00 53.59  ?  88  THR B OG1   1 
ATOM   2308 C  CG2   . THR B 1 71  ? 14.684  24.187 -1.044  1.00 53.74  ?  88  THR B CG2   1 
ATOM   2309 N  N     . PRO B 1 72  ? 10.659  26.306 -1.192  1.00 69.26  ?  89  PRO B N     1 
ATOM   2310 C  CA    . PRO B 1 72  ? 9.194   26.351 -1.216  1.00 70.43  ?  89  PRO B CA    1 
ATOM   2311 C  C     . PRO B 1 72  ? 8.595   24.949 -1.224  1.00 70.63  ?  89  PRO B C     1 
ATOM   2312 O  O     . PRO B 1 72  ? 9.096   24.074 -1.931  1.00 71.26  ?  89  PRO B O     1 
ATOM   2313 C  CB    . PRO B 1 72  ? 8.883   27.093 -2.520  1.00 74.09  ?  89  PRO B CB    1 
ATOM   2314 C  CG    . PRO B 1 72  ? 10.091  26.888 -3.371  1.00 73.74  ?  89  PRO B CG    1 
ATOM   2315 C  CD    . PRO B 1 72  ? 11.250  26.863 -2.421  1.00 71.15  ?  89  PRO B CD    1 
ATOM   2316 N  N     . GLY B 1 73  ? 7.540   24.744 -0.443  1.00 65.02  ?  90  GLY B N     1 
ATOM   2317 C  CA    . GLY B 1 73  ? 6.900   23.445 -0.353  1.00 64.20  ?  90  GLY B CA    1 
ATOM   2318 C  C     . GLY B 1 73  ? 6.287   22.999 -1.666  1.00 66.61  ?  90  GLY B C     1 
ATOM   2319 O  O     . GLY B 1 73  ? 5.863   23.822 -2.477  1.00 70.02  ?  90  GLY B O     1 
ATOM   2320 N  N     . PHE B 1 74  ? 6.244   21.687 -1.875  1.00 65.26  ?  91  PHE B N     1 
ATOM   2321 C  CA    . PHE B 1 74  ? 5.625   21.125 -3.069  1.00 67.88  ?  91  PHE B CA    1 
ATOM   2322 C  C     . PHE B 1 74  ? 4.423   20.256 -2.712  1.00 69.20  ?  91  PHE B C     1 
ATOM   2323 O  O     . PHE B 1 74  ? 4.031   20.172 -1.549  1.00 68.27  ?  91  PHE B O     1 
ATOM   2324 C  CB    . PHE B 1 74  ? 6.648   20.322 -3.879  1.00 66.01  ?  91  PHE B CB    1 
ATOM   2325 C  CG    . PHE B 1 74  ? 7.473   19.371 -3.056  1.00 61.83  ?  91  PHE B CG    1 
ATOM   2326 C  CD1   . PHE B 1 74  ? 7.000   18.107 -2.745  1.00 61.22  ?  91  PHE B CD1   1 
ATOM   2327 C  CD2   . PHE B 1 74  ? 8.733   19.737 -2.612  1.00 58.95  ?  91  PHE B CD2   1 
ATOM   2328 C  CE1   . PHE B 1 74  ? 7.763   17.232 -1.994  1.00 57.83  ?  91  PHE B CE1   1 
ATOM   2329 C  CE2   . PHE B 1 74  ? 9.501   18.867 -1.862  1.00 55.60  ?  91  PHE B CE2   1 
ATOM   2330 C  CZ    . PHE B 1 74  ? 9.016   17.613 -1.553  1.00 55.05  ?  91  PHE B CZ    1 
ATOM   2331 N  N     . GLY B 1 75  ? 3.840   19.614 -3.719  1.00 71.80  ?  92  GLY B N     1 
ATOM   2332 C  CA    . GLY B 1 75  ? 2.679   18.769 -3.506  1.00 73.72  ?  92  GLY B CA    1 
ATOM   2333 C  C     . GLY B 1 75  ? 1.406   19.580 -3.362  1.00 77.81  ?  92  GLY B C     1 
ATOM   2334 O  O     . GLY B 1 75  ? 0.365   19.056 -2.965  1.00 79.67  ?  92  GLY B O     1 
ATOM   2335 N  N     . ASP B 1 76  ? 1.493   20.866 -3.686  1.00 80.40  ?  93  ASP B N     1 
ATOM   2336 C  CA    . ASP B 1 76  ? 0.363   21.776 -3.537  1.00 84.57  ?  93  ASP B CA    1 
ATOM   2337 C  C     . ASP B 1 76  ? -0.450  21.947 -4.819  1.00 89.98  ?  93  ASP B C     1 
ATOM   2338 O  O     . ASP B 1 76  ? -1.604  22.374 -4.777  1.00 94.21  ?  93  ASP B O     1 
ATOM   2339 C  CB    . ASP B 1 76  ? 0.856   23.144 -3.057  1.00 84.00  ?  93  ASP B CB    1 
ATOM   2340 C  CG    . ASP B 1 76  ? 2.004   23.679 -3.892  1.00 83.07  ?  93  ASP B CG    1 
ATOM   2341 O  OD1   . ASP B 1 76  ? 2.281   23.111 -4.969  1.00 83.66  ?  93  ASP B OD1   1 
ATOM   2342 O  OD2   . ASP B 1 76  ? 2.629   24.675 -3.471  1.00 82.08  -1 93  ASP B OD2   1 
ATOM   2343 N  N     . HIS B 1 77  ? 0.155   21.621 -5.957  1.00 91.47  ?  94  HIS B N     1 
ATOM   2344 C  CA    . HIS B 1 77  ? -0.497  21.809 -7.250  1.00 97.03  ?  94  HIS B CA    1 
ATOM   2345 C  C     . HIS B 1 77  ? -1.084  20.513 -7.800  1.00 98.88  ?  94  HIS B C     1 
ATOM   2346 O  O     . HIS B 1 77  ? -1.043  19.470 -7.147  1.00 95.90  ?  94  HIS B O     1 
ATOM   2347 C  CB    . HIS B 1 77  ? 0.485   22.402 -8.261  1.00 97.35  ?  94  HIS B CB    1 
ATOM   2348 C  CG    . HIS B 1 77  ? 0.901   23.806 -7.947  1.00 97.24  ?  94  HIS B CG    1 
ATOM   2349 N  ND1   . HIS B 1 77  ? 1.939   24.102 -7.090  1.00 92.32  ?  94  HIS B ND1   1 
ATOM   2350 C  CD2   . HIS B 1 77  ? 0.416   24.996 -8.375  1.00 101.89 ?  94  HIS B CD2   1 
ATOM   2351 C  CE1   . HIS B 1 77  ? 2.076   25.413 -7.004  1.00 93.89  ?  94  HIS B CE1   1 
ATOM   2352 N  NE2   . HIS B 1 77  ? 1.164   25.979 -7.774  1.00 99.64  ?  94  HIS B NE2   1 
ATOM   2353 N  N     . ILE B 1 78  ? -1.631  20.592 -9.010  1.00 118.74 ?  95  ILE B N     1 
ATOM   2354 C  CA    . ILE B 1 78  ? -2.177  19.423 -9.689  1.00 121.22 ?  95  ILE B CA    1 
ATOM   2355 C  C     . ILE B 1 78  ? -1.052  18.667 -10.387 1.00 120.81 ?  95  ILE B C     1 
ATOM   2356 O  O     . ILE B 1 78  ? -1.099  17.445 -10.526 1.00 120.86 ?  95  ILE B O     1 
ATOM   2357 C  CB    . ILE B 1 78  ? -3.252  19.812 -10.724 1.00 127.52 ?  95  ILE B CB    1 
ATOM   2358 C  CG1   . ILE B 1 78  ? -4.140  20.937 -10.185 1.00 130.22 ?  95  ILE B CG1   1 
ATOM   2359 C  CG2   . ILE B 1 78  ? -4.081  18.597 -11.119 1.00 130.80 ?  95  ILE B CG2   1 
ATOM   2360 C  CD1   . ILE B 1 78  ? -5.010  20.529 -9.021  1.00 129.53 ?  95  ILE B CD1   1 
ATOM   2361 N  N     . ASN B 1 79  ? -0.038  19.411 -10.818 1.00 124.25 ?  96  ASN B N     1 
ATOM   2362 C  CA    . ASN B 1 79  ? 1.166   18.827 -11.396 1.00 123.98 ?  96  ASN B CA    1 
ATOM   2363 C  C     . ASN B 1 79  ? 2.397   19.295 -10.629 1.00 120.60 ?  96  ASN B C     1 
ATOM   2364 O  O     . ASN B 1 79  ? 2.591   20.494 -10.429 1.00 119.96 ?  96  ASN B O     1 
ATOM   2365 C  CB    . ASN B 1 79  ? 1.289   19.190 -12.876 1.00 127.46 ?  96  ASN B CB    1 
ATOM   2366 N  N     . ASN B 1 80  ? 3.227   18.349 -10.202 1.00 94.02  ?  97  ASN B N     1 
ATOM   2367 C  CA    . ASN B 1 80  ? 4.308   18.663 -9.276  1.00 90.68  ?  97  ASN B CA    1 
ATOM   2368 C  C     . ASN B 1 80  ? 5.705   18.475 -9.860  1.00 91.37  ?  97  ASN B C     1 
ATOM   2369 O  O     . ASN B 1 80  ? 6.700   18.557 -9.139  1.00 88.31  ?  97  ASN B O     1 
ATOM   2370 C  CB    . ASN B 1 80  ? 4.164   17.820 -8.009  1.00 87.38  ?  97  ASN B CB    1 
ATOM   2371 C  CG    . ASN B 1 80  ? 2.860   18.084 -7.285  1.00 86.76  ?  97  ASN B CG    1 
ATOM   2372 O  OD1   . ASN B 1 80  ? 2.699   19.114 -6.632  1.00 85.43  ?  97  ASN B OD1   1 
ATOM   2373 N  ND2   . ASN B 1 80  ? 1.918   17.154 -7.400  1.00 87.84  ?  97  ASN B ND2   1 
ATOM   2374 N  N     . GLU B 1 81  ? 5.779   18.217 -11.161 1.00 98.12  ?  98  GLU B N     1 
ATOM   2375 C  CA    . GLU B 1 81  ? 7.064   18.178 -11.847 1.00 95.22  ?  98  GLU B CA    1 
ATOM   2376 C  C     . GLU B 1 81  ? 7.664   19.579 -11.869 1.00 92.53  ?  98  GLU B C     1 
ATOM   2377 O  O     . GLU B 1 81  ? 8.880   19.751 -11.786 1.00 89.61  ?  98  GLU B O     1 
ATOM   2378 C  CB    . GLU B 1 81  ? 6.911   17.635 -13.269 1.00 96.75  ?  98  GLU B CB    1 
ATOM   2379 N  N     . ASN B 1 82  ? 6.791   20.577 -11.979 1.00 128.22 ?  99  ASN B N     1 
ATOM   2380 C  CA    . ASN B 1 82  ? 7.198   21.977 -11.971 1.00 126.45 ?  99  ASN B CA    1 
ATOM   2381 C  C     . ASN B 1 82  ? 7.610   22.463 -10.583 1.00 124.23 ?  99  ASN B C     1 
ATOM   2382 O  O     . ASN B 1 82  ? 8.038   23.605 -10.419 1.00 122.09 ?  99  ASN B O     1 
ATOM   2383 C  CB    . ASN B 1 82  ? 6.070   22.857 -12.512 1.00 129.22 ?  99  ASN B CB    1 
ATOM   2384 N  N     . CYS B 1 83  ? 7.471   21.594 -9.588  1.00 134.64 ?  100 CYS B N     1 
ATOM   2385 C  CA    . CYS B 1 83  ? 7.891   21.913 -8.229  1.00 132.70 ?  100 CYS B CA    1 
ATOM   2386 C  C     . CYS B 1 83  ? 9.193   21.198 -7.892  1.00 129.81 ?  100 CYS B C     1 
ATOM   2387 O  O     . CYS B 1 83  ? 9.995   21.684 -7.094  1.00 127.03 ?  100 CYS B O     1 
ATOM   2388 C  CB    . CYS B 1 83  ? 6.802   21.531 -7.226  1.00 135.60 ?  100 CYS B CB    1 
ATOM   2389 S  SG    . CYS B 1 83  ? 5.281   22.502 -7.355  1.00 139.07 ?  100 CYS B SG    1 
ATOM   2390 N  N     . TRP B 1 84  ? 9.394   20.038 -8.509  1.00 79.38  ?  101 TRP B N     1 
ATOM   2391 C  CA    . TRP B 1 84  ? 10.599  19.247 -8.294  1.00 77.59  ?  101 TRP B CA    1 
ATOM   2392 C  C     . TRP B 1 84  ? 11.762  19.766 -9.132  1.00 75.16  ?  101 TRP B C     1 
ATOM   2393 O  O     . TRP B 1 84  ? 12.905  19.363 -8.936  1.00 73.51  ?  101 TRP B O     1 
ATOM   2394 C  CB    . TRP B 1 84  ? 10.338  17.775 -8.620  1.00 80.09  ?  101 TRP B CB    1 
ATOM   2395 N  N     . GLN B 1 85  ? 11.464  20.669 -10.060 1.00 79.21  ?  102 GLN B N     1 
ATOM   2396 C  CA    . GLN B 1 85  ? 12.476  21.194 -10.974 1.00 77.61  ?  102 GLN B CA    1 
ATOM   2397 C  C     . GLN B 1 85  ? 13.335  22.326 -10.385 1.00 74.84  ?  102 GLN B C     1 
ATOM   2398 O  O     . GLN B 1 85  ? 14.554  22.310 -10.559 1.00 73.79  ?  102 GLN B O     1 
ATOM   2399 C  CB    . GLN B 1 85  ? 11.814  21.671 -12.273 1.00 79.45  ?  102 GLN B CB    1 
ATOM   2400 N  N     . PRO B 1 86  ? 12.719  23.316 -9.703  1.00 75.12  ?  103 PRO B N     1 
ATOM   2401 C  CA    . PRO B 1 86  ? 13.574  24.387 -9.170  1.00 72.58  ?  103 PRO B CA    1 
ATOM   2402 C  C     . PRO B 1 86  ? 14.582  23.906 -8.126  1.00 70.67  ?  103 PRO B C     1 
ATOM   2403 O  O     . PRO B 1 86  ? 15.644  24.511 -7.981  1.00 69.36  ?  103 PRO B O     1 
ATOM   2404 C  CB    . PRO B 1 86  ? 12.569  25.355 -8.535  1.00 73.39  ?  103 PRO B CB    1 
ATOM   2405 C  CG    . PRO B 1 86  ? 11.294  25.095 -9.243  1.00 76.62  ?  103 PRO B CG    1 
ATOM   2406 C  CD    . PRO B 1 86  ? 11.290  23.623 -9.504  1.00 77.49  ?  103 PRO B CD    1 
ATOM   2407 N  N     . ILE B 1 87  ? 14.253  22.834 -7.412  1.00 66.78  ?  104 ILE B N     1 
ATOM   2408 C  CA    . ILE B 1 87  ? 15.141  22.306 -6.382  1.00 65.15  ?  104 ILE B CA    1 
ATOM   2409 C  C     . ILE B 1 87  ? 16.301  21.526 -7.000  1.00 64.76  ?  104 ILE B C     1 
ATOM   2410 O  O     . ILE B 1 87  ? 17.447  21.653 -6.565  1.00 62.90  ?  104 ILE B O     1 
ATOM   2411 C  CB    . ILE B 1 87  ? 14.374  21.399 -5.397  1.00 66.76  ?  104 ILE B CB    1 
ATOM   2412 C  CG1   . ILE B 1 87  ? 13.330  22.215 -4.631  1.00 67.30  ?  104 ILE B CG1   1 
ATOM   2413 C  CG2   . ILE B 1 87  ? 15.332  20.706 -4.437  1.00 65.62  ?  104 ILE B CG2   1 
ATOM   2414 C  CD1   . ILE B 1 87  ? 12.636  21.445 -3.530  1.00 69.07  ?  104 ILE B CD1   1 
ATOM   2415 N  N     . MET B 1 88  ? 16.002  20.732 -8.024  1.00 73.88  ?  105 MET B N     1 
ATOM   2416 C  CA    . MET B 1 88  ? 17.034  20.004 -8.755  1.00 74.29  ?  105 MET B CA    1 
ATOM   2417 C  C     . MET B 1 88  ? 17.972  20.967 -9.472  1.00 73.17  ?  105 MET B C     1 
ATOM   2418 O  O     . MET B 1 88  ? 19.160  20.688 -9.634  1.00 73.66  ?  105 MET B O     1 
ATOM   2419 C  CB    . MET B 1 88  ? 16.410  19.033 -9.759  1.00 75.57  ?  105 MET B CB    1 
ATOM   2420 C  CG    . MET B 1 88  ? 15.635  17.887 -9.127  1.00 77.91  ?  105 MET B CG    1 
ATOM   2421 S  SD    . MET B 1 88  ? 16.658  16.811 -8.105  1.00 80.37  ?  105 MET B SD    1 
ATOM   2422 C  CE    . MET B 1 88  ? 17.894  16.299 -9.295  1.00 79.85  ?  105 MET B CE    1 
ATOM   2423 N  N     . LYS B 1 89  ? 17.429  22.101 -9.902  1.00 65.34  ?  106 LYS B N     1 
ATOM   2424 C  CA    . LYS B 1 89  ? 18.215  23.108 -10.602 1.00 64.49  ?  106 LYS B CA    1 
ATOM   2425 C  C     . LYS B 1 89  ? 19.193  23.808 -9.665  1.00 62.08  ?  106 LYS B C     1 
ATOM   2426 O  O     . LYS B 1 89  ? 20.342  24.046 -10.029 1.00 61.50  ?  106 LYS B O     1 
ATOM   2427 C  CB    . LYS B 1 89  ? 17.297  24.137 -11.264 1.00 65.48  ?  106 LYS B CB    1 
ATOM   2428 N  N     . PHE B 1 90  ? 18.735  24.129 -8.458  1.00 60.92  ?  107 PHE B N     1 
ATOM   2429 C  CA    . PHE B 1 90  ? 19.586  24.787 -7.471  1.00 58.60  ?  107 PHE B CA    1 
ATOM   2430 C  C     . PHE B 1 90  ? 20.765  23.905 -7.081  1.00 57.98  ?  107 PHE B C     1 
ATOM   2431 O  O     . PHE B 1 90  ? 21.896  24.376 -6.989  1.00 56.76  ?  107 PHE B O     1 
ATOM   2432 C  CB    . PHE B 1 90  ? 18.778  25.161 -6.225  1.00 57.83  ?  107 PHE B CB    1 
ATOM   2433 C  CG    . PHE B 1 90  ? 19.568  25.918 -5.192  1.00 55.43  ?  107 PHE B CG    1 
ATOM   2434 C  CD1   . PHE B 1 90  ? 19.661  27.299 -5.245  1.00 54.53  ?  107 PHE B CD1   1 
ATOM   2435 C  CD2   . PHE B 1 90  ? 20.214  25.250 -4.165  1.00 54.34  ?  107 PHE B CD2   1 
ATOM   2436 C  CE1   . PHE B 1 90  ? 20.385  27.997 -4.295  1.00 52.39  ?  107 PHE B CE1   1 
ATOM   2437 C  CE2   . PHE B 1 90  ? 20.937  25.941 -3.212  1.00 52.18  ?  107 PHE B CE2   1 
ATOM   2438 C  CZ    . PHE B 1 90  ? 21.024  27.316 -3.278  1.00 51.10  ?  107 PHE B CZ    1 
ATOM   2439 N  N     . ILE B 1 91  ? 20.489  22.625 -6.852  1.00 59.23  ?  108 ILE B N     1 
ATOM   2440 C  CA    . ILE B 1 91  ? 21.520  21.659 -6.488  1.00 59.39  ?  108 ILE B CA    1 
ATOM   2441 C  C     . ILE B 1 91  ? 22.585  21.551 -7.575  1.00 60.12  ?  108 ILE B C     1 
ATOM   2442 O  O     . ILE B 1 91  ? 23.782  21.640 -7.298  1.00 59.42  ?  108 ILE B O     1 
ATOM   2443 C  CB    . ILE B 1 91  ? 20.918  20.265 -6.221  1.00 61.40  ?  108 ILE B CB    1 
ATOM   2444 C  CG1   . ILE B 1 91  ? 20.087  20.283 -4.938  1.00 61.01  ?  108 ILE B CG1   1 
ATOM   2445 C  CG2   . ILE B 1 91  ? 22.014  19.215 -6.126  1.00 62.40  ?  108 ILE B CG2   1 
ATOM   2446 C  CD1   . ILE B 1 91  ? 19.263  19.033 -4.728  1.00 63.54  ?  108 ILE B CD1   1 
ATOM   2447 N  N     . ASN B 1 92  ? 22.140  21.365 -8.814  1.00 64.71  ?  109 ASN B N     1 
ATOM   2448 C  CA    . ASN B 1 92  ? 23.050  21.215 -9.944  1.00 65.78  ?  109 ASN B CA    1 
ATOM   2449 C  C     . ASN B 1 92  ? 23.816  22.497 -10.258 1.00 65.79  ?  109 ASN B C     1 
ATOM   2450 O  O     . ASN B 1 92  ? 24.936  22.446 -10.768 1.00 67.17  ?  109 ASN B O     1 
ATOM   2451 C  CB    . ASN B 1 92  ? 22.281  20.752 -11.183 1.00 67.71  ?  109 ASN B CB    1 
ATOM   2452 C  CG    . ASN B 1 92  ? 21.774  19.329 -11.055 1.00 69.43  ?  109 ASN B CG    1 
ATOM   2453 O  OD1   . ASN B 1 92  ? 22.495  18.439 -10.604 1.00 70.09  ?  109 ASN B OD1   1 
ATOM   2454 N  ND2   . ASN B 1 92  ? 20.527  19.106 -11.454 1.00 70.54  ?  109 ASN B ND2   1 
ATOM   2455 N  N     . ASP B 1 93  ? 23.212  23.644 -9.958  1.00 78.77  ?  110 ASP B N     1 
ATOM   2456 C  CA    . ASP B 1 93  ? 23.872  24.928 -10.176 1.00 78.41  ?  110 ASP B CA    1 
ATOM   2457 C  C     . ASP B 1 93  ? 25.066  25.096 -9.243  1.00 77.46  ?  110 ASP B C     1 
ATOM   2458 O  O     . ASP B 1 93  ? 26.079  25.687 -9.618  1.00 77.61  ?  110 ASP B O     1 
ATOM   2459 C  CB    . ASP B 1 93  ? 22.890  26.086 -9.981  1.00 76.50  ?  110 ASP B CB    1 
ATOM   2460 C  CG    . ASP B 1 93  ? 21.966  26.275 -11.168 1.00 79.36  ?  110 ASP B CG    1 
ATOM   2461 O  OD1   . ASP B 1 93  ? 22.264  25.722 -12.248 1.00 82.87  ?  110 ASP B OD1   1 
ATOM   2462 O  OD2   . ASP B 1 93  ? 20.942  26.975 -11.021 1.00 78.92  -1 110 ASP B OD2   1 
ATOM   2463 N  N     . GLN B 1 94  ? 24.942  24.574 -8.028  1.00 76.22  ?  111 GLN B N     1 
ATOM   2464 C  CA    . GLN B 1 94  ? 26.045  24.600 -7.075  1.00 76.92  ?  111 GLN B CA    1 
ATOM   2465 C  C     . GLN B 1 94  ? 27.145  23.639 -7.509  1.00 78.63  ?  111 GLN B C     1 
ATOM   2466 O  O     . GLN B 1 94  ? 28.332  23.928 -7.354  1.00 79.35  ?  111 GLN B O     1 
ATOM   2467 C  CB    . GLN B 1 94  ? 25.555  24.257 -5.669  1.00 77.71  ?  111 GLN B CB    1 
ATOM   2468 C  CG    . GLN B 1 94  ? 24.372  25.091 -5.208  1.00 74.93  ?  111 GLN B CG    1 
ATOM   2469 C  CD    . GLN B 1 94  ? 24.524  26.564 -5.542  1.00 69.74  ?  111 GLN B CD    1 
ATOM   2470 O  OE1   . GLN B 1 94  ? 25.553  27.176 -5.256  1.00 68.74  ?  111 GLN B OE1   1 
ATOM   2471 N  NE2   . GLN B 1 94  ? 23.497  27.139 -6.157  1.00 66.59  ?  111 GLN B NE2   1 
ATOM   2472 N  N     . TYR B 1 95  ? 26.743  22.494 -8.051  1.00 67.93  ?  112 TYR B N     1 
ATOM   2473 C  CA    . TYR B 1 95  ? 27.692  21.545 -8.622  1.00 69.59  ?  112 TYR B CA    1 
ATOM   2474 C  C     . TYR B 1 95  ? 28.351  22.145 -9.859  1.00 70.49  ?  112 TYR B C     1 
ATOM   2475 O  O     . TYR B 1 95  ? 29.476  21.789 -10.210 1.00 72.17  ?  112 TYR B O     1 
ATOM   2476 C  CB    . TYR B 1 95  ? 27.001  20.227 -8.978  1.00 70.53  ?  112 TYR B CB    1 
ATOM   2477 C  CG    . TYR B 1 95  ? 26.686  19.347 -7.788  1.00 70.66  ?  112 TYR B CG    1 
ATOM   2478 C  CD1   . TYR B 1 95  ? 27.350  19.513 -6.581  1.00 70.60  ?  112 TYR B CD1   1 
ATOM   2479 C  CD2   . TYR B 1 95  ? 25.725  18.347 -7.876  1.00 71.13  ?  112 TYR B CD2   1 
ATOM   2480 C  CE1   . TYR B 1 95  ? 27.065  18.710 -5.492  1.00 70.95  ?  112 TYR B CE1   1 
ATOM   2481 C  CE2   . TYR B 1 95  ? 25.434  17.539 -6.793  1.00 71.81  ?  112 TYR B CE2   1 
ATOM   2482 C  CZ    . TYR B 1 95  ? 26.106  17.725 -5.604  1.00 71.66  ?  112 TYR B CZ    1 
ATOM   2483 O  OH    . TYR B 1 95  ? 25.819  16.923 -4.523  1.00 72.61  ?  112 TYR B OH    1 
ATOM   2484 N  N     . GLU B 1 96  ? 27.640  23.058 -10.514 1.00 62.58  ?  113 GLU B N     1 
ATOM   2485 C  CA    . GLU B 1 96  ? 28.152  23.731 -11.702 1.00 64.10  ?  113 GLU B CA    1 
ATOM   2486 C  C     . GLU B 1 96  ? 29.109  24.858 -11.330 1.00 63.17  ?  113 GLU B C     1 
ATOM   2487 O  O     . GLU B 1 96  ? 30.146  25.039 -11.969 1.00 65.00  ?  113 GLU B O     1 
ATOM   2488 C  CB    . GLU B 1 96  ? 26.999  24.282 -12.545 1.00 64.43  ?  113 GLU B CB    1 
ATOM   2489 N  N     . LYS B 1 97  ? 28.751  25.616 -10.299 1.00 67.76  ?  114 LYS B N     1 
ATOM   2490 C  CA    . LYS B 1 97  ? 29.587  26.713 -9.824  1.00 66.67  ?  114 LYS B CA    1 
ATOM   2491 C  C     . LYS B 1 97  ? 30.914  26.196 -9.281  1.00 67.63  ?  114 LYS B C     1 
ATOM   2492 O  O     . LYS B 1 97  ? 31.942  26.863 -9.386  1.00 68.07  ?  114 LYS B O     1 
ATOM   2493 C  CB    . LYS B 1 97  ? 28.857  27.520 -8.748  1.00 64.05  ?  114 LYS B CB    1 
ATOM   2494 N  N     . TYR B 1 98  ? 30.882  25.001 -8.700  1.00 58.36  ?  115 TYR B N     1 
ATOM   2495 C  CA    . TYR B 1 98  ? 32.081  24.389 -8.142  1.00 58.33  ?  115 TYR B CA    1 
ATOM   2496 C  C     . TYR B 1 98  ? 32.942  23.774 -9.240  1.00 60.71  ?  115 TYR B C     1 
ATOM   2497 O  O     . TYR B 1 98  ? 34.167  23.732 -9.129  1.00 61.88  ?  115 TYR B O     1 
ATOM   2498 C  CB    . TYR B 1 98  ? 31.710  23.328 -7.104  1.00 56.61  ?  115 TYR B CB    1 
ATOM   2499 C  CG    . TYR B 1 98  ? 32.811  23.033 -6.110  1.00 56.68  ?  115 TYR B CG    1 
ATOM   2500 C  CD1   . TYR B 1 98  ? 33.852  22.170 -6.430  1.00 58.71  ?  115 TYR B CD1   1 
ATOM   2501 C  CD2   . TYR B 1 98  ? 32.812  23.622 -4.853  1.00 55.34  ?  115 TYR B CD2   1 
ATOM   2502 C  CE1   . TYR B 1 98  ? 34.860  21.899 -5.524  1.00 59.56  ?  115 TYR B CE1   1 
ATOM   2503 C  CE2   . TYR B 1 98  ? 33.816  23.358 -3.940  1.00 56.09  ?  115 TYR B CE2   1 
ATOM   2504 C  CZ    . TYR B 1 98  ? 34.838  22.496 -4.282  1.00 58.28  ?  115 TYR B CZ    1 
ATOM   2505 O  OH    . TYR B 1 98  ? 35.840  22.230 -3.378  1.00 59.76  ?  115 TYR B OH    1 
ATOM   2506 N  N     . LEU B 1 99  ? 32.298  23.312 -10.306 1.00 58.81  ?  116 LEU B N     1 
ATOM   2507 C  CA    . LEU B 1 99  ? 33.012  22.668 -11.399 1.00 61.46  ?  116 LEU B CA    1 
ATOM   2508 C  C     . LEU B 1 99  ? 33.703  23.717 -12.264 1.00 63.26  ?  116 LEU B C     1 
ATOM   2509 O  O     . LEU B 1 99  ? 34.746  23.451 -12.861 1.00 65.36  ?  116 LEU B O     1 
ATOM   2510 C  CB    . LEU B 1 99  ? 32.057  21.819 -12.243 1.00 62.70  ?  116 LEU B CB    1 
ATOM   2511 C  CG    . LEU B 1 99  ? 32.673  20.985 -13.370 1.00 65.95  ?  116 LEU B CG    1 
ATOM   2512 C  CD1   . LEU B 1 99  ? 33.558  19.884 -12.803 1.00 66.56  ?  116 LEU B CD1   1 
ATOM   2513 C  CD2   . LEU B 1 99  ? 31.589  20.403 -14.266 1.00 67.74  ?  116 LEU B CD2   1 
ATOM   2514 N  N     . GLN B 1 100 ? 33.118  24.910 -12.326 1.00 67.29  ?  117 GLN B N     1 
ATOM   2515 C  CA    . GLN B 1 100 ? 33.697  25.999 -13.104 1.00 69.31  ?  117 GLN B CA    1 
ATOM   2516 C  C     . GLN B 1 100 ? 34.889  26.635 -12.384 1.00 69.19  ?  117 GLN B C     1 
ATOM   2517 O  O     . GLN B 1 100 ? 35.687  27.338 -13.001 1.00 71.25  ?  117 GLN B O     1 
ATOM   2518 C  CB    . GLN B 1 100 ? 32.638  27.059 -13.410 1.00 69.76  ?  117 GLN B CB    1 
ATOM   2519 N  N     . GLU B 1 101 ? 35.008  26.381 -11.082 1.00 80.63  ?  118 GLU B N     1 
ATOM   2520 C  CA    . GLU B 1 101 ? 36.165  26.842 -10.312 1.00 80.52  ?  118 GLU B CA    1 
ATOM   2521 C  C     . GLU B 1 101 ? 37.238  25.766 -10.210 1.00 77.59  ?  118 GLU B C     1 
ATOM   2522 O  O     . GLU B 1 101 ? 38.397  26.070 -9.931  1.00 77.83  ?  118 GLU B O     1 
ATOM   2523 C  CB    . GLU B 1 101 ? 35.776  27.312 -8.905  1.00 83.24  ?  118 GLU B CB    1 
ATOM   2524 C  CG    . GLU B 1 101 ? 35.270  28.753 -8.767  1.00 84.20  ?  118 GLU B CG    1 
ATOM   2525 C  CD    . GLU B 1 101 ? 34.042  29.081 -9.581  1.00 82.24  ?  118 GLU B CD    1 
ATOM   2526 O  OE1   . GLU B 1 101 ? 33.033  29.497 -8.974  1.00 81.39  ?  118 GLU B OE1   1 
ATOM   2527 O  OE2   . GLU B 1 101 ? 34.091  28.958 -10.822 1.00 81.59  -1 118 GLU B OE2   1 
ATOM   2528 N  N     . GLU B 1 102 ? 36.860  24.512 -10.436 1.00 105.60 ?  119 GLU B N     1 
ATOM   2529 C  CA    . GLU B 1 102 ? 37.842  23.436 -10.451 1.00 106.64 ?  119 GLU B CA    1 
ATOM   2530 C  C     . GLU B 1 102 ? 38.488  23.493 -11.826 1.00 109.34 ?  119 GLU B C     1 
ATOM   2531 O  O     . GLU B 1 102 ? 39.677  23.214 -11.987 1.00 112.08 ?  119 GLU B O     1 
ATOM   2532 C  CB    . GLU B 1 102 ? 37.207  22.083 -10.156 1.00 106.29 ?  119 GLU B CB    1 
ATOM   2533 C  CG    . GLU B 1 102 ? 37.273  21.728 -8.678  1.00 104.98 ?  119 GLU B CG    1 
ATOM   2534 C  CD    . GLU B 1 102 ? 36.891  20.294 -8.395  1.00 105.44 ?  119 GLU B CD    1 
ATOM   2535 O  OE1   . GLU B 1 102 ? 36.412  19.611 -9.324  1.00 106.44 ?  119 GLU B OE1   1 
ATOM   2536 O  OE2   . GLU B 1 102 ? 37.071  19.848 -7.242  1.00 105.10 -1 119 GLU B OE2   1 
ATOM   2537 N  N     . VAL B 1 103 ? 37.681  23.864 -12.816 1.00 90.08  ?  120 VAL B N     1 
ATOM   2538 C  CA    . VAL B 1 103 ? 38.211  24.234 -14.116 1.00 91.74  ?  120 VAL B CA    1 
ATOM   2539 C  C     . VAL B 1 103 ? 38.733  25.632 -13.832 1.00 91.62  ?  120 VAL B C     1 
ATOM   2540 O  O     . VAL B 1 103 ? 38.363  26.212 -12.813 1.00 91.13  ?  120 VAL B O     1 
ATOM   2541 C  CB    . VAL B 1 103 ? 37.157  24.223 -15.234 1.00 92.88  ?  120 VAL B CB    1 
ATOM   2542 N  N     . ASN B 1 104 ? 39.566  26.181 -14.709 1.00 119.15 ?  121 ASN B N     1 
ATOM   2543 C  CA    . ASN B 1 104 ? 40.265  27.430 -14.410 1.00 119.42 ?  121 ASN B CA    1 
ATOM   2544 C  C     . ASN B 1 104 ? 41.137  27.182 -13.181 1.00 119.03 ?  121 ASN B C     1 
ATOM   2545 O  O     . ASN B 1 104 ? 40.833  27.628 -12.074 1.00 118.41 ?  121 ASN B O     1 
ATOM   2546 C  CB    . ASN B 1 104 ? 39.270  28.581 -14.172 1.00 119.12 ?  121 ASN B CB    1 
ATOM   2547 C  CG    . ASN B 1 104 ? 39.947  29.909 -13.871 1.00 119.95 ?  121 ASN B CG    1 
ATOM   2548 O  OD1   . ASN B 1 104 ? 41.171  30.024 -13.893 1.00 121.47 ?  121 ASN B OD1   1 
ATOM   2549 N  ND2   . ASN B 1 104 ? 39.139  30.917 -13.556 1.00 120.98 ?  121 ASN B ND2   1 
ATOM   2550 N  N     . ILE B 1 105 ? 42.221  26.445 -13.403 1.00 114.30 ?  122 ILE B N     1 
ATOM   2551 C  CA    . ILE B 1 105 ? 43.153  26.037 -12.354 1.00 115.31 ?  122 ILE B CA    1 
ATOM   2552 C  C     . ILE B 1 105 ? 44.029  27.198 -11.895 1.00 117.08 ?  122 ILE B C     1 
ATOM   2553 O  O     . ILE B 1 105 ? 44.728  27.107 -10.886 1.00 117.90 ?  122 ILE B O     1 
ATOM   2554 C  CB    . ILE B 1 105 ? 44.053  24.877 -12.820 1.00 117.98 ?  122 ILE B CB    1 
ATOM   2555 N  N     . ASN B 1 106 ? 43.980  28.289 -12.653 1.00 147.45 ?  123 ASN B N     1 
ATOM   2556 C  CA    . ASN B 1 106 ? 44.847  29.444 -12.443 1.00 149.86 ?  123 ASN B CA    1 
ATOM   2557 C  C     . ASN B 1 106 ? 44.396  30.441 -11.376 1.00 148.65 ?  123 ASN B C     1 
ATOM   2558 O  O     . ASN B 1 106 ? 45.180  31.294 -10.963 1.00 151.11 ?  123 ASN B O     1 
ATOM   2559 C  CB    . ASN B 1 106 ? 45.029  30.188 -13.766 1.00 145.66 ?  123 ASN B CB    1 
ATOM   2560 N  N     . ARG B 1 107 ? 43.146  30.340 -10.931 1.00 101.81 ?  124 ARG B N     1 
ATOM   2561 C  CA    . ARG B 1 107 ? 42.604  31.287 -9.955  1.00 101.61 ?  124 ARG B CA    1 
ATOM   2562 C  C     . ARG B 1 107 ? 43.389  31.165 -8.654  1.00 102.36 ?  124 ARG B C     1 
ATOM   2563 O  O     . ARG B 1 107 ? 43.415  30.102 -8.038  1.00 100.97 ?  124 ARG B O     1 
ATOM   2564 C  CB    . ARG B 1 107 ? 41.116  31.028 -9.712  1.00 102.26 ?  124 ARG B CB    1 
ATOM   2565 N  N     . LYS B 1 108 ? 44.017  32.259 -8.228  1.00 138.42 ?  125 LYS B N     1 
ATOM   2566 C  CA    . LYS B 1 108 ? 44.889  32.221 -7.055  1.00 140.10 ?  125 LYS B CA    1 
ATOM   2567 C  C     . LYS B 1 108 ? 44.146  32.030 -5.738  1.00 138.61 ?  125 LYS B C     1 
ATOM   2568 O  O     . LYS B 1 108 ? 44.771  31.909 -4.687  1.00 140.08 ?  125 LYS B O     1 
ATOM   2569 C  CB    . LYS B 1 108 ? 45.730  33.499 -6.979  1.00 143.86 ?  125 LYS B CB    1 
ATOM   2570 N  N     . LYS B 1 109 ? 42.819  32.050 -5.771  1.00 82.61  ?  126 LYS B N     1 
ATOM   2571 C  CA    . LYS B 1 109 ? 42.076  31.905 -4.530  1.00 80.53  ?  126 LYS B CA    1 
ATOM   2572 C  C     . LYS B 1 109 ? 41.382  30.549 -4.488  1.00 77.14  ?  126 LYS B C     1 
ATOM   2573 O  O     . LYS B 1 109 ? 41.016  29.987 -5.522  1.00 75.79  ?  126 LYS B O     1 
ATOM   2574 C  CB    . LYS B 1 109 ? 41.063  33.037 -4.376  1.00 79.74  ?  126 LYS B CB    1 
ATOM   2575 N  N     . ARG B 1 110 ? 41.172  30.049 -3.279  1.00 82.23  ?  127 ARG B N     1 
ATOM   2576 C  CA    . ARG B 1 110 ? 40.494  28.779 -3.081  1.00 81.39  ?  127 ARG B CA    1 
ATOM   2577 C  C     . ARG B 1 110 ? 38.993  28.869 -3.346  1.00 80.98  ?  127 ARG B C     1 
ATOM   2578 O  O     . ARG B 1 110 ? 38.384  29.937 -3.237  1.00 81.31  ?  127 ARG B O     1 
ATOM   2579 C  CB    . ARG B 1 110 ? 40.798  28.234 -1.688  1.00 83.48  ?  127 ARG B CB    1 
ATOM   2580 C  CG    . ARG B 1 110 ? 40.135  28.912 -0.521  1.00 85.93  ?  127 ARG B CG    1 
ATOM   2581 C  CD    . ARG B 1 110 ? 40.434  28.067 0.701   1.00 88.16  ?  127 ARG B CD    1 
ATOM   2582 N  NE    . ARG B 1 110 ? 40.381  26.650 0.352   1.00 86.49  ?  127 ARG B NE    1 
ATOM   2583 C  CZ    . ARG B 1 110 ? 40.335  25.657 1.231   1.00 85.29  ?  127 ARG B CZ    1 
ATOM   2584 N  NH1   . ARG B 1 110 ? 40.351  25.917 2.531   1.00 86.31  1  127 ARG B NH1   1 
ATOM   2585 N  NH2   . ARG B 1 110 ? 40.282  24.402 0.809   1.00 82.68  ?  127 ARG B NH2   1 
ATOM   2586 N  N     . ILE B 1 111 ? 38.413  27.730 -3.704  1.00 62.60  ?  128 ILE B N     1 
ATOM   2587 C  CA    . ILE B 1 111 ? 37.011  27.645 -4.081  1.00 59.78  ?  128 ILE B CA    1 
ATOM   2588 C  C     . ILE B 1 111 ? 36.065  27.570 -2.892  1.00 57.51  ?  128 ILE B C     1 
ATOM   2589 O  O     . ILE B 1 111 ? 36.221  26.717 -2.018  1.00 57.07  ?  128 ILE B O     1 
ATOM   2590 C  CB    . ILE B 1 111 ? 36.767  26.399 -4.951  1.00 59.09  ?  128 ILE B CB    1 
ATOM   2591 C  CG1   . ILE B 1 111 ? 37.837  26.292 -6.041  1.00 61.73  ?  128 ILE B CG1   1 
ATOM   2592 C  CG2   . ILE B 1 111 ? 35.360  26.411 -5.527  1.00 57.05  ?  128 ILE B CG2   1 
ATOM   2593 C  CD1   . ILE B 1 111 ? 37.715  25.051 -6.890  1.00 61.89  ?  128 ILE B CD1   1 
ATOM   2594 N  N     . PRO B 1 112 ? 35.073  28.472 -2.863  1.00 63.56  ?  129 PRO B N     1 
ATOM   2595 C  CA    . PRO B 1 112 ? 34.011  28.481 -1.852  1.00 63.06  ?  129 PRO B CA    1 
ATOM   2596 C  C     . PRO B 1 112 ? 32.994  27.375 -2.121  1.00 61.01  ?  129 PRO B C     1 
ATOM   2597 O  O     . PRO B 1 112 ? 32.472  27.284 -3.233  1.00 59.44  ?  129 PRO B O     1 
ATOM   2598 C  CB    . PRO B 1 112 ? 33.380  29.867 -2.010  1.00 61.29  ?  129 PRO B CB    1 
ATOM   2599 C  CG    . PRO B 1 112 ? 33.676  30.265 -3.411  1.00 61.15  ?  129 PRO B CG    1 
ATOM   2600 C  CD    . PRO B 1 112 ? 34.976  29.618 -3.785  1.00 63.10  ?  129 PRO B CD    1 
ATOM   2601 N  N     . ASP B 1 113 ? 32.719  26.549 -1.118  1.00 74.45  ?  130 ASP B N     1 
ATOM   2602 C  CA    . ASP B 1 113 ? 31.852  25.389 -1.299  1.00 71.10  ?  130 ASP B CA    1 
ATOM   2603 C  C     . ASP B 1 113 ? 30.388  25.752 -1.061  1.00 68.53  ?  130 ASP B C     1 
ATOM   2604 O  O     . ASP B 1 113 ? 29.956  25.918 0.080   1.00 67.78  ?  130 ASP B O     1 
ATOM   2605 C  CB    . ASP B 1 113 ? 32.276  24.258 -0.358  1.00 70.22  ?  130 ASP B CB    1 
ATOM   2606 C  CG    . ASP B 1 113 ? 31.804  22.895 -0.829  1.00 65.23  ?  130 ASP B CG    1 
ATOM   2607 O  OD1   . ASP B 1 113 ? 30.957  22.837 -1.746  1.00 63.60  ?  130 ASP B OD1   1 
ATOM   2608 O  OD2   . ASP B 1 113 ? 32.282  21.880 -0.280  1.00 62.75  -1 130 ASP B OD2   1 
ATOM   2609 N  N     . THR B 1 114 ? 29.630  25.871 -2.147  1.00 57.78  ?  131 THR B N     1 
ATOM   2610 C  CA    . THR B 1 114 ? 28.213  26.208 -2.063  1.00 53.83  ?  131 THR B CA    1 
ATOM   2611 C  C     . THR B 1 114 ? 27.338  25.006 -2.404  1.00 49.86  ?  131 THR B C     1 
ATOM   2612 O  O     . THR B 1 114 ? 26.112  25.113 -2.454  1.00 49.39  ?  131 THR B O     1 
ATOM   2613 C  CB    . THR B 1 114 ? 27.851  27.372 -3.003  1.00 52.74  ?  131 THR B CB    1 
ATOM   2614 O  OG1   . THR B 1 114 ? 28.125  26.998 -4.359  1.00 55.93  ?  131 THR B OG1   1 
ATOM   2615 C  CG2   . THR B 1 114 ? 28.653  28.616 -2.652  1.00 54.05  ?  131 THR B CG2   1 
ATOM   2616 N  N     . ARG B 1 115 ? 27.977  23.865 -2.639  1.00 49.03  ?  132 ARG B N     1 
ATOM   2617 C  CA    . ARG B 1 115 ? 27.269  22.631 -2.960  1.00 47.46  ?  132 ARG B CA    1 
ATOM   2618 C  C     . ARG B 1 115 ? 26.434  22.152 -1.780  1.00 45.65  ?  132 ARG B C     1 
ATOM   2619 O  O     . ARG B 1 115 ? 26.854  22.264 -0.629  1.00 44.78  ?  132 ARG B O     1 
ATOM   2620 C  CB    . ARG B 1 115 ? 28.256  21.537 -3.370  1.00 48.76  ?  132 ARG B CB    1 
ATOM   2621 C  CG    . ARG B 1 115 ? 29.126  21.890 -4.562  1.00 50.77  ?  132 ARG B CG    1 
ATOM   2622 C  CD    . ARG B 1 115 ? 30.216  20.850 -4.764  1.00 52.43  ?  132 ARG B CD    1 
ATOM   2623 N  NE    . ARG B 1 115 ? 31.039  20.689 -3.569  1.00 52.19  ?  132 ARG B NE    1 
ATOM   2624 C  CZ    . ARG B 1 115 ? 32.118  19.917 -3.502  1.00 54.17  ?  132 ARG B CZ    1 
ATOM   2625 N  NH1   . ARG B 1 115 ? 32.512  19.230 -4.565  1.00 56.37  1  132 ARG B NH1   1 
ATOM   2626 N  NH2   . ARG B 1 115 ? 32.805  19.832 -2.371  1.00 54.47  ?  132 ARG B NH2   1 
ATOM   2627 N  N     . VAL B 1 116 ? 25.253  21.613 -2.067  1.00 43.00  ?  133 VAL B N     1 
ATOM   2628 C  CA    . VAL B 1 116 ? 24.424  21.039 -1.018  1.00 41.51  ?  133 VAL B CA    1 
ATOM   2629 C  C     . VAL B 1 116 ? 25.035  19.716 -0.578  1.00 41.71  ?  133 VAL B C     1 
ATOM   2630 O  O     . VAL B 1 116 ? 25.005  18.731 -1.317  1.00 43.13  ?  133 VAL B O     1 
ATOM   2631 C  CB    . VAL B 1 116 ? 22.974  20.815 -1.487  1.00 41.84  ?  133 VAL B CB    1 
ATOM   2632 C  CG1   . VAL B 1 116 ? 22.146  20.196 -0.372  1.00 40.42  ?  133 VAL B CG1   1 
ATOM   2633 C  CG2   . VAL B 1 116 ? 22.357  22.125 -1.952  1.00 42.51  ?  133 VAL B CG2   1 
ATOM   2634 N  N     . HIS B 1 117 ? 25.598  19.702 0.625   1.00 41.96  ?  134 HIS B N     1 
ATOM   2635 C  CA    . HIS B 1 117 ? 26.230  18.502 1.159   1.00 42.80  ?  134 HIS B CA    1 
ATOM   2636 C  C     . HIS B 1 117 ? 25.183  17.548 1.716   1.00 42.20  ?  134 HIS B C     1 
ATOM   2637 O  O     . HIS B 1 117 ? 25.202  16.350 1.435   1.00 43.73  ?  134 HIS B O     1 
ATOM   2638 C  CB    . HIS B 1 117 ? 27.243  18.873 2.243   1.00 42.89  ?  134 HIS B CB    1 
ATOM   2639 C  CG    . HIS B 1 117 ? 28.269  19.866 1.792   1.00 43.78  ?  134 HIS B CG    1 
ATOM   2640 N  ND1   . HIS B 1 117 ? 28.622  20.963 2.548   1.00 43.44  ?  134 HIS B ND1   1 
ATOM   2641 C  CD2   . HIS B 1 117 ? 29.014  19.929 0.664   1.00 45.35  ?  134 HIS B CD2   1 
ATOM   2642 C  CE1   . HIS B 1 117 ? 29.540  21.661 1.903   1.00 49.47  ?  134 HIS B CE1   1 
ATOM   2643 N  NE2   . HIS B 1 117 ? 29.798  21.054 0.759   1.00 49.59  ?  134 HIS B NE2   1 
ATOM   2644 N  N     . CYS B 1 118 ? 24.263  18.096 2.502   1.00 57.72  ?  135 CYS B N     1 
ATOM   2645 C  CA    . CYS B 1 118 ? 23.242  17.300 3.166   1.00 56.73  ?  135 CYS B CA    1 
ATOM   2646 C  C     . CYS B 1 118 ? 21.870  17.907 2.911   1.00 56.24  ?  135 CYS B C     1 
ATOM   2647 O  O     . CYS B 1 118 ? 21.725  19.127 2.851   1.00 56.29  ?  135 CYS B O     1 
ATOM   2648 C  CB    . CYS B 1 118 ? 23.515  17.211 4.668   1.00 55.96  ?  135 CYS B CB    1 
ATOM   2649 S  SG    . CYS B 1 118 ? 22.294  16.251 5.591   1.00 54.97  ?  135 CYS B SG    1 
ATOM   2650 N  N     . CYS B 1 119 ? 20.865  17.055 2.753   1.00 59.83  ?  136 CYS B N     1 
ATOM   2651 C  CA    . CYS B 1 119 ? 19.519  17.533 2.477   1.00 59.42  ?  136 CYS B CA    1 
ATOM   2652 C  C     . CYS B 1 119 ? 18.478  16.802 3.318   1.00 58.42  ?  136 CYS B C     1 
ATOM   2653 O  O     . CYS B 1 119 ? 18.214  15.619 3.106   1.00 58.62  ?  136 CYS B O     1 
ATOM   2654 C  CB    . CYS B 1 119 ? 19.196  17.383 0.991   1.00 60.55  ?  136 CYS B CB    1 
ATOM   2655 S  SG    . CYS B 1 119 ? 17.497  17.805 0.559   1.00 60.52  ?  136 CYS B SG    1 
ATOM   2656 N  N     . LEU B 1 120 ? 17.890  17.516 4.273   1.00 45.70  ?  137 LEU B N     1 
ATOM   2657 C  CA    . LEU B 1 120 ? 16.813  16.967 5.087   1.00 45.05  ?  137 LEU B CA    1 
ATOM   2658 C  C     . LEU B 1 120 ? 15.526  16.877 4.276   1.00 45.30  ?  137 LEU B C     1 
ATOM   2659 O  O     . LEU B 1 120 ? 15.115  17.849 3.644   1.00 45.63  ?  137 LEU B O     1 
ATOM   2660 C  CB    . LEU B 1 120 ? 16.587  17.822 6.336   1.00 44.44  ?  137 LEU B CB    1 
ATOM   2661 C  CG    . LEU B 1 120 ? 17.764  17.970 7.303   1.00 44.35  ?  137 LEU B CG    1 
ATOM   2662 C  CD1   . LEU B 1 120 ? 17.339  18.726 8.551   1.00 44.01  ?  137 LEU B CD1   1 
ATOM   2663 C  CD2   . LEU B 1 120 ? 18.325  16.611 7.669   1.00 44.39  ?  137 LEU B CD2   1 
ATOM   2664 N  N     . TYR B 1 121 ? 14.894  15.708 4.294   1.00 45.33  ?  138 TYR B N     1 
ATOM   2665 C  CA    . TYR B 1 121 ? 13.626  15.522 3.600   1.00 45.72  ?  138 TYR B CA    1 
ATOM   2666 C  C     . TYR B 1 121 ? 12.485  15.368 4.599   1.00 45.15  ?  138 TYR B C     1 
ATOM   2667 O  O     . TYR B 1 121 ? 12.497  14.466 5.436   1.00 44.87  ?  138 TYR B O     1 
ATOM   2668 C  CB    . TYR B 1 121 ? 13.686  14.303 2.674   1.00 46.61  ?  138 TYR B CB    1 
ATOM   2669 C  CG    . TYR B 1 121 ? 12.575  14.268 1.648   1.00 47.44  ?  138 TYR B CG    1 
ATOM   2670 C  CD1   . TYR B 1 121 ? 11.308  13.802 1.979   1.00 47.37  ?  138 TYR B CD1   1 
ATOM   2671 C  CD2   . TYR B 1 121 ? 12.794  14.700 0.346   1.00 48.49  ?  138 TYR B CD2   1 
ATOM   2672 C  CE1   . TYR B 1 121 ? 10.292  13.773 1.045   1.00 48.30  ?  138 TYR B CE1   1 
ATOM   2673 C  CE2   . TYR B 1 121 ? 11.783  14.674 -0.594  1.00 49.48  ?  138 TYR B CE2   1 
ATOM   2674 C  CZ    . TYR B 1 121 ? 10.535  14.209 -0.239  1.00 49.36  ?  138 TYR B CZ    1 
ATOM   2675 O  OH    . TYR B 1 121 ? 9.526   14.181 -1.172  1.00 50.52  ?  138 TYR B OH    1 
ATOM   2676 N  N     . PHE B 1 122 ? 11.501  16.256 4.504   1.00 50.42  ?  139 PHE B N     1 
ATOM   2677 C  CA    . PHE B 1 122 ? 10.385  16.267 5.441   1.00 50.05  ?  139 PHE B CA    1 
ATOM   2678 C  C     . PHE B 1 122 ? 9.244   15.369 4.976   1.00 50.58  ?  139 PHE B C     1 
ATOM   2679 O  O     . PHE B 1 122 ? 8.649   15.594 3.922   1.00 51.30  ?  139 PHE B O     1 
ATOM   2680 C  CB    . PHE B 1 122 ? 9.876   17.695 5.646   1.00 50.01  ?  139 PHE B CB    1 
ATOM   2681 C  CG    . PHE B 1 122 ? 10.747  18.526 6.543   1.00 49.56  ?  139 PHE B CG    1 
ATOM   2682 C  CD1   . PHE B 1 122 ? 11.987  18.970 6.113   1.00 49.66  ?  139 PHE B CD1   1 
ATOM   2683 C  CD2   . PHE B 1 122 ? 10.325  18.864 7.818   1.00 49.26  ?  139 PHE B CD2   1 
ATOM   2684 C  CE1   . PHE B 1 122 ? 12.789  19.733 6.939   1.00 49.44  ?  139 PHE B CE1   1 
ATOM   2685 C  CE2   . PHE B 1 122 ? 11.122  19.627 8.648   1.00 49.10  ?  139 PHE B CE2   1 
ATOM   2686 C  CZ    . PHE B 1 122 ? 12.355  20.063 8.207   1.00 49.18  ?  139 PHE B CZ    1 
ATOM   2687 N  N     . ILE B 1 123 ? 8.948   14.349 5.775   1.00 51.21  ?  140 ILE B N     1 
ATOM   2688 C  CA    . ILE B 1 123 ? 7.863   13.420 5.483   1.00 51.84  ?  140 ILE B CA    1 
ATOM   2689 C  C     . ILE B 1 123 ? 6.624   13.749 6.308   1.00 51.74  ?  140 ILE B C     1 
ATOM   2690 O  O     . ILE B 1 123 ? 6.692   13.812 7.535   1.00 51.25  ?  140 ILE B O     1 
ATOM   2691 C  CB    . ILE B 1 123 ? 8.279   11.963 5.757   1.00 52.10  ?  140 ILE B CB    1 
ATOM   2692 C  CG1   . ILE B 1 123 ? 9.464   11.572 4.871   1.00 52.48  ?  140 ILE B CG1   1 
ATOM   2693 C  CG2   . ILE B 1 123 ? 7.109   11.019 5.529   1.00 52.94  ?  140 ILE B CG2   1 
ATOM   2694 C  CD1   . ILE B 1 123 ? 9.981   10.175 5.129   1.00 52.94  ?  140 ILE B CD1   1 
ATOM   2695 N  N     . PRO B 1 124 ? 5.484   13.966 5.633   1.00 46.35  ?  141 PRO B N     1 
ATOM   2696 C  CA    . PRO B 1 124 ? 4.227   14.261 6.329   1.00 46.50  ?  141 PRO B CA    1 
ATOM   2697 C  C     . PRO B 1 124 ? 3.741   13.077 7.161   1.00 46.69  ?  141 PRO B C     1 
ATOM   2698 O  O     . PRO B 1 124 ? 3.726   11.945 6.677   1.00 47.27  ?  141 PRO B O     1 
ATOM   2699 C  CB    . PRO B 1 124 ? 3.255   14.563 5.184   1.00 47.45  ?  141 PRO B CB    1 
ATOM   2700 C  CG    . PRO B 1 124 ? 3.826   13.846 4.006   1.00 48.01  ?  141 PRO B CG    1 
ATOM   2701 C  CD    . PRO B 1 124 ? 5.314   13.935 4.170   1.00 47.24  ?  141 PRO B CD    1 
ATOM   2702 N  N     . ALA B 1 125 ? 3.347   13.344 8.402   1.00 46.44  ?  142 ALA B N     1 
ATOM   2703 C  CA    . ALA B 1 125 ? 2.925   12.290 9.319   1.00 46.78  ?  142 ALA B CA    1 
ATOM   2704 C  C     . ALA B 1 125 ? 1.539   11.759 8.968   1.00 47.79  ?  142 ALA B C     1 
ATOM   2705 O  O     . ALA B 1 125 ? 0.574   11.988 9.697   1.00 48.16  ?  142 ALA B O     1 
ATOM   2706 C  CB    . ALA B 1 125 ? 2.948   12.799 10.752  1.00 46.46  ?  142 ALA B CB    1 
ATOM   2707 N  N     . THR B 1 126 ? 1.447   11.048 7.849   1.00 48.42  ?  143 THR B N     1 
ATOM   2708 C  CA    . THR B 1 126 ? 0.180   10.468 7.415   1.00 49.61  ?  143 THR B CA    1 
ATOM   2709 C  C     . THR B 1 126 ? -0.160  9.211  8.209   1.00 50.24  ?  143 THR B C     1 
ATOM   2710 O  O     . THR B 1 126 ? -1.325  8.834  8.320   1.00 51.23  ?  143 THR B O     1 
ATOM   2711 C  CB    . THR B 1 126 ? 0.201   10.123 5.914   1.00 50.40  ?  143 THR B CB    1 
ATOM   2712 O  OG1   . THR B 1 126 ? 1.160   9.086  5.672   1.00 50.50  ?  143 THR B OG1   1 
ATOM   2713 C  CG2   . THR B 1 126 ? 0.564   11.348 5.090   1.00 50.02  ?  143 THR B CG2   1 
ATOM   2714 N  N     . GLY B 1 127 ? 0.864   8.564  8.758   1.00 49.83  ?  144 GLY B N     1 
ATOM   2715 C  CA    . GLY B 1 127 ? 0.676   7.346  9.524   1.00 50.70  ?  144 GLY B CA    1 
ATOM   2716 C  C     . GLY B 1 127 ? 0.497   6.119  8.650   1.00 51.84  ?  144 GLY B C     1 
ATOM   2717 O  O     . GLY B 1 127 ? 0.140   5.046  9.136   1.00 52.88  ?  144 GLY B O     1 
ATOM   2718 N  N     . HIS B 1 128 ? 0.747   6.278  7.354   1.00 52.25  ?  145 HIS B N     1 
ATOM   2719 C  CA    . HIS B 1 128 ? 0.644   5.171  6.411   1.00 53.66  ?  145 HIS B CA    1 
ATOM   2720 C  C     . HIS B 1 128 ? 1.887   5.091  5.535   1.00 53.46  ?  145 HIS B C     1 
ATOM   2721 O  O     . HIS B 1 128 ? 2.878   5.776  5.788   1.00 52.20  ?  145 HIS B O     1 
ATOM   2722 C  CB    . HIS B 1 128 ? -0.604  5.316  5.538   1.00 54.78  ?  145 HIS B CB    1 
ATOM   2723 C  CG    . HIS B 1 128 ? -1.885  5.329  6.312   1.00 55.27  ?  145 HIS B CG    1 
ATOM   2724 N  ND1   . HIS B 1 128 ? -2.258  4.301  7.150   1.00 56.12  ?  145 HIS B ND1   1 
ATOM   2725 C  CD2   . HIS B 1 128 ? -2.882  6.244  6.370   1.00 55.24  ?  145 HIS B CD2   1 
ATOM   2726 C  CE1   . HIS B 1 128 ? -3.428  4.583  7.695   1.00 56.56  ?  145 HIS B CE1   1 
ATOM   2727 N  NE2   . HIS B 1 128 ? -3.828  5.756  7.238   1.00 56.03  ?  145 HIS B NE2   1 
ATOM   2728 N  N     . SER B 1 129 ? 1.830   4.246  4.510   1.00 68.50  ?  146 SER B N     1 
ATOM   2729 C  CA    . SER B 1 129 ? 2.945   4.085  3.584   1.00 68.92  ?  146 SER B CA    1 
ATOM   2730 C  C     . SER B 1 129 ? 3.267   5.396  2.874   1.00 68.04  ?  146 SER B C     1 
ATOM   2731 O  O     . SER B 1 129 ? 2.412   6.276  2.763   1.00 67.70  ?  146 SER B O     1 
ATOM   2732 C  CB    . SER B 1 129 ? 2.633   2.996  2.555   1.00 71.27  ?  146 SER B CB    1 
ATOM   2733 O  OG    . SER B 1 129 ? 1.501   3.338  1.776   1.00 72.44  ?  146 SER B OG    1 
ATOM   2734 N  N     . LEU B 1 130 ? 4.501   5.518  2.397   1.00 54.83  ?  147 LEU B N     1 
ATOM   2735 C  CA    . LEU B 1 130 ? 4.926   6.709  1.671   1.00 54.25  ?  147 LEU B CA    1 
ATOM   2736 C  C     . LEU B 1 130 ? 4.114   6.914  0.400   1.00 55.62  ?  147 LEU B C     1 
ATOM   2737 O  O     . LEU B 1 130 ? 3.806   5.963  -0.317  1.00 57.31  ?  147 LEU B O     1 
ATOM   2738 C  CB    . LEU B 1 130 ? 6.415   6.627  1.329   1.00 54.09  ?  147 LEU B CB    1 
ATOM   2739 C  CG    . LEU B 1 130 ? 7.381   6.987  2.457   1.00 52.53  ?  147 LEU B CG    1 
ATOM   2740 C  CD1   . LEU B 1 130 ? 8.820   6.761  2.029   1.00 52.73  ?  147 LEU B CD1   1 
ATOM   2741 C  CD2   . LEU B 1 130 ? 7.169   8.433  2.874   1.00 51.19  ?  147 LEU B CD2   1 
ATOM   2742 N  N     . ARG B 1 131 ? 3.770   8.169  0.132   1.00 53.96  ?  148 ARG B N     1 
ATOM   2743 C  CA    . ARG B 1 131 ? 3.023   8.521  -1.064  1.00 55.36  ?  148 ARG B CA    1 
ATOM   2744 C  C     . ARG B 1 131 ? 3.951   8.540  -2.273  1.00 56.32  ?  148 ARG B C     1 
ATOM   2745 O  O     . ARG B 1 131 ? 5.133   8.858  -2.140  1.00 55.43  ?  148 ARG B O     1 
ATOM   2746 C  CB    . ARG B 1 131 ? 2.344   9.882  -0.888  1.00 54.66  ?  148 ARG B CB    1 
ATOM   2747 N  N     . PRO B 1 132 ? 3.419   8.185  -3.456  1.00 58.35  ?  149 PRO B N     1 
ATOM   2748 C  CA    . PRO B 1 132 ? 4.167   8.172  -4.719  1.00 59.77  ?  149 PRO B CA    1 
ATOM   2749 C  C     . PRO B 1 132 ? 4.964   9.452  -4.976  1.00 58.92  ?  149 PRO B C     1 
ATOM   2750 O  O     . PRO B 1 132 ? 6.004   9.398  -5.634  1.00 59.54  ?  149 PRO B O     1 
ATOM   2751 C  CB    . PRO B 1 132 ? 3.067   8.000  -5.766  1.00 62.00  ?  149 PRO B CB    1 
ATOM   2752 C  CG    . PRO B 1 132 ? 2.026   7.209  -5.064  1.00 62.10  ?  149 PRO B CG    1 
ATOM   2753 C  CD    . PRO B 1 132 ? 2.044   7.683  -3.633  1.00 59.68  ?  149 PRO B CD    1 
ATOM   2754 N  N     . LEU B 1 133 ? 4.480   10.582 -4.469  1.00 57.72  ?  150 LEU B N     1 
ATOM   2755 C  CA    . LEU B 1 133 ? 5.166   11.857 -4.646  1.00 57.04  ?  150 LEU B CA    1 
ATOM   2756 C  C     . LEU B 1 133 ? 6.514   11.874 -3.932  1.00 55.54  ?  150 LEU B C     1 
ATOM   2757 O  O     . LEU B 1 133 ? 7.548   12.127 -4.550  1.00 55.95  ?  150 LEU B O     1 
ATOM   2758 C  CB    . LEU B 1 133 ? 4.296   13.007 -4.135  1.00 56.24  ?  150 LEU B CB    1 
ATOM   2759 C  CG    . LEU B 1 133 ? 4.914   14.405 -4.184  1.00 55.61  ?  150 LEU B CG    1 
ATOM   2760 C  CD1   . LEU B 1 133 ? 5.197   14.816 -5.621  1.00 57.45  ?  150 LEU B CD1   1 
ATOM   2761 C  CD2   . LEU B 1 133 ? 4.005   15.410 -3.500  1.00 54.89  ?  150 LEU B CD2   1 
ATOM   2762 N  N     . ASP B 1 134 ? 6.495   11.608 -2.630  1.00 53.97  ?  151 ASP B N     1 
ATOM   2763 C  CA    . ASP B 1 134 ? 7.714   11.619 -1.827  1.00 52.62  ?  151 ASP B CA    1 
ATOM   2764 C  C     . ASP B 1 134 ? 8.676   10.510 -2.238  1.00 53.43  ?  151 ASP B C     1 
ATOM   2765 O  O     . ASP B 1 134 ? 9.893   10.684 -2.179  1.00 53.03  ?  151 ASP B O     1 
ATOM   2766 C  CB    . ASP B 1 134 ? 7.383   11.504 -0.338  1.00 51.12  ?  151 ASP B CB    1 
ATOM   2767 C  CG    . ASP B 1 134 ? 6.694   12.743 0.202   1.00 50.28  ?  151 ASP B CG    1 
ATOM   2768 O  OD1   . ASP B 1 134 ? 6.960   13.846 -0.321  1.00 50.36  ?  151 ASP B OD1   1 
ATOM   2769 O  OD2   . ASP B 1 134 ? 5.893   12.616 1.152   1.00 49.71  -1 151 ASP B OD2   1 
ATOM   2770 N  N     . ILE B 1 135 ? 8.128   9.370  -2.648  1.00 54.75  ?  152 ILE B N     1 
ATOM   2771 C  CA    . ILE B 1 135 ? 8.944   8.254  -3.112  1.00 55.93  ?  152 ILE B CA    1 
ATOM   2772 C  C     . ILE B 1 135 ? 9.773   8.659  -4.326  1.00 57.13  ?  152 ILE B C     1 
ATOM   2773 O  O     . ILE B 1 135 ? 10.990  8.477  -4.348  1.00 57.13  ?  152 ILE B O     1 
ATOM   2774 C  CB    . ILE B 1 135 ? 8.080   7.030  -3.475  1.00 57.56  ?  152 ILE B CB    1 
ATOM   2775 C  CG1   . ILE B 1 135 ? 7.405   6.460  -2.226  1.00 56.61  ?  152 ILE B CG1   1 
ATOM   2776 C  CG2   . ILE B 1 135 ? 8.926   5.963  -4.150  1.00 59.23  ?  152 ILE B CG2   1 
ATOM   2777 C  CD1   . ILE B 1 135 ? 6.403   5.365  -2.520  1.00 58.27  ?  152 ILE B CD1   1 
ATOM   2778 N  N     . GLU B 1 136 ? 9.103   9.213  -5.331  1.00 70.63  ?  153 GLU B N     1 
ATOM   2779 C  CA    . GLU B 1 136 ? 9.764   9.641  -6.558  1.00 72.94  ?  153 GLU B CA    1 
ATOM   2780 C  C     . GLU B 1 136 ? 10.713  10.812 -6.324  1.00 71.50  ?  153 GLU B C     1 
ATOM   2781 O  O     . GLU B 1 136 ? 11.766  10.898 -6.954  1.00 72.53  ?  153 GLU B O     1 
ATOM   2782 C  CB    . GLU B 1 136 ? 8.725   10.012 -7.618  1.00 75.84  ?  153 GLU B CB    1 
ATOM   2783 C  CG    . GLU B 1 136 ? 8.057   8.808  -8.260  1.00 78.58  ?  153 GLU B CG    1 
ATOM   2784 C  CD    . GLU B 1 136 ? 9.061   7.833  -8.844  1.00 80.15  ?  153 GLU B CD    1 
ATOM   2785 O  OE1   . GLU B 1 136 ? 9.991   8.283  -9.548  1.00 81.28  ?  153 GLU B OE1   1 
ATOM   2786 O  OE2   . GLU B 1 136 ? 8.925   6.616  -8.595  1.00 80.57  -1 153 GLU B OE2   1 
ATOM   2787 N  N     . PHE B 1 137 ? 10.336  11.710 -5.420  1.00 56.80  ?  154 PHE B N     1 
ATOM   2788 C  CA    . PHE B 1 137 ? 11.150  12.884 -5.129  1.00 55.75  ?  154 PHE B CA    1 
ATOM   2789 C  C     . PHE B 1 137 ? 12.451  12.467 -4.455  1.00 54.87  ?  154 PHE B C     1 
ATOM   2790 O  O     . PHE B 1 137 ? 13.532  12.925 -4.828  1.00 55.19  ?  154 PHE B O     1 
ATOM   2791 C  CB    . PHE B 1 137 ? 10.386  13.867 -4.240  1.00 54.25  ?  154 PHE B CB    1 
ATOM   2792 C  CG    . PHE B 1 137 ? 10.731  15.310 -4.489  1.00 54.17  ?  154 PHE B CG    1 
ATOM   2793 C  CD1   . PHE B 1 137 ? 12.020  15.776 -4.285  1.00 53.67  ?  154 PHE B CD1   1 
ATOM   2794 C  CD2   . PHE B 1 137 ? 9.760   16.204 -4.908  1.00 54.77  ?  154 PHE B CD2   1 
ATOM   2795 C  CE1   . PHE B 1 137 ? 12.337  17.103 -4.510  1.00 53.81  ?  154 PHE B CE1   1 
ATOM   2796 C  CE2   . PHE B 1 137 ? 10.070  17.533 -5.131  1.00 54.92  ?  154 PHE B CE2   1 
ATOM   2797 C  CZ    . PHE B 1 137 ? 11.361  17.983 -4.932  1.00 54.45  ?  154 PHE B CZ    1 
ATOM   2798 N  N     . MET B 1 138 ? 12.336  11.595 -3.459  1.00 72.77  ?  155 MET B N     1 
ATOM   2799 C  CA    . MET B 1 138 ? 13.499  11.091 -2.741  1.00 71.96  ?  155 MET B CA    1 
ATOM   2800 C  C     . MET B 1 138 ? 14.357  10.215 -3.645  1.00 73.64  ?  155 MET B C     1 
ATOM   2801 O  O     . MET B 1 138 ? 15.574  10.142 -3.477  1.00 73.68  ?  155 MET B O     1 
ATOM   2802 C  CB    . MET B 1 138 ? 13.069  10.309 -1.500  1.00 70.86  ?  155 MET B CB    1 
ATOM   2803 C  CG    . MET B 1 138 ? 12.520  11.180 -0.385  1.00 69.19  ?  155 MET B CG    1 
ATOM   2804 S  SD    . MET B 1 138 ? 12.132  10.236 1.098   1.00 68.41  ?  155 MET B SD    1 
ATOM   2805 C  CE    . MET B 1 138 ? 13.778  9.754  1.609   1.00 68.43  ?  155 MET B CE    1 
ATOM   2806 N  N     . LYS B 1 139 ? 13.716  9.549  -4.601  1.00 61.27  ?  156 LYS B N     1 
ATOM   2807 C  CA    . LYS B 1 139 ? 14.429  8.705  -5.551  1.00 63.29  ?  156 LYS B CA    1 
ATOM   2808 C  C     . LYS B 1 139 ? 15.320  9.558  -6.447  1.00 64.16  ?  156 LYS B C     1 
ATOM   2809 O  O     . LYS B 1 139 ? 16.429  9.157  -6.802  1.00 65.16  ?  156 LYS B O     1 
ATOM   2810 C  CB    . LYS B 1 139 ? 13.449  7.891  -6.398  1.00 65.17  ?  156 LYS B CB    1 
ATOM   2811 N  N     . ARG B 1 140 ? 14.823  10.736 -6.812  1.00 65.55  ?  157 ARG B N     1 
ATOM   2812 C  CA    . ARG B 1 140 ? 15.601  11.686 -7.598  1.00 66.41  ?  157 ARG B CA    1 
ATOM   2813 C  C     . ARG B 1 140 ? 16.726  12.297 -6.767  1.00 64.91  ?  157 ARG B C     1 
ATOM   2814 O  O     . ARG B 1 140 ? 17.867  12.388 -7.218  1.00 65.83  ?  157 ARG B O     1 
ATOM   2815 C  CB    . ARG B 1 140 ? 14.706  12.800 -8.147  1.00 66.73  ?  157 ARG B CB    1 
ATOM   2816 C  CG    . ARG B 1 140 ? 13.649  12.347 -9.141  1.00 68.65  ?  157 ARG B CG    1 
ATOM   2817 C  CD    . ARG B 1 140 ? 13.268  13.490 -10.070 1.00 69.89  ?  157 ARG B CD    1 
ATOM   2818 N  NE    . ARG B 1 140 ? 11.944  13.316 -10.661 1.00 71.15  ?  157 ARG B NE    1 
ATOM   2819 C  CZ    . ARG B 1 140 ? 11.123  14.320 -10.955 1.00 73.00  ?  157 ARG B CZ    1 
ATOM   2820 N  NH1   . ARG B 1 140 ? 11.490  15.571 -10.712 1.00 72.54  1  157 ARG B NH1   1 
ATOM   2821 N  NH2   . ARG B 1 140 ? 9.935   14.074 -11.491 1.00 75.84  ?  157 ARG B NH2   1 
ATOM   2822 N  N     . LEU B 1 141 ? 16.388  12.712 -5.550  1.00 59.50  ?  158 LEU B N     1 
ATOM   2823 C  CA    . LEU B 1 141 ? 17.325  13.407 -4.673  1.00 58.13  ?  158 LEU B CA    1 
ATOM   2824 C  C     . LEU B 1 141 ? 18.480  12.528 -4.204  1.00 58.11  ?  158 LEU B C     1 
ATOM   2825 O  O     . LEU B 1 141 ? 19.621  12.985 -4.133  1.00 58.16  ?  158 LEU B O     1 
ATOM   2826 C  CB    . LEU B 1 141 ? 16.586  13.972 -3.458  1.00 56.16  ?  158 LEU B CB    1 
ATOM   2827 C  CG    . LEU B 1 141 ? 15.809  15.270 -3.679  1.00 55.99  ?  158 LEU B CG    1 
ATOM   2828 C  CD1   . LEU B 1 141 ? 15.092  15.693 -2.406  1.00 54.24  ?  158 LEU B CD1   1 
ATOM   2829 C  CD2   . LEU B 1 141 ? 16.741  16.369 -4.160  1.00 56.57  ?  158 LEU B CD2   1 
ATOM   2830 N  N     . SER B 1 142 ? 18.186  11.272 -3.885  1.00 68.24  ?  159 SER B N     1 
ATOM   2831 C  CA    . SER B 1 142 ? 19.206  10.354 -3.388  1.00 68.33  ?  159 SER B CA    1 
ATOM   2832 C  C     . SER B 1 142 ? 20.290  10.104 -4.432  1.00 70.20  ?  159 SER B C     1 
ATOM   2833 O  O     . SER B 1 142 ? 21.421  9.752  -4.095  1.00 70.41  ?  159 SER B O     1 
ATOM   2834 C  CB    . SER B 1 142 ? 18.573  9.027  -2.964  1.00 68.36  ?  159 SER B CB    1 
ATOM   2835 O  OG    . SER B 1 142 ? 18.194  8.258  -4.092  1.00 70.26  ?  159 SER B OG    1 
ATOM   2836 N  N     . LYS B 1 143 ? 19.934  10.286 -5.699  1.00 58.97  ?  160 LYS B N     1 
ATOM   2837 C  CA    . LYS B 1 143 ? 20.863  10.069 -6.802  1.00 61.17  ?  160 LYS B CA    1 
ATOM   2838 C  C     . LYS B 1 143 ? 21.825  11.240 -7.014  1.00 61.21  ?  160 LYS B C     1 
ATOM   2839 O  O     . LYS B 1 143 ? 22.808  11.112 -7.743  1.00 62.94  ?  160 LYS B O     1 
ATOM   2840 C  CB    . LYS B 1 143 ? 20.089  9.799  -8.095  1.00 63.22  ?  160 LYS B CB    1 
ATOM   2841 N  N     . VAL B 1 144 ? 21.546  12.377 -6.381  1.00 59.50  ?  161 VAL B N     1 
ATOM   2842 C  CA    . VAL B 1 144 ? 22.356  13.575 -6.600  1.00 59.69  ?  161 VAL B CA    1 
ATOM   2843 C  C     . VAL B 1 144 ? 22.795  14.282 -5.318  1.00 57.71  ?  161 VAL B C     1 
ATOM   2844 O  O     . VAL B 1 144 ? 23.567  15.241 -5.372  1.00 57.90  ?  161 VAL B O     1 
ATOM   2845 C  CB    . VAL B 1 144 ? 21.604  14.604 -7.471  1.00 60.41  ?  161 VAL B CB    1 
ATOM   2846 C  CG1   . VAL B 1 144 ? 21.365  14.055 -8.871  1.00 62.88  ?  161 VAL B CG1   1 
ATOM   2847 C  CG2   . VAL B 1 144 ? 20.294  15.002 -6.810  1.00 58.72  ?  161 VAL B CG2   1 
ATOM   2848 N  N     . VAL B 1 145 ? 22.318  13.813 -4.170  1.00 60.84  ?  162 VAL B N     1 
ATOM   2849 C  CA    . VAL B 1 145 ? 22.630  14.467 -2.902  1.00 59.14  ?  162 VAL B CA    1 
ATOM   2850 C  C     . VAL B 1 145 ? 22.368  13.536 -1.718  1.00 57.92  ?  162 VAL B C     1 
ATOM   2851 O  O     . VAL B 1 145 ? 21.616  12.567 -1.833  1.00 58.09  ?  162 VAL B O     1 
ATOM   2852 C  CB    . VAL B 1 145 ? 21.813  15.773 -2.727  1.00 58.24  ?  162 VAL B CB    1 
ATOM   2853 C  CG1   . VAL B 1 145 ? 20.417  15.476 -2.196  1.00 57.11  ?  162 VAL B CG1   1 
ATOM   2854 C  CG2   . VAL B 1 145 ? 22.539  16.745 -1.811  1.00 57.35  ?  162 VAL B CG2   1 
ATOM   2855 N  N     . ASN B 1 146 ? 23.004  13.826 -0.587  1.00 52.09  ?  163 ASN B N     1 
ATOM   2856 C  CA    . ASN B 1 146 ? 22.789  13.050 0.627   1.00 51.08  ?  163 ASN B CA    1 
ATOM   2857 C  C     . ASN B 1 146 ? 21.463  13.424 1.275   1.00 49.76  ?  163 ASN B C     1 
ATOM   2858 O  O     . ASN B 1 146 ? 21.254  14.573 1.666   1.00 48.99  ?  163 ASN B O     1 
ATOM   2859 C  CB    . ASN B 1 146 ? 23.939  13.260 1.615   1.00 50.74  ?  163 ASN B CB    1 
ATOM   2860 C  CG    . ASN B 1 146 ? 25.268  12.766 1.077   1.00 52.17  ?  163 ASN B CG    1 
ATOM   2861 O  OD1   . ASN B 1 146 ? 25.351  11.686 0.493   1.00 53.24  ?  163 ASN B OD1   1 
ATOM   2862 N  ND2   . ASN B 1 146 ? 26.317  13.555 1.275   1.00 52.38  ?  163 ASN B ND2   1 
ATOM   2863 N  N     . ILE B 1 147 ? 20.569  12.448 1.386   1.00 49.67  ?  164 ILE B N     1 
ATOM   2864 C  CA    . ILE B 1 147 ? 19.243  12.687 1.940   1.00 48.65  ?  164 ILE B CA    1 
ATOM   2865 C  C     . ILE B 1 147 ? 19.114  12.140 3.357   1.00 47.78  ?  164 ILE B C     1 
ATOM   2866 O  O     . ILE B 1 147 ? 19.549  11.025 3.647   1.00 48.25  ?  164 ILE B O     1 
ATOM   2867 C  CB    . ILE B 1 147 ? 18.151  12.057 1.042   1.00 49.37  ?  164 ILE B CB    1 
ATOM   2868 C  CG1   . ILE B 1 147 ? 17.988  12.873 -0.238  1.00 50.21  ?  164 ILE B CG1   1 
ATOM   2869 C  CG2   . ILE B 1 147 ? 16.819  11.960 1.772   1.00 48.48  ?  164 ILE B CG2   1 
ATOM   2870 C  CD1   . ILE B 1 147 ? 17.492  14.275 0.008   1.00 49.38  ?  164 ILE B CD1   1 
ATOM   2871 N  N     . VAL B 1 148 ? 18.511  12.934 4.236   1.00 46.72  ?  165 VAL B N     1 
ATOM   2872 C  CA    . VAL B 1 148 ? 18.158  12.477 5.572   1.00 46.07  ?  165 VAL B CA    1 
ATOM   2873 C  C     . VAL B 1 148 ? 16.668  12.703 5.807   1.00 45.53  ?  165 VAL B C     1 
ATOM   2874 O  O     . VAL B 1 148 ? 16.235  13.832 6.044   1.00 44.99  ?  165 VAL B O     1 
ATOM   2875 C  CB    . VAL B 1 148 ? 18.976  13.194 6.661   1.00 45.57  ?  165 VAL B CB    1 
ATOM   2876 C  CG1   . VAL B 1 148 ? 18.517  12.756 8.044   1.00 45.14  ?  165 VAL B CG1   1 
ATOM   2877 C  CG2   . VAL B 1 148 ? 20.458  12.915 6.479   1.00 46.24  ?  165 VAL B CG2   1 
ATOM   2878 N  N     . PRO B 1 149 ? 15.877  11.624 5.733   1.00 45.87  ?  166 PRO B N     1 
ATOM   2879 C  CA    . PRO B 1 149 ? 14.419  11.701 5.878   1.00 45.60  ?  166 PRO B CA    1 
ATOM   2880 C  C     . PRO B 1 149 ? 14.013  12.068 7.300   1.00 44.85  ?  166 PRO B C     1 
ATOM   2881 O  O     . PRO B 1 149 ? 14.610  11.575 8.257   1.00 44.82  ?  166 PRO B O     1 
ATOM   2882 C  CB    . PRO B 1 149 ? 13.944  10.285 5.519   1.00 46.44  ?  166 PRO B CB    1 
ATOM   2883 C  CG    . PRO B 1 149 ? 15.139  9.582  4.944   1.00 47.26  ?  166 PRO B CG    1 
ATOM   2884 C  CD    . PRO B 1 149 ? 16.338  10.242 5.526   1.00 46.74  ?  166 PRO B CD    1 
ATOM   2885 N  N     . VAL B 1 150 ? 13.010  12.928 7.429   1.00 44.47  ?  167 VAL B N     1 
ATOM   2886 C  CA    . VAL B 1 150 ? 12.569  13.390 8.738   1.00 43.99  ?  167 VAL B CA    1 
ATOM   2887 C  C     . VAL B 1 150 ? 11.045  13.333 8.867   1.00 44.07  ?  167 VAL B C     1 
ATOM   2888 O  O     . VAL B 1 150 ? 10.321  13.596 7.905   1.00 44.31  ?  167 VAL B O     1 
ATOM   2889 C  CB    . VAL B 1 150 ? 13.081  14.834 8.999   1.00 43.60  ?  167 VAL B CB    1 
ATOM   2890 C  CG1   . VAL B 1 150 ? 11.977  15.742 9.530   1.00 43.43  ?  167 VAL B CG1   1 
ATOM   2891 C  CG2   . VAL B 1 150 ? 14.280  14.814 9.936   1.00 43.53  ?  167 VAL B CG2   1 
ATOM   2892 N  N     . ILE B 1 151 ? 10.566  12.976 10.055  1.00 44.06  ?  168 ILE B N     1 
ATOM   2893 C  CA    . ILE B 1 151 ? 9.135   12.986 10.333  1.00 44.26  ?  168 ILE B CA    1 
ATOM   2894 C  C     . ILE B 1 151 ? 8.700   14.380 10.772  1.00 43.99  ?  168 ILE B C     1 
ATOM   2895 O  O     . ILE B 1 151 ? 8.915   14.775 11.919  1.00 43.92  ?  168 ILE B O     1 
ATOM   2896 C  CB    . ILE B 1 151 ? 8.750   11.962 11.417  1.00 44.66  ?  168 ILE B CB    1 
ATOM   2897 C  CG1   . ILE B 1 151 ? 9.117   10.547 10.968  1.00 45.19  ?  168 ILE B CG1   1 
ATOM   2898 C  CG2   . ILE B 1 151 ? 7.263   12.042 11.723  1.00 45.00  ?  168 ILE B CG2   1 
ATOM   2899 C  CD1   . ILE B 1 151 ? 8.842   9.486  12.010  1.00 46.10  ?  168 ILE B CD1   1 
ATOM   2900 N  N     . ALA B 1 152 ? 8.105   15.124 9.847   1.00 52.02  ?  169 ALA B N     1 
ATOM   2901 C  CA    . ALA B 1 152 ? 7.651   16.482 10.123  1.00 52.01  ?  169 ALA B CA    1 
ATOM   2902 C  C     . ALA B 1 152 ? 6.553   16.508 11.180  1.00 52.33  ?  169 ALA B C     1 
ATOM   2903 O  O     . ALA B 1 152 ? 5.627   15.696 11.139  1.00 52.69  ?  169 ALA B O     1 
ATOM   2904 C  CB    . ALA B 1 152 ? 7.166   17.140 8.846   1.00 52.31  ?  169 ALA B CB    1 
ATOM   2905 N  N     . LYS B 1 153 ? 6.663   17.453 12.112  1.00 51.55  ?  170 LYS B N     1 
ATOM   2906 C  CA    . LYS B 1 153 ? 5.684   17.629 13.185  1.00 52.09  ?  170 LYS B CA    1 
ATOM   2907 C  C     . LYS B 1 153 ? 5.426   16.330 13.945  1.00 52.32  ?  170 LYS B C     1 
ATOM   2908 O  O     . LYS B 1 153 ? 4.314   15.806 13.935  1.00 52.79  ?  170 LYS B O     1 
ATOM   2909 C  CB    . LYS B 1 153 ? 4.370   18.177 12.622  1.00 52.59  ?  170 LYS B CB    1 
ATOM   2910 C  CG    . LYS B 1 153 ? 4.507   19.532 11.945  1.00 52.68  ?  170 LYS B CG    1 
ATOM   2911 C  CD    . LYS B 1 153 ? 3.202   19.961 11.297  1.00 53.35  ?  170 LYS B CD    1 
ATOM   2912 C  CE    . LYS B 1 153 ? 3.268   21.406 10.834  1.00 53.77  ?  170 LYS B CE    1 
ATOM   2913 N  NZ    . LYS B 1 153 ? 1.967   21.870 10.275  1.00 54.67  1  170 LYS B NZ    1 
ATOM   2914 N  N     . ALA B 1 154 ? 6.463   15.816 14.600  1.00 45.04  ?  171 ALA B N     1 
ATOM   2915 C  CA    . ALA B 1 154 ? 6.381   14.532 15.289  1.00 45.43  ?  171 ALA B CA    1 
ATOM   2916 C  C     . ALA B 1 154 ? 5.499   14.578 16.535  1.00 46.29  ?  171 ALA B C     1 
ATOM   2917 O  O     . ALA B 1 154 ? 5.170   13.538 17.106  1.00 46.92  ?  171 ALA B O     1 
ATOM   2918 C  CB    . ALA B 1 154 ? 7.773   14.054 15.658  1.00 45.25  ?  171 ALA B CB    1 
ATOM   2919 N  N     . ASP B 1 155 ? 5.113   15.779 16.955  1.00 76.65  ?  172 ASP B N     1 
ATOM   2920 C  CA    . ASP B 1 155 ? 4.208   15.926 18.089  1.00 77.92  ?  172 ASP B CA    1 
ATOM   2921 C  C     . ASP B 1 155 ? 2.778   15.565 17.690  1.00 78.28  ?  172 ASP B C     1 
ATOM   2922 O  O     . ASP B 1 155 ? 1.909   15.390 18.545  1.00 79.62  ?  172 ASP B O     1 
ATOM   2923 C  CB    . ASP B 1 155 ? 4.272   17.350 18.651  1.00 78.41  ?  172 ASP B CB    1 
ATOM   2924 C  CG    . ASP B 1 155 ? 4.084   18.410 17.584  1.00 77.87  ?  172 ASP B CG    1 
ATOM   2925 O  OD1   . ASP B 1 155 ? 4.554   18.202 16.446  1.00 77.00  ?  172 ASP B OD1   1 
ATOM   2926 O  OD2   . ASP B 1 155 ? 3.474   19.456 17.888  1.00 78.50  -1 172 ASP B OD2   1 
ATOM   2927 N  N     . THR B 1 156 ? 2.543   15.462 16.385  1.00 55.99  ?  173 THR B N     1 
ATOM   2928 C  CA    . THR B 1 156 ? 1.251   15.038 15.856  1.00 56.51  ?  173 THR B CA    1 
ATOM   2929 C  C     . THR B 1 156 ? 0.939   13.592 16.238  1.00 57.21  ?  173 THR B C     1 
ATOM   2930 O  O     . THR B 1 156 ? -0.208  13.246 16.523  1.00 58.27  ?  173 THR B O     1 
ATOM   2931 C  CB    . THR B 1 156 ? 1.207   15.178 14.319  1.00 55.96  ?  173 THR B CB    1 
ATOM   2932 O  OG1   . THR B 1 156 ? 1.517   16.527 13.951  1.00 55.63  ?  173 THR B OG1   1 
ATOM   2933 C  CG2   . THR B 1 156 ? -0.165  14.810 13.776  1.00 56.72  ?  173 THR B CG2   1 
ATOM   2934 N  N     . LEU B 1 157 ? 1.970   12.753 16.259  1.00 55.89  ?  174 LEU B N     1 
ATOM   2935 C  CA    . LEU B 1 157 ? 1.788   11.323 16.489  1.00 56.80  ?  174 LEU B CA    1 
ATOM   2936 C  C     . LEU B 1 157 ? 2.019   10.939 17.946  1.00 57.67  ?  174 LEU B C     1 
ATOM   2937 O  O     . LEU B 1 157 ? 2.738   11.622 18.674  1.00 57.48  ?  174 LEU B O     1 
ATOM   2938 C  CB    . LEU B 1 157 ? 2.732   10.515 15.593  1.00 56.44  ?  174 LEU B CB    1 
ATOM   2939 C  CG    . LEU B 1 157 ? 2.644   10.745 14.084  1.00 55.84  ?  174 LEU B CG    1 
ATOM   2940 C  CD1   . LEU B 1 157 ? 3.804   10.066 13.372  1.00 55.41  ?  174 LEU B CD1   1 
ATOM   2941 C  CD2   . LEU B 1 157 ? 1.317   10.239 13.544  1.00 56.86  ?  174 LEU B CD2   1 
ATOM   2942 N  N     . THR B 1 158 ? 1.403   9.837  18.361  1.00 78.19  ?  175 THR B N     1 
ATOM   2943 C  CA    . THR B 1 158 ? 1.640   9.276  19.683  1.00 79.33  ?  175 THR B CA    1 
ATOM   2944 C  C     . THR B 1 158 ? 2.902   8.423  19.645  1.00 79.27  ?  175 THR B C     1 
ATOM   2945 O  O     . THR B 1 158 ? 3.502   8.250  18.585  1.00 78.46  ?  175 THR B O     1 
ATOM   2946 C  CB    . THR B 1 158 ? 0.450   8.425  20.167  1.00 80.84  ?  175 THR B CB    1 
ATOM   2947 O  OG1   . THR B 1 158 ? 0.378   7.217  19.399  1.00 80.97  ?  175 THR B OG1   1 
ATOM   2948 C  CG2   . THR B 1 158 ? -0.853  9.195  20.016  1.00 81.01  ?  175 THR B CG2   1 
ATOM   2949 N  N     . LEU B 1 159 ? 3.307   7.897  20.796  1.00 61.80  ?  176 LEU B N     1 
ATOM   2950 C  CA    . LEU B 1 159 ? 4.494   7.051  20.863  1.00 61.46  ?  176 LEU B CA    1 
ATOM   2951 C  C     . LEU B 1 159 ? 4.302   5.783  20.038  1.00 55.96  ?  176 LEU B C     1 
ATOM   2952 O  O     . LEU B 1 159 ? 5.205   5.359  19.319  1.00 53.77  ?  176 LEU B O     1 
ATOM   2953 C  CB    . LEU B 1 159 ? 4.824   6.687  22.311  1.00 59.66  ?  176 LEU B CB    1 
ATOM   2954 C  CG    . LEU B 1 159 ? 5.997   5.719  22.486  1.00 54.53  ?  176 LEU B CG    1 
ATOM   2955 C  CD1   . LEU B 1 159 ? 7.294   6.345  21.991  1.00 55.38  ?  176 LEU B CD1   1 
ATOM   2956 C  CD2   . LEU B 1 159 ? 6.128   5.276  23.936  1.00 54.35  ?  176 LEU B CD2   1 
ATOM   2957 N  N     . GLU B 1 160 ? 3.117   5.190  20.143  1.00 63.15  ?  177 GLU B N     1 
ATOM   2958 C  CA    . GLU B 1 160 ? 2.791   3.988  19.384  1.00 56.55  ?  177 GLU B CA    1 
ATOM   2959 C  C     . GLU B 1 160 ? 2.789   4.271  17.886  1.00 57.93  ?  177 GLU B C     1 
ATOM   2960 O  O     . GLU B 1 160 ? 3.333   3.498  17.098  1.00 54.50  ?  177 GLU B O     1 
ATOM   2961 C  CB    . GLU B 1 160 ? 1.433   3.432  19.818  1.00 52.16  ?  177 GLU B CB    1 
ATOM   2962 N  N     . GLU B 1 161 ? 2.169   5.382  17.500  1.00 86.37  ?  178 GLU B N     1 
ATOM   2963 C  CA    . GLU B 1 161 ? 2.082   5.763  16.095  1.00 86.43  ?  178 GLU B CA    1 
ATOM   2964 C  C     . GLU B 1 161 ? 3.457   6.094  15.522  1.00 89.63  ?  178 GLU B C     1 
ATOM   2965 O  O     . GLU B 1 161 ? 3.739   5.805  14.359  1.00 88.00  ?  178 GLU B O     1 
ATOM   2966 C  CB    . GLU B 1 161 ? 1.140   6.956  15.920  1.00 87.22  ?  178 GLU B CB    1 
ATOM   2967 C  CG    . GLU B 1 161 ? -0.319  6.647  16.217  1.00 82.92  ?  178 GLU B CG    1 
ATOM   2968 C  CD    . GLU B 1 161 ? -1.212  7.865  16.072  1.00 81.49  ?  178 GLU B CD    1 
ATOM   2969 O  OE1   . GLU B 1 161 ? -0.679  8.994  16.040  1.00 83.35  ?  178 GLU B OE1   1 
ATOM   2970 O  OE2   . GLU B 1 161 ? -2.447  7.692  15.991  1.00 76.50  -1 178 GLU B OE2   1 
ATOM   2971 N  N     . ARG B 1 162 ? 4.307   6.704  16.343  1.00 74.26  ?  179 ARG B N     1 
ATOM   2972 C  CA    . ARG B 1 162 ? 5.649   7.090  15.918  1.00 76.16  ?  179 ARG B CA    1 
ATOM   2973 C  C     . ARG B 1 162 ? 6.520   5.873  15.613  1.00 71.32  ?  179 ARG B C     1 
ATOM   2974 O  O     . ARG B 1 162 ? 7.269   5.864  14.635  1.00 70.17  ?  179 ARG B O     1 
ATOM   2975 C  CB    . ARG B 1 162 ? 6.318   7.954  16.990  1.00 80.04  ?  179 ARG B CB    1 
ATOM   2976 C  CG    . ARG B 1 162 ? 7.790   8.241  16.737  1.00 80.61  ?  179 ARG B CG    1 
ATOM   2977 C  CD    . ARG B 1 162 ? 8.378   9.144  17.812  1.00 81.38  ?  179 ARG B CD    1 
ATOM   2978 N  NE    . ARG B 1 162 ? 7.665   10.414 17.923  1.00 83.14  ?  179 ARG B NE    1 
ATOM   2979 C  CZ    . ARG B 1 162 ? 6.848   10.729 18.924  1.00 83.41  ?  179 ARG B CZ    1 
ATOM   2980 N  NH1   . ARG B 1 162 ? 6.637   9.864  19.907  1.00 83.35  1  179 ARG B NH1   1 
ATOM   2981 N  NH2   . ARG B 1 162 ? 6.242   11.908 18.942  1.00 82.35  ?  179 ARG B NH2   1 
ATOM   2982 N  N     . VAL B 1 163 ? 6.412   4.848  16.452  1.00 69.22  ?  180 VAL B N     1 
ATOM   2983 C  CA    . VAL B 1 163 ? 7.183   3.622  16.271  1.00 61.56  ?  180 VAL B CA    1 
ATOM   2984 C  C     . VAL B 1 163 ? 6.756   2.890  15.002  1.00 58.68  ?  180 VAL B C     1 
ATOM   2985 O  O     . VAL B 1 163 ? 7.596   2.425  14.231  1.00 56.25  ?  180 VAL B O     1 
ATOM   2986 C  CB    . VAL B 1 163 ? 7.040   2.679  17.485  1.00 55.90  ?  180 VAL B CB    1 
ATOM   2987 C  CG1   . VAL B 1 163 ? 7.737   1.354  17.221  1.00 48.52  ?  180 VAL B CG1   1 
ATOM   2988 C  CG2   . VAL B 1 163 ? 7.599   3.338  18.737  1.00 57.76  ?  180 VAL B CG2   1 
ATOM   2989 N  N     . HIS B 1 164 ? 5.448   2.802  14.785  1.00 62.18  ?  181 HIS B N     1 
ATOM   2990 C  CA    . HIS B 1 164 ? 4.915   2.149  13.595  1.00 59.95  ?  181 HIS B CA    1 
ATOM   2991 C  C     . HIS B 1 164 ? 5.260   2.916  12.326  1.00 63.18  ?  181 HIS B C     1 
ATOM   2992 O  O     . HIS B 1 164 ? 5.513   2.318  11.280  1.00 61.18  ?  181 HIS B O     1 
ATOM   2993 C  CB    . HIS B 1 164 ? 3.397   1.990  13.698  1.00 59.14  ?  181 HIS B CB    1 
ATOM   2994 C  CG    . HIS B 1 164 ? 2.761   1.471  12.445  1.00 57.12  ?  181 HIS B CG    1 
ATOM   2995 N  ND1   . HIS B 1 164 ? 2.314   2.300  11.439  1.00 59.71  ?  181 HIS B ND1   1 
ATOM   2996 C  CD2   . HIS B 1 164 ? 2.505   0.207  12.031  1.00 53.00  ?  181 HIS B CD2   1 
ATOM   2997 C  CE1   . HIS B 1 164 ? 1.807   1.571  10.461  1.00 57.42  ?  181 HIS B CE1   1 
ATOM   2998 N  NE2   . HIS B 1 164 ? 1.911   0.297  10.796  1.00 53.78  ?  181 HIS B NE2   1 
ATOM   2999 N  N     . PHE B 1 165 ? 5.269   4.241  12.421  1.00 43.13  ?  182 PHE B N     1 
ATOM   3000 C  CA    . PHE B 1 165 ? 5.540   5.072  11.257  1.00 43.75  ?  182 PHE B CA    1 
ATOM   3001 C  C     . PHE B 1 165 ? 6.999   4.934  10.836  1.00 43.90  ?  182 PHE B C     1 
ATOM   3002 O  O     . PHE B 1 165 ? 7.293   4.785  9.653   1.00 44.12  ?  182 PHE B O     1 
ATOM   3003 C  CB    . PHE B 1 165 ? 5.198   6.536  11.545  1.00 44.54  ?  182 PHE B CB    1 
ATOM   3004 C  CG    . PHE B 1 165 ? 5.126   7.394  10.314  1.00 45.24  ?  182 PHE B CG    1 
ATOM   3005 C  CD1   . PHE B 1 165 ? 4.452   6.953  9.188   1.00 45.18  ?  182 PHE B CD1   1 
ATOM   3006 C  CD2   . PHE B 1 165 ? 5.722   8.643  10.285  1.00 46.11  ?  182 PHE B CD2   1 
ATOM   3007 C  CE1   . PHE B 1 165 ? 4.379   7.737  8.053   1.00 45.85  ?  182 PHE B CE1   1 
ATOM   3008 C  CE2   . PHE B 1 165 ? 5.652   9.434  9.153   1.00 46.79  ?  182 PHE B CE2   1 
ATOM   3009 C  CZ    . PHE B 1 165 ? 4.980   8.980  8.035   1.00 46.59  ?  182 PHE B CZ    1 
ATOM   3010 N  N     . LYS B 1 166 ? 7.906   4.961  11.810  1.00 59.04  ?  183 LYS B N     1 
ATOM   3011 C  CA    . LYS B 1 166 ? 9.328   4.760  11.539  1.00 57.57  ?  183 LYS B CA    1 
ATOM   3012 C  C     . LYS B 1 166 ? 9.573   3.410  10.878  1.00 52.57  ?  183 LYS B C     1 
ATOM   3013 O  O     . LYS B 1 166 ? 10.325  3.308  9.908   1.00 52.21  ?  183 LYS B O     1 
ATOM   3014 C  CB    . LYS B 1 166 ? 10.148  4.854  12.829  1.00 57.36  ?  183 LYS B CB    1 
ATOM   3015 C  CG    . LYS B 1 166 ? 10.488  6.266  13.274  1.00 63.34  ?  183 LYS B CG    1 
ATOM   3016 C  CD    . LYS B 1 166 ? 11.471  6.229  14.437  1.00 60.88  ?  183 LYS B CD    1 
ATOM   3017 C  CE    . LYS B 1 166 ? 12.135  7.577  14.661  1.00 64.96  ?  183 LYS B CE    1 
ATOM   3018 N  NZ    . LYS B 1 166 ? 11.139  8.673  14.807  1.00 71.58  1  183 LYS B NZ    1 
ATOM   3019 N  N     . GLN B 1 167 ? 8.933   2.378  11.417  1.00 43.36  ?  184 GLN B N     1 
ATOM   3020 C  CA    . GLN B 1 167 ? 9.056   1.025  10.889  1.00 43.30  ?  184 GLN B CA    1 
ATOM   3021 C  C     . GLN B 1 167 ? 8.549   0.935  9.453   1.00 43.60  ?  184 GLN B C     1 
ATOM   3022 O  O     . GLN B 1 167 ? 9.097   0.196  8.635   1.00 44.10  ?  184 GLN B O     1 
ATOM   3023 C  CB    . GLN B 1 167 ? 8.296   0.036  11.774  1.00 42.63  ?  184 GLN B CB    1 
ATOM   3024 N  N     . ARG B 1 168 ? 7.496   1.688  9.152   1.00 47.84  ?  185 ARG B N     1 
ATOM   3025 C  CA    . ARG B 1 168 ? 6.865   1.615  7.841   1.00 48.91  ?  185 ARG B CA    1 
ATOM   3026 C  C     . ARG B 1 168 ? 7.666   2.418  6.818   1.00 50.85  ?  185 ARG B C     1 
ATOM   3027 O  O     . ARG B 1 168 ? 7.854   1.978  5.683   1.00 50.98  ?  185 ARG B O     1 
ATOM   3028 C  CB    . ARG B 1 168 ? 5.425   2.129  7.909   1.00 50.00  ?  185 ARG B CB    1 
ATOM   3029 C  CG    . ARG B 1 168 ? 4.640   1.963  6.620   1.00 50.31  ?  185 ARG B CG    1 
ATOM   3030 C  CD    . ARG B 1 168 ? 4.540   0.486  6.261   1.00 48.69  ?  185 ARG B CD    1 
ATOM   3031 N  NE    . ARG B 1 168 ? 3.793   0.240  5.031   1.00 49.49  ?  185 ARG B NE    1 
ATOM   3032 C  CZ    . ARG B 1 168 ? 4.348   0.108  3.831   1.00 51.26  ?  185 ARG B CZ    1 
ATOM   3033 N  NH1   . ARG B 1 168 ? 5.663   0.199  3.694   1.00 52.28  1  185 ARG B NH1   1 
ATOM   3034 N  NH2   . ARG B 1 168 ? 3.587   -0.116 2.769   1.00 52.17  ?  185 ARG B NH2   1 
ATOM   3035 N  N     . ILE B 1 169 ? 8.126   3.600  7.221   1.00 52.05  ?  186 ILE B N     1 
ATOM   3036 C  CA    . ILE B 1 169 ? 8.967   4.435  6.366   1.00 52.73  ?  186 ILE B CA    1 
ATOM   3037 C  C     . ILE B 1 169 ? 10.263  3.719  6.002   1.00 51.60  ?  186 ILE B C     1 
ATOM   3038 O  O     . ILE B 1 169 ? 10.685  3.730  4.845   1.00 51.44  ?  186 ILE B O     1 
ATOM   3039 C  CB    . ILE B 1 169 ? 9.315   5.783  7.038   1.00 54.67  ?  186 ILE B CB    1 
ATOM   3040 C  CG1   . ILE B 1 169 ? 8.047   6.592  7.317   1.00 55.93  ?  186 ILE B CG1   1 
ATOM   3041 C  CG2   . ILE B 1 169 ? 10.269  6.590  6.168   1.00 54.52  ?  186 ILE B CG2   1 
ATOM   3042 C  CD1   . ILE B 1 169 ? 7.209   6.854  6.097   1.00 54.53  ?  186 ILE B CD1   1 
ATOM   3043 N  N     . THR B 1 170 ? 10.883  3.095  7.000   1.00 45.65  ?  187 THR B N     1 
ATOM   3044 C  CA    . THR B 1 170 ? 12.113  2.337  6.802   1.00 46.37  ?  187 THR B CA    1 
ATOM   3045 C  C     . THR B 1 170 ? 11.936  1.263  5.734   1.00 46.68  ?  187 THR B C     1 
ATOM   3046 O  O     . THR B 1 170 ? 12.771  1.117  4.845   1.00 47.64  ?  187 THR B O     1 
ATOM   3047 C  CB    . THR B 1 170 ? 12.582  1.675  8.114   1.00 46.20  ?  187 THR B CB    1 
ATOM   3048 O  OG1   . THR B 1 170 ? 12.737  2.676  9.128   1.00 46.12  ?  187 THR B OG1   1 
ATOM   3049 C  CG2   . THR B 1 170 ? 13.909  0.957  7.907   1.00 47.29  ?  187 THR B CG2   1 
ATOM   3050 N  N     . ALA B 1 171 ? 10.838  0.520  5.829   1.00 46.09  ?  188 ALA B N     1 
ATOM   3051 C  CA    . ALA B 1 171 ? 10.550  -0.552 4.883   1.00 46.62  ?  188 ALA B CA    1 
ATOM   3052 C  C     . ALA B 1 171 ? 10.334  -0.003 3.474   1.00 47.14  ?  188 ALA B C     1 
ATOM   3053 O  O     . ALA B 1 171 ? 10.749  -0.617 2.491   1.00 48.09  ?  188 ALA B O     1 
ATOM   3054 C  CB    . ALA B 1 171 ? 9.336   -1.342 5.333   1.00 46.06  ?  188 ALA B CB    1 
ATOM   3055 N  N     . ASP B 1 172 ? 9.682   1.153  3.384   1.00 63.53  ?  189 ASP B N     1 
ATOM   3056 C  CA    . ASP B 1 172 ? 9.406   1.776  2.096   1.00 64.51  ?  189 ASP B CA    1 
ATOM   3057 C  C     . ASP B 1 172 ? 10.690  2.264  1.429   1.00 63.90  ?  189 ASP B C     1 
ATOM   3058 O  O     . ASP B 1 172 ? 10.877  2.084  0.224   1.00 64.34  ?  189 ASP B O     1 
ATOM   3059 C  CB    . ASP B 1 172 ? 8.424   2.937  2.259   1.00 64.15  ?  189 ASP B CB    1 
ATOM   3060 C  CG    . ASP B 1 172 ? 6.991   2.470  2.432   1.00 64.80  ?  189 ASP B CG    1 
ATOM   3061 O  OD1   . ASP B 1 172 ? 6.677   1.334  2.020   1.00 65.73  ?  189 ASP B OD1   1 
ATOM   3062 O  OD2   . ASP B 1 172 ? 6.176   3.240  2.984   1.00 64.46  -1 189 ASP B OD2   1 
ATOM   3063 N  N     . LEU B 1 173 ? 11.565  2.886  2.215   1.00 47.89  ?  190 LEU B N     1 
ATOM   3064 C  CA    . LEU B 1 173 ? 12.851  3.352  1.709   1.00 48.85  ?  190 LEU B CA    1 
ATOM   3065 C  C     . LEU B 1 173 ? 13.662  2.188  1.150   1.00 49.84  ?  190 LEU B C     1 
ATOM   3066 O  O     . LEU B 1 173 ? 14.258  2.292  0.077   1.00 50.82  ?  190 LEU B O     1 
ATOM   3067 C  CB    . LEU B 1 173 ? 13.639  4.068  2.808   1.00 48.94  ?  190 LEU B CB    1 
ATOM   3068 C  CG    . LEU B 1 173 ? 13.010  5.359  3.329   1.00 48.43  ?  190 LEU B CG    1 
ATOM   3069 C  CD1   . LEU B 1 173 ? 13.876  5.995  4.406   1.00 48.88  ?  190 LEU B CD1   1 
ATOM   3070 C  CD2   . LEU B 1 173 ? 12.764  6.327  2.185   1.00 48.79  ?  190 LEU B CD2   1 
ATOM   3071 N  N     . LEU B 1 174 ? 13.673  1.080  1.884   1.00 49.73  ?  191 LEU B N     1 
ATOM   3072 C  CA    . LEU B 1 174 ? 14.406  -0.112 1.477   1.00 50.92  ?  191 LEU B CA    1 
ATOM   3073 C  C     . LEU B 1 174 ? 13.819  -0.725 0.208   1.00 51.48  ?  191 LEU B C     1 
ATOM   3074 O  O     . LEU B 1 174 ? 14.550  -1.071 -0.720  1.00 52.85  ?  191 LEU B O     1 
ATOM   3075 C  CB    . LEU B 1 174 ? 14.408  -1.147 2.604   1.00 50.68  ?  191 LEU B CB    1 
ATOM   3076 C  CG    . LEU B 1 174 ? 15.186  -0.773 3.867   1.00 50.54  ?  191 LEU B CG    1 
ATOM   3077 C  CD1   . LEU B 1 174 ? 15.035  -1.848 4.933   1.00 50.22  ?  191 LEU B CD1   1 
ATOM   3078 C  CD2   . LEU B 1 174 ? 16.653  -0.534 3.544   1.00 52.10  ?  191 LEU B CD2   1 
ATOM   3079 N  N     . SER B 1 175 ? 12.497  -0.860 0.178   1.00 50.63  ?  192 SER B N     1 
ATOM   3080 C  CA    . SER B 1 175 ? 11.812  -1.490 -0.946  1.00 51.33  ?  192 SER B CA    1 
ATOM   3081 C  C     . SER B 1 175 ? 11.887  -0.652 -2.221  1.00 51.81  ?  192 SER B C     1 
ATOM   3082 O  O     . SER B 1 175 ? 11.878  -1.193 -3.327  1.00 52.96  ?  192 SER B O     1 
ATOM   3083 C  CB    . SER B 1 175 ? 10.349  -1.760 -0.590  1.00 50.50  ?  192 SER B CB    1 
ATOM   3084 O  OG    . SER B 1 175 ? 9.682   -0.563 -0.231  1.00 49.37  ?  192 SER B OG    1 
ATOM   3085 N  N     . ASN B 1 176 ? 11.963  0.666  -2.065  1.00 54.08  ?  193 ASN B N     1 
ATOM   3086 C  CA    . ASN B 1 176 ? 12.037  1.564  -3.213  1.00 52.70  ?  193 ASN B CA    1 
ATOM   3087 C  C     . ASN B 1 176 ? 13.471  1.869  -3.631  1.00 53.69  ?  193 ASN B C     1 
ATOM   3088 O  O     . ASN B 1 176 ? 13.703  2.635  -4.566  1.00 54.14  ?  193 ASN B O     1 
ATOM   3089 C  CB    . ASN B 1 176 ? 11.300  2.870  -2.913  1.00 51.64  ?  193 ASN B CB    1 
ATOM   3090 C  CG    . ASN B 1 176 ? 9.796   2.732  -3.042  1.00 51.17  ?  193 ASN B CG    1 
ATOM   3091 O  OD1   . ASN B 1 176 ? 9.258   2.692  -4.149  1.00 51.74  ?  193 ASN B OD1   1 
ATOM   3092 N  ND2   . ASN B 1 176 ? 9.109   2.659  -1.908  1.00 51.16  ?  193 ASN B ND2   1 
ATOM   3093 N  N     . GLY B 1 177 ? 14.429  1.264  -2.935  1.00 67.83  ?  194 GLY B N     1 
ATOM   3094 C  CA    . GLY B 1 177 ? 15.833  1.435  -3.259  1.00 66.92  ?  194 GLY B CA    1 
ATOM   3095 C  C     . GLY B 1 177 ? 16.314  2.859  -3.066  1.00 64.38  ?  194 GLY B C     1 
ATOM   3096 O  O     . GLY B 1 177 ? 17.257  3.302  -3.722  1.00 63.53  ?  194 GLY B O     1 
ATOM   3097 N  N     . ILE B 1 178 ? 15.663  3.580  -2.159  1.00 52.86  ?  195 ILE B N     1 
ATOM   3098 C  CA    . ILE B 1 178 ? 16.053  4.949  -1.851  1.00 52.84  ?  195 ILE B CA    1 
ATOM   3099 C  C     . ILE B 1 178 ? 17.247  4.946  -0.904  1.00 53.63  ?  195 ILE B C     1 
ATOM   3100 O  O     . ILE B 1 178 ? 17.107  4.663  0.286   1.00 53.03  ?  195 ILE B O     1 
ATOM   3101 C  CB    . ILE B 1 178 ? 14.890  5.740  -1.224  1.00 51.51  ?  195 ILE B CB    1 
ATOM   3102 C  CG1   . ILE B 1 178 ? 13.677  5.730  -2.158  1.00 50.99  ?  195 ILE B CG1   1 
ATOM   3103 C  CG2   . ILE B 1 178 ? 15.319  7.166  -0.910  1.00 51.84  ?  195 ILE B CG2   1 
ATOM   3104 C  CD1   . ILE B 1 178 ? 12.433  6.345  -1.555  1.00 49.95  ?  195 ILE B CD1   1 
ATOM   3105 N  N     . ASP B 1 179 ? 18.423  5.259  -1.439  1.00 74.26  ?  196 ASP B N     1 
ATOM   3106 C  CA    . ASP B 1 179 ? 19.647  5.250  -0.648  1.00 75.49  ?  196 ASP B CA    1 
ATOM   3107 C  C     . ASP B 1 179 ? 19.813  6.539  0.148   1.00 76.53  ?  196 ASP B C     1 
ATOM   3108 O  O     . ASP B 1 179 ? 20.100  7.596  -0.413  1.00 76.57  ?  196 ASP B O     1 
ATOM   3109 C  CB    . ASP B 1 179 ? 20.864  5.033  -1.551  1.00 75.98  ?  196 ASP B CB    1 
ATOM   3110 N  N     . VAL B 1 180 ? 19.628  6.441  1.460   1.00 55.72  ?  197 VAL B N     1 
ATOM   3111 C  CA    . VAL B 1 180 ? 19.773  7.588  2.348   1.00 55.93  ?  197 VAL B CA    1 
ATOM   3112 C  C     . VAL B 1 180 ? 21.082  7.515  3.130   1.00 57.61  ?  197 VAL B C     1 
ATOM   3113 O  O     . VAL B 1 180 ? 21.660  6.440  3.290   1.00 58.19  ?  197 VAL B O     1 
ATOM   3114 C  CB    . VAL B 1 180 ? 18.592  7.690  3.332   1.00 54.29  ?  197 VAL B CB    1 
ATOM   3115 C  CG1   . VAL B 1 180 ? 17.278  7.771  2.572   1.00 52.94  ?  197 VAL B CG1   1 
ATOM   3116 C  CG2   . VAL B 1 180 ? 18.589  6.505  4.286   1.00 53.77  ?  197 VAL B CG2   1 
ATOM   3117 N  N     . TYR B 1 181 ? 21.549  8.664  3.609   1.00 58.63  ?  198 TYR B N     1 
ATOM   3118 C  CA    . TYR B 1 181 ? 22.747  8.713  4.439   1.00 60.47  ?  198 TYR B CA    1 
ATOM   3119 C  C     . TYR B 1 181 ? 22.457  8.167  5.834   1.00 59.69  ?  198 TYR B C     1 
ATOM   3120 O  O     . TYR B 1 181 ? 21.425  8.485  6.419   1.00 58.20  ?  198 TYR B O     1 
ATOM   3121 C  CB    . TYR B 1 181 ? 23.282  10.146 4.537   1.00 62.04  ?  198 TYR B CB    1 
ATOM   3122 C  CG    . TYR B 1 181 ? 24.516  10.273 5.405   1.00 64.29  ?  198 TYR B CG    1 
ATOM   3123 C  CD1   . TYR B 1 181 ? 25.782  10.070 4.874   1.00 66.52  ?  198 TYR B CD1   1 
ATOM   3124 C  CD2   . TYR B 1 181 ? 24.414  10.584 6.755   1.00 64.40  ?  198 TYR B CD2   1 
ATOM   3125 C  CE1   . TYR B 1 181 ? 26.911  10.174 5.661   1.00 68.87  ?  198 TYR B CE1   1 
ATOM   3126 C  CE2   . TYR B 1 181 ? 25.538  10.690 7.551   1.00 66.66  ?  198 TYR B CE2   1 
ATOM   3127 C  CZ    . TYR B 1 181 ? 26.784  10.484 6.998   1.00 68.93  ?  198 TYR B CZ    1 
ATOM   3128 O  OH    . TYR B 1 181 ? 27.909  10.591 7.781   1.00 71.48  ?  198 TYR B OH    1 
ATOM   3129 N  N     . PRO B 1 182 ? 23.373  7.348  6.376   1.00 60.87  ?  199 PRO B N     1 
ATOM   3130 C  CA    . PRO B 1 182 ? 24.602  6.898  5.717   1.00 62.95  ?  199 PRO B CA    1 
ATOM   3131 C  C     . PRO B 1 182 ? 24.383  5.642  4.887   1.00 62.34  ?  199 PRO B C     1 
ATOM   3132 O  O     . PRO B 1 182 ? 23.928  4.630  5.420   1.00 61.28  ?  199 PRO B O     1 
ATOM   3133 C  CB    . PRO B 1 182 ? 25.551  6.609  6.892   1.00 64.58  ?  199 PRO B CB    1 
ATOM   3134 C  CG    . PRO B 1 182 ? 24.804  7.031  8.146   1.00 63.28  ?  199 PRO B CG    1 
ATOM   3135 C  CD    . PRO B 1 182 ? 23.360  6.958  7.791   1.00 60.64  ?  199 PRO B CD    1 
ATOM   3136 N  N     . GLN B 1 183 ? 24.695  5.715  3.598   1.00 63.13  ?  200 GLN B N     1 
ATOM   3137 C  CA    . GLN B 1 183 ? 24.561  4.568  2.710   1.00 63.01  ?  200 GLN B CA    1 
ATOM   3138 C  C     . GLN B 1 183 ? 25.451  3.425  3.187   1.00 64.60  ?  200 GLN B C     1 
ATOM   3139 O  O     . GLN B 1 183 ? 26.618  3.636  3.516   1.00 66.81  ?  200 GLN B O     1 
ATOM   3140 C  CB    . GLN B 1 183 ? 24.915  4.948  1.269   1.00 64.03  ?  200 GLN B CB    1 
ATOM   3141 C  CG    . GLN B 1 183 ? 24.083  6.084  0.681   1.00 62.70  ?  200 GLN B CG    1 
ATOM   3142 C  CD    . GLN B 1 183 ? 24.562  7.459  1.110   1.00 63.60  ?  200 GLN B CD    1 
ATOM   3143 O  OE1   . GLN B 1 183 ? 25.447  7.586  1.957   1.00 65.11  ?  200 GLN B OE1   1 
ATOM   3144 N  NE2   . GLN B 1 183 ? 23.978  8.497  0.525   1.00 62.88  ?  200 GLN B NE2   1 
ATOM   3145 N  N     . LYS B 1 184 ? 24.891  2.219  3.236   1.00 83.11  ?  201 LYS B N     1 
ATOM   3146 C  CA    . LYS B 1 184 ? 25.629  1.049  3.704   1.00 84.00  ?  201 LYS B CA    1 
ATOM   3147 C  C     . LYS B 1 184 ? 26.837  0.774  2.816   1.00 86.60  ?  201 LYS B C     1 
ATOM   3148 O  O     . LYS B 1 184 ? 27.842  0.225  3.268   1.00 88.52  ?  201 LYS B O     1 
ATOM   3149 C  CB    . LYS B 1 184 ? 24.728  -0.188 3.746   1.00 81.83  ?  201 LYS B CB    1 
ATOM   3150 C  CG    . LYS B 1 184 ? 23.571  -0.109 4.730   1.00 80.08  ?  201 LYS B CG    1 
ATOM   3151 C  CD    . LYS B 1 184 ? 23.045  -1.503 5.047   1.00 79.96  ?  201 LYS B CD    1 
ATOM   3152 C  CE    . LYS B 1 184 ? 21.749  -1.456 5.839   1.00 78.36  ?  201 LYS B CE    1 
ATOM   3153 N  NZ    . LYS B 1 184 ? 20.598  -1.037 4.993   1.00 78.42  1  201 LYS B NZ    1 
ATOM   3154 N  N     . GLU B 1 185 ? 26.729  1.159  1.548   1.00 68.18  ?  202 GLU B N     1 
ATOM   3155 C  CA    . GLU B 1 185 ? 27.784  0.921  0.570   1.00 70.89  ?  202 GLU B CA    1 
ATOM   3156 C  C     . GLU B 1 185 ? 29.019  1.791  0.802   1.00 73.19  ?  202 GLU B C     1 
ATOM   3157 O  O     . GLU B 1 185 ? 30.022  1.649  0.103   1.00 75.82  ?  202 GLU B O     1 
ATOM   3158 C  CB    . GLU B 1 185 ? 27.250  1.153  -0.845  1.00 70.29  ?  202 GLU B CB    1 
ATOM   3159 N  N     . PHE B 1 186 ? 28.948  2.691  1.779   1.00 72.44  ?  203 PHE B N     1 
ATOM   3160 C  CA    . PHE B 1 186 ? 30.061  3.594  2.058   1.00 74.77  ?  203 PHE B CA    1 
ATOM   3161 C  C     . PHE B 1 186 ? 30.664  3.337  3.435   1.00 75.92  ?  203 PHE B C     1 
ATOM   3162 O  O     . PHE B 1 186 ? 31.458  4.134  3.934   1.00 77.73  ?  203 PHE B O     1 
ATOM   3163 C  CB    . PHE B 1 186 ? 29.610  5.052  1.947   1.00 73.61  ?  203 PHE B CB    1 
ATOM   3164 C  CG    . PHE B 1 186 ? 29.113  5.428  0.581   1.00 72.76  ?  203 PHE B CG    1 
ATOM   3165 C  CD1   . PHE B 1 186 ? 29.674  4.866  -0.553  1.00 74.39  ?  203 PHE B CD1   1 
ATOM   3166 C  CD2   . PHE B 1 186 ? 28.088  6.347  0.431   1.00 70.54  ?  203 PHE B CD2   1 
ATOM   3167 C  CE1   . PHE B 1 186 ? 29.221  5.210  -1.812  1.00 73.67  ?  203 PHE B CE1   1 
ATOM   3168 C  CE2   . PHE B 1 186 ? 27.630  6.695  -0.826  1.00 69.86  ?  203 PHE B CE2   1 
ATOM   3169 C  CZ    . PHE B 1 186 ? 28.197  6.126  -1.949  1.00 71.37  ?  203 PHE B CZ    1 
ATOM   3170 N  N     . ASP B 1 187 ? 30.280  2.221  4.046   1.00 77.13  ?  204 ASP B N     1 
ATOM   3171 C  CA    . ASP B 1 187 ? 30.836  1.826  5.334   1.00 78.24  ?  204 ASP B CA    1 
ATOM   3172 C  C     . ASP B 1 187 ? 32.204  1.180  5.143   1.00 81.91  ?  204 ASP B C     1 
ATOM   3173 O  O     . ASP B 1 187 ? 32.345  0.223  4.381   1.00 82.77  ?  204 ASP B O     1 
ATOM   3174 C  CB    . ASP B 1 187 ? 29.889  0.871  6.063   1.00 75.93  ?  204 ASP B CB    1 
ATOM   3175 C  CG    . ASP B 1 187 ? 28.560  1.516  6.407   1.00 72.63  ?  204 ASP B CG    1 
ATOM   3176 O  OD1   . ASP B 1 187 ? 28.514  2.758  6.532   1.00 72.40  ?  204 ASP B OD1   1 
ATOM   3177 O  OD2   . ASP B 1 187 ? 27.560  0.781  6.553   1.00 70.48  -1 204 ASP B OD2   1 
ATOM   3178 N  N     . GLU B 1 188 ? 33.208  1.704  5.837   1.00 91.87  ?  205 GLU B N     1 
ATOM   3179 C  CA    . GLU B 1 188 ? 34.575  1.222  5.676   1.00 95.78  ?  205 GLU B CA    1 
ATOM   3180 C  C     . GLU B 1 188 ? 34.778  -0.086 6.431   1.00 96.57  ?  205 GLU B C     1 
ATOM   3181 O  O     . GLU B 1 188 ? 34.857  -1.156 5.829   1.00 97.37  ?  205 GLU B O     1 
ATOM   3182 C  CB    . GLU B 1 188 ? 35.577  2.273  6.158   1.00 98.42  ?  205 GLU B CB    1 
ATOM   3183 N  N     . ASP B 1 189 ? 34.864  0.007  7.754   1.00 92.77  ?  206 ASP B N     1 
ATOM   3184 C  CA    . ASP B 1 189 ? 35.075  -1.166 8.592   1.00 93.54  ?  206 ASP B CA    1 
ATOM   3185 C  C     . ASP B 1 189 ? 33.950  -1.323 9.611   1.00 90.09  ?  206 ASP B C     1 
ATOM   3186 O  O     . ASP B 1 189 ? 32.909  -0.674 9.505   1.00 87.05  ?  206 ASP B O     1 
ATOM   3187 C  CB    . ASP B 1 189 ? 36.427  -1.082 9.300   1.00 97.46  ?  206 ASP B CB    1 
ATOM   3188 C  CG    . ASP B 1 189 ? 36.627  0.235  10.019  1.00 97.69  ?  206 ASP B CG    1 
ATOM   3189 O  OD1   . ASP B 1 189 ? 36.014  0.430  11.089  1.00 95.68  ?  206 ASP B OD1   1 
ATOM   3190 O  OD2   . ASP B 1 189 ? 37.398  1.078  9.513   1.00 100.06 -1 206 ASP B OD2   1 
ATOM   3191 N  N     . SER B 1 190 ? 34.167  -2.190 10.595  1.00 88.02  ?  207 SER B N     1 
ATOM   3192 C  CA    . SER B 1 190 ? 33.149  -2.493 11.594  1.00 89.02  ?  207 SER B CA    1 
ATOM   3193 C  C     . SER B 1 190 ? 32.883  -1.311 12.522  1.00 88.02  ?  207 SER B C     1 
ATOM   3194 O  O     . SER B 1 190 ? 31.756  -1.110 12.973  1.00 87.98  ?  207 SER B O     1 
ATOM   3195 C  CB    . SER B 1 190 ? 33.559  -3.717 12.415  1.00 90.36  ?  207 SER B CB    1 
ATOM   3196 O  OG    . SER B 1 190 ? 33.762  -4.844 11.580  1.00 91.74  ?  207 SER B OG    1 
ATOM   3197 N  N     . GLU B 1 191 ? 33.921  -0.529 12.803  1.00 69.25  ?  208 GLU B N     1 
ATOM   3198 C  CA    . GLU B 1 191 ? 33.785  0.620  13.691  1.00 69.85  ?  208 GLU B CA    1 
ATOM   3199 C  C     . GLU B 1 191 ? 33.072  1.765  12.982  1.00 67.22  ?  208 GLU B C     1 
ATOM   3200 O  O     . GLU B 1 191 ? 32.351  2.544  13.605  1.00 66.83  ?  208 GLU B O     1 
ATOM   3201 C  CB    . GLU B 1 191 ? 35.155  1.080  14.193  1.00 73.00  ?  208 GLU B CB    1 
ATOM   3202 N  N     . ASP B 1 192 ? 33.279  1.859  11.672  1.00 92.53  ?  209 ASP B N     1 
ATOM   3203 C  CA    . ASP B 1 192 ? 32.587  2.847  10.856  1.00 90.78  ?  209 ASP B CA    1 
ATOM   3204 C  C     . ASP B 1 192 ? 31.121  2.456  10.697  1.00 90.33  ?  209 ASP B C     1 
ATOM   3205 O  O     . ASP B 1 192 ? 30.243  3.314  10.608  1.00 88.83  ?  209 ASP B O     1 
ATOM   3206 C  CB    . ASP B 1 192 ? 33.256  2.983  9.487   1.00 90.28  ?  209 ASP B CB    1 
ATOM   3207 C  CG    . ASP B 1 192 ? 32.580  4.017  8.608   1.00 88.70  ?  209 ASP B CG    1 
ATOM   3208 O  OD1   . ASP B 1 192 ? 32.130  5.051  9.143   1.00 87.60  ?  209 ASP B OD1   1 
ATOM   3209 O  OD2   . ASP B 1 192 ? 32.500  3.795  7.381   1.00 88.58  -1 209 ASP B OD2   1 
ATOM   3210 N  N     . ARG B 1 193 ? 30.870  1.152  10.656  1.00 61.65  ?  210 ARG B N     1 
ATOM   3211 C  CA    . ARG B 1 193 ? 29.520  0.628  10.488  1.00 60.57  ?  210 ARG B CA    1 
ATOM   3212 C  C     . ARG B 1 193 ? 28.677  0.828  11.744  1.00 61.09  ?  210 ARG B C     1 
ATOM   3213 O  O     . ARG B 1 193 ? 27.485  1.117  11.657  1.00 60.00  ?  210 ARG B O     1 
ATOM   3214 C  CB    . ARG B 1 193 ? 29.566  -0.857 10.120  1.00 61.77  ?  210 ARG B CB    1 
ATOM   3215 N  N     . LEU B 1 194 ? 29.302  0.674  12.908  1.00 69.05  ?  211 LEU B N     1 
ATOM   3216 C  CA    . LEU B 1 194 ? 28.599  0.782  14.184  1.00 70.15  ?  211 LEU B CA    1 
ATOM   3217 C  C     . LEU B 1 194 ? 28.017  2.173  14.420  1.00 69.71  ?  211 LEU B C     1 
ATOM   3218 O  O     . LEU B 1 194 ? 26.859  2.307  14.817  1.00 69.50  ?  211 LEU B O     1 
ATOM   3219 C  CB    . LEU B 1 194 ? 29.533  0.417  15.340  1.00 72.08  ?  211 LEU B CB    1 
ATOM   3220 C  CG    . LEU B 1 194 ? 29.762  -1.072 15.602  1.00 73.96  ?  211 LEU B CG    1 
ATOM   3221 C  CD1   . LEU B 1 194 ? 30.756  -1.270 16.738  1.00 77.36  ?  211 LEU B CD1   1 
ATOM   3222 C  CD2   . LEU B 1 194 ? 28.446  -1.770 15.910  1.00 74.79  ?  211 LEU B CD2   1 
ATOM   3223 N  N     . VAL B 1 195 ? 28.821  3.204  14.180  1.00 71.64  ?  212 VAL B N     1 
ATOM   3224 C  CA    . VAL B 1 195 ? 28.374  4.577  14.379  1.00 71.12  ?  212 VAL B CA    1 
ATOM   3225 C  C     . VAL B 1 195 ? 27.307  4.949  13.346  1.00 68.32  ?  212 VAL B C     1 
ATOM   3226 O  O     . VAL B 1 195 ? 26.413  5.750  13.625  1.00 68.22  ?  212 VAL B O     1 
ATOM   3227 C  CB    . VAL B 1 195 ? 29.561  5.576  14.317  1.00 70.14  ?  212 VAL B CB    1 
ATOM   3228 C  CG1   . VAL B 1 195 ? 30.230  5.554  12.949  1.00 67.83  ?  212 VAL B CG1   1 
ATOM   3229 C  CG2   . VAL B 1 195 ? 29.107  6.984  14.680  1.00 70.05  ?  212 VAL B CG2   1 
ATOM   3230 N  N     . ASN B 1 196 ? 27.397  4.354  12.160  1.00 57.98  ?  213 ASN B N     1 
ATOM   3231 C  CA    . ASN B 1 196 ? 26.416  4.589  11.107  1.00 55.77  ?  213 ASN B CA    1 
ATOM   3232 C  C     . ASN B 1 196 ? 25.081  3.910  11.397  1.00 55.97  ?  213 ASN B C     1 
ATOM   3233 O  O     . ASN B 1 196 ? 24.022  4.439  11.056  1.00 54.78  ?  213 ASN B O     1 
ATOM   3234 C  CB    . ASN B 1 196 ? 26.957  4.113  9.758   1.00 55.15  ?  213 ASN B CB    1 
ATOM   3235 C  CG    . ASN B 1 196 ? 27.891  5.120  9.119   1.00 54.92  ?  213 ASN B CG    1 
ATOM   3236 O  OD1   . ASN B 1 196 ? 28.237  6.134  9.725   1.00 55.40  ?  213 ASN B OD1   1 
ATOM   3237 N  ND2   . ASN B 1 196 ? 28.302  4.847  7.886   1.00 54.82  ?  213 ASN B ND2   1 
ATOM   3238 N  N     . GLU B 1 197 ? 25.137  2.737  12.021  1.00 97.24  ?  214 GLU B N     1 
ATOM   3239 C  CA    . GLU B 1 197 ? 23.926  2.019  12.409  1.00 97.64  ?  214 GLU B CA    1 
ATOM   3240 C  C     . GLU B 1 197 ? 23.110  2.829  13.407  1.00 98.18  ?  214 GLU B C     1 
ATOM   3241 O  O     . GLU B 1 197 ? 21.885  2.889  13.311  1.00 97.50  ?  214 GLU B O     1 
ATOM   3242 C  CB    . GLU B 1 197 ? 24.269  0.648  12.996  1.00 99.63  ?  214 GLU B CB    1 
ATOM   3243 C  CG    . GLU B 1 197 ? 24.694  -0.384 11.962  1.00 99.57  ?  214 GLU B CG    1 
ATOM   3244 C  CD    . GLU B 1 197 ? 23.626  -0.638 10.914  1.00 98.72  ?  214 GLU B CD    1 
ATOM   3245 O  OE1   . GLU B 1 197 ? 22.426  -0.610 11.262  1.00 98.86  ?  214 GLU B OE1   1 
ATOM   3246 O  OE2   . GLU B 1 197 ? 23.987  -0.865 9.740   1.00 98.23  -1 214 GLU B OE2   1 
ATOM   3247 N  N     . LYS B 1 198 ? 23.794  3.458  14.358  1.00 60.78  ?  215 LYS B N     1 
ATOM   3248 C  CA    . LYS B 1 198 ? 23.132  4.282  15.363  1.00 61.94  ?  215 LYS B CA    1 
ATOM   3249 C  C     . LYS B 1 198 ? 22.406  5.452  14.706  1.00 59.43  ?  215 LYS B C     1 
ATOM   3250 O  O     . LYS B 1 198 ? 21.418  5.960  15.235  1.00 60.13  ?  215 LYS B O     1 
ATOM   3251 C  CB    . LYS B 1 198 ? 24.142  4.796  16.391  1.00 63.88  ?  215 LYS B CB    1 
ATOM   3252 N  N     . PHE B 1 199 ? 22.906  5.872  13.549  1.00 56.91  ?  216 PHE B N     1 
ATOM   3253 C  CA    . PHE B 1 199 ? 22.268  6.926  12.773  1.00 54.67  ?  216 PHE B CA    1 
ATOM   3254 C  C     . PHE B 1 199 ? 21.068  6.369  12.010  1.00 54.03  ?  216 PHE B C     1 
ATOM   3255 O  O     . PHE B 1 199 ? 19.992  6.966  12.010  1.00 53.66  ?  216 PHE B O     1 
ATOM   3256 C  CB    . PHE B 1 199 ? 23.269  7.562  11.803  1.00 53.07  ?  216 PHE B CB    1 
ATOM   3257 C  CG    . PHE B 1 199 ? 22.810  8.874  11.224  1.00 51.42  ?  216 PHE B CG    1 
ATOM   3258 C  CD1   . PHE B 1 199 ? 21.886  8.911  10.192  1.00 49.86  ?  216 PHE B CD1   1 
ATOM   3259 C  CD2   . PHE B 1 199 ? 23.312  10.070 11.708  1.00 51.93  ?  216 PHE B CD2   1 
ATOM   3260 C  CE1   . PHE B 1 199 ? 21.467  10.115 9.659   1.00 48.58  ?  216 PHE B CE1   1 
ATOM   3261 C  CE2   . PHE B 1 199 ? 22.897  11.277 11.179  1.00 50.72  ?  216 PHE B CE2   1 
ATOM   3262 C  CZ    . PHE B 1 199 ? 21.973  11.300 10.153  1.00 48.90  ?  216 PHE B CZ    1 
ATOM   3263 N  N     . ARG B 1 200 ? 21.261  5.225  11.359  1.00 54.36  ?  217 ARG B N     1 
ATOM   3264 C  CA    . ARG B 1 200 ? 20.222  4.622  10.529  1.00 54.54  ?  217 ARG B CA    1 
ATOM   3265 C  C     . ARG B 1 200 ? 19.012  4.151  11.334  1.00 56.93  ?  217 ARG B C     1 
ATOM   3266 O  O     . ARG B 1 200 ? 17.893  4.127  10.821  1.00 57.36  ?  217 ARG B O     1 
ATOM   3267 C  CB    . ARG B 1 200 ? 20.789  3.442  9.731   1.00 55.16  ?  217 ARG B CB    1 
ATOM   3268 C  CG    . ARG B 1 200 ? 21.695  3.838  8.574   1.00 53.40  ?  217 ARG B CG    1 
ATOM   3269 C  CD    . ARG B 1 200 ? 22.046  2.635  7.707   1.00 54.57  ?  217 ARG B CD    1 
ATOM   3270 N  NE    . ARG B 1 200 ? 23.045  1.766  8.325   1.00 55.83  ?  217 ARG B NE    1 
ATOM   3271 C  CZ    . ARG B 1 200 ? 24.348  1.831  8.072   1.00 55.45  ?  217 ARG B CZ    1 
ATOM   3272 N  NH1   . ARG B 1 200 ? 24.814  2.722  7.208   1.00 54.10  1  217 ARG B NH1   1 
ATOM   3273 N  NH2   . ARG B 1 200 ? 25.187  1.001  8.677   1.00 56.89  ?  217 ARG B NH2   1 
ATOM   3274 N  N     . GLU B 1 201 ? 19.238  3.778  12.589  1.00 97.20  ?  218 GLU B N     1 
ATOM   3275 C  CA    . GLU B 1 201 ? 18.157  3.303  13.449  1.00 98.54  ?  218 GLU B CA    1 
ATOM   3276 C  C     . GLU B 1 201 ? 17.180  4.414  13.824  1.00 98.22  ?  218 GLU B C     1 
ATOM   3277 O  O     . GLU B 1 201 ? 16.037  4.145  14.194  1.00 99.04  ?  218 GLU B O     1 
ATOM   3278 C  CB    . GLU B 1 201 ? 18.730  2.671  14.719  1.00 100.99 ?  218 GLU B CB    1 
ATOM   3279 C  CG    . GLU B 1 201 ? 19.444  1.348  14.494  1.00 102.15 ?  218 GLU B CG    1 
ATOM   3280 C  CD    . GLU B 1 201 ? 20.228  0.896  15.712  1.00 104.63 ?  218 GLU B CD    1 
ATOM   3281 O  OE1   . GLU B 1 201 ? 20.172  1.592  16.748  1.00 105.74 ?  218 GLU B OE1   1 
ATOM   3282 O  OE2   . GLU B 1 201 ? 20.904  -0.151 15.631  1.00 105.91 -1 218 GLU B OE2   1 
ATOM   3283 N  N     . MET B 1 202 ? 17.632  5.659  13.726  1.00 63.16  ?  219 MET B N     1 
ATOM   3284 C  CA    . MET B 1 202 ? 16.797  6.801  14.079  1.00 63.38  ?  219 MET B CA    1 
ATOM   3285 C  C     . MET B 1 202 ? 16.003  7.320  12.883  1.00 60.73  ?  219 MET B C     1 
ATOM   3286 O  O     . MET B 1 202 ? 14.977  7.978  13.049  1.00 61.18  ?  219 MET B O     1 
ATOM   3287 C  CB    . MET B 1 202 ? 17.649  7.919  14.676  1.00 64.99  ?  219 MET B CB    1 
ATOM   3288 C  CG    . MET B 1 202 ? 18.407  7.495  15.920  1.00 67.73  ?  219 MET B CG    1 
ATOM   3289 S  SD    . MET B 1 202 ? 18.232  8.671  17.271  1.00 71.04  ?  219 MET B SD    1 
ATOM   3290 C  CE    . MET B 1 202 ? 16.511  8.434  17.700  1.00 70.49  ?  219 MET B CE    1 
ATOM   3291 N  N     . ILE B 1 203 ? 16.488  7.026  11.682  1.00 55.29  ?  220 ILE B N     1 
ATOM   3292 C  CA    . ILE B 1 203 ? 15.812  7.428  10.452  1.00 53.83  ?  220 ILE B CA    1 
ATOM   3293 C  C     . ILE B 1 203 ? 14.477  6.702  10.303  1.00 56.41  ?  220 ILE B C     1 
ATOM   3294 O  O     . ILE B 1 203 ? 14.419  5.479  10.429  1.00 58.84  ?  220 ILE B O     1 
ATOM   3295 C  CB    . ILE B 1 203 ? 16.692  7.144  9.217   1.00 52.20  ?  220 ILE B CB    1 
ATOM   3296 C  CG1   . ILE B 1 203 ? 17.974  7.973  9.279   1.00 50.28  ?  220 ILE B CG1   1 
ATOM   3297 C  CG2   . ILE B 1 203 ? 15.937  7.429  7.926   1.00 51.60  ?  220 ILE B CG2   1 
ATOM   3298 C  CD1   . ILE B 1 203 ? 18.936  7.670  8.161   1.00 49.39  ?  220 ILE B CD1   1 
ATOM   3299 N  N     . PRO B 1 204 ? 13.395  7.454  10.033  1.00 56.35  ?  221 PRO B N     1 
ATOM   3300 C  CA    . PRO B 1 204 ? 13.367  8.913  9.869   1.00 53.84  ?  221 PRO B CA    1 
ATOM   3301 C  C     . PRO B 1 204 ? 13.296  9.672  11.194  1.00 54.38  ?  221 PRO B C     1 
ATOM   3302 O  O     . PRO B 1 204 ? 12.463  9.354  12.042  1.00 57.21  ?  221 PRO B O     1 
ATOM   3303 C  CB    . PRO B 1 204 ? 12.099  9.141  9.046   1.00 54.50  ?  221 PRO B CB    1 
ATOM   3304 C  CG    . PRO B 1 204 ? 11.202  8.027  9.446   1.00 58.35  ?  221 PRO B CG    1 
ATOM   3305 C  CD    . PRO B 1 204 ? 12.087  6.843  9.735   1.00 59.32  ?  221 PRO B CD    1 
ATOM   3306 N  N     . PHE B 1 205 ? 14.174  10.658 11.362  1.00 55.35  ?  222 PHE B N     1 
ATOM   3307 C  CA    . PHE B 1 205 ? 14.239  11.439 12.594  1.00 56.31  ?  222 PHE B CA    1 
ATOM   3308 C  C     . PHE B 1 205 ? 12.920  12.144 12.896  1.00 57.37  ?  222 PHE B C     1 
ATOM   3309 O  O     . PHE B 1 205 ? 12.347  12.808 12.033  1.00 55.83  ?  222 PHE B O     1 
ATOM   3310 C  CB    . PHE B 1 205 ? 15.366  12.472 12.514  1.00 54.42  ?  222 PHE B CB    1 
ATOM   3311 C  CG    . PHE B 1 205 ? 16.742  11.885 12.651  1.00 54.47  ?  222 PHE B CG    1 
ATOM   3312 C  CD1   . PHE B 1 205 ? 17.373  11.301 11.565  1.00 52.97  ?  222 PHE B CD1   1 
ATOM   3313 C  CD2   . PHE B 1 205 ? 17.408  11.924 13.865  1.00 58.36  ?  222 PHE B CD2   1 
ATOM   3314 C  CE1   . PHE B 1 205 ? 18.640  10.763 11.688  1.00 53.25  ?  222 PHE B CE1   1 
ATOM   3315 C  CE2   . PHE B 1 205 ? 18.675  11.387 13.995  1.00 59.12  ?  222 PHE B CE2   1 
ATOM   3316 C  CZ    . PHE B 1 205 ? 19.291  10.806 12.905  1.00 55.67  ?  222 PHE B CZ    1 
ATOM   3317 N  N     . ALA B 1 206 ? 12.447  11.993 14.128  1.00 57.44  ?  223 ALA B N     1 
ATOM   3318 C  CA    . ALA B 1 206 ? 11.210  12.629 14.563  1.00 59.19  ?  223 ALA B CA    1 
ATOM   3319 C  C     . ALA B 1 206 ? 11.488  14.007 15.156  1.00 58.70  ?  223 ALA B C     1 
ATOM   3320 O  O     . ALA B 1 206 ? 11.842  14.124 16.328  1.00 61.08  ?  223 ALA B O     1 
ATOM   3321 C  CB    . ALA B 1 206 ? 10.493  11.747 15.574  1.00 63.68  ?  223 ALA B CB    1 
ATOM   3322 N  N     . VAL B 1 207 ? 11.325  15.050 14.346  1.00 56.14  ?  224 VAL B N     1 
ATOM   3323 C  CA    . VAL B 1 207 ? 11.640  16.406 14.787  1.00 55.85  ?  224 VAL B CA    1 
ATOM   3324 C  C     . VAL B 1 207 ? 10.390  17.211 15.132  1.00 57.32  ?  224 VAL B C     1 
ATOM   3325 O  O     . VAL B 1 207 ? 9.289   16.908 14.670  1.00 57.69  ?  224 VAL B O     1 
ATOM   3326 C  CB    . VAL B 1 207 ? 12.441  17.179 13.720  1.00 52.58  ?  224 VAL B CB    1 
ATOM   3327 C  CG1   . VAL B 1 207 ? 13.631  16.357 13.253  1.00 51.36  ?  224 VAL B CG1   1 
ATOM   3328 C  CG2   . VAL B 1 207 ? 11.550  17.545 12.546  1.00 50.77  ?  224 VAL B CG2   1 
ATOM   3329 N  N     . VAL B 1 208 ? 10.576  18.241 15.953  1.00 59.06  ?  225 VAL B N     1 
ATOM   3330 C  CA    . VAL B 1 208 ? 9.496   19.142 16.340  1.00 60.67  ?  225 VAL B CA    1 
ATOM   3331 C  C     . VAL B 1 208 ? 10.000  20.582 16.376  1.00 59.92  ?  225 VAL B C     1 
ATOM   3332 O  O     . VAL B 1 208 ? 10.976  20.889 17.062  1.00 61.21  ?  225 VAL B O     1 
ATOM   3333 C  CB    . VAL B 1 208 ? 8.905   18.778 17.721  1.00 65.39  ?  225 VAL B CB    1 
ATOM   3334 C  CG1   . VAL B 1 208 ? 7.956   19.868 18.199  1.00 67.42  ?  225 VAL B CG1   1 
ATOM   3335 C  CG2   . VAL B 1 208 ? 8.195   17.431 17.672  1.00 67.04  ?  225 VAL B CG2   1 
ATOM   3336 N  N     . GLY B 1 209 ? 9.335   21.460 15.632  1.00 91.85  ?  226 GLY B N     1 
ATOM   3337 C  CA    . GLY B 1 209 ? 9.692   22.867 15.613  1.00 94.41  ?  226 GLY B CA    1 
ATOM   3338 C  C     . GLY B 1 209 ? 9.384   23.562 16.925  1.00 95.88  ?  226 GLY B C     1 
ATOM   3339 O  O     . GLY B 1 209 ? 8.367   24.243 17.056  1.00 95.44  ?  226 GLY B O     1 
ATOM   3340 N  N     . GLU B 1 240 ? 13.603  14.572 18.693  1.00 77.31  ?  257 GLU B N     1 
ATOM   3341 C  CA    . GLU B 1 240 ? 14.889  13.971 18.366  1.00 77.61  ?  257 GLU B CA    1 
ATOM   3342 C  C     . GLU B 1 240 ? 15.738  14.920 17.529  1.00 78.93  ?  257 GLU B C     1 
ATOM   3343 O  O     . GLU B 1 240 ? 16.712  14.507 16.901  1.00 78.44  ?  257 GLU B O     1 
ATOM   3344 C  CB    . GLU B 1 240 ? 14.685  12.655 17.612  1.00 74.81  ?  257 GLU B CB    1 
ATOM   3345 C  CG    . GLU B 1 240 ? 13.866  11.621 18.365  1.00 73.79  ?  257 GLU B CG    1 
ATOM   3346 C  CD    . GLU B 1 240 ? 13.637  10.360 17.553  1.00 71.59  ?  257 GLU B CD    1 
ATOM   3347 O  OE1   . GLU B 1 240 ? 13.669  10.441 16.307  1.00 69.67  ?  257 GLU B OE1   1 
ATOM   3348 O  OE2   . GLU B 1 240 ? 13.428  9.288  18.160  1.00 72.58  -1 257 GLU B OE2   1 
ATOM   3349 N  N     . PHE B 1 241 ? 15.362  16.195 17.526  1.00 81.26  ?  258 PHE B N     1 
ATOM   3350 C  CA    . PHE B 1 241 ? 16.063  17.196 16.731  1.00 79.60  ?  258 PHE B CA    1 
ATOM   3351 C  C     . PHE B 1 241 ? 17.427  17.546 17.315  1.00 79.15  ?  258 PHE B C     1 
ATOM   3352 O  O     . PHE B 1 241 ? 18.382  17.787 16.574  1.00 77.85  ?  258 PHE B O     1 
ATOM   3353 C  CB    . PHE B 1 241 ? 15.219  18.464 16.598  1.00 80.08  ?  258 PHE B CB    1 
ATOM   3354 C  CG    . PHE B 1 241 ? 15.947  19.604 15.950  1.00 79.06  ?  258 PHE B CG    1 
ATOM   3355 C  CD1   . PHE B 1 241 ? 16.170  19.609 14.583  1.00 77.79  ?  258 PHE B CD1   1 
ATOM   3356 C  CD2   . PHE B 1 241 ? 16.411  20.669 16.705  1.00 79.59  ?  258 PHE B CD2   1 
ATOM   3357 C  CE1   . PHE B 1 241 ? 16.842  20.652 13.981  1.00 76.92  ?  258 PHE B CE1   1 
ATOM   3358 C  CE2   . PHE B 1 241 ? 17.083  21.716 16.108  1.00 79.03  ?  258 PHE B CE2   1 
ATOM   3359 C  CZ    . PHE B 1 241 ? 17.298  21.707 14.744  1.00 77.66  ?  258 PHE B CZ    1 
ATOM   3360 N  N     . ALA B 1 242 ? 17.508  17.584 18.641  1.00 67.16  ?  259 ALA B N     1 
ATOM   3361 C  CA    . ALA B 1 242 ? 18.758  17.895 19.326  1.00 67.94  ?  259 ALA B CA    1 
ATOM   3362 C  C     . ALA B 1 242 ? 19.831  16.878 18.964  1.00 68.01  ?  259 ALA B C     1 
ATOM   3363 O  O     . ALA B 1 242 ? 20.984  17.234 18.720  1.00 67.18  ?  259 ALA B O     1 
ATOM   3364 C  CB    . ALA B 1 242 ? 18.546  17.935 20.831  1.00 71.01  ?  259 ALA B CB    1 
ATOM   3365 N  N     . TYR B 1 243 ? 19.441  15.609 18.935  1.00 77.42  ?  260 TYR B N     1 
ATOM   3366 C  CA    . TYR B 1 243 ? 20.342  14.534 18.544  1.00 79.26  ?  260 TYR B CA    1 
ATOM   3367 C  C     . TYR B 1 243 ? 20.733  14.670 17.074  1.00 75.83  ?  260 TYR B C     1 
ATOM   3368 O  O     . TYR B 1 243 ? 21.906  14.551 16.723  1.00 75.63  ?  260 TYR B O     1 
ATOM   3369 C  CB    . TYR B 1 243 ? 19.694  13.174 18.806  1.00 83.29  ?  260 TYR B CB    1 
ATOM   3370 C  CG    . TYR B 1 243 ? 20.675  12.026 18.867  1.00 86.84  ?  260 TYR B CG    1 
ATOM   3371 C  CD1   . TYR B 1 243 ? 21.657  11.978 19.847  1.00 89.10  ?  260 TYR B CD1   1 
ATOM   3372 C  CD2   . TYR B 1 243 ? 20.613  10.985 17.951  1.00 88.37  ?  260 TYR B CD2   1 
ATOM   3373 C  CE1   . TYR B 1 243 ? 22.556  10.929 19.909  1.00 92.18  ?  260 TYR B CE1   1 
ATOM   3374 C  CE2   . TYR B 1 243 ? 21.505  9.930  18.007  1.00 91.81  ?  260 TYR B CE2   1 
ATOM   3375 C  CZ    . TYR B 1 243 ? 22.474  9.908  18.986  1.00 93.44  ?  260 TYR B CZ    1 
ATOM   3376 O  OH    . TYR B 1 243 ? 23.364  8.860  19.041  1.00 96.85  ?  260 TYR B OH    1 
ATOM   3377 N  N     . LEU B 1 244 ? 19.740  14.921 16.223  1.00 58.87  ?  261 LEU B N     1 
ATOM   3378 C  CA    . LEU B 1 244 ? 19.958  15.065 14.784  1.00 57.49  ?  261 LEU B CA    1 
ATOM   3379 C  C     . LEU B 1 244 ? 20.927  16.193 14.450  1.00 56.49  ?  261 LEU B C     1 
ATOM   3380 O  O     . LEU B 1 244 ? 21.797  16.040 13.592  1.00 55.69  ?  261 LEU B O     1 
ATOM   3381 C  CB    . LEU B 1 244 ? 18.630  15.305 14.063  1.00 57.46  ?  261 LEU B CB    1 
ATOM   3382 C  CG    . LEU B 1 244 ? 18.733  15.552 12.555  1.00 56.37  ?  261 LEU B CG    1 
ATOM   3383 C  CD1   . LEU B 1 244 ? 19.320  14.341 11.845  1.00 56.31  ?  261 LEU B CD1   1 
ATOM   3384 C  CD2   . LEU B 1 244 ? 17.378  15.918 11.969  1.00 56.82  ?  261 LEU B CD2   1 
ATOM   3385 N  N     . ARG B 1 245 ? 20.762  17.326 15.125  1.00 76.26  ?  262 ARG B N     1 
ATOM   3386 C  CA    . ARG B 1 245 ? 21.620  18.485 14.909  1.00 75.80  ?  262 ARG B CA    1 
ATOM   3387 C  C     . ARG B 1 245 ? 23.082  18.144 15.177  1.00 75.95  ?  262 ARG B C     1 
ATOM   3388 O  O     . ARG B 1 245 ? 23.945  18.381 14.334  1.00 75.09  ?  262 ARG B O     1 
ATOM   3389 C  CB    . ARG B 1 245 ? 21.179  19.653 15.793  1.00 76.91  ?  262 ARG B CB    1 
ATOM   3390 C  CG    . ARG B 1 245 ? 22.060  20.886 15.678  1.00 77.10  ?  262 ARG B CG    1 
ATOM   3391 C  CD    . ARG B 1 245 ? 21.768  21.869 16.798  1.00 78.99  ?  262 ARG B CD    1 
ATOM   3392 N  NE    . ARG B 1 245 ? 21.950  21.261 18.113  1.00 80.62  ?  262 ARG B NE    1 
ATOM   3393 C  CZ    . ARG B 1 245 ? 21.431  21.743 19.237  1.00 82.44  ?  262 ARG B CZ    1 
ATOM   3394 N  NH1   . ARG B 1 245 ? 20.694  22.845 19.211  1.00 82.86  1  262 ARG B NH1   1 
ATOM   3395 N  NH2   . ARG B 1 245 ? 21.649  21.122 20.389  1.00 84.45  ?  262 ARG B NH2   1 
ATOM   3396 N  N     . ASP B 1 246 ? 23.350  17.583 16.352  1.00 72.83  ?  263 ASP B N     1 
ATOM   3397 C  CA    . ASP B 1 246 ? 24.708  17.221 16.743  1.00 74.17  ?  263 ASP B CA    1 
ATOM   3398 C  C     . ASP B 1 246 ? 25.321  16.196 15.792  1.00 73.59  ?  263 ASP B C     1 
ATOM   3399 O  O     . ASP B 1 246 ? 26.504  16.275 15.469  1.00 73.52  ?  263 ASP B O     1 
ATOM   3400 C  CB    . ASP B 1 246 ? 24.725  16.681 18.174  1.00 77.75  ?  263 ASP B CB    1 
ATOM   3401 C  CG    . ASP B 1 246 ? 24.445  17.756 19.205  1.00 79.10  ?  263 ASP B CG    1 
ATOM   3402 O  OD1   . ASP B 1 246 ? 24.651  18.948 18.892  1.00 77.52  ?  263 ASP B OD1   1 
ATOM   3403 O  OD2   . ASP B 1 246 ? 24.019  17.411 20.328  1.00 82.02  -1 263 ASP B OD2   1 
ATOM   3404 N  N     . LEU B 1 247 ? 24.516  15.235 15.350  1.00 59.43  ?  264 LEU B N     1 
ATOM   3405 C  CA    . LEU B 1 247 ? 24.991  14.213 14.422  1.00 59.17  ?  264 LEU B CA    1 
ATOM   3406 C  C     . LEU B 1 247 ? 25.430  14.823 13.095  1.00 57.83  ?  264 LEU B C     1 
ATOM   3407 O  O     . LEU B 1 247 ? 26.480  14.474 12.560  1.00 57.89  ?  264 LEU B O     1 
ATOM   3408 C  CB    . LEU B 1 247 ? 23.907  13.162 14.173  1.00 59.51  ?  264 LEU B CB    1 
ATOM   3409 C  CG    . LEU B 1 247 ? 23.577  12.202 15.316  1.00 61.28  ?  264 LEU B CG    1 
ATOM   3410 C  CD1   . LEU B 1 247 ? 22.430  11.289 14.918  1.00 61.84  ?  264 LEU B CD1   1 
ATOM   3411 C  CD2   . LEU B 1 247 ? 24.800  11.391 15.714  1.00 62.59  ?  264 LEU B CD2   1 
ATOM   3412 N  N     . LEU B 1 248 ? 24.624  15.742 12.576  1.00 54.97  ?  265 LEU B N     1 
ATOM   3413 C  CA    . LEU B 1 248 ? 24.894  16.363 11.285  1.00 53.95  ?  265 LEU B CA    1 
ATOM   3414 C  C     . LEU B 1 248 ? 26.019  17.392 11.366  1.00 54.00  ?  265 LEU B C     1 
ATOM   3415 O  O     . LEU B 1 248 ? 26.789  17.558 10.421  1.00 53.63  ?  265 LEU B O     1 
ATOM   3416 C  CB    . LEU B 1 248 ? 23.627  17.025 10.743  1.00 53.44  ?  265 LEU B CB    1 
ATOM   3417 C  CG    . LEU B 1 248 ? 22.503  16.088 10.295  1.00 53.61  ?  265 LEU B CG    1 
ATOM   3418 C  CD1   . LEU B 1 248 ? 21.323  16.886 9.766   1.00 53.48  ?  265 LEU B CD1   1 
ATOM   3419 C  CD2   . LEU B 1 248 ? 23.000  15.102 9.251   1.00 53.53  ?  265 LEU B CD2   1 
ATOM   3420 N  N     . ILE B 1 249 ? 26.102  18.084 12.497  1.00 54.79  ?  266 ILE B N     1 
ATOM   3421 C  CA    . ILE B 1 249 ? 27.057  19.175 12.668  1.00 55.37  ?  266 ILE B CA    1 
ATOM   3422 C  C     . ILE B 1 249 ? 28.397  18.712 13.239  1.00 56.47  ?  266 ILE B C     1 
ATOM   3423 O  O     . ILE B 1 249 ? 29.453  19.172 12.806  1.00 56.84  ?  266 ILE B O     1 
ATOM   3424 C  CB    . ILE B 1 249 ? 26.471  20.277 13.577  1.00 56.20  ?  266 ILE B CB    1 
ATOM   3425 C  CG1   . ILE B 1 249 ? 25.233  20.897 12.923  1.00 55.51  ?  266 ILE B CG1   1 
ATOM   3426 C  CG2   . ILE B 1 249 ? 27.494  21.363 13.842  1.00 57.38  ?  266 ILE B CG2   1 
ATOM   3427 C  CD1   . ILE B 1 249 ? 25.477  21.411 11.519  1.00 54.76  ?  266 ILE B CD1   1 
ATOM   3428 N  N     . ARG B 1 250 ? 28.359  17.799 14.203  1.00 57.32  ?  267 ARG B N     1 
ATOM   3429 C  CA    . ARG B 1 250 ? 29.583  17.346 14.856  1.00 58.87  ?  267 ARG B CA    1 
ATOM   3430 C  C     . ARG B 1 250 ? 30.080  16.003 14.324  1.00 58.94  ?  267 ARG B C     1 
ATOM   3431 O  O     . ARG B 1 250 ? 31.131  15.929 13.688  1.00 59.22  ?  267 ARG B O     1 
ATOM   3432 C  CB    . ARG B 1 250 ? 29.373  17.254 16.370  1.00 60.46  ?  267 ARG B CB    1 
ATOM   3433 N  N     . THR B 1 251 ? 29.321  14.946 14.592  1.00 60.74  ?  268 THR B N     1 
ATOM   3434 C  CA    . THR B 1 251 ? 29.765  13.583 14.315  1.00 61.55  ?  268 THR B CA    1 
ATOM   3435 C  C     . THR B 1 251 ? 29.919  13.256 12.828  1.00 60.50  ?  268 THR B C     1 
ATOM   3436 O  O     . THR B 1 251 ? 30.976  12.795 12.397  1.00 61.31  ?  268 THR B O     1 
ATOM   3437 C  CB    . THR B 1 251 ? 28.796  12.554 14.932  1.00 62.25  ?  268 THR B CB    1 
ATOM   3438 O  OG1   . THR B 1 251 ? 28.632  12.826 16.330  1.00 63.46  ?  268 THR B OG1   1 
ATOM   3439 C  CG2   . THR B 1 251 ? 29.332  11.142 14.753  1.00 63.74  ?  268 THR B CG2   1 
ATOM   3440 N  N     . HIS B 1 252 ? 28.871  13.500 12.048  1.00 57.28  ?  269 HIS B N     1 
ATOM   3441 C  CA    . HIS B 1 252 ? 28.842  13.054 10.656  1.00 56.62  ?  269 HIS B CA    1 
ATOM   3442 C  C     . HIS B 1 252 ? 29.151  14.154 9.643   1.00 55.43  ?  269 HIS B C     1 
ATOM   3443 O  O     . HIS B 1 252 ? 29.049  13.928 8.439   1.00 54.94  ?  269 HIS B O     1 
ATOM   3444 C  CB    . HIS B 1 252 ? 27.473  12.450 10.330  1.00 56.30  ?  269 HIS B CB    1 
ATOM   3445 C  CG    . HIS B 1 252 ? 27.196  11.158 11.032  1.00 57.87  ?  269 HIS B CG    1 
ATOM   3446 N  ND1   . HIS B 1 252 ? 27.286  9.934  10.404  1.00 58.97  ?  269 HIS B ND1   1 
ATOM   3447 C  CD2   . HIS B 1 252 ? 26.823  10.899 12.308  1.00 58.85  ?  269 HIS B CD2   1 
ATOM   3448 C  CE1   . HIS B 1 252 ? 26.984  8.977  11.263  1.00 60.64  ?  269 HIS B CE1   1 
ATOM   3449 N  NE2   . HIS B 1 252 ? 26.699  9.535  12.426  1.00 60.54  ?  269 HIS B NE2   1 
ATOM   3450 N  N     . MET B 1 253 ? 29.534  15.332 10.126  1.00 55.33  ?  270 MET B N     1 
ATOM   3451 C  CA    . MET B 1 253 ? 29.701  16.497 9.258   1.00 54.53  ?  270 MET B CA    1 
ATOM   3452 C  C     . MET B 1 253 ? 30.720  16.270 8.142   1.00 54.71  ?  270 MET B C     1 
ATOM   3453 O  O     . MET B 1 253 ? 30.405  16.442 6.964   1.00 53.97  ?  270 MET B O     1 
ATOM   3454 C  CB    . MET B 1 253 ? 30.104  17.718 10.088  1.00 55.10  ?  270 MET B CB    1 
ATOM   3455 C  CG    . MET B 1 253 ? 30.013  19.043 9.343   1.00 54.64  ?  270 MET B CG    1 
ATOM   3456 S  SD    . MET B 1 253 ? 31.554  19.520 8.539   1.00 55.43  ?  270 MET B SD    1 
ATOM   3457 C  CE    . MET B 1 253 ? 32.693  19.432 9.919   1.00 57.34  ?  270 MET B CE    1 
ATOM   3458 N  N     . GLN B 1 254 ? 31.937  15.886 8.513   1.00 55.98  ?  271 GLN B N     1 
ATOM   3459 C  CA    . GLN B 1 254 ? 33.010  15.712 7.538   1.00 56.53  ?  271 GLN B CA    1 
ATOM   3460 C  C     . GLN B 1 254 ? 32.774  14.498 6.643   1.00 56.51  ?  271 GLN B C     1 
ATOM   3461 O  O     . GLN B 1 254 ? 33.148  14.501 5.470   1.00 56.48  ?  271 GLN B O     1 
ATOM   3462 C  CB    . GLN B 1 254 ? 34.362  15.586 8.246   1.00 58.36  ?  271 GLN B CB    1 
ATOM   3463 C  CG    . GLN B 1 254 ? 35.562  15.667 7.312   1.00 59.26  ?  271 GLN B CG    1 
ATOM   3464 C  CD    . GLN B 1 254 ? 35.568  16.932 6.473   1.00 58.51  ?  271 GLN B CD    1 
ATOM   3465 O  OE1   . GLN B 1 254 ? 35.479  18.041 7.000   1.00 58.55  ?  271 GLN B OE1   1 
ATOM   3466 N  NE2   . GLN B 1 254 ? 35.674  16.770 5.159   1.00 58.17  ?  271 GLN B NE2   1 
ATOM   3467 N  N     . ASN B 1 255 ? 32.150  13.464 7.199   1.00 56.85  ?  272 ASN B N     1 
ATOM   3468 C  CA    . ASN B 1 255 ? 31.854  12.254 6.440   1.00 57.34  ?  272 ASN B CA    1 
ATOM   3469 C  C     . ASN B 1 255 ? 30.811  12.517 5.357   1.00 56.12  ?  272 ASN B C     1 
ATOM   3470 O  O     . ASN B 1 255 ? 30.884  11.957 4.264   1.00 56.56  ?  272 ASN B O     1 
ATOM   3471 C  CB    . ASN B 1 255 ? 31.379  11.140 7.373   1.00 58.41  ?  272 ASN B CB    1 
ATOM   3472 C  CG    . ASN B 1 255 ? 31.247  9.804  6.668   1.00 59.68  ?  272 ASN B CG    1 
ATOM   3473 O  OD1   . ASN B 1 255 ? 31.955  9.527  5.700   1.00 60.32  ?  272 ASN B OD1   1 
ATOM   3474 N  ND2   . ASN B 1 255 ? 30.342  8.963  7.157   1.00 60.38  ?  272 ASN B ND2   1 
ATOM   3475 N  N     . ILE B 1 256 ? 29.841  13.369 5.674   1.00 54.91  ?  273 ILE B N     1 
ATOM   3476 C  CA    . ILE B 1 256 ? 28.834  13.791 4.706   1.00 54.02  ?  273 ILE B CA    1 
ATOM   3477 C  C     . ILE B 1 256 ? 29.496  14.546 3.556   1.00 53.77  ?  273 ILE B C     1 
ATOM   3478 O  O     . ILE B 1 256 ? 29.213  14.292 2.385   1.00 53.92  ?  273 ILE B O     1 
ATOM   3479 C  CB    . ILE B 1 256 ? 27.755  14.679 5.358   1.00 53.15  ?  273 ILE B CB    1 
ATOM   3480 C  CG1   . ILE B 1 256 ? 26.850  13.840 6.259   1.00 53.59  ?  273 ILE B CG1   1 
ATOM   3481 C  CG2   . ILE B 1 256 ? 26.915  15.373 4.299   1.00 52.55  ?  273 ILE B CG2   1 
ATOM   3482 C  CD1   . ILE B 1 256 ? 25.897  14.659 7.093   1.00 53.07  ?  273 ILE B CD1   1 
ATOM   3483 N  N     . LYS B 1 257 ? 30.387  15.469 3.908   1.00 53.72  ?  274 LYS B N     1 
ATOM   3484 C  CA    . LYS B 1 257 ? 31.106  16.280 2.931   1.00 53.81  ?  274 LYS B CA    1 
ATOM   3485 C  C     . LYS B 1 257 ? 31.971  15.433 2.002   1.00 54.77  ?  274 LYS B C     1 
ATOM   3486 O  O     . LYS B 1 257 ? 32.060  15.705 0.805   1.00 54.88  ?  274 LYS B O     1 
ATOM   3487 C  CB    . LYS B 1 257 ? 31.980  17.311 3.651   1.00 54.17  ?  274 LYS B CB    1 
ATOM   3488 C  CG    . LYS B 1 257 ? 31.204  18.351 4.441   1.00 53.62  ?  274 LYS B CG    1 
ATOM   3489 C  CD    . LYS B 1 257 ? 32.114  19.478 4.909   1.00 54.48  ?  274 LYS B CD    1 
ATOM   3490 C  CE    . LYS B 1 257 ? 32.894  20.094 3.760   1.00 55.06  ?  274 LYS B CE    1 
ATOM   3491 N  NZ    . LYS B 1 257 ? 32.011  20.698 2.730   1.00 54.46  1  274 LYS B NZ    1 
ATOM   3492 N  N     . ASP B 1 258 ? 32.606  14.407 2.560   1.00 55.75  ?  275 ASP B N     1 
ATOM   3493 C  CA    . ASP B 1 258 ? 33.473  13.523 1.787   1.00 57.10  ?  275 ASP B CA    1 
ATOM   3494 C  C     . ASP B 1 258 ? 32.695  12.727 0.741   1.00 57.31  ?  275 ASP B C     1 
ATOM   3495 O  O     . ASP B 1 258 ? 33.186  12.490 -0.362  1.00 58.17  ?  275 ASP B O     1 
ATOM   3496 C  CB    . ASP B 1 258 ? 34.229  12.573 2.716   1.00 58.52  ?  275 ASP B CB    1 
ATOM   3497 C  CG    . ASP B 1 258 ? 35.326  13.273 3.495   1.00 59.12  ?  275 ASP B CG    1 
ATOM   3498 O  OD1   . ASP B 1 258 ? 35.673  14.418 3.137   1.00 58.69  ?  275 ASP B OD1   1 
ATOM   3499 O  OD2   . ASP B 1 258 ? 35.844  12.676 4.463   1.00 60.37  -1 275 ASP B OD2   1 
ATOM   3500 N  N     . ILE B 1 259 ? 31.482  12.316 1.095   1.00 56.82  ?  276 ILE B N     1 
ATOM   3501 C  CA    . ILE B 1 259 ? 30.628  11.572 0.177   1.00 57.39  ?  276 ILE B CA    1 
ATOM   3502 C  C     . ILE B 1 259 ? 30.051  12.515 -0.877  1.00 56.61  ?  276 ILE B C     1 
ATOM   3503 O  O     . ILE B 1 259 ? 29.834  12.126 -2.025  1.00 57.51  ?  276 ILE B O     1 
ATOM   3504 C  CB    . ILE B 1 259 ? 29.489  10.846 0.926   1.00 57.53  ?  276 ILE B CB    1 
ATOM   3505 C  CG1   . ILE B 1 259 ? 30.067  9.848  1.930   1.00 58.76  ?  276 ILE B CG1   1 
ATOM   3506 C  CG2   . ILE B 1 259 ? 28.568  10.126 -0.047  1.00 58.54  ?  276 ILE B CG2   1 
ATOM   3507 C  CD1   . ILE B 1 259 ? 29.022  9.167  2.788   1.00 59.16  ?  276 ILE B CD1   1 
ATOM   3508 N  N     . THR B 1 260 ? 29.826  13.764 -0.484  1.00 55.30  ?  277 THR B N     1 
ATOM   3509 C  CA    . THR B 1 260 ? 29.316  14.775 -1.402  1.00 54.87  ?  277 THR B CA    1 
ATOM   3510 C  C     . THR B 1 260 ? 30.305  15.018 -2.540  1.00 55.65  ?  277 THR B C     1 
ATOM   3511 O  O     . THR B 1 260 ? 29.911  15.181 -3.695  1.00 56.17  ?  277 THR B O     1 
ATOM   3512 C  CB    . THR B 1 260 ? 29.037  16.105 -0.673  1.00 53.78  ?  277 THR B CB    1 
ATOM   3513 O  OG1   . THR B 1 260 ? 28.099  15.882 0.388   1.00 53.25  ?  277 THR B OG1   1 
ATOM   3514 C  CG2   . THR B 1 260 ? 28.474  17.142 -1.634  1.00 53.78  ?  277 THR B CG2   1 
ATOM   3515 N  N     . SER B 1 261 ? 31.592  15.027 -2.207  1.00 71.47  ?  278 SER B N     1 
ATOM   3516 C  CA    . SER B 1 261 ? 32.640  15.281 -3.189  1.00 71.78  ?  278 SER B CA    1 
ATOM   3517 C  C     . SER B 1 261 ? 32.974  14.048 -4.028  1.00 76.62  ?  278 SER B C     1 
ATOM   3518 O  O     . SER B 1 261 ? 32.878  14.076 -5.255  1.00 79.29  ?  278 SER B O     1 
ATOM   3519 C  CB    . SER B 1 261 ? 33.905  15.786 -2.491  1.00 71.24  ?  278 SER B CB    1 
ATOM   3520 O  OG    . SER B 1 261 ? 33.651  16.981 -1.773  1.00 70.59  ?  278 SER B OG    1 
ATOM   3521 N  N     . SER B 1 262 ? 33.364  12.969 -3.358  1.00 62.37  ?  279 SER B N     1 
ATOM   3522 C  CA    . SER B 1 262 ? 33.883  11.783 -4.035  1.00 64.31  ?  279 SER B CA    1 
ATOM   3523 C  C     . SER B 1 262 ? 32.823  10.975 -4.782  1.00 66.60  ?  279 SER B C     1 
ATOM   3524 O  O     . SER B 1 262 ? 33.144  10.248 -5.722  1.00 71.68  ?  279 SER B O     1 
ATOM   3525 C  CB    . SER B 1 262 ? 34.591  10.876 -3.025  1.00 65.29  ?  279 SER B CB    1 
ATOM   3526 O  OG    . SER B 1 262 ? 33.693  10.427 -2.025  1.00 64.63  ?  279 SER B OG    1 
ATOM   3527 N  N     . ILE B 1 263 ? 31.566  11.096 -4.369  1.00 63.66  ?  280 ILE B N     1 
ATOM   3528 C  CA    . ILE B 1 263 ? 30.501  10.296 -4.969  1.00 64.76  ?  280 ILE B CA    1 
ATOM   3529 C  C     . ILE B 1 263 ? 29.525  11.129 -5.796  1.00 64.23  ?  280 ILE B C     1 
ATOM   3530 O  O     . ILE B 1 263 ? 29.408  10.936 -7.007  1.00 67.49  ?  280 ILE B O     1 
ATOM   3531 C  CB    . ILE B 1 263 ? 29.705  9.528  -3.896  1.00 64.91  ?  280 ILE B CB    1 
ATOM   3532 C  CG1   . ILE B 1 263 ? 30.645  8.664  -3.053  1.00 65.71  ?  280 ILE B CG1   1 
ATOM   3533 C  CG2   . ILE B 1 263 ? 28.630  8.670  -4.544  1.00 72.99  ?  280 ILE B CG2   1 
ATOM   3534 C  CD1   . ILE B 1 263 ? 31.457  7.676  -3.865  1.00 69.60  ?  280 ILE B CD1   1 
ATOM   3535 N  N     . HIS B 1 264 ? 28.827  12.051 -5.141  1.00 59.67  ?  281 HIS B N     1 
ATOM   3536 C  CA    . HIS B 1 264 ? 27.780  12.827 -5.797  1.00 59.47  ?  281 HIS B CA    1 
ATOM   3537 C  C     . HIS B 1 264 ? 28.334  13.819 -6.816  1.00 59.62  ?  281 HIS B C     1 
ATOM   3538 O  O     . HIS B 1 264 ? 27.781  13.970 -7.906  1.00 60.74  ?  281 HIS B O     1 
ATOM   3539 C  CB    . HIS B 1 264 ? 26.944  13.576 -4.756  1.00 57.89  ?  281 HIS B CB    1 
ATOM   3540 C  CG    . HIS B 1 264 ? 26.226  12.679 -3.797  1.00 57.96  ?  281 HIS B CG    1 
ATOM   3541 N  ND1   . HIS B 1 264 ? 25.204  11.840 -4.186  1.00 59.41  ?  281 HIS B ND1   1 
ATOM   3542 C  CD2   . HIS B 1 264 ? 26.381  12.491 -2.465  1.00 57.10  ?  281 HIS B CD2   1 
ATOM   3543 C  CE1   . HIS B 1 264 ? 24.761  11.173 -3.135  1.00 59.41  ?  281 HIS B CE1   1 
ATOM   3544 N  NE2   . HIS B 1 264 ? 25.459  11.549 -2.078  1.00 57.98  ?  281 HIS B NE2   1 
ATOM   3545 N  N     . PHE B 1 265 ? 29.426  14.488 -6.463  1.00 58.84  ?  282 PHE B N     1 
ATOM   3546 C  CA    . PHE B 1 265 ? 30.019  15.492 -7.340  1.00 59.20  ?  282 PHE B CA    1 
ATOM   3547 C  C     . PHE B 1 265 ? 30.735  14.847 -8.523  1.00 61.03  ?  282 PHE B C     1 
ATOM   3548 O  O     . PHE B 1 265 ? 30.724  15.383 -9.631  1.00 62.02  ?  282 PHE B O     1 
ATOM   3549 C  CB    . PHE B 1 265 ? 30.986  16.383 -6.557  1.00 58.26  ?  282 PHE B CB    1 
ATOM   3550 C  CG    . PHE B 1 265 ? 31.704  17.392 -7.406  1.00 59.01  ?  282 PHE B CG    1 
ATOM   3551 C  CD1   . PHE B 1 265 ? 31.047  18.520 -7.868  1.00 59.07  ?  282 PHE B CD1   1 
ATOM   3552 C  CD2   . PHE B 1 265 ? 33.039  17.219 -7.733  1.00 60.00  ?  282 PHE B CD2   1 
ATOM   3553 C  CE1   . PHE B 1 265 ? 31.703  19.452 -8.648  1.00 60.12  ?  282 PHE B CE1   1 
ATOM   3554 C  CE2   . PHE B 1 265 ? 33.702  18.148 -8.512  1.00 60.98  ?  282 PHE B CE2   1 
ATOM   3555 C  CZ    . PHE B 1 265 ? 33.033  19.267 -8.970  1.00 61.05  ?  282 PHE B CZ    1 
ATOM   3556 N  N     . GLU B 1 266 ? 31.357  13.697 -8.283  1.00 65.49  ?  283 GLU B N     1 
ATOM   3557 C  CA    . GLU B 1 266 ? 32.044  12.971 -9.345  1.00 70.88  ?  283 GLU B CA    1 
ATOM   3558 C  C     . GLU B 1 266 ? 31.035  12.424 -10.349 1.00 78.81  ?  283 GLU B C     1 
ATOM   3559 O  O     . GLU B 1 266 ? 31.327  12.314 -11.540 1.00 83.05  ?  283 GLU B O     1 
ATOM   3560 C  CB    . GLU B 1 266 ? 32.889  11.835 -8.765  1.00 72.51  ?  283 GLU B CB    1 
ATOM   3561 N  N     . ALA B 1 267 ? 29.849  12.080 -9.855  1.00 74.28  ?  284 ALA B N     1 
ATOM   3562 C  CA    . ALA B 1 267 ? 28.755  11.637 -10.711 1.00 82.19  ?  284 ALA B CA    1 
ATOM   3563 C  C     . ALA B 1 267 ? 28.307  12.775 -11.621 1.00 80.56  ?  284 ALA B C     1 
ATOM   3564 O  O     . ALA B 1 267 ? 27.954  12.560 -12.780 1.00 87.20  ?  284 ALA B O     1 
ATOM   3565 C  CB    . ALA B 1 267 ? 27.592  11.132 -9.873  1.00 84.12  ?  284 ALA B CB    1 
ATOM   3566 N  N     . TYR B 1 268 ? 28.314  13.988 -11.078 1.00 88.76  ?  285 TYR B N     1 
ATOM   3567 C  CA    . TYR B 1 268 ? 27.987  15.180 -11.849 1.00 86.25  ?  285 TYR B CA    1 
ATOM   3568 C  C     . TYR B 1 268 ? 29.096  15.517 -12.837 1.00 86.35  ?  285 TYR B C     1 
ATOM   3569 O  O     . TYR B 1 268 ? 28.830  15.909 -13.974 1.00 89.45  ?  285 TYR B O     1 
ATOM   3570 C  CB    . TYR B 1 268 ? 27.732  16.371 -10.922 1.00 77.65  ?  285 TYR B CB    1 
ATOM   3571 C  CG    . TYR B 1 268 ? 27.459  17.666 -11.655 1.00 74.89  ?  285 TYR B CG    1 
ATOM   3572 C  CD1   . TYR B 1 268 ? 26.190  17.963 -12.133 1.00 77.02  ?  285 TYR B CD1   1 
ATOM   3573 C  CD2   . TYR B 1 268 ? 28.472  18.594 -11.865 1.00 70.76  ?  285 TYR B CD2   1 
ATOM   3574 C  CE1   . TYR B 1 268 ? 25.938  19.145 -12.804 1.00 74.82  ?  285 TYR B CE1   1 
ATOM   3575 C  CE2   . TYR B 1 268 ? 28.230  19.778 -12.534 1.00 69.91  ?  285 TYR B CE2   1 
ATOM   3576 C  CZ    . TYR B 1 268 ? 26.961  20.048 -13.001 1.00 71.71  ?  285 TYR B CZ    1 
ATOM   3577 O  OH    . TYR B 1 268 ? 26.717  21.227 -13.667 1.00 71.76  ?  285 TYR B OH    1 
ATOM   3578 N  N     . ARG B 1 269 ? 30.339  15.370 -12.389 1.00 74.20  ?  286 ARG B N     1 
ATOM   3579 C  CA    . ARG B 1 269 ? 31.502  15.700 -13.205 1.00 73.52  ?  286 ARG B CA    1 
ATOM   3580 C  C     . ARG B 1 269 ? 31.568  14.877 -14.488 1.00 81.78  ?  286 ARG B C     1 
ATOM   3581 O  O     . ARG B 1 269 ? 31.815  15.419 -15.564 1.00 82.61  ?  286 ARG B O     1 
ATOM   3582 C  CB    . ARG B 1 269 ? 32.787  15.503 -12.396 1.00 69.92  ?  286 ARG B CB    1 
ATOM   3583 N  N     . VAL B 1 270 ? 31.349  13.571 -14.371 1.00 86.37  ?  287 VAL B N     1 
ATOM   3584 C  CA    . VAL B 1 270 ? 31.421  12.684 -15.528 1.00 95.40  ?  287 VAL B CA    1 
ATOM   3585 C  C     . VAL B 1 270 ? 30.284  12.955 -16.515 1.00 101.39 ?  287 VAL B C     1 
ATOM   3586 O  O     . VAL B 1 270 ? 30.469  12.845 -17.728 1.00 106.95 ?  287 VAL B O     1 
ATOM   3587 C  CB    . VAL B 1 270 ? 31.407  11.192 -15.109 1.00 101.09 ?  287 VAL B CB    1 
ATOM   3588 C  CG1   . VAL B 1 270 ? 32.674  10.846 -14.339 1.00 95.90  ?  287 VAL B CG1   1 
ATOM   3589 C  CG2   . VAL B 1 270 ? 30.170  10.859 -14.289 1.00 103.25 ?  287 VAL B CG2   1 
ATOM   3590 N  N     . LYS B 1 271 ? 29.112  13.306 -15.992 1.00 115.86 ?  288 LYS B N     1 
ATOM   3591 C  CA    . LYS B 1 271 ? 27.955  13.606 -16.829 1.00 120.49 ?  288 LYS B CA    1 
ATOM   3592 C  C     . LYS B 1 271 ? 28.172  14.856 -17.677 1.00 116.66 ?  288 LYS B C     1 
ATOM   3593 O  O     . LYS B 1 271 ? 27.901  14.855 -18.878 1.00 122.83 ?  288 LYS B O     1 
ATOM   3594 C  CB    . LYS B 1 271 ? 26.704  13.775 -15.964 1.00 118.29 ?  288 LYS B CB    1 
ATOM   3595 N  N     . ARG B 1 272 ? 28.660  15.920 -17.047 1.00 82.97  ?  289 ARG B N     1 
ATOM   3596 C  CA    . ARG B 1 272 ? 28.850  17.194 -17.733 1.00 79.04  ?  289 ARG B CA    1 
ATOM   3597 C  C     . ARG B 1 272 ? 30.088  17.180 -18.624 1.00 80.79  ?  289 ARG B C     1 
ATOM   3598 O  O     . ARG B 1 272 ? 30.259  18.052 -19.477 1.00 80.24  ?  289 ARG B O     1 
ATOM   3599 C  CB    . ARG B 1 272 ? 28.949  18.336 -16.719 1.00 73.07  ?  289 ARG B CB    1 
ATOM   3600 N  N     . LEU B 1 273 ? 30.949  16.187 -18.425 1.00 76.19  ?  290 LEU B N     1 
ATOM   3601 C  CA    . LEU B 1 273 ? 32.200  16.100 -19.169 1.00 77.86  ?  290 LEU B CA    1 
ATOM   3602 C  C     . LEU B 1 273 ? 32.325  14.756 -19.878 1.00 80.26  ?  290 LEU B C     1 
ATOM   3603 O  O     . LEU B 1 273 ? 33.082  13.885 -19.450 1.00 80.16  ?  290 LEU B O     1 
ATOM   3604 C  CB    . LEU B 1 273 ? 33.396  16.319 -18.240 1.00 76.08  ?  290 LEU B CB    1 
ATOM   3605 N  N     . LYS C 1 2   ? -15.801 17.184 63.085  1.00 71.56  ?  19  LYS C N     1 
ATOM   3606 C  CA    . LYS C 1 2   ? -15.306 18.361 63.789  1.00 71.72  ?  19  LYS C CA    1 
ATOM   3607 C  C     . LYS C 1 2   ? -13.913 18.117 64.361  1.00 70.90  ?  19  LYS C C     1 
ATOM   3608 O  O     . LYS C 1 2   ? -13.339 18.988 65.015  1.00 71.40  ?  19  LYS C O     1 
ATOM   3609 C  CB    . LYS C 1 2   ? -16.272 18.761 64.905  1.00 74.59  ?  19  LYS C CB    1 
ATOM   3610 N  N     . GLN C 1 3   ? -13.379 16.925 64.116  1.00 75.13  ?  20  GLN C N     1 
ATOM   3611 C  CA    . GLN C 1 3   ? -12.055 16.562 64.610  1.00 73.96  ?  20  GLN C CA    1 
ATOM   3612 C  C     . GLN C 1 3   ? -11.073 16.179 63.508  1.00 70.38  ?  20  GLN C C     1 
ATOM   3613 O  O     . GLN C 1 3   ? -11.458 15.744 62.422  1.00 69.47  ?  20  GLN C O     1 
ATOM   3614 C  CB    . GLN C 1 3   ? -12.146 15.421 65.625  1.00 75.89  ?  20  GLN C CB    1 
ATOM   3615 C  CG    . GLN C 1 3   ? -13.170 15.626 66.722  1.00 79.54  ?  20  GLN C CG    1 
ATOM   3616 C  CD    . GLN C 1 3   ? -12.878 14.766 67.937  1.00 81.58  ?  20  GLN C CD    1 
ATOM   3617 O  OE1   . GLN C 1 3   ? -11.937 13.975 67.935  1.00 79.94  ?  20  GLN C OE1   1 
ATOM   3618 N  NE2   . GLN C 1 3   ? -13.663 14.941 68.991  1.00 84.73  ?  20  GLN C NE2   1 
ATOM   3619 N  N     . GLY C 1 4   ? -9.796  16.360 63.819  1.00 62.59  ?  21  GLY C N     1 
ATOM   3620 C  CA    . GLY C 1 4   ? -8.695  16.112 62.910  1.00 58.48  ?  21  GLY C CA    1 
ATOM   3621 C  C     . GLY C 1 4   ? -8.495  17.209 61.887  1.00 57.00  ?  21  GLY C C     1 
ATOM   3622 O  O     . GLY C 1 4   ? -9.266  17.348 60.938  1.00 57.49  ?  21  GLY C O     1 
ATOM   3623 N  N     . PHE C 1 5   ? -7.440  17.990 62.092  1.00 67.99  ?  22  PHE C N     1 
ATOM   3624 C  CA    . PHE C 1 5   ? -7.036  19.037 61.164  1.00 65.69  ?  22  PHE C CA    1 
ATOM   3625 C  C     . PHE C 1 5   ? -5.653  18.729 60.607  1.00 59.99  ?  22  PHE C C     1 
ATOM   3626 O  O     . PHE C 1 5   ? -4.718  18.497 61.372  1.00 57.79  ?  22  PHE C O     1 
ATOM   3627 C  CB    . PHE C 1 5   ? -7.044  20.406 61.848  1.00 65.93  ?  22  PHE C CB    1 
ATOM   3628 C  CG    . PHE C 1 5   ? -8.411  20.866 62.272  1.00 70.04  ?  22  PHE C CG    1 
ATOM   3629 C  CD1   . PHE C 1 5   ? -9.544  20.430 61.604  1.00 71.91  ?  22  PHE C CD1   1 
ATOM   3630 C  CD2   . PHE C 1 5   ? -8.562  21.738 63.338  1.00 71.00  ?  22  PHE C CD2   1 
ATOM   3631 C  CE1   . PHE C 1 5   ? -10.801 20.853 61.992  1.00 73.94  ?  22  PHE C CE1   1 
ATOM   3632 C  CE2   . PHE C 1 5   ? -9.817  22.164 63.731  1.00 74.03  ?  22  PHE C CE2   1 
ATOM   3633 C  CZ    . PHE C 1 5   ? -10.938 21.721 63.057  1.00 75.42  ?  22  PHE C CZ    1 
ATOM   3634 N  N     . GLU C 1 6   ? -5.509  18.719 59.287  1.00 67.87  ?  23  GLU C N     1 
ATOM   3635 C  CA    . GLU C 1 6   ? -4.206  18.427 58.706  1.00 63.85  ?  23  GLU C CA    1 
ATOM   3636 C  C     . GLU C 1 6   ? -3.358  19.693 58.681  1.00 61.50  ?  23  GLU C C     1 
ATOM   3637 O  O     . GLU C 1 6   ? -3.878  20.795 58.509  1.00 60.97  ?  23  GLU C O     1 
ATOM   3638 C  CB    . GLU C 1 6   ? -4.340  17.850 57.297  1.00 63.88  ?  23  GLU C CB    1 
ATOM   3639 C  CG    . GLU C 1 6   ? -5.238  16.630 57.202  1.00 66.34  ?  23  GLU C CG    1 
ATOM   3640 C  CD    . GLU C 1 6   ? -5.435  16.168 55.771  1.00 66.69  ?  23  GLU C CD    1 
ATOM   3641 O  OE1   . GLU C 1 6   ? -6.460  15.513 55.488  1.00 68.80  ?  23  GLU C OE1   1 
ATOM   3642 O  OE2   . GLU C 1 6   ? -4.554  16.451 54.930  1.00 64.97  -1 23  GLU C OE2   1 
ATOM   3643 N  N     . PHE C 1 7   ? -2.052  19.529 58.856  1.00 33.18  ?  24  PHE C N     1 
ATOM   3644 C  CA    . PHE C 1 7   ? -1.123  20.651 58.813  1.00 32.30  ?  24  PHE C CA    1 
ATOM   3645 C  C     . PHE C 1 7   ? 0.259   20.146 58.417  1.00 32.78  ?  24  PHE C C     1 
ATOM   3646 O  O     . PHE C 1 7   ? 0.772   19.196 59.008  1.00 33.71  ?  24  PHE C O     1 
ATOM   3647 C  CB    . PHE C 1 7   ? -1.079  21.365 60.166  1.00 31.98  ?  24  PHE C CB    1 
ATOM   3648 C  CG    . PHE C 1 7   ? -0.367  22.688 60.135  1.00 31.40  ?  24  PHE C CG    1 
ATOM   3649 C  CD1   . PHE C 1 7   ? -0.811  23.709 59.311  1.00 30.98  ?  24  PHE C CD1   1 
ATOM   3650 C  CD2   . PHE C 1 7   ? 0.737   22.915 60.940  1.00 31.61  ?  24  PHE C CD2   1 
ATOM   3651 C  CE1   . PHE C 1 7   ? -0.161  24.929 59.282  1.00 30.92  ?  24  PHE C CE1   1 
ATOM   3652 C  CE2   . PHE C 1 7   ? 1.390   24.134 60.917  1.00 31.43  ?  24  PHE C CE2   1 
ATOM   3653 C  CZ    . PHE C 1 7   ? 0.940   25.142 60.087  1.00 31.17  ?  24  PHE C CZ    1 
ATOM   3654 N  N     . ASN C 1 8   ? 0.861   20.784 57.419  1.00 38.31  ?  25  ASN C N     1 
ATOM   3655 C  CA    . ASN C 1 8   ? 2.131   20.311 56.881  1.00 38.64  ?  25  ASN C CA    1 
ATOM   3656 C  C     . ASN C 1 8   ? 3.252   21.332 57.027  1.00 38.07  ?  25  ASN C C     1 
ATOM   3657 O  O     . ASN C 1 8   ? 3.163   22.445 56.511  1.00 37.56  ?  25  ASN C O     1 
ATOM   3658 C  CB    . ASN C 1 8   ? 1.966   19.934 55.408  1.00 38.95  ?  25  ASN C CB    1 
ATOM   3659 C  CG    . ASN C 1 8   ? 0.910   18.868 55.195  1.00 39.87  ?  25  ASN C CG    1 
ATOM   3660 O  OD1   . ASN C 1 8   ? 0.772   17.946 55.998  1.00 40.86  ?  25  ASN C OD1   1 
ATOM   3661 N  ND2   . ASN C 1 8   ? 0.157   18.989 54.108  1.00 39.88  ?  25  ASN C ND2   1 
ATOM   3662 N  N     . ILE C 1 9   ? 4.308   20.942 57.735  1.00 30.27  ?  26  ILE C N     1 
ATOM   3663 C  CA    . ILE C 1 9   ? 5.478   21.794 57.920  1.00 30.20  ?  26  ILE C CA    1 
ATOM   3664 C  C     . ILE C 1 9   ? 6.708   21.176 57.260  1.00 30.92  ?  26  ILE C C     1 
ATOM   3665 O  O     . ILE C 1 9   ? 7.016   20.007 57.478  1.00 31.75  ?  26  ILE C O     1 
ATOM   3666 C  CB    . ILE C 1 9   ? 5.771   22.035 59.413  1.00 30.31  ?  26  ILE C CB    1 
ATOM   3667 C  CG1   . ILE C 1 9   ? 4.522   22.560 60.124  1.00 29.78  ?  26  ILE C CG1   1 
ATOM   3668 C  CG2   . ILE C 1 9   ? 6.935   23.001 59.582  1.00 30.45  ?  26  ILE C CG2   1 
ATOM   3669 C  CD1   . ILE C 1 9   ? 4.702   22.751 61.614  1.00 30.05  ?  26  ILE C CD1   1 
ATOM   3670 N  N     . MET C 1 10  ? 7.407   21.962 56.449  1.00 32.74  ?  27  MET C N     1 
ATOM   3671 C  CA    . MET C 1 10  ? 8.622   21.489 55.796  1.00 33.49  ?  27  MET C CA    1 
ATOM   3672 C  C     . MET C 1 10  ? 9.856   22.219 56.311  1.00 33.79  ?  27  MET C C     1 
ATOM   3673 O  O     . MET C 1 10  ? 9.888   23.447 56.347  1.00 33.54  ?  27  MET C O     1 
ATOM   3674 C  CB    . MET C 1 10  ? 8.517   21.656 54.280  1.00 33.50  ?  27  MET C CB    1 
ATOM   3675 C  CG    . MET C 1 10  ? 9.851   21.552 53.559  1.00 34.27  ?  27  MET C CG    1 
ATOM   3676 S  SD    . MET C 1 10  ? 9.695   21.659 51.768  1.00 34.52  ?  27  MET C SD    1 
ATOM   3677 C  CE    . MET C 1 10  ? 9.014   20.047 51.402  1.00 35.13  ?  27  MET C CE    1 
ATOM   3678 N  N     . VAL C 1 11  ? 10.873  21.462 56.709  1.00 27.50  ?  28  VAL C N     1 
ATOM   3679 C  CA    . VAL C 1 11  ? 12.128  22.067 57.133  1.00 28.00  ?  28  VAL C CA    1 
ATOM   3680 C  C     . VAL C 1 11  ? 13.105  22.128 55.960  1.00 28.59  ?  28  VAL C C     1 
ATOM   3681 O  O     . VAL C 1 11  ? 13.305  21.147 55.244  1.00 29.10  ?  28  VAL C O     1 
ATOM   3682 C  CB    . VAL C 1 11  ? 12.763  21.303 58.315  1.00 28.73  ?  28  VAL C CB    1 
ATOM   3683 C  CG1   . VAL C 1 11  ? 11.950  21.520 59.583  1.00 28.29  ?  28  VAL C CG1   1 
ATOM   3684 C  CG2   . VAL C 1 11  ? 12.888  19.821 58.000  1.00 29.60  ?  28  VAL C CG2   1 
ATOM   3685 N  N     . VAL C 1 12  ? 13.692  23.303 55.759  1.00 41.13  ?  29  VAL C N     1 
ATOM   3686 C  CA    . VAL C 1 12  ? 14.612  23.533 54.652  1.00 41.90  ?  29  VAL C CA    1 
ATOM   3687 C  C     . VAL C 1 12  ? 15.813  24.339 55.147  1.00 42.81  ?  29  VAL C C     1 
ATOM   3688 O  O     . VAL C 1 12  ? 15.660  25.259 55.950  1.00 42.80  ?  29  VAL C O     1 
ATOM   3689 C  CB    . VAL C 1 12  ? 13.904  24.274 53.486  1.00 41.66  ?  29  VAL C CB    1 
ATOM   3690 C  CG1   . VAL C 1 12  ? 14.907  24.871 52.514  1.00 42.80  ?  29  VAL C CG1   1 
ATOM   3691 C  CG2   . VAL C 1 12  ? 12.951  23.340 52.759  1.00 41.11  ?  29  VAL C CG2   1 
ATOM   3692 N  N     . GLY C 1 13  ? 17.005  23.991 54.672  1.00 31.32  ?  30  GLY C N     1 
ATOM   3693 C  CA    . GLY C 1 13  ? 18.213  24.689 55.076  1.00 32.54  ?  30  GLY C CA    1 
ATOM   3694 C  C     . GLY C 1 13  ? 19.476  23.948 54.686  1.00 34.51  ?  30  GLY C C     1 
ATOM   3695 O  O     . GLY C 1 13  ? 19.415  22.842 54.149  1.00 34.55  ?  30  GLY C O     1 
ATOM   3696 N  N     . GLN C 1 14  ? 20.627  24.558 54.955  1.00 65.47  ?  31  GLN C N     1 
ATOM   3697 C  CA    . GLN C 1 14  ? 21.909  23.946 54.617  1.00 67.59  ?  31  GLN C CA    1 
ATOM   3698 C  C     . GLN C 1 14  ? 22.222  22.725 55.472  1.00 68.84  ?  31  GLN C C     1 
ATOM   3699 O  O     . GLN C 1 14  ? 21.580  22.479 56.493  1.00 68.30  ?  31  GLN C O     1 
ATOM   3700 C  CB    . GLN C 1 14  ? 23.051  24.955 54.745  1.00 68.60  ?  31  GLN C CB    1 
ATOM   3701 C  CG    . GLN C 1 14  ? 23.230  25.848 53.533  1.00 68.55  ?  31  GLN C CG    1 
ATOM   3702 C  CD    . GLN C 1 14  ? 24.604  26.484 53.486  1.00 70.27  ?  31  GLN C CD    1 
ATOM   3703 O  OE1   . GLN C 1 14  ? 24.943  27.182 52.531  1.00 70.87  ?  31  GLN C OE1   1 
ATOM   3704 N  NE2   . GLN C 1 14  ? 25.404  26.246 54.519  1.00 71.55  ?  31  GLN C NE2   1 
ATOM   3705 N  N     . SER C 1 15  ? 23.220  21.965 55.035  1.00 47.27  ?  32  SER C N     1 
ATOM   3706 C  CA    . SER C 1 15  ? 23.597  20.716 55.682  1.00 48.81  ?  32  SER C CA    1 
ATOM   3707 C  C     . SER C 1 15  ? 24.142  20.925 57.090  1.00 49.60  ?  32  SER C C     1 
ATOM   3708 O  O     . SER C 1 15  ? 25.053  21.725 57.303  1.00 50.32  ?  32  SER C O     1 
ATOM   3709 C  CB    . SER C 1 15  ? 24.636  19.981 54.834  1.00 50.87  ?  32  SER C CB    1 
ATOM   3710 O  OG    . SER C 1 15  ? 24.248  19.952 53.472  1.00 50.40  ?  32  SER C OG    1 
ATOM   3711 N  N     . GLY C 1 16  ? 23.575  20.199 58.048  1.00 44.56  ?  33  GLY C N     1 
ATOM   3712 C  CA    . GLY C 1 16  ? 24.083  20.197 59.406  1.00 45.69  ?  33  GLY C CA    1 
ATOM   3713 C  C     . GLY C 1 16  ? 23.650  21.387 60.240  1.00 44.50  ?  33  GLY C C     1 
ATOM   3714 O  O     . GLY C 1 16  ? 24.358  21.787 61.162  1.00 45.63  ?  33  GLY C O     1 
ATOM   3715 N  N     . LEU C 1 17  ? 22.493  21.958 59.917  1.00 42.51  ?  34  LEU C N     1 
ATOM   3716 C  CA    . LEU C 1 17  ? 21.983  23.110 60.654  1.00 41.44  ?  34  LEU C CA    1 
ATOM   3717 C  C     . LEU C 1 17  ? 21.017  22.706 61.766  1.00 41.10  ?  34  LEU C C     1 
ATOM   3718 O  O     . LEU C 1 17  ? 20.489  23.558 62.480  1.00 40.39  ?  34  LEU C O     1 
ATOM   3719 C  CB    . LEU C 1 17  ? 21.299  24.093 59.702  1.00 39.58  ?  34  LEU C CB    1 
ATOM   3720 C  CG    . LEU C 1 17  ? 22.217  24.899 58.782  1.00 39.92  ?  34  LEU C CG    1 
ATOM   3721 C  CD1   . LEU C 1 17  ? 21.410  25.892 57.961  1.00 38.16  ?  34  LEU C CD1   1 
ATOM   3722 C  CD2   . LEU C 1 17  ? 23.295  25.615 59.584  1.00 41.32  ?  34  LEU C CD2   1 
ATOM   3723 N  N     . GLY C 1 18  ? 20.790  21.405 61.911  1.00 41.70  ?  35  GLY C N     1 
ATOM   3724 C  CA    . GLY C 1 18  ? 19.934  20.900 62.969  1.00 41.73  ?  35  GLY C CA    1 
ATOM   3725 C  C     . GLY C 1 18  ? 18.477  20.789 62.562  1.00 39.99  ?  35  GLY C C     1 
ATOM   3726 O  O     . GLY C 1 18  ? 17.582  20.882 63.403  1.00 39.56  ?  35  GLY C O     1 
ATOM   3727 N  N     . LYS C 1 19  ? 18.236  20.595 61.269  1.00 47.16  ?  36  LYS C N     1 
ATOM   3728 C  CA    . LYS C 1 19  ? 16.876  20.477 60.752  1.00 45.61  ?  36  LYS C CA    1 
ATOM   3729 C  C     . LYS C 1 19  ? 16.189  19.214 61.262  1.00 46.29  ?  36  LYS C C     1 
ATOM   3730 O  O     . LYS C 1 19  ? 15.081  19.271 61.795  1.00 45.53  ?  36  LYS C O     1 
ATOM   3731 C  CB    . LYS C 1 19  ? 16.875  20.483 59.223  1.00 44.91  ?  36  LYS C CB    1 
ATOM   3732 C  CG    . LYS C 1 19  ? 17.363  21.778 58.601  1.00 44.16  ?  36  LYS C CG    1 
ATOM   3733 C  CD    . LYS C 1 19  ? 17.149  21.772 57.098  1.00 43.52  ?  36  LYS C CD    1 
ATOM   3734 C  CE    . LYS C 1 19  ? 17.831  20.584 56.442  1.00 45.03  ?  36  LYS C CE    1 
ATOM   3735 N  NZ    . LYS C 1 19  ? 19.312  20.717 56.463  1.00 46.55  1  36  LYS C NZ    1 
ATOM   3736 N  N     . SER C 1 20  ? 16.854  18.076 61.090  1.00 45.51  ?  37  SER C N     1 
ATOM   3737 C  CA    . SER C 1 20  ? 16.308  16.794 61.521  1.00 46.52  ?  37  SER C CA    1 
ATOM   3738 C  C     . SER C 1 20  ? 16.158  16.738 63.037  1.00 47.33  ?  37  SER C C     1 
ATOM   3739 O  O     . SER C 1 20  ? 15.202  16.163 63.555  1.00 47.47  ?  37  SER C O     1 
ATOM   3740 C  CB    . SER C 1 20  ? 17.199  15.645 61.041  1.00 48.34  ?  37  SER C CB    1 
ATOM   3741 O  OG    . SER C 1 20  ? 17.473  15.756 59.656  1.00 47.88  ?  37  SER C OG    1 
ATOM   3742 N  N     . THR C 1 21  ? 17.114  17.336 63.740  1.00 43.17  ?  38  THR C N     1 
ATOM   3743 C  CA    . THR C 1 21  ? 17.110  17.352 65.198  1.00 44.22  ?  38  THR C CA    1 
ATOM   3744 C  C     . THR C 1 21  ? 15.913  18.135 65.738  1.00 42.82  ?  38  THR C C     1 
ATOM   3745 O  O     . THR C 1 21  ? 15.369  17.810 66.794  1.00 43.59  ?  38  THR C O     1 
ATOM   3746 C  CB    . THR C 1 21  ? 18.418  17.959 65.751  1.00 45.46  ?  38  THR C CB    1 
ATOM   3747 O  OG1   . THR C 1 21  ? 19.539  17.220 65.247  1.00 47.09  ?  38  THR C OG1   1 
ATOM   3748 C  CG2   . THR C 1 21  ? 18.437  17.927 67.273  1.00 47.58  ?  38  THR C CG2   1 
ATOM   3749 N  N     . LEU C 1 22  ? 15.488  19.151 64.993  1.00 56.08  ?  39  LEU C N     1 
ATOM   3750 C  CA    . LEU C 1 22  ? 14.372  19.989 65.416  1.00 54.81  ?  39  LEU C CA    1 
ATOM   3751 C  C     . LEU C 1 22  ? 13.043  19.262 65.242  1.00 54.33  ?  39  LEU C C     1 
ATOM   3752 O  O     . LEU C 1 22  ? 12.086  19.517 65.972  1.00 54.10  ?  39  LEU C O     1 
ATOM   3753 C  CB    . LEU C 1 22  ? 14.354  21.303 64.634  1.00 53.17  ?  39  LEU C CB    1 
ATOM   3754 C  CG    . LEU C 1 22  ? 13.480  22.402 65.245  1.00 52.23  ?  39  LEU C CG    1 
ATOM   3755 C  CD1   . LEU C 1 22  ? 14.201  23.074 66.405  1.00 53.31  ?  39  LEU C CD1   1 
ATOM   3756 C  CD2   . LEU C 1 22  ? 13.058  23.423 64.199  1.00 50.48  ?  39  LEU C CD2   1 
ATOM   3757 N  N     . ILE C 1 23  ? 12.994  18.358 64.270  1.00 41.97  ?  40  ILE C N     1 
ATOM   3758 C  CA    . ILE C 1 23  ? 11.777  17.614 63.972  1.00 41.69  ?  40  ILE C CA    1 
ATOM   3759 C  C     . ILE C 1 23  ? 11.406  16.713 65.144  1.00 43.29  ?  40  ILE C C     1 
ATOM   3760 O  O     . ILE C 1 23  ? 10.268  16.733 65.616  1.00 43.05  ?  40  ILE C O     1 
ATOM   3761 C  CB    . ILE C 1 23  ? 11.928  16.767 62.699  1.00 41.78  ?  40  ILE C CB    1 
ATOM   3762 C  CG1   . ILE C 1 23  ? 12.195  17.669 61.494  1.00 40.32  ?  40  ILE C CG1   1 
ATOM   3763 C  CG2   . ILE C 1 23  ? 10.685  15.920 62.470  1.00 41.83  ?  40  ILE C CG2   1 
ATOM   3764 C  CD1   . ILE C 1 23  ? 12.342  16.918 60.197  1.00 40.53  ?  40  ILE C CD1   1 
ATOM   3765 N  N     . ASN C 1 24  ? 12.367  15.919 65.606  1.00 73.44  ?  41  ASN C N     1 
ATOM   3766 C  CA    . ASN C 1 24  ? 12.142  15.047 66.751  1.00 75.54  ?  41  ASN C CA    1 
ATOM   3767 C  C     . ASN C 1 24  ? 11.897  15.866 68.013  1.00 75.64  ?  41  ASN C C     1 
ATOM   3768 O  O     . ASN C 1 24  ? 11.186  15.433 68.918  1.00 76.73  ?  41  ASN C O     1 
ATOM   3769 C  CB    . ASN C 1 24  ? 13.333  14.110 66.960  1.00 77.82  ?  41  ASN C CB    1 
ATOM   3770 C  CG    . ASN C 1 24  ? 13.679  13.318 65.715  1.00 78.16  ?  41  ASN C CG    1 
ATOM   3771 O  OD1   . ASN C 1 24  ? 12.908  13.276 64.757  1.00 77.10  ?  41  ASN C OD1   1 
ATOM   3772 N  ND2   . ASN C 1 24  ? 14.847  12.684 65.723  1.00 79.87  ?  41  ASN C ND2   1 
ATOM   3773 N  N     . THR C 1 25  ? 12.490  17.055 68.061  1.00 69.25  ?  42  THR C N     1 
ATOM   3774 C  CA    . THR C 1 25  ? 12.248  17.995 69.148  1.00 70.09  ?  42  THR C CA    1 
ATOM   3775 C  C     . THR C 1 25  ? 10.806  18.489 69.107  1.00 68.54  ?  42  THR C C     1 
ATOM   3776 O  O     . THR C 1 25  ? 10.125  18.553 70.131  1.00 70.23  ?  42  THR C O     1 
ATOM   3777 C  CB    . THR C 1 25  ? 13.204  19.204 69.076  1.00 70.34  ?  42  THR C CB    1 
ATOM   3778 O  OG1   . THR C 1 25  ? 14.561  18.752 69.168  1.00 72.27  ?  42  THR C OG1   1 
ATOM   3779 C  CG2   . THR C 1 25  ? 12.921  20.182 70.206  1.00 72.18  ?  42  THR C CG2   1 
ATOM   3780 N  N     . LEU C 1 26  ? 10.355  18.833 67.906  1.00 63.84  ?  43  LEU C N     1 
ATOM   3781 C  CA    . LEU C 1 26  ? 9.009   19.350 67.687  1.00 62.47  ?  43  LEU C CA    1 
ATOM   3782 C  C     . LEU C 1 26  ? 7.933   18.308 67.996  1.00 63.03  ?  43  LEU C C     1 
ATOM   3783 O  O     . LEU C 1 26  ? 6.880   18.635 68.543  1.00 63.12  ?  43  LEU C O     1 
ATOM   3784 C  CB    . LEU C 1 26  ? 8.879   19.851 66.246  1.00 60.44  ?  43  LEU C CB    1 
ATOM   3785 C  CG    . LEU C 1 26  ? 7.529   20.355 65.741  1.00 59.19  ?  43  LEU C CG    1 
ATOM   3786 C  CD1   . LEU C 1 26  ? 7.704   21.664 64.993  1.00 57.52  ?  43  LEU C CD1   1 
ATOM   3787 C  CD2   . LEU C 1 26  ? 6.905   19.314 64.835  1.00 59.24  ?  43  LEU C CD2   1 
ATOM   3788 N  N     . PHE C 1 27  ? 8.202   17.056 67.639  1.00 60.22  ?  44  PHE C N     1 
ATOM   3789 C  CA    . PHE C 1 27  ? 7.251   15.968 67.856  1.00 61.23  ?  44  PHE C CA    1 
ATOM   3790 C  C     . PHE C 1 27  ? 7.207   15.465 69.297  1.00 63.41  ?  44  PHE C C     1 
ATOM   3791 O  O     . PHE C 1 27  ? 6.159   15.026 69.771  1.00 64.28  ?  44  PHE C O     1 
ATOM   3792 C  CB    . PHE C 1 27  ? 7.561   14.797 66.922  1.00 61.65  ?  44  PHE C CB    1 
ATOM   3793 C  CG    . PHE C 1 27  ? 6.898   14.900 65.580  1.00 59.95  ?  44  PHE C CG    1 
ATOM   3794 C  CD1   . PHE C 1 27  ? 5.574   15.295 65.480  1.00 59.10  ?  44  PHE C CD1   1 
ATOM   3795 C  CD2   . PHE C 1 27  ? 7.589   14.592 64.420  1.00 59.48  ?  44  PHE C CD2   1 
ATOM   3796 C  CE1   . PHE C 1 27  ? 4.953   15.387 64.251  1.00 57.86  ?  44  PHE C CE1   1 
ATOM   3797 C  CE2   . PHE C 1 27  ? 6.973   14.683 63.186  1.00 58.28  ?  44  PHE C CE2   1 
ATOM   3798 C  CZ    . PHE C 1 27  ? 5.653   15.080 63.102  1.00 57.44  ?  44  PHE C CZ    1 
ATOM   3799 N  N     . LYS C 1 28  ? 8.337   15.525 69.995  1.00 95.14  ?  45  LYS C N     1 
ATOM   3800 C  CA    . LYS C 1 28  ? 8.400   15.036 71.370  1.00 98.21  ?  45  LYS C CA    1 
ATOM   3801 C  C     . LYS C 1 28  ? 7.878   16.053 72.382  1.00 98.69  ?  45  LYS C C     1 
ATOM   3802 O  O     . LYS C 1 28  ? 8.233   16.006 73.560  1.00 101.15 ?  45  LYS C O     1 
ATOM   3803 C  CB    . LYS C 1 28  ? 9.836   14.645 71.728  1.00 100.01 ?  45  LYS C CB    1 
ATOM   3804 N  N     . SER C 1 29  ? 7.032   16.966 71.919  1.00 75.07  ?  46  SER C N     1 
ATOM   3805 C  CA    . SER C 1 29  ? 6.424   17.961 72.793  1.00 76.07  ?  46  SER C CA    1 
ATOM   3806 C  C     . SER C 1 29  ? 4.902   17.902 72.704  1.00 75.57  ?  46  SER C C     1 
ATOM   3807 O  O     . SER C 1 29  ? 4.347   17.172 71.882  1.00 74.23  ?  46  SER C O     1 
ATOM   3808 C  CB    . SER C 1 29  ? 6.928   19.362 72.446  1.00 74.94  ?  46  SER C CB    1 
ATOM   3809 O  OG    . SER C 1 29  ? 6.913   19.579 71.046  1.00 71.92  ?  46  SER C OG    1 
ATOM   3810 N  N     . GLU C 1 42  ? 20.319  8.042  69.620  1.00 105.80 ?  59  GLU C N     1 
ATOM   3811 C  CA    . GLU C 1 42  ? 21.300  7.647  68.617  1.00 106.36 ?  59  GLU C CA    1 
ATOM   3812 C  C     . GLU C 1 42  ? 21.570  8.782  67.634  1.00 103.29 ?  59  GLU C C     1 
ATOM   3813 O  O     . GLU C 1 42  ? 20.714  9.640  67.415  1.00 100.04 ?  59  GLU C O     1 
ATOM   3814 C  CB    . GLU C 1 42  ? 20.827  6.401  67.865  1.00 106.62 ?  59  GLU C CB    1 
ATOM   3815 N  N     . ARG C 1 43  ? 22.765  8.778  67.051  1.00 81.14  ?  60  ARG C N     1 
ATOM   3816 C  CA    . ARG C 1 43  ? 23.157  9.789  66.073  1.00 78.81  ?  60  ARG C CA    1 
ATOM   3817 C  C     . ARG C 1 43  ? 22.202  9.776  64.884  1.00 75.62  ?  60  ARG C C     1 
ATOM   3818 O  O     . ARG C 1 43  ? 22.002  8.741  64.248  1.00 76.08  ?  60  ARG C O     1 
ATOM   3819 C  CB    . ARG C 1 43  ? 24.602  9.563  65.617  1.00 79.70  ?  60  ARG C CB    1 
ATOM   3820 C  CG    . ARG C 1 43  ? 25.146  10.624 64.668  1.00 77.94  ?  60  ARG C CG    1 
ATOM   3821 C  CD    . ARG C 1 43  ? 26.113  10.032 63.649  1.00 79.52  ?  60  ARG C CD    1 
ATOM   3822 N  NE    . ARG C 1 43  ? 25.461  9.597  62.417  1.00 77.68  ?  60  ARG C NE    1 
ATOM   3823 C  CZ    . ARG C 1 43  ? 25.910  9.885  61.198  1.00 77.01  ?  60  ARG C CZ    1 
ATOM   3824 N  NH1   . ARG C 1 43  ? 25.260  9.450  60.127  1.00 75.71  1  60  ARG C NH1   1 
ATOM   3825 N  NH2   . ARG C 1 43  ? 27.011  10.609 61.051  1.00 77.95  ?  60  ARG C NH2   1 
ATOM   3826 N  N     . ILE C 1 44  ? 21.616  10.931 64.592  1.00 60.61  ?  61  ILE C N     1 
ATOM   3827 C  CA    . ILE C 1 44  ? 20.764  11.077 63.419  1.00 57.97  ?  61  ILE C CA    1 
ATOM   3828 C  C     . ILE C 1 44  ? 21.601  11.126 62.149  1.00 58.17  ?  61  ILE C C     1 
ATOM   3829 O  O     . ILE C 1 44  ? 22.445  12.005 61.991  1.00 57.92  ?  61  ILE C O     1 
ATOM   3830 C  CB    . ILE C 1 44  ? 19.902  12.353 63.502  1.00 55.20  ?  61  ILE C CB    1 
ATOM   3831 C  CG1   . ILE C 1 44  ? 19.016  12.327 64.749  1.00 55.14  ?  61  ILE C CG1   1 
ATOM   3832 C  CG2   . ILE C 1 44  ? 19.065  12.517 62.240  1.00 53.26  ?  61  ILE C CG2   1 
ATOM   3833 C  CD1   . ILE C 1 44  ? 18.086  13.517 64.860  1.00 52.67  ?  61  ILE C CD1   1 
ATOM   3834 N  N     . PRO C 1 45  ? 21.367  10.169 61.239  1.00 62.44  ?  62  PRO C N     1 
ATOM   3835 C  CA    . PRO C 1 45  ? 22.134  10.046 59.995  1.00 63.08  ?  62  PRO C CA    1 
ATOM   3836 C  C     . PRO C 1 45  ? 21.922  11.230 59.058  1.00 60.69  ?  62  PRO C C     1 
ATOM   3837 O  O     . PRO C 1 45  ? 21.013  12.034 59.264  1.00 58.45  ?  62  PRO C O     1 
ATOM   3838 C  CB    . PRO C 1 45  ? 21.591  8.755  59.374  1.00 64.17  ?  62  PRO C CB    1 
ATOM   3839 C  CG    . PRO C 1 45  ? 20.226  8.608  59.945  1.00 62.90  ?  62  PRO C CG    1 
ATOM   3840 C  CD    . PRO C 1 45  ? 20.321  9.137  61.344  1.00 62.80  ?  62  PRO C CD    1 
ATOM   3841 N  N     . LYS C 1 46  ? 22.765  11.328 58.036  1.00 68.82  ?  63  LYS C N     1 
ATOM   3842 C  CA    . LYS C 1 46  ? 22.654  12.390 57.046  1.00 66.96  ?  63  LYS C CA    1 
ATOM   3843 C  C     . LYS C 1 46  ? 21.397  12.213 56.201  1.00 65.18  ?  63  LYS C C     1 
ATOM   3844 O  O     . LYS C 1 46  ? 21.163  11.146 55.634  1.00 66.29  ?  63  LYS C O     1 
ATOM   3845 C  CB    . LYS C 1 46  ? 23.899  12.417 56.156  1.00 68.79  ?  63  LYS C CB    1 
ATOM   3846 C  CG    . LYS C 1 46  ? 23.878  13.481 55.072  1.00 67.39  ?  63  LYS C CG    1 
ATOM   3847 C  CD    . LYS C 1 46  ? 25.267  13.705 54.492  1.00 69.44  ?  63  LYS C CD    1 
ATOM   3848 C  CE    . LYS C 1 46  ? 25.919  12.395 54.076  1.00 72.51  ?  63  LYS C CE    1 
ATOM   3849 N  NZ    . LYS C 1 46  ? 25.246  11.787 52.897  1.00 72.68  1  63  LYS C NZ    1 
ATOM   3850 N  N     . THR C 1 47  ? 20.589  13.266 56.123  1.00 52.71  ?  64  THR C N     1 
ATOM   3851 C  CA    . THR C 1 47  ? 19.333  13.214 55.386  1.00 51.24  ?  64  THR C CA    1 
ATOM   3852 C  C     . THR C 1 47  ? 19.610  13.242 53.888  1.00 51.54  ?  64  THR C C     1 
ATOM   3853 O  O     . THR C 1 47  ? 20.017  14.267 53.344  1.00 50.75  ?  64  THR C O     1 
ATOM   3854 C  CB    . THR C 1 47  ? 18.407  14.388 55.760  1.00 48.75  ?  64  THR C CB    1 
ATOM   3855 O  OG1   . THR C 1 47  ? 18.350  14.524 57.185  1.00 48.73  ?  64  THR C OG1   1 
ATOM   3856 C  CG2   . THR C 1 47  ? 17.004  14.162 55.214  1.00 47.55  ?  64  THR C CG2   1 
ATOM   3857 N  N     . ILE C 1 48  ? 19.397  12.108 53.227  1.00 50.73  ?  65  ILE C N     1 
ATOM   3858 C  CA    . ILE C 1 48  ? 19.721  11.981 51.810  1.00 51.55  ?  65  ILE C CA    1 
ATOM   3859 C  C     . ILE C 1 48  ? 18.491  12.077 50.908  1.00 50.24  ?  65  ILE C C     1 
ATOM   3860 O  O     . ILE C 1 48  ? 18.605  12.432 49.735  1.00 50.29  ?  65  ILE C O     1 
ATOM   3861 C  CB    . ILE C 1 48  ? 20.453  10.652 51.523  1.00 54.44  ?  65  ILE C CB    1 
ATOM   3862 C  CG1   . ILE C 1 48  ? 19.561  9.457  51.862  1.00 55.08  ?  65  ILE C CG1   1 
ATOM   3863 C  CG2   . ILE C 1 48  ? 21.751  10.580 52.313  1.00 56.05  ?  65  ILE C CG2   1 
ATOM   3864 C  CD1   . ILE C 1 48  ? 20.200  8.116  51.571  1.00 58.10  ?  65  ILE C CD1   1 
ATOM   3865 N  N     . GLU C 1 49  ? 17.319  11.763 51.451  1.00 73.95  ?  66  GLU C N     1 
ATOM   3866 C  CA    . GLU C 1 49  ? 16.085  11.831 50.674  1.00 72.94  ?  66  GLU C CA    1 
ATOM   3867 C  C     . GLU C 1 49  ? 14.993  12.606 51.400  1.00 70.50  ?  66  GLU C C     1 
ATOM   3868 O  O     . GLU C 1 49  ? 14.991  12.698 52.628  1.00 70.21  ?  66  GLU C O     1 
ATOM   3869 C  CB    . GLU C 1 49  ? 15.578  10.427 50.334  1.00 74.76  ?  66  GLU C CB    1 
ATOM   3870 C  CG    . GLU C 1 49  ? 16.112  9.874  49.024  1.00 76.84  ?  66  GLU C CG    1 
ATOM   3871 C  CD    . GLU C 1 49  ? 15.373  8.630  48.572  1.00 78.48  ?  66  GLU C CD    1 
ATOM   3872 O  OE1   . GLU C 1 49  ? 14.463  8.178  49.299  1.00 78.29  ?  66  GLU C OE1   1 
ATOM   3873 O  OE2   . GLU C 1 49  ? 15.700  8.104  47.487  1.00 80.29  -1 66  GLU C OE2   1 
ATOM   3874 N  N     . ILE C 1 50  ? 14.066  13.164 50.628  1.00 41.89  ?  67  ILE C N     1 
ATOM   3875 C  CA    . ILE C 1 50  ? 12.912  13.852 51.190  1.00 39.96  ?  67  ILE C CA    1 
ATOM   3876 C  C     . ILE C 1 50  ? 11.973  12.853 51.860  1.00 40.44  ?  67  ILE C C     1 
ATOM   3877 O  O     . ILE C 1 50  ? 11.462  11.938 51.214  1.00 41.47  ?  67  ILE C O     1 
ATOM   3878 C  CB    . ILE C 1 50  ? 12.143  14.632 50.108  1.00 38.76  ?  67  ILE C CB    1 
ATOM   3879 C  CG1   . ILE C 1 50  ? 13.028  15.723 49.503  1.00 38.32  ?  67  ILE C CG1   1 
ATOM   3880 C  CG2   . ILE C 1 50  ? 10.876  15.233 50.684  1.00 37.06  ?  67  ILE C CG2   1 
ATOM   3881 C  CD1   . ILE C 1 50  ? 12.394  16.442 48.332  1.00 37.53  ?  67  ILE C CD1   1 
ATOM   3882 N  N     . LYS C 1 51  ? 11.750  13.034 53.157  1.00 55.83  ?  68  LYS C N     1 
ATOM   3883 C  CA    . LYS C 1 51  ? 10.932  12.105 53.928  1.00 56.49  ?  68  LYS C CA    1 
ATOM   3884 C  C     . LYS C 1 51  ? 9.834   12.821 54.705  1.00 54.98  ?  68  LYS C C     1 
ATOM   3885 O  O     . LYS C 1 51  ? 10.097  13.781 55.429  1.00 54.07  ?  68  LYS C O     1 
ATOM   3886 C  CB    . LYS C 1 51  ? 11.807  11.296 54.888  1.00 58.03  ?  68  LYS C CB    1 
ATOM   3887 N  N     . SER C 1 52  ? 8.602   12.350 54.546  1.00 46.13  ?  69  SER C N     1 
ATOM   3888 C  CA    . SER C 1 52  ? 7.475   12.881 55.303  1.00 45.04  ?  69  SER C CA    1 
ATOM   3889 C  C     . SER C 1 52  ? 7.258   12.081 56.584  1.00 46.15  ?  69  SER C C     1 
ATOM   3890 O  O     . SER C 1 52  ? 7.283   10.851 56.569  1.00 47.82  ?  69  SER C O     1 
ATOM   3891 C  CB    . SER C 1 52  ? 6.203   12.873 54.452  1.00 44.63  ?  69  SER C CB    1 
ATOM   3892 O  OG    . SER C 1 52  ? 6.318   13.765 53.357  1.00 43.53  ?  69  SER C OG    1 
ATOM   3893 N  N     . ILE C 1 53  ? 7.046   12.786 57.690  1.00 51.61  ?  70  ILE C N     1 
ATOM   3894 C  CA    . ILE C 1 53  ? 6.796   12.146 58.976  1.00 52.89  ?  70  ILE C CA    1 
ATOM   3895 C  C     . ILE C 1 53  ? 5.479   12.643 59.561  1.00 52.31  ?  70  ILE C C     1 
ATOM   3896 O  O     . ILE C 1 53  ? 5.290   13.844 59.749  1.00 51.01  ?  70  ILE C O     1 
ATOM   3897 C  CB    . ILE C 1 53  ? 7.937   12.407 59.984  1.00 53.41  ?  70  ILE C CB    1 
ATOM   3898 C  CG1   . ILE C 1 53  ? 9.281   11.928 59.426  1.00 54.41  ?  70  ILE C CG1   1 
ATOM   3899 C  CG2   . ILE C 1 53  ? 7.648   11.714 61.306  1.00 54.99  ?  70  ILE C CG2   1 
ATOM   3900 C  CD1   . ILE C 1 53  ? 10.078  12.997 58.700  1.00 53.10  ?  70  ILE C CD1   1 
ATOM   3901 N  N     . THR C 1 54  ? 4.572   11.714 59.850  1.00 51.27  ?  71  THR C N     1 
ATOM   3902 C  CA    . THR C 1 54  ? 3.225   12.071 60.284  1.00 50.76  ?  71  THR C CA    1 
ATOM   3903 C  C     . THR C 1 54  ? 2.895   11.514 61.668  1.00 52.23  ?  71  THR C C     1 
ATOM   3904 O  O     . THR C 1 54  ? 3.144   10.342 61.952  1.00 54.23  ?  71  THR C O     1 
ATOM   3905 C  CB    . THR C 1 54  ? 2.170   11.568 59.274  1.00 50.89  ?  71  THR C CB    1 
ATOM   3906 O  OG1   . THR C 1 54  ? 2.430   12.137 57.985  1.00 49.61  ?  71  THR C OG1   1 
ATOM   3907 C  CG2   . THR C 1 54  ? 0.767   11.951 59.719  1.00 50.68  ?  71  THR C CG2   1 
ATOM   3908 N  N     . HIS C 1 55  ? 2.334   12.365 62.523  1.00 47.70  ?  72  HIS C N     1 
ATOM   3909 C  CA    . HIS C 1 55  ? 1.896   11.957 63.854  1.00 49.23  ?  72  HIS C CA    1 
ATOM   3910 C  C     . HIS C 1 55  ? 0.632   12.701 64.273  1.00 48.70  ?  72  HIS C C     1 
ATOM   3911 O  O     . HIS C 1 55  ? 0.512   13.907 64.057  1.00 47.02  ?  72  HIS C O     1 
ATOM   3912 C  CB    . HIS C 1 55  ? 3.002   12.197 64.884  1.00 49.71  ?  72  HIS C CB    1 
ATOM   3913 C  CG    . HIS C 1 55  ? 4.136   11.225 64.794  1.00 51.02  ?  72  HIS C CG    1 
ATOM   3914 N  ND1   . HIS C 1 55  ? 3.981   9.943  64.313  1.00 52.46  ?  72  HIS C ND1   1 
ATOM   3915 C  CD2   . HIS C 1 55  ? 5.442   11.346 65.128  1.00 51.31  ?  72  HIS C CD2   1 
ATOM   3916 C  CE1   . HIS C 1 55  ? 5.144   9.317  64.353  1.00 53.57  ?  72  HIS C CE1   1 
ATOM   3917 N  NE2   . HIS C 1 55  ? 6.047   10.146 64.843  1.00 52.91  ?  72  HIS C NE2   1 
ATOM   3918 N  N     . ASP C 1 56  ? -0.308  11.978 64.874  1.00 74.50  ?  73  ASP C N     1 
ATOM   3919 C  CA    . ASP C 1 56  ? -1.531  12.593 65.373  1.00 74.57  ?  73  ASP C CA    1 
ATOM   3920 C  C     . ASP C 1 56  ? -1.317  13.147 66.777  1.00 75.07  ?  73  ASP C C     1 
ATOM   3921 O  O     . ASP C 1 56  ? -0.947  12.414 67.695  1.00 76.65  ?  73  ASP C O     1 
ATOM   3922 C  CB    . ASP C 1 56  ? -2.684  11.586 65.372  1.00 76.41  ?  73  ASP C CB    1 
ATOM   3923 C  CG    . ASP C 1 56  ? -3.113  11.193 63.973  1.00 76.20  ?  73  ASP C CG    1 
ATOM   3924 O  OD1   . ASP C 1 56  ? -2.697  11.872 63.011  1.00 74.72  ?  73  ASP C OD1   1 
ATOM   3925 O  OD2   . ASP C 1 56  ? -3.868  10.207 63.833  1.00 78.05  -1 73  ASP C OD2   1 
ATOM   3926 N  N     . ILE C 1 57  ? -1.549  14.445 66.937  1.00 56.80  ?  74  ILE C N     1 
ATOM   3927 C  CA    . ILE C 1 57  ? -1.365  15.104 68.223  1.00 57.34  ?  74  ILE C CA    1 
ATOM   3928 C  C     . ILE C 1 57  ? -2.627  15.846 68.656  1.00 57.43  ?  74  ILE C C     1 
ATOM   3929 O  O     . ILE C 1 57  ? -3.287  16.496 67.845  1.00 56.53  ?  74  ILE C O     1 
ATOM   3930 C  CB    . ILE C 1 57  ? -0.180  16.088 68.186  1.00 55.85  ?  74  ILE C CB    1 
ATOM   3931 C  CG1   . ILE C 1 57  ? -0.218  16.923 66.905  1.00 53.60  ?  74  ILE C CG1   1 
ATOM   3932 C  CG2   . ILE C 1 57  ? 1.136   15.334 68.277  1.00 56.57  ?  74  ILE C CG2   1 
ATOM   3933 C  CD1   . ILE C 1 57  ? 0.731   18.100 66.918  1.00 52.24  ?  74  ILE C CD1   1 
ATOM   3934 N  N     . GLU C 1 58  ? -2.960  15.741 69.939  1.00 115.08 ?  75  GLU C N     1 
ATOM   3935 C  CA    . GLU C 1 58  ? -4.140  16.406 70.480  1.00 116.41 ?  75  GLU C CA    1 
ATOM   3936 C  C     . GLU C 1 58  ? -3.745  17.610 71.328  1.00 116.41 ?  75  GLU C C     1 
ATOM   3937 O  O     . GLU C 1 58  ? -3.544  17.491 72.537  1.00 118.41 ?  75  GLU C O     1 
ATOM   3938 C  CB    . GLU C 1 58  ? -4.976  15.428 71.309  1.00 118.59 ?  75  GLU C CB    1 
ATOM   3939 N  N     . GLU C 1 59  ? -3.635  18.769 70.686  1.00 106.65 ?  76  GLU C N     1 
ATOM   3940 C  CA    . GLU C 1 59  ? -3.262  19.997 71.379  1.00 107.37 ?  76  GLU C CA    1 
ATOM   3941 C  C     . GLU C 1 59  ? -4.400  20.501 72.259  1.00 111.28 ?  76  GLU C C     1 
ATOM   3942 O  O     . GLU C 1 59  ? -5.113  21.436 71.894  1.00 111.45 ?  76  GLU C O     1 
ATOM   3943 C  CB    . GLU C 1 59  ? -2.857  21.077 70.373  1.00 104.93 ?  76  GLU C CB    1 
ATOM   3944 N  N     . GLY C 1 61  ? -7.619  19.880 72.817  1.00 82.86  ?  78  GLY C N     1 
ATOM   3945 C  CA    . GLY C 1 61  ? -9.029  19.994 72.495  1.00 83.75  ?  78  GLY C CA    1 
ATOM   3946 C  C     . GLY C 1 61  ? -9.369  19.372 71.155  1.00 81.45  ?  78  GLY C C     1 
ATOM   3947 O  O     . GLY C 1 61  ? -10.368 18.665 71.022  1.00 82.38  ?  78  GLY C O     1 
ATOM   3948 N  N     . VAL C 1 62  ? -8.531  19.637 70.157  1.00 95.22  ?  79  VAL C N     1 
ATOM   3949 C  CA    . VAL C 1 62  ? -8.754  19.124 68.811  1.00 94.13  ?  79  VAL C CA    1 
ATOM   3950 C  C     . VAL C 1 62  ? -7.523  18.363 68.322  1.00 91.90  ?  79  VAL C C     1 
ATOM   3951 O  O     . VAL C 1 62  ? -6.388  18.746 68.606  1.00 90.81  ?  79  VAL C O     1 
ATOM   3952 C  CB    . VAL C 1 62  ? -9.092  20.262 67.817  1.00 93.45  ?  79  VAL C CB    1 
ATOM   3953 C  CG1   . VAL C 1 62  ? -9.490  19.698 66.460  1.00 92.59  ?  79  VAL C CG1   1 
ATOM   3954 C  CG2   . VAL C 1 62  ? -10.204 21.142 68.368  1.00 95.24  ?  79  VAL C CG2   1 
ATOM   3955 N  N     . ARG C 1 63  ? -7.761  17.284 67.583  1.00 47.17  ?  80  ARG C N     1 
ATOM   3956 C  CA    . ARG C 1 63  ? -6.697  16.452 67.035  1.00 46.69  ?  80  ARG C CA    1 
ATOM   3957 C  C     . ARG C 1 63  ? -6.111  17.048 65.762  1.00 44.37  ?  80  ARG C C     1 
ATOM   3958 O  O     . ARG C 1 63  ? -6.840  17.532 64.900  1.00 43.53  ?  80  ARG C O     1 
ATOM   3959 C  CB    . ARG C 1 63  ? -7.205  15.035 66.758  1.00 48.37  ?  80  ARG C CB    1 
ATOM   3960 C  CG    . ARG C 1 63  ? -7.562  14.247 68.005  1.00 50.98  ?  80  ARG C CG    1 
ATOM   3961 C  CD    . ARG C 1 63  ? -8.842  13.446 67.826  1.00 52.81  ?  80  ARG C CD    1 
ATOM   3962 N  NE    . ARG C 1 63  ? -9.434  13.615 66.501  1.00 51.64  ?  80  ARG C NE    1 
ATOM   3963 C  CZ    . ARG C 1 63  ? -9.448  12.674 65.562  1.00 51.92  ?  80  ARG C CZ    1 
ATOM   3964 N  NH1   . ARG C 1 63  ? -8.906  11.487 65.799  1.00 53.30  1  80  ARG C NH1   1 
ATOM   3965 N  NH2   . ARG C 1 63  ? -10.010 12.918 64.386  1.00 51.00  ?  80  ARG C NH2   1 
ATOM   3966 N  N     . MET C 1 64  ? -4.787  17.039 65.663  1.00 64.70  ?  81  MET C N     1 
ATOM   3967 C  CA    . MET C 1 64  ? -4.120  17.545 64.473  1.00 62.56  ?  81  MET C CA    1 
ATOM   3968 C  C     . MET C 1 64  ? -3.238  16.463 63.863  1.00 61.56  ?  81  MET C C     1 
ATOM   3969 O  O     . MET C 1 64  ? -2.523  15.758 64.574  1.00 61.80  ?  81  MET C O     1 
ATOM   3970 C  CB    . MET C 1 64  ? -3.282  18.781 64.809  1.00 61.53  ?  81  MET C CB    1 
ATOM   3971 C  CG    . MET C 1 64  ? -2.221  19.117 63.772  1.00 59.46  ?  81  MET C CG    1 
ATOM   3972 S  SD    . MET C 1 64  ? -1.246  20.569 64.204  1.00 58.53  ?  81  MET C SD    1 
ATOM   3973 C  CE    . MET C 1 64  ? -2.512  21.834 64.195  1.00 58.64  ?  81  MET C CE    1 
ATOM   3974 N  N     . LYS C 1 65  ? -3.293  16.339 62.540  1.00 50.43  ?  82  LYS C N     1 
ATOM   3975 C  CA    . LYS C 1 65  ? -2.471  15.368 61.834  1.00 49.80  ?  82  LYS C CA    1 
ATOM   3976 C  C     . LYS C 1 65  ? -1.228  16.061 61.301  1.00 48.22  ?  82  LYS C C     1 
ATOM   3977 O  O     . LYS C 1 65  ? -1.136  16.380 60.115  1.00 47.12  ?  82  LYS C O     1 
ATOM   3978 C  CB    . LYS C 1 65  ? -3.251  14.707 60.696  1.00 50.29  ?  82  LYS C CB    1 
ATOM   3979 C  CG    . LYS C 1 65  ? -2.599  13.436 60.171  1.00 51.25  ?  82  LYS C CG    1 
ATOM   3980 C  CD    . LYS C 1 65  ? -3.492  12.713 59.178  1.00 52.16  ?  82  LYS C CD    1 
ATOM   3981 C  CE    . LYS C 1 65  ? -3.628  13.496 57.885  1.00 50.86  ?  82  LYS C CE    1 
ATOM   3982 N  NZ    . LYS C 1 65  ? -2.310  13.711 57.225  1.00 49.82  1  82  LYS C NZ    1 
ATOM   3983 N  N     . LEU C 1 66  ? -0.274  16.293 62.194  1.00 37.71  ?  83  LEU C N     1 
ATOM   3984 C  CA    . LEU C 1 66  ? 0.935   17.027 61.857  1.00 36.54  ?  83  LEU C CA    1 
ATOM   3985 C  C     . LEU C 1 66  ? 1.862   16.203 60.976  1.00 36.82  ?  83  LEU C C     1 
ATOM   3986 O  O     . LEU C 1 66  ? 2.242   15.086 61.328  1.00 38.26  ?  83  LEU C O     1 
ATOM   3987 C  CB    . LEU C 1 66  ? 1.663   17.455 63.131  1.00 36.89  ?  83  LEU C CB    1 
ATOM   3988 C  CG    . LEU C 1 66  ? 2.914   18.316 62.960  1.00 35.90  ?  83  LEU C CG    1 
ATOM   3989 C  CD1   . LEU C 1 66  ? 2.621   19.534 62.101  1.00 34.21  ?  83  LEU C CD1   1 
ATOM   3990 C  CD2   . LEU C 1 66  ? 3.436   18.733 64.322  1.00 36.54  ?  83  LEU C CD2   1 
ATOM   3991 N  N     . THR C 1 67  ? 2.222   16.762 59.827  1.00 37.15  ?  84  THR C N     1 
ATOM   3992 C  CA    . THR C 1 67  ? 3.190   16.126 58.947  1.00 37.47  ?  84  THR C CA    1 
ATOM   3993 C  C     . THR C 1 67  ? 4.403   17.028 58.778  1.00 36.57  ?  84  THR C C     1 
ATOM   3994 O  O     . THR C 1 67  ? 4.281   18.175 58.345  1.00 35.25  ?  84  THR C O     1 
ATOM   3995 C  CB    . THR C 1 67  ? 2.590   15.813 57.564  1.00 37.30  ?  84  THR C CB    1 
ATOM   3996 O  OG1   . THR C 1 67  ? 1.489   14.908 57.708  1.00 38.39  ?  84  THR C OG1   1 
ATOM   3997 C  CG2   . THR C 1 67  ? 3.638   15.188 56.656  1.00 37.83  ?  84  THR C CG2   1 
ATOM   3998 N  N     . VAL C 1 68  ? 5.573   16.504 59.121  1.00 39.06  ?  85  VAL C N     1 
ATOM   3999 C  CA    . VAL C 1 68  ? 6.812   17.247 58.948  1.00 38.52  ?  85  VAL C CA    1 
ATOM   4000 C  C     . VAL C 1 68  ? 7.656   16.612 57.854  1.00 39.15  ?  85  VAL C C     1 
ATOM   4001 O  O     . VAL C 1 68  ? 7.982   15.427 57.914  1.00 40.58  ?  85  VAL C O     1 
ATOM   4002 C  CB    . VAL C 1 68  ? 7.623   17.319 60.253  1.00 39.23  ?  85  VAL C CB    1 
ATOM   4003 C  CG1   . VAL C 1 68  ? 8.873   18.154 60.048  1.00 38.85  ?  85  VAL C CG1   1 
ATOM   4004 C  CG2   . VAL C 1 68  ? 6.774   17.902 61.370  1.00 39.01  ?  85  VAL C CG2   1 
ATOM   4005 N  N     . ILE C 1 69  ? 8.002   17.410 56.852  1.00 38.94  ?  86  ILE C N     1 
ATOM   4006 C  CA    . ILE C 1 69  ? 8.757   16.916 55.711  1.00 39.55  ?  86  ILE C CA    1 
ATOM   4007 C  C     . ILE C 1 69  ? 10.227  17.300 55.821  1.00 39.89  ?  86  ILE C C     1 
ATOM   4008 O  O     . ILE C 1 69  ? 10.581  18.472 55.701  1.00 38.92  ?  86  ILE C O     1 
ATOM   4009 C  CB    . ILE C 1 69  ? 8.187   17.456 54.388  1.00 38.64  ?  86  ILE C CB    1 
ATOM   4010 C  CG1   . ILE C 1 69  ? 6.690   17.157 54.290  1.00 38.39  ?  86  ILE C CG1   1 
ATOM   4011 C  CG2   . ILE C 1 69  ? 8.929   16.857 53.211  1.00 39.58  ?  86  ILE C CG2   1 
ATOM   4012 C  CD1   . ILE C 1 69  ? 5.859   18.337 53.837  1.00 36.97  ?  86  ILE C CD1   1 
ATOM   4013 N  N     . ASP C 1 70  ? 11.078  16.304 56.047  1.00 35.68  ?  87  ASP C N     1 
ATOM   4014 C  CA    . ASP C 1 70  ? 12.510  16.539 56.172  1.00 36.35  ?  87  ASP C CA    1 
ATOM   4015 C  C     . ASP C 1 70  ? 13.158  16.579 54.793  1.00 36.63  ?  87  ASP C C     1 
ATOM   4016 O  O     . ASP C 1 70  ? 12.800  15.802 53.908  1.00 37.21  ?  87  ASP C O     1 
ATOM   4017 C  CB    . ASP C 1 70  ? 13.161  15.457 57.035  1.00 38.16  ?  87  ASP C CB    1 
ATOM   4018 C  CG    . ASP C 1 70  ? 14.506  15.883 57.588  1.00 38.83  ?  87  ASP C CG    1 
ATOM   4019 O  OD1   . ASP C 1 70  ? 14.810  17.093 57.547  1.00 37.78  ?  87  ASP C OD1   1 
ATOM   4020 O  OD2   . ASP C 1 70  ? 15.257  15.010 58.070  1.00 40.57  -1 87  ASP C OD2   1 
ATOM   4021 N  N     . THR C 1 71  ? 14.113  17.485 54.617  1.00 37.36  ?  88  THR C N     1 
ATOM   4022 C  CA    . THR C 1 71  ? 14.783  17.649 53.332  1.00 37.76  ?  88  THR C CA    1 
ATOM   4023 C  C     . THR C 1 71  ? 16.298  17.553 53.470  1.00 39.19  ?  88  THR C C     1 
ATOM   4024 O  O     . THR C 1 71  ? 16.857  17.943 54.496  1.00 39.30  ?  88  THR C O     1 
ATOM   4025 C  CB    . THR C 1 71  ? 14.426  19.002 52.682  1.00 36.22  ?  88  THR C CB    1 
ATOM   4026 O  OG1   . THR C 1 71  ? 14.835  20.072 53.543  1.00 35.54  ?  88  THR C OG1   1 
ATOM   4027 C  CG2   . THR C 1 71  ? 12.929  19.100 52.435  1.00 35.01  ?  88  THR C CG2   1 
ATOM   4028 N  N     . PRO C 1 72  ? 16.969  17.026 52.434  1.00 44.37  ?  89  PRO C N     1 
ATOM   4029 C  CA    . PRO C 1 72  ? 18.435  16.994 52.412  1.00 45.92  ?  89  PRO C CA    1 
ATOM   4030 C  C     . PRO C 1 72  ? 19.025  18.397 52.336  1.00 45.14  ?  89  PRO C C     1 
ATOM   4031 O  O     . PRO C 1 72  ? 18.520  19.232 51.585  1.00 43.93  ?  89  PRO C O     1 
ATOM   4032 C  CB    . PRO C 1 72  ? 18.752  16.195 51.144  1.00 47.42  ?  89  PRO C CB    1 
ATOM   4033 C  CG    . PRO C 1 72  ? 17.543  16.345 50.287  1.00 46.21  ?  89  PRO C CG    1 
ATOM   4034 C  CD    . PRO C 1 72  ? 16.385  16.401 51.235  1.00 44.72  ?  89  PRO C CD    1 
ATOM   4035 N  N     . GLY C 1 73  ? 20.076  18.649 53.109  1.00 46.15  ?  90  GLY C N     1 
ATOM   4036 C  CA    . GLY C 1 73  ? 20.707  19.955 53.131  1.00 45.68  ?  90  GLY C CA    1 
ATOM   4037 C  C     . GLY C 1 73  ? 21.326  20.331 51.799  1.00 46.32  ?  90  GLY C C     1 
ATOM   4038 O  O     . GLY C 1 73  ? 21.764  19.466 51.040  1.00 47.85  ?  90  GLY C O     1 
ATOM   4039 N  N     . PHE C 1 74  ? 21.358  21.628 51.513  1.00 59.32  ?  91  PHE C N     1 
ATOM   4040 C  CA    . PHE C 1 74  ? 21.986  22.127 50.296  1.00 60.25  ?  91  PHE C CA    1 
ATOM   4041 C  C     . PHE C 1 74  ? 23.164  23.029 50.640  1.00 61.23  ?  91  PHE C C     1 
ATOM   4042 O  O     . PHE C 1 74  ? 23.528  23.165 51.807  1.00 61.24  ?  91  PHE C O     1 
ATOM   4043 C  CB    . PHE C 1 74  ? 20.974  22.875 49.423  1.00 58.66  ?  91  PHE C CB    1 
ATOM   4044 C  CG    . PHE C 1 74  ? 20.154  23.889 50.168  1.00 56.51  ?  91  PHE C CG    1 
ATOM   4045 C  CD1   . PHE C 1 74  ? 20.635  25.171 50.380  1.00 56.23  ?  91  PHE C CD1   1 
ATOM   4046 C  CD2   . PHE C 1 74  ? 18.897  23.563 50.647  1.00 55.04  ?  91  PHE C CD2   1 
ATOM   4047 C  CE1   . PHE C 1 74  ? 19.879  26.106 51.060  1.00 54.51  ?  91  PHE C CE1   1 
ATOM   4048 C  CE2   . PHE C 1 74  ? 18.139  24.493 51.328  1.00 53.45  ?  91  PHE C CE2   1 
ATOM   4049 C  CZ    . PHE C 1 74  ? 18.629  25.766 51.535  1.00 53.14  ?  91  PHE C CZ    1 
ATOM   4050 N  N     . GLY C 1 75  ? 23.761  23.640 49.622  1.00 71.82  ?  92  GLY C N     1 
ATOM   4051 C  CA    . GLY C 1 75  ? 24.894  24.522 49.828  1.00 72.90  ?  92  GLY C CA    1 
ATOM   4052 C  C     . GLY C 1 75  ? 26.186  23.760 50.046  1.00 75.41  ?  92  GLY C C     1 
ATOM   4053 O  O     . GLY C 1 75  ? 27.200  24.336 50.439  1.00 76.45  ?  92  GLY C O     1 
ATOM   4054 N  N     . ASP C 1 76  ? 26.144  22.457 49.790  1.00 64.66  ?  93  ASP C N     1 
ATOM   4055 C  CA    . ASP C 1 76  ? 27.298  21.593 50.010  1.00 66.96  ?  93  ASP C CA    1 
ATOM   4056 C  C     . ASP C 1 76  ? 28.128  21.385 48.744  1.00 68.78  ?  93  ASP C C     1 
ATOM   4057 O  O     . ASP C 1 76  ? 29.290  20.991 48.817  1.00 70.73  ?  93  ASP C O     1 
ATOM   4058 C  CB    . ASP C 1 76  ? 26.845  20.239 50.563  1.00 66.92  ?  93  ASP C CB    1 
ATOM   4059 C  CG    . ASP C 1 76  ? 25.728  19.616 49.745  1.00 65.98  ?  93  ASP C CG    1 
ATOM   4060 O  OD1   . ASP C 1 76  ? 25.449  20.110 48.632  1.00 65.76  ?  93  ASP C OD1   1 
ATOM   4061 O  OD2   . ASP C 1 76  ? 25.131  18.624 50.215  1.00 65.87  -1 93  ASP C OD2   1 
ATOM   4062 N  N     . HIS C 1 77  ? 27.527  21.645 47.587  1.00 71.45  ?  94  HIS C N     1 
ATOM   4063 C  CA    . HIS C 1 77  ? 28.198  21.415 46.311  1.00 73.38  ?  94  HIS C CA    1 
ATOM   4064 C  C     . HIS C 1 77  ? 28.770  22.699 45.721  1.00 74.10  ?  94  HIS C C     1 
ATOM   4065 O  O     . HIS C 1 77  ? 28.702  23.763 46.336  1.00 73.43  ?  94  HIS C O     1 
ATOM   4066 C  CB    . HIS C 1 77  ? 27.237  20.771 45.310  1.00 72.93  ?  94  HIS C CB    1 
ATOM   4067 C  CG    . HIS C 1 77  ? 26.833  19.375 45.671  1.00 73.33  ?  94  HIS C CG    1 
ATOM   4068 N  ND1   . HIS C 1 77  ? 25.787  19.099 46.526  1.00 71.47  ?  94  HIS C ND1   1 
ATOM   4069 C  CD2   . HIS C 1 77  ? 27.335  18.176 45.293  1.00 75.75  ?  94  HIS C CD2   1 
ATOM   4070 C  CE1   . HIS C 1 77  ? 25.663  17.791 46.657  1.00 72.47  ?  94  HIS C CE1   1 
ATOM   4071 N  NE2   . HIS C 1 77  ? 26.590  17.208 45.919  1.00 75.20  ?  94  HIS C NE2   1 
ATOM   4072 N  N     . ILE C 1 78  ? 29.336  22.587 44.523  1.00 108.14 ?  95  ILE C N     1 
ATOM   4073 C  CA    . ILE C 1 78  ? 29.871  23.743 43.814  1.00 109.00 ?  95  ILE C CA    1 
ATOM   4074 C  C     . ILE C 1 78  ? 28.754  24.463 43.067  1.00 107.54 ?  95  ILE C C     1 
ATOM   4075 O  O     . ILE C 1 78  ? 28.794  25.679 42.890  1.00 107.20 ?  95  ILE C O     1 
ATOM   4076 C  CB    . ILE C 1 78  ? 30.975  23.342 42.819  1.00 112.32 ?  95  ILE C CB    1 
ATOM   4077 N  N     . ASN C 1 79  ? 27.758  23.697 42.632  1.00 100.13 ?  96  ASN C N     1 
ATOM   4078 C  CA    . ASN C 1 79  ? 26.560  24.252 42.013  1.00 98.57  ?  96  ASN C CA    1 
ATOM   4079 C  C     . ASN C 1 79  ? 25.318  23.774 42.757  1.00 96.33  ?  96  ASN C C     1 
ATOM   4080 O  O     . ASN C 1 79  ? 25.147  22.576 42.982  1.00 96.72  ?  96  ASN C O     1 
ATOM   4081 C  CB    . ASN C 1 79  ? 26.484  23.867 40.536  1.00 100.10 ?  96  ASN C CB    1 
ATOM   4082 C  CG    . ASN C 1 79  ? 27.235  24.838 39.643  1.00 101.71 ?  96  ASN C CG    1 
ATOM   4083 O  OD1   . ASN C 1 79  ? 28.073  25.609 40.111  1.00 101.85 ?  96  ASN C OD1   1 
ATOM   4084 N  ND2   . ASN C 1 79  ? 26.935  24.806 38.350  1.00 103.01 ?  96  ASN C ND2   1 
ATOM   4085 N  N     . ASN C 1 80  ? 24.453  24.708 43.138  1.00 101.20 ?  97  ASN C N     1 
ATOM   4086 C  CA    . ASN C 1 80  ? 23.357  24.387 44.046  1.00 99.01  ?  97  ASN C CA    1 
ATOM   4087 C  C     . ASN C 1 80  ? 21.968  24.510 43.428  1.00 97.22  ?  97  ASN C C     1 
ATOM   4088 O  O     . ASN C 1 80  ? 20.961  24.415 44.130  1.00 95.05  ?  97  ASN C O     1 
ATOM   4089 C  CB    . ASN C 1 80  ? 23.440  25.273 45.288  1.00 98.10  ?  97  ASN C CB    1 
ATOM   4090 C  CG    . ASN C 1 80  ? 24.734  25.081 46.049  1.00 99.68  ?  97  ASN C CG    1 
ATOM   4091 O  OD1   . ASN C 1 80  ? 24.919  24.077 46.735  1.00 100.28 ?  97  ASN C OD1   1 
ATOM   4092 N  ND2   . ASN C 1 80  ? 25.639  26.047 45.934  1.00 100.64 ?  97  ASN C ND2   1 
ATOM   4093 N  N     . GLU C 1 81  ? 21.913  24.724 42.117  1.00 80.33  ?  98  GLU C N     1 
ATOM   4094 C  CA    . GLU C 1 81  ? 20.641  24.704 41.405  1.00 75.95  ?  98  GLU C CA    1 
ATOM   4095 C  C     . GLU C 1 81  ? 20.075  23.288 41.414  1.00 75.91  ?  98  GLU C C     1 
ATOM   4096 O  O     . GLU C 1 81  ? 18.862  23.091 41.478  1.00 71.96  ?  98  GLU C O     1 
ATOM   4097 C  CB    . GLU C 1 81  ? 20.809  25.206 39.970  1.00 76.03  ?  98  GLU C CB    1 
ATOM   4098 N  N     . ASN C 1 82  ? 20.971  22.306 41.355  1.00 88.98  ?  99  ASN C N     1 
ATOM   4099 C  CA    . ASN C 1 82  ? 20.590  20.898 41.398  1.00 88.67  ?  99  ASN C CA    1 
ATOM   4100 C  C     . ASN C 1 82  ? 20.149  20.457 42.792  1.00 87.73  ?  99  ASN C C     1 
ATOM   4101 O  O     . ASN C 1 82  ? 19.735  19.315 42.990  1.00 86.07  ?  99  ASN C O     1 
ATOM   4102 C  CB    . ASN C 1 82  ? 21.749  20.021 40.920  1.00 92.47  ?  99  ASN C CB    1 
ATOM   4103 N  N     . CYS C 1 83  ? 20.248  21.367 43.754  1.00 128.38 ?  100 CYS C N     1 
ATOM   4104 C  CA    . CYS C 1 83  ? 19.794  21.105 45.113  1.00 126.25 ?  100 CYS C CA    1 
ATOM   4105 C  C     . CYS C 1 83  ? 18.478  21.825 45.378  1.00 120.91 ?  100 CYS C C     1 
ATOM   4106 O  O     . CYS C 1 83  ? 17.659  21.374 46.179  1.00 118.18 ?  100 CYS C O     1 
ATOM   4107 C  CB    . CYS C 1 83  ? 20.850  21.543 46.128  1.00 128.94 ?  100 CYS C CB    1 
ATOM   4108 S  SG    . CYS C 1 83  ? 22.380  20.581 46.085  1.00 134.77 ?  100 CYS C SG    1 
ATOM   4109 N  N     . TRP C 1 84  ? 18.284  22.948 44.696  1.00 79.73  ?  101 TRP C N     1 
ATOM   4110 C  CA    . TRP C 1 84  ? 17.071  23.742 44.847  1.00 75.04  ?  101 TRP C CA    1 
ATOM   4111 C  C     . TRP C 1 84  ? 15.915  23.179 44.027  1.00 72.15  ?  101 TRP C C     1 
ATOM   4112 O  O     . TRP C 1 84  ? 14.772  23.597 44.190  1.00 68.88  ?  101 TRP C O     1 
ATOM   4113 C  CB    . TRP C 1 84  ? 17.335  25.195 44.441  1.00 75.07  ?  101 TRP C CB    1 
ATOM   4114 N  N     . GLN C 1 85  ? 16.216  22.227 43.150  1.00 61.82  ?  102 GLN C N     1 
ATOM   4115 C  CA    . GLN C 1 85  ? 15.207  21.653 42.262  1.00 59.13  ?  102 GLN C CA    1 
ATOM   4116 C  C     . GLN C 1 85  ? 14.345  20.540 42.887  1.00 56.84  ?  102 GLN C C     1 
ATOM   4117 O  O     . GLN C 1 85  ? 13.127  20.546 42.705  1.00 53.97  ?  102 GLN C O     1 
ATOM   4118 C  CB    . GLN C 1 85  ? 15.874  21.127 40.985  1.00 61.12  ?  102 GLN C CB    1 
ATOM   4119 N  N     . PRO C 1 86  ? 14.958  19.579 43.613  1.00 55.71  ?  103 PRO C N     1 
ATOM   4120 C  CA    . PRO C 1 86  ? 14.113  18.508 44.164  1.00 52.91  ?  103 PRO C CA    1 
ATOM   4121 C  C     . PRO C 1 86  ? 13.067  18.988 45.170  1.00 49.79  ?  103 PRO C C     1 
ATOM   4122 O  O     . PRO C 1 86  ? 12.019  18.354 45.299  1.00 47.68  ?  103 PRO C O     1 
ATOM   4123 C  CB    . PRO C 1 86  ? 15.125  17.584 44.851  1.00 55.12  ?  103 PRO C CB    1 
ATOM   4124 C  CG    . PRO C 1 86  ? 16.408  17.847 44.161  1.00 59.36  ?  103 PRO C CG    1 
ATOM   4125 C  CD    . PRO C 1 86  ? 16.389  19.307 43.850  1.00 59.90  ?  103 PRO C CD    1 
ATOM   4126 N  N     . ILE C 1 87  ? 13.344  20.082 45.872  1.00 44.69  ?  104 ILE C N     1 
ATOM   4127 C  CA    . ILE C 1 87  ? 12.402  20.611 46.852  1.00 41.99  ?  104 ILE C CA    1 
ATOM   4128 C  C     . ILE C 1 87  ? 11.259  21.356 46.162  1.00 40.20  ?  104 ILE C C     1 
ATOM   4129 O  O     . ILE C 1 87  ? 10.099  21.236 46.562  1.00 38.78  ?  104 ILE C O     1 
ATOM   4130 C  CB    . ILE C 1 87  ? 13.101  21.540 47.867  1.00 43.09  ?  104 ILE C CB    1 
ATOM   4131 C  CG1   . ILE C 1 87  ? 14.077  20.737 48.728  1.00 44.79  ?  104 ILE C CG1   1 
ATOM   4132 C  CG2   . ILE C 1 87  ? 12.083  22.237 48.755  1.00 40.53  ?  104 ILE C CG2   1 
ATOM   4133 C  CD1   . ILE C 1 87  ? 14.688  21.528 49.866  1.00 45.49  ?  104 ILE C CD1   1 
ATOM   4134 N  N     . MET C 1 88  ? 11.584  22.111 45.117  1.00 65.24  ?  105 MET C N     1 
ATOM   4135 C  CA    . MET C 1 88  ? 10.564  22.807 44.337  1.00 63.94  ?  105 MET C CA    1 
ATOM   4136 C  C     . MET C 1 88  ? 9.619   21.825 43.652  1.00 62.92  ?  105 MET C C     1 
ATOM   4137 O  O     . MET C 1 88  ? 8.436   22.115 43.476  1.00 61.57  ?  105 MET C O     1 
ATOM   4138 C  CB    . MET C 1 88  ? 11.209  23.719 43.291  1.00 65.71  ?  105 MET C CB    1 
ATOM   4139 C  CG    . MET C 1 88  ? 11.978  24.894 43.870  1.00 67.00  ?  105 MET C CG    1 
ATOM   4140 S  SD    . MET C 1 88  ? 10.928  26.019 44.808  1.00 65.34  ?  105 MET C SD    1 
ATOM   4141 C  CE    . MET C 1 88  ? 9.719   26.460 43.562  1.00 65.09  ?  105 MET C CE    1 
ATOM   4142 N  N     . LYS C 1 89  ? 10.145  20.668 43.264  1.00 48.62  ?  106 LYS C N     1 
ATOM   4143 C  CA    . LYS C 1 89  ? 9.329   19.650 42.616  1.00 48.04  ?  106 LYS C CA    1 
ATOM   4144 C  C     . LYS C 1 89  ? 8.370   19.004 43.607  1.00 46.28  ?  106 LYS C C     1 
ATOM   4145 O  O     . LYS C 1 89  ? 7.209   18.759 43.285  1.00 45.56  ?  106 LYS C O     1 
ATOM   4146 C  CB    . LYS C 1 89  ? 10.201  18.576 41.965  1.00 49.89  ?  106 LYS C CB    1 
ATOM   4147 C  CG    . LYS C 1 89  ? 9.399   17.566 41.160  1.00 49.91  ?  106 LYS C CG    1 
ATOM   4148 C  CD    . LYS C 1 89  ? 10.285  16.539 40.480  1.00 51.89  ?  106 LYS C CD    1 
ATOM   4149 C  CE    . LYS C 1 89  ? 9.442   15.487 39.775  1.00 52.19  ?  106 LYS C CE    1 
ATOM   4150 N  NZ    . LYS C 1 89  ? 10.262  14.354 39.267  1.00 54.05  1  106 LYS C NZ    1 
ATOM   4151 N  N     . PHE C 1 90  ? 8.860   18.737 44.814  1.00 26.89  ?  107 PHE C N     1 
ATOM   4152 C  CA    . PHE C 1 90  ? 8.037   18.129 45.852  1.00 25.99  ?  107 PHE C CA    1 
ATOM   4153 C  C     . PHE C 1 90  ? 6.865   19.037 46.198  1.00 24.99  ?  107 PHE C C     1 
ATOM   4154 O  O     . PHE C 1 90  ? 5.735   18.576 46.330  1.00 24.80  ?  107 PHE C O     1 
ATOM   4155 C  CB    . PHE C 1 90  ? 8.869   17.836 47.103  1.00 25.99  ?  107 PHE C CB    1 
ATOM   4156 C  CG    . PHE C 1 90  ? 8.107   17.128 48.193  1.00 25.44  ?  107 PHE C CG    1 
ATOM   4157 C  CD1   . PHE C 1 90  ? 8.018   15.746 48.208  1.00 26.27  ?  107 PHE C CD1   1 
ATOM   4158 C  CD2   . PHE C 1 90  ? 7.491   17.843 49.207  1.00 24.45  ?  107 PHE C CD2   1 
ATOM   4159 C  CE1   . PHE C 1 90  ? 7.323   15.092 49.211  1.00 26.19  ?  107 PHE C CE1   1 
ATOM   4160 C  CE2   . PHE C 1 90  ? 6.797   17.196 50.213  1.00 24.26  ?  107 PHE C CE2   1 
ATOM   4161 C  CZ    . PHE C 1 90  ? 6.713   15.819 50.215  1.00 25.16  ?  107 PHE C CZ    1 
ATOM   4162 N  N     . ILE C 1 91  ? 7.144   20.330 46.333  1.00 28.12  ?  108 ILE C N     1 
ATOM   4163 C  CA    . ILE C 1 91  ? 6.115   21.319 46.635  1.00 27.54  ?  108 ILE C CA    1 
ATOM   4164 C  C     . ILE C 1 91  ? 5.041   21.359 45.549  1.00 27.99  ?  108 ILE C C     1 
ATOM   4165 O  O     . ILE C 1 91  ? 3.846   21.293 45.842  1.00 27.82  ?  108 ILE C O     1 
ATOM   4166 C  CB    . ILE C 1 91  ? 6.723   22.723 46.808  1.00 27.80  ?  108 ILE C CB    1 
ATOM   4167 C  CG1   . ILE C 1 91  ? 7.558   22.782 48.089  1.00 27.64  ?  108 ILE C CG1   1 
ATOM   4168 C  CG2   . ILE C 1 91  ? 5.631   23.782 46.836  1.00 27.70  ?  108 ILE C CG2   1 
ATOM   4169 C  CD1   . ILE C 1 91  ? 8.391   24.037 48.217  1.00 28.55  ?  108 ILE C CD1   1 
ATOM   4170 N  N     . ASN C 1 92  ? 5.470   21.470 44.295  1.00 43.75  ?  109 ASN C N     1 
ATOM   4171 C  CA    . ASN C 1 92  ? 4.539   21.541 43.174  1.00 44.68  ?  109 ASN C CA    1 
ATOM   4172 C  C     . ASN C 1 92  ? 3.786   20.232 42.955  1.00 45.15  ?  109 ASN C C     1 
ATOM   4173 O  O     . ASN C 1 92  ? 2.656   20.236 42.466  1.00 46.00  ?  109 ASN C O     1 
ATOM   4174 C  CB    . ASN C 1 92  ? 5.274   21.938 41.891  1.00 45.80  ?  109 ASN C CB    1 
ATOM   4175 C  CG    . ASN C 1 92  ? 5.750   23.378 41.915  1.00 46.14  ?  109 ASN C CG    1 
ATOM   4176 O  OD1   . ASN C 1 92  ? 5.017   24.279 42.323  1.00 46.09  ?  109 ASN C OD1   1 
ATOM   4177 N  ND2   . ASN C 1 92  ? 6.981   23.602 41.470  1.00 46.95  ?  109 ASN C ND2   1 
ATOM   4178 N  N     . ASP C 1 93  ? 4.414   19.115 43.311  1.00 54.57  ?  110 ASP C N     1 
ATOM   4179 C  CA    . ASP C 1 93  ? 3.769   17.811 43.194  1.00 55.45  ?  110 ASP C CA    1 
ATOM   4180 C  C     . ASP C 1 93  ? 2.604   17.693 44.170  1.00 55.35  ?  110 ASP C C     1 
ATOM   4181 O  O     . ASP C 1 93  ? 1.596   17.057 43.866  1.00 56.74  ?  110 ASP C O     1 
ATOM   4182 C  CB    . ASP C 1 93  ? 4.771   16.678 43.428  1.00 55.68  ?  110 ASP C CB    1 
ATOM   4183 C  CG    . ASP C 1 93  ? 5.660   16.426 42.224  1.00 56.91  ?  110 ASP C CG    1 
ATOM   4184 O  OD1   . ASP C 1 93  ? 5.322   16.908 41.121  1.00 57.58  ?  110 ASP C OD1   1 
ATOM   4185 O  OD2   . ASP C 1 93  ? 6.696   15.744 42.381  1.00 57.31  -1 110 ASP C OD2   1 
ATOM   4186 N  N     . GLN C 1 94  ? 2.747   18.303 45.344  1.00 53.90  ?  111 GLN C N     1 
ATOM   4187 C  CA    . GLN C 1 94  ? 1.664   18.324 46.318  1.00 53.78  ?  111 GLN C CA    1 
ATOM   4188 C  C     . GLN C 1 94  ? 0.545   19.229 45.813  1.00 54.33  ?  111 GLN C C     1 
ATOM   4189 O  O     . GLN C 1 94  ? -0.636  18.935 45.994  1.00 55.33  ?  111 GLN C O     1 
ATOM   4190 C  CB    . GLN C 1 94  ? 2.155   18.801 47.686  1.00 52.54  ?  111 GLN C CB    1 
ATOM   4191 C  CG    . GLN C 1 94  ? 3.386   18.079 48.218  1.00 52.19  ?  111 GLN C CG    1 
ATOM   4192 C  CD    . GLN C 1 94  ? 3.337   16.577 48.018  1.00 53.24  ?  111 GLN C CD    1 
ATOM   4193 O  OE1   . GLN C 1 94  ? 2.352   15.923 48.354  1.00 54.03  ?  111 GLN C OE1   1 
ATOM   4194 N  NE2   . GLN C 1 94  ? 4.411   16.020 47.469  1.00 53.63  ?  111 GLN C NE2   1 
ATOM   4195 N  N     . TYR C 1 95  ? 0.931   20.333 45.180  1.00 40.60  ?  112 TYR C N     1 
ATOM   4196 C  CA    . TYR C 1 95  ? -0.025  21.225 44.532  1.00 41.71  ?  112 TYR C CA    1 
ATOM   4197 C  C     . TYR C 1 95  ? -0.678  20.531 43.343  1.00 43.48  ?  112 TYR C C     1 
ATOM   4198 O  O     . TYR C 1 95  ? -1.798  20.862 42.953  1.00 44.87  ?  112 TYR C O     1 
ATOM   4199 C  CB    . TYR C 1 95  ? 0.653   22.520 44.076  1.00 41.54  ?  112 TYR C CB    1 
ATOM   4200 C  CG    . TYR C 1 95  ? 0.944   23.504 45.188  1.00 40.57  ?  112 TYR C CG    1 
ATOM   4201 C  CD1   . TYR C 1 95  ? 0.274   23.431 46.402  1.00 40.16  ?  112 TYR C CD1   1 
ATOM   4202 C  CD2   . TYR C 1 95  ? 1.878   24.517 45.015  1.00 40.40  ?  112 TYR C CD2   1 
ATOM   4203 C  CE1   . TYR C 1 95  ? 0.535   24.333 47.417  1.00 39.55  ?  112 TYR C CE1   1 
ATOM   4204 C  CE2   . TYR C 1 95  ? 2.144   25.425 46.023  1.00 39.95  ?  112 TYR C CE2   1 
ATOM   4205 C  CZ    . TYR C 1 95  ? 1.470   25.328 47.222  1.00 39.46  ?  112 TYR C CZ    1 
ATOM   4206 O  OH    . TYR C 1 95  ? 1.733   26.228 48.229  1.00 39.08  ?  112 TYR C OH    1 
ATOM   4207 N  N     . GLU C 1 96  ? 0.033   19.566 42.770  1.00 39.99  ?  113 GLU C N     1 
ATOM   4208 C  CA    . GLU C 1 96  ? -0.474  18.807 41.635  1.00 41.89  ?  113 GLU C CA    1 
ATOM   4209 C  C     . GLU C 1 96  ? -1.457  17.739 42.099  1.00 43.07  ?  113 GLU C C     1 
ATOM   4210 O  O     . GLU C 1 96  ? -2.489  17.516 41.466  1.00 45.17  ?  113 GLU C O     1 
ATOM   4211 C  CB    . GLU C 1 96  ? 0.680   18.165 40.860  1.00 42.01  ?  113 GLU C CB    1 
ATOM   4212 C  CG    . GLU C 1 96  ? 0.250   17.329 39.662  1.00 44.23  ?  113 GLU C CG    1 
ATOM   4213 C  CD    . GLU C 1 96  ? -0.217  18.170 38.486  1.00 45.63  ?  113 GLU C CD    1 
ATOM   4214 O  OE1   . GLU C 1 96  ? -0.149  19.415 38.567  1.00 44.90  ?  113 GLU C OE1   1 
ATOM   4215 O  OE2   . GLU C 1 96  ? -0.652  17.582 37.474  1.00 47.77  -1 113 GLU C OE2   1 
ATOM   4216 N  N     . LYS C 1 97  ? -1.131  17.080 43.208  1.00 45.28  ?  114 LYS C N     1 
ATOM   4217 C  CA    . LYS C 1 97  ? -1.996  16.048 43.770  1.00 46.53  ?  114 LYS C CA    1 
ATOM   4218 C  C     . LYS C 1 97  ? -3.338  16.615 44.221  1.00 47.35  ?  114 LYS C C     1 
ATOM   4219 O  O     . LYS C 1 97  ? -4.359  15.932 44.161  1.00 49.66  ?  114 LYS C O     1 
ATOM   4220 C  CB    . LYS C 1 97  ? -1.316  15.352 44.952  1.00 45.59  ?  114 LYS C CB    1 
ATOM   4221 C  CG    . LYS C 1 97  ? -0.159  14.445 44.579  1.00 45.80  ?  114 LYS C CG    1 
ATOM   4222 C  CD    . LYS C 1 97  ? 0.602   14.007 45.821  1.00 44.96  ?  114 LYS C CD    1 
ATOM   4223 C  CE    . LYS C 1 97  ? 1.697   13.009 45.484  1.00 45.68  ?  114 LYS C CE    1 
ATOM   4224 N  NZ    . LYS C 1 97  ? 2.422   12.556 46.705  1.00 44.89  1  114 LYS C NZ    1 
ATOM   4225 N  N     . TYR C 1 98  ? -3.331  17.863 44.675  1.00 36.80  ?  115 TYR C N     1 
ATOM   4226 C  CA    . TYR C 1 98  ? -4.553  18.501 45.146  1.00 37.86  ?  115 TYR C CA    1 
ATOM   4227 C  C     . TYR C 1 98  ? -5.402  18.977 43.972  1.00 40.01  ?  115 TYR C C     1 
ATOM   4228 O  O     . TYR C 1 98  ? -6.631  18.993 44.050  1.00 42.23  ?  115 TYR C O     1 
ATOM   4229 C  CB    . TYR C 1 98  ? -4.226  19.677 46.069  1.00 35.97  ?  115 TYR C CB    1 
ATOM   4230 C  CG    . TYR C 1 98  ? -5.337  20.029 47.034  1.00 36.91  ?  115 TYR C CG    1 
ATOM   4231 C  CD1   . TYR C 1 98  ? -6.423  20.795 46.632  1.00 38.79  ?  115 TYR C CD1   1 
ATOM   4232 C  CD2   . TYR C 1 98  ? -5.291  19.601 48.354  1.00 36.24  ?  115 TYR C CD2   1 
ATOM   4233 C  CE1   . TYR C 1 98  ? -7.437  21.117 47.516  1.00 40.01  ?  115 TYR C CE1   1 
ATOM   4234 C  CE2   . TYR C 1 98  ? -6.298  19.918 49.245  1.00 37.35  ?  115 TYR C CE2   1 
ATOM   4235 C  CZ    . TYR C 1 98  ? -7.368  20.676 48.821  1.00 39.25  ?  115 TYR C CZ    1 
ATOM   4236 O  OH    . TYR C 1 98  ? -8.371  20.993 49.708  1.00 40.71  ?  115 TYR C OH    1 
ATOM   4237 N  N     . LEU C 1 99  ? -4.743  19.359 42.882  1.00 33.76  ?  116 LEU C N     1 
ATOM   4238 C  CA    . LEU C 1 99  ? -5.445  19.864 41.707  1.00 35.97  ?  116 LEU C CA    1 
ATOM   4239 C  C     . LEU C 1 99  ? -6.049  18.732 40.883  1.00 38.65  ?  116 LEU C C     1 
ATOM   4240 O  O     . LEU C 1 99  ? -7.089  18.902 40.248  1.00 41.42  ?  116 LEU C O     1 
ATOM   4241 C  CB    . LEU C 1 99  ? -4.500  20.696 40.836  1.00 35.04  ?  116 LEU C CB    1 
ATOM   4242 C  CG    . LEU C 1 99  ? -5.140  21.362 39.616  1.00 37.45  ?  116 LEU C CG    1 
ATOM   4243 C  CD1   . LEU C 1 99  ? -6.138  22.418 40.055  1.00 38.50  ?  116 LEU C CD1   1 
ATOM   4244 C  CD2   . LEU C 1 99  ? -4.084  21.964 38.705  1.00 36.82  ?  116 LEU C CD2   1 
ATOM   4245 N  N     . GLN C 1 100 ? -5.398  17.574 40.904  1.00 59.50  ?  117 GLN C N     1 
ATOM   4246 C  CA    . GLN C 1 100 ? -5.882  16.416 40.162  1.00 62.44  ?  117 GLN C CA    1 
ATOM   4247 C  C     . GLN C 1 100 ? -7.061  15.766 40.875  1.00 64.83  ?  117 GLN C C     1 
ATOM   4248 O  O     . GLN C 1 100 ? -7.786  14.961 40.290  1.00 68.18  ?  117 GLN C O     1 
ATOM   4249 C  CB    . GLN C 1 100 ? -4.758  15.397 39.964  1.00 61.52  ?  117 GLN C CB    1 
ATOM   4250 N  N     . GLU C 1 101 ? -7.247  16.120 42.142  1.00 80.12  ?  118 GLU C N     1 
ATOM   4251 C  CA    . GLU C 1 101 ? -8.361  15.604 42.926  1.00 82.49  ?  118 GLU C CA    1 
ATOM   4252 C  C     . GLU C 1 101 ? -9.548  16.565 42.932  1.00 84.25  ?  118 GLU C C     1 
ATOM   4253 O  O     . GLU C 1 101 ? -10.676 16.163 43.214  1.00 87.40  ?  118 GLU C O     1 
ATOM   4254 C  CB    . GLU C 1 101 ? -7.909  15.312 44.357  1.00 80.56  ?  118 GLU C CB    1 
ATOM   4255 C  CG    . GLU C 1 101 ? -6.997  14.100 44.478  1.00 80.00  ?  118 GLU C CG    1 
ATOM   4256 C  CD    . GLU C 1 101 ? -7.064  13.448 45.845  1.00 80.16  ?  118 GLU C CD    1 
ATOM   4257 O  OE1   . GLU C 1 101 ? -8.183  13.287 46.376  1.00 82.69  ?  118 GLU C OE1   1 
ATOM   4258 O  OE2   . GLU C 1 101 ? -5.996  13.096 46.389  1.00 78.07  -1 118 GLU C OE2   1 
ATOM   4259 N  N     . GLU C 1 102 ? -9.292  17.834 42.624  1.00 65.66  ?  119 GLU C N     1 
ATOM   4260 C  CA    . GLU C 1 102 ? -10.360 18.827 42.556  1.00 67.67  ?  119 GLU C CA    1 
ATOM   4261 C  C     . GLU C 1 102 ? -11.102 18.763 41.224  1.00 71.35  ?  119 GLU C C     1 
ATOM   4262 O  O     . GLU C 1 102 ? -12.315 18.967 41.170  1.00 74.66  ?  119 GLU C O     1 
ATOM   4263 C  CB    . GLU C 1 102 ? -9.806  20.238 42.770  1.00 65.49  ?  119 GLU C CB    1 
ATOM   4264 C  CG    . GLU C 1 102 ? -9.886  20.725 44.207  1.00 65.05  ?  119 GLU C CG    1 
ATOM   4265 C  CD    . GLU C 1 102 ? -9.575  22.202 44.348  1.00 64.25  ?  119 GLU C CD    1 
ATOM   4266 O  OE1   . GLU C 1 102 ? -9.135  22.816 43.354  1.00 63.39  ?  119 GLU C OE1   1 
ATOM   4267 O  OE2   . GLU C 1 102 ? -9.773  22.749 45.454  1.00 64.67  -1 119 GLU C OE2   1 
ATOM   4268 N  N     . VAL C 1 103 ? -10.368 18.477 40.153  1.00 62.68  ?  120 VAL C N     1 
ATOM   4269 C  CA    . VAL C 1 103 ? -10.969 18.270 38.839  1.00 64.46  ?  120 VAL C CA    1 
ATOM   4270 C  C     . VAL C 1 103 ? -11.592 16.880 38.714  1.00 66.40  ?  120 VAL C C     1 
ATOM   4271 O  O     . VAL C 1 103 ? -12.280 16.580 37.737  1.00 68.59  ?  120 VAL C O     1 
ATOM   4272 C  CB    . VAL C 1 103 ? -9.934  18.467 37.718  1.00 63.83  ?  120 VAL C CB    1 
ATOM   4273 C  CG1   . VAL C 1 103 ? -9.381  19.885 37.754  1.00 62.50  ?  120 VAL C CG1   1 
ATOM   4274 C  CG2   . VAL C 1 103 ? -8.812  17.449 37.847  1.00 63.41  ?  120 VAL C CG2   1 
ATOM   4275 N  N     . ASN C 1 104 ? -11.340 16.039 39.712  1.00 63.09  ?  121 ASN C N     1 
ATOM   4276 C  CA    . ASN C 1 104 ? -11.787 14.648 39.714  1.00 64.86  ?  121 ASN C CA    1 
ATOM   4277 C  C     . ASN C 1 104 ? -13.299 14.568 39.909  1.00 67.38  ?  121 ASN C C     1 
ATOM   4278 O  O     . ASN C 1 104 ? -13.779 14.470 41.039  1.00 67.47  ?  121 ASN C O     1 
ATOM   4279 C  CB    . ASN C 1 104 ? -11.068 13.851 40.804  1.00 64.04  ?  121 ASN C CB    1 
ATOM   4280 C  CG    . ASN C 1 104 ? -11.430 12.374 40.790  1.00 65.93  ?  121 ASN C CG    1 
ATOM   4281 O  OD1   . ASN C 1 104 ? -12.173 11.907 39.925  1.00 67.85  ?  121 ASN C OD1   1 
ATOM   4282 N  ND2   . ASN C 1 104 ? -10.906 11.631 41.757  1.00 65.35  ?  121 ASN C ND2   1 
ATOM   4283 N  N     . ILE C 1 105 ? -14.048 14.616 38.810  1.00 85.31  ?  122 ILE C N     1 
ATOM   4284 C  CA    . ILE C 1 105 ? -15.506 14.706 38.878  1.00 87.96  ?  122 ILE C CA    1 
ATOM   4285 C  C     . ILE C 1 105 ? -16.183 13.485 39.504  1.00 89.90  ?  122 ILE C C     1 
ATOM   4286 O  O     . ILE C 1 105 ? -17.363 13.540 39.848  1.00 91.85  ?  122 ILE C O     1 
ATOM   4287 C  CB    . ILE C 1 105 ? -16.105 14.919 37.474  1.00 89.74  ?  122 ILE C CB    1 
ATOM   4288 N  N     . ASN C 1 106 ? -15.450 12.386 39.649  1.00 78.35  ?  123 ASN C N     1 
ATOM   4289 C  CA    . ASN C 1 106 ? -16.012 11.183 40.255  1.00 80.16  ?  123 ASN C CA    1 
ATOM   4290 C  C     . ASN C 1 106 ? -15.875 11.170 41.777  1.00 78.84  ?  123 ASN C C     1 
ATOM   4291 O  O     . ASN C 1 106 ? -16.563 10.416 42.464  1.00 80.45  ?  123 ASN C O     1 
ATOM   4292 C  CB    . ASN C 1 106 ? -15.357 9.927  39.676  1.00 80.54  ?  123 ASN C CB    1 
ATOM   4293 C  CG    . ASN C 1 106 ? -15.678 9.725  38.209  1.00 82.45  ?  123 ASN C CG    1 
ATOM   4294 O  OD1   . ASN C 1 106 ? -16.794 9.993  37.765  1.00 84.81  ?  123 ASN C OD1   1 
ATOM   4295 N  ND2   . ASN C 1 106 ? -14.700 9.246  37.448  1.00 81.88  ?  123 ASN C ND2   1 
ATOM   4296 N  N     . ARG C 1 107 ? -14.986 12.011 42.297  1.00 76.27  ?  124 ARG C N     1 
ATOM   4297 C  CA    . ARG C 1 107 ? -14.675 12.020 43.728  1.00 75.03  ?  124 ARG C CA    1 
ATOM   4298 C  C     . ARG C 1 107 ? -15.813 12.502 44.634  1.00 76.32  ?  124 ARG C C     1 
ATOM   4299 O  O     . ARG C 1 107 ? -16.237 13.659 44.570  1.00 76.12  ?  124 ARG C O     1 
ATOM   4300 C  CB    . ARG C 1 107 ? -13.432 12.878 43.966  1.00 71.94  ?  124 ARG C CB    1 
ATOM   4301 C  CG    . ARG C 1 107 ? -13.195 13.271 45.412  1.00 70.55  ?  124 ARG C CG    1 
ATOM   4302 C  CD    . ARG C 1 107 ? -12.085 14.302 45.524  1.00 67.92  ?  124 ARG C CD    1 
ATOM   4303 N  NE    . ARG C 1 107 ? -12.381 15.526 44.783  1.00 67.94  ?  124 ARG C NE    1 
ATOM   4304 C  CZ    . ARG C 1 107 ? -13.345 16.384 45.100  1.00 69.08  ?  124 ARG C CZ    1 
ATOM   4305 N  NH1   . ARG C 1 107 ? -14.114 16.160 46.155  1.00 70.46  1  124 ARG C NH1   1 
ATOM   4306 N  NH2   . ARG C 1 107 ? -13.537 17.472 44.364  1.00 69.06  ?  124 ARG C NH2   1 
ATOM   4307 N  N     . LYS C 1 108 ? -16.300 11.593 45.475  1.00 83.29  ?  125 LYS C N     1 
ATOM   4308 C  CA    . LYS C 1 108 ? -17.350 11.902 46.437  1.00 84.65  ?  125 LYS C CA    1 
ATOM   4309 C  C     . LYS C 1 108 ? -16.774 12.247 47.815  1.00 82.56  ?  125 LYS C C     1 
ATOM   4310 O  O     . LYS C 1 108 ? -17.500 12.702 48.706  1.00 83.56  ?  125 LYS C O     1 
ATOM   4311 C  CB    . LYS C 1 108 ? -18.317 10.725 46.561  1.00 87.66  ?  125 LYS C CB    1 
ATOM   4312 N  N     . LYS C 1 109 ? -15.467 12.054 47.977  1.00 40.95  ?  126 LYS C N     1 
ATOM   4313 C  CA    . LYS C 1 109 ? -14.824 12.182 49.283  1.00 39.36  ?  126 LYS C CA    1 
ATOM   4314 C  C     . LYS C 1 109 ? -14.003 13.462 49.388  1.00 36.89  ?  126 LYS C C     1 
ATOM   4315 O  O     . LYS C 1 109 ? -13.657 14.074 48.377  1.00 36.07  ?  126 LYS C O     1 
ATOM   4316 C  CB    . LYS C 1 109 ? -13.933 10.974 49.551  1.00 38.80  ?  126 LYS C CB    1 
ATOM   4317 N  N     . ARG C 1 110 ? -13.710 13.886 50.613  1.00 46.21  ?  127 ARG C N     1 
ATOM   4318 C  CA    . ARG C 1 110 ? -12.886 15.076 50.807  1.00 44.06  ?  127 ARG C CA    1 
ATOM   4319 C  C     . ARG C 1 110 ? -11.446 14.796 50.387  1.00 42.10  ?  127 ARG C C     1 
ATOM   4320 O  O     . ARG C 1 110 ? -10.971 13.663 50.457  1.00 42.16  ?  127 ARG C O     1 
ATOM   4321 C  CB    . ARG C 1 110 ? -12.927 15.568 52.258  1.00 43.74  ?  127 ARG C CB    1 
ATOM   4322 C  CG    . ARG C 1 110 ? -12.135 14.747 53.259  1.00 43.06  ?  127 ARG C CG    1 
ATOM   4323 C  CD    . ARG C 1 110 ? -12.059 15.492 54.586  1.00 42.82  ?  127 ARG C CD    1 
ATOM   4324 N  NE    . ARG C 1 110 ? -13.382 15.713 55.165  1.00 44.70  ?  127 ARG C NE    1 
ATOM   4325 C  CZ    . ARG C 1 110 ? -13.645 16.584 56.134  1.00 45.11  ?  127 ARG C CZ    1 
ATOM   4326 N  NH1   . ARG C 1 110 ? -12.681 17.350 56.628  1.00 43.53  1  127 ARG C NH1   1 
ATOM   4327 N  NH2   . ARG C 1 110 ? -14.882 16.706 56.595  1.00 47.38  ?  127 ARG C NH2   1 
ATOM   4328 N  N     . ILE C 1 111 ? -10.764 15.844 49.944  1.00 51.97  ?  128 ILE C N     1 
ATOM   4329 C  CA    . ILE C 1 111 ? -9.397  15.741 49.448  1.00 49.99  ?  128 ILE C CA    1 
ATOM   4330 C  C     . ILE C 1 111 ? -8.362  15.794 50.565  1.00 48.51  ?  128 ILE C C     1 
ATOM   4331 O  O     . ILE C 1 111 ? -8.391  16.697 51.402  1.00 48.26  ?  128 ILE C O     1 
ATOM   4332 C  CB    . ILE C 1 111 ? -9.103  16.862 48.439  1.00 49.15  ?  128 ILE C CB    1 
ATOM   4333 C  CG1   . ILE C 1 111 ? -10.232 16.935 47.411  1.00 50.76  ?  128 ILE C CG1   1 
ATOM   4334 C  CG2   . ILE C 1 111 ? -7.761  16.642 47.761  1.00 47.56  ?  128 ILE C CG2   1 
ATOM   4335 C  CD1   . ILE C 1 111 ? -10.071 18.038 46.413  1.00 50.34  ?  128 ILE C CD1   1 
ATOM   4336 N  N     . PRO C 1 112 ? -7.439  14.819 50.582  1.00 41.75  ?  129 PRO C N     1 
ATOM   4337 C  CA    . PRO C 1 112 ? -6.367  14.843 51.580  1.00 40.71  ?  129 PRO C CA    1 
ATOM   4338 C  C     . PRO C 1 112 ? -5.339  15.921 51.255  1.00 38.97  ?  129 PRO C C     1 
ATOM   4339 O  O     . PRO C 1 112 ? -4.811  15.965 50.143  1.00 38.36  ?  129 PRO C O     1 
ATOM   4340 C  CB    . PRO C 1 112 ? -5.752  13.444 51.475  1.00 40.71  ?  129 PRO C CB    1 
ATOM   4341 C  CG    . PRO C 1 112 ? -6.072  12.987 50.093  1.00 41.33  ?  129 PRO C CG    1 
ATOM   4342 C  CD    . PRO C 1 112 ? -7.373  13.633 49.709  1.00 42.38  ?  129 PRO C CD    1 
ATOM   4343 N  N     . ASP C 1 113 ? -5.065  16.785 52.225  1.00 41.01  ?  130 ASP C N     1 
ATOM   4344 C  CA    . ASP C 1 113 ? -4.190  17.928 52.002  1.00 39.67  ?  130 ASP C CA    1 
ATOM   4345 C  C     . ASP C 1 113 ? -2.741  17.544 52.264  1.00 38.49  ?  130 ASP C C     1 
ATOM   4346 O  O     . ASP C 1 113 ? -2.321  17.407 53.412  1.00 38.60  ?  130 ASP C O     1 
ATOM   4347 C  CB    . ASP C 1 113 ? -4.601  19.103 52.892  1.00 40.07  ?  130 ASP C CB    1 
ATOM   4348 C  CG    . ASP C 1 113 ? -4.111  20.437 52.361  1.00 39.17  ?  130 ASP C CG    1 
ATOM   4349 O  OD1   . ASP C 1 113 ? -3.263  20.440 51.443  1.00 38.13  ?  130 ASP C OD1   1 
ATOM   4350 O  OD2   . ASP C 1 113 ? -4.577  21.484 52.860  1.00 39.57  -1 130 ASP C OD2   1 
ATOM   4351 N  N     . THR C 1 114 ? -1.983  17.372 51.188  1.00 40.73  ?  131 THR C N     1 
ATOM   4352 C  CA    . THR C 1 114 ? -0.579  16.999 51.290  1.00 40.25  ?  131 THR C CA    1 
ATOM   4353 C  C     . THR C 1 114 ? 0.309   18.183 50.931  1.00 39.73  ?  131 THR C C     1 
ATOM   4354 O  O     . THR C 1 114 ? 1.534   18.072 50.900  1.00 39.33  ?  131 THR C O     1 
ATOM   4355 C  CB    . THR C 1 114 ? -0.249  15.810 50.371  1.00 40.82  ?  131 THR C CB    1 
ATOM   4356 O  OG1   . THR C 1 114 ? 1.169   15.599 50.345  1.00 40.49  ?  131 THR C OG1   1 
ATOM   4357 C  CG2   . THR C 1 114 ? -0.744  16.080 48.957  1.00 41.48  ?  131 THR C CG2   1 
ATOM   4358 N  N     . ARG C 1 115 ? -0.328  19.319 50.664  1.00 35.37  ?  132 ARG C N     1 
ATOM   4359 C  CA    . ARG C 1 115 ? 0.378   20.548 50.325  1.00 35.11  ?  132 ARG C CA    1 
ATOM   4360 C  C     . ARG C 1 115 ? 1.187   21.084 51.500  1.00 34.68  ?  132 ARG C C     1 
ATOM   4361 O  O     . ARG C 1 115 ? 0.750   21.015 52.648  1.00 34.61  ?  132 ARG C O     1 
ATOM   4362 C  CB    . ARG C 1 115 ? -0.615  21.607 49.846  1.00 35.38  ?  132 ARG C CB    1 
ATOM   4363 C  CG    . ARG C 1 115 ? -1.425  21.181 48.635  1.00 35.96  ?  132 ARG C CG    1 
ATOM   4364 C  CD    . ARG C 1 115 ? -2.541  22.166 48.343  1.00 36.28  ?  132 ARG C CD    1 
ATOM   4365 N  NE    . ARG C 1 115 ? -3.425  22.335 49.493  1.00 36.21  ?  132 ARG C NE    1 
ATOM   4366 C  CZ    . ARG C 1 115 ? -4.537  23.061 49.479  1.00 36.70  ?  132 ARG C CZ    1 
ATOM   4367 N  NH1   . ARG C 1 115 ? -4.907  23.688 48.371  1.00 37.14  1  132 ARG C NH1   1 
ATOM   4368 N  NH2   . ARG C 1 115 ? -5.281  23.159 50.573  1.00 37.48  ?  132 ARG C NH2   1 
ATOM   4369 N  N     . VAL C 1 116 ? 2.367   21.617 51.207  1.00 38.26  ?  133 VAL C N     1 
ATOM   4370 C  CA    . VAL C 1 116 ? 3.188   22.250 52.230  1.00 38.10  ?  133 VAL C CA    1 
ATOM   4371 C  C     . VAL C 1 116 ? 2.597   23.606 52.601  1.00 38.37  ?  133 VAL C C     1 
ATOM   4372 O  O     . VAL C 1 116 ? 2.633   24.543 51.806  1.00 38.67  ?  133 VAL C O     1 
ATOM   4373 C  CB    . VAL C 1 116 ? 4.644   22.433 51.760  1.00 38.05  ?  133 VAL C CB    1 
ATOM   4374 C  CG1   . VAL C 1 116 ? 5.469   23.112 52.840  1.00 38.10  ?  133 VAL C CG1   1 
ATOM   4375 C  CG2   . VAL C 1 116 ? 5.253   21.092 51.385  1.00 37.89  ?  133 VAL C CG2   1 
ATOM   4376 N  N     . HIS C 1 117 ? 2.038   23.700 53.803  1.00 34.04  ?  134 HIS C N     1 
ATOM   4377 C  CA    . HIS C 1 117 ? 1.446   24.948 54.275  1.00 34.48  ?  134 HIS C CA    1 
ATOM   4378 C  C     . HIS C 1 117 ? 2.521   25.901 54.785  1.00 34.79  ?  134 HIS C C     1 
ATOM   4379 O  O     . HIS C 1 117 ? 2.526   27.088 54.457  1.00 35.37  ?  134 HIS C O     1 
ATOM   4380 C  CB    . HIS C 1 117 ? 0.422   24.681 55.381  1.00 34.59  ?  134 HIS C CB    1 
ATOM   4381 C  CG    . HIS C 1 117 ? -0.656  23.718 54.990  1.00 34.51  ?  134 HIS C CG    1 
ATOM   4382 N  ND1   . HIS C 1 117 ? -1.059  22.683 55.807  1.00 35.54  ?  134 HIS C ND1   1 
ATOM   4383 C  CD2   . HIS C 1 117 ? -1.420  23.637 53.876  1.00 34.72  ?  134 HIS C CD2   1 
ATOM   4384 C  CE1   . HIS C 1 117 ? -2.020  22.002 55.209  1.00 35.74  ?  134 HIS C CE1   1 
ATOM   4385 N  NE2   . HIS C 1 117 ? -2.260  22.561 54.037  1.00 35.39  ?  134 HIS C NE2   1 
ATOM   4386 N  N     . CYS C 1 118 ? 3.435   25.365 55.586  1.00 44.27  ?  135 CYS C N     1 
ATOM   4387 C  CA    . CYS C 1 118 ? 4.465   26.171 56.227  1.00 45.01  ?  135 CYS C CA    1 
ATOM   4388 C  C     . CYS C 1 118 ? 5.842   25.572 55.980  1.00 44.13  ?  135 CYS C C     1 
ATOM   4389 O  O     . CYS C 1 118 ? 6.002   24.352 55.948  1.00 42.67  ?  135 CYS C O     1 
ATOM   4390 C  CB    . CYS C 1 118 ? 4.196   26.283 57.728  1.00 45.04  ?  135 CYS C CB    1 
ATOM   4391 S  SG    . CYS C 1 118 ? 5.416   27.247 58.644  1.00 46.34  ?  135 CYS C SG    1 
ATOM   4392 N  N     . CYS C 1 119 ? 6.834   26.435 55.802  1.00 38.82  ?  136 CYS C N     1 
ATOM   4393 C  CA    . CYS C 1 119 ? 8.190   25.983 55.529  1.00 38.46  ?  136 CYS C CA    1 
ATOM   4394 C  C     . CYS C 1 119 ? 9.213   26.744 56.361  1.00 39.15  ?  136 CYS C C     1 
ATOM   4395 O  O     . CYS C 1 119 ? 9.448   27.930 56.139  1.00 40.80  ?  136 CYS C O     1 
ATOM   4396 C  CB    . CYS C 1 119 ? 8.511   26.133 54.041  1.00 39.47  ?  136 CYS C CB    1 
ATOM   4397 S  SG    . CYS C 1 119 ? 10.225  25.765 53.609  1.00 39.67  ?  136 CYS C SG    1 
ATOM   4398 N  N     . LEU C 1 120 ? 9.813   26.061 57.329  1.00 35.95  ?  137 LEU C N     1 
ATOM   4399 C  CA    . LEU C 1 120 ? 10.884  26.656 58.117  1.00 36.54  ?  137 LEU C CA    1 
ATOM   4400 C  C     . LEU C 1 120 ? 12.161  26.721 57.289  1.00 37.09  ?  137 LEU C C     1 
ATOM   4401 O  O     . LEU C 1 120 ? 12.584  25.720 56.712  1.00 36.27  ?  137 LEU C O     1 
ATOM   4402 C  CB    . LEU C 1 120 ? 11.126  25.860 59.401  1.00 35.32  ?  137 LEU C CB    1 
ATOM   4403 C  CG    . LEU C 1 120 ? 9.957   25.737 60.379  1.00 35.00  ?  137 LEU C CG    1 
ATOM   4404 C  CD1   . LEU C 1 120 ? 10.404  25.044 61.656  1.00 34.25  ?  137 LEU C CD1   1 
ATOM   4405 C  CD2   . LEU C 1 120 ? 9.367   27.104 60.687  1.00 36.74  ?  137 LEU C CD2   1 
ATOM   4406 N  N     . TYR C 1 121 ? 12.774  27.898 57.234  1.00 28.19  ?  138 TYR C N     1 
ATOM   4407 C  CA    . TYR C 1 121 ? 14.038  28.052 56.529  1.00 29.00  ?  138 TYR C CA    1 
ATOM   4408 C  C     . TYR C 1 121 ? 15.158  28.291 57.533  1.00 29.21  ?  138 TYR C C     1 
ATOM   4409 O  O     . TYR C 1 121 ? 15.122  29.251 58.303  1.00 30.15  ?  138 TYR C O     1 
ATOM   4410 C  CB    . TYR C 1 121 ? 13.970  29.197 55.516  1.00 31.03  ?  138 TYR C CB    1 
ATOM   4411 C  CG    . TYR C 1 121 ? 15.094  29.166 54.503  1.00 31.96  ?  138 TYR C CG    1 
ATOM   4412 C  CD1   . TYR C 1 121 ? 16.348  29.680 54.810  1.00 32.95  ?  138 TYR C CD1   1 
ATOM   4413 C  CD2   . TYR C 1 121 ? 14.905  28.609 53.245  1.00 32.04  ?  138 TYR C CD2   1 
ATOM   4414 C  CE1   . TYR C 1 121 ? 17.378  29.645 53.891  1.00 33.94  ?  138 TYR C CE1   1 
ATOM   4415 C  CE2   . TYR C 1 121 ? 15.930  28.571 52.319  1.00 33.07  ?  138 TYR C CE2   1 
ATOM   4416 C  CZ    . TYR C 1 121 ? 17.164  29.091 52.648  1.00 34.00  ?  138 TYR C CZ    1 
ATOM   4417 O  OH    . TYR C 1 121 ? 18.188  29.057 51.732  1.00 35.25  ?  138 TYR C OH    1 
ATOM   4418 N  N     . PHE C 1 122 ? 16.151  27.410 57.519  1.00 41.27  ?  139 PHE C N     1 
ATOM   4419 C  CA    . PHE C 1 122 ? 17.237  27.470 58.488  1.00 41.35  ?  139 PHE C CA    1 
ATOM   4420 C  C     . PHE C 1 122 ? 18.385  28.352 58.015  1.00 43.12  ?  139 PHE C C     1 
ATOM   4421 O  O     . PHE C 1 122 ? 19.018  28.078 56.996  1.00 43.71  ?  139 PHE C O     1 
ATOM   4422 C  CB    . PHE C 1 122 ? 17.750  26.062 58.793  1.00 39.95  ?  139 PHE C CB    1 
ATOM   4423 C  CG    . PHE C 1 122 ? 16.854  25.279 59.708  1.00 38.49  ?  139 PHE C CG    1 
ATOM   4424 C  CD1   . PHE C 1 122 ? 15.634  24.799 59.262  1.00 37.64  ?  139 PHE C CD1   1 
ATOM   4425 C  CD2   . PHE C 1 122 ? 17.233  25.022 61.014  1.00 38.08  ?  139 PHE C CD2   1 
ATOM   4426 C  CE1   . PHE C 1 122 ? 14.808  24.078 60.103  1.00 36.49  ?  139 PHE C CE1   1 
ATOM   4427 C  CE2   . PHE C 1 122 ? 16.413  24.304 61.860  1.00 37.00  ?  139 PHE C CE2   1 
ATOM   4428 C  CZ    . PHE C 1 122 ? 15.199  23.831 61.404  1.00 36.21  ?  139 PHE C CZ    1 
ATOM   4429 N  N     . ILE C 1 123 ? 18.642  29.415 58.769  1.00 31.47  ?  140 ILE C N     1 
ATOM   4430 C  CA    . ILE C 1 123 ? 19.736  30.327 58.470  1.00 33.28  ?  140 ILE C CA    1 
ATOM   4431 C  C     . ILE C 1 123 ? 20.928  30.025 59.371  1.00 33.16  ?  140 ILE C C     1 
ATOM   4432 O  O     . ILE C 1 123 ? 20.800  30.035 60.595  1.00 32.76  ?  140 ILE C O     1 
ATOM   4433 C  CB    . ILE C 1 123 ? 19.316  31.798 58.656  1.00 35.10  ?  140 ILE C CB    1 
ATOM   4434 C  CG1   . ILE C 1 123 ? 18.151  32.144 57.727  1.00 35.52  ?  140 ILE C CG1   1 
ATOM   4435 C  CG2   . ILE C 1 123 ? 20.497  32.726 58.412  1.00 37.13  ?  140 ILE C CG2   1 
ATOM   4436 C  CD1   . ILE C 1 123 ? 17.630  33.553 57.902  1.00 37.57  ?  140 ILE C CD1   1 
ATOM   4437 N  N     . PRO C 1 124 ? 22.093  29.749 58.766  1.00 30.05  ?  141 PRO C N     1 
ATOM   4438 C  CA    . PRO C 1 124 ? 23.309  29.471 59.535  1.00 30.19  ?  141 PRO C CA    1 
ATOM   4439 C  C     . PRO C 1 124 ? 23.775  30.695 60.315  1.00 31.72  ?  141 PRO C C     1 
ATOM   4440 O  O     . PRO C 1 124 ? 23.821  31.796 59.764  1.00 33.40  ?  141 PRO C O     1 
ATOM   4441 C  CB    . PRO C 1 124 ? 24.326  29.080 58.459  1.00 30.89  ?  141 PRO C CB    1 
ATOM   4442 C  CG    . PRO C 1 124 ? 23.827  29.735 57.219  1.00 31.89  ?  141 PRO C CG    1 
ATOM   4443 C  CD    . PRO C 1 124 ? 22.332  29.687 57.314  1.00 30.77  ?  141 PRO C CD    1 
ATOM   4444 N  N     . ALA C 1 125 ? 24.120  30.500 61.583  1.00 42.34  ?  142 ALA C N     1 
ATOM   4445 C  CA    . ALA C 1 125 ? 24.509  31.606 62.450  1.00 43.86  ?  142 ALA C CA    1 
ATOM   4446 C  C     . ALA C 1 125 ? 25.900  32.127 62.104  1.00 45.53  ?  142 ALA C C     1 
ATOM   4447 O  O     . ALA C 1 125 ? 26.848  31.949 62.868  1.00 45.79  ?  142 ALA C O     1 
ATOM   4448 C  CB    . ALA C 1 125 ? 24.453  31.177 63.907  1.00 43.08  ?  142 ALA C CB    1 
ATOM   4449 N  N     . THR C 1 126 ? 26.012  32.774 60.948  1.00 43.02  ?  143 THR C N     1 
ATOM   4450 C  CA    . THR C 1 126 ? 27.279  33.346 60.507  1.00 44.91  ?  143 THR C CA    1 
ATOM   4451 C  C     . THR C 1 126 ? 27.578  34.651 61.237  1.00 46.88  ?  143 THR C C     1 
ATOM   4452 O  O     . THR C 1 126 ? 28.734  35.053 61.360  1.00 48.36  ?  143 THR C O     1 
ATOM   4453 C  CB    . THR C 1 126 ? 27.284  33.608 58.989  1.00 45.95  ?  143 THR C CB    1 
ATOM   4454 O  OG1   . THR C 1 126 ? 26.320  34.621 58.673  1.00 46.98  ?  143 THR C OG1   1 
ATOM   4455 C  CG2   . THR C 1 126 ? 26.947  32.336 58.226  1.00 44.24  ?  143 THR C CG2   1 
ATOM   4456 N  N     . GLY C 1 127 ? 26.528  35.306 61.720  1.00 40.36  ?  144 GLY C N     1 
ATOM   4457 C  CA    . GLY C 1 127 ? 26.672  36.571 62.417  1.00 42.48  ?  144 GLY C CA    1 
ATOM   4458 C  C     . GLY C 1 127 ? 26.844  37.752 61.481  1.00 45.01  ?  144 GLY C C     1 
ATOM   4459 O  O     . GLY C 1 127 ? 27.168  38.857 61.917  1.00 47.26  ?  144 GLY C O     1 
ATOM   4460 N  N     . HIS C 1 128 ? 26.624  37.522 60.191  1.00 52.37  ?  145 HIS C N     1 
ATOM   4461 C  CA    . HIS C 1 128 ? 26.733  38.584 59.197  1.00 55.25  ?  145 HIS C CA    1 
ATOM   4462 C  C     . HIS C 1 128 ? 25.508  38.614 58.290  1.00 55.14  ?  145 HIS C C     1 
ATOM   4463 O  O     . HIS C 1 128 ? 24.518  37.931 58.550  1.00 53.00  ?  145 HIS C O     1 
ATOM   4464 C  CB    . HIS C 1 128 ? 28.002  38.411 58.361  1.00 56.51  ?  145 HIS C CB    1 
ATOM   4465 C  CG    . HIS C 1 128 ? 29.264  38.440 59.166  1.00 57.10  ?  145 HIS C CG    1 
ATOM   4466 N  ND1   . HIS C 1 128 ? 29.607  39.504 59.972  1.00 59.05  ?  145 HIS C ND1   1 
ATOM   4467 C  CD2   . HIS C 1 128 ? 30.266  37.537 59.288  1.00 56.20  ?  145 HIS C CD2   1 
ATOM   4468 C  CE1   . HIS C 1 128 ? 30.765  39.255 60.557  1.00 59.35  ?  145 HIS C CE1   1 
ATOM   4469 N  NE2   . HIS C 1 128 ? 31.186  38.068 60.158  1.00 57.63  ?  145 HIS C NE2   1 
ATOM   4470 N  N     . SER C 1 129 ? 25.581  39.412 57.229  1.00 107.95 ?  146 SER C N     1 
ATOM   4471 C  CA    . SER C 1 129 ? 24.485  39.527 56.271  1.00 108.33 ?  146 SER C CA    1 
ATOM   4472 C  C     . SER C 1 129 ? 24.177  38.187 55.609  1.00 105.65 ?  146 SER C C     1 
ATOM   4473 O  O     . SER C 1 129 ? 25.028  37.298 55.564  1.00 104.47 ?  146 SER C O     1 
ATOM   4474 C  CB    . SER C 1 129 ? 24.814  40.575 55.206  1.00 111.80 ?  146 SER C CB    1 
ATOM   4475 O  OG    . SER C 1 129 ? 25.966  40.207 54.468  1.00 112.52 ?  146 SER C OG    1 
ATOM   4476 N  N     . LEU C 1 130 ? 22.955  38.049 55.101  1.00 59.37  ?  147 LEU C N     1 
ATOM   4477 C  CA    . LEU C 1 130 ? 22.542  36.829 54.418  1.00 57.18  ?  147 LEU C CA    1 
ATOM   4478 C  C     . LEU C 1 130 ? 23.399  36.562 53.187  1.00 58.29  ?  147 LEU C C     1 
ATOM   4479 O  O     . LEU C 1 130 ? 23.741  37.479 52.442  1.00 61.07  ?  147 LEU C O     1 
ATOM   4480 C  CB    . LEU C 1 130 ? 21.068  36.908 54.017  1.00 56.91  ?  147 LEU C CB    1 
ATOM   4481 C  CG    . LEU C 1 130 ? 20.040  36.634 55.115  1.00 55.09  ?  147 LEU C CG    1 
ATOM   4482 C  CD1   . LEU C 1 130 ? 18.629  36.846 54.590  1.00 55.40  ?  147 LEU C CD1   1 
ATOM   4483 C  CD2   . LEU C 1 130 ? 20.204  35.226 55.660  1.00 52.06  ?  147 LEU C CD2   1 
ATOM   4484 N  N     . ARG C 1 131 ? 23.741  35.296 52.985  1.00 74.85  ?  148 ARG C N     1 
ATOM   4485 C  CA    . ARG C 1 131 ? 24.534  34.890 51.834  1.00 75.93  ?  148 ARG C CA    1 
ATOM   4486 C  C     . ARG C 1 131 ? 23.662  34.821 50.583  1.00 76.45  ?  148 ARG C C     1 
ATOM   4487 O  O     . ARG C 1 131 ? 22.473  34.513 50.673  1.00 74.77  ?  148 ARG C O     1 
ATOM   4488 C  CB    . ARG C 1 131 ? 25.200  33.541 52.106  1.00 74.01  ?  148 ARG C CB    1 
ATOM   4489 C  CG    . ARG C 1 131 ? 26.141  33.549 53.302  1.00 73.73  ?  148 ARG C CG    1 
ATOM   4490 C  CD    . ARG C 1 131 ? 26.495  32.133 53.709  1.00 71.53  ?  148 ARG C CD    1 
ATOM   4491 N  NE    . ARG C 1 131 ? 25.291  31.323 53.839  1.00 69.28  ?  148 ARG C NE    1 
ATOM   4492 C  CZ    . ARG C 1 131 ? 25.276  29.996 53.876  1.00 67.44  ?  148 ARG C CZ    1 
ATOM   4493 N  NH1   . ARG C 1 131 ? 26.408  29.310 53.792  1.00 67.81  1  148 ARG C NH1   1 
ATOM   4494 N  NH2   . ARG C 1 131 ? 24.121  29.358 53.993  1.00 65.48  ?  148 ARG C NH2   1 
ATOM   4495 N  N     . PRO C 1 132 ? 24.250  35.125 49.413  1.00 43.19  ?  149 PRO C N     1 
ATOM   4496 C  CA    . PRO C 1 132 ? 23.568  35.100 48.111  1.00 44.30  ?  149 PRO C CA    1 
ATOM   4497 C  C     . PRO C 1 132 ? 22.772  33.821 47.847  1.00 42.81  ?  149 PRO C C     1 
ATOM   4498 O  O     . PRO C 1 132 ? 21.762  33.864 47.145  1.00 43.68  ?  149 PRO C O     1 
ATOM   4499 C  CB    . PRO C 1 132 ? 24.725  35.224 47.119  1.00 45.20  ?  149 PRO C CB    1 
ATOM   4500 C  CG    . PRO C 1 132 ? 25.741  36.020 47.848  1.00 45.55  ?  149 PRO C CG    1 
ATOM   4501 C  CD    . PRO C 1 132 ? 25.642  35.596 49.289  1.00 43.72  ?  149 PRO C CD    1 
ATOM   4502 N  N     . LEU C 1 133 ? 23.229  32.702 48.401  1.00 40.43  ?  150 LEU C N     1 
ATOM   4503 C  CA    . LEU C 1 133 ? 22.551  31.422 48.228  1.00 39.15  ?  150 LEU C CA    1 
ATOM   4504 C  C     . LEU C 1 133 ? 21.178  31.417 48.891  1.00 38.82  ?  150 LEU C C     1 
ATOM   4505 O  O     . LEU C 1 133 ? 20.169  31.119 48.251  1.00 39.10  ?  150 LEU C O     1 
ATOM   4506 C  CB    . LEU C 1 133 ? 23.403  30.285 48.791  1.00 37.45  ?  150 LEU C CB    1 
ATOM   4507 C  CG    . LEU C 1 133 ? 22.786  28.889 48.748  1.00 36.30  ?  150 LEU C CG    1 
ATOM   4508 C  CD1   . LEU C 1 133 ? 22.547  28.456 47.311  1.00 37.13  ?  150 LEU C CD1   1 
ATOM   4509 C  CD2   . LEU C 1 133 ? 23.677  27.896 49.472  1.00 35.03  ?  150 LEU C CD2   1 
ATOM   4510 N  N     . ASP C 1 134 ? 21.151  31.746 50.179  1.00 51.84  ?  151 ASP C N     1 
ATOM   4511 C  CA    . ASP C 1 134 ? 19.915  31.740 50.952  1.00 51.70  ?  151 ASP C CA    1 
ATOM   4512 C  C     . ASP C 1 134 ? 18.923  32.778 50.439  1.00 53.60  ?  151 ASP C C     1 
ATOM   4513 O  O     . ASP C 1 134 ? 17.714  32.560 50.480  1.00 53.61  ?  151 ASP C O     1 
ATOM   4514 C  CB    . ASP C 1 134 ? 20.211  31.987 52.432  1.00 51.44  ?  151 ASP C CB    1 
ATOM   4515 C  CG    . ASP C 1 134 ? 20.960  30.838 53.075  1.00 49.95  ?  151 ASP C CG    1 
ATOM   4516 O  OD1   . ASP C 1 134 ? 20.770  29.684 52.637  1.00 49.06  ?  151 ASP C OD1   1 
ATOM   4517 O  OD2   . ASP C 1 134 ? 21.739  31.088 54.019  1.00 50.05  -1 151 ASP C OD2   1 
ATOM   4518 N  N     . ILE C 1 135 ? 19.441  33.904 49.960  1.00 44.73  ?  152 ILE C N     1 
ATOM   4519 C  CA    . ILE C 1 135 ? 18.601  34.954 49.397  1.00 46.91  ?  152 ILE C CA    1 
ATOM   4520 C  C     . ILE C 1 135 ? 17.812  34.434 48.199  1.00 47.13  ?  152 ILE C C     1 
ATOM   4521 O  O     . ILE C 1 135 ? 16.593  34.590 48.135  1.00 47.76  ?  152 ILE C O     1 
ATOM   4522 C  CB    . ILE C 1 135 ? 19.435  36.176 48.968  1.00 49.02  ?  152 ILE C CB    1 
ATOM   4523 C  CG1   . ILE C 1 135 ? 20.059  36.849 50.192  1.00 49.25  ?  152 ILE C CG1   1 
ATOM   4524 C  CG2   . ILE C 1 135 ? 18.576  37.167 48.199  1.00 51.67  ?  152 ILE C CG2   1 
ATOM   4525 C  CD1   . ILE C 1 135 ? 21.035  37.951 49.850  1.00 51.19  ?  152 ILE C CD1   1 
ATOM   4526 N  N     . GLU C 1 136 ? 18.514  33.818 47.253  1.00 59.84  ?  153 GLU C N     1 
ATOM   4527 C  CA    . GLU C 1 136 ? 17.878  33.278 46.057  1.00 60.77  ?  153 GLU C CA    1 
ATOM   4528 C  C     . GLU C 1 136 ? 16.946  32.117 46.383  1.00 58.72  ?  153 GLU C C     1 
ATOM   4529 O  O     . GLU C 1 136 ? 15.894  31.966 45.764  1.00 59.53  ?  153 GLU C O     1 
ATOM   4530 C  CB    . GLU C 1 136 ? 18.934  32.829 45.046  1.00 61.77  ?  153 GLU C CB    1 
ATOM   4531 C  CG    . GLU C 1 136 ? 19.586  33.973 44.289  1.00 64.60  ?  153 GLU C CG    1 
ATOM   4532 C  CD    . GLU C 1 136 ? 18.568  34.854 43.590  1.00 67.12  ?  153 GLU C CD    1 
ATOM   4533 O  OE1   . GLU C 1 136 ? 17.662  34.305 42.926  1.00 67.71  ?  153 GLU C OE1   1 
ATOM   4534 O  OE2   . GLU C 1 136 ? 18.671  36.094 43.705  1.00 68.68  -1 153 GLU C OE2   1 
ATOM   4535 N  N     . PHE C 1 137 ? 17.333  31.298 47.355  1.00 51.28  ?  154 PHE C N     1 
ATOM   4536 C  CA    . PHE C 1 137 ? 16.528  30.145 47.734  1.00 49.75  ?  154 PHE C CA    1 
ATOM   4537 C  C     . PHE C 1 137 ? 15.231  30.597 48.397  1.00 50.00  ?  154 PHE C C     1 
ATOM   4538 O  O     . PHE C 1 137 ? 14.151  30.105 48.069  1.00 49.86  ?  154 PHE C O     1 
ATOM   4539 C  CB    . PHE C 1 137 ? 17.307  29.219 48.669  1.00 48.05  ?  154 PHE C CB    1 
ATOM   4540 C  CG    . PHE C 1 137 ? 16.965  27.763 48.506  1.00 47.07  ?  154 PHE C CG    1 
ATOM   4541 C  CD1   . PHE C 1 137 ? 15.681  27.304 48.755  1.00 46.79  ?  154 PHE C CD1   1 
ATOM   4542 C  CD2   . PHE C 1 137 ? 17.930  26.852 48.108  1.00 46.78  ?  154 PHE C CD2   1 
ATOM   4543 C  CE1   . PHE C 1 137 ? 15.365  25.965 48.604  1.00 45.95  ?  154 PHE C CE1   1 
ATOM   4544 C  CE2   . PHE C 1 137 ? 17.622  25.513 47.959  1.00 46.24  ?  154 PHE C CE2   1 
ATOM   4545 C  CZ    . PHE C 1 137 ? 16.337  25.069 48.206  1.00 45.77  ?  154 PHE C CZ    1 
ATOM   4546 N  N     . MET C 1 138 ? 15.346  31.534 49.332  1.00 53.91  ?  155 MET C N     1 
ATOM   4547 C  CA    . MET C 1 138 ? 14.182  32.061 50.033  1.00 54.55  ?  155 MET C CA    1 
ATOM   4548 C  C     . MET C 1 138 ? 13.279  32.867 49.104  1.00 56.52  ?  155 MET C C     1 
ATOM   4549 O  O     . MET C 1 138 ? 12.065  32.910 49.296  1.00 57.00  ?  155 MET C O     1 
ATOM   4550 C  CB    . MET C 1 138 ? 14.615  32.923 51.218  1.00 55.10  ?  155 MET C CB    1 
ATOM   4551 C  CG    . MET C 1 138 ? 15.189  32.132 52.380  1.00 53.58  ?  155 MET C CG    1 
ATOM   4552 S  SD    . MET C 1 138 ? 15.576  33.186 53.786  1.00 54.84  ?  155 MET C SD    1 
ATOM   4553 C  CE    . MET C 1 138 ? 13.927  33.680 54.266  1.00 56.24  ?  155 MET C CE    1 
ATOM   4554 N  N     . LYS C 1 139 ? 13.875  33.512 48.105  1.00 63.60  ?  156 LYS C N     1 
ATOM   4555 C  CA    . LYS C 1 139 ? 13.104  34.281 47.133  1.00 65.94  ?  156 LYS C CA    1 
ATOM   4556 C  C     . LYS C 1 139 ? 12.245  33.359 46.273  1.00 65.44  ?  156 LYS C C     1 
ATOM   4557 O  O     . LYS C 1 139 ? 11.121  33.705 45.911  1.00 66.78  ?  156 LYS C O     1 
ATOM   4558 C  CB    . LYS C 1 139 ? 14.023  35.131 46.252  1.00 68.12  ?  156 LYS C CB    1 
ATOM   4559 C  CG    . LYS C 1 139 ? 14.120  36.584 46.699  1.00 70.50  ?  156 LYS C CG    1 
ATOM   4560 C  CD    . LYS C 1 139 ? 14.674  37.484 45.604  1.00 73.42  ?  156 LYS C CD    1 
ATOM   4561 C  CE    . LYS C 1 139 ? 16.059  37.046 45.161  1.00 72.71  ?  156 LYS C CE    1 
ATOM   4562 N  NZ    . LYS C 1 139 ? 16.649  38.003 44.183  1.00 75.65  1  156 LYS C NZ    1 
ATOM   4563 N  N     . ARG C 1 140 ? 12.781  32.186 45.945  1.00 50.82  ?  157 ARG C N     1 
ATOM   4564 C  CA    . ARG C 1 140 ? 12.027  31.191 45.190  1.00 50.99  ?  157 ARG C CA    1 
ATOM   4565 C  C     . ARG C 1 140 ? 10.908  30.598 46.036  1.00 48.89  ?  157 ARG C C     1 
ATOM   4566 O  O     . ARG C 1 140 ? 9.772   30.465 45.580  1.00 50.51  ?  157 ARG C O     1 
ATOM   4567 C  CB    . ARG C 1 140 ? 12.935  30.060 44.701  1.00 50.62  ?  157 ARG C CB    1 
ATOM   4568 C  CG    . ARG C 1 140 ? 14.009  30.447 43.703  1.00 52.88  ?  157 ARG C CG    1 
ATOM   4569 C  CD    . ARG C 1 140 ? 14.366  29.236 42.851  1.00 52.95  ?  157 ARG C CD    1 
ATOM   4570 N  NE    . ARG C 1 140 ? 15.703  29.315 42.273  1.00 53.72  ?  157 ARG C NE    1 
ATOM   4571 C  CZ    . ARG C 1 140 ? 16.477  28.256 42.053  1.00 52.29  ?  157 ARG C CZ    1 
ATOM   4572 N  NH1   . ARG C 1 140 ? 16.043  27.041 42.361  1.00 49.87  1  157 ARG C NH1   1 
ATOM   4573 N  NH2   . ARG C 1 140 ? 17.683  28.409 41.524  1.00 53.21  ?  157 ARG C NH2   1 
ATOM   4574 N  N     . LEU C 1 141 ? 11.244  30.246 47.273  1.00 50.82  ?  158 LEU C N     1 
ATOM   4575 C  CA    . LEU C 1 141 ? 10.314  29.569 48.170  1.00 49.49  ?  158 LEU C CA    1 
ATOM   4576 C  C     . LEU C 1 141 ? 9.131   30.445 48.565  1.00 50.64  ?  158 LEU C C     1 
ATOM   4577 O  O     . LEU C 1 141 ? 7.999   29.970 48.636  1.00 50.30  ?  158 LEU C O     1 
ATOM   4578 C  CB    . LEU C 1 141 ? 11.046  29.095 49.427  1.00 48.09  ?  158 LEU C CB    1 
ATOM   4579 C  CG    . LEU C 1 141 ? 11.882  27.821 49.295  1.00 46.75  ?  158 LEU C CG    1 
ATOM   4580 C  CD1   . LEU C 1 141 ? 12.582  27.501 50.607  1.00 45.81  ?  158 LEU C CD1   1 
ATOM   4581 C  CD2   . LEU C 1 141 ? 11.017  26.653 48.846  1.00 46.03  ?  158 LEU C CD2   1 
ATOM   4582 N  N     . SER C 1 142 ? 9.395   31.722 48.819  1.00 52.92  ?  159 SER C N     1 
ATOM   4583 C  CA    . SER C 1 142 ? 8.352   32.649 49.244  1.00 54.37  ?  159 SER C CA    1 
ATOM   4584 C  C     . SER C 1 142 ? 7.283   32.828 48.171  1.00 55.67  ?  159 SER C C     1 
ATOM   4585 O  O     . SER C 1 142 ? 6.141   33.177 48.472  1.00 56.50  ?  159 SER C O     1 
ATOM   4586 C  CB    . SER C 1 142 ? 8.960   34.006 49.606  1.00 56.19  ?  159 SER C CB    1 
ATOM   4587 O  OG    . SER C 1 142 ? 9.355   34.716 48.446  1.00 58.10  ?  159 SER C OG    1 
ATOM   4588 N  N     . LYS C 1 143 ? 7.660   32.587 46.920  1.00 42.97  ?  160 LYS C N     1 
ATOM   4589 C  CA    . LYS C 1 143 ? 6.744   32.740 45.797  1.00 44.50  ?  160 LYS C CA    1 
ATOM   4590 C  C     . LYS C 1 143 ? 5.794   31.554 45.641  1.00 43.03  ?  160 LYS C C     1 
ATOM   4591 O  O     . LYS C 1 143 ? 4.818   31.633 44.896  1.00 44.19  ?  160 LYS C O     1 
ATOM   4592 C  CB    . LYS C 1 143 ? 7.531   32.942 44.499  1.00 45.87  ?  160 LYS C CB    1 
ATOM   4593 N  N     . VAL C 1 144 ? 6.077   30.457 46.339  1.00 31.47  ?  161 VAL C N     1 
ATOM   4594 C  CA    . VAL C 1 144 ? 5.276   29.245 46.190  1.00 32.87  ?  161 VAL C CA    1 
ATOM   4595 C  C     . VAL C 1 144 ? 4.848   28.629 47.522  1.00 33.26  ?  161 VAL C C     1 
ATOM   4596 O  O     . VAL C 1 144 ? 4.079   27.668 47.543  1.00 34.33  ?  161 VAL C O     1 
ATOM   4597 C  CB    . VAL C 1 144 ? 6.034   28.167 45.385  1.00 32.03  ?  161 VAL C CB    1 
ATOM   4598 C  CG1   . VAL C 1 144 ? 6.275   28.633 43.955  1.00 32.21  ?  161 VAL C CG1   1 
ATOM   4599 C  CG2   . VAL C 1 144 ? 7.346   27.815 46.072  1.00 30.90  ?  161 VAL C CG2   1 
ATOM   4600 N  N     . VAL C 1 145 ? 5.337   29.183 48.628  1.00 39.21  ?  162 VAL C N     1 
ATOM   4601 C  CA    . VAL C 1 145 ? 5.027   28.634 49.945  1.00 39.25  ?  162 VAL C CA    1 
ATOM   4602 C  C     . VAL C 1 145 ? 5.312   29.649 51.049  1.00 38.42  ?  162 VAL C C     1 
ATOM   4603 O  O     . VAL C 1 145 ? 6.091   30.584 50.860  1.00 37.46  ?  162 VAL C O     1 
ATOM   4604 C  CB    . VAL C 1 145 ? 5.830   27.333 50.214  1.00 38.16  ?  162 VAL C CB    1 
ATOM   4605 C  CG1   . VAL C 1 145 ? 7.233   27.650 50.709  1.00 36.31  ?  162 VAL C CG1   1 
ATOM   4606 C  CG2   . VAL C 1 145 ? 5.102   26.447 51.209  1.00 38.66  ?  162 VAL C CG2   1 
ATOM   4607 N  N     . ASN C 1 146 ? 4.660   29.474 52.195  1.00 44.47  ?  163 ASN C N     1 
ATOM   4608 C  CA    . ASN C 1 146 ? 4.899   30.333 53.348  1.00 43.69  ?  163 ASN C CA    1 
ATOM   4609 C  C     . ASN C 1 146 ? 6.179   29.948 54.077  1.00 42.48  ?  163 ASN C C     1 
ATOM   4610 O  O     . ASN C 1 146 ? 6.296   28.835 54.592  1.00 42.30  ?  163 ASN C O     1 
ATOM   4611 C  CB    . ASN C 1 146 ? 3.714   30.275 54.314  1.00 44.19  ?  163 ASN C CB    1 
ATOM   4612 C  CG    . ASN C 1 146 ? 2.435   30.804 53.700  1.00 45.41  ?  163 ASN C CG    1 
ATOM   4613 O  OD1   . ASN C 1 146 ? 2.436   31.837 53.031  1.00 45.61  ?  163 ASN C OD1   1 
ATOM   4614 N  ND2   . ASN C 1 146 ? 1.332   30.100 53.930  1.00 46.20  ?  163 ASN C ND2   1 
ATOM   4615 N  N     . ILE C 1 147 ? 7.137   30.867 54.123  1.00 38.32  ?  164 ILE C N     1 
ATOM   4616 C  CA    . ILE C 1 147 ? 8.409   30.595 54.781  1.00 37.31  ?  164 ILE C CA    1 
ATOM   4617 C  C     . ILE C 1 147 ? 8.520   31.321 56.118  1.00 36.97  ?  164 ILE C C     1 
ATOM   4618 O  O     . ILE C 1 147 ? 8.129   32.482 56.247  1.00 36.96  ?  164 ILE C O     1 
ATOM   4619 C  CB    . ILE C 1 147 ? 9.610   30.982 53.892  1.00 36.29  ?  164 ILE C CB    1 
ATOM   4620 C  CG1   . ILE C 1 147 ? 9.517   32.443 53.452  1.00 36.11  ?  164 ILE C CG1   1 
ATOM   4621 C  CG2   . ILE C 1 147 ? 9.691   30.066 52.681  1.00 36.21  ?  164 ILE C CG2   1 
ATOM   4622 C  CD1   . ILE C 1 147 ? 10.679  32.892 52.596  1.00 34.81  ?  164 ILE C CD1   1 
ATOM   4623 N  N     . VAL C 1 148 ? 9.047   30.620 57.116  1.00 32.22  ?  165 VAL C N     1 
ATOM   4624 C  CA    . VAL C 1 148 ? 9.375   31.235 58.394  1.00 32.34  ?  165 VAL C CA    1 
ATOM   4625 C  C     . VAL C 1 148 ? 10.846  30.988 58.696  1.00 31.83  ?  165 VAL C C     1 
ATOM   4626 O  O     . VAL C 1 148 ? 11.230  29.884 59.086  1.00 32.03  ?  165 VAL C O     1 
ATOM   4627 C  CB    . VAL C 1 148 ? 8.507   30.687 59.540  1.00 33.30  ?  165 VAL C CB    1 
ATOM   4628 C  CG1   . VAL C 1 148 ? 8.946   31.285 60.870  1.00 33.50  ?  165 VAL C CG1   1 
ATOM   4629 C  CG2   . VAL C 1 148 ? 7.040   30.979 59.280  1.00 33.98  ?  165 VAL C CG2   1 
ATOM   4630 N  N     . PRO C 1 149 ? 11.678  32.020 58.504  1.00 36.39  ?  166 PRO C N     1 
ATOM   4631 C  CA    . PRO C 1 149 ? 13.128  31.911 58.687  1.00 36.01  ?  166 PRO C CA    1 
ATOM   4632 C  C     . PRO C 1 149 ? 13.503  31.715 60.147  1.00 36.60  ?  166 PRO C C     1 
ATOM   4633 O  O     . PRO C 1 149 ? 12.913  32.344 61.025  1.00 36.94  ?  166 PRO C O     1 
ATOM   4634 C  CB    . PRO C 1 149 ? 13.661  33.255 58.165  1.00 35.33  ?  166 PRO C CB    1 
ATOM   4635 C  CG    . PRO C 1 149 ? 12.501  33.925 57.491  1.00 35.32  ?  166 PRO C CG    1 
ATOM   4636 C  CD    . PRO C 1 149 ? 11.271  33.382 58.129  1.00 36.12  ?  166 PRO C CD    1 
ATOM   4637 N  N     . VAL C 1 150 ? 14.469  30.840 60.400  1.00 34.22  ?  167 VAL C N     1 
ATOM   4638 C  CA    . VAL C 1 150 ? 14.898  30.552 61.760  1.00 34.87  ?  167 VAL C CA    1 
ATOM   4639 C  C     . VAL C 1 150 ? 16.417  30.578 61.852  1.00 34.96  ?  167 VAL C C     1 
ATOM   4640 O  O     . VAL C 1 150 ? 17.114  30.194 60.912  1.00 34.58  ?  167 VAL C O     1 
ATOM   4641 C  CB    . VAL C 1 150 ? 14.375  29.185 62.258  1.00 35.37  ?  167 VAL C CB    1 
ATOM   4642 C  CG1   . VAL C 1 150 ? 12.860  29.211 62.399  1.00 35.47  ?  167 VAL C CG1   1 
ATOM   4643 C  CG2   . VAL C 1 150 ? 14.813  28.064 61.328  1.00 35.18  ?  167 VAL C CG2   1 
ATOM   4644 N  N     . ILE C 1 151 ? 16.930  31.040 62.987  1.00 36.01  ?  168 ILE C N     1 
ATOM   4645 C  CA    . ILE C 1 151 ? 18.366  31.031 63.216  1.00 36.48  ?  168 ILE C CA    1 
ATOM   4646 C  C     . ILE C 1 151 ? 18.783  29.661 63.729  1.00 37.13  ?  168 ILE C C     1 
ATOM   4647 O  O     . ILE C 1 151 ? 18.590  29.336 64.901  1.00 37.63  ?  168 ILE C O     1 
ATOM   4648 C  CB    . ILE C 1 151 ? 18.796  32.117 64.218  1.00 37.07  ?  168 ILE C CB    1 
ATOM   4649 C  CG1   . ILE C 1 151 ? 18.420  33.504 63.694  1.00 36.41  ?  168 ILE C CG1   1 
ATOM   4650 C  CG2   . ILE C 1 151 ? 20.293  32.039 64.478  1.00 37.94  ?  168 ILE C CG2   1 
ATOM   4651 C  CD1   . ILE C 1 151 ? 18.737  34.627 64.658  1.00 37.02  ?  168 ILE C CD1   1 
ATOM   4652 N  N     . ALA C 1 152 ? 19.340  28.855 62.831  1.00 40.41  ?  169 ALA C N     1 
ATOM   4653 C  CA    . ALA C 1 152 ? 19.773  27.507 63.168  1.00 40.77  ?  169 ALA C CA    1 
ATOM   4654 C  C     . ALA C 1 152 ? 20.879  27.546 64.214  1.00 41.97  ?  169 ALA C C     1 
ATOM   4655 O  O     . ALA C 1 152 ? 21.801  28.357 64.117  1.00 43.02  ?  169 ALA C O     1 
ATOM   4656 C  CB    . ALA C 1 152 ? 20.242  26.776 61.923  1.00 40.11  ?  169 ALA C CB    1 
ATOM   4657 N  N     . LYS C 1 153 ? 20.778  26.660 65.202  1.00 43.45  ?  170 LYS C N     1 
ATOM   4658 C  CA    . LYS C 1 153 ? 21.757  26.568 66.282  1.00 44.75  ?  170 LYS C CA    1 
ATOM   4659 C  C     . LYS C 1 153 ? 21.979  27.917 66.956  1.00 45.13  ?  170 LYS C C     1 
ATOM   4660 O  O     . LYS C 1 153 ? 23.077  28.467 66.915  1.00 46.44  ?  170 LYS C O     1 
ATOM   4661 C  CB    . LYS C 1 153 ? 23.085  26.023 65.756  1.00 44.80  ?  170 LYS C CB    1 
ATOM   4662 C  CG    . LYS C 1 153 ? 22.993  24.632 65.157  1.00 44.60  ?  170 LYS C CG    1 
ATOM   4663 C  CD    . LYS C 1 153 ? 24.316  24.216 64.541  1.00 44.58  ?  170 LYS C CD    1 
ATOM   4664 C  CE    . LYS C 1 153 ? 24.310  22.748 64.162  1.00 44.71  ?  170 LYS C CE    1 
ATOM   4665 N  NZ    . LYS C 1 153 ? 25.634  22.311 63.637  1.00 44.84  1  170 LYS C NZ    1 
ATOM   4666 N  N     . ALA C 1 154 ? 20.927  28.448 67.572  1.00 42.70  ?  171 ALA C N     1 
ATOM   4667 C  CA    . ALA C 1 154 ? 20.978  29.773 68.180  1.00 43.25  ?  171 ALA C CA    1 
ATOM   4668 C  C     . ALA C 1 154 ? 21.856  29.808 69.430  1.00 45.34  ?  171 ALA C C     1 
ATOM   4669 O  O     . ALA C 1 154 ? 22.158  30.881 69.952  1.00 46.85  ?  171 ALA C O     1 
ATOM   4670 C  CB    . ALA C 1 154 ? 19.573  30.249 68.515  1.00 42.61  ?  171 ALA C CB    1 
ATOM   4671 N  N     . ASP C 1 155 ? 22.264  28.636 69.906  1.00 52.49  ?  172 ASP C N     1 
ATOM   4672 C  CA    . ASP C 1 155 ? 23.165  28.553 71.051  1.00 54.85  ?  172 ASP C CA    1 
ATOM   4673 C  C     . ASP C 1 155 ? 24.590  28.925 70.650  1.00 58.04  ?  172 ASP C C     1 
ATOM   4674 O  O     . ASP C 1 155 ? 25.445  29.163 71.504  1.00 60.63  ?  172 ASP C O     1 
ATOM   4675 C  CB    . ASP C 1 155 ? 23.136  27.148 71.658  1.00 54.74  ?  172 ASP C CB    1 
ATOM   4676 C  CG    . ASP C 1 155 ? 23.379  26.062 70.629  1.00 53.97  ?  172 ASP C CG    1 
ATOM   4677 O  OD1   . ASP C 1 155 ? 22.921  26.219 69.476  1.00 52.67  ?  172 ASP C OD1   1 
ATOM   4678 O  OD2   . ASP C 1 155 ? 24.027  25.051 70.972  1.00 54.73  -1 172 ASP C OD2   1 
ATOM   4679 N  N     . THR C 1 156 ? 24.835  28.970 69.344  1.00 57.27  ?  173 THR C N     1 
ATOM   4680 C  CA    . THR C 1 156 ? 26.126  29.384 68.807  1.00 60.30  ?  173 THR C CA    1 
ATOM   4681 C  C     . THR C 1 156 ? 26.425  30.848 69.124  1.00 62.31  ?  173 THR C C     1 
ATOM   4682 O  O     . THR C 1 156 ? 27.568  31.216 69.399  1.00 65.39  ?  173 THR C O     1 
ATOM   4683 C  CB    . THR C 1 156 ? 26.183  29.176 67.279  1.00 59.38  ?  173 THR C CB    1 
ATOM   4684 O  OG1   . THR C 1 156 ? 25.884  27.809 66.969  1.00 56.99  ?  173 THR C OG1   1 
ATOM   4685 C  CG2   . THR C 1 156 ? 27.558  29.530 66.730  1.00 62.42  ?  173 THR C CG2   1 
ATOM   4686 N  N     . LEU C 1 157 ? 25.385  31.675 69.102  1.00 39.79  ?  174 LEU C N     1 
ATOM   4687 C  CA    . LEU C 1 157 ? 25.550  33.115 69.260  1.00 40.36  ?  174 LEU C CA    1 
ATOM   4688 C  C     . LEU C 1 157 ? 25.311  33.562 70.697  1.00 41.09  ?  174 LEU C C     1 
ATOM   4689 O  O     . LEU C 1 157 ? 24.608  32.896 71.456  1.00 40.97  ?  174 LEU C O     1 
ATOM   4690 C  CB    . LEU C 1 157 ? 24.597  33.861 68.324  1.00 37.43  ?  174 LEU C CB    1 
ATOM   4691 C  CG    . LEU C 1 157 ? 24.703  33.525 66.835  1.00 36.20  ?  174 LEU C CG    1 
ATOM   4692 C  CD1   . LEU C 1 157 ? 23.544  34.142 66.065  1.00 34.69  ?  174 LEU C CD1   1 
ATOM   4693 C  CD2   . LEU C 1 157 ? 26.037  33.985 66.266  1.00 37.62  ?  174 LEU C CD2   1 
ATOM   4694 N  N     . THR C 1 158 ? 25.903  34.693 71.066  1.00 58.01  ?  175 THR C N     1 
ATOM   4695 C  CA    . THR C 1 158 ? 25.646  35.295 72.367  1.00 58.74  ?  175 THR C CA    1 
ATOM   4696 C  C     . THR C 1 158 ? 24.360  36.108 72.296  1.00 56.14  ?  175 THR C C     1 
ATOM   4697 O  O     . THR C 1 158 ? 23.756  36.230 71.229  1.00 53.94  ?  175 THR C O     1 
ATOM   4698 C  CB    . THR C 1 158 ? 26.807  36.198 72.826  1.00 61.16  ?  175 THR C CB    1 
ATOM   4699 O  OG1   . THR C 1 158 ? 26.845  37.383 72.021  1.00 59.75  ?  175 THR C OG1   1 
ATOM   4700 C  CG2   . THR C 1 158 ? 28.136  35.465 72.709  1.00 63.85  ?  175 THR C CG2   1 
ATOM   4701 N  N     . LEU C 1 159 ? 23.939  36.656 73.431  1.00 69.03  ?  176 LEU C N     1 
ATOM   4702 C  CA    . LEU C 1 159 ? 22.726  37.464 73.482  1.00 67.40  ?  176 LEU C CA    1 
ATOM   4703 C  C     . LEU C 1 159 ? 22.870  38.717 72.624  1.00 67.82  ?  176 LEU C C     1 
ATOM   4704 O  O     . LEU C 1 159 ? 21.948  39.098 71.903  1.00 66.35  ?  176 LEU C O     1 
ATOM   4705 C  CB    . LEU C 1 159 ? 22.395  37.848 74.925  1.00 67.50  ?  176 LEU C CB    1 
ATOM   4706 N  N     . GLU C 1 160 ? 24.034  39.352 72.711  1.00 62.76  ?  177 GLU C N     1 
ATOM   4707 C  CA    . GLU C 1 160 ? 24.328  40.540 71.918  1.00 62.96  ?  177 GLU C CA    1 
ATOM   4708 C  C     . GLU C 1 160 ? 24.365  40.219 70.427  1.00 62.15  ?  177 GLU C C     1 
ATOM   4709 O  O     . GLU C 1 160 ? 23.811  40.954 69.610  1.00 60.93  ?  177 GLU C O     1 
ATOM   4710 C  CB    . GLU C 1 160 ? 25.658  41.158 72.355  1.00 64.97  ?  177 GLU C CB    1 
ATOM   4711 N  N     . GLU C 1 161 ? 25.027  39.119 70.081  1.00 64.98  ?  178 GLU C N     1 
ATOM   4712 C  CA    . GLU C 1 161 ? 25.168  38.708 68.688  1.00 64.46  ?  178 GLU C CA    1 
ATOM   4713 C  C     . GLU C 1 161 ? 23.830  38.329 68.061  1.00 62.14  ?  178 GLU C C     1 
ATOM   4714 O  O     . GLU C 1 161 ? 23.601  38.580 66.878  1.00 60.73  ?  178 GLU C O     1 
ATOM   4715 C  CB    . GLU C 1 161 ? 26.148  37.538 68.575  1.00 66.32  ?  178 GLU C CB    1 
ATOM   4716 C  CG    . GLU C 1 161 ? 27.587  37.902 68.907  1.00 68.51  ?  178 GLU C CG    1 
ATOM   4717 C  CD    . GLU C 1 161 ? 28.523  36.712 68.829  1.00 70.51  ?  178 GLU C CD    1 
ATOM   4718 O  OE1   . GLU C 1 161 ? 28.031  35.564 68.818  1.00 70.23  ?  178 GLU C OE1   1 
ATOM   4719 O  OE2   . GLU C 1 161 ? 29.753  36.925 68.779  1.00 71.91  -1 178 GLU C OE2   1 
ATOM   4720 N  N     . ARG C 1 162 ? 22.952  37.722 68.854  1.00 71.63  ?  179 ARG C N     1 
ATOM   4721 C  CA    . ARG C 1 162 ? 21.642  37.300 68.367  1.00 69.40  ?  179 ARG C CA    1 
ATOM   4722 C  C     . ARG C 1 162 ? 20.790  38.504 67.978  1.00 68.54  ?  179 ARG C C     1 
ATOM   4723 O  O     . ARG C 1 162 ? 20.076  38.473 66.974  1.00 67.97  ?  179 ARG C O     1 
ATOM   4724 C  CB    . ARG C 1 162 ? 20.919  36.462 69.422  1.00 68.29  ?  179 ARG C CB    1 
ATOM   4725 N  N     . VAL C 1 163 ? 20.869  39.561 68.780  1.00 65.10  ?  180 VAL C N     1 
ATOM   4726 C  CA    . VAL C 1 163 ? 20.118  40.782 68.519  1.00 65.78  ?  180 VAL C CA    1 
ATOM   4727 C  C     . VAL C 1 163 ? 20.600  41.461 67.239  1.00 66.01  ?  180 VAL C C     1 
ATOM   4728 O  O     . VAL C 1 163 ? 19.795  41.891 66.412  1.00 66.10  ?  180 VAL C O     1 
ATOM   4729 C  CB    . VAL C 1 163 ? 20.232  41.774 69.696  1.00 67.20  ?  180 VAL C CB    1 
ATOM   4730 C  CG1   . VAL C 1 163 ? 19.559  43.095 69.355  1.00 68.20  ?  180 VAL C CG1   1 
ATOM   4731 C  CG2   . VAL C 1 163 ? 19.630  41.172 70.956  1.00 66.95  ?  180 VAL C CG2   1 
ATOM   4732 N  N     . HIS C 1 164 ? 21.917  41.542 67.076  1.00 51.33  ?  181 HIS C N     1 
ATOM   4733 C  CA    . HIS C 1 164 ? 22.508  42.148 65.888  1.00 51.78  ?  181 HIS C CA    1 
ATOM   4734 C  C     . HIS C 1 164 ? 22.227  41.311 64.643  1.00 50.49  ?  181 HIS C C     1 
ATOM   4735 O  O     . HIS C 1 164 ? 22.022  41.849 63.555  1.00 50.64  ?  181 HIS C O     1 
ATOM   4736 C  CB    . HIS C 1 164 ? 24.016  42.332 66.074  1.00 52.76  ?  181 HIS C CB    1 
ATOM   4737 C  CG    . HIS C 1 164 ? 24.720  42.835 64.853  1.00 53.52  ?  181 HIS C CG    1 
ATOM   4738 N  ND1   . HIS C 1 164 ? 25.242  41.995 63.893  1.00 52.95  ?  181 HIS C ND1   1 
ATOM   4739 C  CD2   . HIS C 1 164 ? 24.988  44.095 64.435  1.00 54.80  ?  181 HIS C CD2   1 
ATOM   4740 C  CE1   . HIS C 1 164 ? 25.802  42.715 62.937  1.00 53.77  ?  181 HIS C CE1   1 
ATOM   4741 N  NE2   . HIS C 1 164 ? 25.662  43.992 63.242  1.00 54.90  ?  181 HIS C NE2   1 
ATOM   4742 N  N     . PHE C 1 165 ? 22.219  39.992 64.812  1.00 46.11  ?  182 PHE C N     1 
ATOM   4743 C  CA    . PHE C 1 165 ? 21.990  39.076 63.700  1.00 45.11  ?  182 PHE C CA    1 
ATOM   4744 C  C     . PHE C 1 165 ? 20.547  39.155 63.213  1.00 44.44  ?  182 PHE C C     1 
ATOM   4745 O  O     . PHE C 1 165 ? 20.293  39.172 62.010  1.00 44.07  ?  182 PHE C O     1 
ATOM   4746 C  CB    . PHE C 1 165 ? 22.340  37.642 64.107  1.00 44.77  ?  182 PHE C CB    1 
ATOM   4747 C  CG    . PHE C 1 165 ? 22.422  36.683 62.953  1.00 43.98  ?  182 PHE C CG    1 
ATOM   4748 C  CD1   . PHE C 1 165 ? 23.080  37.034 61.785  1.00 43.98  ?  182 PHE C CD1   1 
ATOM   4749 C  CD2   . PHE C 1 165 ? 21.864  35.419 63.046  1.00 43.19  ?  182 PHE C CD2   1 
ATOM   4750 C  CE1   . PHE C 1 165 ? 23.160  36.149 60.725  1.00 43.22  ?  182 PHE C CE1   1 
ATOM   4751 C  CE2   . PHE C 1 165 ? 21.945  34.528 61.991  1.00 42.46  ?  182 PHE C CE2   1 
ATOM   4752 C  CZ    . PHE C 1 165 ? 22.595  34.894 60.829  1.00 42.41  ?  182 PHE C CZ    1 
ATOM   4753 N  N     . LYS C 1 166 ? 19.608  39.199 64.154  1.00 57.29  ?  183 LYS C N     1 
ATOM   4754 C  CA    . LYS C 1 166 ? 18.194  39.354 63.826  1.00 57.15  ?  183 LYS C CA    1 
ATOM   4755 C  C     . LYS C 1 166 ? 17.944  40.644 63.049  1.00 58.15  ?  183 LYS C C     1 
ATOM   4756 O  O     . LYS C 1 166 ? 17.206  40.654 62.063  1.00 57.99  ?  183 LYS C O     1 
ATOM   4757 C  CB    . LYS C 1 166 ? 17.341  39.337 65.098  1.00 57.25  ?  183 LYS C CB    1 
ATOM   4758 C  CG    . LYS C 1 166 ? 17.038  37.947 65.636  1.00 56.06  ?  183 LYS C CG    1 
ATOM   4759 C  CD    . LYS C 1 166 ? 16.026  38.008 66.769  1.00 56.22  ?  183 LYS C CD    1 
ATOM   4760 C  CE    . LYS C 1 166 ? 15.429  36.640 67.054  1.00 55.21  ?  183 LYS C CE    1 
ATOM   4761 N  NZ    . LYS C 1 166 ? 14.315  36.708 68.041  1.00 55.54  1  183 LYS C NZ    1 
ATOM   4762 N  N     . GLN C 1 167 ? 18.562  41.728 63.506  1.00 52.60  ?  184 GLN C N     1 
ATOM   4763 C  CA    . GLN C 1 167 ? 18.427  43.035 62.870  1.00 53.84  ?  184 GLN C CA    1 
ATOM   4764 C  C     . GLN C 1 167 ? 18.930  43.046 61.428  1.00 53.71  ?  184 GLN C C     1 
ATOM   4765 O  O     . GLN C 1 167 ? 18.366  43.729 60.574  1.00 54.36  ?  184 GLN C O     1 
ATOM   4766 C  CB    . GLN C 1 167 ? 19.166  44.099 63.683  1.00 55.31  ?  184 GLN C CB    1 
ATOM   4767 C  CG    . GLN C 1 167 ? 18.459  44.493 64.969  1.00 56.00  ?  184 GLN C CG    1 
ATOM   4768 C  CD    . GLN C 1 167 ? 19.219  45.544 65.752  1.00 57.63  ?  184 GLN C CD    1 
ATOM   4769 O  OE1   . GLN C 1 167 ? 20.287  45.994 65.336  1.00 58.41  ?  184 GLN C OE1   1 
ATOM   4770 N  NE2   . GLN C 1 167 ? 18.668  45.945 66.893  1.00 58.35  ?  184 GLN C NE2   1 
ATOM   4771 N  N     . ARG C 1 168 ? 19.991  42.292 61.161  1.00 36.32  ?  185 ARG C N     1 
ATOM   4772 C  CA    . ARG C 1 168 ? 20.600  42.291 59.836  1.00 36.47  ?  185 ARG C CA    1 
ATOM   4773 C  C     . ARG C 1 168 ? 19.789  41.439 58.869  1.00 35.42  ?  185 ARG C C     1 
ATOM   4774 O  O     . ARG C 1 168 ? 19.578  41.822 57.718  1.00 35.90  ?  185 ARG C O     1 
ATOM   4775 C  CB    . ARG C 1 168 ? 22.041  41.783 59.906  1.00 36.31  ?  185 ARG C CB    1 
ATOM   4776 N  N     . ILE C 1 169 ? 19.343  40.280 59.341  1.00 43.83  ?  186 ILE C N     1 
ATOM   4777 C  CA    . ILE C 1 169 ? 18.495  39.399 58.546  1.00 42.89  ?  186 ILE C CA    1 
ATOM   4778 C  C     . ILE C 1 169 ? 17.179  40.071 58.161  1.00 43.29  ?  186 ILE C C     1 
ATOM   4779 O  O     . ILE C 1 169 ? 16.752  39.990 57.009  1.00 43.28  ?  186 ILE C O     1 
ATOM   4780 C  CB    . ILE C 1 169 ? 18.204  38.085 59.291  1.00 41.88  ?  186 ILE C CB    1 
ATOM   4781 C  CG1   . ILE C 1 169 ? 19.508  37.322 59.529  1.00 41.66  ?  186 ILE C CG1   1 
ATOM   4782 C  CG2   . ILE C 1 169 ? 17.234  37.221 58.501  1.00 41.03  ?  186 ILE C CG2   1 
ATOM   4783 C  CD1   . ILE C 1 169 ? 19.320  35.969 60.166  1.00 41.04  ?  186 ILE C CD1   1 
ATOM   4784 N  N     . THR C 1 170 ? 16.545  40.736 59.125  1.00 35.23  ?  187 THR C N     1 
ATOM   4785 C  CA    . THR C 1 170 ? 15.300  41.457 58.872  1.00 35.96  ?  187 THR C CA    1 
ATOM   4786 C  C     . THR C 1 170 ? 15.481  42.471 57.747  1.00 37.21  ?  187 THR C C     1 
ATOM   4787 O  O     . THR C 1 170 ? 14.662  42.552 56.834  1.00 37.44  ?  187 THR C O     1 
ATOM   4788 C  CB    . THR C 1 170 ? 14.794  42.184 60.135  1.00 36.71  ?  187 THR C CB    1 
ATOM   4789 O  OG1   . THR C 1 170 ? 14.634  41.241 61.201  1.00 35.69  ?  187 THR C OG1   1 
ATOM   4790 C  CG2   . THR C 1 170 ? 13.458  42.862 59.861  1.00 37.55  ?  187 THR C CG2   1 
ATOM   4791 N  N     . ALA C 1 171 ? 16.565  43.237 57.822  1.00 37.12  ?  188 ALA C N     1 
ATOM   4792 C  CA    . ALA C 1 171 ? 16.863  44.252 56.819  1.00 38.53  ?  188 ALA C CA    1 
ATOM   4793 C  C     . ALA C 1 171 ? 17.127  43.607 55.459  1.00 38.04  ?  188 ALA C C     1 
ATOM   4794 O  O     . ALA C 1 171 ? 16.734  44.142 54.422  1.00 38.95  ?  188 ALA C O     1 
ATOM   4795 C  CB    . ALA C 1 171 ? 18.052  45.089 57.248  1.00 39.61  ?  188 ALA C CB    1 
ATOM   4796 N  N     . ASP C 1 172 ? 17.794  42.457 55.475  1.00 58.29  ?  189 ASP C N     1 
ATOM   4797 C  CA    . ASP C 1 172 ? 18.115  41.743 54.248  1.00 57.82  ?  189 ASP C CA    1 
ATOM   4798 C  C     . ASP C 1 172 ? 16.846  41.198 53.594  1.00 57.25  ?  189 ASP C C     1 
ATOM   4799 O  O     . ASP C 1 172 ? 16.687  41.277 52.374  1.00 57.62  ?  189 ASP C O     1 
ATOM   4800 C  CB    . ASP C 1 172 ? 19.103  40.611 54.527  1.00 56.84  ?  189 ASP C CB    1 
ATOM   4801 C  CG    . ASP C 1 172 ? 20.526  41.108 54.711  1.00 57.77  ?  189 ASP C CG    1 
ATOM   4802 O  OD1   . ASP C 1 172 ? 20.843  42.214 54.225  1.00 59.29  ?  189 ASP C OD1   1 
ATOM   4803 O  OD2   . ASP C 1 172 ? 21.331  40.393 55.347  1.00 57.44  -1 189 ASP C OD2   1 
ATOM   4804 N  N     . LEU C 1 173 ? 15.954  40.637 54.407  1.00 39.16  ?  190 LEU C N     1 
ATOM   4805 C  CA    . LEU C 1 173 ? 14.676  40.133 53.914  1.00 38.71  ?  190 LEU C CA    1 
ATOM   4806 C  C     . LEU C 1 173 ? 13.861  41.243 53.257  1.00 40.16  ?  190 LEU C C     1 
ATOM   4807 O  O     . LEU C 1 173 ? 13.292  41.056 52.181  1.00 40.32  ?  190 LEU C O     1 
ATOM   4808 C  CB    . LEU C 1 173 ? 13.868  39.497 55.047  1.00 37.79  ?  190 LEU C CB    1 
ATOM   4809 C  CG    . LEU C 1 173 ? 14.460  38.243 55.689  1.00 36.39  ?  190 LEU C CG    1 
ATOM   4810 C  CD1   . LEU C 1 173 ? 13.548  37.717 56.788  1.00 35.75  ?  190 LEU C CD1   1 
ATOM   4811 C  CD2   . LEU C 1 173 ? 14.717  37.182 54.633  1.00 35.58  ?  190 LEU C CD2   1 
ATOM   4812 N  N     . LEU C 1 174 ? 13.813  42.397 53.915  1.00 53.00  ?  191 LEU C N     1 
ATOM   4813 C  CA    . LEU C 1 174 ? 13.065  43.544 53.414  1.00 54.53  ?  191 LEU C CA    1 
ATOM   4814 C  C     . LEU C 1 174 ? 13.661  44.091 52.120  1.00 55.59  ?  191 LEU C C     1 
ATOM   4815 O  O     . LEU C 1 174 ? 12.937  44.378 51.166  1.00 56.42  ?  191 LEU C O     1 
ATOM   4816 C  CB    . LEU C 1 174 ? 13.008  44.649 54.472  1.00 55.59  ?  191 LEU C CB    1 
ATOM   4817 C  CG    . LEU C 1 174 ? 12.197  44.336 55.731  1.00 55.05  ?  191 LEU C CG    1 
ATOM   4818 C  CD1   . LEU C 1 174 ? 12.287  45.478 56.731  1.00 56.20  ?  191 LEU C CD1   1 
ATOM   4819 C  CD2   . LEU C 1 174 ? 10.748  44.041 55.377  1.00 55.07  ?  191 LEU C CD2   1 
ATOM   4820 N  N     . SER C 1 175 ? 14.982  44.241 52.094  1.00 42.11  ?  192 SER C N     1 
ATOM   4821 C  CA    . SER C 1 175 ? 15.665  44.821 50.942  1.00 43.36  ?  192 SER C CA    1 
ATOM   4822 C  C     . SER C 1 175 ? 15.587  43.920 49.711  1.00 42.73  ?  192 SER C C     1 
ATOM   4823 O  O     . SER C 1 175 ? 15.595  44.405 48.580  1.00 43.96  ?  192 SER C O     1 
ATOM   4824 C  CB    . SER C 1 175 ? 17.128  45.110 51.282  1.00 43.68  ?  192 SER C CB    1 
ATOM   4825 O  OG    . SER C 1 175 ? 17.799  43.933 51.694  1.00 42.02  ?  192 SER C OG    1 
ATOM   4826 N  N     . ASN C 1 176 ? 15.511  42.611 49.933  1.00 45.99  ?  193 ASN C N     1 
ATOM   4827 C  CA    . ASN C 1 176 ? 15.423  41.658 48.831  1.00 45.24  ?  193 ASN C CA    1 
ATOM   4828 C  C     . ASN C 1 176 ? 13.982  41.334 48.447  1.00 45.18  ?  193 ASN C C     1 
ATOM   4829 O  O     . ASN C 1 176 ? 13.738  40.521 47.555  1.00 44.87  ?  193 ASN C O     1 
ATOM   4830 C  CB    . ASN C 1 176 ? 16.166  40.368 49.181  1.00 43.50  ?  193 ASN C CB    1 
ATOM   4831 C  CG    . ASN C 1 176 ? 17.667  40.497 49.014  1.00 43.78  ?  193 ASN C CG    1 
ATOM   4832 O  OD1   . ASN C 1 176 ? 18.182  40.479 47.896  1.00 44.35  ?  193 ASN C OD1   1 
ATOM   4833 N  ND2   . ASN C 1 176 ? 18.379  40.623 50.128  1.00 43.50  ?  193 ASN C ND2   1 
ATOM   4834 N  N     . GLY C 1 177 ? 13.032  41.973 49.122  1.00 53.38  ?  194 GLY C N     1 
ATOM   4835 C  CA    . GLY C 1 177 ? 11.624  41.786 48.822  1.00 53.50  ?  194 GLY C CA    1 
ATOM   4836 C  C     . GLY C 1 177 ? 11.134  40.377 49.093  1.00 51.76  ?  194 GLY C C     1 
ATOM   4837 O  O     . GLY C 1 177 ? 10.188  39.908 48.460  1.00 51.78  ?  194 GLY C O     1 
ATOM   4838 N  N     . ILE C 1 178 ? 11.777  39.700 50.038  1.00 39.55  ?  195 ILE C N     1 
ATOM   4839 C  CA    . ILE C 1 178 ? 11.382  38.348 50.414  1.00 37.99  ?  195 ILE C CA    1 
ATOM   4840 C  C     . ILE C 1 178 ? 10.179  38.375 51.349  1.00 37.87  ?  195 ILE C C     1 
ATOM   4841 O  O     . ILE C 1 178 ? 10.304  38.715 52.526  1.00 37.82  ?  195 ILE C O     1 
ATOM   4842 C  CB    . ILE C 1 178 ? 12.536  37.589 51.095  1.00 36.83  ?  195 ILE C CB    1 
ATOM   4843 C  CG1   . ILE C 1 178 ? 13.760  37.543 50.178  1.00 37.05  ?  195 ILE C CG1   1 
ATOM   4844 C  CG2   . ILE C 1 178 ? 12.099  36.184 51.479  1.00 35.39  ?  195 ILE C CG2   1 
ATOM   4845 C  CD1   . ILE C 1 178 ? 14.990  36.955 50.831  1.00 36.23  ?  195 ILE C CD1   1 
ATOM   4846 N  N     . ASP C 1 179 ? 9.013   38.018 50.819  1.00 69.96  ?  196 ASP C N     1 
ATOM   4847 C  CA    . ASP C 1 179 ? 7.782   38.031 51.599  1.00 70.12  ?  196 ASP C CA    1 
ATOM   4848 C  C     . ASP C 1 179 ? 7.645   36.765 52.437  1.00 68.97  ?  196 ASP C C     1 
ATOM   4849 O  O     . ASP C 1 179 ? 7.389   35.683 51.909  1.00 68.51  ?  196 ASP C O     1 
ATOM   4850 C  CB    . ASP C 1 179 ? 6.566   38.187 50.683  1.00 71.16  ?  196 ASP C CB    1 
ATOM   4851 C  CG    . ASP C 1 179 ? 6.565   39.507 49.936  1.00 73.11  ?  196 ASP C CG    1 
ATOM   4852 O  OD1   . ASP C 1 179 ? 7.332   40.412 50.324  1.00 73.82  ?  196 ASP C OD1   1 
ATOM   4853 O  OD2   . ASP C 1 179 ? 5.796   39.638 48.959  1.00 74.13  -1 196 ASP C OD2   1 
ATOM   4854 N  N     . VAL C 1 180 ? 7.816   36.909 53.746  1.00 32.03  ?  197 VAL C N     1 
ATOM   4855 C  CA    . VAL C 1 180 ? 7.697   35.785 54.666  1.00 30.82  ?  197 VAL C CA    1 
ATOM   4856 C  C     . VAL C 1 180 ? 6.372   35.848 55.416  1.00 31.15  ?  197 VAL C C     1 
ATOM   4857 O  O     . VAL C 1 180 ? 5.762   36.912 55.516  1.00 32.34  ?  197 VAL C O     1 
ATOM   4858 C  CB    . VAL C 1 180 ? 8.856   35.761 55.685  1.00 30.34  ?  197 VAL C CB    1 
ATOM   4859 C  CG1   . VAL C 1 180 ? 10.195  35.724 54.966  1.00 30.16  ?  197 VAL C CG1   1 
ATOM   4860 C  CG2   . VAL C 1 180 ? 8.779   36.970 56.607  1.00 31.34  ?  197 VAL C CG2   1 
ATOM   4861 N  N     . TYR C 1 181 ? 5.918   34.709 55.930  1.00 30.90  ?  198 TYR C N     1 
ATOM   4862 C  CA    . TYR C 1 181 ? 4.713   34.700 56.747  1.00 31.25  ?  198 TYR C CA    1 
ATOM   4863 C  C     . TYR C 1 181 ? 5.018   35.311 58.110  1.00 31.57  ?  198 TYR C C     1 
ATOM   4864 O  O     . TYR C 1 181 ? 6.047   35.006 58.711  1.00 30.92  ?  198 TYR C O     1 
ATOM   4865 C  CB    . TYR C 1 181 ? 4.156   33.281 56.918  1.00 30.28  ?  198 TYR C CB    1 
ATOM   4866 C  CG    . TYR C 1 181 ? 2.923   33.241 57.797  1.00 30.73  ?  198 TYR C CG    1 
ATOM   4867 C  CD1   . TYR C 1 181 ? 1.658   33.453 57.263  1.00 31.54  ?  198 TYR C CD1   1 
ATOM   4868 C  CD2   . TYR C 1 181 ? 3.027   33.019 59.166  1.00 30.50  ?  198 TYR C CD2   1 
ATOM   4869 C  CE1   . TYR C 1 181 ? 0.532   33.436 58.064  1.00 32.11  ?  198 TYR C CE1   1 
ATOM   4870 C  CE2   . TYR C 1 181 ? 1.906   33.001 59.974  1.00 31.06  ?  198 TYR C CE2   1 
ATOM   4871 C  CZ    . TYR C 1 181 ? 0.661   33.209 59.417  1.00 31.86  ?  198 TYR C CZ    1 
ATOM   4872 O  OH    . TYR C 1 181 ? -0.458  33.188 60.215  1.00 32.86  ?  198 TYR C OH    1 
ATOM   4873 N  N     . PRO C 1 182 ? 4.119   36.175 58.605  1.00 38.88  ?  199 PRO C N     1 
ATOM   4874 C  CA    . PRO C 1 182 ? 2.902   36.605 57.914  1.00 39.88  ?  199 PRO C CA    1 
ATOM   4875 C  C     . PRO C 1 182 ? 3.133   37.807 57.007  1.00 41.03  ?  199 PRO C C     1 
ATOM   4876 O  O     . PRO C 1 182 ? 3.604   38.847 57.468  1.00 41.85  ?  199 PRO C O     1 
ATOM   4877 C  CB    . PRO C 1 182 ? 1.955   36.960 59.064  1.00 40.69  ?  199 PRO C CB    1 
ATOM   4878 C  CG    . PRO C 1 182 ? 2.846   37.222 60.258  1.00 40.50  ?  199 PRO C CG    1 
ATOM   4879 C  CD    . PRO C 1 182 ? 4.257   36.827 59.916  1.00 39.44  ?  199 PRO C CD    1 
ATOM   4880 N  N     . GLN C 1 183 ? 2.811   37.651 55.727  1.00 40.57  ?  200 GLN C N     1 
ATOM   4881 C  CA    . GLN C 1 183 ? 2.960   38.730 54.761  1.00 41.81  ?  200 GLN C CA    1 
ATOM   4882 C  C     . GLN C 1 183 ? 2.101   39.922 55.168  1.00 43.52  ?  200 GLN C C     1 
ATOM   4883 O  O     . GLN C 1 183 ? 0.927   39.765 55.505  1.00 43.97  ?  200 GLN C O     1 
ATOM   4884 C  CB    . GLN C 1 183 ? 2.584   38.257 53.353  1.00 41.81  ?  200 GLN C CB    1 
ATOM   4885 C  CG    . GLN C 1 183 ? 3.387   37.065 52.842  1.00 40.30  ?  200 GLN C CG    1 
ATOM   4886 C  CD    . GLN C 1 183 ? 2.884   35.733 53.373  1.00 39.09  ?  200 GLN C CD    1 
ATOM   4887 O  OE1   . GLN C 1 183 ? 2.004   35.686 54.233  1.00 39.29  ?  200 GLN C OE1   1 
ATOM   4888 N  NE2   . GLN C 1 183 ? 3.442   34.642 52.859  1.00 37.94  ?  200 GLN C NE2   1 
ATOM   4889 N  N     . LYS C 1 184 ? 2.697   41.110 55.144  1.00 48.96  ?  201 LYS C N     1 
ATOM   4890 C  CA    . LYS C 1 184 ? 2.012   42.334 55.551  1.00 50.78  ?  201 LYS C CA    1 
ATOM   4891 C  C     . LYS C 1 184 ? 0.807   42.628 54.665  1.00 52.10  ?  201 LYS C C     1 
ATOM   4892 O  O     . LYS C 1 184 ? -0.165  43.243 55.105  1.00 53.47  ?  201 LYS C O     1 
ATOM   4893 C  CB    . LYS C 1 184 ? 2.979   43.519 55.528  1.00 51.75  ?  201 LYS C CB    1 
ATOM   4894 N  N     . GLU C 1 185 ? 0.876   42.185 53.414  1.00 64.10  ?  202 GLU C N     1 
ATOM   4895 C  CA    . GLU C 1 185 ? -0.187  42.435 52.446  1.00 65.59  ?  202 GLU C CA    1 
ATOM   4896 C  C     . GLU C 1 185 ? -1.453  41.633 52.746  1.00 65.36  ?  202 GLU C C     1 
ATOM   4897 O  O     . GLU C 1 185 ? -2.464  41.785 52.061  1.00 66.61  ?  202 GLU C O     1 
ATOM   4898 C  CB    . GLU C 1 185 ? 0.303   42.119 51.031  1.00 65.38  ?  202 GLU C CB    1 
ATOM   4899 N  N     . PHE C 1 186 ? -1.395  40.778 53.763  1.00 55.58  ?  203 PHE C N     1 
ATOM   4900 C  CA    . PHE C 1 186 ? -2.533  39.930 54.105  1.00 55.40  ?  203 PHE C CA    1 
ATOM   4901 C  C     . PHE C 1 186 ? -3.112  40.255 55.479  1.00 55.86  ?  203 PHE C C     1 
ATOM   4902 O  O     . PHE C 1 186 ? -3.920  39.495 56.012  1.00 55.46  ?  203 PHE C O     1 
ATOM   4903 C  CB    . PHE C 1 186 ? -2.131  38.455 54.047  1.00 53.69  ?  203 PHE C CB    1 
ATOM   4904 C  CG    . PHE C 1 186 ? -1.671  38.005 52.689  1.00 53.41  ?  203 PHE C CG    1 
ATOM   4905 C  CD1   . PHE C 1 186 ? -2.233  38.538 51.541  1.00 54.80  ?  203 PHE C CD1   1 
ATOM   4906 C  CD2   . PHE C 1 186 ? -0.680  37.047 52.561  1.00 52.27  ?  203 PHE C CD2   1 
ATOM   4907 C  CE1   . PHE C 1 186 ? -1.813  38.126 50.291  1.00 54.57  ?  203 PHE C CE1   1 
ATOM   4908 C  CE2   . PHE C 1 186 ? -0.255  36.630 51.313  1.00 52.31  ?  203 PHE C CE2   1 
ATOM   4909 C  CZ    . PHE C 1 186 ? -0.823  37.171 50.177  1.00 53.40  ?  203 PHE C CZ    1 
ATOM   4910 N  N     . ASP C 1 187 ? -2.701  41.382 56.052  1.00 65.69  ?  204 ASP C N     1 
ATOM   4911 C  CA    . ASP C 1 187 ? -3.242  41.814 57.335  1.00 66.66  ?  204 ASP C CA    1 
ATOM   4912 C  C     . ASP C 1 187 ? -4.611  42.457 57.135  1.00 68.70  ?  204 ASP C C     1 
ATOM   4913 O  O     . ASP C 1 187 ? -4.756  43.401 56.357  1.00 70.04  ?  204 ASP C O     1 
ATOM   4914 C  CB    . ASP C 1 187 ? -2.288  42.788 58.032  1.00 67.07  ?  204 ASP C CB    1 
ATOM   4915 C  CG    . ASP C 1 187 ? -0.958  42.149 58.386  1.00 65.20  ?  204 ASP C CG    1 
ATOM   4916 O  OD1   . ASP C 1 187 ? -0.915  40.911 58.544  1.00 63.76  ?  204 ASP C OD1   1 
ATOM   4917 O  OD2   . ASP C 1 187 ? 0.044   42.885 58.512  1.00 65.09  -1 204 ASP C OD2   1 
ATOM   4918 N  N     . GLU C 1 188 ? -5.610  41.944 57.845  1.00 61.42  ?  205 GLU C N     1 
ATOM   4919 C  CA    . GLU C 1 188 ? -6.987  42.393 57.675  1.00 63.46  ?  205 GLU C CA    1 
ATOM   4920 C  C     . GLU C 1 188 ? -7.269  43.717 58.381  1.00 65.57  ?  205 GLU C C     1 
ATOM   4921 O  O     . GLU C 1 188 ? -7.389  44.759 57.737  1.00 67.21  ?  205 GLU C O     1 
ATOM   4922 C  CB    . GLU C 1 188 ? -7.957  41.322 58.180  1.00 63.63  ?  205 GLU C CB    1 
ATOM   4923 N  N     . ASP C 1 189 ? -7.375  43.670 59.705  1.00 80.92  ?  206 ASP C N     1 
ATOM   4924 C  CA    . ASP C 1 189 ? -7.687  44.862 60.485  1.00 83.08  ?  206 ASP C CA    1 
ATOM   4925 C  C     . ASP C 1 189 ? -6.602  45.170 61.511  1.00 82.21  ?  206 ASP C C     1 
ATOM   4926 O  O     . ASP C 1 189 ? -5.509  44.606 61.461  1.00 80.33  ?  206 ASP C O     1 
ATOM   4927 C  CB    . ASP C 1 189 ? -9.039  44.701 61.186  1.00 85.23  ?  206 ASP C CB    1 
ATOM   4928 C  CG    . ASP C 1 189 ? -9.140  43.406 61.970  1.00 84.25  ?  206 ASP C CG    1 
ATOM   4929 O  OD1   . ASP C 1 189 ? -8.526  43.315 63.054  1.00 83.65  ?  206 ASP C OD1   1 
ATOM   4930 O  OD2   . ASP C 1 189 ? -9.835  42.479 61.504  1.00 84.13  -1 206 ASP C OD2   1 
ATOM   4931 N  N     . SER C 1 190 ? -6.913  46.069 62.439  1.00 65.98  ?  207 SER C N     1 
ATOM   4932 C  CA    . SER C 1 190 ? -5.945  46.514 63.433  1.00 63.79  ?  207 SER C CA    1 
ATOM   4933 C  C     . SER C 1 190 ? -5.602  45.410 64.429  1.00 61.52  ?  207 SER C C     1 
ATOM   4934 O  O     . SER C 1 190 ? -4.467  45.318 64.896  1.00 59.42  ?  207 SER C O     1 
ATOM   4935 C  CB    . SER C 1 190 ? -6.479  47.739 64.179  1.00 65.49  ?  207 SER C CB    1 
ATOM   4936 O  OG    . SER C 1 190 ? -6.773  48.795 63.281  1.00 67.42  ?  207 SER C OG    1 
ATOM   4937 N  N     . GLU C 1 191 ? -6.585  44.576 64.750  1.00 55.75  ?  208 GLU C N     1 
ATOM   4938 C  CA    . GLU C 1 191 ? -6.379  43.486 65.697  1.00 54.81  ?  208 GLU C CA    1 
ATOM   4939 C  C     . GLU C 1 191 ? -5.614  42.337 65.049  1.00 52.12  ?  208 GLU C C     1 
ATOM   4940 O  O     . GLU C 1 191 ? -4.843  41.641 65.708  1.00 50.81  ?  208 GLU C O     1 
ATOM   4941 C  CB    . GLU C 1 191 ? -7.719  42.988 66.242  1.00 56.57  ?  208 GLU C CB    1 
ATOM   4942 N  N     . ASP C 1 192 ? -5.833  42.147 63.752  1.00 82.27  ?  209 ASP C N     1 
ATOM   4943 C  CA    . ASP C 1 192 ? -5.108  41.138 62.991  1.00 78.43  ?  209 ASP C CA    1 
ATOM   4944 C  C     . ASP C 1 192 ? -3.663  41.568 62.776  1.00 75.61  ?  209 ASP C C     1 
ATOM   4945 O  O     . ASP C 1 192 ? -2.757  40.737 62.725  1.00 71.81  ?  209 ASP C O     1 
ATOM   4946 C  CB    . ASP C 1 192 ? -5.789  40.882 61.645  1.00 79.84  ?  209 ASP C CB    1 
ATOM   4947 C  CG    . ASP C 1 192 ? -5.075  39.825 60.823  1.00 75.64  ?  209 ASP C CG    1 
ATOM   4948 O  OD1   . ASP C 1 192 ? -4.571  38.848 61.416  1.00 71.92  ?  209 ASP C OD1   1 
ATOM   4949 O  OD2   . ASP C 1 192 ? -5.015  39.974 59.584  1.00 76.20  -1 209 ASP C OD2   1 
ATOM   4950 N  N     . ARG C 1 193 ? -3.457  42.873 62.643  1.00 68.16  ?  210 ARG C N     1 
ATOM   4951 C  CA    . ARG C 1 193 ? -2.127  43.415 62.399  1.00 66.10  ?  210 ARG C CA    1 
ATOM   4952 C  C     . ARG C 1 193 ? -1.230  43.316 63.630  1.00 62.54  ?  210 ARG C C     1 
ATOM   4953 O  O     . ARG C 1 193 ? -0.041  43.028 63.512  1.00 59.39  ?  210 ARG C O     1 
ATOM   4954 C  CB    . ARG C 1 193 ? -2.224  44.872 61.947  1.00 69.45  ?  210 ARG C CB    1 
ATOM   4955 C  CG    . ARG C 1 193 ? -0.933  45.432 61.377  1.00 68.31  ?  210 ARG C CG    1 
ATOM   4956 C  CD    . ARG C 1 193 ? -1.023  46.935 61.198  1.00 71.19  ?  210 ARG C CD    1 
ATOM   4957 N  NE    . ARG C 1 193 ? -1.295  47.614 62.461  1.00 71.06  ?  210 ARG C NE    1 
ATOM   4958 C  CZ    . ARG C 1 193 ? -0.379  47.852 63.394  1.00 68.32  ?  210 ARG C CZ    1 
ATOM   4959 N  NH1   . ARG C 1 193 ? 0.876   47.466 63.208  1.00 65.21  1  210 ARG C NH1   1 
ATOM   4960 N  NH2   . ARG C 1 193 ? -0.718  48.476 64.515  1.00 68.56  ?  210 ARG C NH2   1 
ATOM   4961 N  N     . LEU C 1 194 ? -1.804  43.546 64.807  1.00 48.01  ?  211 LEU C N     1 
ATOM   4962 C  CA    . LEU C 1 194 ? -1.037  43.537 66.050  1.00 47.88  ?  211 LEU C CA    1 
ATOM   4963 C  C     . LEU C 1 194 ? -0.438  42.167 66.360  1.00 46.00  ?  211 LEU C C     1 
ATOM   4964 O  O     . LEU C 1 194 ? 0.742   42.063 66.698  1.00 44.91  ?  211 LEU C O     1 
ATOM   4965 C  CB    . LEU C 1 194 ? -1.910  43.994 67.220  1.00 50.13  ?  211 LEU C CB    1 
ATOM   4966 C  CG    . LEU C 1 194 ? -2.115  45.504 67.361  1.00 52.17  ?  211 LEU C CG    1 
ATOM   4967 C  CD1   . LEU C 1 194 ? -3.044  45.815 68.525  1.00 54.48  ?  211 LEU C CD1   1 
ATOM   4968 C  CD2   . LEU C 1 194 ? -0.779  46.211 67.534  1.00 51.61  ?  211 LEU C CD2   1 
ATOM   4969 N  N     . VAL C 1 195 ? -1.250  41.121 66.245  1.00 87.71  ?  212 VAL C N     1 
ATOM   4970 C  CA    . VAL C 1 195 ? -0.782  39.767 66.514  1.00 84.79  ?  212 VAL C CA    1 
ATOM   4971 C  C     . VAL C 1 195 ? 0.219   39.319 65.452  1.00 81.21  ?  212 VAL C C     1 
ATOM   4972 O  O     . VAL C 1 195 ? 1.124   38.533 65.731  1.00 78.40  ?  212 VAL C O     1 
ATOM   4973 C  CB    . VAL C 1 195 ? -1.951  38.761 66.583  1.00 87.07  ?  212 VAL C CB    1 
ATOM   4974 C  CG1   . VAL C 1 195 ? -2.732  38.945 67.876  1.00 90.47  ?  212 VAL C CG1   1 
ATOM   4975 C  CG2   . VAL C 1 195 ? -2.863  38.911 65.377  1.00 89.22  ?  212 VAL C CG2   1 
ATOM   4976 N  N     . ASN C 1 196 ? 0.052   39.826 64.235  1.00 54.61  ?  213 ASN C N     1 
ATOM   4977 C  CA    . ASN C 1 196 ? 0.968   39.517 63.144  1.00 52.60  ?  213 ASN C CA    1 
ATOM   4978 C  C     . ASN C 1 196 ? 2.309   40.219 63.323  1.00 51.29  ?  213 ASN C C     1 
ATOM   4979 O  O     . ASN C 1 196 ? 3.353   39.678 62.959  1.00 49.30  ?  213 ASN C O     1 
ATOM   4980 C  CB    . ASN C 1 196 ? 0.349   39.897 61.799  1.00 55.36  ?  213 ASN C CB    1 
ATOM   4981 C  CG    . ASN C 1 196 ? -0.620  38.849 61.288  1.00 55.23  ?  213 ASN C CG    1 
ATOM   4982 O  OD1   . ASN C 1 196 ? -0.929  37.880 61.983  1.00 53.55  ?  213 ASN C OD1   1 
ATOM   4983 N  ND2   . ASN C 1 196 ? -1.103  39.035 60.065  1.00 57.33  ?  213 ASN C ND2   1 
ATOM   4984 N  N     . GLU C 1 197 ? 2.272   41.429 63.874  1.00 68.68  ?  214 GLU C N     1 
ATOM   4985 C  CA    . GLU C 1 197 ? 3.493   42.169 64.168  1.00 67.95  ?  214 GLU C CA    1 
ATOM   4986 C  C     . GLU C 1 197 ? 4.334   41.405 65.182  1.00 66.62  ?  214 GLU C C     1 
ATOM   4987 O  O     . GLU C 1 197 ? 5.553   41.318 65.050  1.00 65.81  ?  214 GLU C O     1 
ATOM   4988 C  CB    . GLU C 1 197 ? 3.175   43.572 64.695  1.00 70.21  ?  214 GLU C CB    1 
ATOM   4989 C  CG    . GLU C 1 197 ? 2.690   44.552 63.637  1.00 73.34  ?  214 GLU C CG    1 
ATOM   4990 C  CD    . GLU C 1 197 ? 3.692   44.758 62.517  1.00 73.19  ?  214 GLU C CD    1 
ATOM   4991 O  OE1   . GLU C 1 197 ? 4.911   44.747 62.794  1.00 70.69  ?  214 GLU C OE1   1 
ATOM   4992 O  OE2   . GLU C 1 197 ? 3.260   44.931 61.358  1.00 76.10  -1 214 GLU C OE2   1 
ATOM   4993 N  N     . LYS C 1 198 ? 3.667   40.841 66.185  1.00 47.18  ?  215 LYS C N     1 
ATOM   4994 C  CA    . LYS C 1 198 ? 4.337   40.073 67.230  1.00 46.35  ?  215 LYS C CA    1 
ATOM   4995 C  C     . LYS C 1 198 ? 5.050   38.848 66.663  1.00 44.53  ?  215 LYS C C     1 
ATOM   4996 O  O     . LYS C 1 198 ? 6.034   38.375 67.230  1.00 43.84  ?  215 LYS C O     1 
ATOM   4997 C  CB    . LYS C 1 198 ? 3.332   39.643 68.301  1.00 47.58  ?  215 LYS C CB    1 
ATOM   4998 N  N     . PHE C 1 199 ? 4.549   38.338 65.543  1.00 51.41  ?  216 PHE C N     1 
ATOM   4999 C  CA    . PHE C 1 199 ? 5.189   37.216 64.869  1.00 49.87  ?  216 PHE C CA    1 
ATOM   5000 C  C     . PHE C 1 199 ? 6.403   37.707 64.087  1.00 49.68  ?  216 PHE C C     1 
ATOM   5001 O  O     . PHE C 1 199 ? 7.477   37.110 64.153  1.00 48.79  ?  216 PHE C O     1 
ATOM   5002 C  CB    . PHE C 1 199 ? 4.204   36.507 63.936  1.00 49.44  ?  216 PHE C CB    1 
ATOM   5003 C  CG    . PHE C 1 199 ? 4.666   35.148 63.479  1.00 47.96  ?  216 PHE C CG    1 
ATOM   5004 C  CD1   . PHE C 1 199 ? 5.612   35.019 62.475  1.00 47.31  ?  216 PHE C CD1   1 
ATOM   5005 C  CD2   . PHE C 1 199 ? 4.143   33.999 64.048  1.00 47.37  ?  216 PHE C CD2   1 
ATOM   5006 C  CE1   . PHE C 1 199 ? 6.033   33.773 62.053  1.00 46.11  ?  216 PHE C CE1   1 
ATOM   5007 C  CE2   . PHE C 1 199 ? 4.560   32.749 63.630  1.00 46.17  ?  216 PHE C CE2   1 
ATOM   5008 C  CZ    . PHE C 1 199 ? 5.507   32.636 62.631  1.00 45.55  ?  216 PHE C CZ    1 
ATOM   5009 N  N     . ARG C 1 200 ? 6.222   38.795 63.344  1.00 47.20  ?  217 ARG C N     1 
ATOM   5010 C  CA    . ARG C 1 200 ? 7.280   39.335 62.495  1.00 47.24  ?  217 ARG C CA    1 
ATOM   5011 C  C     . ARG C 1 200 ? 8.457   39.873 63.306  1.00 47.54  ?  217 ARG C C     1 
ATOM   5012 O  O     . ARG C 1 200 ? 9.593   39.875 62.831  1.00 47.19  ?  217 ARG C O     1 
ATOM   5013 C  CB    . ARG C 1 200 ? 6.728   40.435 61.582  1.00 48.59  ?  217 ARG C CB    1 
ATOM   5014 C  CG    . ARG C 1 200 ? 5.865   39.913 60.444  1.00 48.50  ?  217 ARG C CG    1 
ATOM   5015 C  CD    . ARG C 1 200 ? 5.503   41.007 59.451  1.00 51.59  ?  217 ARG C CD    1 
ATOM   5016 N  NE    . ARG C 1 200 ? 4.464   41.900 59.956  1.00 54.48  ?  217 ARG C NE    1 
ATOM   5017 C  CZ    . ARG C 1 200 ? 3.169   41.764 59.691  1.00 57.11  ?  217 ARG C CZ    1 
ATOM   5018 N  NH1   . ARG C 1 200 ? 2.747   40.767 58.924  1.00 56.55  1  217 ARG C NH1   1 
ATOM   5019 N  NH2   . ARG C 1 200 ? 2.293   42.625 60.192  1.00 60.33  ?  217 ARG C NH2   1 
ATOM   5020 N  N     . GLU C 1 201 ? 8.186   40.332 64.525  1.00 61.32  ?  218 GLU C N     1 
ATOM   5021 C  CA    . GLU C 1 201 ? 9.238   40.860 65.388  1.00 63.69  ?  218 GLU C CA    1 
ATOM   5022 C  C     . GLU C 1 201 ? 10.186  39.761 65.857  1.00 62.77  ?  218 GLU C C     1 
ATOM   5023 O  O     . GLU C 1 201 ? 11.321  40.033 66.248  1.00 64.36  ?  218 GLU C O     1 
ATOM   5024 C  CB    . GLU C 1 201 ? 8.635   41.567 66.605  1.00 67.26  ?  218 GLU C CB    1 
ATOM   5025 C  CG    . GLU C 1 201 ? 7.932   42.876 66.297  1.00 69.16  ?  218 GLU C CG    1 
ATOM   5026 C  CD    . GLU C 1 201 ? 7.128   43.390 67.477  1.00 72.68  ?  218 GLU C CD    1 
ATOM   5027 O  OE1   . GLU C 1 201 ? 7.165   42.746 68.547  1.00 73.95  ?  218 GLU C OE1   1 
ATOM   5028 O  OE2   . GLU C 1 201 ? 6.458   44.435 67.335  1.00 74.56  -1 218 GLU C OE2   1 
ATOM   5029 N  N     . MET C 1 202 ? 9.717   38.518 65.812  1.00 66.73  ?  219 MET C N     1 
ATOM   5030 C  CA    . MET C 1 202 ? 10.520  37.387 66.257  1.00 66.14  ?  219 MET C CA    1 
ATOM   5031 C  C     . MET C 1 202 ? 11.348  36.806 65.116  1.00 63.28  ?  219 MET C C     1 
ATOM   5032 O  O     . MET C 1 202 ? 12.366  36.158 65.347  1.00 63.15  ?  219 MET C O     1 
ATOM   5033 C  CB    . MET C 1 202 ? 9.628   36.305 66.866  1.00 66.40  ?  219 MET C CB    1 
ATOM   5034 C  CG    . MET C 1 202 ? 8.802   36.784 68.048  1.00 69.76  ?  219 MET C CG    1 
ATOM   5035 S  SD    . MET C 1 202 ? 8.884   35.669 69.459  1.00 72.81  ?  219 MET C SD    1 
ATOM   5036 C  CE    . MET C 1 202 ? 10.576  35.921 69.983  1.00 74.11  ?  219 MET C CE    1 
ATOM   5037 N  N     . ILE C 1 203 ? 10.900  37.041 63.887  1.00 36.29  ?  220 ILE C N     1 
ATOM   5038 C  CA    . ILE C 1 203 ? 11.610  36.573 62.702  1.00 34.62  ?  220 ILE C CA    1 
ATOM   5039 C  C     . ILE C 1 203 ? 12.947  37.294 62.559  1.00 35.92  ?  220 ILE C C     1 
ATOM   5040 O  O     . ILE C 1 203 ? 12.997  38.523 62.612  1.00 38.01  ?  220 ILE C O     1 
ATOM   5041 C  CB    . ILE C 1 203 ? 10.767  36.794 61.426  1.00 33.79  ?  220 ILE C CB    1 
ATOM   5042 C  CG1   . ILE C 1 203 ? 9.464   35.997 61.502  1.00 33.17  ?  220 ILE C CG1   1 
ATOM   5043 C  CG2   . ILE C 1 203 ? 11.558  36.427 60.177  1.00 32.53  ?  220 ILE C CG2   1 
ATOM   5044 C  CD1   . ILE C 1 203 ? 8.532   36.247 60.339  1.00 33.16  ?  220 ILE C CD1   1 
ATOM   5045 N  N     . PRO C 1 204 ? 14.041  36.533 62.379  1.00 47.01  ?  221 PRO C N     1 
ATOM   5046 C  CA    . PRO C 1 204 ? 14.089  35.067 62.315  1.00 44.87  ?  221 PRO C CA    1 
ATOM   5047 C  C     . PRO C 1 204 ? 14.122  34.409 63.693  1.00 45.33  ?  221 PRO C C     1 
ATOM   5048 O  O     . PRO C 1 204 ? 14.927  34.793 64.540  1.00 47.43  ?  221 PRO C O     1 
ATOM   5049 C  CB    . PRO C 1 204 ? 15.391  34.799 61.561  1.00 44.38  ?  221 PRO C CB    1 
ATOM   5050 C  CG    . PRO C 1 204 ? 16.259  35.945 61.926  1.00 47.03  ?  221 PRO C CG    1 
ATOM   5051 C  CD    . PRO C 1 204 ? 15.357  37.136 62.099  1.00 48.55  ?  221 PRO C CD    1 
ATOM   5052 N  N     . PHE C 1 205 ? 13.247  33.430 63.905  1.00 47.48  ?  222 PHE C N     1 
ATOM   5053 C  CA    . PHE C 1 205 ? 13.145  32.741 65.187  1.00 49.06  ?  222 PHE C CA    1 
ATOM   5054 C  C     . PHE C 1 205 ? 14.460  32.075 65.583  1.00 49.41  ?  222 PHE C C     1 
ATOM   5055 O  O     . PHE C 1 205 ? 15.080  31.377 64.783  1.00 47.53  ?  222 PHE C O     1 
ATOM   5056 C  CB    . PHE C 1 205 ? 12.027  31.697 65.144  1.00 48.68  ?  222 PHE C CB    1 
ATOM   5057 C  CG    . PHE C 1 205 ? 10.646  32.285 65.189  1.00 49.55  ?  222 PHE C CG    1 
ATOM   5058 C  CD1   . PHE C 1 205 ? 10.054  32.782 64.040  1.00 48.28  ?  222 PHE C CD1   1 
ATOM   5059 C  CD2   . PHE C 1 205 ? 9.939   32.339 66.378  1.00 52.19  ?  222 PHE C CD2   1 
ATOM   5060 C  CE1   . PHE C 1 205 ? 8.783   33.322 64.077  1.00 49.45  ?  222 PHE C CE1   1 
ATOM   5061 C  CE2   . PHE C 1 205 ? 8.667   32.877 66.421  1.00 53.43  ?  222 PHE C CE2   1 
ATOM   5062 C  CZ    . PHE C 1 205 ? 8.088   33.370 65.269  1.00 51.85  ?  222 PHE C CZ    1 
ATOM   5063 N  N     . ALA C 1 206 ? 14.883  32.296 66.822  1.00 38.27  ?  223 ALA C N     1 
ATOM   5064 C  CA    . ALA C 1 206 ? 16.114  31.696 67.317  1.00 39.36  ?  223 ALA C CA    1 
ATOM   5065 C  C     . ALA C 1 206 ? 15.819  30.328 67.917  1.00 39.76  ?  223 ALA C C     1 
ATOM   5066 O  O     . ALA C 1 206 ? 15.411  30.221 69.073  1.00 42.69  ?  223 ALA C O     1 
ATOM   5067 C  CB    . ALA C 1 206 ? 16.774  32.601 68.342  1.00 43.20  ?  223 ALA C CB    1 
ATOM   5068 N  N     . VAL C 1 207 ? 16.032  29.282 67.124  1.00 38.42  ?  224 VAL C N     1 
ATOM   5069 C  CA    . VAL C 1 207 ? 15.709  27.926 67.547  1.00 39.06  ?  224 VAL C CA    1 
ATOM   5070 C  C     . VAL C 1 207 ? 16.953  27.156 67.974  1.00 40.06  ?  224 VAL C C     1 
ATOM   5071 O  O     . VAL C 1 207 ? 18.070  27.479 67.565  1.00 39.33  ?  224 VAL C O     1 
ATOM   5072 C  CB    . VAL C 1 207 ? 14.993  27.144 66.424  1.00 36.59  ?  224 VAL C CB    1 
ATOM   5073 C  CG1   . VAL C 1 207 ? 13.815  27.943 65.888  1.00 35.86  ?  224 VAL C CG1   1 
ATOM   5074 C  CG2   . VAL C 1 207 ? 15.963  26.805 65.301  1.00 34.10  ?  224 VAL C CG2   1 
ATOM   5075 N  N     . VAL C 1 208 ? 16.750  26.137 68.803  1.00 51.29  ?  225 VAL C N     1 
ATOM   5076 C  CA    . VAL C 1 208 ? 17.841  25.285 69.265  1.00 52.72  ?  225 VAL C CA    1 
ATOM   5077 C  C     . VAL C 1 208 ? 17.414  23.820 69.323  1.00 55.26  ?  225 VAL C C     1 
ATOM   5078 O  O     . VAL C 1 208 ? 16.432  23.477 69.978  1.00 56.52  ?  225 VAL C O     1 
ATOM   5079 C  CB    . VAL C 1 208 ? 18.350  25.709 70.665  1.00 57.13  ?  225 VAL C CB    1 
ATOM   5080 C  CG1   . VAL C 1 208 ? 19.313  24.672 71.221  1.00 64.92  ?  225 VAL C CG1   1 
ATOM   5081 C  CG2   . VAL C 1 208 ? 19.012  27.079 70.614  1.00 57.49  ?  225 VAL C CG2   1 
ATOM   5082 N  N     . GLY C 1 209 ? 18.155  22.961 68.629  1.00 103.21 ?  226 GLY C N     1 
ATOM   5083 C  CA    . GLY C 1 209 ? 17.894  21.534 68.654  1.00 97.52  ?  226 GLY C CA    1 
ATOM   5084 C  C     . GLY C 1 209 ? 18.240  20.939 70.006  1.00 103.69 ?  226 GLY C C     1 
ATOM   5085 O  O     . GLY C 1 209 ? 19.087  21.470 70.724  1.00 112.64 ?  226 GLY C O     1 
ATOM   5086 N  N     . SER C 1 210 ? 17.590  19.834 70.357  1.00 76.53  ?  227 SER C N     1 
ATOM   5087 C  CA    . SER C 1 210 ? 17.800  19.217 71.662  1.00 78.04  ?  227 SER C CA    1 
ATOM   5088 C  C     . SER C 1 210 ? 18.866  18.128 71.596  1.00 76.40  ?  227 SER C C     1 
ATOM   5089 O  O     . SER C 1 210 ? 18.781  17.210 70.781  1.00 71.80  ?  227 SER C O     1 
ATOM   5090 C  CB    . SER C 1 210 ? 16.490  18.635 72.197  1.00 77.26  ?  227 SER C CB    1 
ATOM   5091 O  OG    . SER C 1 210 ? 16.056  17.544 71.403  1.00 73.18  ?  227 SER C OG    1 
ATOM   5092 N  N     . VAL C 1 233 ? 15.346  24.152 75.779  1.00 82.85  ?  250 VAL C N     1 
ATOM   5093 C  CA    . VAL C 1 233 ? 14.739  24.422 74.481  1.00 80.69  ?  250 VAL C CA    1 
ATOM   5094 C  C     . VAL C 1 233 ? 13.286  24.859 74.650  1.00 79.04  ?  250 VAL C C     1 
ATOM   5095 O  O     . VAL C 1 233 ? 12.774  25.676 73.882  1.00 77.56  ?  250 VAL C O     1 
ATOM   5096 C  CB    . VAL C 1 233 ? 14.809  23.182 73.564  1.00 76.35  ?  250 VAL C CB    1 
ATOM   5097 C  CG1   . VAL C 1 233 ? 14.152  23.462 72.222  1.00 73.30  ?  250 VAL C CG1   1 
ATOM   5098 C  CG2   . VAL C 1 233 ? 16.255  22.747 73.373  1.00 78.51  ?  250 VAL C CG2   1 
ATOM   5099 N  N     . GLU C 1 234 ? 12.629  24.330 75.676  1.00 106.26 ?  251 GLU C N     1 
ATOM   5100 C  CA    . GLU C 1 234 ? 11.236  24.670 75.940  1.00 104.92 ?  251 GLU C CA    1 
ATOM   5101 C  C     . GLU C 1 234 ? 11.143  25.973 76.726  1.00 106.52 ?  251 GLU C C     1 
ATOM   5102 O  O     . GLU C 1 234 ? 10.051  26.460 77.019  1.00 105.90 ?  251 GLU C O     1 
ATOM   5103 C  CB    . GLU C 1 234 ? 10.540  23.540 76.700  1.00 104.18 ?  251 GLU C CB    1 
ATOM   5104 N  N     . ASN C 1 235 ? 12.302  26.532 77.061  1.00 128.95 ?  252 ASN C N     1 
ATOM   5105 C  CA    . ASN C 1 235 ? 12.371  27.793 77.787  1.00 129.68 ?  252 ASN C CA    1 
ATOM   5106 C  C     . ASN C 1 235 ? 12.301  28.990 76.847  1.00 126.60 ?  252 ASN C C     1 
ATOM   5107 O  O     . ASN C 1 235 ? 12.953  29.010 75.804  1.00 124.34 ?  252 ASN C O     1 
ATOM   5108 C  CB    . ASN C 1 235 ? 13.651  27.858 78.622  1.00 132.23 ?  252 ASN C CB    1 
ATOM   5109 N  N     . THR C 1 236 ? 11.508  29.987 77.224  1.00 141.02 ?  253 THR C N     1 
ATOM   5110 C  CA    . THR C 1 236 ? 11.311  31.164 76.388  1.00 136.63 ?  253 THR C CA    1 
ATOM   5111 C  C     . THR C 1 236 ? 12.516  32.097 76.456  1.00 135.26 ?  253 THR C C     1 
ATOM   5112 O  O     . THR C 1 236 ? 12.690  32.964 75.599  1.00 130.45 ?  253 THR C O     1 
ATOM   5113 C  CB    . THR C 1 236 ? 10.046  31.941 76.798  1.00 137.30 ?  253 THR C CB    1 
ATOM   5114 O  OG1   . THR C 1 236 ? 10.208  32.459 78.124  1.00 141.58 ?  253 THR C OG1   1 
ATOM   5115 C  CG2   . THR C 1 236 ? 8.827   31.032 76.760  1.00 138.87 ?  253 THR C CG2   1 
ATOM   5116 N  N     . THR C 1 237 ? 13.345  31.914 77.479  1.00 113.18 ?  254 THR C N     1 
ATOM   5117 C  CA    . THR C 1 237 ? 14.515  32.762 77.677  1.00 114.20 ?  254 THR C CA    1 
ATOM   5118 C  C     . THR C 1 237 ? 15.770  32.175 77.032  1.00 111.26 ?  254 THR C C     1 
ATOM   5119 O  O     . THR C 1 237 ? 16.645  32.915 76.581  1.00 110.44 ?  254 THR C O     1 
ATOM   5120 C  CB    . THR C 1 237 ? 14.789  32.997 79.175  1.00 122.13 ?  254 THR C CB    1 
ATOM   5121 O  OG1   . THR C 1 237 ? 15.090  31.749 79.811  1.00 124.75 ?  254 THR C OG1   1 
ATOM   5122 C  CG2   . THR C 1 237 ? 13.576  33.623 79.846  1.00 125.29 ?  254 THR C CG2   1 
ATOM   5123 N  N     . HIS C 1 238 ? 15.856  30.849 76.989  1.00 107.48 ?  255 HIS C N     1 
ATOM   5124 C  CA    . HIS C 1 238 ? 17.011  30.180 76.397  1.00 106.63 ?  255 HIS C CA    1 
ATOM   5125 C  C     . HIS C 1 238 ? 16.978  30.243 74.873  1.00 100.49 ?  255 HIS C C     1 
ATOM   5126 O  O     . HIS C 1 238 ? 17.949  30.658 74.240  1.00 96.77  ?  255 HIS C O     1 
ATOM   5127 C  CB    . HIS C 1 238 ? 17.084  28.722 76.858  1.00 111.55 ?  255 HIS C CB    1 
ATOM   5128 C  CG    . HIS C 1 238 ? 17.548  28.559 78.272  1.00 115.78 ?  255 HIS C CG    1 
ATOM   5129 N  ND1   . HIS C 1 238 ? 17.771  27.325 78.844  1.00 118.81 ?  255 HIS C ND1   1 
ATOM   5130 C  CD2   . HIS C 1 238 ? 17.836  29.474 79.228  1.00 118.25 ?  255 HIS C CD2   1 
ATOM   5131 C  CE1   . HIS C 1 238 ? 18.174  27.487 80.092  1.00 122.62 ?  255 HIS C CE1   1 
ATOM   5132 N  NE2   . HIS C 1 238 ? 18.222  28.781 80.350  1.00 123.05 ?  255 HIS C NE2   1 
ATOM   5133 N  N     . CYS C 1 239 ? 15.857  29.833 74.288  1.00 84.16  ?  256 CYS C N     1 
ATOM   5134 C  CA    . CYS C 1 239 ? 15.664  29.950 72.848  1.00 77.81  ?  256 CYS C CA    1 
ATOM   5135 C  C     . CYS C 1 239 ? 14.215  30.306 72.533  1.00 75.69  ?  256 CYS C C     1 
ATOM   5136 O  O     . CYS C 1 239 ? 13.411  30.523 73.439  1.00 79.17  ?  256 CYS C O     1 
ATOM   5137 C  CB    . CYS C 1 239 ? 16.068  28.656 72.137  1.00 79.83  ?  256 CYS C CB    1 
ATOM   5138 S  SG    . CYS C 1 239 ? 14.873  27.314 72.269  1.00 86.49  ?  256 CYS C SG    1 
ATOM   5139 N  N     . GLU C 1 240 ? 13.885  30.365 71.248  1.00 53.74  ?  257 GLU C N     1 
ATOM   5140 C  CA    . GLU C 1 240 ? 12.561  30.807 70.827  1.00 52.65  ?  257 GLU C CA    1 
ATOM   5141 C  C     . GLU C 1 240 ? 11.746  29.730 70.111  1.00 51.18  ?  257 GLU C C     1 
ATOM   5142 O  O     . GLU C 1 240 ? 10.776  30.043 69.420  1.00 49.18  ?  257 GLU C O     1 
ATOM   5143 C  CB    . GLU C 1 240 ? 12.700  32.035 69.926  1.00 50.40  ?  257 GLU C CB    1 
ATOM   5144 C  CG    . GLU C 1 240 ? 13.423  33.195 70.595  1.00 53.24  ?  257 GLU C CG    1 
ATOM   5145 C  CD    . GLU C 1 240 ? 13.609  34.381 69.671  1.00 51.64  ?  257 GLU C CD    1 
ATOM   5146 O  OE1   . GLU C 1 240 ? 13.637  34.179 68.439  1.00 48.07  ?  257 GLU C OE1   1 
ATOM   5147 O  OE2   . GLU C 1 240 ? 13.728  35.516 70.178  1.00 54.49  -1 257 GLU C OE2   1 
ATOM   5148 N  N     . PHE C 1 241 ? 12.134  28.469 70.271  1.00 43.84  ?  258 PHE C N     1 
ATOM   5149 C  CA    . PHE C 1 241 ? 11.441  27.379 69.587  1.00 43.90  ?  258 PHE C CA    1 
ATOM   5150 C  C     . PHE C 1 241 ? 10.056  27.099 70.166  1.00 44.61  ?  258 PHE C C     1 
ATOM   5151 O  O     . PHE C 1 241 ? 9.121   26.787 69.427  1.00 44.11  ?  258 PHE C O     1 
ATOM   5152 C  CB    . PHE C 1 241 ? 12.277  26.098 69.628  1.00 45.17  ?  258 PHE C CB    1 
ATOM   5153 C  CG    . PHE C 1 241 ? 11.549  24.888 69.112  1.00 45.95  ?  258 PHE C CG    1 
ATOM   5154 C  CD1   . PHE C 1 241 ? 11.352  24.711 67.752  1.00 44.81  ?  258 PHE C CD1   1 
ATOM   5155 C  CD2   . PHE C 1 241 ? 11.058  23.931 69.985  1.00 48.14  ?  258 PHE C CD2   1 
ATOM   5156 C  CE1   . PHE C 1 241 ? 10.679  23.603 67.273  1.00 45.60  ?  258 PHE C CE1   1 
ATOM   5157 C  CE2   . PHE C 1 241 ? 10.385  22.821 69.512  1.00 49.23  ?  258 PHE C CE2   1 
ATOM   5158 C  CZ    . PHE C 1 241 ? 10.196  22.657 68.155  1.00 48.00  ?  258 PHE C CZ    1 
ATOM   5159 N  N     . ALA C 1 242 ? 9.930   27.208 71.486  1.00 49.11  ?  259 ALA C N     1 
ATOM   5160 C  CA    . ALA C 1 242 ? 8.656   26.972 72.161  1.00 49.97  ?  259 ALA C CA    1 
ATOM   5161 C  C     . ALA C 1 242 ? 7.581   27.940 71.680  1.00 48.40  ?  259 ALA C C     1 
ATOM   5162 O  O     . ALA C 1 242 ? 6.437   27.547 71.447  1.00 48.24  ?  259 ALA C O     1 
ATOM   5163 C  CB    . ALA C 1 242 ? 8.828   27.079 73.667  1.00 52.04  ?  259 ALA C CB    1 
ATOM   5164 N  N     . TYR C 1 243 ? 7.956   29.207 71.539  1.00 50.78  ?  260 TYR C N     1 
ATOM   5165 C  CA    . TYR C 1 243 ? 7.045   30.225 71.032  1.00 49.19  ?  260 TYR C CA    1 
ATOM   5166 C  C     . TYR C 1 243 ? 6.677   29.927 69.583  1.00 47.87  ?  260 TYR C C     1 
ATOM   5167 O  O     . TYR C 1 243 ? 5.508   29.987 69.207  1.00 47.30  ?  260 TYR C O     1 
ATOM   5168 C  CB    . TYR C 1 243 ? 7.668   31.617 71.147  1.00 48.03  ?  260 TYR C CB    1 
ATOM   5169 N  N     . LEU C 1 244 ? 7.686   29.601 68.781  1.00 48.53  ?  261 LEU C N     1 
ATOM   5170 C  CA    . LEU C 1 244 ? 7.492   29.297 67.367  1.00 47.19  ?  261 LEU C CA    1 
ATOM   5171 C  C     . LEU C 1 244 ? 6.533   28.126 67.174  1.00 47.95  ?  261 LEU C C     1 
ATOM   5172 O  O     . LEU C 1 244 ? 5.664   28.162 66.302  1.00 46.86  ?  261 LEU C O     1 
ATOM   5173 C  CB    . LEU C 1 244 ? 8.833   28.990 66.698  1.00 47.10  ?  261 LEU C CB    1 
ATOM   5174 C  CG    . LEU C 1 244 ? 8.774   28.586 65.225  1.00 45.99  ?  261 LEU C CG    1 
ATOM   5175 C  CD1   . LEU C 1 244 ? 8.197   29.713 64.385  1.00 44.34  ?  261 LEU C CD1   1 
ATOM   5176 C  CD2   . LEU C 1 244 ? 10.153  28.191 64.723  1.00 46.29  ?  261 LEU C CD2   1 
ATOM   5177 N  N     . ARG C 1 245 ? 6.703   27.089 67.990  1.00 43.40  ?  262 ARG C N     1 
ATOM   5178 C  CA    . ARG C 1 245 ? 5.850   25.907 67.930  1.00 45.11  ?  262 ARG C CA    1 
ATOM   5179 C  C     . ARG C 1 245 ? 4.384   26.261 68.172  1.00 45.15  ?  262 ARG C C     1 
ATOM   5180 O  O     . ARG C 1 245 ? 3.516   25.915 67.372  1.00 44.71  ?  262 ARG C O     1 
ATOM   5181 C  CB    . ARG C 1 245 ? 6.311   24.862 68.948  1.00 47.85  ?  262 ARG C CB    1 
ATOM   5182 N  N     . ASP C 1 246 ? 4.118   26.949 69.279  1.00 61.50  ?  263 ASP C N     1 
ATOM   5183 C  CA    . ASP C 1 246 ? 2.757   27.336 69.640  1.00 61.91  ?  263 ASP C CA    1 
ATOM   5184 C  C     . ASP C 1 246 ? 2.129   28.247 68.592  1.00 58.88  ?  263 ASP C C     1 
ATOM   5185 O  O     . ASP C 1 246 ? 0.947   28.118 68.278  1.00 58.94  ?  263 ASP C O     1 
ATOM   5186 C  CB    . ASP C 1 246 ? 2.741   28.028 71.005  1.00 63.07  ?  263 ASP C CB    1 
ATOM   5187 C  CG    . ASP C 1 246 ? 3.036   27.075 72.146  1.00 66.52  ?  263 ASP C CG    1 
ATOM   5188 O  OD1   . ASP C 1 246 ? 2.844   25.854 71.966  1.00 68.70  ?  263 ASP C OD1   1 
ATOM   5189 O  OD2   . ASP C 1 246 ? 3.457   27.547 73.224  1.00 67.01  -1 263 ASP C OD2   1 
ATOM   5190 N  N     . LEU C 1 247 ? 2.923   29.169 68.056  1.00 37.75  ?  264 LEU C N     1 
ATOM   5191 C  CA    . LEU C 1 247 ? 2.441   30.086 67.030  1.00 36.75  ?  264 LEU C CA    1 
ATOM   5192 C  C     . LEU C 1 247 ? 2.019   29.340 65.768  1.00 35.18  ?  264 LEU C C     1 
ATOM   5193 O  O     . LEU C 1 247 ? 0.967   29.622 65.200  1.00 34.65  ?  264 LEU C O     1 
ATOM   5194 C  CB    . LEU C 1 247 ? 3.511   31.130 66.697  1.00 36.84  ?  264 LEU C CB    1 
ATOM   5195 C  CG    . LEU C 1 247 ? 3.774   32.190 67.771  1.00 38.46  ?  264 LEU C CG    1 
ATOM   5196 C  CD1   . LEU C 1 247 ? 4.914   33.113 67.367  1.00 38.56  ?  264 LEU C CD1   1 
ATOM   5197 C  CD2   . LEU C 1 247 ? 2.513   32.990 68.060  1.00 38.98  ?  264 LEU C CD2   1 
ATOM   5198 N  N     . LEU C 1 248 ? 2.830   28.377 65.343  1.00 47.66  ?  265 LEU C N     1 
ATOM   5199 C  CA    . LEU C 1 248 ? 2.560   27.638 64.113  1.00 46.35  ?  265 LEU C CA    1 
ATOM   5200 C  C     . LEU C 1 248 ? 1.429   26.623 64.267  1.00 47.28  ?  265 LEU C C     1 
ATOM   5201 O  O     . LEU C 1 248 ? 0.663   26.394 63.332  1.00 45.25  ?  265 LEU C O     1 
ATOM   5202 C  CB    . LEU C 1 248 ? 3.824   26.917 63.637  1.00 46.71  ?  265 LEU C CB    1 
ATOM   5203 C  CG    . LEU C 1 248 ? 4.970   27.767 63.086  1.00 45.60  ?  265 LEU C CG    1 
ATOM   5204 C  CD1   . LEU C 1 248 ? 6.124   26.880 62.645  1.00 46.04  ?  265 LEU C CD1   1 
ATOM   5205 C  CD2   . LEU C 1 248 ? 4.496   28.642 61.937  1.00 43.22  ?  265 LEU C CD2   1 
ATOM   5206 N  N     . ILE C 1 249 ? 1.327   26.018 65.446  1.00 57.13  ?  266 ILE C N     1 
ATOM   5207 C  CA    . ILE C 1 249 ? 0.362   24.945 65.668  1.00 58.83  ?  266 ILE C CA    1 
ATOM   5208 C  C     . ILE C 1 249 ? -0.982  25.464 66.177  1.00 59.09  ?  266 ILE C C     1 
ATOM   5209 O  O     . ILE C 1 249 ? -2.039  24.994 65.753  1.00 58.29  ?  266 ILE C O     1 
ATOM   5210 C  CB    . ILE C 1 249 ? 0.913   23.903 66.665  1.00 62.83  ?  266 ILE C CB    1 
ATOM   5211 C  CG1   . ILE C 1 249 ? 2.196   23.273 66.121  1.00 62.71  ?  266 ILE C CG1   1 
ATOM   5212 C  CG2   . ILE C 1 249 ? -0.121  22.824 66.950  1.00 64.89  ?  266 ILE C CG2   1 
ATOM   5213 C  CD1   . ILE C 1 249 ? 2.829   22.269 67.059  1.00 66.51  ?  266 ILE C CD1   1 
ATOM   5214 N  N     . ARG C 1 250 ? -0.942  26.438 67.081  1.00 50.45  ?  267 ARG C N     1 
ATOM   5215 C  CA    . ARG C 1 250 ? -2.164  26.959 67.687  1.00 50.92  ?  267 ARG C CA    1 
ATOM   5216 C  C     . ARG C 1 250 ? -2.623  28.279 67.069  1.00 47.49  ?  267 ARG C C     1 
ATOM   5217 O  O     . ARG C 1 250 ? -3.663  28.339 66.412  1.00 45.60  ?  267 ARG C O     1 
ATOM   5218 C  CB    . ARG C 1 250 ? -1.971  27.136 69.195  1.00 53.88  ?  267 ARG C CB    1 
ATOM   5219 N  N     . THR C 1 251 ? -1.841  29.332 67.286  1.00 48.13  ?  268 THR C N     1 
ATOM   5220 C  CA    . THR C 1 251 ? -2.250  30.687 66.924  1.00 45.62  ?  268 THR C CA    1 
ATOM   5221 C  C     . THR C 1 251 ? -2.376  30.928 65.418  1.00 42.42  ?  268 THR C C     1 
ATOM   5222 O  O     . THR C 1 251 ? -3.415  31.389 64.947  1.00 41.31  ?  268 THR C O     1 
ATOM   5223 C  CB    . THR C 1 251 ? -1.268  31.726 67.497  1.00 45.52  ?  268 THR C CB    1 
ATOM   5224 O  OG1   . THR C 1 251 ? -1.137  31.532 68.911  1.00 48.09  ?  268 THR C OG1   1 
ATOM   5225 C  CG2   . THR C 1 251 ? -1.768  33.138 67.228  1.00 43.80  ?  268 THR C CG2   1 
ATOM   5226 N  N     . HIS C 1 252 ? -1.326  30.614 64.664  1.00 36.57  ?  269 HIS C N     1 
ATOM   5227 C  CA    . HIS C 1 252 ? -1.280  30.972 63.247  1.00 34.69  ?  269 HIS C CA    1 
ATOM   5228 C  C     . HIS C 1 252 ? -1.609  29.818 62.304  1.00 33.55  ?  269 HIS C C     1 
ATOM   5229 O  O     . HIS C 1 252 ? -1.511  29.973 61.088  1.00 32.74  ?  269 HIS C O     1 
ATOM   5230 C  CB    . HIS C 1 252 ? 0.103   31.521 62.884  1.00 34.48  ?  269 HIS C CB    1 
ATOM   5231 C  CG    . HIS C 1 252 ? 0.412   32.852 63.495  1.00 35.59  ?  269 HIS C CG    1 
ATOM   5232 N  ND1   . HIS C 1 252 ? 0.354   34.029 62.780  1.00 35.69  ?  269 HIS C ND1   1 
ATOM   5233 C  CD2   . HIS C 1 252 ? 0.794   33.191 64.748  1.00 36.81  ?  269 HIS C CD2   1 
ATOM   5234 C  CE1   . HIS C 1 252 ? 0.682   35.037 63.568  1.00 36.91  ?  269 HIS C CE1   1 
ATOM   5235 N  NE2   . HIS C 1 252 ? 0.953   34.556 64.768  1.00 37.60  ?  269 HIS C NE2   1 
ATOM   5236 N  N     . MET C 1 253 ? -2.009  28.676 62.854  1.00 37.78  ?  270 MET C N     1 
ATOM   5237 C  CA    . MET C 1 253 ? -2.196  27.467 62.051  1.00 37.58  ?  270 MET C CA    1 
ATOM   5238 C  C     . MET C 1 253 ? -3.216  27.645 60.930  1.00 36.31  ?  270 MET C C     1 
ATOM   5239 O  O     . MET C 1 253 ? -2.914  27.399 59.762  1.00 34.34  ?  270 MET C O     1 
ATOM   5240 C  CB    . MET C 1 253 ? -2.622  26.295 62.935  1.00 40.71  ?  270 MET C CB    1 
ATOM   5241 C  CG    . MET C 1 253 ? -2.541  24.939 62.243  1.00 40.77  ?  270 MET C CG    1 
ATOM   5242 S  SD    . MET C 1 253 ? -4.065  24.442 61.416  1.00 40.91  ?  270 MET C SD    1 
ATOM   5243 C  CE    . MET C 1 253 ? -5.248  24.600 62.751  1.00 44.20  ?  270 MET C CE    1 
ATOM   5244 N  N     . GLN C 1 254 ? -4.421  28.073 61.289  1.00 28.97  ?  271 GLN C N     1 
ATOM   5245 C  CA    . GLN C 1 254 ? -5.501  28.181 60.315  1.00 28.74  ?  271 GLN C CA    1 
ATOM   5246 C  C     . GLN C 1 254 ? -5.265  29.302 59.306  1.00 28.54  ?  271 GLN C C     1 
ATOM   5247 O  O     . GLN C 1 254 ? -5.652  29.186 58.144  1.00 28.11  ?  271 GLN C O     1 
ATOM   5248 C  CB    . GLN C 1 254 ? -6.838  28.392 61.025  1.00 29.70  ?  271 GLN C CB    1 
ATOM   5249 C  CG    . GLN C 1 254 ? -8.036  28.247 60.108  1.00 29.64  ?  271 GLN C CG    1 
ATOM   5250 C  CD    . GLN C 1 254 ? -8.046  26.915 59.384  1.00 28.85  ?  271 GLN C CD    1 
ATOM   5251 O  OE1   . GLN C 1 254 ? -7.963  25.856 60.006  1.00 28.85  ?  271 GLN C OE1   1 
ATOM   5252 N  NE2   . GLN C 1 254 ? -8.138  26.963 58.060  1.00 28.33  ?  271 GLN C NE2   1 
ATOM   5253 N  N     . ASN C 1 255 ? -4.626  30.381 59.746  1.00 42.49  ?  272 ASN C N     1 
ATOM   5254 C  CA    . ASN C 1 255 ? -4.324  31.493 58.853  1.00 41.02  ?  272 ASN C CA    1 
ATOM   5255 C  C     . ASN C 1 255 ? -3.288  31.109 57.805  1.00 38.95  ?  272 ASN C C     1 
ATOM   5256 O  O     . ASN C 1 255 ? -3.360  31.554 56.660  1.00 38.11  ?  272 ASN C O     1 
ATOM   5257 C  CB    . ASN C 1 255 ? -3.836  32.707 59.640  1.00 41.14  ?  272 ASN C CB    1 
ATOM   5258 C  CG    . ASN C 1 255 ? -3.693  33.945 58.771  1.00 40.47  ?  272 ASN C CG    1 
ATOM   5259 O  OD1   . ASN C 1 255 ? -4.402  34.105 57.777  1.00 40.51  ?  272 ASN C OD1   1 
ATOM   5260 N  ND2   . ASN C 1 255 ? -2.772  34.827 59.143  1.00 40.62  ?  272 ASN C ND2   1 
ATOM   5261 N  N     . ILE C 1 256 ? -2.324  30.283 58.203  1.00 35.88  ?  273 ILE C N     1 
ATOM   5262 C  CA    . ILE C 1 256 ? -1.308  29.792 57.279  1.00 34.24  ?  273 ILE C CA    1 
ATOM   5263 C  C     . ILE C 1 256 ? -1.927  28.967 56.156  1.00 33.58  ?  273 ILE C C     1 
ATOM   5264 O  O     . ILE C 1 256 ? -1.625  29.183 54.981  1.00 32.87  ?  273 ILE C O     1 
ATOM   5265 C  CB    . ILE C 1 256 ? -0.250  28.939 58.010  1.00 34.21  ?  273 ILE C CB    1 
ATOM   5266 C  CG1   . ILE C 1 256 ? 0.647   29.826 58.872  1.00 34.81  ?  273 ILE C CG1   1 
ATOM   5267 C  CG2   . ILE C 1 256 ? 0.603   28.169 57.016  1.00 33.04  ?  273 ILE C CG2   1 
ATOM   5268 C  CD1   . ILE C 1 256 ? 1.575   29.052 59.777  1.00 35.34  ?  273 ILE C CD1   1 
ATOM   5269 N  N     . LYS C 1 257 ? -2.794  28.025 56.516  1.00 35.87  ?  274 LYS C N     1 
ATOM   5270 C  CA    . LYS C 1 257 ? -3.460  27.191 55.521  1.00 35.46  ?  274 LYS C CA    1 
ATOM   5271 C  C     . LYS C 1 257 ? -4.366  28.029 54.622  1.00 35.81  ?  274 LYS C C     1 
ATOM   5272 O  O     . LYS C 1 257 ? -4.485  27.755 53.429  1.00 35.51  ?  274 LYS C O     1 
ATOM   5273 C  CB    . LYS C 1 257 ? -4.245  26.054 56.182  1.00 35.64  ?  274 LYS C CB    1 
ATOM   5274 C  CG    . LYS C 1 257 ? -3.353  25.068 56.929  1.00 35.49  ?  274 LYS C CG    1 
ATOM   5275 C  CD    . LYS C 1 257 ? -4.066  23.767 57.272  1.00 35.69  ?  274 LYS C CD    1 
ATOM   5276 C  CE    . LYS C 1 257 ? -5.450  23.981 57.848  1.00 36.38  ?  274 LYS C CE    1 
ATOM   5277 N  NZ    . LYS C 1 257 ? -6.155  22.677 58.026  1.00 37.48  1  274 LYS C NZ    1 
ATOM   5278 N  N     . ASP C 1 258 ? -5.008  29.043 55.198  1.00 44.22  ?  275 ASP C N     1 
ATOM   5279 C  CA    . ASP C 1 258 ? -5.899  29.910 54.432  1.00 45.27  ?  275 ASP C CA    1 
ATOM   5280 C  C     . ASP C 1 258 ? -5.123  30.662 53.356  1.00 43.85  ?  275 ASP C C     1 
ATOM   5281 O  O     . ASP C 1 258 ? -5.618  30.859 52.246  1.00 44.66  ?  275 ASP C O     1 
ATOM   5282 C  CB    . ASP C 1 258 ? -6.612  30.909 55.349  1.00 46.70  ?  275 ASP C CB    1 
ATOM   5283 C  CG    . ASP C 1 258 ? -7.690  30.261 56.197  1.00 48.58  ?  275 ASP C CG    1 
ATOM   5284 O  OD1   . ASP C 1 258 ? -8.073  29.109 55.904  1.00 49.13  ?  275 ASP C OD1   1 
ATOM   5285 O  OD2   . ASP C 1 258 ? -8.155  30.909 57.160  1.00 49.68  -1 275 ASP C OD2   1 
ATOM   5286 N  N     . ILE C 1 259 ? -3.906  31.078 53.688  1.00 32.99  ?  276 ILE C N     1 
ATOM   5287 C  CA    . ILE C 1 259 ? -3.048  31.768 52.732  1.00 32.90  ?  276 ILE C CA    1 
ATOM   5288 C  C     . ILE C 1 259 ? -2.435  30.778 51.740  1.00 32.00  ?  276 ILE C C     1 
ATOM   5289 O  O     . ILE C 1 259 ? -2.240  31.099 50.569  1.00 32.06  ?  276 ILE C O     1 
ATOM   5290 C  CB    . ILE C 1 259 ? -1.926  32.553 53.447  1.00 33.06  ?  276 ILE C CB    1 
ATOM   5291 C  CG1   . ILE C 1 259 ? -2.525  33.611 54.375  1.00 34.16  ?  276 ILE C CG1   1 
ATOM   5292 C  CG2   . ILE C 1 259 ? -0.996  33.216 52.442  1.00 33.02  ?  276 ILE C CG2   1 
ATOM   5293 C  CD1   . ILE C 1 259 ? -1.497  34.354 55.200  1.00 34.51  ?  276 ILE C CD1   1 
ATOM   5294 N  N     . THR C 1 260 ? -2.155  29.565 52.207  1.00 42.68  ?  277 THR C N     1 
ATOM   5295 C  CA    . THR C 1 260 ? -1.590  28.530 51.346  1.00 41.92  ?  277 THR C CA    1 
ATOM   5296 C  C     . THR C 1 260 ? -2.552  28.142 50.225  1.00 42.19  ?  277 THR C C     1 
ATOM   5297 O  O     . THR C 1 260 ? -2.140  27.946 49.082  1.00 41.86  ?  277 THR C O     1 
ATOM   5298 C  CB    . THR C 1 260 ? -1.217  27.270 52.155  1.00 41.45  ?  277 THR C CB    1 
ATOM   5299 O  OG1   . THR C 1 260 ? -0.277  27.618 53.179  1.00 41.39  ?  277 THR C OG1   1 
ATOM   5300 C  CG2   . THR C 1 260 ? -0.601  26.210 51.252  1.00 40.96  ?  277 THR C CG2   1 
ATOM   5301 N  N     . SER C 1 261 ? -3.835  28.054 50.555  1.00 50.94  ?  278 SER C N     1 
ATOM   5302 C  CA    . SER C 1 261 ? -4.848  27.656 49.585  1.00 52.57  ?  278 SER C CA    1 
ATOM   5303 C  C     . SER C 1 261 ? -5.241  28.814 48.671  1.00 54.18  ?  278 SER C C     1 
ATOM   5304 O  O     . SER C 1 261 ? -5.138  28.714 47.448  1.00 54.33  ?  278 SER C O     1 
ATOM   5305 C  CB    . SER C 1 261 ? -6.086  27.105 50.297  1.00 54.63  ?  278 SER C CB    1 
ATOM   5306 O  OG    . SER C 1 261 ? -6.672  28.083 51.137  1.00 56.12  ?  278 SER C OG    1 
ATOM   5307 N  N     . SER C 1 262 ? -5.696  29.908 49.271  1.00 67.52  ?  279 SER C N     1 
ATOM   5308 C  CA    . SER C 1 262 ? -6.259  31.022 48.515  1.00 69.63  ?  279 SER C CA    1 
ATOM   5309 C  C     . SER C 1 262 ? -5.217  31.830 47.739  1.00 68.36  ?  279 SER C C     1 
ATOM   5310 O  O     . SER C 1 262 ? -5.551  32.480 46.748  1.00 70.40  ?  279 SER C O     1 
ATOM   5311 C  CB    . SER C 1 262 ? -7.031  31.953 49.454  1.00 70.75  ?  279 SER C CB    1 
ATOM   5312 O  OG    . SER C 1 262 ? -6.178  32.507 50.440  1.00 69.02  ?  279 SER C OG    1 
ATOM   5313 N  N     . ILE C 1 263 ? -3.964  31.799 48.182  1.00 56.81  ?  280 ILE C N     1 
ATOM   5314 C  CA    . ILE C 1 263 ? -2.926  32.605 47.542  1.00 56.43  ?  280 ILE C CA    1 
ATOM   5315 C  C     . ILE C 1 263 ? -1.892  31.766 46.793  1.00 55.34  ?  280 ILE C C     1 
ATOM   5316 O  O     . ILE C 1 263 ? -1.771  31.867 45.572  1.00 56.13  ?  280 ILE C O     1 
ATOM   5317 C  CB    . ILE C 1 263 ? -2.191  33.491 48.565  1.00 56.09  ?  280 ILE C CB    1 
ATOM   5318 C  CG1   . ILE C 1 263 ? -3.187  34.379 49.312  1.00 57.32  ?  280 ILE C CG1   1 
ATOM   5319 C  CG2   . ILE C 1 263 ? -1.143  34.345 47.873  1.00 56.40  ?  280 ILE C CG2   1 
ATOM   5320 C  CD1   . ILE C 1 263 ? -4.014  35.262 48.403  1.00 58.95  ?  280 ILE C CD1   1 
ATOM   5321 N  N     . HIS C 1 264 ? -1.150  30.940 47.525  1.00 34.51  ?  281 HIS C N     1 
ATOM   5322 C  CA    . HIS C 1 264 ? -0.058  30.172 46.932  1.00 33.75  ?  281 HIS C CA    1 
ATOM   5323 C  C     . HIS C 1 264 ? -0.553  29.068 46.000  1.00 33.58  ?  281 HIS C C     1 
ATOM   5324 O  O     . HIS C 1 264 ? 0.019   28.850 44.932  1.00 33.53  ?  281 HIS C O     1 
ATOM   5325 C  CB    . HIS C 1 264 ? 0.828   29.569 48.026  1.00 33.02  ?  281 HIS C CB    1 
ATOM   5326 C  CG    . HIS C 1 264 ? 1.512   30.590 48.882  1.00 33.27  ?  281 HIS C CG    1 
ATOM   5327 N  ND1   . HIS C 1 264 ? 2.486   31.437 48.396  1.00 33.49  ?  281 HIS C ND1   1 
ATOM   5328 C  CD2   . HIS C 1 264 ? 1.370   30.894 50.194  1.00 33.47  ?  281 HIS C CD2   1 
ATOM   5329 C  CE1   . HIS C 1 264 ? 2.911   32.221 49.371  1.00 33.82  ?  281 HIS C CE1   1 
ATOM   5330 N  NE2   . HIS C 1 264 ? 2.250   31.912 50.472  1.00 33.83  ?  281 HIS C NE2   1 
ATOM   5331 N  N     . PHE C 1 265 ? -1.613  28.373 46.402  1.00 39.35  ?  282 PHE C N     1 
ATOM   5332 C  CA    . PHE C 1 265 ? -2.143  27.271 45.604  1.00 39.47  ?  282 PHE C CA    1 
ATOM   5333 C  C     . PHE C 1 265 ? -2.880  27.770 44.365  1.00 41.06  ?  282 PHE C C     1 
ATOM   5334 O  O     . PHE C 1 265 ? -2.832  27.137 43.310  1.00 41.25  ?  282 PHE C O     1 
ATOM   5335 C  CB    . PHE C 1 265 ? -3.072  26.392 46.443  1.00 39.54  ?  282 PHE C CB    1 
ATOM   5336 C  CG    . PHE C 1 265 ? -3.727  25.289 45.662  1.00 39.86  ?  282 PHE C CG    1 
ATOM   5337 C  CD1   . PHE C 1 265 ? -3.008  24.166 45.290  1.00 38.91  ?  282 PHE C CD1   1 
ATOM   5338 C  CD2   . PHE C 1 265 ? -5.061  25.375 45.299  1.00 41.43  ?  282 PHE C CD2   1 
ATOM   5339 C  CE1   . PHE C 1 265 ? -3.605  23.150 44.570  1.00 39.37  ?  282 PHE C CE1   1 
ATOM   5340 C  CE2   . PHE C 1 265 ? -5.664  24.362 44.579  1.00 41.70  ?  282 PHE C CE2   1 
ATOM   5341 C  CZ    . PHE C 1 265 ? -4.935  23.248 44.214  1.00 40.61  ?  282 PHE C CZ    1 
ATOM   5342 N  N     . GLU C 1 266 ? -3.564  28.902 44.497  1.00 70.40  ?  283 GLU C N     1 
ATOM   5343 C  CA    . GLU C 1 266 ? -4.282  29.492 43.373  1.00 73.57  ?  283 GLU C CA    1 
ATOM   5344 C  C     . GLU C 1 266 ? -3.301  29.984 42.317  1.00 72.70  ?  283 GLU C C     1 
ATOM   5345 O  O     . GLU C 1 266 ? -3.611  30.004 41.126  1.00 74.73  ?  283 GLU C O     1 
ATOM   5346 C  CB    . GLU C 1 266 ? -5.185  30.633 43.841  1.00 77.02  ?  283 GLU C CB    1 
ATOM   5347 C  CG    . GLU C 1 266 ? -6.402  30.161 44.619  1.00 79.01  ?  283 GLU C CG    1 
ATOM   5348 C  CD    . GLU C 1 266 ? -7.216  29.135 43.852  1.00 79.92  ?  283 GLU C CD    1 
ATOM   5349 O  OE1   . GLU C 1 266 ? -7.492  29.365 42.655  1.00 81.58  ?  283 GLU C OE1   1 
ATOM   5350 O  OE2   . GLU C 1 266 ? -7.576  28.096 44.445  1.00 78.47  -1 283 GLU C OE2   1 
ATOM   5351 N  N     . ALA C 1 267 ? -2.118  30.387 42.769  1.00 46.05  ?  284 ALA C N     1 
ATOM   5352 C  CA    . ALA C 1 267 ? -1.042  30.780 41.869  1.00 45.93  ?  284 ALA C CA    1 
ATOM   5353 C  C     . ALA C 1 267 ? -0.611  29.582 41.029  1.00 45.15  ?  284 ALA C C     1 
ATOM   5354 O  O     . ALA C 1 267 ? -0.250  29.724 39.861  1.00 45.92  ?  284 ALA C O     1 
ATOM   5355 C  CB    . ALA C 1 267 ? 0.135   31.339 42.652  1.00 44.59  ?  284 ALA C CB    1 
ATOM   5356 N  N     . TYR C 1 268 ? -0.638  28.402 41.640  1.00 42.39  ?  285 TYR C N     1 
ATOM   5357 C  CA    . TYR C 1 268 ? -0.315  27.170 40.934  1.00 42.05  ?  285 TYR C CA    1 
ATOM   5358 C  C     . TYR C 1 268 ? -1.429  26.812 39.949  1.00 42.98  ?  285 TYR C C     1 
ATOM   5359 O  O     . TYR C 1 268 ? -1.161  26.371 38.831  1.00 43.37  ?  285 TYR C O     1 
ATOM   5360 C  CB    . TYR C 1 268 ? -0.086  26.026 41.924  1.00 41.07  ?  285 TYR C CB    1 
ATOM   5361 C  CG    . TYR C 1 268 ? 0.247   24.703 41.272  1.00 40.87  ?  285 TYR C CG    1 
ATOM   5362 C  CD1   . TYR C 1 268 ? 1.549   24.409 40.888  1.00 40.51  ?  285 TYR C CD1   1 
ATOM   5363 C  CD2   . TYR C 1 268 ? -0.735  23.746 41.043  1.00 41.17  ?  285 TYR C CD2   1 
ATOM   5364 C  CE1   . TYR C 1 268 ? 1.864   23.205 40.293  1.00 40.48  ?  285 TYR C CE1   1 
ATOM   5365 C  CE2   . TYR C 1 268 ? -0.428  22.537 40.448  1.00 41.15  ?  285 TYR C CE2   1 
ATOM   5366 C  CZ    . TYR C 1 268 ? 0.874   22.272 40.075  1.00 40.82  ?  285 TYR C CZ    1 
ATOM   5367 O  OH    . TYR C 1 268 ? 1.189   21.072 39.482  1.00 40.95  ?  285 TYR C OH    1 
ATOM   5368 N  N     . ARG C 1 269 ? -2.678  26.998 40.375  1.00 51.62  ?  286 ARG C N     1 
ATOM   5369 C  CA    . ARG C 1 269 ? -3.838  26.675 39.544  1.00 53.09  ?  286 ARG C CA    1 
ATOM   5370 C  C     . ARG C 1 269 ? -3.881  27.474 38.247  1.00 54.91  ?  286 ARG C C     1 
ATOM   5371 O  O     . ARG C 1 269 ? -4.110  26.918 37.172  1.00 55.49  ?  286 ARG C O     1 
ATOM   5372 C  CB    . ARG C 1 269 ? -5.138  26.924 40.314  1.00 54.21  ?  286 ARG C CB    1 
ATOM   5373 C  CG    . ARG C 1 269 ? -5.535  25.836 41.293  1.00 53.24  ?  286 ARG C CG    1 
ATOM   5374 C  CD    . ARG C 1 269 ? -6.941  26.093 41.819  1.00 55.68  ?  286 ARG C CD    1 
ATOM   5375 N  NE    . ARG C 1 269 ? -7.935  26.089 40.749  1.00 57.73  ?  286 ARG C NE    1 
ATOM   5376 C  CZ    . ARG C 1 269 ? -8.865  25.151 40.594  1.00 58.09  ?  286 ARG C CZ    1 
ATOM   5377 N  NH1   . ARG C 1 269 ? -8.940  24.141 41.450  1.00 56.80  1  286 ARG C NH1   1 
ATOM   5378 N  NH2   . ARG C 1 269 ? -9.727  25.228 39.589  1.00 59.69  ?  286 ARG C NH2   1 
ATOM   5379 N  N     . VAL C 1 270 ? -3.660  28.780 38.355  1.00 84.78  ?  287 VAL C N     1 
ATOM   5380 C  CA    . VAL C 1 270 ? -3.730  29.668 37.201  1.00 87.55  ?  287 VAL C CA    1 
ATOM   5381 C  C     . VAL C 1 270 ? -2.604  29.385 36.209  1.00 86.43  ?  287 VAL C C     1 
ATOM   5382 O  O     . VAL C 1 270 ? -2.788  29.518 35.003  1.00 88.02  ?  287 VAL C O     1 
ATOM   5383 C  CB    . VAL C 1 270 ? -3.703  31.157 37.622  1.00 90.20  ?  287 VAL C CB    1 
ATOM   5384 C  CG1   . VAL C 1 270 ? -4.962  31.507 38.404  1.00 92.72  ?  287 VAL C CG1   1 
ATOM   5385 C  CG2   . VAL C 1 270 ? -2.460  31.477 38.434  1.00 87.34  ?  287 VAL C CG2   1 
ATOM   5386 N  N     . LYS C 1 271 ? -1.438  29.003 36.719  1.00 70.69  ?  288 LYS C N     1 
ATOM   5387 C  CA    . LYS C 1 271 ? -0.303  28.681 35.863  1.00 70.10  ?  288 LYS C CA    1 
ATOM   5388 C  C     . LYS C 1 271 ? -0.601  27.455 35.005  1.00 70.04  ?  288 LYS C C     1 
ATOM   5389 O  O     . LYS C 1 271 ? -0.347  27.448 33.801  1.00 71.21  ?  288 LYS C O     1 
ATOM   5390 C  CB    . LYS C 1 271 ? 0.954   28.445 36.702  1.00 67.82  ?  288 LYS C CB    1 
ATOM   5391 N  N     . ARG C 1 272 ? -1.140  26.419 35.639  1.00 55.30  ?  289 ARG C N     1 
ATOM   5392 C  CA    . ARG C 1 272 ? -1.417  25.154 34.967  1.00 55.26  ?  289 ARG C CA    1 
ATOM   5393 C  C     . ARG C 1 272 ? -2.663  25.184 34.082  1.00 57.21  ?  289 ARG C C     1 
ATOM   5394 O  O     . ARG C 1 272 ? -2.871  24.278 33.275  1.00 57.61  ?  289 ARG C O     1 
ATOM   5395 C  CB    . ARG C 1 272 ? -1.561  24.034 35.999  1.00 53.76  ?  289 ARG C CB    1 
ATOM   5396 C  CG    . ARG C 1 272 ? -0.264  23.647 36.686  1.00 52.58  ?  289 ARG C CG    1 
ATOM   5397 C  CD    . ARG C 1 272 ? -0.044  22.149 36.594  1.00 52.28  ?  289 ARG C CD    1 
ATOM   5398 N  NE    . ARG C 1 272 ? 0.035   21.708 35.205  1.00 53.24  ?  289 ARG C NE    1 
ATOM   5399 C  CZ    . ARG C 1 272 ? -0.043  20.440 34.817  1.00 53.57  ?  289 ARG C CZ    1 
ATOM   5400 N  NH1   . ARG C 1 272 ? -0.212  19.478 35.714  1.00 52.87  1  289 ARG C NH1   1 
ATOM   5401 N  NH2   . ARG C 1 272 ? 0.041   20.133 33.530  1.00 54.69  ?  289 ARG C NH2   1 
ATOM   5402 N  N     . LEU C 1 273 ? -3.489  26.215 34.229  1.00 78.06  ?  290 LEU C N     1 
ATOM   5403 C  CA    . LEU C 1 273 ? -4.755  26.269 33.501  1.00 79.83  ?  290 LEU C CA    1 
ATOM   5404 C  C     . LEU C 1 273 ? -4.924  27.524 32.646  1.00 81.89  ?  290 LEU C C     1 
ATOM   5405 O  O     . LEU C 1 273 ? -5.561  27.474 31.592  1.00 83.28  ?  290 LEU C O     1 
ATOM   5406 C  CB    . LEU C 1 273 ? -5.926  26.158 34.481  1.00 79.80  ?  290 LEU C CB    1 
ATOM   5407 C  CG    . LEU C 1 273 ? -5.959  24.898 35.349  1.00 78.07  ?  290 LEU C CG    1 
ATOM   5408 C  CD1   . LEU C 1 273 ? -7.119  24.951 36.331  1.00 78.36  ?  290 LEU C CD1   1 
ATOM   5409 C  CD2   . LEU C 1 273 ? -6.039  23.651 34.484  1.00 77.94  ?  290 LEU C CD2   1 
ATOM   5410 N  N     . ASN C 1 274 ? -4.370  28.641 33.111  1.00 71.95  ?  291 ASN C N     1 
ATOM   5411 C  CA    . ASN C 1 274 ? -4.465  29.924 32.412  1.00 75.01  ?  291 ASN C CA    1 
ATOM   5412 C  C     . ASN C 1 274 ? -5.909  30.376 32.225  1.00 77.73  ?  291 ASN C C     1 
ATOM   5413 O  O     . ASN C 1 274 ? -6.527  30.904 33.150  1.00 78.57  ?  291 ASN C O     1 
ATOM   5414 C  CB    . ASN C 1 274 ? -3.758  29.854 31.055  1.00 75.19  ?  291 ASN C CB    1 
ATOM   5415 N  N     . LYS D 1 2   ? 69.288  35.652 68.460  1.00 106.97 ?  19  LYS D N     1 
ATOM   5416 C  CA    . LYS D 1 2   ? 68.045  36.383 68.242  1.00 106.06 ?  19  LYS D CA    1 
ATOM   5417 C  C     . LYS D 1 2   ? 67.961  36.911 66.815  1.00 105.26 ?  19  LYS D C     1 
ATOM   5418 O  O     . LYS D 1 2   ? 68.377  38.035 66.534  1.00 107.79 ?  19  LYS D O     1 
ATOM   5419 C  CB    . LYS D 1 2   ? 67.922  37.538 69.238  1.00 109.34 ?  19  LYS D CB    1 
ATOM   5420 N  N     . GLN D 1 3   ? 67.423  36.094 65.917  1.00 74.38  ?  20  GLN D N     1 
ATOM   5421 C  CA    . GLN D 1 3   ? 67.301  36.477 64.517  1.00 73.34  ?  20  GLN D CA    1 
ATOM   5422 C  C     . GLN D 1 3   ? 65.840  36.437 64.075  1.00 70.35  ?  20  GLN D C     1 
ATOM   5423 O  O     . GLN D 1 3   ? 65.038  35.687 64.629  1.00 68.18  ?  20  GLN D O     1 
ATOM   5424 C  CB    . GLN D 1 3   ? 68.154  35.558 63.641  1.00 72.14  ?  20  GLN D CB    1 
ATOM   5425 C  CG    . GLN D 1 3   ? 69.560  35.332 64.185  1.00 74.67  ?  20  GLN D CG    1 
ATOM   5426 C  CD    . GLN D 1 3   ? 70.533  34.868 63.123  1.00 74.62  ?  20  GLN D CD    1 
ATOM   5427 O  OE1   . GLN D 1 3   ? 70.162  34.688 61.965  1.00 72.39  ?  20  GLN D OE1   1 
ATOM   5428 N  NE2   . GLN D 1 3   ? 71.786  34.664 63.514  1.00 77.11  ?  20  GLN D NE2   1 
ATOM   5429 N  N     . GLY D 1 4   ? 65.502  37.246 63.075  1.00 56.53  ?  21  GLY D N     1 
ATOM   5430 C  CA    . GLY D 1 4   ? 64.131  37.352 62.607  1.00 54.34  ?  21  GLY D CA    1 
ATOM   5431 C  C     . GLY D 1 4   ? 63.755  36.276 61.607  1.00 50.94  ?  21  GLY D C     1 
ATOM   5432 O  O     . GLY D 1 4   ? 64.272  36.248 60.491  1.00 50.86  ?  21  GLY D O     1 
ATOM   5433 N  N     . PHE D 1 5   ? 62.845  35.392 62.006  1.00 48.33  ?  22  PHE D N     1 
ATOM   5434 C  CA    . PHE D 1 5   ? 62.370  34.331 61.124  1.00 45.19  ?  22  PHE D CA    1 
ATOM   5435 C  C     . PHE D 1 5   ? 60.910  34.544 60.730  1.00 43.46  ?  22  PHE D C     1 
ATOM   5436 O  O     . PHE D 1 5   ? 60.040  34.706 61.585  1.00 43.31  ?  22  PHE D O     1 
ATOM   5437 C  CB    . PHE D 1 5   ? 62.539  32.966 61.792  1.00 43.63  ?  22  PHE D CB    1 
ATOM   5438 N  N     . GLU D 1 6   ? 60.651  34.535 59.427  1.00 70.27  ?  23  GLU D N     1 
ATOM   5439 C  CA    . GLU D 1 6   ? 59.311  34.773 58.904  1.00 68.89  ?  23  GLU D CA    1 
ATOM   5440 C  C     . GLU D 1 6   ? 58.458  33.507 58.914  1.00 65.69  ?  23  GLU D C     1 
ATOM   5441 O  O     . GLU D 1 6   ? 58.969  32.399 58.748  1.00 64.41  ?  23  GLU D O     1 
ATOM   5442 C  CB    . GLU D 1 6   ? 59.394  35.337 57.484  1.00 69.52  ?  23  GLU D CB    1 
ATOM   5443 C  CG    . GLU D 1 6   ? 60.266  36.578 57.365  1.00 73.00  ?  23  GLU D CG    1 
ATOM   5444 C  CD    . GLU D 1 6   ? 60.451  37.029 55.929  1.00 73.72  ?  23  GLU D CD    1 
ATOM   5445 O  OE1   . GLU D 1 6   ? 61.465  37.698 55.641  1.00 76.56  ?  23  GLU D OE1   1 
ATOM   5446 O  OE2   . GLU D 1 6   ? 59.579  36.720 55.089  1.00 71.82  -1 23  GLU D OE2   1 
ATOM   5447 N  N     . PHE D 1 7   ? 57.155  33.682 59.112  1.00 46.65  ?  24  PHE D N     1 
ATOM   5448 C  CA    . PHE D 1 7   ? 56.211  32.568 59.102  1.00 44.34  ?  24  PHE D CA    1 
ATOM   5449 C  C     . PHE D 1 7   ? 54.820  33.055 58.709  1.00 43.82  ?  24  PHE D C     1 
ATOM   5450 O  O     . PHE D 1 7   ? 54.309  34.023 59.272  1.00 45.13  ?  24  PHE D O     1 
ATOM   5451 C  CB    . PHE D 1 7   ? 56.169  31.881 60.468  1.00 44.23  ?  24  PHE D CB    1 
ATOM   5452 C  CG    . PHE D 1 7   ? 55.429  30.573 60.465  1.00 42.12  ?  24  PHE D CG    1 
ATOM   5453 C  CD1   . PHE D 1 7   ? 55.850  29.527 59.661  1.00 40.78  ?  24  PHE D CD1   1 
ATOM   5454 C  CD2   . PHE D 1 7   ? 54.313  30.390 61.264  1.00 41.71  ?  24  PHE D CD2   1 
ATOM   5455 C  CE1   . PHE D 1 7   ? 55.172  28.322 59.654  1.00 39.11  ?  24  PHE D CE1   1 
ATOM   5456 C  CE2   . PHE D 1 7   ? 53.631  29.187 61.262  1.00 39.87  ?  24  PHE D CE2   1 
ATOM   5457 C  CZ    . PHE D 1 7   ? 54.061  28.152 60.455  1.00 38.59  ?  24  PHE D CZ    1 
ATOM   5458 N  N     . ASN D 1 8   ? 54.208  32.377 57.743  1.00 52.83  ?  25  ASN D N     1 
ATOM   5459 C  CA    . ASN D 1 8   ? 52.928  32.813 57.199  1.00 52.35  ?  25  ASN D CA    1 
ATOM   5460 C  C     . ASN D 1 8   ? 51.810  31.792 57.387  1.00 50.44  ?  25  ASN D C     1 
ATOM   5461 O  O     . ASN D 1 8   ? 51.914  30.654 56.930  1.00 48.76  ?  25  ASN D O     1 
ATOM   5462 C  CB    . ASN D 1 8   ? 53.077  33.137 55.712  1.00 52.19  ?  25  ASN D CB    1 
ATOM   5463 C  CG    . ASN D 1 8   ? 54.112  34.212 55.453  1.00 54.44  ?  25  ASN D CG    1 
ATOM   5464 O  OD1   . ASN D 1 8   ? 54.235  35.168 56.218  1.00 56.43  ?  25  ASN D OD1   1 
ATOM   5465 N  ND2   . ASN D 1 8   ? 54.867  34.059 54.371  1.00 54.42  ?  25  ASN D ND2   1 
ATOM   5466 N  N     . ILE D 1 9   ? 50.748  32.204 58.071  1.00 35.60  ?  26  ILE D N     1 
ATOM   5467 C  CA    . ILE D 1 9   ? 49.581  31.349 58.269  1.00 33.91  ?  26  ILE D CA    1 
ATOM   5468 C  C     . ILE D 1 9   ? 48.363  31.942 57.568  1.00 33.93  ?  26  ILE D C     1 
ATOM   5469 O  O     . ILE D 1 9   ? 48.039  33.112 57.755  1.00 35.66  ?  26  ILE D O     1 
ATOM   5470 C  CB    . ILE D 1 9   ? 49.260  31.157 59.764  1.00 34.30  ?  26  ILE D CB    1 
ATOM   5471 C  CG1   . ILE D 1 9   ? 50.495  30.663 60.519  1.00 34.68  ?  26  ILE D CG1   1 
ATOM   5472 C  CG2   . ILE D 1 9   ? 48.098  30.189 59.941  1.00 32.69  ?  26  ILE D CG2   1 
ATOM   5473 C  CD1   . ILE D 1 9   ? 50.282  30.518 62.010  1.00 35.40  ?  26  ILE D CD1   1 
ATOM   5474 N  N     . MET D 1 10  ? 47.690  31.130 56.761  1.00 45.10  ?  27  MET D N     1 
ATOM   5475 C  CA    . MET D 1 10  ? 46.486  31.575 56.069  1.00 45.05  ?  27  MET D CA    1 
ATOM   5476 C  C     . MET D 1 10  ? 45.249  30.844 56.574  1.00 44.53  ?  27  MET D C     1 
ATOM   5477 O  O     . MET D 1 10  ? 45.227  29.615 56.633  1.00 43.35  ?  27  MET D O     1 
ATOM   5478 C  CB    . MET D 1 10  ? 46.628  31.376 54.560  1.00 44.11  ?  27  MET D CB    1 
ATOM   5479 C  CG    . MET D 1 10  ? 45.308  31.445 53.808  1.00 43.88  ?  27  MET D CG    1 
ATOM   5480 S  SD    . MET D 1 10  ? 45.511  31.307 52.026  1.00 43.36  ?  27  MET D SD    1 
ATOM   5481 C  CE    . MET D 1 10  ? 46.172  32.926 51.658  1.00 45.83  ?  27  MET D CE    1 
ATOM   5482 N  N     . VAL D 1 11  ? 44.219  31.602 56.934  1.00 40.86  ?  28  VAL D N     1 
ATOM   5483 C  CA    . VAL D 1 11  ? 42.959  31.005 57.353  1.00 40.52  ?  28  VAL D CA    1 
ATOM   5484 C  C     . VAL D 1 11  ? 41.994  30.903 56.174  1.00 39.76  ?  28  VAL D C     1 
ATOM   5485 O  O     . VAL D 1 11  ? 41.796  31.861 55.426  1.00 40.46  ?  28  VAL D O     1 
ATOM   5486 C  CB    . VAL D 1 11  ? 42.306  31.802 58.505  1.00 42.04  ?  28  VAL D CB    1 
ATOM   5487 C  CG1   . VAL D 1 11  ? 43.100  31.623 59.790  1.00 42.41  ?  28  VAL D CG1   1 
ATOM   5488 C  CG2   . VAL D 1 11  ? 42.188  33.275 58.144  1.00 43.64  ?  28  VAL D CG2   1 
ATOM   5489 N  N     . VAL D 1 12  ? 41.411  29.721 56.005  1.00 39.77  ?  29  VAL D N     1 
ATOM   5490 C  CA    . VAL D 1 12  ? 40.502  29.455 54.898  1.00 38.96  ?  29  VAL D CA    1 
ATOM   5491 C  C     . VAL D 1 12  ? 39.299  28.665 55.408  1.00 38.66  ?  29  VAL D C     1 
ATOM   5492 O  O     . VAL D 1 12  ? 39.446  27.774 56.242  1.00 38.40  ?  29  VAL D O     1 
ATOM   5493 C  CB    . VAL D 1 12  ? 41.221  28.680 53.762  1.00 37.50  ?  29  VAL D CB    1 
ATOM   5494 C  CG1   . VAL D 1 12  ? 40.228  28.054 52.798  1.00 36.63  ?  29  VAL D CG1   1 
ATOM   5495 C  CG2   . VAL D 1 12  ? 42.179  29.594 53.015  1.00 38.00  ?  29  VAL D CG2   1 
ATOM   5496 N  N     . GLY D 1 13  ? 38.111  28.995 54.910  1.00 28.03  ?  30  GLY D N     1 
ATOM   5497 C  CA    . GLY D 1 13  ? 36.901  28.309 55.322  1.00 27.99  ?  30  GLY D CA    1 
ATOM   5498 C  C     . GLY D 1 13  ? 35.645  29.034 54.885  1.00 29.14  ?  30  GLY D C     1 
ATOM   5499 O  O     . GLY D 1 13  ? 35.713  30.121 54.312  1.00 30.12  ?  30  GLY D O     1 
ATOM   5500 N  N     . GLN D 1 14  ? 34.492  28.429 55.154  1.00 58.20  ?  31  GLN D N     1 
ATOM   5501 C  CA    . GLN D 1 14  ? 33.214  29.020 54.772  1.00 59.26  ?  31  GLN D CA    1 
ATOM   5502 C  C     . GLN D 1 14  ? 32.900  30.265 55.598  1.00 61.03  ?  31  GLN D C     1 
ATOM   5503 O  O     . GLN D 1 14  ? 33.535  30.522 56.621  1.00 61.61  ?  31  GLN D O     1 
ATOM   5504 C  CB    . GLN D 1 14  ? 32.085  27.996 54.910  1.00 58.94  ?  31  GLN D CB    1 
ATOM   5505 C  CG    . GLN D 1 14  ? 31.971  27.045 53.727  1.00 57.85  ?  31  GLN D CG    1 
ATOM   5506 C  CD    . GLN D 1 14  ? 30.627  26.349 53.660  1.00 58.25  ?  31  GLN D CD    1 
ATOM   5507 O  OE1   . GLN D 1 14  ? 29.579  26.987 53.771  1.00 59.47  ?  31  GLN D OE1   1 
ATOM   5508 N  NE2   . GLN D 1 14  ? 30.649  25.033 53.478  1.00 57.20  ?  31  GLN D NE2   1 
ATOM   5509 N  N     . SER D 1 15  ? 31.916  31.031 55.140  1.00 38.16  ?  32  SER D N     1 
ATOM   5510 C  CA    . SER D 1 15  ? 31.555  32.302 55.763  1.00 40.39  ?  32  SER D CA    1 
ATOM   5511 C  C     . SER D 1 15  ? 30.993  32.146 57.174  1.00 41.10  ?  32  SER D C     1 
ATOM   5512 O  O     . SER D 1 15  ? 30.070  31.364 57.404  1.00 40.91  ?  32  SER D O     1 
ATOM   5513 C  CB    . SER D 1 15  ? 30.540  33.041 54.890  1.00 41.99  ?  32  SER D CB    1 
ATOM   5514 O  OG    . SER D 1 15  ? 30.947  33.044 53.533  1.00 41.45  ?  32  SER D OG    1 
ATOM   5515 N  N     . GLY D 1 16  ? 31.558  32.898 58.114  1.00 34.35  ?  33  GLY D N     1 
ATOM   5516 C  CA    . GLY D 1 16  ? 31.037  32.952 59.468  1.00 35.53  ?  33  GLY D CA    1 
ATOM   5517 C  C     . GLY D 1 16  ? 31.451  31.796 60.357  1.00 34.14  ?  33  GLY D C     1 
ATOM   5518 O  O     . GLY D 1 16  ? 30.729  31.434 61.284  1.00 34.77  ?  33  GLY D O     1 
ATOM   5519 N  N     . LEU D 1 17  ? 32.613  31.214 60.078  1.00 38.85  ?  34  LEU D N     1 
ATOM   5520 C  CA    . LEU D 1 17  ? 33.108  30.085 60.860  1.00 37.65  ?  34  LEU D CA    1 
ATOM   5521 C  C     . LEU D 1 17  ? 34.044  30.513 61.990  1.00 38.34  ?  34  LEU D C     1 
ATOM   5522 O  O     . LEU D 1 17  ? 34.563  29.674 62.726  1.00 37.60  ?  34  LEU D O     1 
ATOM   5523 C  CB    . LEU D 1 17  ? 33.816  29.080 59.950  1.00 35.54  ?  34  LEU D CB    1 
ATOM   5524 C  CG    . LEU D 1 17  ? 32.907  28.254 59.039  1.00 34.68  ?  34  LEU D CG    1 
ATOM   5525 C  CD1   . LEU D 1 17  ? 33.718  27.238 58.251  1.00 32.79  ?  34  LEU D CD1   1 
ATOM   5526 C  CD2   . LEU D 1 17  ? 31.825  27.562 59.854  1.00 35.17  ?  34  LEU D CD2   1 
ATOM   5527 N  N     . GLY D 1 18  ? 34.257  31.818 62.126  1.00 41.45  ?  35  GLY D N     1 
ATOM   5528 C  CA    . GLY D 1 18  ? 35.085  32.340 63.198  1.00 42.43  ?  35  GLY D CA    1 
ATOM   5529 C  C     . GLY D 1 18  ? 36.542  32.451 62.796  1.00 41.55  ?  35  GLY D C     1 
ATOM   5530 O  O     . GLY D 1 18  ? 37.440  32.373 63.634  1.00 41.64  ?  35  GLY D O     1 
ATOM   5531 N  N     . LYS D 1 19  ? 36.771  32.634 61.500  1.00 50.02  ?  36  LYS D N     1 
ATOM   5532 C  CA    . LYS D 1 19  ? 38.119  32.746 60.959  1.00 49.64  ?  36  LYS D CA    1 
ATOM   5533 C  C     . LYS D 1 19  ? 38.815  34.011 61.453  1.00 51.39  ?  36  LYS D C     1 
ATOM   5534 O  O     . LYS D 1 19  ? 39.933  33.952 61.966  1.00 51.49  ?  36  LYS D O     1 
ATOM   5535 C  CB    . LYS D 1 19  ? 38.075  32.723 59.432  1.00 48.78  ?  36  LYS D CB    1 
ATOM   5536 C  CG    . LYS D 1 19  ? 37.559  31.412 58.862  1.00 47.14  ?  36  LYS D CG    1 
ATOM   5537 C  CD    . LYS D 1 19  ? 37.689  31.370 57.351  1.00 46.27  ?  36  LYS D CD    1 
ATOM   5538 C  CE    . LYS D 1 19  ? 36.964  32.541 56.715  1.00 47.33  ?  36  LYS D CE    1 
ATOM   5539 N  NZ    . LYS D 1 19  ? 36.461  32.215 55.355  1.00 46.47  1  36  LYS D NZ    1 
ATOM   5540 N  N     . SER D 1 20  ? 38.152  35.152 61.290  1.00 47.83  ?  37  SER D N     1 
ATOM   5541 C  CA    . SER D 1 20  ? 38.702  36.431 61.728  1.00 50.07  ?  37  SER D CA    1 
ATOM   5542 C  C     . SER D 1 20  ? 38.844  36.477 63.246  1.00 51.08  ?  37  SER D C     1 
ATOM   5543 O  O     . SER D 1 20  ? 39.796  37.051 63.774  1.00 52.14  ?  37  SER D O     1 
ATOM   5544 C  CB    . SER D 1 20  ? 37.820  37.587 61.251  1.00 52.24  ?  37  SER D CB    1 
ATOM   5545 O  OG    . SER D 1 20  ? 37.551  37.487 59.864  1.00 51.39  ?  37  SER D OG    1 
ATOM   5546 N  N     . THR D 1 21  ? 37.884  35.872 63.939  1.00 54.75  ?  38  THR D N     1 
ATOM   5547 C  CA    . THR D 1 21  ? 37.874  35.845 65.397  1.00 55.84  ?  38  THR D CA    1 
ATOM   5548 C  C     . THR D 1 21  ? 39.075  35.071 65.939  1.00 54.86  ?  38  THR D C     1 
ATOM   5549 O  O     . THR D 1 21  ? 39.584  35.366 67.019  1.00 56.29  ?  38  THR D O     1 
ATOM   5550 C  CB    . THR D 1 21  ? 36.568  35.216 65.933  1.00 55.85  ?  38  THR D CB    1 
ATOM   5551 O  OG1   . THR D 1 21  ? 35.442  35.941 65.424  1.00 57.34  ?  38  THR D OG1   1 
ATOM   5552 C  CG2   . THR D 1 21  ? 36.533  35.236 67.456  1.00 57.13  ?  38  THR D CG2   1 
ATOM   5553 N  N     . LEU D 1 22  ? 39.526  34.074 65.187  1.00 51.10  ?  39  LEU D N     1 
ATOM   5554 C  CA    . LEU D 1 22  ? 40.657  33.264 65.618  1.00 49.87  ?  39  LEU D CA    1 
ATOM   5555 C  C     . LEU D 1 22  ? 41.984  34.002 65.434  1.00 50.40  ?  39  LEU D C     1 
ATOM   5556 O  O     . LEU D 1 22  ? 42.941  33.765 66.170  1.00 50.41  ?  39  LEU D O     1 
ATOM   5557 C  CB    . LEU D 1 22  ? 40.686  31.936 64.860  1.00 47.45  ?  39  LEU D CB    1 
ATOM   5558 C  CG    . LEU D 1 22  ? 41.565  30.857 65.496  1.00 46.38  ?  39  LEU D CG    1 
ATOM   5559 C  CD1   . LEU D 1 22  ? 40.835  30.207 66.664  1.00 46.88  ?  39  LEU D CD1   1 
ATOM   5560 C  CD2   . LEU D 1 22  ? 41.995  29.814 64.478  1.00 44.27  ?  39  LEU D CD2   1 
ATOM   5561 N  N     . ILE D 1 23  ? 42.034  34.893 64.447  1.00 48.14  ?  40  ILE D N     1 
ATOM   5562 C  CA    . ILE D 1 23  ? 43.264  35.615 64.124  1.00 48.63  ?  40  ILE D CA    1 
ATOM   5563 C  C     . ILE D 1 23  ? 43.725  36.568 65.226  1.00 50.78  ?  40  ILE D C     1 
ATOM   5564 O  O     . ILE D 1 23  ? 44.866  36.485 65.680  1.00 50.92  ?  40  ILE D O     1 
ATOM   5565 C  CB    . ILE D 1 23  ? 43.106  36.419 62.822  1.00 48.84  ?  40  ILE D CB    1 
ATOM   5566 C  CG1   . ILE D 1 23  ? 42.832  35.477 61.651  1.00 46.74  ?  40  ILE D CG1   1 
ATOM   5567 C  CG2   . ILE D 1 23  ? 44.350  37.253 62.555  1.00 49.96  ?  40  ILE D CG2   1 
ATOM   5568 C  CD1   . ILE D 1 23  ? 42.678  36.185 60.330  1.00 46.97  ?  40  ILE D CD1   1 
ATOM   5569 N  N     . ASN D 1 24  ? 42.847  37.472 65.656  1.00 93.26  ?  41  ASN D N     1 
ATOM   5570 C  CA    . ASN D 1 24  ? 43.197  38.391 66.735  1.00 96.08  ?  41  ASN D CA    1 
ATOM   5571 C  C     . ASN D 1 24  ? 43.378  37.620 68.039  1.00 95.81  ?  41  ASN D C     1 
ATOM   5572 O  O     . ASN D 1 24  ? 44.112  38.047 68.929  1.00 97.93  ?  41  ASN D O     1 
ATOM   5573 C  CB    . ASN D 1 24  ? 42.151  39.505 66.888  1.00 98.66  ?  41  ASN D CB    1 
ATOM   5574 C  CG    . ASN D 1 24  ? 40.823  39.003 67.413  1.00 98.52  ?  41  ASN D CG    1 
ATOM   5575 O  OD1   . ASN D 1 24  ? 40.506  37.823 67.308  1.00 96.41  ?  41  ASN D OD1   1 
ATOM   5576 N  ND2   . ASN D 1 24  ? 40.037  39.907 67.986  1.00 101.26 ?  41  ASN D ND2   1 
ATOM   5577 N  N     . THR D 1 25  ? 42.697  36.483 68.139  1.00 94.86  ?  42  THR D N     1 
ATOM   5578 C  CA    . THR D 1 25  ? 42.867  35.571 69.264  1.00 94.58  ?  42  THR D CA    1 
ATOM   5579 C  C     . THR D 1 25  ? 44.287  35.015 69.256  1.00 93.79  ?  42  THR D C     1 
ATOM   5580 O  O     . THR D 1 25  ? 44.944  34.935 70.294  1.00 95.04  ?  42  THR D O     1 
ATOM   5581 C  CB    . THR D 1 25  ? 41.857  34.406 69.212  1.00 93.17  ?  42  THR D CB    1 
ATOM   5582 O  OG1   . THR D 1 25  ? 40.521  34.923 69.255  1.00 94.20  ?  42  THR D OG1   1 
ATOM   5583 C  CG2   . THR D 1 25  ? 42.069  33.457 70.382  1.00 92.98  ?  42  THR D CG2   1 
ATOM   5584 N  N     . LEU D 1 26  ? 44.749  34.634 68.069  1.00 65.11  ?  43  LEU D N     1 
ATOM   5585 C  CA    . LEU D 1 26  ? 46.084  34.071 67.894  1.00 64.60  ?  43  LEU D CA    1 
ATOM   5586 C  C     . LEU D 1 26  ? 47.169  35.090 68.230  1.00 66.51  ?  43  LEU D C     1 
ATOM   5587 O  O     . LEU D 1 26  ? 48.197  34.747 68.814  1.00 67.06  ?  43  LEU D O     1 
ATOM   5588 C  CB    . LEU D 1 26  ? 46.261  33.567 66.459  1.00 62.67  ?  43  LEU D CB    1 
ATOM   5589 C  CG    . LEU D 1 26  ? 47.637  33.032 66.059  1.00 61.94  ?  43  LEU D CG    1 
ATOM   5590 C  CD1   . LEU D 1 26  ? 48.060  31.897 66.973  1.00 61.71  ?  43  LEU D CD1   1 
ATOM   5591 C  CD2   . LEU D 1 26  ? 47.632  32.578 64.606  1.00 60.18  ?  43  LEU D CD2   1 
ATOM   5592 N  N     . PHE D 1 27  ? 46.932  36.344 67.860  1.00 76.17  ?  44  PHE D N     1 
ATOM   5593 C  CA    . PHE D 1 27  ? 47.901  37.408 68.092  1.00 78.40  ?  44  PHE D CA    1 
ATOM   5594 C  C     . PHE D 1 27  ? 47.900  37.876 69.545  1.00 80.97  ?  44  PHE D C     1 
ATOM   5595 O  O     . PHE D 1 27  ? 48.935  38.281 70.074  1.00 83.08  ?  44  PHE D O     1 
ATOM   5596 C  CB    . PHE D 1 27  ? 47.623  38.588 67.159  1.00 79.46  ?  44  PHE D CB    1 
ATOM   5597 C  CG    . PHE D 1 27  ? 48.262  38.451 65.807  1.00 77.93  ?  44  PHE D CG    1 
ATOM   5598 C  CD1   . PHE D 1 27  ? 49.568  38.006 65.687  1.00 77.52  ?  44  PHE D CD1   1 
ATOM   5599 C  CD2   . PHE D 1 27  ? 47.555  38.757 64.657  1.00 77.30  ?  44  PHE D CD2   1 
ATOM   5600 C  CE1   . PHE D 1 27  ? 50.160  37.876 64.445  1.00 76.50  ?  44  PHE D CE1   1 
ATOM   5601 C  CE2   . PHE D 1 27  ? 48.140  38.628 63.412  1.00 76.25  ?  44  PHE D CE2   1 
ATOM   5602 C  CZ    . PHE D 1 27  ? 49.445  38.188 63.307  1.00 75.93  ?  44  PHE D CZ    1 
ATOM   5603 N  N     . LYS D 1 28  ? 46.737  37.817 70.186  1.00 87.05  ?  45  LYS D N     1 
ATOM   5604 C  CA    . LYS D 1 28  ? 46.614  38.239 71.578  1.00 89.36  ?  45  LYS D CA    1 
ATOM   5605 C  C     . LYS D 1 28  ? 47.053  37.133 72.532  1.00 88.54  ?  45  LYS D C     1 
ATOM   5606 O  O     . LYS D 1 28  ? 47.866  36.278 72.178  1.00 86.69  ?  45  LYS D O     1 
ATOM   5607 C  CB    . LYS D 1 28  ? 45.175  38.657 71.888  1.00 90.08  ?  45  LYS D CB    1 
ATOM   5608 N  N     . ARG D 1 43  ? 31.789  44.181 67.006  1.00 77.49  ?  60  ARG D N     1 
ATOM   5609 C  CA    . ARG D 1 43  ? 31.534  43.288 65.883  1.00 74.60  ?  60  ARG D CA    1 
ATOM   5610 C  C     . ARG D 1 43  ? 32.696  43.272 64.899  1.00 73.01  ?  60  ARG D C     1 
ATOM   5611 O  O     . ARG D 1 43  ? 33.087  44.313 64.370  1.00 74.73  ?  60  ARG D O     1 
ATOM   5612 C  CB    . ARG D 1 43  ? 30.250  43.699 65.154  1.00 75.87  ?  60  ARG D CB    1 
ATOM   5613 C  CG    . ARG D 1 43  ? 29.855  42.778 64.004  1.00 73.08  ?  60  ARG D CG    1 
ATOM   5614 C  CD    . ARG D 1 43  ? 29.240  43.563 62.850  1.00 74.58  ?  60  ARG D CD    1 
ATOM   5615 N  NE    . ARG D 1 43  ? 28.810  42.695 61.756  1.00 72.31  ?  60  ARG D NE    1 
ATOM   5616 C  CZ    . ARG D 1 43  ? 28.751  43.070 60.481  1.00 72.40  ?  60  ARG D CZ    1 
ATOM   5617 N  NH1   . ARG D 1 43  ? 29.100  44.301 60.131  1.00 74.68  1  60  ARG D NH1   1 
ATOM   5618 N  NH2   . ARG D 1 43  ? 28.345  42.213 59.553  1.00 70.09  ?  60  ARG D NH2   1 
ATOM   5619 N  N     . ILE D 1 44  ? 33.248  42.088 64.654  1.00 57.91  ?  61  ILE D N     1 
ATOM   5620 C  CA    . ILE D 1 44  ? 34.237  41.930 63.598  1.00 56.19  ?  61  ILE D CA    1 
ATOM   5621 C  C     . ILE D 1 44  ? 33.492  41.919 62.270  1.00 55.74  ?  61  ILE D C     1 
ATOM   5622 O  O     . ILE D 1 44  ? 32.636  41.064 62.046  1.00 54.21  ?  61  ILE D O     1 
ATOM   5623 C  CB    . ILE D 1 44  ? 35.067  40.644 63.760  1.00 52.96  ?  61  ILE D CB    1 
ATOM   5624 C  CG1   . ILE D 1 44  ? 35.828  40.666 65.087  1.00 53.58  ?  61  ILE D CG1   1 
ATOM   5625 C  CG2   . ILE D 1 44  ? 36.036  40.489 62.599  1.00 51.35  ?  61  ILE D CG2   1 
ATOM   5626 C  CD1   . ILE D 1 44  ? 36.737  39.472 65.292  1.00 50.77  ?  61  ILE D CD1   1 
ATOM   5627 N  N     . PRO D 1 45  ? 33.812  42.875 61.386  1.00 56.46  ?  62  PRO D N     1 
ATOM   5628 C  CA    . PRO D 1 45  ? 33.092  43.038 60.118  1.00 56.59  ?  62  PRO D CA    1 
ATOM   5629 C  C     . PRO D 1 45  ? 33.249  41.863 59.157  1.00 53.22  ?  62  PRO D C     1 
ATOM   5630 O  O     . PRO D 1 45  ? 34.110  41.002 59.341  1.00 50.84  ?  62  PRO D O     1 
ATOM   5631 C  CB    . PRO D 1 45  ? 33.719  44.303 59.523  1.00 59.08  ?  62  PRO D CB    1 
ATOM   5632 C  CG    . PRO D 1 45  ? 35.073  44.378 60.139  1.00 58.84  ?  62  PRO D CG    1 
ATOM   5633 C  CD    . PRO D 1 45  ? 34.906  43.850 61.531  1.00 58.33  ?  62  PRO D CD    1 
ATOM   5634 N  N     . LYS D 1 46  ? 32.400  41.845 58.135  1.00 58.94  ?  63  LYS D N     1 
ATOM   5635 C  CA    . LYS D 1 46  ? 32.434  40.820 57.101  1.00 56.15  ?  63  LYS D CA    1 
ATOM   5636 C  C     . LYS D 1 46  ? 33.684  40.975 56.239  1.00 55.39  ?  63  LYS D C     1 
ATOM   5637 O  O     . LYS D 1 46  ? 33.944  42.050 55.701  1.00 57.54  ?  63  LYS D O     1 
ATOM   5638 C  CB    . LYS D 1 46  ? 31.170  40.907 56.242  1.00 56.89  ?  63  LYS D CB    1 
ATOM   5639 C  CG    . LYS D 1 46  ? 31.076  39.892 55.118  1.00 54.34  ?  63  LYS D CG    1 
ATOM   5640 C  CD    . LYS D 1 46  ? 29.656  39.807 54.562  1.00 55.10  ?  63  LYS D CD    1 
ATOM   5641 C  CE    . LYS D 1 46  ? 29.097  41.181 54.197  1.00 58.51  ?  63  LYS D CE    1 
ATOM   5642 N  NZ    . LYS D 1 46  ? 28.606  41.956 55.375  1.00 61.07  1  63  LYS D NZ    1 
ATOM   5643 N  N     . THR D 1 47  ? 34.455  39.900 56.111  1.00 55.30  ?  64  THR D N     1 
ATOM   5644 C  CA    . THR D 1 47  ? 35.699  39.936 55.349  1.00 54.38  ?  64  THR D CA    1 
ATOM   5645 C  C     . THR D 1 47  ? 35.435  39.933 53.847  1.00 53.89  ?  64  THR D C     1 
ATOM   5646 O  O     . THR D 1 47  ? 35.012  38.922 53.286  1.00 51.72  ?  64  THR D O     1 
ATOM   5647 C  CB    . THR D 1 47  ? 36.610  38.747 55.699  1.00 51.75  ?  64  THR D CB    1 
ATOM   5648 O  OG1   . THR D 1 47  ? 36.702  38.616 57.123  1.00 52.32  ?  64  THR D OG1   1 
ATOM   5649 C  CG2   . THR D 1 47  ? 38.001  38.951 55.119  1.00 51.25  ?  64  THR D CG2   1 
ATOM   5650 N  N     . ILE D 1 48  ? 35.685  41.067 53.200  1.00 60.10  ?  65  ILE D N     1 
ATOM   5651 C  CA    . ILE D 1 48  ? 35.386  41.213 51.780  1.00 60.31  ?  65  ILE D CA    1 
ATOM   5652 C  C     . ILE D 1 48  ? 36.632  41.088 50.905  1.00 59.35  ?  65  ILE D C     1 
ATOM   5653 O  O     . ILE D 1 48  ? 36.539  40.733 49.730  1.00 58.45  ?  65  ILE D O     1 
ATOM   5654 C  CB    . ILE D 1 48  ? 34.712  42.568 51.488  1.00 63.85  ?  65  ILE D CB    1 
ATOM   5655 N  N     . GLU D 1 49  ? 37.795  41.379 51.478  1.00 52.30  ?  66  GLU D N     1 
ATOM   5656 C  CA    . GLU D 1 49  ? 39.047  41.293 50.734  1.00 51.67  ?  66  GLU D CA    1 
ATOM   5657 C  C     . GLU D 1 49  ? 40.112  40.507 51.493  1.00 49.70  ?  66  GLU D C     1 
ATOM   5658 O  O     . GLU D 1 49  ? 40.087  40.434 52.721  1.00 49.72  ?  66  GLU D O     1 
ATOM   5659 C  CB    . GLU D 1 49  ? 39.568  42.695 50.408  1.00 54.96  ?  66  GLU D CB    1 
ATOM   5660 N  N     . ILE D 1 50  ? 41.049  39.922 50.752  1.00 41.23  ?  67  ILE D N     1 
ATOM   5661 C  CA    . ILE D 1 50  ? 42.179  39.228 51.356  1.00 39.66  ?  67  ILE D CA    1 
ATOM   5662 C  C     . ILE D 1 50  ? 43.115  40.235 52.019  1.00 41.96  ?  67  ILE D C     1 
ATOM   5663 O  O     . ILE D 1 50  ? 43.636  41.136 51.361  1.00 44.02  ?  67  ILE D O     1 
ATOM   5664 C  CB    . ILE D 1 50  ? 42.957  38.399 50.318  1.00 37.81  ?  67  ILE D CB    1 
ATOM   5665 C  CG1   . ILE D 1 50  ? 42.068  37.293 49.747  1.00 35.53  ?  67  ILE D CG1   1 
ATOM   5666 C  CG2   . ILE D 1 50  ? 44.201  37.799 50.940  1.00 36.67  ?  67  ILE D CG2   1 
ATOM   5667 C  CD1   . ILE D 1 50  ? 42.708  36.516 48.616  1.00 34.02  ?  67  ILE D CD1   1 
ATOM   5668 N  N     . LYS D 1 51  ? 43.324  40.079 53.322  1.00 57.29  ?  68  LYS D N     1 
ATOM   5669 C  CA    . LYS D 1 51  ? 44.130  41.028 54.082  1.00 58.65  ?  68  LYS D CA    1 
ATOM   5670 C  C     . LYS D 1 51  ? 45.240  40.341 54.868  1.00 57.26  ?  68  LYS D C     1 
ATOM   5671 O  O     . LYS D 1 51  ? 44.994  39.384 55.602  1.00 55.55  ?  68  LYS D O     1 
ATOM   5672 C  CB    . LYS D 1 51  ? 43.243  41.835 55.033  1.00 59.75  ?  68  LYS D CB    1 
ATOM   5673 N  N     . SER D 1 52  ? 46.463  40.837 54.705  1.00 53.24  ?  69  SER D N     1 
ATOM   5674 C  CA    . SER D 1 52  ? 47.604  40.335 55.459  1.00 52.60  ?  69  SER D CA    1 
ATOM   5675 C  C     . SER D 1 52  ? 47.810  41.135 56.741  1.00 54.15  ?  69  SER D C     1 
ATOM   5676 O  O     . SER D 1 52  ? 47.760  42.365 56.732  1.00 57.07  ?  69  SER D O     1 
ATOM   5677 C  CB    . SER D 1 52  ? 48.872  40.381 54.603  1.00 53.58  ?  69  SER D CB    1 
ATOM   5678 O  OG    . SER D 1 52  ? 48.781  39.490 53.505  1.00 52.31  ?  69  SER D OG    1 
ATOM   5679 N  N     . ILE D 1 53  ? 48.039  40.429 57.843  1.00 62.34  ?  70  ILE D N     1 
ATOM   5680 C  CA    . ILE D 1 53  ? 48.290  41.068 59.130  1.00 63.95  ?  70  ILE D CA    1 
ATOM   5681 C  C     . ILE D 1 53  ? 49.614  40.575 59.704  1.00 63.99  ?  70  ILE D C     1 
ATOM   5682 O  O     . ILE D 1 53  ? 49.803  39.374 59.895  1.00 61.84  ?  70  ILE D O     1 
ATOM   5683 C  CB    . ILE D 1 53  ? 47.156  40.790 60.135  1.00 63.58  ?  70  ILE D CB    1 
ATOM   5684 C  CG1   . ILE D 1 53  ? 45.809  41.234 59.560  1.00 63.78  ?  70  ILE D CG1   1 
ATOM   5685 C  CG2   . ILE D 1 53  ? 47.432  41.492 61.455  1.00 66.01  ?  70  ILE D CG2   1 
ATOM   5686 C  CD1   . ILE D 1 53  ? 44.617  40.776 60.374  1.00 63.29  ?  70  ILE D CD1   1 
ATOM   5687 N  N     . THR D 1 54  ? 50.523  41.503 59.987  1.00 45.74  ?  71  THR D N     1 
ATOM   5688 C  CA    . THR D 1 54  ? 51.875  41.148 60.407  1.00 46.35  ?  71  THR D CA    1 
ATOM   5689 C  C     . THR D 1 54  ? 52.210  41.700 61.791  1.00 48.50  ?  71  THR D C     1 
ATOM   5690 O  O     . THR D 1 54  ? 51.955  42.868 62.082  1.00 51.18  ?  71  THR D O     1 
ATOM   5691 C  CB    . THR D 1 54  ? 52.921  41.663 59.395  1.00 48.46  ?  71  THR D CB    1 
ATOM   5692 O  OG1   . THR D 1 54  ? 52.654  41.106 58.102  1.00 46.83  ?  71  THR D OG1   1 
ATOM   5693 C  CG2   . THR D 1 54  ? 54.330  41.280 59.827  1.00 49.45  ?  71  THR D CG2   1 
ATOM   5694 N  N     . HIS D 1 55  ? 52.784  40.850 62.639  1.00 60.63  ?  72  HIS D N     1 
ATOM   5695 C  CA    . HIS D 1 55  ? 53.213  41.263 63.971  1.00 63.11  ?  72  HIS D CA    1 
ATOM   5696 C  C     . HIS D 1 55  ? 54.492  40.543 64.393  1.00 63.48  ?  72  HIS D C     1 
ATOM   5697 O  O     . HIS D 1 55  ? 54.638  39.340 64.177  1.00 61.07  ?  72  HIS D O     1 
ATOM   5698 C  CB    . HIS D 1 55  ? 52.106  41.000 64.992  1.00 62.55  ?  72  HIS D CB    1 
ATOM   5699 C  CG    . HIS D 1 55  ? 50.941  41.934 64.878  1.00 63.66  ?  72  HIS D CG    1 
ATOM   5700 N  ND1   . HIS D 1 55  ? 51.061  43.215 64.382  1.00 66.35  ?  72  HIS D ND1   1 
ATOM   5701 C  CD2   . HIS D 1 55  ? 49.635  41.771 65.191  1.00 62.81  ?  72  HIS D CD2   1 
ATOM   5702 C  CE1   . HIS D 1 55  ? 49.876  43.801 64.397  1.00 66.89  ?  72  HIS D CE1   1 
ATOM   5703 N  NE2   . HIS D 1 55  ? 48.994  42.948 64.883  1.00 64.89  ?  72  HIS D NE2   1 
ATOM   5704 N  N     . ASP D 1 56  ? 55.415  41.286 64.997  1.00 69.44  ?  73  ASP D N     1 
ATOM   5705 C  CA    . ASP D 1 56  ? 56.660  40.713 65.501  1.00 70.50  ?  73  ASP D CA    1 
ATOM   5706 C  C     . ASP D 1 56  ? 56.491  40.146 66.908  1.00 71.13  ?  73  ASP D C     1 
ATOM   5707 O  O     . ASP D 1 56  ? 56.069  40.851 67.825  1.00 73.17  ?  73  ASP D O     1 
ATOM   5708 C  CB    . ASP D 1 56  ? 57.779  41.757 65.488  1.00 74.71  ?  73  ASP D CB    1 
ATOM   5709 C  CG    . ASP D 1 56  ? 58.199  42.144 64.084  1.00 75.39  ?  73  ASP D CG    1 
ATOM   5710 O  OD1   . ASP D 1 56  ? 57.809  41.439 63.130  1.00 72.85  ?  73  ASP D OD1   1 
ATOM   5711 O  OD2   . ASP D 1 56  ? 58.924  43.150 63.934  1.00 79.14  -1 73  ASP D OD2   1 
ATOM   5712 N  N     . ILE D 1 57  ? 56.825  38.869 67.069  1.00 67.68  ?  74  ILE D N     1 
ATOM   5713 C  CA    . ILE D 1 57  ? 56.692  38.193 68.355  1.00 69.50  ?  74  ILE D CA    1 
ATOM   5714 C  C     . ILE D 1 57  ? 58.032  37.605 68.794  1.00 71.51  ?  74  ILE D C     1 
ATOM   5715 O  O     . ILE D 1 57  ? 58.762  37.033 67.985  1.00 68.91  ?  74  ILE D O     1 
ATOM   5716 C  CB    . ILE D 1 57  ? 55.636  37.068 68.296  1.00 67.97  ?  74  ILE D CB    1 
ATOM   5717 C  CG1   . ILE D 1 57  ? 54.316  37.599 67.735  1.00 65.09  ?  74  ILE D CG1   1 
ATOM   5718 C  CG2   . ILE D 1 57  ? 55.419  36.457 69.672  1.00 70.97  ?  74  ILE D CG2   1 
ATOM   5719 C  CD1   . ILE D 1 57  ? 53.671  38.663 68.595  1.00 67.46  ?  74  ILE D CD1   1 
ATOM   5720 N  N     . GLU D 1 58  ? 58.349  37.751 70.077  1.00 115.08 ?  75  GLU D N     1 
ATOM   5721 C  CA    . GLU D 1 58  ? 59.601  37.237 70.620  1.00 117.14 ?  75  GLU D CA    1 
ATOM   5722 C  C     . GLU D 1 58  ? 59.368  35.990 71.465  1.00 119.17 ?  75  GLU D C     1 
ATOM   5723 O  O     . GLU D 1 58  ? 58.518  35.981 72.356  1.00 121.13 ?  75  GLU D O     1 
ATOM   5724 C  CB    . GLU D 1 58  ? 60.303  38.311 71.453  1.00 120.36 ?  75  GLU D CB    1 
ATOM   5725 N  N     . VAL D 1 62  ? 64.108  34.117 70.189  1.00 92.02  ?  79  VAL D N     1 
ATOM   5726 C  CA    . VAL D 1 62  ? 64.249  34.425 68.770  1.00 90.66  ?  79  VAL D CA    1 
ATOM   5727 C  C     . VAL D 1 62  ? 63.043  35.204 68.252  1.00 88.58  ?  79  VAL D C     1 
ATOM   5728 O  O     . VAL D 1 62  ? 61.909  34.956 68.661  1.00 86.86  ?  79  VAL D O     1 
ATOM   5729 C  CB    . VAL D 1 62  ? 64.426  33.147 67.930  1.00 88.67  ?  79  VAL D CB    1 
ATOM   5730 N  N     . ARG D 1 63  ? 63.299  36.143 67.347  1.00 137.59 ?  80  ARG D N     1 
ATOM   5731 C  CA    . ARG D 1 63  ? 62.242  36.963 66.766  1.00 135.98 ?  80  ARG D CA    1 
ATOM   5732 C  C     . ARG D 1 63  ? 61.522  36.253 65.629  1.00 132.38 ?  80  ARG D C     1 
ATOM   5733 O  O     . ARG D 1 63  ? 62.158  35.667 64.752  1.00 132.04 ?  80  ARG D O     1 
ATOM   5734 C  CB    . ARG D 1 63  ? 62.798  38.284 66.235  1.00 138.87 ?  80  ARG D CB    1 
ATOM   5735 C  CG    . ARG D 1 63  ? 61.718  39.171 65.629  1.00 137.90 ?  80  ARG D CG    1 
ATOM   5736 C  CD    . ARG D 1 63  ? 62.257  40.503 65.150  1.00 141.61 ?  80  ARG D CD    1 
ATOM   5737 N  NE    . ARG D 1 63  ? 62.951  40.363 63.873  1.00 142.11 ?  80  ARG D NE    1 
ATOM   5738 C  CZ    . ARG D 1 63  ? 62.360  40.484 62.688  1.00 140.44 ?  80  ARG D CZ    1 
ATOM   5739 N  NH1   . ARG D 1 63  ? 61.061  40.745 62.616  1.00 138.11 1  80  ARG D NH1   1 
ATOM   5740 N  NH2   . ARG D 1 63  ? 63.064  40.340 61.573  1.00 141.53 ?  80  ARG D NH2   1 
ATOM   5741 N  N     . MET D 1 64  ? 60.195  36.300 65.645  1.00 71.93  ?  81  MET D N     1 
ATOM   5742 C  CA    . MET D 1 64  ? 59.420  35.718 64.561  1.00 68.61  ?  81  MET D CA    1 
ATOM   5743 C  C     . MET D 1 64  ? 58.506  36.781 63.965  1.00 68.11  ?  81  MET D C     1 
ATOM   5744 O  O     . MET D 1 64  ? 57.858  37.536 64.690  1.00 69.15  ?  81  MET D O     1 
ATOM   5745 C  CB    . MET D 1 64  ? 58.603  34.522 65.052  1.00 66.77  ?  81  MET D CB    1 
ATOM   5746 N  N     . LYS D 1 65  ? 58.458  36.833 62.638  1.00 47.35  ?  82  LYS D N     1 
ATOM   5747 C  CA    . LYS D 1 65  ? 57.602  37.781 61.937  1.00 47.46  ?  82  LYS D CA    1 
ATOM   5748 C  C     . LYS D 1 65  ? 56.315  37.097 61.502  1.00 44.05  ?  82  LYS D C     1 
ATOM   5749 O  O     . LYS D 1 65  ? 56.154  36.744 60.334  1.00 42.94  ?  82  LYS D O     1 
ATOM   5750 C  CB    . LYS D 1 65  ? 58.327  38.375 60.728  1.00 49.60  ?  82  LYS D CB    1 
ATOM   5751 N  N     . LEU D 1 66  ? 55.398  36.913 62.446  1.00 50.75  ?  83  LEU D N     1 
ATOM   5752 C  CA    . LEU D 1 66  ? 54.169  36.185 62.170  1.00 47.89  ?  83  LEU D CA    1 
ATOM   5753 C  C     . LEU D 1 66  ? 53.226  37.000 61.293  1.00 47.86  ?  83  LEU D C     1 
ATOM   5754 O  O     . LEU D 1 66  ? 52.852  38.122 61.636  1.00 49.60  ?  83  LEU D O     1 
ATOM   5755 C  CB    . LEU D 1 66  ? 53.473  35.801 63.478  1.00 47.28  ?  83  LEU D CB    1 
ATOM   5756 C  CG    . LEU D 1 66  ? 52.215  34.942 63.348  1.00 44.80  ?  83  LEU D CG    1 
ATOM   5757 C  CD1   . LEU D 1 66  ? 52.501  33.701 62.516  1.00 42.88  ?  83  LEU D CD1   1 
ATOM   5758 C  CD2   . LEU D 1 66  ? 51.682  34.562 64.720  1.00 44.96  ?  83  LEU D CD2   1 
ATOM   5759 N  N     . THR D 1 67  ? 52.847  36.422 60.159  1.00 57.73  ?  84  THR D N     1 
ATOM   5760 C  CA    . THR D 1 67  ? 51.872  37.039 59.270  1.00 57.45  ?  84  THR D CA    1 
ATOM   5761 C  C     . THR D 1 67  ? 50.657  36.138 59.093  1.00 55.09  ?  84  THR D C     1 
ATOM   5762 O  O     . THR D 1 67  ? 50.785  34.985 58.683  1.00 53.66  ?  84  THR D O     1 
ATOM   5763 C  CB    . THR D 1 67  ? 52.476  37.348 57.887  1.00 58.38  ?  84  THR D CB    1 
ATOM   5764 O  OG1   . THR D 1 67  ? 53.564  38.269 58.031  1.00 61.10  ?  84  THR D OG1   1 
ATOM   5765 C  CG2   . THR D 1 67  ? 51.424  37.954 56.970  1.00 58.12  ?  84  THR D CG2   1 
ATOM   5766 N  N     . VAL D 1 68  ? 49.479  36.667 59.404  1.00 47.03  ?  85  VAL D N     1 
ATOM   5767 C  CA    . VAL D 1 68  ? 48.247  35.918 59.206  1.00 45.34  ?  85  VAL D CA    1 
ATOM   5768 C  C     . VAL D 1 68  ? 47.431  36.538 58.079  1.00 45.33  ?  85  VAL D C     1 
ATOM   5769 O  O     . VAL D 1 68  ? 47.099  37.723 58.115  1.00 46.81  ?  85  VAL D O     1 
ATOM   5770 C  CB    . VAL D 1 68  ? 47.396  35.863 60.486  1.00 45.55  ?  85  VAL D CB    1 
ATOM   5771 C  CG1   . VAL D 1 68  ? 46.162  35.011 60.254  1.00 44.28  ?  85  VAL D CG1   1 
ATOM   5772 C  CG2   . VAL D 1 68  ? 48.211  35.306 61.640  1.00 45.90  ?  85  VAL D CG2   1 
ATOM   5773 N  N     . ILE D 1 69  ? 47.113  35.726 57.077  1.00 33.49  ?  86  ILE D N     1 
ATOM   5774 C  CA    . ILE D 1 69  ? 46.387  36.201 55.909  1.00 34.38  ?  86  ILE D CA    1 
ATOM   5775 C  C     . ILE D 1 69  ? 44.916  35.809 55.993  1.00 33.68  ?  86  ILE D C     1 
ATOM   5776 O  O     . ILE D 1 69  ? 44.571  34.633 55.882  1.00 32.37  ?  86  ILE D O     1 
ATOM   5777 C  CB    . ILE D 1 69  ? 46.993  35.643 54.608  1.00 34.33  ?  86  ILE D CB    1 
ATOM   5778 C  CG1   . ILE D 1 69  ? 48.495  35.935 54.549  1.00 35.24  ?  86  ILE D CG1   1 
ATOM   5779 C  CG2   . ILE D 1 69  ? 46.285  36.221 53.398  1.00 35.60  ?  86  ILE D CG2   1 
ATOM   5780 C  CD1   . ILE D 1 69  ? 49.334  34.746 54.136  1.00 34.20  ?  86  ILE D CD1   1 
ATOM   5781 N  N     . ASP D 1 70  ? 44.053  36.801 56.190  1.00 39.51  ?  87  ASP D N     1 
ATOM   5782 C  CA    . ASP D 1 70  ? 42.619  36.554 56.293  1.00 39.31  ?  87  ASP D CA    1 
ATOM   5783 C  C     . ASP D 1 70  ? 41.977  36.493 54.913  1.00 39.90  ?  87  ASP D C     1 
ATOM   5784 O  O     . ASP D 1 70  ? 42.329  37.263 54.020  1.00 41.25  ?  87  ASP D O     1 
ATOM   5785 C  CB    . ASP D 1 70  ? 41.946  37.636 57.138  1.00 40.67  ?  87  ASP D CB    1 
ATOM   5786 C  CG    . ASP D 1 70  ? 40.591  37.203 57.667  1.00 40.39  ?  87  ASP D CG    1 
ATOM   5787 O  OD1   . ASP D 1 70  ? 40.299  35.989 57.625  1.00 39.01  ?  87  ASP D OD1   1 
ATOM   5788 O  OD2   . ASP D 1 70  ? 39.822  38.074 58.127  1.00 42.13  -1 87  ASP D OD2   1 
ATOM   5789 N  N     . THR D 1 71  ? 41.032  35.575 54.746  1.00 37.88  ?  88  THR D N     1 
ATOM   5790 C  CA    . THR D 1 71  ? 40.361  35.389 53.465  1.00 38.58  ?  88  THR D CA    1 
ATOM   5791 C  C     . THR D 1 71  ? 38.843  35.464 53.607  1.00 39.32  ?  88  THR D C     1 
ATOM   5792 O  O     . THR D 1 71  ? 38.292  35.067 54.634  1.00 38.76  ?  88  THR D O     1 
ATOM   5793 C  CB    . THR D 1 71  ? 40.736  34.036 52.828  1.00 37.50  ?  88  THR D CB    1 
ATOM   5794 O  OG1   . THR D 1 71  ? 40.348  32.970 53.704  1.00 36.34  ?  88  THR D OG1   1 
ATOM   5795 C  CG2   . THR D 1 71  ? 42.233  33.959 52.574  1.00 37.05  ?  88  THR D CG2   1 
ATOM   5796 N  N     . PRO D 1 72  ? 38.164  35.979 52.571  1.00 47.46  ?  89  PRO D N     1 
ATOM   5797 C  CA    . PRO D 1 72  ? 36.697  35.995 52.538  1.00 48.65  ?  89  PRO D CA    1 
ATOM   5798 C  C     . PRO D 1 72  ? 36.120  34.585 52.459  1.00 47.87  ?  89  PRO D C     1 
ATOM   5799 O  O     . PRO D 1 72  ? 36.647  33.747 51.727  1.00 47.09  ?  89  PRO D O     1 
ATOM   5800 C  CB    . PRO D 1 72  ? 36.380  36.792 51.268  1.00 50.42  ?  89  PRO D CB    1 
ATOM   5801 C  CG    . PRO D 1 72  ? 37.597  36.658 50.421  1.00 49.99  ?  89  PRO D CG    1 
ATOM   5802 C  CD    . PRO D 1 72  ? 38.748  36.615 51.377  1.00 48.46  ?  89  PRO D CD    1 
ATOM   5803 N  N     . GLY D 1 73  ? 35.057  34.331 53.213  1.00 48.00  ?  90  GLY D N     1 
ATOM   5804 C  CA    . GLY D 1 73  ? 34.430  33.023 53.236  1.00 47.70  ?  90  GLY D CA    1 
ATOM   5805 C  C     . GLY D 1 73  ? 33.839  32.616 51.901  1.00 48.90  ?  90  GLY D C     1 
ATOM   5806 O  O     . GLY D 1 73  ? 33.422  33.462 51.110  1.00 50.38  ?  90  GLY D O     1 
ATOM   5807 N  N     . PHE D 1 74  ? 33.807  31.311 51.649  1.00 66.76  ?  91  PHE D N     1 
ATOM   5808 C  CA    . PHE D 1 74  ? 33.208  30.784 50.429  1.00 67.84  ?  91  PHE D CA    1 
ATOM   5809 C  C     . PHE D 1 74  ? 32.004  29.908 50.757  1.00 69.47  ?  91  PHE D C     1 
ATOM   5810 O  O     . PHE D 1 74  ? 31.612  29.790 51.917  1.00 70.22  ?  91  PHE D O     1 
ATOM   5811 C  CB    . PHE D 1 74  ? 34.238  29.990 49.622  1.00 67.01  ?  91  PHE D CB    1 
ATOM   5812 C  CG    . PHE D 1 74  ? 35.016  28.996 50.436  1.00 65.40  ?  91  PHE D CG    1 
ATOM   5813 C  CD1   . PHE D 1 74  ? 34.509  27.731 50.685  1.00 65.83  ?  91  PHE D CD1   1 
ATOM   5814 C  CD2   . PHE D 1 74  ? 36.259  29.325 50.949  1.00 63.81  ?  91  PHE D CD2   1 
ATOM   5815 C  CE1   . PHE D 1 74  ? 35.226  26.816 51.433  1.00 64.79  ?  91  PHE D CE1   1 
ATOM   5816 C  CE2   . PHE D 1 74  ? 36.978  28.416 51.697  1.00 62.56  ?  91  PHE D CE2   1 
ATOM   5817 C  CZ    . PHE D 1 74  ? 36.462  27.159 51.939  1.00 63.03  ?  91  PHE D CZ    1 
ATOM   5818 N  N     . GLY D 1 75  ? 31.419  29.298 49.732  1.00 70.77  ?  92  GLY D N     1 
ATOM   5819 C  CA    . GLY D 1 75  ? 30.267  28.436 49.923  1.00 73.40  ?  92  GLY D CA    1 
ATOM   5820 C  C     . GLY D 1 75  ? 28.987  29.220 50.129  1.00 76.11  ?  92  GLY D C     1 
ATOM   5821 O  O     . GLY D 1 75  ? 27.957  28.660 50.506  1.00 78.91  ?  92  GLY D O     1 
ATOM   5822 N  N     . ASP D 1 76  ? 29.055  30.523 49.881  1.00 75.61  ?  93  ASP D N     1 
ATOM   5823 C  CA    . ASP D 1 76  ? 27.916  31.408 50.094  1.00 78.01  ?  93  ASP D CA    1 
ATOM   5824 C  C     . ASP D 1 76  ? 27.103  31.632 48.823  1.00 79.96  ?  93  ASP D C     1 
ATOM   5825 O  O     . ASP D 1 76  ? 25.956  32.071 48.886  1.00 82.39  ?  93  ASP D O     1 
ATOM   5826 C  CB    . ASP D 1 76  ? 28.387  32.753 50.651  1.00 77.19  ?  93  ASP D CB    1 
ATOM   5827 C  CG    . ASP D 1 76  ? 29.518  33.358 49.844  1.00 75.36  ?  93  ASP D CG    1 
ATOM   5828 O  OD1   . ASP D 1 76  ? 29.801  32.858 48.735  1.00 75.34  ?  93  ASP D OD1   1 
ATOM   5829 O  OD2   . ASP D 1 76  ? 30.119  34.345 50.317  1.00 74.65  -1 93  ASP D OD2   1 
ATOM   5830 N  N     . HIS D 1 77  ? 27.705  31.350 47.672  1.00 59.76  ?  94  HIS D N     1 
ATOM   5831 C  CA    . HIS D 1 77  ? 27.047  31.594 46.392  1.00 62.42  ?  94  HIS D CA    1 
ATOM   5832 C  C     . HIS D 1 77  ? 26.439  30.326 45.803  1.00 64.39  ?  94  HIS D C     1 
ATOM   5833 O  O     . HIS D 1 77  ? 26.484  29.258 46.414  1.00 63.78  ?  94  HIS D O     1 
ATOM   5834 C  CB    . HIS D 1 77  ? 28.034  32.202 45.395  1.00 61.65  ?  94  HIS D CB    1 
ATOM   5835 C  CG    . HIS D 1 77  ? 28.484  33.584 45.755  1.00 60.78  ?  94  HIS D CG    1 
ATOM   5836 N  ND1   . HIS D 1 77  ? 29.534  33.826 46.613  1.00 58.02  ?  94  HIS D ND1   1 
ATOM   5837 C  CD2   . HIS D 1 77  ? 28.023  34.799 45.372  1.00 62.68  ?  94  HIS D CD2   1 
ATOM   5838 C  CE1   . HIS D 1 77  ? 29.703  35.130 46.743  1.00 58.33  ?  94  HIS D CE1   1 
ATOM   5839 N  NE2   . HIS D 1 77  ? 28.798  35.743 46.001  1.00 61.13  ?  94  HIS D NE2   1 
ATOM   5840 N  N     . ILE D 1 78  ? 25.869  30.456 44.609  1.00 71.13  ?  95  ILE D N     1 
ATOM   5841 C  CA    . ILE D 1 78  ? 25.301  29.319 43.896  1.00 73.61  ?  95  ILE D CA    1 
ATOM   5842 C  C     . ILE D 1 78  ? 26.406  28.593 43.126  1.00 72.45  ?  95  ILE D C     1 
ATOM   5843 O  O     . ILE D 1 78  ? 26.335  27.382 42.915  1.00 73.46  ?  95  ILE D O     1 
ATOM   5844 C  CB    . ILE D 1 78  ? 24.155  29.757 42.946  1.00 77.62  ?  95  ILE D CB    1 
ATOM   5845 C  CG1   . ILE D 1 78  ? 23.336  28.547 42.488  1.00 80.81  ?  95  ILE D CG1   1 
ATOM   5846 C  CG2   . ILE D 1 78  ? 24.687  30.558 41.761  1.00 78.06  ?  95  ILE D CG2   1 
ATOM   5847 C  CD1   . ILE D 1 78  ? 22.065  28.916 41.754  1.00 85.18  ?  95  ILE D CD1   1 
ATOM   5848 N  N     . ASN D 1 79  ? 27.423  29.343 42.711  1.00 106.91 ?  96  ASN D N     1 
ATOM   5849 C  CA    . ASN D 1 79  ? 28.613  28.772 42.089  1.00 105.87 ?  96  ASN D CA    1 
ATOM   5850 C  C     . ASN D 1 79  ? 29.853  29.211 42.860  1.00 102.24 ?  96  ASN D C     1 
ATOM   5851 O  O     . ASN D 1 79  ? 30.056  30.404 43.088  1.00 101.48 ?  96  ASN D O     1 
ATOM   5852 C  CB    . ASN D 1 79  ? 28.715  29.189 40.622  1.00 108.28 ?  96  ASN D CB    1 
ATOM   5853 N  N     . ASN D 1 80  ? 30.682  28.252 43.261  1.00 94.96  ?  97  ASN D N     1 
ATOM   5854 C  CA    . ASN D 1 80  ? 31.765  28.547 44.194  1.00 91.59  ?  97  ASN D CA    1 
ATOM   5855 C  C     . ASN D 1 80  ? 33.172  28.364 43.631  1.00 90.48  ?  97  ASN D C     1 
ATOM   5856 O  O     . ASN D 1 80  ? 34.153  28.439 44.372  1.00 87.78  ?  97  ASN D O     1 
ATOM   5857 C  CB    . ASN D 1 80  ? 31.604  27.689 45.448  1.00 90.24  ?  97  ASN D CB    1 
ATOM   5858 C  CG    . ASN D 1 80  ? 30.298  27.956 46.166  1.00 91.40  ?  97  ASN D CG    1 
ATOM   5859 O  OD1   . ASN D 1 80  ? 30.140  28.980 46.830  1.00 90.39  ?  97  ASN D OD1   1 
ATOM   5860 N  ND2   . ASN D 1 80  ? 29.351  27.034 46.036  1.00 93.60  ?  97  ASN D ND2   1 
ATOM   5861 N  N     . GLU D 1 81  ? 33.272  28.120 42.329  1.00 63.11  ?  98  GLU D N     1 
ATOM   5862 C  CA    . GLU D 1 81  ? 34.572  28.082 41.669  1.00 62.35  ?  98  GLU D CA    1 
ATOM   5863 C  C     . GLU D 1 81  ? 35.185  29.478 41.671  1.00 61.65  ?  98  GLU D C     1 
ATOM   5864 O  O     . GLU D 1 81  ? 36.401  29.637 41.773  1.00 60.77  ?  98  GLU D O     1 
ATOM   5865 C  CB    . GLU D 1 81  ? 34.446  27.553 40.239  1.00 63.27  ?  98  GLU D CB    1 
ATOM   5866 N  N     . ASN D 1 82  ? 34.323  30.485 41.561  1.00 90.08  ?  99  ASN D N     1 
ATOM   5867 C  CA    . ASN D 1 82  ? 34.745  31.882 41.584  1.00 89.66  ?  99  ASN D CA    1 
ATOM   5868 C  C     . ASN D 1 82  ? 35.163  32.344 42.977  1.00 88.77  ?  99  ASN D C     1 
ATOM   5869 O  O     . ASN D 1 82  ? 35.597  33.482 43.160  1.00 87.93  ?  99  ASN D O     1 
ATOM   5870 C  CB    . ASN D 1 82  ? 33.625  32.781 41.057  1.00 90.67  ?  99  ASN D CB    1 
ATOM   5871 N  N     . CYS D 1 83  ? 35.020  31.459 43.958  1.00 146.16 ?  100 CYS D N     1 
ATOM   5872 C  CA    . CYS D 1 83  ? 35.451  31.743 45.319  1.00 145.43 ?  100 CYS D CA    1 
ATOM   5873 C  C     . CYS D 1 83  ? 36.746  30.999 45.625  1.00 144.25 ?  100 CYS D C     1 
ATOM   5874 O  O     . CYS D 1 83  ? 37.562  31.450 46.429  1.00 143.46 ?  100 CYS D O     1 
ATOM   5875 C  CB    . CYS D 1 83  ? 34.365  31.353 46.321  1.00 146.27 ?  100 CYS D CB    1 
ATOM   5876 S  SG    . CYS D 1 83  ? 32.858  32.347 46.221  1.00 147.50 ?  100 CYS D SG    1 
ATOM   5877 N  N     . TRP D 1 84  ? 36.924  29.853 44.976  1.00 81.81  ?  101 TRP D N     1 
ATOM   5878 C  CA    . TRP D 1 84  ? 38.118  29.038 45.160  1.00 81.18  ?  101 TRP D CA    1 
ATOM   5879 C  C     . TRP D 1 84  ? 39.287  29.556 44.329  1.00 80.84  ?  101 TRP D C     1 
ATOM   5880 O  O     . TRP D 1 84  ? 40.424  29.129 44.514  1.00 80.57  ?  101 TRP D O     1 
ATOM   5881 C  CB    . TRP D 1 84  ? 37.830  27.579 44.797  1.00 81.69  ?  101 TRP D CB    1 
ATOM   5882 N  N     . GLN D 1 85  ? 39.001  30.481 43.420  1.00 57.15  ?  102 GLN D N     1 
ATOM   5883 C  CA    . GLN D 1 85  ? 40.017  31.012 42.514  1.00 57.10  ?  102 GLN D CA    1 
ATOM   5884 C  C     . GLN D 1 85  ? 40.887  32.136 43.107  1.00 56.41  ?  102 GLN D C     1 
ATOM   5885 O  O     . GLN D 1 85  ? 42.106  32.111 42.931  1.00 56.19  ?  102 GLN D O     1 
ATOM   5886 C  CB    . GLN D 1 85  ? 39.359  31.502 41.219  1.00 57.95  ?  102 GLN D CB    1 
ATOM   5887 N  N     . PRO D 1 86  ? 40.281  33.128 43.795  1.00 62.02  ?  103 PRO D N     1 
ATOM   5888 C  CA    . PRO D 1 86  ? 41.135  34.204 44.320  1.00 61.52  ?  103 PRO D CA    1 
ATOM   5889 C  C     . PRO D 1 86  ? 42.160  33.740 45.356  1.00 60.83  ?  103 PRO D C     1 
ATOM   5890 O  O     . PRO D 1 86  ? 43.217  34.357 45.482  1.00 60.55  ?  103 PRO D O     1 
ATOM   5891 C  CB    . PRO D 1 86  ? 40.130  35.166 44.964  1.00 61.62  ?  103 PRO D CB    1 
ATOM   5892 C  CG    . PRO D 1 86  ? 38.850  34.898 44.271  1.00 62.43  ?  103 PRO D CG    1 
ATOM   5893 C  CD    . PRO D 1 86  ? 38.852  33.427 44.010  1.00 62.50  ?  103 PRO D CD    1 
ATOM   5894 N  N     . ILE D 1 87  ? 41.852  32.670 46.082  1.00 52.66  ?  104 ILE D N     1 
ATOM   5895 C  CA    . ILE D 1 87  ? 42.763  32.163 47.102  1.00 52.13  ?  104 ILE D CA    1 
ATOM   5896 C  C     . ILE D 1 87  ? 43.919  31.399 46.457  1.00 52.25  ?  104 ILE D C     1 
ATOM   5897 O  O     . ILE D 1 87  ? 45.069  31.528 46.879  1.00 52.01  ?  104 ILE D O     1 
ATOM   5898 C  CB    . ILE D 1 87  ? 42.028  31.259 48.113  1.00 52.08  ?  104 ILE D CB    1 
ATOM   5899 C  CG1   . ILE D 1 87  ? 41.001  32.079 48.899  1.00 52.14  ?  104 ILE D CG1   1 
ATOM   5900 C  CG2   . ILE D 1 87  ? 43.013  30.589 49.058  1.00 51.67  ?  104 ILE D CG2   1 
ATOM   5901 C  CD1   . ILE D 1 87  ? 40.341  31.321 50.029  1.00 52.23  ?  104 ILE D CD1   1 
ATOM   5902 N  N     . MET D 1 88  ? 43.612  30.616 45.428  1.00 69.79  ?  105 MET D N     1 
ATOM   5903 C  CA    . MET D 1 88  ? 44.641  29.912 44.668  1.00 70.24  ?  105 MET D CA    1 
ATOM   5904 C  C     . MET D 1 88  ? 45.556  30.905 43.960  1.00 70.39  ?  105 MET D C     1 
ATOM   5905 O  O     . MET D 1 88  ? 46.746  30.646 43.773  1.00 70.65  ?  105 MET D O     1 
ATOM   5906 C  CB    . MET D 1 88  ? 44.010  28.957 43.652  1.00 71.12  ?  105 MET D CB    1 
ATOM   5907 C  CG    . MET D 1 88  ? 43.254  27.794 44.272  1.00 71.42  ?  105 MET D CG    1 
ATOM   5908 S  SD    . MET D 1 88  ? 44.307  26.713 45.256  1.00 71.64  ?  105 MET D SD    1 
ATOM   5909 C  CE    . MET D 1 88  ? 45.528  26.236 44.035  1.00 72.49  ?  105 MET D CE    1 
ATOM   5910 N  N     . LYS D 1 89  ? 44.990  32.042 43.568  1.00 70.91  ?  106 LYS D N     1 
ATOM   5911 C  CA    . LYS D 1 89  ? 45.748  33.083 42.887  1.00 71.11  ?  106 LYS D CA    1 
ATOM   5912 C  C     . LYS D 1 89  ? 46.725  33.750 43.847  1.00 70.48  ?  106 LYS D C     1 
ATOM   5913 O  O     . LYS D 1 89  ? 47.864  34.041 43.482  1.00 70.90  ?  106 LYS D O     1 
ATOM   5914 C  CB    . LYS D 1 89  ? 44.807  34.126 42.281  1.00 71.32  ?  106 LYS D CB    1 
ATOM   5915 N  N     . PHE D 1 90  ? 46.272  33.993 45.073  1.00 43.24  ?  107 PHE D N     1 
ATOM   5916 C  CA    . PHE D 1 90  ? 47.116  34.594 46.099  1.00 42.87  ?  107 PHE D CA    1 
ATOM   5917 C  C     . PHE D 1 90  ? 48.297  33.679 46.403  1.00 42.99  ?  107 PHE D C     1 
ATOM   5918 O  O     . PHE D 1 90  ? 49.426  34.141 46.554  1.00 43.21  ?  107 PHE D O     1 
ATOM   5919 C  CB    . PHE D 1 90  ? 46.317  34.874 47.374  1.00 42.32  ?  107 PHE D CB    1 
ATOM   5920 C  CG    . PHE D 1 90  ? 47.105  35.582 48.444  1.00 42.03  ?  107 PHE D CG    1 
ATOM   5921 C  CD1   . PHE D 1 90  ? 47.831  34.865 49.381  1.00 41.82  ?  107 PHE D CD1   1 
ATOM   5922 C  CD2   . PHE D 1 90  ? 47.115  36.965 48.515  1.00 42.09  ?  107 PHE D CD2   1 
ATOM   5923 C  CE1   . PHE D 1 90  ? 48.552  35.512 50.366  1.00 41.67  ?  107 PHE D CE1   1 
ATOM   5924 C  CE2   . PHE D 1 90  ? 47.836  37.618 49.498  1.00 41.95  ?  107 PHE D CE2   1 
ATOM   5925 C  CZ    . PHE D 1 90  ? 48.556  36.890 50.425  1.00 41.74  ?  107 PHE D CZ    1 
ATOM   5926 N  N     . ILE D 1 91  ? 48.021  32.381 46.491  1.00 52.34  ?  108 ILE D N     1 
ATOM   5927 C  CA    . ILE D 1 91  ? 49.049  31.382 46.765  1.00 52.65  ?  108 ILE D CA    1 
ATOM   5928 C  C     . ILE D 1 91  ? 50.147  31.410 45.706  1.00 53.58  ?  108 ILE D C     1 
ATOM   5929 O  O     . ILE D 1 91  ? 51.333  31.487 46.028  1.00 53.97  ?  108 ILE D O     1 
ATOM   5930 C  CB    . ILE D 1 91  ? 48.451  29.960 46.821  1.00 52.73  ?  108 ILE D CB    1 
ATOM   5931 C  CG1   . ILE D 1 91  ? 47.543  29.801 48.042  1.00 52.12  ?  108 ILE D CG1   1 
ATOM   5932 C  CG2   . ILE D 1 91  ? 49.554  28.911 46.827  1.00 53.33  ?  108 ILE D CG2   1 
ATOM   5933 C  CD1   . ILE D 1 91  ? 48.266  29.916 49.357  1.00 51.82  ?  108 ILE D CD1   1 
ATOM   5934 N  N     . ASN D 1 92  ? 49.741  31.354 44.442  1.00 63.18  ?  109 ASN D N     1 
ATOM   5935 C  CA    . ASN D 1 92  ? 50.687  31.344 43.332  1.00 64.28  ?  109 ASN D CA    1 
ATOM   5936 C  C     . ASN D 1 92  ? 51.426  32.669 43.171  1.00 64.52  ?  109 ASN D C     1 
ATOM   5937 O  O     . ASN D 1 92  ? 52.562  32.695 42.698  1.00 65.53  ?  109 ASN D O     1 
ATOM   5938 C  CB    . ASN D 1 92  ? 49.968  30.990 42.030  1.00 64.84  ?  109 ASN D CB    1 
ATOM   5939 C  CG    . ASN D 1 92  ? 49.502  29.549 41.997  1.00 64.95  ?  109 ASN D CG    1 
ATOM   5940 O  OD1   . ASN D 1 92  ? 50.236  28.637 42.378  1.00 65.28  ?  109 ASN D OD1   1 
ATOM   5941 N  ND2   . ASN D 1 92  ? 48.273  29.335 41.540  1.00 64.86  ?  109 ASN D ND2   1 
ATOM   5942 N  N     . ASP D 1 93  ? 50.781  33.764 43.560  1.00 60.43  ?  110 ASP D N     1 
ATOM   5943 C  CA    . ASP D 1 93  ? 51.408  35.080 43.482  1.00 60.83  ?  110 ASP D CA    1 
ATOM   5944 C  C     . ASP D 1 93  ? 52.573  35.207 44.459  1.00 61.28  ?  110 ASP D C     1 
ATOM   5945 O  O     . ASP D 1 93  ? 53.573  35.859 44.160  1.00 62.71  ?  110 ASP D O     1 
ATOM   5946 C  CB    . ASP D 1 93  ? 50.382  36.185 43.745  1.00 60.13  ?  110 ASP D CB    1 
ATOM   5947 C  CG    . ASP D 1 93  ? 49.490  36.451 42.547  1.00 60.53  ?  110 ASP D CG    1 
ATOM   5948 O  OD1   . ASP D 1 93  ? 49.841  36.006 41.433  1.00 61.35  ?  110 ASP D OD1   1 
ATOM   5949 O  OD2   . ASP D 1 93  ? 48.441  37.107 42.718  1.00 60.08  -1 110 ASP D OD2   1 
ATOM   5950 N  N     . GLN D 1 94  ? 52.441  34.586 45.628  1.00 54.99  ?  111 GLN D N     1 
ATOM   5951 C  CA    . GLN D 1 94  ? 53.526  34.575 46.602  1.00 55.55  ?  111 GLN D CA    1 
ATOM   5952 C  C     . GLN D 1 94  ? 54.670  33.680 46.136  1.00 56.89  ?  111 GLN D C     1 
ATOM   5953 O  O     . GLN D 1 94  ? 55.842  34.005 46.326  1.00 58.09  ?  111 GLN D O     1 
ATOM   5954 C  CB    . GLN D 1 94  ? 53.021  34.116 47.971  1.00 54.41  ?  111 GLN D CB    1 
ATOM   5955 C  CG    . GLN D 1 94  ? 51.801  34.872 48.476  1.00 53.22  ?  111 GLN D CG    1 
ATOM   5956 C  CD    . GLN D 1 94  ? 51.904  36.370 48.261  1.00 53.30  ?  111 GLN D CD    1 
ATOM   5957 O  OE1   . GLN D 1 94  ? 52.907  36.993 48.609  1.00 53.81  ?  111 GLN D OE1   1 
ATOM   5958 N  NE2   . GLN D 1 94  ? 50.862  36.956 47.684  1.00 53.10  ?  111 GLN D NE2   1 
ATOM   5959 N  N     . TYR D 1 95  ? 54.322  32.550 45.526  1.00 63.02  ?  112 TYR D N     1 
ATOM   5960 C  CA    . TYR D 1 95  ? 55.318  31.662 44.935  1.00 64.28  ?  112 TYR D CA    1 
ATOM   5961 C  C     . TYR D 1 95  ? 55.994  32.320 43.736  1.00 65.70  ?  112 TYR D C     1 
ATOM   5962 O  O     . TYR D 1 95  ? 57.140  32.011 43.411  1.00 67.18  ?  112 TYR D O     1 
ATOM   5963 C  CB    . TYR D 1 95  ? 54.679  30.336 44.513  1.00 63.93  ?  112 TYR D CB    1 
ATOM   5964 C  CG    . TYR D 1 95  ? 54.384  29.393 45.660  1.00 63.24  ?  112 TYR D CG    1 
ATOM   5965 C  CD1   . TYR D 1 95  ? 55.030  29.530 46.882  1.00 63.25  ?  112 TYR D CD1   1 
ATOM   5966 C  CD2   . TYR D 1 95  ? 53.466  28.359 45.518  1.00 62.73  ?  112 TYR D CD2   1 
ATOM   5967 C  CE1   . TYR D 1 95  ? 54.767  28.669 47.931  1.00 62.72  ?  112 TYR D CE1   1 
ATOM   5968 C  CE2   . TYR D 1 95  ? 53.197  27.493 46.561  1.00 62.26  ?  112 TYR D CE2   1 
ATOM   5969 C  CZ    . TYR D 1 95  ? 53.850  27.652 47.765  1.00 62.20  ?  112 TYR D CZ    1 
ATOM   5970 O  OH    . TYR D 1 95  ? 53.586  26.794 48.807  1.00 61.93  ?  112 TYR D OH    1 
ATOM   5971 N  N     . GLU D 1 96  ? 55.275  33.230 43.086  1.00 62.71  ?  113 GLU D N     1 
ATOM   5972 C  CA    . GLU D 1 96  ? 55.802  33.950 41.933  1.00 64.07  ?  113 GLU D CA    1 
ATOM   5973 C  C     . GLU D 1 96  ? 56.710  35.094 42.368  1.00 65.11  ?  113 GLU D C     1 
ATOM   5974 O  O     . GLU D 1 96  ? 57.753  35.336 41.760  1.00 66.72  ?  113 GLU D O     1 
ATOM   5975 C  CB    . GLU D 1 96  ? 54.661  34.484 41.064  1.00 63.56  ?  113 GLU D CB    1 
ATOM   5976 C  CG    . GLU D 1 96  ? 55.118  35.268 39.840  1.00 65.16  ?  113 GLU D CG    1 
ATOM   5977 C  CD    . GLU D 1 96  ? 55.693  34.383 38.746  1.00 66.63  ?  113 GLU D CD    1 
ATOM   5978 O  OE1   . GLU D 1 96  ? 55.681  33.143 38.903  1.00 66.63  ?  113 GLU D OE1   1 
ATOM   5979 O  OE2   . GLU D 1 96  ? 56.162  34.931 37.726  1.00 68.07  -1 113 GLU D OE2   1 
ATOM   5980 N  N     . LYS D 1 97  ? 56.303  35.797 43.421  1.00 58.34  ?  114 LYS D N     1 
ATOM   5981 C  CA    . LYS D 1 97  ? 57.078  36.913 43.951  1.00 58.88  ?  114 LYS D CA    1 
ATOM   5982 C  C     . LYS D 1 97  ? 58.432  36.442 44.470  1.00 60.00  ?  114 LYS D C     1 
ATOM   5983 O  O     . LYS D 1 97  ? 59.417  37.174 44.408  1.00 61.35  ?  114 LYS D O     1 
ATOM   5984 C  CB    . LYS D 1 97  ? 56.305  37.623 45.065  1.00 57.48  ?  114 LYS D CB    1 
ATOM   5985 N  N     . TYR D 1 98  ? 58.472  35.217 44.983  1.00 50.58  ?  115 TYR D N     1 
ATOM   5986 C  CA    . TYR D 1 98  ? 59.712  34.642 45.489  1.00 51.70  ?  115 TYR D CA    1 
ATOM   5987 C  C     . TYR D 1 98  ? 60.580  34.147 44.338  1.00 53.61  ?  115 TYR D C     1 
ATOM   5988 O  O     . TYR D 1 98  ? 61.808  34.174 44.417  1.00 55.26  ?  115 TYR D O     1 
ATOM   5989 C  CB    . TYR D 1 98  ? 59.415  33.498 46.461  1.00 50.73  ?  115 TYR D CB    1 
ATOM   5990 C  CG    . TYR D 1 98  ? 60.546  33.183 47.415  1.00 51.55  ?  115 TYR D CG    1 
ATOM   5991 C  CD1   . TYR D 1 98  ? 61.616  32.393 47.016  1.00 53.24  ?  115 TYR D CD1   1 
ATOM   5992 C  CD2   . TYR D 1 98  ? 60.542  33.673 48.715  1.00 50.78  ?  115 TYR D CD2   1 
ATOM   5993 C  CE1   . TYR D 1 98  ? 62.652  32.100 47.882  1.00 54.17  ?  115 TYR D CE1   1 
ATOM   5994 C  CE2   . TYR D 1 98  ? 61.574  33.385 49.589  1.00 51.63  ?  115 TYR D CE2   1 
ATOM   5995 C  CZ    . TYR D 1 98  ? 62.626  32.598 49.167  1.00 53.34  ?  115 TYR D CZ    1 
ATOM   5996 O  OH    . TYR D 1 98  ? 63.657  32.307 50.031  1.00 54.36  ?  115 TYR D OH    1 
ATOM   5997 N  N     . LEU D 1 99  ? 59.933  33.696 43.267  1.00 53.53  ?  116 LEU D N     1 
ATOM   5998 C  CA    . LEU D 1 99  ? 60.641  33.168 42.106  1.00 55.39  ?  116 LEU D CA    1 
ATOM   5999 C  C     . LEU D 1 99  ? 61.196  34.271 41.208  1.00 56.92  ?  116 LEU D C     1 
ATOM   6000 O  O     . LEU D 1 99  ? 62.237  34.099 40.573  1.00 59.04  ?  116 LEU D O     1 
ATOM   6001 C  CB    . LEU D 1 99  ? 59.718  32.253 41.299  1.00 54.87  ?  116 LEU D CB    1 
ATOM   6002 C  CG    . LEU D 1 99  ? 60.360  31.564 40.094  1.00 56.83  ?  116 LEU D CG    1 
ATOM   6003 C  CD1   . LEU D 1 99  ? 61.428  30.597 40.556  1.00 58.08  ?  116 LEU D CD1   1 
ATOM   6004 C  CD2   . LEU D 1 99  ? 59.309  30.846 39.266  1.00 56.28  ?  116 LEU D CD2   1 
ATOM   6005 N  N     . GLN D 1 100 ? 60.507  35.406 41.167  1.00 76.23  ?  117 GLN D N     1 
ATOM   6006 C  CA    . GLN D 1 100 ? 60.948  36.531 40.350  1.00 77.91  ?  117 GLN D CA    1 
ATOM   6007 C  C     . GLN D 1 100 ? 62.117  37.240 41.021  1.00 79.24  ?  117 GLN D C     1 
ATOM   6008 O  O     . GLN D 1 100 ? 62.823  38.031 40.395  1.00 81.28  ?  117 GLN D O     1 
ATOM   6009 C  CB    . GLN D 1 100 ? 59.797  37.509 40.110  1.00 76.71  ?  117 GLN D CB    1 
ATOM   6010 N  N     . GLU D 1 101 ? 62.313  36.946 42.301  1.00 74.52  ?  118 GLU D N     1 
ATOM   6011 C  CA    . GLU D 1 101 ? 63.421  37.499 43.065  1.00 75.84  ?  118 GLU D CA    1 
ATOM   6012 C  C     . GLU D 1 101 ? 64.595  36.527 43.079  1.00 77.63  ?  118 GLU D C     1 
ATOM   6013 O  O     . GLU D 1 101 ? 65.734  36.918 43.327  1.00 79.72  ?  118 GLU D O     1 
ATOM   6014 C  CB    . GLU D 1 101 ? 62.978  37.814 44.494  1.00 74.02  ?  118 GLU D CB    1 
ATOM   6015 C  CG    . GLU D 1 101 ? 62.045  39.008 44.611  1.00 72.88  ?  118 GLU D CG    1 
ATOM   6016 C  CD    . GLU D 1 101 ? 62.117  39.675 45.971  1.00 72.07  ?  118 GLU D CD    1 
ATOM   6017 O  OE1   . GLU D 1 101 ? 61.049  40.015 46.524  1.00 70.24  ?  118 GLU D OE1   1 
ATOM   6018 O  OE2   . GLU D 1 101 ? 63.241  39.864 46.485  1.00 73.43  -1 118 GLU D OE2   1 
ATOM   6019 N  N     . GLU D 1 102 ? 64.312  35.260 42.799  1.00 101.45 ?  119 GLU D N     1 
ATOM   6020 C  CA    . GLU D 1 102 ? 65.348  34.235 42.761  1.00 103.00 ?  119 GLU D CA    1 
ATOM   6021 C  C     . GLU D 1 102 ? 66.114  34.249 41.443  1.00 105.43 ?  119 GLU D C     1 
ATOM   6022 O  O     . GLU D 1 102 ? 67.346  34.232 41.432  1.00 107.98 ?  119 GLU D O     1 
ATOM   6023 C  CB    . GLU D 1 102 ? 64.735  32.852 42.990  1.00 101.80 ?  119 GLU D CB    1 
ATOM   6024 C  CG    . GLU D 1 102 ? 64.764  32.393 44.438  1.00 100.86 ?  119 GLU D CG    1 
ATOM   6025 C  CD    . GLU D 1 102 ? 64.385  30.933 44.596  1.00 100.41 ?  119 GLU D CD    1 
ATOM   6026 O  OE1   . GLU D 1 102 ? 63.940  30.322 43.602  1.00 100.44 ?  119 GLU D OE1   1 
ATOM   6027 O  OE2   . GLU D 1 102 ? 64.532  30.398 45.715  1.00 100.18 -1 119 GLU D OE2   1 
ATOM   6028 N  N     . VAL D 1 103 ? 65.379  34.283 40.336  1.00 56.41  ?  120 VAL D N     1 
ATOM   6029 C  CA    . VAL D 1 103 ? 65.984  34.252 39.008  1.00 57.71  ?  120 VAL D CA    1 
ATOM   6030 C  C     . VAL D 1 103 ? 66.841  35.489 38.747  1.00 60.29  ?  120 VAL D C     1 
ATOM   6031 O  O     . VAL D 1 103 ? 67.781  35.446 37.952  1.00 62.04  ?  120 VAL D O     1 
ATOM   6032 C  CB    . VAL D 1 103 ? 64.907  34.122 37.942  1.00 56.33  ?  120 VAL D CB    1 
ATOM   6033 N  N     . ASN D 1 104 ? 66.512  36.586 39.421  1.00 81.44  ?  121 ASN D N     1 
ATOM   6034 C  CA    . ASN D 1 104 ? 67.263  37.828 39.279  1.00 83.98  ?  121 ASN D CA    1 
ATOM   6035 C  C     . ASN D 1 104 ? 68.643  37.706 39.915  1.00 86.00  ?  121 ASN D C     1 
ATOM   6036 O  O     . ASN D 1 104 ? 68.765  37.390 41.098  1.00 85.57  ?  121 ASN D O     1 
ATOM   6037 C  CB    . ASN D 1 104 ? 66.496  38.986 39.895  1.00 83.83  ?  121 ASN D CB    1 
ATOM   6038 N  N     . ILE D 1 105 ? 69.679  37.959 39.121  1.00 126.92 ?  122 ILE D N     1 
ATOM   6039 C  CA    . ILE D 1 105 ? 71.053  37.860 39.599  1.00 129.18 ?  122 ILE D CA    1 
ATOM   6040 C  C     . ILE D 1 105 ? 71.524  39.173 40.212  1.00 131.38 ?  122 ILE D C     1 
ATOM   6041 O  O     . ILE D 1 105 ? 72.369  39.181 41.107  1.00 132.81 ?  122 ILE D O     1 
ATOM   6042 C  CB    . ILE D 1 105 ? 71.978  37.444 38.468  1.00 130.81 ?  122 ILE D CB    1 
ATOM   6043 N  N     . ASN D 1 106 ? 70.973  40.283 39.727  1.00 96.83  ?  123 ASN D N     1 
ATOM   6044 C  CA    . ASN D 1 106 ? 71.336  41.595 40.252  1.00 98.99  ?  123 ASN D CA    1 
ATOM   6045 C  C     . ASN D 1 106 ? 70.917  41.776 41.706  1.00 98.13  ?  123 ASN D C     1 
ATOM   6046 O  O     . ASN D 1 106 ? 71.412  42.672 42.389  1.00 100.12 ?  123 ASN D O     1 
ATOM   6047 C  CB    . ASN D 1 106 ? 70.732  42.706 39.392  1.00 98.88  ?  123 ASN D CB    1 
ATOM   6048 C  CG    . ASN D 1 106 ? 71.324  42.749 37.994  1.00 100.41 ?  123 ASN D CG    1 
ATOM   6049 O  OD1   . ASN D 1 106 ? 72.462  43.181 37.803  1.00 103.24 ?  123 ASN D OD1   1 
ATOM   6050 N  ND2   . ASN D 1 106 ? 70.554  42.300 37.009  1.00 98.67  ?  123 ASN D ND2   1 
ATOM   6051 N  N     . ARG D 1 107 ? 70.000  40.935 42.178  1.00 111.72 ?  124 ARG D N     1 
ATOM   6052 C  CA    . ARG D 1 107 ? 69.531  41.052 43.554  1.00 110.96 ?  124 ARG D CA    1 
ATOM   6053 C  C     . ARG D 1 107 ? 70.654  40.672 44.515  1.00 112.44 ?  124 ARG D C     1 
ATOM   6054 O  O     . ARG D 1 107 ? 71.092  39.519 44.552  1.00 111.70 ?  124 ARG D O     1 
ATOM   6055 C  CB    . ARG D 1 107 ? 68.312  40.165 43.793  1.00 107.92 ?  124 ARG D CB    1 
ATOM   6056 C  CG    . ARG D 1 107 ? 67.992  39.952 45.265  1.00 107.41 ?  124 ARG D CG    1 
ATOM   6057 C  CD    . ARG D 1 107 ? 66.951  38.871 45.457  1.00 104.51 ?  124 ARG D CD    1 
ATOM   6058 N  NE    . ARG D 1 107 ? 67.398  37.593 44.907  1.00 103.92 ?  124 ARG D NE    1 
ATOM   6059 C  CZ    . ARG D 1 107 ? 68.413  36.884 45.390  1.00 104.87 ?  124 ARG D CZ    1 
ATOM   6060 N  NH1   . ARG D 1 107 ? 69.096  37.328 46.436  1.00 106.78 1  124 ARG D NH1   1 
ATOM   6061 N  NH2   . ARG D 1 107 ? 68.750  35.731 44.825  1.00 103.87 ?  124 ARG D NH2   1 
ATOM   6062 N  N     . LYS D 1 108 ? 71.114  41.646 45.292  1.00 138.56 ?  125 LYS D N     1 
ATOM   6063 C  CA    . LYS D 1 108 ? 72.178  41.416 46.260  1.00 140.21 ?  125 LYS D CA    1 
ATOM   6064 C  C     . LYS D 1 108 ? 71.638  41.115 47.658  1.00 138.91 ?  125 LYS D C     1 
ATOM   6065 O  O     . LYS D 1 108 ? 72.395  40.725 48.553  1.00 140.31 ?  125 LYS D O     1 
ATOM   6066 C  CB    . LYS D 1 108 ? 73.104  42.631 46.317  1.00 143.42 ?  125 LYS D CB    1 
ATOM   6067 N  N     . LYS D 1 109 ? 70.328  41.263 47.833  1.00 76.17  ?  126 LYS D N     1 
ATOM   6068 C  CA    . LYS D 1 109 ? 69.722  41.189 49.159  1.00 75.23  ?  126 LYS D CA    1 
ATOM   6069 C  C     . LYS D 1 109 ? 68.959  39.891 49.393  1.00 72.26  ?  126 LYS D C     1 
ATOM   6070 O  O     . LYS D 1 109 ? 68.605  39.179 48.452  1.00 70.60  ?  126 LYS D O     1 
ATOM   6071 C  CB    . LYS D 1 109 ? 68.787  42.374 49.369  1.00 75.20  ?  126 LYS D CB    1 
ATOM   6072 N  N     . ARG D 1 110 ? 68.723  39.579 50.663  1.00 67.83  ?  127 ARG D N     1 
ATOM   6073 C  CA    . ARG D 1 110 ? 67.959  38.391 51.023  1.00 65.16  ?  127 ARG D CA    1 
ATOM   6074 C  C     . ARG D 1 110 ? 66.503  38.562 50.612  1.00 62.92  ?  127 ARG D C     1 
ATOM   6075 O  O     . ARG D 1 110 ? 65.973  39.673 50.605  1.00 63.43  ?  127 ARG D O     1 
ATOM   6076 C  CB    . ARG D 1 110 ? 68.060  38.117 52.527  1.00 65.30  ?  127 ARG D CB    1 
ATOM   6077 N  N     . ILE D 1 111 ? 65.861  37.452 50.271  1.00 63.50  ?  128 ILE D N     1 
ATOM   6078 C  CA    . ILE D 1 111 ? 64.480  37.473 49.804  1.00 61.39  ?  128 ILE D CA    1 
ATOM   6079 C  C     . ILE D 1 111 ? 63.468  37.423 50.945  1.00 60.09  ?  128 ILE D C     1 
ATOM   6080 O  O     . ILE D 1 111 ? 63.542  36.547 51.807  1.00 59.37  ?  128 ILE D O     1 
ATOM   6081 C  CB    . ILE D 1 111 ? 64.211  36.302 48.843  1.00 59.57  ?  128 ILE D CB    1 
ATOM   6082 C  CG1   . ILE D 1 111 ? 65.321  36.221 47.793  1.00 60.93  ?  128 ILE D CG1   1 
ATOM   6083 C  CG2   . ILE D 1 111 ? 62.850  36.452 48.185  1.00 57.76  ?  128 ILE D CG2   1 
ATOM   6084 C  CD1   . ILE D 1 111 ? 65.174  35.065 46.837  1.00 59.36  ?  128 ILE D CD1   1 
ATOM   6085 N  N     . PRO D 1 112 ? 62.516  38.369 50.953  1.00 61.39  ?  129 PRO D N     1 
ATOM   6086 C  CA    . PRO D 1 112 ? 61.448  38.340 51.956  1.00 60.11  ?  129 PRO D CA    1 
ATOM   6087 C  C     . PRO D 1 112 ? 60.436  37.243 51.638  1.00 57.57  ?  129 PRO D C     1 
ATOM   6088 O  O     . PRO D 1 112 ? 59.910  37.189 50.526  1.00 56.70  ?  129 PRO D O     1 
ATOM   6089 C  CB    . PRO D 1 112 ? 60.817  39.729 51.845  1.00 60.88  ?  129 PRO D CB    1 
ATOM   6090 C  CG    . PRO D 1 112 ? 61.125  40.182 50.461  1.00 61.57  ?  129 PRO D CG    1 
ATOM   6091 C  CD    . PRO D 1 112 ? 62.432  39.549 50.074  1.00 62.49  ?  129 PRO D CD    1 
ATOM   6092 N  N     . ASP D 1 113 ? 60.170  36.377 52.610  1.00 61.57  ?  130 ASP D N     1 
ATOM   6093 C  CA    . ASP D 1 113 ? 59.313  35.221 52.381  1.00 59.34  ?  130 ASP D CA    1 
ATOM   6094 C  C     . ASP D 1 113 ? 57.850  35.559 52.636  1.00 58.07  ?  130 ASP D C     1 
ATOM   6095 O  O     . ASP D 1 113 ? 57.417  35.675 53.782  1.00 57.89  ?  130 ASP D O     1 
ATOM   6096 C  CB    . ASP D 1 113 ? 59.745  34.051 53.267  1.00 58.84  ?  130 ASP D CB    1 
ATOM   6097 C  CG    . ASP D 1 113 ? 59.279  32.709 52.732  1.00 56.98  ?  130 ASP D CG    1 
ATOM   6098 O  OD1   . ASP D 1 113 ? 58.433  32.692 51.813  1.00 55.91  ?  130 ASP D OD1   1 
ATOM   6099 O  OD2   . ASP D 1 113 ? 59.759  31.670 53.232  1.00 56.67  -1 130 ASP D OD2   1 
ATOM   6100 N  N     . THR D 1 114 ? 57.093  35.715 51.556  1.00 50.47  ?  131 THR D N     1 
ATOM   6101 C  CA    . THR D 1 114 ? 55.676  36.028 51.657  1.00 49.36  ?  131 THR D CA    1 
ATOM   6102 C  C     . THR D 1 114 ? 54.844  34.812 51.272  1.00 47.39  ?  131 THR D C     1 
ATOM   6103 O  O     . THR D 1 114 ? 53.615  34.877 51.220  1.00 46.35  ?  131 THR D O     1 
ATOM   6104 C  CB    . THR D 1 114 ? 55.288  37.216 50.759  1.00 50.06  ?  131 THR D CB    1 
ATOM   6105 O  OG1   . THR D 1 114 ? 55.549  36.888 49.389  1.00 49.84  ?  131 THR D OG1   1 
ATOM   6106 C  CG2   . THR D 1 114 ? 56.080  38.457 51.143  1.00 52.18  ?  131 THR D CG2   1 
ATOM   6107 N  N     . ARG D 1 115 ? 55.526  33.704 50.998  1.00 44.25  ?  132 ARG D N     1 
ATOM   6108 C  CA    . ARG D 1 115 ? 54.856  32.460 50.644  1.00 42.55  ?  132 ARG D CA    1 
ATOM   6109 C  C     . ARG D 1 115 ? 54.062  31.927 51.827  1.00 41.53  ?  132 ARG D C     1 
ATOM   6110 O  O     . ARG D 1 115 ? 54.507  32.009 52.971  1.00 42.09  ?  132 ARG D O     1 
ATOM   6111 C  CB    . ARG D 1 115 ? 55.869  31.410 50.181  1.00 42.57  ?  132 ARG D CB    1 
ATOM   6112 C  CG    . ARG D 1 115 ? 56.717  31.829 48.993  1.00 43.59  ?  132 ARG D CG    1 
ATOM   6113 C  CD    . ARG D 1 115 ? 57.823  30.818 48.736  1.00 43.82  ?  132 ARG D CD    1 
ATOM   6114 N  NE    . ARG D 1 115 ? 58.663  30.619 49.914  1.00 44.62  ?  132 ARG D NE    1 
ATOM   6115 C  CZ    . ARG D 1 115 ? 59.754  29.861 49.935  1.00 45.17  ?  132 ARG D CZ    1 
ATOM   6116 N  NH1   . ARG D 1 115 ? 60.143  29.224 48.839  1.00 44.97  1  132 ARG D NH1   1 
ATOM   6117 N  NH2   . ARG D 1 115 ? 60.456  29.737 51.053  1.00 45.99  ?  132 ARG D NH2   1 
ATOM   6118 N  N     . VAL D 1 116 ? 52.885  31.380 51.549  1.00 40.13  ?  133 VAL D N     1 
ATOM   6119 C  CA    . VAL D 1 116 ? 52.082  30.752 52.588  1.00 39.13  ?  133 VAL D CA    1 
ATOM   6120 C  C     . VAL D 1 116 ? 52.685  29.406 52.966  1.00 38.66  ?  133 VAL D C     1 
ATOM   6121 O  O     . VAL D 1 116 ? 52.668  28.464 52.176  1.00 37.96  ?  133 VAL D O     1 
ATOM   6122 C  CB    . VAL D 1 116 ? 50.622  30.566 52.144  1.00 37.94  ?  133 VAL D CB    1 
ATOM   6123 C  CG1   . VAL D 1 116 ? 49.818  29.882 53.237  1.00 37.00  ?  133 VAL D CG1   1 
ATOM   6124 C  CG2   . VAL D 1 116 ? 50.010  31.911 51.784  1.00 38.48  ?  133 VAL D CG2   1 
ATOM   6125 N  N     . HIS D 1 117 ? 53.239  29.328 54.171  1.00 39.13  ?  134 HIS D N     1 
ATOM   6126 C  CA    . HIS D 1 117 ? 53.848  28.095 54.652  1.00 38.82  ?  134 HIS D CA    1 
ATOM   6127 C  C     . HIS D 1 117 ? 52.776  27.132 55.144  1.00 37.42  ?  134 HIS D C     1 
ATOM   6128 O  O     . HIS D 1 117 ? 52.787  25.945 54.813  1.00 36.69  ?  134 HIS D O     1 
ATOM   6129 C  CB    . HIS D 1 117 ? 54.847  28.386 55.774  1.00 39.96  ?  134 HIS D CB    1 
ATOM   6130 C  CG    . HIS D 1 117 ? 55.901  29.384 55.407  1.00 41.58  ?  134 HIS D CG    1 
ATOM   6131 N  ND1   . HIS D 1 117 ? 56.262  30.422 56.237  1.00 42.82  ?  134 HIS D ND1   1 
ATOM   6132 C  CD2   . HIS D 1 117 ? 56.671  29.504 54.299  1.00 42.26  ?  134 HIS D CD2   1 
ATOM   6133 C  CE1   . HIS D 1 117 ? 57.209  31.139 55.659  1.00 44.26  ?  134 HIS D CE1   1 
ATOM   6134 N  NE2   . HIS D 1 117 ? 57.475  30.603 54.481  1.00 43.93  ?  134 HIS D NE2   1 
ATOM   6135 N  N     . CYS D 1 118 ? 51.846  27.659 55.933  1.00 71.35  ?  135 CYS D N     1 
ATOM   6136 C  CA    . CYS D 1 118 ? 50.807  26.851 56.556  1.00 69.41  ?  135 CYS D CA    1 
ATOM   6137 C  C     . CYS D 1 118 ? 49.435  27.464 56.306  1.00 68.62  ?  135 CYS D C     1 
ATOM   6138 O  O     . CYS D 1 118 ? 49.288  28.686 56.276  1.00 69.65  ?  135 CYS D O     1 
ATOM   6139 C  CB    . CYS D 1 118 ? 51.062  26.715 58.058  1.00 69.62  ?  135 CYS D CB    1 
ATOM   6140 S  SG    . CYS D 1 118 ? 49.827  25.739 58.941  1.00 68.07  ?  135 CYS D SG    1 
ATOM   6141 N  N     . CYS D 1 119 ? 48.431  26.613 56.123  1.00 50.68  ?  136 CYS D N     1 
ATOM   6142 C  CA    . CYS D 1 119 ? 47.080  27.084 55.845  1.00 50.06  ?  136 CYS D CA    1 
ATOM   6143 C  C     . CYS D 1 119 ? 46.035  26.347 56.674  1.00 48.58  ?  136 CYS D C     1 
ATOM   6144 O  O     . CYS D 1 119 ? 45.779  25.163 56.456  1.00 47.48  ?  136 CYS D O     1 
ATOM   6145 C  CB    . CYS D 1 119 ? 46.759  26.933 54.357  1.00 49.99  ?  136 CYS D CB    1 
ATOM   6146 S  SG    . CYS D 1 119 ? 45.049  27.323 53.922  1.00 49.37  ?  136 CYS D SG    1 
ATOM   6147 N  N     . LEU D 1 120 ? 45.438  27.053 57.630  1.00 40.75  ?  137 LEU D N     1 
ATOM   6148 C  CA    . LEU D 1 120 ? 44.350  26.492 58.420  1.00 39.67  ?  137 LEU D CA    1 
ATOM   6149 C  C     . LEU D 1 120 ? 43.072  26.430 57.591  1.00 39.02  ?  137 LEU D C     1 
ATOM   6150 O  O     . LEU D 1 120 ? 42.663  27.426 56.993  1.00 39.76  ?  137 LEU D O     1 
ATOM   6151 C  CB    . LEU D 1 120 ? 44.115  27.318 59.687  1.00 40.50  ?  137 LEU D CB    1 
ATOM   6152 C  CG    . LEU D 1 120 ? 45.276  27.440 60.676  1.00 41.51  ?  137 LEU D CG    1 
ATOM   6153 C  CD1   . LEU D 1 120 ? 44.831  28.172 61.935  1.00 42.46  ?  137 LEU D CD1   1 
ATOM   6154 C  CD2   . LEU D 1 120 ? 45.832  26.070 61.021  1.00 40.65  ?  137 LEU D CD2   1 
ATOM   6155 N  N     . TYR D 1 121 ? 42.445  25.260 57.557  1.00 36.20  ?  138 TYR D N     1 
ATOM   6156 C  CA    . TYR D 1 121 ? 41.177  25.098 56.857  1.00 35.80  ?  138 TYR D CA    1 
ATOM   6157 C  C     . TYR D 1 121 ? 40.051  24.875 57.857  1.00 35.41  ?  138 TYR D C     1 
ATOM   6158 O  O     . TYR D 1 121 ? 40.074  23.914 58.626  1.00 34.78  ?  138 TYR D O     1 
ATOM   6159 C  CB    . TYR D 1 121 ? 41.245  23.938 55.861  1.00 35.21  ?  138 TYR D CB    1 
ATOM   6160 C  CG    . TYR D 1 121 ? 40.116  23.939 54.855  1.00 35.31  ?  138 TYR D CG    1 
ATOM   6161 C  CD1   . TYR D 1 121 ? 38.871  23.413 55.179  1.00 34.89  ?  138 TYR D CD1   1 
ATOM   6162 C  CD2   . TYR D 1 121 ? 40.290  24.477 53.587  1.00 36.09  ?  138 TYR D CD2   1 
ATOM   6163 C  CE1   . TYR D 1 121 ? 37.835  23.415 54.266  1.00 35.27  ?  138 TYR D CE1   1 
ATOM   6164 C  CE2   . TYR D 1 121 ? 39.258  24.484 52.667  1.00 36.45  ?  138 TYR D CE2   1 
ATOM   6165 C  CZ    . TYR D 1 121 ? 38.034  23.952 53.013  1.00 36.05  ?  138 TYR D CZ    1 
ATOM   6166 O  OH    . TYR D 1 121 ? 37.003  23.958 52.103  1.00 36.69  ?  138 TYR D OH    1 
ATOM   6167 N  N     . PHE D 1 122 ? 39.060  25.759 57.831  1.00 41.41  ?  139 PHE D N     1 
ATOM   6168 C  CA    . PHE D 1 122 ? 37.970  25.711 58.797  1.00 41.42  ?  139 PHE D CA    1 
ATOM   6169 C  C     . PHE D 1 122 ? 36.833  24.817 58.322  1.00 40.92  ?  139 PHE D C     1 
ATOM   6170 O  O     . PHE D 1 122 ? 36.208  25.077 57.293  1.00 41.26  ?  139 PHE D O     1 
ATOM   6171 C  CB    . PHE D 1 122 ? 37.444  27.118 59.080  1.00 42.63  ?  139 PHE D CB    1 
ATOM   6172 C  CG    . PHE D 1 122 ? 38.338  27.929 59.973  1.00 43.48  ?  139 PHE D CG    1 
ATOM   6173 C  CD1   . PHE D 1 122 ? 39.544  28.425 59.504  1.00 43.94  ?  139 PHE D CD1   1 
ATOM   6174 C  CD2   . PHE D 1 122 ? 37.976  28.190 61.284  1.00 44.09  ?  139 PHE D CD2   1 
ATOM   6175 C  CE1   . PHE D 1 122 ? 40.368  29.170 60.324  1.00 45.03  ?  139 PHE D CE1   1 
ATOM   6176 C  CE2   . PHE D 1 122 ? 38.797  28.933 62.109  1.00 45.18  ?  139 PHE D CE2   1 
ATOM   6177 C  CZ    . PHE D 1 122 ? 39.994  29.424 61.628  1.00 45.68  ?  139 PHE D CZ    1 
ATOM   6178 N  N     . ILE D 1 123 ? 36.571  23.762 59.085  1.00 47.82  ?  140 ILE D N     1 
ATOM   6179 C  CA    . ILE D 1 123 ? 35.495  22.833 58.774  1.00 47.61  ?  140 ILE D CA    1 
ATOM   6180 C  C     . ILE D 1 123 ? 34.268  23.124 59.630  1.00 48.27  ?  140 ILE D C     1 
ATOM   6181 O  O     . ILE D 1 123 ? 34.351  23.125 60.858  1.00 48.41  ?  140 ILE D O     1 
ATOM   6182 C  CB    . ILE D 1 123 ? 35.935  21.374 58.992  1.00 46.93  ?  140 ILE D CB    1 
ATOM   6183 C  CG1   . ILE D 1 123 ? 37.122  21.038 58.086  1.00 46.42  ?  140 ILE D CG1   1 
ATOM   6184 C  CG2   . ILE D 1 123 ? 34.776  20.422 58.744  1.00 47.09  ?  140 ILE D CG2   1 
ATOM   6185 C  CD1   . ILE D 1 123 ? 37.668  19.644 58.289  1.00 45.93  ?  140 ILE D CD1   1 
ATOM   6186 N  N     . PRO D 1 124 ? 33.123  23.374 58.979  1.00 39.10  ?  141 PRO D N     1 
ATOM   6187 C  CA    . PRO D 1 124 ? 31.874  23.642 59.698  1.00 39.99  ?  141 PRO D CA    1 
ATOM   6188 C  C     . PRO D 1 124 ? 31.384  22.423 60.473  1.00 39.81  ?  141 PRO D C     1 
ATOM   6189 O  O     . PRO D 1 124 ? 31.357  21.316 59.934  1.00 39.36  ?  141 PRO D O     1 
ATOM   6190 C  CB    . PRO D 1 124 ? 30.897  24.011 58.577  1.00 40.80  ?  141 PRO D CB    1 
ATOM   6191 C  CG    . PRO D 1 124 ? 31.454  23.352 57.361  1.00 40.17  ?  141 PRO D CG    1 
ATOM   6192 C  CD    . PRO D 1 124 ? 32.942  23.421 57.518  1.00 39.28  ?  141 PRO D CD    1 
ATOM   6193 N  N     . ALA D 1 125 ? 31.001  22.633 61.729  1.00 46.66  ?  142 ALA D N     1 
ATOM   6194 C  CA    . ALA D 1 125 ? 30.569  21.543 62.595  1.00 47.11  ?  142 ALA D CA    1 
ATOM   6195 C  C     . ALA D 1 125 ? 29.169  21.057 62.230  1.00 48.25  ?  142 ALA D C     1 
ATOM   6196 O  O     . ALA D 1 125 ? 28.215  21.267 62.979  1.00 49.87  ?  142 ALA D O     1 
ATOM   6197 C  CB    . ALA D 1 125 ? 30.615  21.978 64.051  1.00 48.10  ?  142 ALA D CB    1 
ATOM   6198 N  N     . THR D 1 126 ? 29.053  20.405 61.079  1.00 43.10  ?  143 THR D N     1 
ATOM   6199 C  CA    . THR D 1 126 ? 27.774  19.867 60.633  1.00 44.17  ?  143 THR D CA    1 
ATOM   6200 C  C     . THR D 1 126 ? 27.445  18.589 61.394  1.00 44.44  ?  143 THR D C     1 
ATOM   6201 O  O     . THR D 1 126 ? 26.283  18.200 61.502  1.00 45.74  ?  143 THR D O     1 
ATOM   6202 C  CB    . THR D 1 126 ? 27.770  19.577 59.119  1.00 44.10  ?  143 THR D CB    1 
ATOM   6203 O  OG1   . THR D 1 126 ? 28.699  18.527 58.826  1.00 43.09  ?  143 THR D OG1   1 
ATOM   6204 C  CG2   . THR D 1 126 ? 28.151  20.824 58.337  1.00 43.98  ?  143 THR D CG2   1 
ATOM   6205 N  N     . GLY D 1 127 ? 28.478  17.938 61.917  1.00 46.88  ?  144 GLY D N     1 
ATOM   6206 C  CA    . GLY D 1 127 ? 28.311  16.695 62.647  1.00 47.26  ?  144 GLY D CA    1 
ATOM   6207 C  C     . GLY D 1 127 ? 28.159  15.503 61.723  1.00 46.94  ?  144 GLY D C     1 
ATOM   6208 O  O     . GLY D 1 127 ? 27.820  14.404 62.161  1.00 47.41  ?  144 GLY D O     1 
ATOM   6209 N  N     . HIS D 1 128 ? 28.415  15.724 60.438  1.00 38.33  ?  145 HIS D N     1 
ATOM   6210 C  CA    . HIS D 1 128 ? 28.338  14.656 59.449  1.00 38.68  ?  145 HIS D CA    1 
ATOM   6211 C  C     . HIS D 1 128 ? 29.582  14.632 58.568  1.00 37.58  ?  145 HIS D C     1 
ATOM   6212 O  O     . HIS D 1 128 ? 30.560  15.327 58.842  1.00 36.50  ?  145 HIS D O     1 
ATOM   6213 C  CB    . HIS D 1 128 ? 27.085  14.816 58.587  1.00 40.13  ?  145 HIS D CB    1 
ATOM   6214 C  CG    . HIS D 1 128 ? 25.809  14.782 59.368  1.00 41.57  ?  145 HIS D CG    1 
ATOM   6215 N  ND1   . HIS D 1 128 ? 25.458  13.719 60.172  1.00 42.32  ?  145 HIS D ND1   1 
ATOM   6216 C  CD2   . HIS D 1 128 ? 24.802  15.680 59.471  1.00 42.64  ?  145 HIS D CD2   1 
ATOM   6217 C  CE1   . HIS D 1 128 ? 24.290  13.965 60.736  1.00 43.79  ?  145 HIS D CE1   1 
ATOM   6218 N  NE2   . HIS D 1 128 ? 23.870  15.148 60.327  1.00 44.01  ?  145 HIS D NE2   1 
ATOM   6219 N  N     . SER D 1 129 ? 29.536  13.824 57.514  1.00 66.49  ?  146 SER D N     1 
ATOM   6220 C  CA    . SER D 1 129 ? 30.646  13.709 56.575  1.00 65.51  ?  146 SER D CA    1 
ATOM   6221 C  C     . SER D 1 129 ? 30.954  15.041 55.902  1.00 65.57  ?  146 SER D C     1 
ATOM   6222 O  O     . SER D 1 129 ? 30.094  15.920 55.828  1.00 66.59  ?  146 SER D O     1 
ATOM   6223 C  CB    . SER D 1 129 ? 30.338  12.655 55.513  1.00 65.98  ?  146 SER D CB    1 
ATOM   6224 O  OG    . SER D 1 129 ? 29.195  13.013 54.756  1.00 67.39  ?  146 SER D OG    1 
ATOM   6225 N  N     . LEU D 1 130 ? 32.183  15.184 55.416  1.00 45.75  ?  147 LEU D N     1 
ATOM   6226 C  CA    . LEU D 1 130 ? 32.585  16.393 54.708  1.00 45.82  ?  147 LEU D CA    1 
ATOM   6227 C  C     . LEU D 1 130 ? 31.754  16.602 53.450  1.00 46.86  ?  147 LEU D C     1 
ATOM   6228 O  O     . LEU D 1 130 ? 31.454  15.655 52.723  1.00 47.21  ?  147 LEU D O     1 
ATOM   6229 C  CB    . LEU D 1 130 ? 34.071  16.343 54.348  1.00 44.95  ?  147 LEU D CB    1 
ATOM   6230 C  CG    . LEU D 1 130 ? 35.047  16.700 55.469  1.00 44.08  ?  147 LEU D CG    1 
ATOM   6231 C  CD1   . LEU D 1 130 ? 36.485  16.513 55.017  1.00 43.60  ?  147 LEU D CD1   1 
ATOM   6232 C  CD2   . LEU D 1 130 ? 34.810  18.132 55.920  1.00 44.36  ?  147 LEU D CD2   1 
ATOM   6233 N  N     . ARG D 1 131 ? 31.387  17.854 53.206  1.00 49.84  ?  148 ARG D N     1 
ATOM   6234 C  CA    . ARG D 1 131 ? 30.622  18.217 52.024  1.00 51.11  ?  148 ARG D CA    1 
ATOM   6235 C  C     . ARG D 1 131 ? 31.541  18.266 50.810  1.00 51.05  ?  148 ARG D C     1 
ATOM   6236 O  O     . ARG D 1 131 ? 32.724  18.579 50.945  1.00 50.02  ?  148 ARG D O     1 
ATOM   6237 C  CB    . ARG D 1 131 ? 29.931  19.567 52.230  1.00 51.99  ?  148 ARG D CB    1 
ATOM   6238 N  N     . PRO D 1 132 ? 31.003  17.940 49.621  1.00 40.46  ?  149 PRO D N     1 
ATOM   6239 C  CA    . PRO D 1 132 ? 31.750  17.962 48.357  1.00 41.08  ?  149 PRO D CA    1 
ATOM   6240 C  C     . PRO D 1 132 ? 32.552  19.248 48.150  1.00 40.62  ?  149 PRO D C     1 
ATOM   6241 O  O     . PRO D 1 132 ? 33.589  19.222 47.487  1.00 40.66  ?  149 PRO D O     1 
ATOM   6242 C  CB    . PRO D 1 132 ? 30.648  17.834 47.306  1.00 43.11  ?  149 PRO D CB    1 
ATOM   6243 C  CG    . PRO D 1 132 ? 29.599  17.030 47.983  1.00 43.49  ?  149 PRO D CG    1 
ATOM   6244 C  CD    . PRO D 1 132 ? 29.623  17.457 49.429  1.00 41.92  ?  149 PRO D CD    1 
ATOM   6245 N  N     . LEU D 1 133 ? 32.071  20.353 48.710  1.00 42.84  ?  150 LEU D N     1 
ATOM   6246 C  CA    . LEU D 1 133 ? 32.756  21.636 48.596  1.00 42.66  ?  150 LEU D CA    1 
ATOM   6247 C  C     . LEU D 1 133 ? 34.109  21.629 49.301  1.00 41.27  ?  150 LEU D C     1 
ATOM   6248 O  O     . LEU D 1 133 ? 35.135  21.934 48.693  1.00 41.42  ?  150 LEU D O     1 
ATOM   6249 C  CB    . LEU D 1 133 ? 31.887  22.755 49.170  1.00 42.99  ?  150 LEU D CB    1 
ATOM   6250 C  CG    . LEU D 1 133 ? 32.518  24.147 49.197  1.00 43.04  ?  150 LEU D CG    1 
ATOM   6251 C  CD1   . LEU D 1 133 ? 32.812  24.634 47.787  1.00 44.34  ?  150 LEU D CD1   1 
ATOM   6252 C  CD2   . LEU D 1 133 ? 31.619  25.123 49.936  1.00 43.47  ?  150 LEU D CD2   1 
ATOM   6253 N  N     . ASP D 1 134 ? 34.105  21.288 50.586  1.00 45.59  ?  151 ASP D N     1 
ATOM   6254 C  CA    . ASP D 1 134 ? 35.331  21.278 51.377  1.00 44.25  ?  151 ASP D CA    1 
ATOM   6255 C  C     . ASP D 1 134 ? 36.309  20.220 50.879  1.00 43.93  ?  151 ASP D C     1 
ATOM   6256 O  O     . ASP D 1 134 ? 37.522  20.419 50.919  1.00 43.53  ?  151 ASP D O     1 
ATOM   6257 C  CB    . ASP D 1 134 ? 35.017  21.045 52.856  1.00 43.29  ?  151 ASP D CB    1 
ATOM   6258 C  CG    . ASP D 1 134 ? 34.284  22.212 53.489  1.00 43.72  ?  151 ASP D CG    1 
ATOM   6259 O  OD1   . ASP D 1 134 ? 34.496  23.361 53.047  1.00 44.27  ?  151 ASP D OD1   1 
ATOM   6260 O  OD2   . ASP D 1 134 ? 33.500  21.979 54.432  1.00 43.68  -1 151 ASP D OD2   1 
ATOM   6261 N  N     . ILE D 1 135 ? 35.772  19.097 50.413  1.00 50.87  ?  152 ILE D N     1 
ATOM   6262 C  CA    . ILE D 1 135 ? 36.589  18.021 49.867  1.00 51.18  ?  152 ILE D CA    1 
ATOM   6263 C  C     . ILE D 1 135 ? 37.389  18.484 48.653  1.00 52.86  ?  152 ILE D C     1 
ATOM   6264 O  O     . ILE D 1 135 ? 38.607  18.310 48.596  1.00 53.35  ?  152 ILE D O     1 
ATOM   6265 C  CB    . ILE D 1 135 ? 35.727  16.809 49.470  1.00 51.69  ?  152 ILE D CB    1 
ATOM   6266 C  CG1   . ILE D 1 135 ? 35.099  16.174 50.712  1.00 50.35  ?  152 ILE D CG1   1 
ATOM   6267 C  CG2   . ILE D 1 135 ? 36.558  15.789 48.713  1.00 52.48  ?  152 ILE D CG2   1 
ATOM   6268 C  CD1   . ILE D 1 135 ? 34.095  15.086 50.401  1.00 50.88  ?  152 ILE D CD1   1 
ATOM   6269 N  N     . GLU D 1 136 ? 36.695  19.075 47.685  1.00 40.93  ?  153 GLU D N     1 
ATOM   6270 C  CA    . GLU D 1 136 ? 37.332  19.558 46.466  1.00 42.08  ?  153 GLU D CA    1 
ATOM   6271 C  C     . GLU D 1 136 ? 38.281  20.717 46.757  1.00 41.68  ?  153 GLU D C     1 
ATOM   6272 O  O     . GLU D 1 136 ? 39.332  20.841 46.129  1.00 42.28  ?  153 GLU D O     1 
ATOM   6273 C  CB    . GLU D 1 136 ? 36.276  19.988 45.445  1.00 43.61  ?  153 GLU D CB    1 
ATOM   6274 N  N     . PHE D 1 137 ? 37.902  21.560 47.711  1.00 47.54  ?  154 PHE D N     1 
ATOM   6275 C  CA    . PHE D 1 137 ? 38.703  22.725 48.069  1.00 47.42  ?  154 PHE D CA    1 
ATOM   6276 C  C     . PHE D 1 137 ? 40.012  22.312 48.737  1.00 46.57  ?  154 PHE D C     1 
ATOM   6277 O  O     . PHE D 1 137 ? 41.081  22.809 48.386  1.00 47.67  ?  154 PHE D O     1 
ATOM   6278 C  CB    . PHE D 1 137 ? 37.914  23.653 48.996  1.00 46.25  ?  154 PHE D CB    1 
ATOM   6279 C  CG    . PHE D 1 137 ? 38.244  25.110 48.827  1.00 47.10  ?  154 PHE D CG    1 
ATOM   6280 C  CD1   . PHE D 1 137 ? 39.522  25.582 49.078  1.00 47.15  ?  154 PHE D CD1   1 
ATOM   6281 C  CD2   . PHE D 1 137 ? 37.270  26.011 48.430  1.00 48.05  ?  154 PHE D CD2   1 
ATOM   6282 C  CE1   . PHE D 1 137 ? 39.825  26.923 48.926  1.00 48.08  ?  154 PHE D CE1   1 
ATOM   6283 C  CE2   . PHE D 1 137 ? 37.566  27.353 48.280  1.00 48.93  ?  154 PHE D CE2   1 
ATOM   6284 C  CZ    . PHE D 1 137 ? 38.845  27.809 48.526  1.00 48.92  ?  154 PHE D CZ    1 
ATOM   6285 N  N     . MET D 1 138 ? 39.919  21.401 49.701  1.00 49.13  ?  155 MET D N     1 
ATOM   6286 C  CA    . MET D 1 138 ? 41.097  20.919 50.412  1.00 48.51  ?  155 MET D CA    1 
ATOM   6287 C  C     . MET D 1 138 ? 42.021  20.101 49.519  1.00 50.36  ?  155 MET D C     1 
ATOM   6288 O  O     . MET D 1 138 ? 43.237  20.101 49.710  1.00 51.02  ?  155 MET D O     1 
ATOM   6289 C  CB    . MET D 1 138 ? 40.687  20.082 51.623  1.00 46.58  ?  155 MET D CB    1 
ATOM   6290 C  CG    . MET D 1 138 ? 40.106  20.883 52.771  1.00 45.42  ?  155 MET D CG    1 
ATOM   6291 S  SD    . MET D 1 138 ? 39.767  19.828 54.188  1.00 43.95  ?  155 MET D SD    1 
ATOM   6292 C  CE    . MET D 1 138 ? 41.437  19.383 54.651  1.00 44.06  ?  155 MET D CE    1 
ATOM   6293 N  N     . LYS D 1 139 ? 41.442  19.406 48.545  1.00 49.53  ?  156 LYS D N     1 
ATOM   6294 C  CA    . LYS D 1 139 ? 42.228  18.600 47.619  1.00 51.96  ?  156 LYS D CA    1 
ATOM   6295 C  C     . LYS D 1 139 ? 43.107  19.489 46.748  1.00 54.89  ?  156 LYS D C     1 
ATOM   6296 O  O     . LYS D 1 139 ? 44.244  19.140 46.434  1.00 56.94  ?  156 LYS D O     1 
ATOM   6297 C  CB    . LYS D 1 139 ? 41.315  17.737 46.746  1.00 52.68  ?  156 LYS D CB    1 
ATOM   6298 N  N     . ARG D 1 140 ? 42.569  20.640 46.359  1.00 68.80  ?  157 ARG D N     1 
ATOM   6299 C  CA    . ARG D 1 140 ? 43.322  21.617 45.582  1.00 71.57  ?  157 ARG D CA    1 
ATOM   6300 C  C     . ARG D 1 140 ? 44.403  22.300 46.420  1.00 70.68  ?  157 ARG D C     1 
ATOM   6301 O  O     . ARG D 1 140 ? 45.540  22.446 45.973  1.00 72.94  ?  157 ARG D O     1 
ATOM   6302 C  CB    . ARG D 1 140 ? 42.374  22.655 44.976  1.00 72.48  ?  157 ARG D CB    1 
ATOM   6303 C  CG    . ARG D 1 140 ? 41.406  22.064 43.959  1.00 74.30  ?  157 ARG D CG    1 
ATOM   6304 C  CD    . ARG D 1 140 ? 40.938  23.096 42.946  1.00 77.03  ?  157 ARG D CD    1 
ATOM   6305 N  NE    . ARG D 1 140 ? 39.675  22.710 42.323  1.00 78.09  ?  157 ARG D NE    1 
ATOM   6306 C  CZ    . ARG D 1 140 ? 38.740  23.567 41.927  1.00 79.18  ?  157 ARG D CZ    1 
ATOM   6307 N  NH1   . ARG D 1 140 ? 38.919  24.871 42.089  1.00 79.28  1  157 ARG D NH1   1 
ATOM   6308 N  NH2   . ARG D 1 140 ? 37.623  23.121 41.369  1.00 80.11  ?  157 ARG D NH2   1 
ATOM   6309 N  N     . LEU D 1 141 ? 44.044  22.718 47.631  1.00 53.04  ?  158 LEU D N     1 
ATOM   6310 C  CA    . LEU D 1 141 ? 44.970  23.448 48.496  1.00 52.45  ?  158 LEU D CA    1 
ATOM   6311 C  C     . LEU D 1 141 ? 46.141  22.588 48.962  1.00 52.78  ?  158 LEU D C     1 
ATOM   6312 O  O     . LEU D 1 141 ? 47.278  23.056 49.012  1.00 53.85  ?  158 LEU D O     1 
ATOM   6313 C  CB    . LEU D 1 141 ? 44.237  24.014 49.715  1.00 49.64  ?  158 LEU D CB    1 
ATOM   6314 C  CG    . LEU D 1 141 ? 43.428  25.296 49.514  1.00 49.66  ?  158 LEU D CG    1 
ATOM   6315 C  CD1   . LEU D 1 141 ? 42.738  25.696 50.808  1.00 47.52  ?  158 LEU D CD1   1 
ATOM   6316 C  CD2   . LEU D 1 141 ? 44.321  26.419 49.012  1.00 51.49  ?  158 LEU D CD2   1 
ATOM   6317 N  N     . SER D 1 142 ? 45.862  21.332 49.299  1.00 62.47  ?  159 SER D N     1 
ATOM   6318 C  CA    . SER D 1 142 ? 46.891  20.423 49.800  1.00 62.83  ?  159 SER D CA    1 
ATOM   6319 C  C     . SER D 1 142 ? 47.971  20.164 48.754  1.00 66.55  ?  159 SER D C     1 
ATOM   6320 O  O     . SER D 1 142 ? 49.103  19.815 49.089  1.00 67.53  ?  159 SER D O     1 
ATOM   6321 C  CB    . SER D 1 142 ? 46.267  19.099 50.243  1.00 61.34  ?  159 SER D CB    1 
ATOM   6322 O  OG    . SER D 1 142 ? 45.884  18.316 49.127  1.00 63.05  ?  159 SER D OG    1 
ATOM   6323 N  N     . LYS D 1 143 ? 47.611  20.337 47.486  1.00 43.24  ?  160 LYS D N     1 
ATOM   6324 C  CA    . LYS D 1 143 ? 48.534  20.109 46.381  1.00 45.19  ?  160 LYS D CA    1 
ATOM   6325 C  C     . LYS D 1 143 ? 49.504  21.273 46.184  1.00 45.44  ?  160 LYS D C     1 
ATOM   6326 O  O     . LYS D 1 143 ? 50.481  21.153 45.445  1.00 46.83  ?  160 LYS D O     1 
ATOM   6327 C  CB    . LYS D 1 143 ? 47.757  19.856 45.087  1.00 46.65  ?  160 LYS D CB    1 
ATOM   6328 N  N     . VAL D 1 144 ? 49.236  22.399 46.841  1.00 39.18  ?  161 VAL D N     1 
ATOM   6329 C  CA    . VAL D 1 144 ? 50.049  23.598 46.652  1.00 39.15  ?  161 VAL D CA    1 
ATOM   6330 C  C     . VAL D 1 144 ? 50.489  24.250 47.963  1.00 37.25  ?  161 VAL D C     1 
ATOM   6331 O  O     . VAL D 1 144 ? 51.258  25.213 47.951  1.00 37.03  ?  161 VAL D O     1 
ATOM   6332 C  CB    . VAL D 1 144 ? 49.297  24.658 45.817  1.00 39.73  ?  161 VAL D CB    1 
ATOM   6333 C  CG1   . VAL D 1 144 ? 49.046  24.152 44.403  1.00 42.22  ?  161 VAL D CG1   1 
ATOM   6334 C  CG2   . VAL D 1 144 ? 47.992  25.041 46.499  1.00 37.81  ?  161 VAL D CG2   1 
ATOM   6335 N  N     . VAL D 1 145 ? 50.011  23.726 49.087  1.00 46.67  ?  162 VAL D N     1 
ATOM   6336 C  CA    . VAL D 1 145 ? 50.320  24.313 50.389  1.00 44.76  ?  162 VAL D CA    1 
ATOM   6337 C  C     . VAL D 1 145 ? 50.054  23.321 51.522  1.00 44.11  ?  162 VAL D C     1 
ATOM   6338 O  O     . VAL D 1 145 ? 49.309  22.356 51.352  1.00 44.86  ?  162 VAL D O     1 
ATOM   6339 C  CB    . VAL D 1 145 ? 49.505  25.610 50.629  1.00 43.43  ?  162 VAL D CB    1 
ATOM   6340 C  CG1   . VAL D 1 145 ? 48.112  25.289 51.149  1.00 42.73  ?  162 VAL D CG1   1 
ATOM   6341 C  CG2   . VAL D 1 145 ? 50.233  26.531 51.592  1.00 42.16  ?  162 VAL D CG2   1 
ATOM   6342 N  N     . ASN D 1 146 ? 50.681  23.555 52.673  1.00 39.09  ?  163 ASN D N     1 
ATOM   6343 C  CA    . ASN D 1 146 ? 50.469  22.721 53.852  1.00 38.95  ?  163 ASN D CA    1 
ATOM   6344 C  C     . ASN D 1 146 ? 49.137  23.038 54.526  1.00 37.99  ?  163 ASN D C     1 
ATOM   6345 O  O     . ASN D 1 146 ? 48.900  24.167 54.957  1.00 37.09  ?  163 ASN D O     1 
ATOM   6346 C  CB    . ASN D 1 146 ? 51.616  22.894 54.850  1.00 39.01  ?  163 ASN D CB    1 
ATOM   6347 C  CG    . ASN D 1 146 ? 52.950  22.430 54.295  1.00 40.18  ?  163 ASN D CG    1 
ATOM   6348 O  OD1   . ASN D 1 146 ? 53.043  21.374 53.668  1.00 41.13  ?  163 ASN D OD1   1 
ATOM   6349 N  ND2   . ASN D 1 146 ? 53.995  23.216 54.531  1.00 40.26  ?  163 ASN D ND2   1 
ATOM   6350 N  N     . ILE D 1 147 ? 48.272  22.031 54.614  1.00 34.20  ?  164 ILE D N     1 
ATOM   6351 C  CA    . ILE D 1 147 ? 46.938  22.204 55.178  1.00 33.59  ?  164 ILE D CA    1 
ATOM   6352 C  C     . ILE D 1 147 ? 46.804  21.632 56.590  1.00 33.79  ?  164 ILE D C     1 
ATOM   6353 O  O     . ILE D 1 147 ? 47.268  20.526 56.870  1.00 34.74  ?  164 ILE D O     1 
ATOM   6354 C  CB    . ILE D 1 147 ? 45.878  21.538 54.266  1.00 34.05  ?  164 ILE D CB    1 
ATOM   6355 C  CG1   . ILE D 1 147 ? 45.665  22.367 53.001  1.00 33.76  ?  164 ILE D CG1   1 
ATOM   6356 C  CG2   . ILE D 1 147 ? 44.556  21.357 54.995  1.00 33.85  ?  164 ILE D CG2   1 
ATOM   6357 C  CD1   . ILE D 1 147 ? 45.084  23.736 53.266  1.00 32.66  ?  164 ILE D CD1   1 
ATOM   6358 N  N     . VAL D 1 148 ? 46.166  22.397 57.473  1.00 36.90  ?  165 VAL D N     1 
ATOM   6359 C  CA    . VAL D 1 148 ? 45.792  21.910 58.795  1.00 38.05  ?  165 VAL D CA    1 
ATOM   6360 C  C     . VAL D 1 148 ? 44.296  22.121 59.024  1.00 38.46  ?  165 VAL D C     1 
ATOM   6361 O  O     . VAL D 1 148 ? 43.858  23.241 59.292  1.00 37.94  ?  165 VAL D O     1 
ATOM   6362 C  CB    . VAL D 1 148 ? 46.585  22.614 59.912  1.00 38.46  ?  165 VAL D CB    1 
ATOM   6363 C  CG1   . VAL D 1 148 ? 46.104  22.148 61.280  1.00 40.51  ?  165 VAL D CG1   1 
ATOM   6364 C  CG2   . VAL D 1 148 ? 48.074  22.353 59.753  1.00 38.26  ?  165 VAL D CG2   1 
ATOM   6365 N  N     . PRO D 1 149 ? 43.503  21.045 58.903  1.00 40.70  ?  166 PRO D N     1 
ATOM   6366 C  CA    . PRO D 1 149 ? 42.046  21.133 59.060  1.00 41.32  ?  166 PRO D CA    1 
ATOM   6367 C  C     . PRO D 1 149 ? 41.636  21.397 60.505  1.00 43.25  ?  166 PRO D C     1 
ATOM   6368 O  O     . PRO D 1 149 ? 42.211  20.805 61.419  1.00 44.69  ?  166 PRO D O     1 
ATOM   6369 C  CB    . PRO D 1 149 ? 41.550  19.753 58.600  1.00 42.02  ?  166 PRO D CB    1 
ATOM   6370 C  CG    . PRO D 1 149 ? 42.736  19.075 57.978  1.00 41.51  ?  166 PRO D CG    1 
ATOM   6371 C  CD    . PRO D 1 149 ? 43.944  19.674 58.605  1.00 41.28  ?  166 PRO D CD    1 
ATOM   6372 N  N     . VAL D 1 150 ? 40.657  22.274 60.707  1.00 41.42  ?  167 VAL D N     1 
ATOM   6373 C  CA    . VAL D 1 150 ? 40.200  22.609 62.053  1.00 43.58  ?  167 VAL D CA    1 
ATOM   6374 C  C     . VAL D 1 150 ? 38.675  22.602 62.136  1.00 44.74  ?  167 VAL D C     1 
ATOM   6375 O  O     . VAL D 1 150 ? 37.988  22.953 61.177  1.00 42.81  ?  167 VAL D O     1 
ATOM   6376 C  CB    . VAL D 1 150 ? 40.734  23.984 62.523  1.00 42.45  ?  167 VAL D CB    1 
ATOM   6377 C  CG1   . VAL D 1 150 ? 42.244  23.935 62.714  1.00 42.63  ?  167 VAL D CG1   1 
ATOM   6378 C  CG2   . VAL D 1 150 ? 40.342  25.085 61.550  1.00 41.34  ?  167 VAL D CG2   1 
ATOM   6379 N  N     . ILE D 1 151 ? 38.153  22.191 63.287  1.00 40.52  ?  168 ILE D N     1 
ATOM   6380 C  CA    . ILE D 1 151 ? 36.715  22.204 63.527  1.00 41.93  ?  168 ILE D CA    1 
ATOM   6381 C  C     . ILE D 1 151 ? 36.259  23.582 63.994  1.00 41.57  ?  168 ILE D C     1 
ATOM   6382 O  O     . ILE D 1 151 ? 36.447  23.949 65.155  1.00 43.71  ?  168 ILE D O     1 
ATOM   6383 C  CB    . ILE D 1 151 ? 36.306  21.156 64.579  1.00 45.36  ?  168 ILE D CB    1 
ATOM   6384 C  CG1   . ILE D 1 151 ? 36.721  19.755 64.129  1.00 44.50  ?  168 ILE D CG1   1 
ATOM   6385 C  CG2   . ILE D 1 151 ? 34.808  21.219 64.844  1.00 46.49  ?  168 ILE D CG2   1 
ATOM   6386 C  CD1   . ILE D 1 151 ? 36.434  18.678 65.151  1.00 46.57  ?  168 ILE D CD1   1 
ATOM   6387 N  N     . ALA D 1 152 ? 35.674  24.348 63.078  1.00 49.06  ?  169 ALA D N     1 
ATOM   6388 C  CA    . ALA D 1 152 ? 35.204  25.692 63.389  1.00 48.18  ?  169 ALA D CA    1 
ATOM   6389 C  C     . ALA D 1 152 ? 34.092  25.665 64.431  1.00 51.30  ?  169 ALA D C     1 
ATOM   6390 O  O     . ALA D 1 152 ? 33.170  24.852 64.341  1.00 52.74  ?  169 ALA D O     1 
ATOM   6391 C  CB    . ALA D 1 152 ? 34.727  26.386 62.127  1.00 44.75  ?  169 ALA D CB    1 
ATOM   6392 N  N     . LYS D 1 153 ? 34.183  26.568 65.405  1.00 46.08  ?  170 LYS D N     1 
ATOM   6393 C  CA    . LYS D 1 153 ? 33.195  26.680 66.478  1.00 48.37  ?  170 LYS D CA    1 
ATOM   6394 C  C     . LYS D 1 153 ? 32.946  25.339 67.160  1.00 52.23  ?  170 LYS D C     1 
ATOM   6395 O  O     . LYS D 1 153 ? 31.838  24.809 67.116  1.00 53.28  ?  170 LYS D O     1 
ATOM   6396 C  CB    . LYS D 1 153 ? 31.878  27.245 65.943  1.00 47.80  ?  170 LYS D CB    1 
ATOM   6397 C  CG    . LYS D 1 153 ? 31.993  28.637 65.346  1.00 46.44  ?  170 LYS D CG    1 
ATOM   6398 C  CD    . LYS D 1 153 ? 30.678  29.076 64.729  1.00 46.75  ?  170 LYS D CD    1 
ATOM   6399 C  CE    . LYS D 1 153 ? 30.710  30.544 64.352  1.00 45.75  ?  170 LYS D CE    1 
ATOM   6400 N  NZ    . LYS D 1 153 ? 29.397  31.013 63.829  1.00 46.29  1  170 LYS D NZ    1 
ATOM   6401 N  N     . ALA D 1 154 ? 33.985  24.793 67.784  1.00 47.17  ?  171 ALA D N     1 
ATOM   6402 C  CA    . ALA D 1 154 ? 33.905  23.472 68.401  1.00 50.47  ?  171 ALA D CA    1 
ATOM   6403 C  C     . ALA D 1 154 ? 33.028  23.465 69.652  1.00 53.51  ?  171 ALA D C     1 
ATOM   6404 O  O     . ALA D 1 154 ? 32.701  22.402 70.180  1.00 55.66  ?  171 ALA D O     1 
ATOM   6405 C  CB    . ALA D 1 154 ? 35.297  22.968 68.737  1.00 51.28  ?  171 ALA D CB    1 
ATOM   6406 N  N     . ASP D 1 155 ? 32.647  24.649 70.122  1.00 61.26  ?  172 ASP D N     1 
ATOM   6407 C  CA    . ASP D 1 155 ? 31.751  24.759 71.268  1.00 63.66  ?  172 ASP D CA    1 
ATOM   6408 C  C     . ASP D 1 155 ? 30.317  24.415 70.873  1.00 63.60  ?  172 ASP D C     1 
ATOM   6409 O  O     . ASP D 1 155 ? 29.459  24.204 71.730  1.00 65.63  ?  172 ASP D O     1 
ATOM   6410 C  CB    . ASP D 1 155 ? 31.816  26.165 71.869  1.00 62.68  ?  172 ASP D CB    1 
ATOM   6411 C  CG    . ASP D 1 155 ? 31.608  27.253 70.834  1.00 59.02  ?  172 ASP D CG    1 
ATOM   6412 O  OD1   . ASP D 1 155 ? 32.065  27.077 69.685  1.00 56.93  ?  172 ASP D OD1   1 
ATOM   6413 O  OD2   . ASP D 1 155 ? 30.990  28.285 71.172  1.00 58.02  -1 172 ASP D OD2   1 
ATOM   6414 N  N     . THR D 1 156 ? 30.069  24.362 69.568  1.00 58.55  ?  173 THR D N     1 
ATOM   6415 C  CA    . THR D 1 156 ? 28.771  23.960 69.038  1.00 58.17  ?  173 THR D CA    1 
ATOM   6416 C  C     . THR D 1 156 ? 28.471  22.503 69.381  1.00 60.21  ?  173 THR D C     1 
ATOM   6417 O  O     . THR D 1 156 ? 27.330  22.140 69.669  1.00 61.20  ?  173 THR D O     1 
ATOM   6418 C  CB    . THR D 1 156 ? 28.712  24.148 67.507  1.00 55.05  ?  173 THR D CB    1 
ATOM   6419 O  OG1   . THR D 1 156 ? 29.024  25.508 67.179  1.00 52.74  ?  173 THR D OG1   1 
ATOM   6420 C  CG2   . THR D 1 156 ? 27.334  23.803 66.966  1.00 54.72  ?  173 THR D CG2   1 
ATOM   6421 N  N     . LEU D 1 157 ? 29.511  21.675 69.364  1.00 49.65  ?  174 LEU D N     1 
ATOM   6422 C  CA    . LEU D 1 157 ? 29.355  20.238 69.553  1.00 50.68  ?  174 LEU D CA    1 
ATOM   6423 C  C     . LEU D 1 157 ? 29.617  19.818 70.995  1.00 53.58  ?  174 LEU D C     1 
ATOM   6424 O  O     . LEU D 1 157 ? 30.327  20.502 71.733  1.00 54.83  ?  174 LEU D O     1 
ATOM   6425 C  CB    . LEU D 1 157 ? 30.298  19.477 68.618  1.00 48.55  ?  174 LEU D CB    1 
ATOM   6426 C  CG    . LEU D 1 157 ? 30.173  19.772 67.123  1.00 45.46  ?  174 LEU D CG    1 
ATOM   6427 C  CD1   . LEU D 1 157 ? 31.325  19.144 66.357  1.00 43.55  ?  174 LEU D CD1   1 
ATOM   6428 C  CD2   . LEU D 1 157 ? 28.838  19.277 66.589  1.00 45.00  ?  174 LEU D CD2   1 
ATOM   6429 N  N     . THR D 1 158 ? 29.035  18.691 71.391  1.00 56.29  ?  175 THR D N     1 
ATOM   6430 C  CA    . THR D 1 158 ? 29.308  18.108 72.697  1.00 58.30  ?  175 THR D CA    1 
ATOM   6431 C  C     . THR D 1 158 ? 30.592  17.292 72.631  1.00 57.74  ?  175 THR D C     1 
ATOM   6432 O  O     . THR D 1 158 ? 31.187  17.150 71.563  1.00 55.91  ?  175 THR D O     1 
ATOM   6433 C  CB    . THR D 1 158 ? 28.153  17.210 73.180  1.00 61.19  ?  175 THR D CB    1 
ATOM   6434 O  OG1   . THR D 1 158 ? 28.114  16.011 72.396  1.00 61.50  ?  175 THR D OG1   1 
ATOM   6435 C  CG2   . THR D 1 158 ? 26.822  17.937 73.059  1.00 61.86  ?  175 THR D CG2   1 
ATOM   6436 N  N     . LEU D 1 159 ? 31.019  16.759 73.772  1.00 54.47  ?  176 LEU D N     1 
ATOM   6437 C  CA    . LEU D 1 159 ? 32.227  15.944 73.827  1.00 53.14  ?  176 LEU D CA    1 
ATOM   6438 C  C     . LEU D 1 159 ? 32.065  14.678 72.992  1.00 52.62  ?  176 LEU D C     1 
ATOM   6439 O  O     . LEU D 1 159 ? 32.976  14.281 72.265  1.00 50.65  ?  176 LEU D O     1 
ATOM   6440 C  CB    . LEU D 1 159 ? 32.567  15.583 75.273  1.00 55.54  ?  176 LEU D CB    1 
ATOM   6441 N  N     . GLU D 1 160 ? 30.897  14.051 73.101  1.00 69.59  ?  177 GLU D N     1 
ATOM   6442 C  CA    . GLU D 1 160 ? 30.587  12.850 72.333  1.00 69.47  ?  177 GLU D CA    1 
ATOM   6443 C  C     . GLU D 1 160 ? 30.544  13.148 70.837  1.00 67.08  ?  177 GLU D C     1 
ATOM   6444 O  O     . GLU D 1 160 ? 31.085  12.394 70.028  1.00 64.69  ?  177 GLU D O     1 
ATOM   6445 C  CB    . GLU D 1 160 ? 29.255  12.251 72.789  1.00 72.68  ?  177 GLU D CB    1 
ATOM   6446 N  N     . GLU D 1 161 ? 29.891  14.250 70.480  1.00 81.97  ?  178 GLU D N     1 
ATOM   6447 C  CA    . GLU D 1 161 ? 29.752  14.647 69.084  1.00 79.53  ?  178 GLU D CA    1 
ATOM   6448 C  C     . GLU D 1 161 ? 31.104  14.997 68.471  1.00 75.04  ?  178 GLU D C     1 
ATOM   6449 O  O     . GLU D 1 161 ? 31.351  14.725 67.296  1.00 72.56  ?  178 GLU D O     1 
ATOM   6450 C  CB    . GLU D 1 161 ? 28.798  15.838 68.962  1.00 80.25  ?  178 GLU D CB    1 
ATOM   6451 C  CG    . GLU D 1 161 ? 27.351  15.523 69.313  1.00 83.98  ?  178 GLU D CG    1 
ATOM   6452 C  CD    . GLU D 1 161 ? 26.453  16.743 69.229  1.00 83.98  ?  178 GLU D CD    1 
ATOM   6453 O  OE1   . GLU D 1 161 ? 26.984  17.874 69.196  1.00 81.41  ?  178 GLU D OE1   1 
ATOM   6454 O  OE2   . GLU D 1 161 ? 25.215  16.573 69.203  1.00 85.97  -1 178 GLU D OE2   1 
ATOM   6455 N  N     . ARG D 1 162 ? 31.973  15.602 69.275  1.00 72.90  ?  179 ARG D N     1 
ATOM   6456 C  CA    . ARG D 1 162 ? 33.299  16.011 68.820  1.00 69.23  ?  179 ARG D CA    1 
ATOM   6457 C  C     . ARG D 1 162 ? 34.188  14.820 68.465  1.00 68.12  ?  179 ARG D C     1 
ATOM   6458 O  O     . ARG D 1 162 ? 34.918  14.856 67.473  1.00 65.73  ?  179 ARG D O     1 
ATOM   6459 C  CB    . ARG D 1 162 ? 33.983  16.869 69.888  1.00 69.55  ?  179 ARG D CB    1 
ATOM   6460 C  CG    . ARG D 1 162 ? 35.445  17.174 69.600  1.00 67.35  ?  179 ARG D CG    1 
ATOM   6461 C  CD    . ARG D 1 162 ? 36.051  18.076 70.664  1.00 68.08  ?  179 ARG D CD    1 
ATOM   6462 N  NE    . ARG D 1 162 ? 35.330  19.339 70.794  1.00 68.35  ?  179 ARG D NE    1 
ATOM   6463 C  CZ    . ARG D 1 162 ? 34.534  19.645 71.813  1.00 71.09  ?  179 ARG D CZ    1 
ATOM   6464 N  NH1   . ARG D 1 162 ? 34.353  18.776 72.799  1.00 73.88  1  179 ARG D NH1   1 
ATOM   6465 N  NH2   . ARG D 1 162 ? 33.918  20.818 71.847  1.00 71.18  ?  179 ARG D NH2   1 
ATOM   6466 N  N     . VAL D 1 163 ? 34.118  13.766 69.273  1.00 48.75  ?  180 VAL D N     1 
ATOM   6467 C  CA    . VAL D 1 163 ? 34.920  12.570 69.037  1.00 48.48  ?  180 VAL D CA    1 
ATOM   6468 C  C     . VAL D 1 163 ? 34.499  11.889 67.740  1.00 47.51  ?  180 VAL D C     1 
ATOM   6469 O  O     . VAL D 1 163 ? 35.343  11.478 66.941  1.00 46.00  ?  180 VAL D O     1 
ATOM   6470 C  CB    . VAL D 1 163 ? 34.804  11.569 70.204  1.00 51.01  ?  180 VAL D CB    1 
ATOM   6471 C  CG1   . VAL D 1 163 ? 35.547  10.281 69.882  1.00 50.78  ?  180 VAL D CG1   1 
ATOM   6472 C  CG2   . VAL D 1 163 ? 35.339  12.188 71.485  1.00 52.07  ?  180 VAL D CG2   1 
ATOM   6473 N  N     . HIS D 1 164 ? 33.191  11.781 67.531  1.00 58.38  ?  181 HIS D N     1 
ATOM   6474 C  CA    . HIS D 1 164 ? 32.663  11.187 66.310  1.00 57.89  ?  181 HIS D CA    1 
ATOM   6475 C  C     . HIS D 1 164 ? 32.986  12.054 65.102  1.00 55.22  ?  181 HIS D C     1 
ATOM   6476 O  O     . HIS D 1 164 ? 33.238  11.543 64.010  1.00 54.01  ?  181 HIS D O     1 
ATOM   6477 C  CB    . HIS D 1 164 ? 31.152  10.980 66.407  1.00 60.61  ?  181 HIS D CB    1 
ATOM   6478 C  CG    . HIS D 1 164 ? 30.529  10.517 65.126  1.00 60.35  ?  181 HIS D CG    1 
ATOM   6479 N  ND1   . HIS D 1 164 ? 30.678  9.234  64.647  1.00 60.03  ?  181 HIS D ND1   1 
ATOM   6480 C  CD2   . HIS D 1 164 ? 29.771  11.174 64.217  1.00 60.31  ?  181 HIS D CD2   1 
ATOM   6481 C  CE1   . HIS D 1 164 ? 30.029  9.117  63.501  1.00 60.02  ?  181 HIS D CE1   1 
ATOM   6482 N  NE2   . HIS D 1 164 ? 29.470  10.279 63.218  1.00 60.14  ?  181 HIS D NE2   1 
ATOM   6483 N  N     . PHE D 1 165 ? 32.975  13.367 65.303  1.00 45.50  ?  182 PHE D N     1 
ATOM   6484 C  CA    . PHE D 1 165 ? 33.228  14.294 64.211  1.00 43.31  ?  182 PHE D CA    1 
ATOM   6485 C  C     . PHE D 1 165 ? 34.685  14.184 63.780  1.00 42.01  ?  182 PHE D C     1 
ATOM   6486 O  O     . PHE D 1 165 ? 34.977  14.125 62.590  1.00 41.12  ?  182 PHE D O     1 
ATOM   6487 C  CB    . PHE D 1 165 ? 32.886  15.729 64.624  1.00 42.17  ?  182 PHE D CB    1 
ATOM   6488 C  CG    . PHE D 1 165 ? 32.798  16.690 63.470  1.00 40.34  ?  182 PHE D CG    1 
ATOM   6489 C  CD1   . PHE D 1 165 ? 32.115  16.343 62.315  1.00 40.62  ?  182 PHE D CD1   1 
ATOM   6490 C  CD2   . PHE D 1 165 ? 33.382  17.943 63.546  1.00 38.55  ?  182 PHE D CD2   1 
ATOM   6491 C  CE1   . PHE D 1 165 ? 32.028  17.224 61.253  1.00 39.12  ?  182 PHE D CE1   1 
ATOM   6492 C  CE2   . PHE D 1 165 ? 33.297  18.829 62.486  1.00 37.02  ?  182 PHE D CE2   1 
ATOM   6493 C  CZ    . PHE D 1 165 ? 32.618  18.468 61.339  1.00 37.30  ?  182 PHE D CZ    1 
ATOM   6494 N  N     . LYS D 1 166 ? 35.593  14.130 64.751  1.00 51.08  ?  183 LYS D N     1 
ATOM   6495 C  CA    . LYS D 1 166 ? 37.011  13.931 64.459  1.00 49.74  ?  183 LYS D CA    1 
ATOM   6496 C  C     . LYS D 1 166 ? 37.247  12.623 63.712  1.00 49.81  ?  183 LYS D C     1 
ATOM   6497 O  O     . LYS D 1 166 ? 37.994  12.582 62.735  1.00 48.35  ?  183 LYS D O     1 
ATOM   6498 C  CB    . LYS D 1 166 ? 37.842  13.943 65.745  1.00 50.76  ?  183 LYS D CB    1 
ATOM   6499 C  CG    . LYS D 1 166 ? 38.209  15.325 66.258  1.00 50.28  ?  183 LYS D CG    1 
ATOM   6500 C  CD    . LYS D 1 166 ? 39.203  15.217 67.406  1.00 51.54  ?  183 LYS D CD    1 
ATOM   6501 C  CE    . LYS D 1 166 ? 39.895  16.542 67.680  1.00 50.73  ?  183 LYS D CE    1 
ATOM   6502 N  NZ    . LYS D 1 166 ? 38.925  17.651 67.883  1.00 50.76  1  183 LYS D NZ    1 
ATOM   6503 N  N     . GLN D 1 167 ? 36.607  11.557 64.182  1.00 33.89  ?  184 GLN D N     1 
ATOM   6504 C  CA    . GLN D 1 167 ? 36.737  10.242 63.564  1.00 35.22  ?  184 GLN D CA    1 
ATOM   6505 C  C     . GLN D 1 167 ? 36.237  10.220 62.121  1.00 34.74  ?  184 GLN D C     1 
ATOM   6506 O  O     . GLN D 1 167 ? 36.806  9.537  61.271  1.00 34.95  ?  184 GLN D O     1 
ATOM   6507 C  CB    . GLN D 1 167 ? 35.985  9.194  64.387  1.00 37.77  ?  184 GLN D CB    1 
ATOM   6508 N  N     . ARG D 1 168 ? 35.170  10.965 61.850  1.00 57.07  ?  185 ARG D N     1 
ATOM   6509 C  CA    . ARG D 1 168 ? 34.548  10.946 60.531  1.00 56.69  ?  185 ARG D CA    1 
ATOM   6510 C  C     . ARG D 1 168 ? 35.338  11.823 59.562  1.00 54.41  ?  185 ARG D C     1 
ATOM   6511 O  O     . ARG D 1 168 ? 35.551  11.449 58.408  1.00 54.01  ?  185 ARG D O     1 
ATOM   6512 C  CB    . ARG D 1 168 ? 33.095  11.412 60.619  1.00 57.71  ?  185 ARG D CB    1 
ATOM   6513 C  CG    . ARG D 1 168 ? 32.294  11.305 59.327  1.00 58.06  ?  185 ARG D CG    1 
ATOM   6514 C  CD    . ARG D 1 168 ? 32.212  9.855  58.863  1.00 59.68  ?  185 ARG D CD    1 
ATOM   6515 N  NE    . ARG D 1 168 ? 31.419  9.694  57.646  1.00 60.56  ?  185 ARG D NE    1 
ATOM   6516 C  CZ    . ARG D 1 168 ? 31.916  9.685  56.414  1.00 60.23  ?  185 ARG D CZ    1 
ATOM   6517 N  NH1   . ARG D 1 168 ? 33.219  9.834  56.218  1.00 59.00  1  185 ARG D NH1   1 
ATOM   6518 N  NH2   . ARG D 1 168 ? 31.107  9.529  55.374  1.00 61.26  ?  185 ARG D NH2   1 
ATOM   6519 N  N     . ILE D 1 169 ? 35.763  12.993 60.035  1.00 53.77  ?  186 ILE D N     1 
ATOM   6520 C  CA    . ILE D 1 169 ? 36.594  13.887 59.234  1.00 51.67  ?  186 ILE D CA    1 
ATOM   6521 C  C     . ILE D 1 169 ? 37.900  13.198 58.853  1.00 51.34  ?  186 ILE D C     1 
ATOM   6522 O  O     . ILE D 1 169 ? 38.338  13.269 57.704  1.00 50.54  ?  186 ILE D O     1 
ATOM   6523 C  CB    . ILE D 1 169 ? 36.914  15.204 59.975  1.00 50.79  ?  186 ILE D CB    1 
ATOM   6524 C  CG1   . ILE D 1 169 ? 35.632  15.983 60.277  1.00 51.40  ?  186 ILE D CG1   1 
ATOM   6525 C  CG2   . ILE D 1 169 ? 37.859  16.065 59.153  1.00 48.70  ?  186 ILE D CG2   1 
ATOM   6526 C  CD1   . ILE D 1 169 ? 34.802  16.298 59.062  1.00 50.76  ?  186 ILE D CD1   1 
ATOM   6527 N  N     . THR D 1 170 ? 38.511  12.528 59.827  1.00 48.68  ?  187 THR D N     1 
ATOM   6528 C  CA    . THR D 1 170 ? 39.746  11.784 59.604  1.00 48.71  ?  187 THR D CA    1 
ATOM   6529 C  C     . THR D 1 170 ? 39.581  10.764 58.481  1.00 49.71  ?  187 THR D C     1 
ATOM   6530 O  O     . THR D 1 170 ? 40.427  10.661 57.595  1.00 49.52  ?  187 THR D O     1 
ATOM   6531 C  CB    . THR D 1 170 ? 40.203  11.056 60.885  1.00 49.93  ?  187 THR D CB    1 
ATOM   6532 O  OG1   . THR D 1 170 ? 40.343  12.002 61.952  1.00 49.96  ?  187 THR D OG1   1 
ATOM   6533 C  CG2   . THR D 1 170 ? 41.533  10.353 60.657  1.00 50.21  ?  187 THR D CG2   1 
ATOM   6534 N  N     . ALA D 1 171 ? 38.483  10.016 58.527  1.00 40.19  ?  188 ALA D N     1 
ATOM   6535 C  CA    . ALA D 1 171 ? 38.204  8.992  57.526  1.00 41.64  ?  188 ALA D CA    1 
ATOM   6536 C  C     . ALA D 1 171 ? 37.992  9.602  56.140  1.00 40.67  ?  188 ALA D C     1 
ATOM   6537 O  O     . ALA D 1 171 ? 38.415  9.035  55.133  1.00 41.27  ?  188 ALA D O     1 
ATOM   6538 C  CB    . ALA D 1 171 ? 36.993  8.174  57.932  1.00 43.69  ?  188 ALA D CB    1 
ATOM   6539 N  N     . ASP D 1 172 ? 37.335  10.759 56.098  1.00 41.13  ?  189 ASP D N     1 
ATOM   6540 C  CA    . ASP D 1 172 ? 37.056  11.433 54.836  1.00 40.30  ?  189 ASP D CA    1 
ATOM   6541 C  C     . ASP D 1 172 ? 38.338  11.944 54.185  1.00 38.91  ?  189 ASP D C     1 
ATOM   6542 O  O     . ASP D 1 172 ? 38.515  11.824 52.971  1.00 39.45  ?  189 ASP D O     1 
ATOM   6543 C  CB    . ASP D 1 172 ? 36.077  12.587 55.046  1.00 39.48  ?  189 ASP D CB    1 
ATOM   6544 C  CG    . ASP D 1 172 ? 34.643  12.115 55.201  1.00 41.14  ?  189 ASP D CG    1 
ATOM   6545 O  OD1   . ASP D 1 172 ? 34.328  10.996 54.744  1.00 42.89  ?  189 ASP D OD1   1 
ATOM   6546 O  OD2   . ASP D 1 172 ? 33.828  12.864 55.782  1.00 41.11  -1 189 ASP D OD2   1 
ATOM   6547 N  N     . LEU D 1 173 ? 39.223  12.522 54.994  1.00 30.82  ?  190 LEU D N     1 
ATOM   6548 C  CA    . LEU D 1 173 ? 40.508  13.005 54.501  1.00 30.04  ?  190 LEU D CA    1 
ATOM   6549 C  C     . LEU D 1 173 ? 41.292  11.862 53.870  1.00 31.55  ?  190 LEU D C     1 
ATOM   6550 O  O     . LEU D 1 173 ? 41.877  12.012 52.797  1.00 31.66  ?  190 LEU D O     1 
ATOM   6551 C  CB    . LEU D 1 173 ? 41.321  13.644 55.629  1.00 28.85  ?  190 LEU D CB    1 
ATOM   6552 C  CG    . LEU D 1 173 ? 40.732  14.910 56.254  1.00 27.36  ?  190 LEU D CG    1 
ATOM   6553 C  CD1   . LEU D 1 173 ? 41.639  15.451 57.349  1.00 26.68  ?  190 LEU D CD1   1 
ATOM   6554 C  CD2   . LEU D 1 173 ? 40.477  15.961 55.188  1.00 26.45  ?  190 LEU D CD2   1 
ATOM   6555 N  N     . LEU D 1 174 ? 41.292  10.718 54.547  1.00 43.19  ?  191 LEU D N     1 
ATOM   6556 C  CA    . LEU D 1 174 ? 41.998  9.534  54.074  1.00 44.85  ?  191 LEU D CA    1 
ATOM   6557 C  C     . LEU D 1 174 ? 41.391  8.977  52.788  1.00 46.21  ?  191 LEU D C     1 
ATOM   6558 O  O     . LEU D 1 174 ? 42.111  8.652  51.844  1.00 47.02  ?  191 LEU D O     1 
ATOM   6559 C  CB    . LEU D 1 174 ? 42.003  8.455  55.157  1.00 46.07  ?  191 LEU D CB    1 
ATOM   6560 C  CG    . LEU D 1 174 ? 42.814  8.780  56.413  1.00 45.27  ?  191 LEU D CG    1 
ATOM   6561 C  CD1   . LEU D 1 174 ? 42.678  7.671  57.446  1.00 47.09  ?  191 LEU D CD1   1 
ATOM   6562 C  CD2   . LEU D 1 174 ? 44.273  9.019  56.062  1.00 44.90  ?  191 LEU D CD2   1 
ATOM   6563 N  N     . SER D 1 175 ? 40.066  8.863  52.758  1.00 33.62  ?  192 SER D N     1 
ATOM   6564 C  CA    . SER D 1 175 ? 39.379  8.274  51.613  1.00 35.25  ?  192 SER D CA    1 
ATOM   6565 C  C     . SER D 1 175 ? 39.486  9.145  50.365  1.00 34.58  ?  192 SER D C     1 
ATOM   6566 O  O     . SER D 1 175 ? 39.488  8.636  49.244  1.00 36.04  ?  192 SER D O     1 
ATOM   6567 C  CB    . SER D 1 175 ? 37.907  8.025  51.948  1.00 36.02  ?  192 SER D CB    1 
ATOM   6568 O  OG    . SER D 1 175 ? 37.259  9.226  52.329  1.00 34.27  ?  192 SER D OG    1 
ATOM   6569 N  N     . ASN D 1 176 ? 39.574  10.457 50.560  1.00 40.10  ?  193 ASN D N     1 
ATOM   6570 C  CA    . ASN D 1 176 ? 39.695  11.383 49.440  1.00 39.45  ?  193 ASN D CA    1 
ATOM   6571 C  C     . ASN D 1 176 ? 41.147  11.693 49.092  1.00 38.92  ?  193 ASN D C     1 
ATOM   6572 O  O     . ASN D 1 176 ? 41.421  12.482 48.189  1.00 38.44  ?  193 ASN D O     1 
ATOM   6573 C  CB    . ASN D 1 176 ? 38.942  12.680 49.738  1.00 37.75  ?  193 ASN D CB    1 
ATOM   6574 C  CG    . ASN D 1 176 ? 37.445  12.542 49.536  1.00 38.58  ?  193 ASN D CG    1 
ATOM   6575 O  OD1   . ASN D 1 176 ? 36.960  12.528 48.404  1.00 39.55  ?  193 ASN D OD1   1 
ATOM   6576 N  ND2   . ASN D 1 176 ? 36.705  12.443 50.633  1.00 38.37  ?  193 ASN D ND2   1 
ATOM   6577 N  N     . GLY D 1 177 ? 42.072  11.065 49.812  1.00 42.48  ?  194 GLY D N     1 
ATOM   6578 C  CA    . GLY D 1 177 ? 43.490  11.234 49.552  1.00 42.28  ?  194 GLY D CA    1 
ATOM   6579 C  C     . GLY D 1 177 ? 43.989  12.645 49.802  1.00 40.29  ?  194 GLY D C     1 
ATOM   6580 O  O     . GLY D 1 177 ? 44.958  13.087 49.184  1.00 40.14  ?  194 GLY D O     1 
ATOM   6581 N  N     . ILE D 1 178 ? 43.327  13.354 50.709  1.00 31.90  ?  195 ILE D N     1 
ATOM   6582 C  CA    . ILE D 1 178 ? 43.728  14.711 51.062  1.00 30.12  ?  195 ILE D CA    1 
ATOM   6583 C  C     . ILE D 1 178 ? 44.902  14.690 52.036  1.00 29.75  ?  195 ILE D C     1 
ATOM   6584 O  O     . ILE D 1 178 ? 44.740  14.371 53.215  1.00 29.64  ?  195 ILE D O     1 
ATOM   6585 C  CB    . ILE D 1 178 ? 42.562  15.505 51.678  1.00 28.97  ?  195 ILE D CB    1 
ATOM   6586 C  CG1   . ILE D 1 178 ? 41.376  15.544 50.711  1.00 29.50  ?  195 ILE D CG1   1 
ATOM   6587 C  CG2   . ILE D 1 178 ? 43.007  16.915 52.036  1.00 27.30  ?  195 ILE D CG2   1 
ATOM   6588 C  CD1   . ILE D 1 178 ? 40.129  16.166 51.297  1.00 28.73  ?  195 ILE D CD1   1 
ATOM   6589 N  N     . ASP D 1 179 ? 46.084  15.028 51.532  1.00 56.26  ?  196 ASP D N     1 
ATOM   6590 C  CA    . ASP D 1 179 ? 47.301  15.012 52.336  1.00 56.18  ?  196 ASP D CA    1 
ATOM   6591 C  C     . ASP D 1 179 ? 47.453  16.275 53.178  1.00 54.61  ?  196 ASP D C     1 
ATOM   6592 O  O     . ASP D 1 179 ? 47.722  17.356 52.653  1.00 54.04  ?  196 ASP D O     1 
ATOM   6593 C  CB    . ASP D 1 179 ? 48.526  14.837 51.437  1.00 57.09  ?  196 ASP D CB    1 
ATOM   6594 N  N     . VAL D 1 180 ? 47.281  16.129 54.488  1.00 49.41  ?  197 VAL D N     1 
ATOM   6595 C  CA    . VAL D 1 180 ? 47.411  17.249 55.413  1.00 48.33  ?  197 VAL D CA    1 
ATOM   6596 C  C     . VAL D 1 180 ? 48.735  17.184 56.172  1.00 48.54  ?  197 VAL D C     1 
ATOM   6597 O  O     . VAL D 1 180 ? 49.338  16.116 56.287  1.00 49.87  ?  197 VAL D O     1 
ATOM   6598 C  CB    . VAL D 1 180 ? 46.249  17.276 56.422  1.00 48.07  ?  197 VAL D CB    1 
ATOM   6599 C  CG1   . VAL D 1 180 ? 44.921  17.320 55.688  1.00 48.06  ?  197 VAL D CG1   1 
ATOM   6600 C  CG2   . VAL D 1 180 ? 46.309  16.060 57.333  1.00 49.10  ?  197 VAL D CG2   1 
ATOM   6601 N  N     . TYR D 1 181 ? 49.194  18.326 56.677  1.00 29.91  ?  198 TYR D N     1 
ATOM   6602 C  CA    . TYR D 1 181 ? 50.405  18.352 57.491  1.00 30.37  ?  198 TYR D CA    1 
ATOM   6603 C  C     . TYR D 1 181 ? 50.120  17.773 58.874  1.00 30.85  ?  198 TYR D C     1 
ATOM   6604 O  O     . TYR D 1 181 ? 49.095  18.086 59.480  1.00 30.38  ?  198 TYR D O     1 
ATOM   6605 C  CB    . TYR D 1 181 ? 50.965  19.775 57.620  1.00 29.43  ?  198 TYR D CB    1 
ATOM   6606 C  CG    . TYR D 1 181 ? 52.218  19.836 58.470  1.00 30.13  ?  198 TYR D CG    1 
ATOM   6607 C  CD1   . TYR D 1 181 ? 53.471  19.619 57.909  1.00 31.07  ?  198 TYR D CD1   1 
ATOM   6608 C  CD2   . TYR D 1 181 ? 52.148  20.080 59.837  1.00 30.46  ?  198 TYR D CD2   1 
ATOM   6609 C  CE1   . TYR D 1 181 ? 54.617  19.654 58.681  1.00 32.07  ?  198 TYR D CE1   1 
ATOM   6610 C  CE2   . TYR D 1 181 ? 53.290  20.116 60.617  1.00 31.59  ?  198 TYR D CE2   1 
ATOM   6611 C  CZ    . TYR D 1 181 ? 54.521  19.903 60.033  1.00 32.40  ?  198 TYR D CZ    1 
ATOM   6612 O  OH    . TYR D 1 181 ? 55.662  19.940 60.801  1.00 33.74  ?  198 TYR D OH    1 
ATOM   6613 N  N     . PRO D 1 182 ? 51.033  16.931 59.384  1.00 33.43  ?  199 PRO D N     1 
ATOM   6614 C  CA    . PRO D 1 182 ? 52.249  16.503 58.689  1.00 34.31  ?  199 PRO D CA    1 
ATOM   6615 C  C     . PRO D 1 182 ? 52.016  15.284 57.808  1.00 35.35  ?  199 PRO D C     1 
ATOM   6616 O  O     . PRO D 1 182 ? 51.556  14.247 58.289  1.00 36.21  ?  199 PRO D O     1 
ATOM   6617 C  CB    . PRO D 1 182 ? 53.214  16.183 59.834  1.00 35.60  ?  199 PRO D CB    1 
ATOM   6618 C  CG    . PRO D 1 182 ? 52.343  15.936 61.044  1.00 35.86  ?  199 PRO D CG    1 
ATOM   6619 C  CD    . PRO D 1 182 ? 50.921  16.306 60.711  1.00 34.56  ?  199 PRO D CD    1 
ATOM   6620 N  N     . GLN D 1 183 ? 52.327  15.425 56.524  1.00 35.57  ?  200 GLN D N     1 
ATOM   6621 C  CA    . GLN D 1 183 ? 52.166  14.339 55.570  1.00 36.73  ?  200 GLN D CA    1 
ATOM   6622 C  C     . GLN D 1 183 ? 53.018  13.150 55.994  1.00 38.50  ?  200 GLN D C     1 
ATOM   6623 O  O     . GLN D 1 183 ? 54.193  13.309 56.329  1.00 39.06  ?  200 GLN D O     1 
ATOM   6624 C  CB    . GLN D 1 183 ? 52.555  14.790 54.159  1.00 36.73  ?  200 GLN D CB    1 
ATOM   6625 C  CG    . GLN D 1 183 ? 51.795  16.005 53.635  1.00 35.18  ?  200 GLN D CG    1 
ATOM   6626 C  CD    . GLN D 1 183 ? 52.353  17.320 54.153  1.00 34.06  ?  200 GLN D CD    1 
ATOM   6627 O  OE1   . GLN D 1 183 ? 53.238  17.339 55.010  1.00 34.41  ?  200 GLN D OE1   1 
ATOM   6628 N  NE2   . GLN D 1 183 ? 51.840  18.429 53.629  1.00 32.88  ?  200 GLN D NE2   1 
ATOM   6629 N  N     . LYS D 1 184 ? 52.419  11.964 55.992  1.00 58.46  ?  201 LYS D N     1 
ATOM   6630 C  CA    . LYS D 1 184 ? 53.111  10.751 56.411  1.00 60.32  ?  201 LYS D CA    1 
ATOM   6631 C  C     . LYS D 1 184 ? 54.304  10.456 55.507  1.00 61.45  ?  201 LYS D C     1 
ATOM   6632 O  O     . LYS D 1 184 ? 55.293  9.862  55.938  1.00 62.75  ?  201 LYS D O     1 
ATOM   6633 C  CB    . LYS D 1 184 ? 52.149  9.561  56.419  1.00 61.15  ?  201 LYS D CB    1 
ATOM   6634 N  N     . GLU D 1 185 ? 54.202  10.881 54.252  1.00 42.18  ?  202 GLU D N     1 
ATOM   6635 C  CA    . GLU D 1 185 ? 55.242  10.634 53.259  1.00 43.49  ?  202 GLU D CA    1 
ATOM   6636 C  C     . GLU D 1 185 ? 56.507  11.459 53.495  1.00 43.37  ?  202 GLU D C     1 
ATOM   6637 O  O     . GLU D 1 185 ? 57.495  11.301 52.779  1.00 44.62  ?  202 GLU D O     1 
ATOM   6638 C  CB    . GLU D 1 185 ? 54.701  10.914 51.855  1.00 43.25  ?  202 GLU D CB    1 
ATOM   6639 N  N     . PHE D 1 186 ? 56.477  12.337 54.492  1.00 37.85  ?  203 PHE D N     1 
ATOM   6640 C  CA    . PHE D 1 186 ? 57.615  13.208 54.773  1.00 37.79  ?  203 PHE D CA    1 
ATOM   6641 C  C     . PHE D 1 186 ? 58.242  12.910 56.132  1.00 38.56  ?  203 PHE D C     1 
ATOM   6642 O  O     . PHE D 1 186 ? 59.046  13.692 56.638  1.00 38.48  ?  203 PHE D O     1 
ATOM   6643 C  CB    . PHE D 1 186 ? 57.195  14.679 54.706  1.00 35.83  ?  203 PHE D CB    1 
ATOM   6644 C  CG    . PHE D 1 186 ? 56.682  15.103 53.359  1.00 35.23  ?  203 PHE D CG    1 
ATOM   6645 C  CD1   . PHE D 1 186 ? 57.205  14.555 52.199  1.00 36.61  ?  203 PHE D CD1   1 
ATOM   6646 C  CD2   . PHE D 1 186 ? 55.683  16.056 53.252  1.00 33.47  ?  203 PHE D CD2   1 
ATOM   6647 C  CE1   . PHE D 1 186 ? 56.736  14.943 50.959  1.00 36.28  ?  203 PHE D CE1   1 
ATOM   6648 C  CE2   . PHE D 1 186 ? 55.210  16.450 52.013  1.00 33.11  ?  203 PHE D CE2   1 
ATOM   6649 C  CZ    . PHE D 1 186 ? 55.738  15.892 50.865  1.00 34.53  ?  203 PHE D CZ    1 
ATOM   6650 N  N     . ASP D 1 187 ? 57.872  11.776 56.717  1.00 75.46  ?  204 ASP D N     1 
ATOM   6651 C  CA    . ASP D 1 187 ? 58.437  11.358 57.995  1.00 76.78  ?  204 ASP D CA    1 
ATOM   6652 C  C     . ASP D 1 187 ? 59.827  10.758 57.808  1.00 78.92  ?  204 ASP D C     1 
ATOM   6653 O  O     . ASP D 1 187 ? 60.011  9.826  57.026  1.00 80.31  ?  204 ASP D O     1 
ATOM   6654 C  CB    . ASP D 1 187 ? 57.515  10.351 58.687  1.00 77.26  ?  204 ASP D CB    1 
ATOM   6655 C  CG    . ASP D 1 187 ? 56.164  10.944 59.037  1.00 75.55  ?  204 ASP D CG    1 
ATOM   6656 O  OD1   . ASP D 1 187 ? 56.078  12.180 59.199  1.00 74.24  ?  204 ASP D OD1   1 
ATOM   6657 O  OD2   . ASP D 1 187 ? 55.187  10.174 59.151  1.00 75.80  -1 204 ASP D OD2   1 
ATOM   6658 N  N     . GLU D 1 188 ? 60.800  11.300 58.533  1.00 69.15  ?  205 GLU D N     1 
ATOM   6659 C  CA    . GLU D 1 188 ? 62.192  10.885 58.388  1.00 71.26  ?  205 GLU D CA    1 
ATOM   6660 C  C     . GLU D 1 188 ? 62.478  9.570  59.107  1.00 73.15  ?  205 GLU D C     1 
ATOM   6661 O  O     . GLU D 1 188 ? 62.633  8.528  58.471  1.00 74.57  ?  205 GLU D O     1 
ATOM   6662 C  CB    . GLU D 1 188 ? 63.127  11.977 58.912  1.00 71.47  ?  205 GLU D CB    1 
ATOM   6663 N  N     . ASP D 1 189 ? 62.550  9.625  60.433  1.00 63.48  ?  206 ASP D N     1 
ATOM   6664 C  CA    . ASP D 1 189 ? 62.851  8.439  61.227  1.00 65.62  ?  206 ASP D CA    1 
ATOM   6665 C  C     . ASP D 1 189 ? 61.743  8.135  62.229  1.00 65.24  ?  206 ASP D C     1 
ATOM   6666 O  O     . ASP D 1 189 ? 60.653  8.703  62.155  1.00 63.55  ?  206 ASP D O     1 
ATOM   6667 C  CB    . ASP D 1 189 ? 64.184  8.614  61.959  1.00 67.78  ?  206 ASP D CB    1 
ATOM   6668 C  CG    . ASP D 1 189 ? 64.255  9.912  62.741  1.00 67.05  ?  206 ASP D CG    1 
ATOM   6669 O  OD1   . ASP D 1 189 ? 63.617  10.001 63.811  1.00 66.95  ?  206 ASP D OD1   1 
ATOM   6670 O  OD2   . ASP D 1 189 ? 64.950  10.846 62.286  1.00 66.81  -1 206 ASP D OD2   1 
ATOM   6671 N  N     . SER D 1 190 ? 62.030  7.235  63.164  1.00 59.40  ?  207 SER D N     1 
ATOM   6672 C  CA    . SER D 1 190 ? 61.041  6.800  64.144  1.00 58.93  ?  207 SER D CA    1 
ATOM   6673 C  C     . SER D 1 190 ? 60.706  7.903  65.144  1.00 56.80  ?  207 SER D C     1 
ATOM   6674 O  O     . SER D 1 190 ? 59.569  8.013  65.601  1.00 55.57  ?  207 SER D O     1 
ATOM   6675 C  CB    . SER D 1 190 ? 61.538  5.558  64.885  1.00 61.59  ?  207 SER D CB    1 
ATOM   6676 O  OG    . SER D 1 190 ? 62.668  5.859  65.686  1.00 62.32  ?  207 SER D OG    1 
ATOM   6677 N  N     . GLU D 1 191 ? 61.701  8.720  65.477  1.00 54.64  ?  208 GLU D N     1 
ATOM   6678 C  CA    . GLU D 1 191 ? 61.511  9.803  66.434  1.00 53.09  ?  208 GLU D CA    1 
ATOM   6679 C  C     . GLU D 1 191 ? 60.754  10.962 65.796  1.00 50.50  ?  208 GLU D C     1 
ATOM   6680 O  O     . GLU D 1 191 ? 59.999  11.669 66.464  1.00 48.97  ?  208 GLU D O     1 
ATOM   6681 C  CB    . GLU D 1 191 ? 62.857  10.284 66.977  1.00 54.27  ?  208 GLU D CB    1 
ATOM   6682 N  N     . ASP D 1 192 ? 60.962  11.149 64.497  1.00 91.03  ?  209 ASP D N     1 
ATOM   6683 C  CA    . ASP D 1 192 ? 60.242  12.165 63.740  1.00 88.70  ?  209 ASP D CA    1 
ATOM   6684 C  C     . ASP D 1 192 ? 58.788  11.752 63.544  1.00 86.39  ?  209 ASP D C     1 
ATOM   6685 O  O     . ASP D 1 192 ? 57.890  12.593 63.509  1.00 84.56  ?  209 ASP D O     1 
ATOM   6686 C  CB    . ASP D 1 192 ? 60.915  12.404 62.386  1.00 88.23  ?  209 ASP D CB    1 
ATOM   6687 C  CG    . ASP D 1 192 ? 60.211  13.467 61.564  1.00 85.76  ?  209 ASP D CG    1 
ATOM   6688 O  OD1   . ASP D 1 192 ? 59.726  14.455 62.155  1.00 84.87  ?  209 ASP D OD1   1 
ATOM   6689 O  OD2   . ASP D 1 192 ? 60.142  13.313 60.326  1.00 84.37  -1 209 ASP D OD2   1 
ATOM   6690 N  N     . ARG D 1 193 ? 58.565  10.449 63.411  1.00 68.56  ?  210 ARG D N     1 
ATOM   6691 C  CA    . ARG D 1 193 ? 57.227  9.915  63.192  1.00 66.88  ?  210 ARG D CA    1 
ATOM   6692 C  C     . ARG D 1 193 ? 56.368  10.007 64.453  1.00 67.17  ?  210 ARG D C     1 
ATOM   6693 O  O     . ARG D 1 193 ? 55.168  10.268 64.375  1.00 65.80  ?  210 ARG D O     1 
ATOM   6694 C  CB    . ARG D 1 193 ? 57.304  8.463  62.711  1.00 68.73  ?  210 ARG D CB    1 
ATOM   6695 C  CG    . ARG D 1 193 ? 55.997  7.925  62.148  1.00 68.89  ?  210 ARG D CG    1 
ATOM   6696 C  CD    . ARG D 1 193 ? 56.063  6.424  61.916  1.00 71.84  ?  210 ARG D CD    1 
ATOM   6697 N  NE    . ARG D 1 193 ? 56.340  5.686  63.145  1.00 73.63  ?  210 ARG D NE    1 
ATOM   6698 C  CZ    . ARG D 1 193 ? 55.429  5.416  64.074  1.00 73.92  ?  210 ARG D CZ    1 
ATOM   6699 N  NH1   . ARG D 1 193 ? 54.177  5.824  63.916  1.00 72.63  1  210 ARG D NH1   1 
ATOM   6700 N  NH2   . ARG D 1 193 ? 55.770  4.737  65.162  1.00 75.76  ?  210 ARG D NH2   1 
ATOM   6701 N  N     . LEU D 1 194 ? 56.988  9.792  65.610  1.00 54.65  ?  211 LEU D N     1 
ATOM   6702 C  CA    . LEU D 1 194 ? 56.269  9.789  66.883  1.00 54.62  ?  211 LEU D CA    1 
ATOM   6703 C  C     . LEU D 1 194 ? 55.633  11.139 67.211  1.00 52.34  ?  211 LEU D C     1 
ATOM   6704 O  O     . LEU D 1 194 ? 54.467  11.201 67.600  1.00 51.76  ?  211 LEU D O     1 
ATOM   6705 C  CB    . LEU D 1 194 ? 57.205  9.370  68.018  1.00 56.48  ?  211 LEU D CB    1 
ATOM   6706 C  CG    . LEU D 1 194 ? 57.467  7.868  68.153  1.00 59.08  ?  211 LEU D CG    1 
ATOM   6707 C  CD1   . LEU D 1 194 ? 58.454  7.589  69.276  1.00 60.83  ?  211 LEU D CD1   1 
ATOM   6708 C  CD2   . LEU D 1 194 ? 56.164  7.118  68.382  1.00 59.68  ?  211 LEU D CD2   1 
ATOM   6709 N  N     . VAL D 1 195 ? 56.399  12.215 67.061  1.00 84.77  ?  212 VAL D N     1 
ATOM   6710 C  CA    . VAL D 1 195 ? 55.886  13.555 67.337  1.00 83.58  ?  212 VAL D CA    1 
ATOM   6711 C  C     . VAL D 1 195 ? 54.837  13.971 66.311  1.00 81.08  ?  212 VAL D C     1 
ATOM   6712 O  O     . VAL D 1 195 ? 53.933  14.748 66.616  1.00 80.43  ?  212 VAL D O     1 
ATOM   6713 C  CB    . VAL D 1 195 ? 57.013  14.603 67.373  1.00 83.58  ?  212 VAL D CB    1 
ATOM   6714 C  CG1   . VAL D 1 195 ? 57.807  14.472 68.659  1.00 85.37  ?  212 VAL D CG1   1 
ATOM   6715 C  CG2   . VAL D 1 195 ? 57.912  14.476 66.152  1.00 83.29  ?  212 VAL D CG2   1 
ATOM   6716 N  N     . ASN D 1 196 ? 54.966  13.452 65.095  1.00 59.91  ?  213 ASN D N     1 
ATOM   6717 C  CA    . ASN D 1 196 ? 54.006  13.735 64.037  1.00 57.48  ?  213 ASN D CA    1 
ATOM   6718 C  C     . ASN D 1 196 ? 52.675  13.043 64.298  1.00 57.32  ?  213 ASN D C     1 
ATOM   6719 O  O     . ASN D 1 196 ? 51.616  13.567 63.950  1.00 55.97  ?  213 ASN D O     1 
ATOM   6720 C  CB    . ASN D 1 196 ? 54.560  13.310 62.676  1.00 56.12  ?  213 ASN D CB    1 
ATOM   6721 C  CG    . ASN D 1 196 ? 55.511  14.334 62.088  1.00 55.69  ?  213 ASN D CG    1 
ATOM   6722 O  OD1   . ASN D 1 196 ? 55.859  15.320 62.739  1.00 56.20  ?  213 ASN D OD1   1 
ATOM   6723 N  ND2   . ASN D 1 196 ? 55.932  14.109 60.849  1.00 55.15  ?  213 ASN D ND2   1 
ATOM   6724 N  N     . GLU D 1 197 ? 52.735  11.862 64.905  1.00 82.56  ?  214 GLU D N     1 
ATOM   6725 C  CA    . GLU D 1 197 ? 51.529  11.128 65.268  1.00 82.68  ?  214 GLU D CA    1 
ATOM   6726 C  C     . GLU D 1 197 ? 50.683  11.920 66.259  1.00 83.20  ?  214 GLU D C     1 
ATOM   6727 O  O     . GLU D 1 197 ? 49.462  11.975 66.135  1.00 82.44  ?  214 GLU D O     1 
ATOM   6728 C  CB    . GLU D 1 197 ? 51.884  9.761  65.857  1.00 84.17  ?  214 GLU D CB    1 
ATOM   6729 C  CG    . GLU D 1 197 ? 52.357  8.742  64.832  1.00 84.97  ?  214 GLU D CG    1 
ATOM   6730 C  CD    . GLU D 1 197 ? 51.324  8.470  63.756  1.00 85.03  ?  214 GLU D CD    1 
ATOM   6731 O  OE1   . GLU D 1 197 ? 50.115  8.473  64.072  1.00 85.22  ?  214 GLU D OE1   1 
ATOM   6732 O  OE2   . GLU D 1 197 ? 51.721  8.252  62.592  1.00 85.34  -1 214 GLU D OE2   1 
ATOM   6733 N  N     . LYS D 1 198 ? 51.341  12.541 67.234  1.00 69.31  ?  215 LYS D N     1 
ATOM   6734 C  CA    . LYS D 1 198 ? 50.653  13.346 68.238  1.00 70.26  ?  215 LYS D CA    1 
ATOM   6735 C  C     . LYS D 1 198 ? 49.933  14.535 67.606  1.00 68.37  ?  215 LYS D C     1 
ATOM   6736 O  O     . LYS D 1 198 ? 48.933  15.021 68.135  1.00 68.37  ?  215 LYS D O     1 
ATOM   6737 C  CB    . LYS D 1 198 ? 51.640  13.838 69.300  1.00 72.47  ?  215 LYS D CB    1 
ATOM   6738 C  CG    . LYS D 1 198 ? 52.282  12.729 70.118  1.00 74.75  ?  215 LYS D CG    1 
ATOM   6739 C  CD    . LYS D 1 198 ? 53.354  13.278 71.046  1.00 75.92  ?  215 LYS D CD    1 
ATOM   6740 C  CE    . LYS D 1 198 ? 52.785  14.313 72.003  1.00 75.73  ?  215 LYS D CE    1 
ATOM   6741 N  NZ    . LYS D 1 198 ? 51.742  13.734 72.896  1.00 76.91  1  215 LYS D NZ    1 
ATOM   6742 N  N     . PHE D 1 199 ? 50.448  14.997 66.471  1.00 53.08  ?  216 PHE D N     1 
ATOM   6743 C  CA    . PHE D 1 199 ? 49.826  16.088 65.731  1.00 51.05  ?  216 PHE D CA    1 
ATOM   6744 C  C     . PHE D 1 199 ? 48.621  15.588 64.940  1.00 49.51  ?  216 PHE D C     1 
ATOM   6745 O  O     . PHE D 1 199 ? 47.555  16.204 64.960  1.00 48.97  ?  216 PHE D O     1 
ATOM   6746 C  CB    . PHE D 1 199 ? 50.840  16.741 64.786  1.00 49.62  ?  216 PHE D CB    1 
ATOM   6747 C  CG    . PHE D 1 199 ? 50.406  18.081 64.251  1.00 47.73  ?  216 PHE D CG    1 
ATOM   6748 C  CD1   . PHE D 1 199 ? 49.481  18.172 63.224  1.00 45.53  ?  216 PHE D CD1   1 
ATOM   6749 C  CD2   . PHE D 1 199 ? 50.945  19.249 64.761  1.00 48.00  ?  216 PHE D CD2   1 
ATOM   6750 C  CE1   . PHE D 1 199 ? 49.088  19.401 62.730  1.00 43.63  ?  216 PHE D CE1   1 
ATOM   6751 C  CE2   . PHE D 1 199 ? 50.557  20.481 64.271  1.00 46.15  ?  216 PHE D CE2   1 
ATOM   6752 C  CZ    . PHE D 1 199 ? 49.628  20.557 63.253  1.00 43.90  ?  216 PHE D CZ    1 
ATOM   6753 N  N     . ARG D 1 200 ? 48.801  14.471 64.241  1.00 49.68  ?  217 ARG D N     1 
ATOM   6754 C  CA    . ARG D 1 200 ? 47.763  13.922 63.374  1.00 49.24  ?  217 ARG D CA    1 
ATOM   6755 C  C     . ARG D 1 200 ? 46.546  13.435 64.155  1.00 50.49  ?  217 ARG D C     1 
ATOM   6756 O  O     . ARG D 1 200 ? 45.426  13.454 63.646  1.00 50.32  ?  217 ARG D O     1 
ATOM   6757 C  CB    . ARG D 1 200 ? 48.324  12.771 62.536  1.00 50.35  ?  217 ARG D CB    1 
ATOM   6758 C  CG    . ARG D 1 200 ? 49.274  13.203 61.434  1.00 49.28  ?  217 ARG D CG    1 
ATOM   6759 C  CD    . ARG D 1 200 ? 49.623  12.035 60.527  1.00 50.66  ?  217 ARG D CD    1 
ATOM   6760 N  NE    . ARG D 1 200 ? 50.966  12.152 59.967  1.00 50.99  ?  217 ARG D NE    1 
ATOM   6761 C  CZ    . ARG D 1 200 ? 52.018  11.471 60.408  1.00 52.69  ?  217 ARG D CZ    1 
ATOM   6762 N  NH1   . ARG D 1 200 ? 51.884  10.616 61.413  1.00 54.14  1  217 ARG D NH1   1 
ATOM   6763 N  NH2   . ARG D 1 200 ? 53.204  11.639 59.841  1.00 53.15  ?  217 ARG D NH2   1 
ATOM   6764 N  N     . GLU D 1 201 ? 46.773  12.999 65.391  1.00 73.33  ?  218 GLU D N     1 
ATOM   6765 C  CA    . GLU D 1 201 ? 45.694  12.510 66.244  1.00 73.90  ?  218 GLU D CA    1 
ATOM   6766 C  C     . GLU D 1 201 ? 44.759  13.637 66.666  1.00 73.29  ?  218 GLU D C     1 
ATOM   6767 O  O     . GLU D 1 201 ? 43.618  13.396 67.058  1.00 71.74  ?  218 GLU D O     1 
ATOM   6768 C  CB    . GLU D 1 201 ? 46.261  11.814 67.482  1.00 79.05  ?  218 GLU D CB    1 
ATOM   6769 C  CG    . GLU D 1 201 ? 46.941  10.486 67.198  1.00 80.25  ?  218 GLU D CG    1 
ATOM   6770 C  CD    . GLU D 1 201 ? 47.718  9.966  68.391  1.00 83.96  ?  218 GLU D CD    1 
ATOM   6771 O  OE1   . GLU D 1 201 ? 47.681  10.620 69.455  1.00 85.26  ?  218 GLU D OE1   1 
ATOM   6772 O  OE2   . GLU D 1 201 ? 48.369  8.908  68.264  1.00 85.45  -1 218 GLU D OE2   1 
ATOM   6773 N  N     . MET D 1 202 ? 45.249  14.869 66.579  1.00 56.59  ?  219 MET D N     1 
ATOM   6774 C  CA    . MET D 1 202 ? 44.465  16.031 66.972  1.00 56.58  ?  219 MET D CA    1 
ATOM   6775 C  C     . MET D 1 202 ? 43.643  16.552 65.800  1.00 51.22  ?  219 MET D C     1 
ATOM   6776 O  O     . MET D 1 202 ? 42.628  17.217 65.993  1.00 50.13  ?  219 MET D O     1 
ATOM   6777 C  CB    . MET D 1 202 ? 45.376  17.136 67.508  1.00 60.59  ?  219 MET D CB    1 
ATOM   6778 C  CG    . MET D 1 202 ? 46.207  16.730 68.711  1.00 65.18  ?  219 MET D CG    1 
ATOM   6779 S  SD    . MET D 1 202 ? 45.258  16.748 70.242  1.00 66.99  ?  219 MET D SD    1 
ATOM   6780 C  CE    . MET D 1 202 ? 44.879  18.492 70.383  1.00 67.95  ?  219 MET D CE    1 
ATOM   6781 N  N     . ILE D 1 203 ? 44.091  16.243 64.587  1.00 34.83  ?  220 ILE D N     1 
ATOM   6782 C  CA    . ILE D 1 203 ? 43.386  16.640 63.373  1.00 32.91  ?  220 ILE D CA    1 
ATOM   6783 C  C     . ILE D 1 203 ? 42.050  15.909 63.259  1.00 33.62  ?  220 ILE D C     1 
ATOM   6784 O  O     . ILE D 1 203 ? 42.002  14.684 63.377  1.00 35.83  ?  220 ILE D O     1 
ATOM   6785 C  CB    . ILE D 1 203 ? 44.237  16.358 62.115  1.00 32.76  ?  220 ILE D CB    1 
ATOM   6786 C  CG1   . ILE D 1 203 ? 45.521  17.189 62.144  1.00 32.16  ?  220 ILE D CG1   1 
ATOM   6787 C  CG2   . ILE D 1 203 ? 43.448  16.642 60.844  1.00 31.42  ?  220 ILE D CG2   1 
ATOM   6788 C  CD1   . ILE D 1 203 ? 46.462  16.891 61.000  1.00 32.48  ?  220 ILE D CD1   1 
ATOM   6789 N  N     . PRO D 1 204 ? 40.957  16.656 63.028  1.00 37.71  ?  221 PRO D N     1 
ATOM   6790 C  CA    . PRO D 1 204 ? 40.925  18.118 62.888  1.00 35.53  ?  221 PRO D CA    1 
ATOM   6791 C  C     . PRO D 1 204 ? 40.884  18.842 64.232  1.00 35.82  ?  221 PRO D C     1 
ATOM   6792 O  O     . PRO D 1 204 ? 40.072  18.498 65.092  1.00 37.03  ?  221 PRO D O     1 
ATOM   6793 C  CB    . PRO D 1 204 ? 39.637  18.359 62.102  1.00 34.54  ?  221 PRO D CB    1 
ATOM   6794 C  CG    . PRO D 1 204 ? 38.749  17.239 62.512  1.00 36.41  ?  221 PRO D CG    1 
ATOM   6795 C  CD    . PRO D 1 204 ? 39.640  16.051 62.760  1.00 38.45  ?  221 PRO D CD    1 
ATOM   6796 N  N     . PHE D 1 205 ? 41.764  19.823 64.409  1.00 41.36  ?  222 PHE D N     1 
ATOM   6797 C  CA    . PHE D 1 205 ? 41.845  20.569 65.662  1.00 46.09  ?  222 PHE D CA    1 
ATOM   6798 C  C     . PHE D 1 205 ? 40.533  21.262 66.005  1.00 44.22  ?  222 PHE D C     1 
ATOM   6799 O  O     . PHE D 1 205 ? 39.939  21.947 65.174  1.00 40.76  ?  222 PHE D O     1 
ATOM   6800 C  CB    . PHE D 1 205 ? 42.972  21.603 65.602  1.00 49.02  ?  222 PHE D CB    1 
ATOM   6801 C  CG    . PHE D 1 205 ? 44.347  21.015 65.735  1.00 51.69  ?  222 PHE D CG    1 
ATOM   6802 C  CD1   . PHE D 1 205 ? 44.985  20.446 64.645  1.00 47.94  ?  222 PHE D CD1   1 
ATOM   6803 C  CD2   . PHE D 1 205 ? 45.007  21.040 66.953  1.00 57.26  ?  222 PHE D CD2   1 
ATOM   6804 C  CE1   . PHE D 1 205 ? 46.253  19.908 64.770  1.00 49.81  ?  222 PHE D CE1   1 
ATOM   6805 C  CE2   . PHE D 1 205 ? 46.273  20.506 67.084  1.00 59.30  ?  222 PHE D CE2   1 
ATOM   6806 C  CZ    . PHE D 1 205 ? 46.897  19.939 65.992  1.00 55.61  ?  222 PHE D CZ    1 
ATOM   6807 N  N     . ALA D 1 206 ? 40.090  21.080 67.244  1.00 41.69  ?  223 ALA D N     1 
ATOM   6808 C  CA    . ALA D 1 206 ? 38.863  21.700 67.721  1.00 38.82  ?  223 ALA D CA    1 
ATOM   6809 C  C     . ALA D 1 206 ? 39.165  23.070 68.312  1.00 41.24  ?  223 ALA D C     1 
ATOM   6810 O  O     . ALA D 1 206 ? 39.583  23.178 69.464  1.00 44.37  ?  223 ALA D O     1 
ATOM   6811 C  CB    . ALA D 1 206 ? 38.183  20.811 68.749  1.00 40.47  ?  223 ALA D CB    1 
ATOM   6812 N  N     . VAL D 1 207 ? 38.957  24.117 67.520  1.00 43.14  ?  224 VAL D N     1 
ATOM   6813 C  CA    . VAL D 1 207 ? 39.292  25.466 67.957  1.00 44.92  ?  224 VAL D CA    1 
ATOM   6814 C  C     . VAL D 1 207 ? 38.054  26.239 68.401  1.00 41.19  ?  224 VAL D C     1 
ATOM   6815 O  O     . VAL D 1 207 ? 36.933  25.932 67.993  1.00 38.45  ?  224 VAL D O     1 
ATOM   6816 C  CB    . VAL D 1 207 ? 40.012  26.255 66.843  1.00 45.42  ?  224 VAL D CB    1 
ATOM   6817 C  CG1   . VAL D 1 207 ? 41.189  25.458 66.303  1.00 47.94  ?  224 VAL D CG1   1 
ATOM   6818 C  CG2   . VAL D 1 207 ? 39.045  26.610 65.723  1.00 40.00  ?  224 VAL D CG2   1 
ATOM   6819 N  N     . VAL D 1 208 ? 38.272  27.239 69.249  1.00 59.65  ?  225 VAL D N     1 
ATOM   6820 C  CA    . VAL D 1 208 ? 37.202  28.100 69.741  1.00 58.79  ?  225 VAL D CA    1 
ATOM   6821 C  C     . VAL D 1 208 ? 37.683  29.545 69.817  1.00 59.97  ?  225 VAL D C     1 
ATOM   6822 O  O     . VAL D 1 208 ? 38.694  29.837 70.457  1.00 62.39  ?  225 VAL D O     1 
ATOM   6823 C  CB    . VAL D 1 208 ? 36.698  27.658 71.136  1.00 60.15  ?  225 VAL D CB    1 
ATOM   6824 C  CG1   . VAL D 1 208 ? 35.757  28.702 71.719  1.00 61.30  ?  225 VAL D CG1   1 
ATOM   6825 C  CG2   . VAL D 1 208 ? 36.015  26.299 71.065  1.00 59.38  ?  225 VAL D CG2   1 
ATOM   6826 N  N     . GLY D 1 209 ? 36.960  30.446 69.160  1.00 54.36  ?  226 GLY D N     1 
ATOM   6827 C  CA    . GLY D 1 209 ? 37.294  31.858 69.191  1.00 55.59  ?  226 GLY D CA    1 
ATOM   6828 C  C     . GLY D 1 209 ? 37.061  32.484 70.552  1.00 58.20  ?  226 GLY D C     1 
ATOM   6829 O  O     . GLY D 1 209 ? 35.930  32.810 70.913  1.00 58.92  ?  226 GLY D O     1 
ATOM   6830 N  N     . CYS D 1 239 ? 39.528  25.725 72.880  1.00 100.47 ?  256 CYS D N     1 
ATOM   6831 C  CA    . CYS D 1 239 ? 39.538  24.322 73.277  1.00 101.15 ?  256 CYS D CA    1 
ATOM   6832 C  C     . CYS D 1 239 ? 40.926  23.721 73.071  1.00 105.02 ?  256 CYS D C     1 
ATOM   6833 O  O     . CYS D 1 239 ? 41.667  23.507 74.030  1.00 107.52 ?  256 CYS D O     1 
ATOM   6834 C  CB    . CYS D 1 239 ? 38.489  23.535 72.490  1.00 98.04  ?  256 CYS D CB    1 
ATOM   6835 S  SG    . CYS D 1 239 ? 38.043  21.943 73.218  1.00 98.82  ?  256 CYS D SG    1 
ATOM   6836 N  N     . GLU D 1 240 ? 41.271  23.450 71.816  1.00 63.93  ?  257 GLU D N     1 
ATOM   6837 C  CA    . GLU D 1 240 ? 42.553  22.835 71.489  1.00 68.83  ?  257 GLU D CA    1 
ATOM   6838 C  C     . GLU D 1 240 ? 43.399  23.811 70.683  1.00 71.14  ?  257 GLU D C     1 
ATOM   6839 O  O     . GLU D 1 240 ? 44.371  23.423 70.035  1.00 73.60  ?  257 GLU D O     1 
ATOM   6840 C  CB    . GLU D 1 240 ? 42.361  21.537 70.702  1.00 67.78  ?  257 GLU D CB    1 
ATOM   6841 C  CG    . GLU D 1 240 ? 41.538  20.476 71.410  1.00 64.41  ?  257 GLU D CG    1 
ATOM   6842 C  CD    . GLU D 1 240 ? 41.348  19.235 70.559  1.00 62.78  ?  257 GLU D CD    1 
ATOM   6843 O  OE1   . GLU D 1 240 ? 41.411  19.350 69.317  1.00 61.51  ?  257 GLU D OE1   1 
ATOM   6844 O  OE2   . GLU D 1 240 ? 41.139  18.144 71.132  1.00 61.94  -1 257 GLU D OE2   1 
ATOM   6845 N  N     . PHE D 1 241 ? 43.020  25.083 70.734  1.00 64.38  ?  258 PHE D N     1 
ATOM   6846 C  CA    . PHE D 1 241 ? 43.706  26.122 69.978  1.00 64.49  ?  258 PHE D CA    1 
ATOM   6847 C  C     . PHE D 1 241 ? 45.080  26.424 70.566  1.00 67.52  ?  258 PHE D C     1 
ATOM   6848 O  O     . PHE D 1 241 ? 46.030  26.697 69.832  1.00 67.48  ?  258 PHE D O     1 
ATOM   6849 C  CB    . PHE D 1 241 ? 42.859  27.395 69.934  1.00 60.40  ?  258 PHE D CB    1 
ATOM   6850 C  CG    . PHE D 1 241 ? 43.566  28.570 69.326  1.00 59.41  ?  258 PHE D CG    1 
ATOM   6851 C  CD1   . PHE D 1 241 ? 43.746  28.650 67.956  1.00 57.22  ?  258 PHE D CD1   1 
ATOM   6852 C  CD2   . PHE D 1 241 ? 44.045  29.598 70.122  1.00 59.72  ?  258 PHE D CD2   1 
ATOM   6853 C  CE1   . PHE D 1 241 ? 44.395  29.729 67.390  1.00 54.51  ?  258 PHE D CE1   1 
ATOM   6854 C  CE2   . PHE D 1 241 ? 44.695  30.680 69.562  1.00 57.98  ?  258 PHE D CE2   1 
ATOM   6855 C  CZ    . PHE D 1 241 ? 44.870  30.745 68.194  1.00 55.15  ?  258 PHE D CZ    1 
ATOM   6856 N  N     . ALA D 1 242 ? 45.172  26.379 71.892  1.00 53.76  ?  259 ALA D N     1 
ATOM   6857 C  CA    . ALA D 1 242 ? 46.429  26.626 72.589  1.00 55.95  ?  259 ALA D CA    1 
ATOM   6858 C  C     . ALA D 1 242 ? 47.489  25.611 72.175  1.00 58.45  ?  259 ALA D C     1 
ATOM   6859 O  O     . ALA D 1 242 ? 48.647  25.964 71.952  1.00 58.86  ?  259 ALA D O     1 
ATOM   6860 C  CB    . ALA D 1 242 ? 46.216  26.589 74.095  1.00 56.57  ?  259 ALA D CB    1 
ATOM   6861 N  N     . TYR D 1 243 ? 47.081  24.350 72.078  1.00 85.56  ?  260 TYR D N     1 
ATOM   6862 C  CA    . TYR D 1 243 ? 47.971  23.283 71.638  1.00 86.43  ?  260 TYR D CA    1 
ATOM   6863 C  C     . TYR D 1 243 ? 48.383  23.494 70.183  1.00 84.85  ?  260 TYR D C     1 
ATOM   6864 O  O     . TYR D 1 243 ? 49.559  23.380 69.840  1.00 84.71  ?  260 TYR D O     1 
ATOM   6865 C  CB    . TYR D 1 243 ? 47.298  21.920 71.813  1.00 85.98  ?  260 TYR D CB    1 
ATOM   6866 C  CG    . TYR D 1 243 ? 48.256  20.749 71.812  1.00 86.68  ?  260 TYR D CG    1 
ATOM   6867 C  CD1   . TYR D 1 243 ? 49.232  20.624 72.792  1.00 87.83  ?  260 TYR D CD1   1 
ATOM   6868 C  CD2   . TYR D 1 243 ? 48.175  19.761 70.840  1.00 85.48  ?  260 TYR D CD2   1 
ATOM   6869 C  CE1   . TYR D 1 243 ? 50.108  19.554 72.797  1.00 88.23  ?  260 TYR D CE1   1 
ATOM   6870 C  CE2   . TYR D 1 243 ? 49.045  18.686 70.837  1.00 85.68  ?  260 TYR D CE2   1 
ATOM   6871 C  CZ    . TYR D 1 243 ? 50.009  18.588 71.817  1.00 87.22  ?  260 TYR D CZ    1 
ATOM   6872 O  OH    . TYR D 1 243 ? 50.877  17.521 71.818  1.00 87.49  ?  260 TYR D OH    1 
ATOM   6873 N  N     . LEU D 1 244 ? 47.404  23.807 69.338  1.00 61.05  ?  261 LEU D N     1 
ATOM   6874 C  CA    . LEU D 1 244 ? 47.638  24.034 67.914  1.00 56.70  ?  261 LEU D CA    1 
ATOM   6875 C  C     . LEU D 1 244 ? 48.623  25.176 67.679  1.00 54.62  ?  261 LEU D C     1 
ATOM   6876 O  O     . LEU D 1 244 ? 49.509  25.080 66.829  1.00 51.05  ?  261 LEU D O     1 
ATOM   6877 C  CB    . LEU D 1 244 ? 46.321  24.335 67.197  1.00 53.51  ?  261 LEU D CB    1 
ATOM   6878 C  CG    . LEU D 1 244 ? 46.429  24.650 65.704  1.00 46.29  ?  261 LEU D CG    1 
ATOM   6879 C  CD1   . LEU D 1 244 ? 46.980  23.452 64.947  1.00 43.27  ?  261 LEU D CD1   1 
ATOM   6880 C  CD2   . LEU D 1 244 ? 45.086  25.080 65.134  1.00 43.15  ?  261 LEU D CD2   1 
ATOM   6881 N  N     . ARG D 1 245 ? 48.453  26.254 68.439  1.00 76.36  ?  262 ARG D N     1 
ATOM   6882 C  CA    . ARG D 1 245 ? 49.313  27.428 68.338  1.00 73.59  ?  262 ARG D CA    1 
ATOM   6883 C  C     . ARG D 1 245 ? 50.778  27.090 68.591  1.00 75.21  ?  262 ARG D C     1 
ATOM   6884 O  O     . ARG D 1 245 ? 51.647  27.420 67.784  1.00 71.61  ?  262 ARG D O     1 
ATOM   6885 C  CB    . ARG D 1 245 ? 48.851  28.508 69.319  1.00 74.55  ?  262 ARG D CB    1 
ATOM   6886 C  CG    . ARG D 1 245 ? 49.739  29.739 69.349  1.00 72.54  ?  262 ARG D CG    1 
ATOM   6887 C  CD    . ARG D 1 245 ? 49.416  30.620 70.544  1.00 74.41  ?  262 ARG D CD    1 
ATOM   6888 N  NE    . ARG D 1 245 ? 50.517  31.520 70.874  1.00 75.25  ?  262 ARG D NE    1 
ATOM   6889 C  CZ    . ARG D 1 245 ? 50.908  32.537 70.112  1.00 73.56  ?  262 ARG D CZ    1 
ATOM   6890 N  NH1   . ARG D 1 245 ? 50.293  32.782 68.963  1.00 70.67  1  262 ARG D NH1   1 
ATOM   6891 N  NH2   . ARG D 1 245 ? 51.920  33.304 70.495  1.00 75.76  ?  262 ARG D NH2   1 
ATOM   6892 N  N     . ASP D 1 246 ? 51.045  26.439 69.718  1.00 93.92  ?  263 ASP D N     1 
ATOM   6893 C  CA    . ASP D 1 246 ? 52.404  26.065 70.087  1.00 95.70  ?  263 ASP D CA    1 
ATOM   6894 C  C     . ASP D 1 246 ? 53.026  25.128 69.055  1.00 93.82  ?  263 ASP D C     1 
ATOM   6895 O  O     . ASP D 1 246 ? 54.212  25.234 68.748  1.00 92.67  ?  263 ASP D O     1 
ATOM   6896 C  CB    . ASP D 1 246 ? 52.425  25.411 71.470  1.00 100.31 ?  263 ASP D CB    1 
ATOM   6897 C  CG    . ASP D 1 246 ? 52.133  26.398 72.585  1.00 101.31 ?  263 ASP D CG    1 
ATOM   6898 O  OD1   . ASP D 1 246 ? 52.328  27.613 72.370  1.00 99.27  ?  263 ASP D OD1   1 
ATOM   6899 O  OD2   . ASP D 1 246 ? 51.711  25.958 73.675  1.00 103.50 -1 263 ASP D OD2   1 
ATOM   6900 N  N     . LEU D 1 247 ? 52.224  24.211 68.526  1.00 63.18  ?  264 LEU D N     1 
ATOM   6901 C  CA    . LEU D 1 247 ? 52.707  23.264 67.527  1.00 60.61  ?  264 LEU D CA    1 
ATOM   6902 C  C     . LEU D 1 247 ? 53.172  23.954 66.244  1.00 54.29  ?  264 LEU D C     1 
ATOM   6903 O  O     . LEU D 1 247 ? 54.238  23.638 65.721  1.00 52.77  ?  264 LEU D O     1 
ATOM   6904 C  CB    . LEU D 1 247 ? 51.618  22.238 67.206  1.00 60.31  ?  264 LEU D CB    1 
ATOM   6905 C  CG    . LEU D 1 247 ? 51.328  21.223 68.315  1.00 64.60  ?  264 LEU D CG    1 
ATOM   6906 C  CD1   . LEU D 1 247 ? 50.171  20.317 67.933  1.00 62.95  ?  264 LEU D CD1   1 
ATOM   6907 C  CD2   . LEU D 1 247 ? 52.571  20.405 68.633  1.00 65.96  ?  264 LEU D CD2   1 
ATOM   6908 N  N     . LEU D 1 248 ? 52.384  24.903 65.747  1.00 56.52  ?  265 LEU D N     1 
ATOM   6909 C  CA    . LEU D 1 248 ? 52.719  25.594 64.501  1.00 50.30  ?  265 LEU D CA    1 
ATOM   6910 C  C     . LEU D 1 248 ? 53.828  26.627 64.676  1.00 51.56  ?  265 LEU D C     1 
ATOM   6911 O  O     . LEU D 1 248 ? 54.637  26.831 63.773  1.00 50.38  ?  265 LEU D O     1 
ATOM   6912 C  CB    . LEU D 1 248 ? 51.483  26.276 63.896  1.00 47.29  ?  265 LEU D CB    1 
ATOM   6913 C  CG    . LEU D 1 248 ? 50.356  25.489 63.210  1.00 44.54  ?  265 LEU D CG    1 
ATOM   6914 C  CD1   . LEU D 1 248 ? 50.275  24.033 63.646  1.00 46.97  ?  265 LEU D CD1   1 
ATOM   6915 C  CD2   . LEU D 1 248 ? 49.018  26.190 63.419  1.00 43.85  ?  265 LEU D CD2   1 
ATOM   6916 N  N     . ILE D 1 249 ? 53.862  27.280 65.832  1.00 57.68  ?  266 ILE D N     1 
ATOM   6917 C  CA    . ILE D 1 249 ? 54.806  28.370 66.056  1.00 59.18  ?  266 ILE D CA    1 
ATOM   6918 C  C     . ILE D 1 249 ? 56.126  27.873 66.644  1.00 62.07  ?  266 ILE D C     1 
ATOM   6919 O  O     . ILE D 1 249 ? 57.199  28.336 66.256  1.00 62.56  ?  266 ILE D O     1 
ATOM   6920 C  CB    . ILE D 1 249 ? 54.203  29.446 66.985  1.00 60.92  ?  266 ILE D CB    1 
ATOM   6921 C  CG1   . ILE D 1 249 ? 52.936  30.035 66.362  1.00 58.32  ?  266 ILE D CG1   1 
ATOM   6922 C  CG2   . ILE D 1 249 ? 55.215  30.546 67.271  1.00 62.99  ?  266 ILE D CG2   1 
ATOM   6923 C  CD1   . ILE D 1 249 ? 53.137  30.571 64.960  1.00 55.40  ?  266 ILE D CD1   1 
ATOM   6924 N  N     . ARG D 1 250 ? 56.048  26.928 67.574  1.00 51.87  ?  267 ARG D N     1 
ATOM   6925 C  CA    . ARG D 1 250 ? 57.246  26.429 68.242  1.00 54.86  ?  267 ARG D CA    1 
ATOM   6926 C  C     . ARG D 1 250 ? 57.727  25.093 67.677  1.00 53.83  ?  267 ARG D C     1 
ATOM   6927 O  O     . ARG D 1 250 ? 58.789  25.017 67.061  1.00 54.70  ?  267 ARG D O     1 
ATOM   6928 C  CB    . ARG D 1 250 ? 56.998  26.294 69.747  1.00 57.37  ?  267 ARG D CB    1 
ATOM   6929 N  N     . THR D 1 251 ? 56.939  24.043 67.892  1.00 55.25  ?  268 THR D N     1 
ATOM   6930 C  CA    . THR D 1 251 ? 57.367  22.681 67.584  1.00 55.31  ?  268 THR D CA    1 
ATOM   6931 C  C     . THR D 1 251 ? 57.558  22.394 66.092  1.00 52.30  ?  268 THR D C     1 
ATOM   6932 O  O     . THR D 1 251 ? 58.621  21.933 65.678  1.00 52.94  ?  268 THR D O     1 
ATOM   6933 C  CB    . THR D 1 251 ? 56.365  21.652 68.147  1.00 57.76  ?  268 THR D CB    1 
ATOM   6934 O  OG1   . THR D 1 251 ? 56.172  21.885 69.548  1.00 61.60  ?  268 THR D OG1   1 
ATOM   6935 C  CG2   . THR D 1 251 ? 56.879  20.237 67.941  1.00 58.31  ?  268 THR D CG2   1 
ATOM   6936 N  N     . HIS D 1 252 ? 56.537  22.670 65.287  1.00 46.76  ?  269 HIS D N     1 
ATOM   6937 C  CA    . HIS D 1 252 ? 56.551  22.268 63.881  1.00 44.06  ?  269 HIS D CA    1 
ATOM   6938 C  C     . HIS D 1 252 ? 56.888  23.398 62.907  1.00 42.38  ?  269 HIS D C     1 
ATOM   6939 O  O     . HIS D 1 252 ? 56.815  23.205 61.695  1.00 41.21  ?  269 HIS D O     1 
ATOM   6940 C  CB    . HIS D 1 252 ? 55.198  21.664 63.494  1.00 41.85  ?  269 HIS D CB    1 
ATOM   6941 C  CG    . HIS D 1 252 ? 54.910  20.349 64.149  1.00 43.56  ?  269 HIS D CG    1 
ATOM   6942 N  ND1   . HIS D 1 252 ? 55.032  19.144 63.488  1.00 43.30  ?  269 HIS D ND1   1 
ATOM   6943 C  CD2   . HIS D 1 252 ? 54.494  20.047 65.401  1.00 47.62  ?  269 HIS D CD2   1 
ATOM   6944 C  CE1   . HIS D 1 252 ? 54.710  18.160 64.306  1.00 45.96  ?  269 HIS D CE1   1 
ATOM   6945 N  NE2   . HIS D 1 252 ? 54.379  18.681 65.475  1.00 49.07  ?  269 HIS D NE2   1 
ATOM   6946 N  N     . MET D 1 253 ? 57.264  24.562 63.430  1.00 40.96  ?  270 MET D N     1 
ATOM   6947 C  CA    . MET D 1 253 ? 57.447  25.754 62.599  1.00 41.05  ?  270 MET D CA    1 
ATOM   6948 C  C     . MET D 1 253 ? 58.473  25.570 61.482  1.00 41.28  ?  270 MET D C     1 
ATOM   6949 O  O     . MET D 1 253 ? 58.163  25.784 60.309  1.00 41.01  ?  270 MET D O     1 
ATOM   6950 C  CB    . MET D 1 253 ? 57.853  26.946 63.467  1.00 41.33  ?  270 MET D CB    1 
ATOM   6951 C  CG    . MET D 1 253 ? 57.782  28.292 62.755  1.00 41.43  ?  270 MET D CG    1 
ATOM   6952 S  SD    . MET D 1 253 ? 59.337  28.769 61.973  1.00 41.61  ?  270 MET D SD    1 
ATOM   6953 C  CE    . MET D 1 253 ? 60.468  28.627 63.355  1.00 42.16  ?  270 MET D CE    1 
ATOM   6954 N  N     . GLN D 1 254 ? 59.689  25.175 61.842  1.00 35.04  ?  271 GLN D N     1 
ATOM   6955 C  CA    . GLN D 1 254 ? 60.756  25.047 60.855  1.00 35.17  ?  271 GLN D CA    1 
ATOM   6956 C  C     . GLN D 1 254 ? 60.486  23.879 59.914  1.00 34.13  ?  271 GLN D C     1 
ATOM   6957 O  O     . GLN D 1 254 ? 60.839  23.926 58.736  1.00 34.14  ?  271 GLN D O     1 
ATOM   6958 C  CB    . GLN D 1 254 ? 62.112  24.873 61.540  1.00 35.96  ?  271 GLN D CB    1 
ATOM   6959 C  CG    . GLN D 1 254 ? 63.299  24.993 60.594  1.00 36.48  ?  271 GLN D CG    1 
ATOM   6960 C  CD    . GLN D 1 254 ? 63.302  26.299 59.822  1.00 37.17  ?  271 GLN D CD    1 
ATOM   6961 O  OE1   . GLN D 1 254 ? 63.230  27.380 60.407  1.00 38.02  ?  271 GLN D OE1   1 
ATOM   6962 N  NE2   . GLN D 1 254 ? 63.385  26.205 58.499  1.00 36.97  ?  271 GLN D NE2   1 
ATOM   6963 N  N     . ASN D 1 255 ? 59.851  22.837 60.439  1.00 44.60  ?  272 ASN D N     1 
ATOM   6964 C  CA    . ASN D 1 255 ? 59.509  21.672 59.634  1.00 44.14  ?  272 ASN D CA    1 
ATOM   6965 C  C     . ASN D 1 255 ? 58.445  22.007 58.593  1.00 42.36  ?  272 ASN D C     1 
ATOM   6966 O  O     . ASN D 1 255 ? 58.489  21.510 57.468  1.00 42.06  ?  272 ASN D O     1 
ATOM   6967 C  CB    . ASN D 1 255 ? 59.033  20.526 60.527  1.00 43.74  ?  272 ASN D CB    1 
ATOM   6968 C  CG    . ASN D 1 255 ? 58.849  19.230 59.763  1.00 43.32  ?  272 ASN D CG    1 
ATOM   6969 O  OD1   . ASN D 1 255 ? 59.524  18.985 58.764  1.00 44.52  ?  272 ASN D OD1   1 
ATOM   6970 N  ND2   . ASN D 1 255 ? 57.932  18.391 60.232  1.00 41.83  ?  272 ASN D ND2   1 
ATOM   6971 N  N     . ILE D 1 256 ? 57.493  22.855 58.975  1.00 48.68  ?  273 ILE D N     1 
ATOM   6972 C  CA    . ILE D 1 256 ? 56.467  23.332 58.051  1.00 47.55  ?  273 ILE D CA    1 
ATOM   6973 C  C     . ILE D 1 256 ? 57.090  24.143 56.917  1.00 47.44  ?  273 ILE D C     1 
ATOM   6974 O  O     . ILE D 1 256 ? 56.774  23.934 55.745  1.00 46.79  ?  273 ILE D O     1 
ATOM   6975 C  CB    . ILE D 1 256 ? 55.405  24.190 58.773  1.00 47.56  ?  273 ILE D CB    1 
ATOM   6976 C  CG1   . ILE D 1 256 ? 54.504  23.307 59.636  1.00 47.77  ?  273 ILE D CG1   1 
ATOM   6977 C  CG2   . ILE D 1 256 ? 54.549  24.946 57.771  1.00 47.03  ?  273 ILE D CG2   1 
ATOM   6978 C  CD1   . ILE D 1 256 ? 53.565  24.083 60.534  1.00 48.64  ?  273 ILE D CD1   1 
ATOM   6979 N  N     . LYS D 1 257 ? 57.981  25.063 57.276  1.00 30.58  ?  274 LYS D N     1 
ATOM   6980 C  CA    . LYS D 1 257 ? 58.654  25.913 56.299  1.00 31.34  ?  274 LYS D CA    1 
ATOM   6981 C  C     . LYS D 1 257 ? 59.513  25.108 55.327  1.00 31.28  ?  274 LYS D C     1 
ATOM   6982 O  O     . LYS D 1 257 ? 59.569  25.414 54.136  1.00 31.54  ?  274 LYS D O     1 
ATOM   6983 C  CB    . LYS D 1 257 ? 59.523  26.953 57.011  1.00 32.55  ?  274 LYS D CB    1 
ATOM   6984 C  CG    . LYS D 1 257 ? 58.750  27.949 57.858  1.00 33.03  ?  274 LYS D CG    1 
ATOM   6985 C  CD    . LYS D 1 257 ? 59.638  29.108 58.283  1.00 34.50  ?  274 LYS D CD    1 
ATOM   6986 C  CE    . LYS D 1 257 ? 60.292  29.765 57.079  1.00 35.22  ?  274 LYS D CE    1 
ATOM   6987 N  NZ    . LYS D 1 257 ? 61.018  31.012 57.444  1.00 36.84  1  274 LYS D NZ    1 
ATOM   6988 N  N     . ASP D 1 258 ? 60.181  24.082 55.843  1.00 38.69  ?  275 ASP D N     1 
ATOM   6989 C  CA    . ASP D 1 258 ? 61.055  23.242 55.030  1.00 39.22  ?  275 ASP D CA    1 
ATOM   6990 C  C     . ASP D 1 258 ? 60.285  22.466 53.965  1.00 38.30  ?  275 ASP D C     1 
ATOM   6991 O  O     . ASP D 1 258 ? 60.771  22.277 52.850  1.00 38.90  ?  275 ASP D O     1 
ATOM   6992 C  CB    . ASP D 1 258 ? 61.839  22.274 55.917  1.00 40.12  ?  275 ASP D CB    1 
ATOM   6993 C  CG    . ASP D 1 258 ? 62.930  22.965 56.712  1.00 41.53  ?  275 ASP D CG    1 
ATOM   6994 O  OD1   . ASP D 1 258 ? 63.257  24.129 56.395  1.00 41.88  ?  275 ASP D OD1   1 
ATOM   6995 O  OD2   . ASP D 1 258 ? 63.462  22.343 57.656  1.00 42.54  -1 275 ASP D OD2   1 
ATOM   6996 N  N     . ILE D 1 259 ? 59.083  22.019 54.313  1.00 39.14  ?  276 ILE D N     1 
ATOM   6997 C  CA    . ILE D 1 259 ? 58.243  21.288 53.373  1.00 37.98  ?  276 ILE D CA    1 
ATOM   6998 C  C     . ILE D 1 259 ? 57.647  22.254 52.351  1.00 37.08  ?  276 ILE D C     1 
ATOM   6999 O  O     . ILE D 1 259 ? 57.444  21.902 51.189  1.00 37.06  ?  276 ILE D O     1 
ATOM   7000 C  CB    . ILE D 1 259 ? 57.121  20.520 54.104  1.00 36.76  ?  276 ILE D CB    1 
ATOM   7001 C  CG1   . ILE D 1 259 ? 57.723  19.509 55.082  1.00 37.49  ?  276 ILE D CG1   1 
ATOM   7002 C  CG2   . ILE D 1 259 ? 56.211  19.810 53.114  1.00 35.51  ?  276 ILE D CG2   1 
ATOM   7003 C  CD1   . ILE D 1 259 ? 56.698  18.785 55.925  1.00 36.46  ?  276 ILE D CD1   1 
ATOM   7004 N  N     . THR D 1 260 ? 57.386  23.481 52.788  1.00 48.88  ?  277 THR D N     1 
ATOM   7005 C  CA    . THR D 1 260 ? 56.869  24.517 51.902  1.00 47.85  ?  277 THR D CA    1 
ATOM   7006 C  C     . THR D 1 260 ? 57.880  24.847 50.805  1.00 49.02  ?  277 THR D C     1 
ATOM   7007 O  O     . THR D 1 260 ? 57.515  25.056 49.648  1.00 48.10  ?  277 THR D O     1 
ATOM   7008 C  CB    . THR D 1 260 ? 56.525  25.802 52.680  1.00 47.64  ?  277 THR D CB    1 
ATOM   7009 O  OG1   . THR D 1 260 ? 55.565  25.500 53.700  1.00 47.34  ?  277 THR D OG1   1 
ATOM   7010 C  CG2   . THR D 1 260 ? 55.955  26.864 51.748  1.00 46.73  ?  277 THR D CG2   1 
ATOM   7011 N  N     . SER D 1 261 ? 59.155  24.876 51.180  1.00 57.99  ?  278 SER D N     1 
ATOM   7012 C  CA    . SER D 1 261 ? 60.227  25.224 50.253  1.00 59.90  ?  278 SER D CA    1 
ATOM   7013 C  C     . SER D 1 261 ? 60.618  24.063 49.342  1.00 61.37  ?  278 SER D C     1 
ATOM   7014 O  O     . SER D 1 261 ? 60.562  24.178 48.118  1.00 61.21  ?  278 SER D O     1 
ATOM   7015 C  CB    . SER D 1 261 ? 61.456  25.705 51.027  1.00 62.34  ?  278 SER D CB    1 
ATOM   7016 O  OG    . SER D 1 261 ? 61.148  26.838 51.821  1.00 61.21  ?  278 SER D OG    1 
ATOM   7017 N  N     . SER D 1 262 ? 61.013  22.948 49.947  1.00 62.84  ?  279 SER D N     1 
ATOM   7018 C  CA    . SER D 1 262 ? 61.577  21.826 49.203  1.00 64.75  ?  279 SER D CA    1 
ATOM   7019 C  C     . SER D 1 262 ? 60.548  21.066 48.369  1.00 62.23  ?  279 SER D C     1 
ATOM   7020 O  O     . SER D 1 262 ? 60.902  20.416 47.385  1.00 63.71  ?  279 SER D O     1 
ATOM   7021 C  CB    . SER D 1 262 ? 62.269  20.857 50.165  1.00 66.53  ?  279 SER D CB    1 
ATOM   7022 O  OG    . SER D 1 262 ? 61.348  20.318 51.097  1.00 63.99  ?  279 SER D OG    1 
ATOM   7023 N  N     . ILE D 1 263 ? 59.280  21.142 48.758  1.00 54.66  ?  280 ILE D N     1 
ATOM   7024 C  CA    . ILE D 1 263 ? 58.240  20.379 48.074  1.00 52.32  ?  280 ILE D CA    1 
ATOM   7025 C  C     . ILE D 1 263 ? 57.271  21.260 47.288  1.00 50.22  ?  280 ILE D C     1 
ATOM   7026 O  O     . ILE D 1 263 ? 57.193  21.168 46.063  1.00 49.98  ?  280 ILE D O     1 
ATOM   7027 C  CB    . ILE D 1 263 ? 57.430  19.525 49.069  1.00 50.54  ?  280 ILE D CB    1 
ATOM   7028 C  CG1   . ILE D 1 263 ? 58.361  18.633 49.894  1.00 52.52  ?  280 ILE D CG1   1 
ATOM   7029 C  CG2   . ILE D 1 263 ? 56.385  18.696 48.336  1.00 48.24  ?  280 ILE D CG2   1 
ATOM   7030 C  CD1   . ILE D 1 263 ? 59.229  17.715 49.060  1.00 54.18  ?  280 ILE D CD1   1 
ATOM   7031 N  N     . HIS D 1 264 ? 56.536  22.112 47.997  1.00 44.55  ?  281 HIS D N     1 
ATOM   7032 C  CA    . HIS D 1 264 ? 55.486  22.918 47.379  1.00 42.57  ?  281 HIS D CA    1 
ATOM   7033 C  C     . HIS D 1 264 ? 56.043  24.005 46.463  1.00 43.14  ?  281 HIS D C     1 
ATOM   7034 O  O     . HIS D 1 264 ? 55.518  24.236 45.374  1.00 42.04  ?  281 HIS D O     1 
ATOM   7035 C  CB    . HIS D 1 264 ? 54.605  23.551 48.457  1.00 41.85  ?  281 HIS D CB    1 
ATOM   7036 C  CG    . HIS D 1 264 ? 53.895  22.553 49.317  1.00 41.38  ?  281 HIS D CG    1 
ATOM   7037 N  ND1   . HIS D 1 264 ? 52.911  21.718 48.832  1.00 39.97  ?  281 HIS D ND1   1 
ATOM   7038 C  CD2   . HIS D 1 264 ? 54.029  22.254 50.631  1.00 42.20  ?  281 HIS D CD2   1 
ATOM   7039 C  CE1   . HIS D 1 264 ? 52.469  20.949 49.811  1.00 39.88  ?  281 HIS D CE1   1 
ATOM   7040 N  NE2   . HIS D 1 264 ? 53.130  21.254 50.913  1.00 41.28  ?  281 HIS D NE2   1 
ATOM   7041 N  N     . PHE D 1 265 ? 57.104  24.670 46.908  1.00 61.71  ?  282 PHE D N     1 
ATOM   7042 C  CA    . PHE D 1 265 ? 57.704  25.747 46.129  1.00 62.44  ?  282 PHE D CA    1 
ATOM   7043 C  C     . PHE D 1 265 ? 58.486  25.206 44.938  1.00 64.15  ?  282 PHE D C     1 
ATOM   7044 O  O     . PHE D 1 265 ? 58.509  25.818 43.871  1.00 63.84  ?  282 PHE D O     1 
ATOM   7045 C  CB    . PHE D 1 265 ? 58.618  26.604 47.007  1.00 63.88  ?  282 PHE D CB    1 
ATOM   7046 C  CG    . PHE D 1 265 ? 59.353  27.674 46.251  1.00 64.60  ?  282 PHE D CG    1 
ATOM   7047 C  CD1   . PHE D 1 265 ? 58.698  28.819 45.830  1.00 62.98  ?  282 PHE D CD1   1 
ATOM   7048 C  CD2   . PHE D 1 265 ? 60.701  27.534 45.962  1.00 67.16  ?  282 PHE D CD2   1 
ATOM   7049 C  CE1   . PHE D 1 265 ? 59.373  29.804 45.132  1.00 63.79  ?  282 PHE D CE1   1 
ATOM   7050 C  CE2   . PHE D 1 265 ? 61.381  28.515 45.266  1.00 67.48  ?  282 PHE D CE2   1 
ATOM   7051 C  CZ    . PHE D 1 265 ? 60.716  29.651 44.851  1.00 65.63  ?  282 PHE D CZ    1 
ATOM   7052 N  N     . GLU D 1 266 ? 59.128  24.058 45.127  1.00 66.96  ?  283 GLU D N     1 
ATOM   7053 C  CA    . GLU D 1 266 ? 59.891  23.432 44.055  1.00 69.17  ?  283 GLU D CA    1 
ATOM   7054 C  C     . GLU D 1 266 ? 58.971  22.931 42.946  1.00 67.19  ?  283 GLU D C     1 
ATOM   7055 O  O     . GLU D 1 266 ? 59.346  22.924 41.774  1.00 68.19  ?  283 GLU D O     1 
ATOM   7056 C  CB    . GLU D 1 266 ? 60.734  22.278 44.601  1.00 72.06  ?  283 GLU D CB    1 
ATOM   7057 N  N     . ALA D 1 267 ? 57.768  22.511 43.324  1.00 63.25  ?  284 ALA D N     1 
ATOM   7058 C  CA    . ALA D 1 267 ? 56.760  22.083 42.360  1.00 61.14  ?  284 ALA D CA    1 
ATOM   7059 C  C     . ALA D 1 267 ? 56.286  23.231 41.470  1.00 60.80  ?  284 ALA D C     1 
ATOM   7060 O  O     . ALA D 1 267 ? 56.052  23.047 40.276  1.00 61.21  ?  284 ALA D O     1 
ATOM   7061 C  CB    . ALA D 1 267 ? 55.578  21.456 43.081  1.00 58.77  ?  284 ALA D CB    1 
ATOM   7062 N  N     . TYR D 1 268 ? 56.150  24.416 42.059  1.00 62.83  ?  285 TYR D N     1 
ATOM   7063 C  CA    . TYR D 1 268 ? 55.752  25.604 41.310  1.00 62.67  ?  285 TYR D CA    1 
ATOM   7064 C  C     . TYR D 1 268 ? 56.866  26.079 40.389  1.00 64.72  ?  285 TYR D C     1 
ATOM   7065 O  O     . TYR D 1 268 ? 56.621  26.474 39.250  1.00 65.30  ?  285 TYR D O     1 
ATOM   7066 C  CB    . TYR D 1 268 ? 55.348  26.729 42.266  1.00 61.84  ?  285 TYR D CB    1 
ATOM   7067 C  CG    . TYR D 1 268 ? 54.989  28.022 41.569  1.00 62.59  ?  285 TYR D CG    1 
ATOM   7068 C  CD1   . TYR D 1 268 ? 53.719  28.222 41.045  1.00 61.94  ?  285 TYR D CD1   1 
ATOM   7069 C  CD2   . TYR D 1 268 ? 55.920  29.046 41.439  1.00 63.96  ?  285 TYR D CD2   1 
ATOM   7070 C  CE1   . TYR D 1 268 ? 53.387  29.401 40.406  1.00 62.83  ?  285 TYR D CE1   1 
ATOM   7071 C  CE2   . TYR D 1 268 ? 55.597  30.229 40.802  1.00 64.69  ?  285 TYR D CE2   1 
ATOM   7072 C  CZ    . TYR D 1 268 ? 54.329  30.402 40.288  1.00 64.31  ?  285 TYR D CZ    1 
ATOM   7073 O  OH    . TYR D 1 268 ? 54.002  31.578 39.653  1.00 65.36  ?  285 TYR D OH    1 
ATOM   7074 N  N     . ARG D 1 269 ? 58.089  26.044 40.903  1.00 75.33  ?  286 ARG D N     1 
ATOM   7075 C  CA    . ARG D 1 269 ? 59.265  26.484 40.164  1.00 77.23  ?  286 ARG D CA    1 
ATOM   7076 C  C     . ARG D 1 269 ? 59.484  25.670 38.895  1.00 78.37  ?  286 ARG D C     1 
ATOM   7077 O  O     . ARG D 1 269 ? 59.754  26.224 37.829  1.00 79.24  ?  286 ARG D O     1 
ATOM   7078 C  CB    . ARG D 1 269 ? 60.494  26.396 41.062  1.00 84.22  ?  286 ARG D CB    1 
ATOM   7079 C  CG    . ARG D 1 269 ? 61.768  26.955 40.469  1.00 86.12  ?  286 ARG D CG    1 
ATOM   7080 C  CD    . ARG D 1 269 ? 62.674  27.404 41.593  1.00 86.27  ?  286 ARG D CD    1 
ATOM   7081 N  NE    . ARG D 1 269 ? 63.147  26.264 42.369  1.00 85.52  ?  286 ARG D NE    1 
ATOM   7082 C  CZ    . ARG D 1 269 ? 64.075  26.335 43.316  1.00 85.71  ?  286 ARG D CZ    1 
ATOM   7083 N  NH1   . ARG D 1 269 ? 64.634  27.499 43.615  1.00 86.64  ?  286 ARG D NH1   1 
ATOM   7084 N  NH2   . ARG D 1 269 ? 64.437  25.241 43.971  1.00 85.08  ?  286 ARG D NH2   1 
ATOM   7085 N  N     . VAL D 1 270 ? 59.363  24.352 39.018  1.00 82.97  ?  287 VAL D N     1 
ATOM   7086 C  CA    . VAL D 1 270 ? 59.587  23.451 37.895  1.00 84.28  ?  287 VAL D CA    1 
ATOM   7087 C  C     . VAL D 1 270 ? 58.508  23.660 36.837  1.00 83.27  ?  287 VAL D C     1 
ATOM   7088 O  O     . VAL D 1 270 ? 58.779  23.624 35.638  1.00 84.92  ?  287 VAL D O     1 
ATOM   7089 C  CB    . VAL D 1 270 ? 59.601  21.977 38.358  1.00 84.61  ?  287 VAL D CB    1 
ATOM   7090 C  CG1   . VAL D 1 270 ? 59.549  21.029 37.169  1.00 85.39  ?  287 VAL D CG1   1 
ATOM   7091 C  CG2   . VAL D 1 270 ? 60.835  21.701 39.204  1.00 87.63  ?  287 VAL D CG2   1 
ATOM   7092 N  N     . LYS D 1 271 ? 57.284  23.902 37.293  1.00 62.13  ?  288 LYS D N     1 
ATOM   7093 C  CA    . LYS D 1 271 ? 56.170  24.164 36.392  1.00 61.11  ?  288 LYS D CA    1 
ATOM   7094 C  C     . LYS D 1 271 ? 56.369  25.481 35.646  1.00 62.32  ?  288 LYS D C     1 
ATOM   7095 O  O     . LYS D 1 271 ? 56.184  25.556 34.431  1.00 63.33  ?  288 LYS D O     1 
ATOM   7096 C  CB    . LYS D 1 271 ? 54.850  24.189 37.165  1.00 59.21  ?  288 LYS D CB    1 
ATOM   7097 N  N     . ARG D 1 272 ? 56.753  26.513 36.389  1.00 52.99  ?  289 ARG D N     1 
ATOM   7098 C  CA    . ARG D 1 272 ? 56.891  27.860 35.843  1.00 54.32  ?  289 ARG D CA    1 
ATOM   7099 C  C     . ARG D 1 272 ? 58.149  28.070 34.999  1.00 56.37  ?  289 ARG D C     1 
ATOM   7100 O  O     . ARG D 1 272 ? 58.253  29.068 34.286  1.00 57.81  ?  289 ARG D O     1 
ATOM   7101 C  CB    . ARG D 1 272 ? 56.870  28.884 36.981  1.00 53.82  ?  289 ARG D CB    1 
ATOM   7102 N  N     . LEU D 1 273 ? 59.102  27.146 35.075  1.00 76.18  ?  290 LEU D N     1 
ATOM   7103 C  CA    . LEU D 1 273 ? 60.363  27.326 34.358  1.00 78.21  ?  290 LEU D CA    1 
ATOM   7104 C  C     . LEU D 1 273 ? 60.701  26.175 33.412  1.00 79.30  ?  290 LEU D C     1 
ATOM   7105 O  O     . LEU D 1 273 ? 61.290  26.396 32.354  1.00 81.38  ?  290 LEU D O     1 
ATOM   7106 C  CB    . LEU D 1 273 ? 61.510  27.528 35.351  1.00 78.71  ?  290 LEU D CB    1 
ATOM   7107 C  CG    . LEU D 1 273 ? 61.366  28.717 36.304  1.00 78.06  ?  290 LEU D CG    1 
ATOM   7108 C  CD1   . LEU D 1 273 ? 62.524  28.764 37.289  1.00 78.71  ?  290 LEU D CD1   1 
ATOM   7109 C  CD2   . LEU D 1 273 ? 61.267  30.019 35.523  1.00 79.09  ?  290 LEU D CD2   1 
ATOM   7110 N  N     . ASN D 1 274 ? 60.333  24.954 33.784  1.00 72.68  ?  291 ASN D N     1 
ATOM   7111 C  CA    . ASN D 1 274 ? 60.617  23.796 32.941  1.00 73.70  ?  291 ASN D CA    1 
ATOM   7112 C  C     . ASN D 1 274 ? 59.408  23.405 32.099  1.00 73.46  ?  291 ASN D C     1 
ATOM   7113 O  O     . ASN D 1 274 ? 58.966  24.169 31.241  1.00 74.31  ?  291 ASN D O     1 
ATOM   7114 C  CB    . ASN D 1 274 ? 61.071  22.603 33.786  1.00 72.89  ?  291 ASN D CB    1 
ATOM   7115 C  CG    . ASN D 1 274 ? 62.445  22.805 34.393  1.00 73.62  ?  291 ASN D CG    1 
ATOM   7116 O  OD1   . ASN D 1 274 ? 62.903  23.934 34.564  1.00 74.13  ?  291 ASN D OD1   1 
ATOM   7117 N  ND2   . ASN D 1 274 ? 63.114  21.704 34.721  1.00 73.80  ?  291 ASN D ND2   1 
HETATM 7118 P  PG    . GSP E 2 .   ? -6.025  7.929  4.166   1.00 38.61  ?  301 GSP A PG    1 
HETATM 7119 O  O3B   . GSP E 2 .   ? -5.565  8.191  5.604   1.00 34.89  ?  301 GSP A O3B   1 
HETATM 7120 S  S1G   . GSP E 2 .   ? -4.966  7.034  2.895   1.00 43.72  ?  301 GSP A S1G   1 
HETATM 7121 O  O2G   . GSP E 2 .   ? -7.408  7.138  4.345   1.00 42.80  ?  301 GSP A O2G   1 
HETATM 7122 O  O3G   . GSP E 2 .   ? -6.648  9.296  3.661   1.00 37.19  ?  301 GSP A O3G   1 
HETATM 7123 P  PB    . GSP E 2 .   ? -6.846  8.912  6.518   1.00 31.47  ?  301 GSP A PB    1 
HETATM 7124 O  O1B   . GSP E 2 .   ? -7.100  10.004 5.527   1.00 31.06  -1 301 GSP A O1B   1 
HETATM 7125 O  O2B   . GSP E 2 .   ? -7.727  7.697  6.642   1.00 34.08  -1 301 GSP A O2B   1 
HETATM 7126 P  PA    . GSP E 2 .   ? -6.415  8.056  8.923   1.00 35.57  ?  301 GSP A PA    1 
HETATM 7127 O  O1A   . GSP E 2 .   ? -5.550  7.114  8.151   1.00 39.32  -1 301 GSP A O1A   1 
HETATM 7128 O  O2A   . GSP E 2 .   ? -7.837  7.733  9.309   1.00 36.66  -1 301 GSP A O2A   1 
HETATM 7129 O  O3A   . GSP E 2 .   ? -6.415  9.347  7.962   1.00 34.48  ?  301 GSP A O3A   1 
HETATM 7130 O  "O5'" . GSP E 2 .   ? -5.546  8.464  10.245  1.00 37.13  ?  301 GSP A "O5'" 1 
HETATM 7131 C  "C5'" . GSP E 2 .   ? -4.262  8.615  9.741   1.00 37.36  ?  301 GSP A "C5'" 1 
HETATM 7132 C  "C4'" . GSP E 2 .   ? -3.390  8.923  10.941  1.00 38.76  ?  301 GSP A "C4'" 1 
HETATM 7133 O  "O4'" . GSP E 2 .   ? -3.794  10.208 11.446  1.00 40.76  ?  301 GSP A "O4'" 1 
HETATM 7134 C  "C3'" . GSP E 2 .   ? -3.617  7.881  12.073  1.00 38.21  ?  301 GSP A "C3'" 1 
HETATM 7135 O  "O3'" . GSP E 2 .   ? -2.376  7.489  12.565  1.00 37.57  ?  301 GSP A "O3'" 1 
HETATM 7136 C  "C2'" . GSP E 2 .   ? -4.406  8.671  13.122  1.00 38.62  ?  301 GSP A "C2'" 1 
HETATM 7137 O  "O2'" . GSP E 2 .   ? -4.035  8.345  14.418  1.00 43.17  ?  301 GSP A "O2'" 1 
HETATM 7138 C  "C1'" . GSP E 2 .   ? -3.913  10.113 12.846  1.00 39.28  ?  301 GSP A "C1'" 1 
HETATM 7139 N  N9    . GSP E 2 .   ? -4.934  11.059 13.222  1.00 39.13  ?  301 GSP A N9    1 
HETATM 7140 C  C8    . GSP E 2 .   ? -6.315  11.010 12.881  1.00 41.30  ?  301 GSP A C8    1 
HETATM 7141 N  N7    . GSP E 2 .   ? -6.985  12.060 13.393  1.00 44.17  ?  301 GSP A N7    1 
HETATM 7142 C  C5    . GSP E 2 .   ? -6.011  12.794 14.073  1.00 40.03  ?  301 GSP A C5    1 
HETATM 7143 C  C6    . GSP E 2 .   ? -6.218  13.999 14.787  1.00 39.82  ?  301 GSP A C6    1 
HETATM 7144 O  O6    . GSP E 2 .   ? -7.235  14.642 14.965  1.00 43.37  ?  301 GSP A O6    1 
HETATM 7145 N  N1    . GSP E 2 .   ? -5.010  14.497 15.370  1.00 38.42  ?  301 GSP A N1    1 
HETATM 7146 C  C2    . GSP E 2 .   ? -3.794  13.816 15.211  1.00 38.00  ?  301 GSP A C2    1 
HETATM 7147 N  N2    . GSP E 2 .   ? -2.694  14.388 15.817  1.00 36.94  ?  301 GSP A N2    1 
HETATM 7148 N  N3    . GSP E 2 .   ? -3.563  12.667 14.536  1.00 38.83  ?  301 GSP A N3    1 
HETATM 7149 C  C4    . GSP E 2 .   ? -4.746  12.196 13.978  1.00 38.21  ?  301 GSP A C4    1 
HETATM 7150 MG MG    . MG  F 3 .   ? -9.221  6.873  5.081   1.00 33.41  2  302 MG  A MG    1 
HETATM 7151 P  PG    . GSP G 2 .   ? 6.079   26.188 3.580   1.00 40.05  ?  301 GSP B PG    1 
HETATM 7152 O  O3B   . GSP G 2 .   ? 5.567   26.086 5.021   1.00 38.68  ?  301 GSP B O3B   1 
HETATM 7153 S  S1G   . GSP G 2 .   ? 5.020   26.803 2.152   1.00 47.87  ?  301 GSP B S1G   1 
HETATM 7154 O  O2G   . GSP G 2 .   ? 6.599   24.705 3.250   1.00 35.68  ?  301 GSP B O2G   1 
HETATM 7155 O  O3G   . GSP G 2 .   ? 7.501   26.871 3.687   1.00 43.17  ?  301 GSP B O3G   1 
HETATM 7156 P  PB    . GSP G 2 .   ? 6.825   25.495 6.051   1.00 39.24  ?  301 GSP B PB    1 
HETATM 7157 O  O1B   . GSP G 2 .   ? 7.077   24.187 5.349   1.00 36.42  -1 301 GSP B O1B   1 
HETATM 7158 O  O2B   . GSP G 2 .   ? 7.698   26.698 5.872   1.00 41.94  -1 301 GSP B O2B   1 
HETATM 7159 P  PA    . GSP G 2 .   ? 6.271   26.542 8.351   1.00 48.83  ?  301 GSP B PA    1 
HETATM 7160 O  O1A   . GSP G 2 .   ? 5.644   27.617 7.500   1.00 46.68  -1 301 GSP B O1A   1 
HETATM 7161 O  O2A   . GSP G 2 .   ? 7.671   26.637 8.864   1.00 46.07  -1 301 GSP B O2A   1 
HETATM 7162 O  O3A   . GSP G 2 .   ? 6.348   25.174 7.508   1.00 44.64  ?  301 GSP B O3A   1 
HETATM 7163 O  "O5'" . GSP G 2 .   ? 5.362   26.226 9.668   1.00 47.90  ?  301 GSP B "O5'" 1 
HETATM 7164 C  "C5'" . GSP G 2 .   ? 4.077   26.196 9.156   1.00 50.45  ?  301 GSP B "C5'" 1 
HETATM 7165 C  "C4'" . GSP G 2 .   ? 3.201   25.966 10.359  1.00 53.46  ?  301 GSP B "C4'" 1 
HETATM 7166 O  "O4'" . GSP G 2 .   ? 3.666   24.760 10.987  1.00 54.26  ?  301 GSP B "O4'" 1 
HETATM 7167 C  "C3'" . GSP G 2 .   ? 3.379   27.126 11.380  1.00 52.79  ?  301 GSP B "C3'" 1 
HETATM 7168 O  "O3'" . GSP G 2 .   ? 2.120   27.602 11.735  1.00 54.92  ?  301 GSP B "O3'" 1 
HETATM 7169 C  "C2'" . GSP G 2 .   ? 4.076   26.452 12.568  1.00 51.66  ?  301 GSP B "C2'" 1 
HETATM 7170 O  "O2'" . GSP G 2 .   ? 3.556   26.868 13.785  1.00 56.02  ?  301 GSP B "O2'" 1 
HETATM 7171 C  "C1'" . GSP G 2 .   ? 3.665   24.969 12.375  1.00 52.04  ?  301 GSP B "C1'" 1 
HETATM 7172 N  N9    . GSP G 2 .   ? 4.688   24.107 12.916  1.00 48.43  ?  301 GSP B N9    1 
HETATM 7173 C  C8    . GSP G 2 .   ? 6.096   24.209 12.719  1.00 49.77  ?  301 GSP B C8    1 
HETATM 7174 N  N7    . GSP G 2 .   ? 6.756   23.231 13.371  1.00 49.58  ?  301 GSP B N7    1 
HETATM 7175 C  C5    . GSP G 2 .   ? 5.749   22.489 13.993  1.00 48.89  ?  301 GSP B C5    1 
HETATM 7176 C  C6    . GSP G 2 .   ? 5.931   21.344 14.806  1.00 50.89  ?  301 GSP B C6    1 
HETATM 7177 O  O6    . GSP G 2 .   ? 6.952   20.767 15.137  1.00 47.94  ?  301 GSP B O6    1 
HETATM 7178 N  N1    . GSP G 2 .   ? 4.688   20.822 15.290  1.00 49.68  ?  301 GSP B N1    1 
HETATM 7179 C  C2    . GSP G 2 .   ? 3.467   21.428 14.956  1.00 47.99  ?  301 GSP B C2    1 
HETATM 7180 N  N2    . GSP G 2 .   ? 2.331   20.840 15.479  1.00 52.45  ?  301 GSP B N2    1 
HETATM 7181 N  N3    . GSP G 2 .   ? 3.261   22.518 14.185  1.00 44.47  ?  301 GSP B N3    1 
HETATM 7182 C  C4    . GSP G 2 .   ? 4.474   23.013 13.724  1.00 45.99  ?  301 GSP B C4    1 
HETATM 7183 MG MG    . MG  H 3 .   ? 9.496   27.030 4.247   1.00 38.10  2  302 MG  B MG    1 
HETATM 7184 P  PG    . GSP I 2 .   ? 21.524  17.424 57.300  1.00 35.61  ?  301 GSP C PG    1 
HETATM 7185 O  O3B   . GSP I 2 .   ? 22.046  17.617 58.727  1.00 33.82  ?  301 GSP C O3B   1 
HETATM 7186 S  S1G   . GSP I 2 .   ? 22.563  16.693 55.914  1.00 37.95  ?  301 GSP C S1G   1 
HETATM 7187 O  O2G   . GSP I 2 .   ? 20.205  16.533 57.495  1.00 37.47  ?  301 GSP C O2G   1 
HETATM 7188 O  O3G   . GSP I 2 .   ? 20.792  18.778 56.929  1.00 32.60  ?  301 GSP C O3G   1 
HETATM 7189 P  PB    . GSP I 2 .   ? 20.764  18.172 59.753  1.00 31.96  ?  301 GSP C PB    1 
HETATM 7190 O  O1B   . GSP I 2 .   ? 20.378  19.397 58.967  1.00 27.15  -1 301 GSP C O1B   1 
HETATM 7191 O  O2B   . GSP I 2 .   ? 19.998  16.888 59.684  1.00 33.44  -1 301 GSP C O2B   1 
HETATM 7192 P  PA    . GSP I 2 .   ? 21.285  17.370 62.160  1.00 37.36  ?  301 GSP C PA    1 
HETATM 7193 O  O1A   . GSP I 2 .   ? 22.158  16.428 61.398  1.00 36.83  -1 301 GSP C O1A   1 
HETATM 7194 O  O2A   . GSP I 2 .   ? 19.875  17.029 62.571  1.00 36.43  -1 301 GSP C O2A   1 
HETATM 7195 O  O3A   . GSP I 2 .   ? 21.250  18.639 61.170  1.00 34.54  ?  301 GSP C O3A   1 
HETATM 7196 O  "O5'" . GSP I 2 .   ? 22.160  17.824 63.462  1.00 39.62  ?  301 GSP C "O5'" 1 
HETATM 7197 C  "C5'" . GSP I 2 .   ? 23.465  17.728 63.007  1.00 41.61  ?  301 GSP C "C5'" 1 
HETATM 7198 C  "C4'" . GSP I 2 .   ? 24.325  18.041 64.209  1.00 43.97  ?  301 GSP C "C4'" 1 
HETATM 7199 O  "O4'" . GSP I 2 .   ? 23.906  19.323 64.707  1.00 46.96  ?  301 GSP C "O4'" 1 
HETATM 7200 C  "C3'" . GSP I 2 .   ? 24.090  16.995 65.336  1.00 43.74  ?  301 GSP C "C3'" 1 
HETATM 7201 O  "O3'" . GSP I 2 .   ? 25.327  16.588 65.826  1.00 43.67  ?  301 GSP C "O3'" 1 
HETATM 7202 C  "C2'" . GSP I 2 .   ? 23.303  17.781 66.390  1.00 43.62  ?  301 GSP C "C2'" 1 
HETATM 7203 O  "O2'" . GSP I 2 .   ? 23.699  17.468 67.683  1.00 45.05  ?  301 GSP C "O2'" 1 
HETATM 7204 C  "C1'" . GSP I 2 .   ? 23.766  19.232 66.105  1.00 43.97  ?  301 GSP C "C1'" 1 
HETATM 7205 N  N9    . GSP I 2 .   ? 22.716  20.155 66.454  1.00 42.78  ?  301 GSP C N9    1 
HETATM 7206 C  C8    . GSP I 2 .   ? 21.342  20.070 66.089  1.00 44.02  ?  301 GSP C C8    1 
HETATM 7207 N  N7    . GSP I 2 .   ? 20.639  21.108 66.580  1.00 46.29  ?  301 GSP C N7    1 
HETATM 7208 C  C5    . GSP I 2 .   ? 21.584  21.872 67.268  1.00 43.76  ?  301 GSP C C5    1 
HETATM 7209 C  C6    . GSP I 2 .   ? 21.337  23.078 67.966  1.00 42.22  ?  301 GSP C C6    1 
HETATM 7210 O  O6    . GSP I 2 .   ? 20.305  23.698 68.121  1.00 43.12  ?  301 GSP C O6    1 
HETATM 7211 N  N1    . GSP I 2 .   ? 22.521  23.611 68.564  1.00 41.92  ?  301 GSP C N1    1 
HETATM 7212 C  C2    . GSP I 2 .   ? 23.754  22.959 68.433  1.00 44.20  ?  301 GSP C C2    1 
HETATM 7213 N  N2    . GSP I 2 .   ? 24.829  23.565 69.053  1.00 47.75  ?  301 GSP C N2    1 
HETATM 7214 N  N3    . GSP I 2 .   ? 24.024  21.809 67.775  1.00 43.51  ?  301 GSP C N3    1 
HETATM 7215 C  C4    . GSP I 2 .   ? 22.864  21.304 67.200  1.00 42.50  ?  301 GSP C C4    1 
HETATM 7216 MG MG    . MG  J 3 .   ? 18.224  16.590 57.970  1.00 38.94  2  302 MG  C MG    1 
HETATM 7217 P  PG    . GSP K 2 .   ? 33.813  35.734 57.168  1.00 41.61  ?  301 GSP D PG    1 
HETATM 7218 O  O3B   . GSP K 2 .   ? 33.284  35.519 58.588  1.00 38.73  ?  301 GSP D O3B   1 
HETATM 7219 S  S1G   . GSP K 2 .   ? 32.774  36.467 55.783  1.00 47.35  ?  301 GSP D S1G   1 
HETATM 7220 O  O2G   . GSP K 2 .   ? 34.328  34.283 56.727  1.00 39.39  ?  301 GSP D O2G   1 
HETATM 7221 O  O3G   . GSP K 2 .   ? 35.235  36.398 57.348  1.00 45.38  ?  301 GSP D O3G   1 
HETATM 7222 P  PB    . GSP K 2 .   ? 34.496  34.755 59.567  1.00 39.00  ?  301 GSP D PB    1 
HETATM 7223 O  O1B   . GSP K 2 .   ? 34.638  33.563 58.673  1.00 40.46  -1 301 GSP D O1B   1 
HETATM 7224 O  O2B   . GSP K 2 .   ? 35.504  35.875 59.590  1.00 42.52  -1 301 GSP D O2B   1 
HETATM 7225 P  PA    . GSP K 2 .   ? 33.919  35.880 61.844  1.00 48.38  ?  301 GSP D PA    1 
HETATM 7226 O  O1A   . GSP K 2 .   ? 33.875  36.878 60.733  1.00 47.57  -1 301 GSP D O1A   1 
HETATM 7227 O  O2A   . GSP K 2 .   ? 34.972  35.900 62.923  1.00 40.30  -1 301 GSP D O2A   1 
HETATM 7228 O  O3A   . GSP K 2 .   ? 34.018  34.486 61.038  1.00 43.83  ?  301 GSP D O3A   1 
HETATM 7229 O  "O5'" . GSP K 2 .   ? 32.421  35.929 62.491  1.00 47.50  ?  301 GSP D "O5'" 1 
HETATM 7230 C  "C5'" . GSP K 2 .   ? 32.441  34.890 63.398  1.00 45.64  ?  301 GSP D "C5'" 1 
HETATM 7231 C  "C4'" . GSP K 2 .   ? 31.062  34.905 63.994  1.00 47.22  ?  301 GSP D "C4'" 1 
HETATM 7232 O  "O4'" . GSP K 2 .   ? 30.908  33.696 64.758  1.00 47.15  ?  301 GSP D "O4'" 1 
HETATM 7233 C  "C3'" . GSP K 2 .   ? 30.936  36.058 64.997  1.00 45.62  ?  301 GSP D "C3'" 1 
HETATM 7234 O  "O3'" . GSP K 2 .   ? 29.587  36.256 65.273  1.00 41.37  ?  301 GSP D "O3'" 1 
HETATM 7235 C  "C2'" . GSP K 2 .   ? 31.663  35.472 66.193  1.00 46.88  ?  301 GSP D "C2'" 1 
HETATM 7236 O  "O2'" . GSP K 2 .   ? 31.204  35.992 67.393  1.00 54.54  ?  301 GSP D "O2'" 1 
HETATM 7237 C  "C1'" . GSP K 2 .   ? 31.190  33.987 66.122  1.00 46.35  ?  301 GSP D "C1'" 1 
HETATM 7238 N  N9    . GSP K 2 .   ? 32.254  33.107 66.547  1.00 43.28  ?  301 GSP D N9    1 
HETATM 7239 C  C8    . GSP K 2 .   ? 33.652  33.247 66.303  1.00 44.68  ?  301 GSP D C8    1 
HETATM 7240 N  N7    . GSP K 2 .   ? 34.350  32.232 66.854  1.00 45.56  ?  301 GSP D N7    1 
HETATM 7241 C  C5    . GSP K 2 .   ? 33.377  31.431 67.459  1.00 42.84  ?  301 GSP D C5    1 
HETATM 7242 C  C6    . GSP K 2 .   ? 33.602  30.231 68.178  1.00 42.20  ?  301 GSP D C6    1 
HETATM 7243 O  O6    . GSP K 2 .   ? 34.640  29.643 68.426  1.00 41.61  ?  301 GSP D O6    1 
HETATM 7244 N  N1    . GSP K 2 .   ? 32.383  29.660 68.670  1.00 41.40  ?  301 GSP D N1    1 
HETATM 7245 C  C2    . GSP K 2 .   ? 31.145  30.274 68.429  1.00 41.49  ?  301 GSP D C2    1 
HETATM 7246 N  N2    . GSP K 2 .   ? 30.035  29.636 68.950  1.00 43.51  ?  301 GSP D N2    1 
HETATM 7247 N  N3    . GSP K 2 .   ? 30.899  31.414 67.749  1.00 41.13  ?  301 GSP D N3    1 
HETATM 7248 C  C4    . GSP K 2 .   ? 32.088  31.956 67.279  1.00 41.75  ?  301 GSP D C4    1 
HETATM 7249 MG MG    . MG  L 3 .   ? 37.037  36.811 58.092  1.00 49.37  2  302 MG  D MG    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 0.6808 0.5867 1.1385 0.0030  0.3580  0.0506  18  MET A N   
2    C CA  . MET A 1   ? 0.6546 0.6711 1.1785 -0.0050 0.3312  0.0739  18  MET A CA  
3    C C   . MET A 1   ? 0.6202 0.6920 1.1507 0.0139  0.2893  0.1141  18  MET A C   
4    O O   . MET A 1   ? 0.5995 0.6589 1.1421 0.0500  0.2783  0.1544  18  MET A O   
5    C CB  . MET A 1   ? 0.6668 0.6293 1.2092 0.0254  0.3504  0.0934  18  MET A CB  
6    N N   . LYS A 2   ? 0.6869 0.8095 1.2038 -0.0114 0.2694  0.1033  19  LYS A N   
7    C CA  . LYS A 2   ? 0.6614 0.8403 1.1838 0.0034  0.2284  0.1402  19  LYS A CA  
8    C C   . LYS A 2   ? 0.6570 0.9483 1.1925 -0.0448 0.2031  0.1218  19  LYS A C   
9    O O   . LYS A 2   ? 0.6841 0.9993 1.2183 -0.0929 0.2223  0.0766  19  LYS A O   
10   C CB  . LYS A 2   ? 0.6690 0.7471 1.1344 0.0407  0.2318  0.1564  19  LYS A CB  
11   N N   . GLN A 3   ? 0.5855 0.9387 1.1235 -0.0334 0.1613  0.1555  20  GLN A N   
12   C CA  . GLN A 3   ? 0.5755 1.0375 1.1152 -0.0762 0.1314  0.1417  20  GLN A CA  
13   C C   . GLN A 3   ? 0.5901 1.0082 1.0712 -0.0658 0.1139  0.1473  20  GLN A C   
14   O O   . GLN A 3   ? 0.5888 0.9300 1.0421 -0.0219 0.1090  0.1762  20  GLN A O   
15   C CB  . GLN A 3   ? 0.5237 1.1031 1.0946 -0.0719 0.0894  0.1700  20  GLN A CB  
16   C CG  . GLN A 3   ? 0.5257 1.0843 1.1295 -0.0298 0.0969  0.2061  20  GLN A CG  
17   C CD  . GLN A 3   ? 0.5454 1.2253 1.1883 -0.0354 0.0713  0.2239  20  GLN A CD  
18   O OE1 . GLN A 3   ? 0.5591 1.3384 1.2006 -0.0699 0.0443  0.2084  20  GLN A OE1 
19   N NE2 . GLN A 3   ? 0.5578 1.2236 1.2307 0.0002  0.0822  0.2588  20  GLN A NE2 
20   N N   . GLY A 4   ? 0.5736 1.0408 1.0313 -0.1104 0.1059  0.1155  21  GLY A N   
21   C CA  . GLY A 4   ? 0.5922 1.0173 0.9918 -0.1060 0.0949  0.1138  21  GLY A CA  
22   C C   . GLY A 4   ? 0.5383 1.0447 0.9365 -0.0969 0.0465  0.1508  21  GLY A C   
23   O O   . GLY A 4   ? 0.5099 1.1253 0.9187 -0.1280 0.0218  0.1452  21  GLY A O   
24   N N   . PHE A 5   ? 0.4604 0.9045 0.8349 -0.0535 0.0345  0.1851  22  PHE A N   
25   C CA  . PHE A 5   ? 0.3907 0.8921 0.7592 -0.0416 -0.0024 0.2216  22  PHE A CA  
26   C C   . PHE A 5   ? 0.4092 0.8597 0.7217 -0.0466 -0.0038 0.2081  22  PHE A C   
27   O O   . PHE A 5   ? 0.4359 0.7878 0.7192 -0.0262 0.0137  0.2032  22  PHE A O   
28   C CB  . PHE A 5   ? 0.3603 0.8212 0.7376 0.0072  -0.0089 0.2690  22  PHE A CB  
29   C CG  . PHE A 5   ? 0.3637 0.8562 0.7757 0.0180  -0.0051 0.2850  22  PHE A CG  
30   C CD1 . PHE A 5   ? 0.3851 0.9740 0.8042 0.0048  -0.0250 0.2940  22  PHE A CD1 
31   C CD2 . PHE A 5   ? 0.3699 0.7957 0.8044 0.0429  0.0209  0.2928  22  PHE A CD2 
32   C CE1 . PHE A 5   ? 0.4038 1.0308 0.8596 0.0170  -0.0203 0.3136  22  PHE A CE1 
33   C CE2 . PHE A 5   ? 0.3794 0.8344 0.8474 0.0534  0.0274  0.3102  22  PHE A CE2 
34   C CZ  . PHE A 5   ? 0.3990 0.9590 0.8814 0.0412  0.0061  0.3222  22  PHE A CZ  
35   N N   . GLU A 6   ? 0.5066 1.0341 0.8049 -0.0733 -0.0248 0.2045  23  GLU A N   
36   C CA  . GLU A 6   ? 0.5211 1.0109 0.7696 -0.0812 -0.0234 0.1918  23  GLU A CA  
37   C C   . GLU A 6   ? 0.4829 0.9522 0.7215 -0.0456 -0.0446 0.2351  23  GLU A C   
38   O O   . GLU A 6   ? 0.4668 0.9539 0.7124 -0.0258 -0.0578 0.2665  23  GLU A O   
39   C CB  . GLU A 6   ? 0.5364 1.1121 0.7666 -0.1295 -0.0316 0.1651  23  GLU A CB  
40   C CG  . GLU A 6   ? 0.6028 1.2055 0.8418 -0.1776 -0.0065 0.1148  23  GLU A CG  
41   C CD  . GLU A 6   ? 0.6173 1.3066 0.8275 -0.2305 -0.0164 0.0835  23  GLU A CD  
42   O OE1 . GLU A 6   ? 0.6037 1.3066 0.7776 -0.2334 -0.0297 0.0921  23  GLU A OE1 
43   O OE2 . GLU A 6   ? 0.6467 1.3789 0.8620 -0.2666 -0.0096 0.0486  23  GLU A OE2 
44   N N   . PHE A 7   ? 0.2437 0.6438 0.4460 -0.0383 -0.0350 0.2278  24  PHE A N   
45   C CA  . PHE A 7   ? 0.2346 0.6114 0.4245 -0.0143 -0.0497 0.2598  24  PHE A CA  
46   C C   . PHE A 7   ? 0.2402 0.5893 0.3934 -0.0230 -0.0430 0.2458  24  PHE A C   
47   O O   . PHE A 7   ? 0.2473 0.5424 0.3844 -0.0236 -0.0182 0.2220  24  PHE A O   
48   C CB  . PHE A 7   ? 0.2345 0.5256 0.4265 0.0106  -0.0337 0.2579  24  PHE A CB  
49   C CG  . PHE A 7   ? 0.2439 0.4989 0.4222 0.0174  -0.0316 0.2529  24  PHE A CG  
50   C CD1 . PHE A 7   ? 0.2590 0.5470 0.4470 0.0189  -0.0352 0.2698  24  PHE A CD1 
51   C CD2 . PHE A 7   ? 0.2426 0.4402 0.4000 0.0229  -0.0257 0.2346  24  PHE A CD2 
52   C CE1 . PHE A 7   ? 0.2716 0.5295 0.4532 0.0267  -0.0305 0.2709  24  PHE A CE1 
53   C CE2 . PHE A 7   ? 0.2540 0.4306 0.4031 0.0254  -0.0261 0.2336  24  PHE A CE2 
54   C CZ  . PHE A 7   ? 0.2686 0.4709 0.4312 0.0279  -0.0270 0.2524  24  PHE A CZ  
55   N N   . ASN A 8   ? 0.3506 0.7230 0.4893 -0.0282 -0.0534 0.2540  25  ASN A N   
56   C CA  . ASN A 8   ? 0.3605 0.7245 0.4697 -0.0361 -0.0494 0.2491  25  ASN A CA  
57   C C   . ASN A 8   ? 0.3518 0.6669 0.4630 -0.0214 -0.0447 0.2436  25  ASN A C   
58   O O   . ASN A 8   ? 0.3590 0.6818 0.4773 -0.0190 -0.0490 0.2502  25  ASN A O   
59   C CB  . ASN A 8   ? 0.3826 0.8166 0.4705 -0.0666 -0.0566 0.2408  25  ASN A CB  
60   C CG  . ASN A 8   ? 0.4226 0.8876 0.5107 -0.0990 -0.0437 0.2036  25  ASN A CG  
61   O OD1 . ASN A 8   ? 0.4590 0.8698 0.5487 -0.1018 -0.0150 0.1764  25  ASN A OD1 
62   N ND2 . ASN A 8   ? 0.4214 0.9791 0.5073 -0.1253 -0.0627 0.2026  25  ASN A ND2 
63   N N   . ILE A 9   ? 0.3288 0.6009 0.4319 -0.0123 -0.0343 0.2340  26  ILE A N   
64   C CA  . ILE A 9   ? 0.3265 0.5722 0.4296 -0.0065 -0.0337 0.2279  26  ILE A CA  
65   C C   . ILE A 9   ? 0.3311 0.5880 0.4216 -0.0097 -0.0281 0.2293  26  ILE A C   
66   O O   . ILE A 9   ? 0.3368 0.5859 0.4149 -0.0052 -0.0142 0.2287  26  ILE A O   
67   C CB  . ILE A 9   ? 0.3206 0.5230 0.4249 0.0048  -0.0289 0.2167  26  ILE A CB  
68   C CG1 . ILE A 9   ? 0.3223 0.5075 0.4351 0.0098  -0.0301 0.2158  26  ILE A CG1 
69   C CG2 . ILE A 9   ? 0.3237 0.5174 0.4274 0.0025  -0.0321 0.2163  26  ILE A CG2 
70   C CD1 . ILE A 9   ? 0.3252 0.4700 0.4298 0.0185  -0.0260 0.2049  26  ILE A CD1 
71   N N   . MET A 10  ? 0.3554 0.6249 0.4469 -0.0148 -0.0328 0.2342  27  MET A N   
72   C CA  . MET A 10  ? 0.3627 0.6422 0.4446 -0.0162 -0.0260 0.2375  27  MET A CA  
73   C C   . MET A 10  ? 0.3551 0.6237 0.4512 -0.0118 -0.0257 0.2380  27  MET A C   
74   O O   . MET A 10  ? 0.3571 0.6210 0.4622 -0.0158 -0.0326 0.2417  27  MET A O   
75   C CB  . MET A 10  ? 0.3820 0.6952 0.4494 -0.0288 -0.0307 0.2457  27  MET A CB  
76   C CG  . MET A 10  ? 0.3945 0.7108 0.4526 -0.0291 -0.0227 0.2502  27  MET A CG  
77   S SD  . MET A 10  ? 0.4287 0.7827 0.4576 -0.0452 -0.0260 0.2572  27  MET A SD  
78   C CE  . MET A 10  ? 0.4596 0.8233 0.4419 -0.0671 -0.0097 0.2425  27  MET A CE  
79   N N   . VAL A 11  ? 0.3030 0.5735 0.4012 -0.0035 -0.0155 0.2391  28  VAL A N   
80   C CA  . VAL A 11  ? 0.2979 0.5808 0.4129 -0.0042 -0.0171 0.2454  28  VAL A CA  
81   C C   . VAL A 11  ? 0.3072 0.6137 0.4251 -0.0068 -0.0131 0.2573  28  VAL A C   
82   O O   . VAL A 11  ? 0.3209 0.6292 0.4246 0.0002  -0.0001 0.2598  28  VAL A O   
83   C CB  . VAL A 11  ? 0.2928 0.5815 0.4149 0.0091  -0.0084 0.2462  28  VAL A CB  
84   C CG1 . VAL A 11  ? 0.2895 0.5525 0.4051 0.0100  -0.0145 0.2350  28  VAL A CG1 
85   C CG2 . VAL A 11  ? 0.3032 0.5910 0.4177 0.0280  0.0127  0.2502  28  VAL A CG2 
86   N N   . VAL A 12  ? 0.3131 0.6311 0.4442 -0.0173 -0.0210 0.2661  29  VAL A N   
87   C CA  . VAL A 12  ? 0.3253 0.6631 0.4594 -0.0198 -0.0171 0.2788  29  VAL A CA  
88   C C   . VAL A 12  ? 0.3221 0.6885 0.4833 -0.0281 -0.0218 0.2941  29  VAL A C   
89   O O   . VAL A 12  ? 0.3219 0.6838 0.4905 -0.0400 -0.0320 0.2963  29  VAL A O   
90   C CB  . VAL A 12  ? 0.3436 0.6707 0.4614 -0.0259 -0.0211 0.2807  29  VAL A CB  
91   C CG1 . VAL A 12  ? 0.3620 0.7023 0.4824 -0.0292 -0.0168 0.2956  29  VAL A CG1 
92   C CG2 . VAL A 12  ? 0.3542 0.6780 0.4442 -0.0243 -0.0181 0.2727  29  VAL A CG2 
93   N N   . GLY A 13  ? 0.3790 0.7767 0.5530 -0.0232 -0.0139 0.3077  30  GLY A N   
94   C CA  . GLY A 13  ? 0.3787 0.8205 0.5817 -0.0342 -0.0205 0.3277  30  GLY A CA  
95   C C   . GLY A 13  ? 0.3825 0.8655 0.6034 -0.0197 -0.0090 0.3446  30  GLY A C   
96   O O   . GLY A 13  ? 0.3905 0.8564 0.5976 0.0007  0.0088  0.3399  30  GLY A O   
97   N N   . GLN A 14  ? 0.7413 0.9890 1.2329 -0.1275 0.1867  0.0089  31  GLN A N   
98   C CA  . GLN A 14  ? 0.6733 0.9753 1.2376 -0.1430 0.2212  -0.0113 31  GLN A CA  
99   C C   . GLN A 14  ? 0.5641 0.9067 1.2016 -0.1199 0.2034  -0.0407 31  GLN A C   
100  O O   . GLN A 14  ? 0.5374 0.8645 1.1740 -0.0960 0.1652  -0.0406 31  GLN A O   
101  C CB  . GLN A 14  ? 0.6739 0.9769 1.2906 -0.1751 0.2362  -0.0020 31  GLN A CB  
102  C CG  . GLN A 14  ? 0.7655 1.0468 1.3288 -0.2073 0.2762  0.0255  31  GLN A CG  
103  C CD  . GLN A 14  ? 0.7404 1.0444 1.3820 -0.2449 0.3049  0.0285  31  GLN A CD  
104  O OE1 . GLN A 14  ? 0.6841 0.9967 1.4077 -0.2472 0.2800  0.0160  31  GLN A OE1 
105  N NE2 . GLN A 14  ? 0.7861 1.1029 1.4039 -0.2745 0.3580  0.0443  31  GLN A NE2 
106  N N   . SER A 15  ? 0.4177 0.8126 1.1168 -0.1262 0.2321  -0.0652 32  SER A N   
107  C CA  . SER A 15  ? 0.3724 0.7975 1.1303 -0.1016 0.2136  -0.0926 32  SER A CA  
108  C C   . SER A 15  ? 0.3503 0.7645 1.1501 -0.0902 0.1740  -0.0938 32  SER A C   
109  O O   . SER A 15  ? 0.3688 0.7870 1.2036 -0.1076 0.1762  -0.0932 32  SER A O   
110  C CB  . SER A 15  ? 0.4005 0.8621 1.1773 -0.1044 0.2405  -0.1158 32  SER A CB  
111  O OG  . SER A 15  ? 0.4338 0.9097 1.1666 -0.1157 0.2811  -0.1164 32  SER A OG  
112  N N   . GLY A 16  ? 0.3180 0.7176 1.1115 -0.0608 0.1384  -0.0953 33  GLY A N   
113  C CA  . GLY A 16  ? 0.3054 0.6958 1.1271 -0.0438 0.1013  -0.0990 33  GLY A CA  
114  C C   . GLY A 16  ? 0.2962 0.6672 1.1180 -0.0449 0.0772  -0.0836 33  GLY A C   
115  O O   . GLY A 16  ? 0.2997 0.6685 1.1531 -0.0390 0.0524  -0.0911 33  GLY A O   
116  N N   . LEU A 17  ? 0.2971 0.6454 1.0685 -0.0492 0.0796  -0.0637 34  LEU A N   
117  C CA  . LEU A 17  ? 0.3102 0.6205 1.0462 -0.0452 0.0504  -0.0483 34  LEU A CA  
118  C C   . LEU A 17  ? 0.2864 0.5848 0.9901 -0.0107 0.0152  -0.0423 34  LEU A C   
119  O O   . LEU A 17  ? 0.2967 0.5685 0.9677 0.0000  -0.0117 -0.0337 34  LEU A O   
120  C CB  . LEU A 17  ? 0.3515 0.6240 1.0179 -0.0650 0.0664  -0.0271 34  LEU A CB  
121  C CG  . LEU A 17  ? 0.3934 0.6663 1.0822 -0.1024 0.0989  -0.0230 34  LEU A CG  
122  C CD1 . LEU A 17  ? 0.4464 0.6696 1.0527 -0.1169 0.1080  0.0041  34  LEU A CD1 
123  C CD2 . LEU A 17  ? 0.3952 0.6749 1.1596 -0.1128 0.0820  -0.0337 34  LEU A CD2 
124  N N   . GLY A 18  ? 0.2606 0.5785 0.9746 0.0066  0.0163  -0.0469 35  GLY A N   
125  C CA  . GLY A 18  ? 0.2447 0.5558 0.9328 0.0365  -0.0107 -0.0371 35  GLY A CA  
126  C C   . GLY A 18  ? 0.2457 0.5393 0.8686 0.0401  -0.0054 -0.0211 35  GLY A C   
127  O O   . GLY A 18  ? 0.2425 0.5274 0.8311 0.0601  -0.0257 -0.0092 35  GLY A O   
128  N N   . LYS A 19  ? 0.2786 0.5716 0.8855 0.0224  0.0218  -0.0231 36  LYS A N   
129  C CA  . LYS A 19  ? 0.2831 0.5627 0.8341 0.0257  0.0247  -0.0133 36  LYS A CA  
130  C C   . LYS A 19  ? 0.2599 0.5516 0.8230 0.0432  0.0175  -0.0103 36  LYS A C   
131  O O   . LYS A 19  ? 0.2564 0.5422 0.7873 0.0564  0.0041  0.0024  36  LYS A O   
132  C CB  . LYS A 19  ? 0.3056 0.5841 0.8358 0.0060  0.0531  -0.0201 36  LYS A CB  
133  C CG  . LYS A 19  ? 0.3428 0.6022 0.8483 -0.0144 0.0644  -0.0140 36  LYS A CG  
134  C CD  . LYS A 19  ? 0.3778 0.6337 0.8420 -0.0292 0.0924  -0.0158 36  LYS A CD  
135  C CE  . LYS A 19  ? 0.3677 0.6603 0.8759 -0.0333 0.1175  -0.0379 36  LYS A CE  
136  N NZ  . LYS A 19  ? 0.4143 0.7116 0.8931 -0.0527 0.1522  -0.0413 36  LYS A NZ  
137  N N   . SER A 20  ? 0.2560 0.5647 0.8690 0.0430  0.0271  -0.0220 37  SER A N   
138  C CA  . SER A 20  ? 0.2513 0.5565 0.8673 0.0551  0.0202  -0.0160 37  SER A CA  
139  C C   . SER A 20  ? 0.2545 0.5508 0.8541 0.0736  -0.0022 0.0017  37  SER A C   
140  O O   . SER A 20  ? 0.2555 0.5482 0.8377 0.0829  -0.0075 0.0176  37  SER A O   
141  C CB  . SER A 20  ? 0.2621 0.5671 0.9090 0.0509  0.0297  -0.0332 37  SER A CB  
142  O OG  . SER A 20  ? 0.2667 0.5858 0.9236 0.0364  0.0526  -0.0535 37  SER A OG  
143  N N   . THR A 21  ? 0.2291 0.5251 0.8367 0.0785  -0.0142 -0.0024 38  THR A N   
144  C CA  . THR A 21  ? 0.2406 0.5313 0.8274 0.0996  -0.0369 0.0097  38  THR A CA  
145  C C   . THR A 21  ? 0.2392 0.5306 0.7826 0.1114  -0.0468 0.0241  38  THR A C   
146  O O   . THR A 21  ? 0.2512 0.5436 0.7659 0.1302  -0.0571 0.0386  38  THR A O   
147  C CB  . THR A 21  ? 0.2517 0.5437 0.8588 0.1023  -0.0509 -0.0045 38  THR A CB  
148  O OG1 . THR A 21  ? 0.2561 0.5521 0.9055 0.0931  -0.0414 -0.0205 38  THR A OG1 
149  C CG2 . THR A 21  ? 0.2722 0.5605 0.8501 0.1283  -0.0758 0.0049  38  THR A CG2 
150  N N   . LEU A 22  ? 0.3278 0.6207 0.8675 0.1022  -0.0432 0.0202  39  LEU A N   
151  C CA  . LEU A 22  ? 0.3308 0.6233 0.8302 0.1158  -0.0558 0.0297  39  LEU A CA  
152  C C   . LEU A 22  ? 0.3244 0.6262 0.8061 0.1177  -0.0448 0.0423  39  LEU A C   
153  O O   . LEU A 22  ? 0.3318 0.6411 0.7791 0.1335  -0.0529 0.0519  39  LEU A O   
154  C CB  . LEU A 22  ? 0.3451 0.6169 0.8179 0.1021  -0.0567 0.0212  39  LEU A CB  
155  C CG  . LEU A 22  ? 0.3616 0.6239 0.7877 0.1203  -0.0783 0.0240  39  LEU A CG  
156  C CD1 . LEU A 22  ? 0.3733 0.6333 0.8076 0.1372  -0.1044 0.0163  39  LEU A CD1 
157  C CD2 . LEU A 22  ? 0.4032 0.6383 0.7942 0.1069  -0.0767 0.0215  39  LEU A CD2 
158  N N   . ILE A 23  ? 0.2585 0.5621 0.7661 0.1012  -0.0263 0.0384  40  ILE A N   
159  C CA  . ILE A 23  ? 0.2543 0.5667 0.7591 0.0988  -0.0171 0.0457  40  ILE A CA  
160  C C   . ILE A 23  ? 0.2652 0.5803 0.7671 0.1092  -0.0187 0.0637  40  ILE A C   
161  O O   . ILE A 23  ? 0.2687 0.5979 0.7531 0.1169  -0.0184 0.0766  40  ILE A O   
162  C CB  . ILE A 23  ? 0.2502 0.5602 0.7840 0.0803  -0.0009 0.0311  40  ILE A CB  
163  C CG1 . ILE A 23  ? 0.2613 0.5597 0.7660 0.0676  0.0049  0.0147  40  ILE A CG1 
164  C CG2 . ILE A 23  ? 0.2488 0.5676 0.7915 0.0773  0.0041  0.0356  40  ILE A CG2 
165  C CD1 . ILE A 23  ? 0.2665 0.5661 0.7878 0.0537  0.0208  -0.0038 40  ILE A CD1 
166  N N   . ASN A 24  ? 0.3594 0.6636 0.8831 0.1103  -0.0199 0.0655  41  ASN A N   
167  C CA  . ASN A 24  ? 0.3792 0.6833 0.9062 0.1225  -0.0224 0.0886  41  ASN A CA  
168  C C   . ASN A 24  ? 0.3948 0.7086 0.8785 0.1454  -0.0360 0.0999  41  ASN A C   
169  O O   . ASN A 24  ? 0.4192 0.7437 0.8925 0.1570  -0.0331 0.1250  41  ASN A O   
170  C CB  . ASN A 24  ? 0.3873 0.6748 0.9466 0.1235  -0.0264 0.0861  41  ASN A CB  
171  C CG  . ASN A 24  ? 0.3765 0.6547 0.9768 0.1044  -0.0147 0.0678  41  ASN A CG  
172  O OD1 . ASN A 24  ? 0.3657 0.6491 0.9704 0.0908  -0.0036 0.0603  41  ASN A OD1 
173  N ND2 . ASN A 24  ? 0.3851 0.6512 1.0139 0.1060  -0.0193 0.0568  41  ASN A ND2 
174  N N   . THR A 25  ? 0.3600 0.6713 0.8212 0.1522  -0.0501 0.0817  42  THR A N   
175  C CA  . THR A 25  ? 0.3792 0.6964 0.7972 0.1755  -0.0677 0.0818  42  THR A CA  
176  C C   . THR A 25  ? 0.3779 0.7107 0.7692 0.1781  -0.0615 0.0886  42  THR A C   
177  O O   . THR A 25  ? 0.4006 0.7462 0.7626 0.1944  -0.0628 0.1021  42  THR A O   
178  C CB  . THR A 25  ? 0.3796 0.6894 0.7896 0.1801  -0.0856 0.0591  42  THR A CB  
179  O OG1 . THR A 25  ? 0.3837 0.6855 0.8224 0.1761  -0.0888 0.0529  42  THR A OG1 
180  C CG2 . THR A 25  ? 0.4054 0.7086 0.7813 0.2013  -0.1107 0.0518  42  THR A CG2 
181  N N   . LEU A 26  ? 0.4518 0.7868 0.8523 0.1632  -0.0537 0.0795  43  LEU A N   
182  C CA  . LEU A 26  ? 0.4525 0.8037 0.8314 0.1663  -0.0506 0.0798  43  LEU A CA  
183  C C   . LEU A 26  ? 0.4576 0.8342 0.8506 0.1632  -0.0314 0.1010  43  LEU A C   
184  O O   . LEU A 26  ? 0.4733 0.8738 0.8440 0.1747  -0.0285 0.1069  43  LEU A O   
185  C CB  . LEU A 26  ? 0.4418 0.7892 0.8303 0.1534  -0.0496 0.0666  43  LEU A CB  
186  C CG  . LEU A 26  ? 0.4433 0.8069 0.8140 0.1572  -0.0503 0.0615  43  LEU A CG  
187  C CD1 . LEU A 26  ? 0.4655 0.8099 0.8083 0.1618  -0.0675 0.0467  43  LEU A CD1 
188  C CD2 . LEU A 26  ? 0.4312 0.8103 0.8385 0.1398  -0.0334 0.0638  43  LEU A CD2 
189  N N   . PHE A 27  ? 0.3987 0.7711 0.8343 0.1472  -0.0177 0.1122  44  PHE A N   
190  C CA  . PHE A 27  ? 0.4122 0.8063 0.8777 0.1401  0.0009  0.1363  44  PHE A CA  
191  C C   . PHE A 27  ? 0.4599 0.8671 0.9165 0.1581  0.0054  0.1703  44  PHE A C   
192  O O   . PHE A 27  ? 0.4938 0.9349 0.9590 0.1611  0.0224  0.1966  44  PHE A O   
193  C CB  . PHE A 27  ? 0.3982 0.7753 0.9174 0.1167  0.0101  0.1336  44  PHE A CB  
194  C CG  . PHE A 27  ? 0.3744 0.7555 0.9062 0.1004  0.0124  0.1093  44  PHE A CG  
195  C CD1 . PHE A 27  ? 0.3722 0.7825 0.8958 0.1020  0.0150  0.1063  44  PHE A CD1 
196  C CD2 . PHE A 27  ? 0.3619 0.7215 0.9136 0.0865  0.0111  0.0873  44  PHE A CD2 
197  C CE1 . PHE A 27  ? 0.3579 0.7737 0.8934 0.0914  0.0121  0.0823  44  PHE A CE1 
198  C CE2 . PHE A 27  ? 0.3546 0.7208 0.9140 0.0763  0.0109  0.0651  44  PHE A CE2 
199  C CZ  . PHE A 27  ? 0.3523 0.7455 0.9041 0.0794  0.0093  0.0630  44  PHE A CZ  
200  N N   . LYS A 28  ? 0.5468 0.9310 0.9871 0.1710  -0.0092 0.1703  45  LYS A N   
201  C CA  . LYS A 28  ? 0.6023 0.9941 1.0225 0.1937  -0.0100 0.2020  45  LYS A CA  
202  C C   . LYS A 28  ? 0.6279 1.0396 0.9843 0.2191  -0.0194 0.1955  45  LYS A C   
203  O O   . LYS A 28  ? 0.6665 1.0750 0.9860 0.2423  -0.0305 0.2052  45  LYS A O   
204  C CB  . LYS A 28  ? 0.5997 0.9562 1.0278 0.1990  -0.0271 0.1977  45  LYS A CB  
205  N N   . SER A 29  ? 0.8783 1.3069 1.2203 0.2157  -0.0176 0.1752  46  SER A N   
206  C CA  . SER A 29  ? 0.9003 1.3459 1.1868 0.2389  -0.0271 0.1627  46  SER A CA  
207  C C   . SER A 29  ? 0.9268 1.4249 1.2142 0.2427  -0.0043 0.1769  46  SER A C   
208  O O   . SER A 29  ? 0.9431 1.4621 1.1901 0.2611  -0.0091 0.1617  46  SER A O   
209  C CB  . SER A 29  ? 0.8636 1.2761 1.1339 0.2347  -0.0515 0.1214  46  SER A CB  
210  O OG  . SER A 29  ? 0.8875 1.3141 1.1134 0.2533  -0.0593 0.1068  46  SER A OG  
211  N N   . LYS A 30  ? 0.8642 1.3839 1.2053 0.2238  0.0205  0.2037  47  LYS A N   
212  C CA  . LYS A 30  ? 0.8761 1.4496 1.2377 0.2194  0.0453  0.2152  47  LYS A CA  
213  C C   . LYS A 30  ? 0.9526 1.5593 1.3316 0.2195  0.0765  0.2668  47  LYS A C   
214  O O   . LYS A 30  ? 0.9634 1.5388 1.3810 0.1959  0.0861  0.2904  47  LYS A O   
215  C CB  . LYS A 30  ? 0.8115 1.3728 1.2233 0.1869  0.0481  0.1946  47  LYS A CB  
216  C CG  . LYS A 30  ? 0.7597 1.2776 1.1518 0.1827  0.0205  0.1513  47  LYS A CG  
217  C CD  . LYS A 30  ? 0.7536 1.2852 1.1104 0.1968  0.0084  0.1230  47  LYS A CD  
218  C CE  . LYS A 30  ? 0.7821 1.2979 1.0792 0.2230  -0.0112 0.1117  47  LYS A CE  
219  N NZ  . LYS A 30  ? 0.7869 1.3126 1.0533 0.2375  -0.0233 0.0853  47  LYS A NZ  
220  N N   . ARG A 43  ? 0.5813 0.8080 1.3886 0.1738  -0.1036 -0.0274 60  ARG A N   
221  C CA  . ARG A 43  ? 0.5500 0.8012 1.3714 0.1503  -0.0817 -0.0556 60  ARG A CA  
222  C C   . ARG A 43  ? 0.5256 0.7748 1.3391 0.1314  -0.0580 -0.0517 60  ARG A C   
223  O O   . ARG A 43  ? 0.5349 0.7687 1.3717 0.1301  -0.0545 -0.0527 60  ARG A O   
224  C CB  . ARG A 43  ? 0.5641 0.8278 1.4374 0.1484  -0.0806 -0.0917 60  ARG A CB  
225  C CG  . ARG A 43  ? 0.5423 0.8346 1.4292 0.1257  -0.0548 -0.1184 60  ARG A CG  
226  C CD  . ARG A 43  ? 0.5548 0.8575 1.4858 0.1210  -0.0417 -0.1502 60  ARG A CD  
227  N NE  . ARG A 43  ? 0.5452 0.8797 1.4847 0.1011  -0.0134 -0.1728 60  ARG A NE  
228  C CZ  . ARG A 43  ? 0.5536 0.9031 1.5093 0.0924  0.0091  -0.1961 60  ARG A CZ  
229  N NH1 . ARG A 43  ? 0.5678 0.9005 1.5387 0.1015  0.0035  -0.2042 60  ARG A NH1 
230  N NH2 . ARG A 43  ? 0.5488 0.9306 1.5067 0.0750  0.0373  -0.2116 60  ARG A NH2 
231  N N   . ILE A 44  ? 0.3248 0.5879 1.1079 0.1177  -0.0443 -0.0489 61  ILE A N   
232  C CA  . ILE A 44  ? 0.3048 0.5707 1.0782 0.1004  -0.0224 -0.0509 61  ILE A CA  
233  C C   . ILE A 44  ? 0.3060 0.5885 1.1083 0.0877  -0.0039 -0.0847 61  ILE A C   
234  O O   . ILE A 44  ? 0.3043 0.6068 1.1138 0.0806  0.0033  -0.0997 61  ILE A O   
235  C CB  . ILE A 44  ? 0.2826 0.5573 1.0131 0.0926  -0.0162 -0.0372 61  ILE A CB  
236  C CG1 . ILE A 44  ? 0.2863 0.5509 0.9844 0.1081  -0.0326 -0.0062 61  ILE A CG1 
237  C CG2 . ILE A 44  ? 0.2681 0.5475 0.9882 0.0768  0.0042  -0.0423 61  ILE A CG2 
238  C CD1 . ILE A 44  ? 0.2684 0.5415 0.9258 0.1044  -0.0297 0.0048  61  ILE A CD1 
239  N N   . PRO A 45  ? 0.3830 0.6594 1.2058 0.0850  0.0042  -0.0978 62  PRO A N   
240  C CA  . PRO A 45  ? 0.3924 0.6891 1.2408 0.0775  0.0221  -0.1333 62  PRO A CA  
241  C C   . PRO A 45  ? 0.3791 0.7011 1.2006 0.0604  0.0475  -0.1401 62  PRO A C   
242  O O   . PRO A 45  ? 0.3612 0.6799 1.1460 0.0542  0.0494  -0.1192 62  PRO A O   
243  C CB  . PRO A 45  ? 0.4051 0.6861 1.2768 0.0809  0.0205  -0.1444 62  PRO A CB  
244  C CG  . PRO A 45  ? 0.3928 0.6520 1.2419 0.0805  0.0123  -0.1122 62  PRO A CG  
245  C CD  . PRO A 45  ? 0.3874 0.6401 1.2152 0.0887  -0.0024 -0.0821 62  PRO A CD  
246  N N   . LYS A 46  ? 0.3237 0.6725 1.1649 0.0537  0.0675  -0.1691 63  LYS A N   
247  C CA  . LYS A 46  ? 0.3222 0.6979 1.1409 0.0367  0.0963  -0.1747 63  LYS A CA  
248  C C   . LYS A 46  ? 0.3189 0.6931 1.1098 0.0335  0.1068  -0.1767 63  LYS A C   
249  O O   . LYS A 46  ? 0.3316 0.7035 1.1390 0.0410  0.1054  -0.1978 63  LYS A O   
250  C CB  . LYS A 46  ? 0.3469 0.7572 1.1959 0.0313  0.1185  -0.2048 63  LYS A CB  
251  C CG  . LYS A 46  ? 0.3575 0.7993 1.1844 0.0119  0.1547  -0.2085 63  LYS A CG  
252  C CD  . LYS A 46  ? 0.3852 0.8648 1.2463 0.0042  0.1771  -0.2306 63  LYS A CD  
253  C CE  . LYS A 46  ? 0.4062 0.8971 1.3053 0.0206  0.1727  -0.2650 63  LYS A CE  
254  N NZ  . LYS A 46  ? 0.3995 0.8670 1.3364 0.0373  0.1373  -0.2658 63  LYS A NZ  
255  N N   . THR A 47  ? 0.3049 0.6807 1.0585 0.0233  0.1148  -0.1580 64  THR A N   
256  C CA  . THR A 47  ? 0.3026 0.6797 1.0300 0.0217  0.1219  -0.1610 64  THR A CA  
257  C C   . THR A 47  ? 0.3290 0.7389 1.0501 0.0155  0.1536  -0.1914 64  THR A C   
258  O O   . THR A 47  ? 0.3412 0.7724 1.0427 0.0011  0.1805  -0.1888 64  THR A O   
259  C CB  . THR A 47  ? 0.2834 0.6541 0.9752 0.0152  0.1192  -0.1336 64  THR A CB  
260  O OG1 . THR A 47  ? 0.2657 0.6130 0.9580 0.0229  0.0930  -0.1073 64  THR A OG1 
261  C CG2 . THR A 47  ? 0.2852 0.6505 0.9476 0.0180  0.1163  -0.1365 64  THR A CG2 
262  N N   . ILE A 48  ? 0.3445 0.7581 1.0814 0.0261  0.1515  -0.2208 65  ILE A N   
263  C CA  . ILE A 48  ? 0.3788 0.8271 1.1053 0.0261  0.1805  -0.2563 65  ILE A CA  
264  C C   . ILE A 48  ? 0.3919 0.8424 1.0736 0.0294  0.1839  -0.2679 65  ILE A C   
265  O O   . ILE A 48  ? 0.4364 0.9046 1.0652 0.0272  0.2081  -0.2839 65  ILE A O   
266  C CB  . ILE A 48  ? 0.4013 0.8546 1.1713 0.0395  0.1737  -0.2912 65  ILE A CB  
267  C CG1 . ILE A 48  ? 0.3937 0.8154 1.1914 0.0524  0.1414  -0.2994 65  ILE A CG1 
268  C CG2 . ILE A 48  ? 0.3993 0.8510 1.2055 0.0384  0.1683  -0.2837 65  ILE A CG2 
269  C CD1 . ILE A 48  ? 0.4211 0.8423 1.2665 0.0659  0.1311  -0.3362 65  ILE A CD1 
270  N N   . GLU A 49  ? 0.3722 0.7907 1.0505 0.0341  0.1536  -0.2527 66  GLU A N   
271  C CA  . GLU A 49  ? 0.3975 0.8018 1.0176 0.0373  0.1430  -0.2587 66  GLU A CA  
272  C C   . GLU A 49  ? 0.3776 0.7534 0.9595 0.0315  0.1240  -0.2194 66  GLU A C   
273  O O   . GLU A 49  ? 0.3405 0.7048 0.9536 0.0289  0.1125  -0.1917 66  GLU A O   
274  C CB  . GLU A 49  ? 0.4027 0.8045 1.0715 0.0510  0.1230  -0.2939 66  GLU A CB  
275  N N   . ILE A 50  ? 0.5083 0.8751 1.0201 0.0329  0.1193  -0.2197 67  ILE A N   
276  C CA  . ILE A 50  ? 0.5184 0.8629 0.9956 0.0317  0.0987  -0.1903 67  ILE A CA  
277  C C   . ILE A 50  ? 0.4576 0.7969 0.9917 0.0366  0.0733  -0.1917 67  ILE A C   
278  O O   . ILE A 50  ? 0.4815 0.8255 1.0393 0.0428  0.0626  -0.2222 67  ILE A O   
279  C CB  . ILE A 50  ? 0.6446 0.9804 1.0335 0.0361  0.0959  -0.1944 67  ILE A CB  
280  C CG1 . ILE A 50  ? 0.7104 1.0442 1.0363 0.0273  0.1241  -0.1813 67  ILE A CG1 
281  C CG2 . ILE A 50  ? 0.6520 0.9695 1.0165 0.0393  0.0703  -0.1711 67  ILE A CG2 
282  C CD1 . ILE A 50  ? 0.8471 1.1675 1.0755 0.0341  0.1229  -0.1831 67  ILE A CD1 
283  N N   . LYS A 51  ? 0.8649 1.1951 1.4216 0.0335  0.0641  -0.1590 68  LYS A N   
284  C CA  . LYS A 51  ? 0.8019 1.1286 1.4139 0.0348  0.0464  -0.1517 68  LYS A CA  
285  C C   . LYS A 51  ? 0.7867 1.1101 1.3717 0.0353  0.0337  -0.1237 68  LYS A C   
286  O O   . LYS A 51  ? 0.7748 1.0933 1.3288 0.0358  0.0359  -0.0980 68  LYS A O   
287  C CB  . LYS A 51  ? 0.7270 1.0503 1.4027 0.0347  0.0487  -0.1390 68  LYS A CB  
288  C CG  . LYS A 51  ? 0.7323 1.0611 1.4532 0.0381  0.0565  -0.1710 68  LYS A CG  
289  C CD  . LYS A 51  ? 0.6808 0.9934 1.4370 0.0403  0.0536  -0.1526 68  LYS A CD  
290  C CE  . LYS A 51  ? 0.6563 0.9433 1.4313 0.0394  0.0370  -0.1209 68  LYS A CE  
291  N NZ  . LYS A 51  ? 0.6437 0.9101 1.4378 0.0449  0.0314  -0.1014 68  LYS A NZ  
292  N N   . SER A 52  ? 0.4038 0.7327 1.0063 0.0359  0.0190  -0.1326 69  SER A N   
293  C CA  . SER A 52  ? 0.3759 0.7113 0.9673 0.0377  0.0080  -0.1102 69  SER A CA  
294  C C   . SER A 52  ? 0.3094 0.6485 0.9630 0.0329  0.0087  -0.0849 69  SER A C   
295  O O   . SER A 52  ? 0.3124 0.6481 1.0281 0.0264  0.0080  -0.0935 69  SER A O   
296  C CB  . SER A 52  ? 0.4192 0.7657 1.0005 0.0413  -0.0085 -0.1345 69  SER A CB  
297  O OG  . SER A 52  ? 0.5199 0.8589 1.0271 0.0493  -0.0109 -0.1511 69  SER A OG  
298  N N   . ILE A 53  ? 0.3832 0.7270 1.0178 0.0372  0.0095  -0.0534 70  ILE A N   
299  C CA  . ILE A 53  ? 0.3417 0.6856 1.0105 0.0345  0.0127  -0.0235 70  ILE A CA  
300  C C   . ILE A 53  ? 0.3306 0.6977 0.9863 0.0378  0.0091  -0.0081 70  ILE A C   
301  O O   . ILE A 53  ? 0.3325 0.7120 0.9483 0.0498  0.0047  -0.0028 70  ILE A O   
302  C CB  . ILE A 53  ? 0.3283 0.6568 0.9800 0.0409  0.0178  -0.0004 70  ILE A CB  
303  C CG1 . ILE A 53  ? 0.3379 0.6493 1.0070 0.0387  0.0219  -0.0192 70  ILE A CG1 
304  C CG2 . ILE A 53  ? 0.3242 0.6483 0.9956 0.0408  0.0205  0.0320  70  ILE A CG2 
305  C CD1 . ILE A 53  ? 0.3277 0.6287 0.9808 0.0461  0.0232  -0.0051 70  ILE A CD1 
306  N N   . THR A 54  ? 0.2347 0.6087 0.9301 0.0272  0.0109  -0.0022 71  THR A N   
307  C CA  . THR A 54  ? 0.2341 0.6395 0.9274 0.0285  0.0103  0.0063  71  THR A CA  
308  C C   . THR A 54  ? 0.2436 0.6560 0.9598 0.0228  0.0247  0.0427  71  THR A C   
309  O O   . THR A 54  ? 0.2594 0.6524 1.0224 0.0097  0.0316  0.0556  71  THR A O   
310  C CB  . THR A 54  ? 0.2442 0.6643 0.9714 0.0198  -0.0001 -0.0238 71  THR A CB  
311  O OG1 . THR A 54  ? 0.2412 0.6597 0.9443 0.0292  -0.0146 -0.0579 71  THR A OG1 
312  C CG2 . THR A 54  ? 0.2452 0.7042 0.9755 0.0218  -0.0005 -0.0180 71  THR A CG2 
313  N N   . HIS A 55  ? 0.3318 0.7727 1.0179 0.0348  0.0290  0.0593  72  HIS A N   
314  C CA  . HIS A 55  ? 0.3462 0.8051 1.0505 0.0322  0.0463  0.0953  72  HIS A CA  
315  C C   . HIS A 55  ? 0.3430 0.8500 1.0330 0.0409  0.0494  0.0926  72  HIS A C   
316  O O   . HIS A 55  ? 0.3304 0.8490 0.9754 0.0599  0.0363  0.0747  72  HIS A O   
317  C CB  . HIS A 55  ? 0.3570 0.8003 1.0333 0.0465  0.0509  0.1252  72  HIS A CB  
318  C CG  . HIS A 55  ? 0.3701 0.7736 1.0777 0.0387  0.0504  0.1335  72  HIS A CG  
319  N ND1 . HIS A 55  ? 0.3599 0.7349 1.0459 0.0451  0.0384  0.1130  72  HIS A ND1 
320  C CD2 . HIS A 55  ? 0.3974 0.7862 1.1622 0.0257  0.0601  0.1598  72  HIS A CD2 
321  C CE1 . HIS A 55  ? 0.3751 0.7220 1.1022 0.0390  0.0392  0.1214  72  HIS A CE1 
322  N NE2 . HIS A 55  ? 0.3993 0.7513 1.1765 0.0280  0.0505  0.1508  72  HIS A NE2 
323  N N   . ASP A 56  ? 0.5357 1.0705 1.2685 0.0270  0.0667  0.1100  73  ASP A N   
324  C CA  . ASP A 56  ? 0.5386 1.1267 1.2669 0.0348  0.0732  0.1051  73  ASP A CA  
325  C C   . ASP A 56  ? 0.5530 1.1609 1.2402 0.0549  0.0874  0.1364  73  ASP A C   
326  O O   . ASP A 56  ? 0.5829 1.1879 1.2810 0.0500  0.1076  0.1785  73  ASP A O   
327  C CB  . ASP A 56  ? 0.5596 1.1749 1.3558 0.0090  0.0879  0.1081  73  ASP A CB  
328  C CG  . ASP A 56  ? 0.5550 1.1605 1.3868 -0.0048 0.0682  0.0704  73  ASP A CG  
329  O OD1 . ASP A 56  ? 0.5352 1.1233 1.3325 0.0089  0.0452  0.0420  73  ASP A OD1 
330  O OD2 . ASP A 56  ? 0.5754 1.1896 1.4694 -0.0286 0.0756  0.0708  73  ASP A OD2 
331  N N   . ILE A 57  ? 0.4972 1.1239 1.1361 0.0803  0.0747  0.1165  74  ILE A N   
332  C CA  . ILE A 57  ? 0.5227 1.1688 1.1123 0.1053  0.0825  0.1379  74  ILE A CA  
333  C C   . ILE A 57  ? 0.5291 1.2262 1.1125 0.1188  0.0863  0.1215  74  ILE A C   
334  O O   . ILE A 57  ? 0.5146 1.2153 1.1053 0.1222  0.0676  0.0844  74  ILE A O   
335  C CB  . ILE A 57  ? 0.5190 1.1262 1.0462 0.1280  0.0585  0.1277  74  ILE A CB  
336  C CG1 . ILE A 57  ? 0.4916 1.0747 1.0075 0.1298  0.0317  0.0870  74  ILE A CG1 
337  C CG2 . ILE A 57  ? 0.5279 1.0966 1.0601 0.1210  0.0606  0.1517  74  ILE A CG2 
338  C CD1 . ILE A 57  ? 0.4932 1.0397 0.9483 0.1501  0.0091  0.0764  74  ILE A CD1 
339  N N   . GLU A 58  ? 1.1804 1.9183 1.7511 0.1288  0.1105  0.1503  75  GLU A N   
340  C CA  . GLU A 58  ? 1.1956 1.9872 1.7613 0.1431  0.1178  0.1349  75  GLU A CA  
341  C C   . GLU A 58  ? 1.2151 2.0113 1.7030 0.1822  0.1042  0.1287  75  GLU A C   
342  O O   . GLU A 58  ? 1.2555 2.0816 1.7116 0.1986  0.1234  0.1581  75  GLU A O   
343  C CB  . GLU A 58  ? 1.2260 2.0693 1.8350 0.1252  0.1586  0.1680  75  GLU A CB  
344  N N   . GLU A 59  ? 0.7046 1.4689 1.1601 0.1978  0.0701  0.0910  76  GLU A N   
345  C CA  . GLU A 59  ? 0.7259 1.4822 1.1098 0.2322  0.0508  0.0774  76  GLU A CA  
346  C C   . GLU A 59  ? 0.7574 1.5758 1.1321 0.2527  0.0620  0.0671  76  GLU A C   
347  O O   . GLU A 59  ? 0.7501 1.5895 1.1575 0.2486  0.0583  0.0427  76  GLU A O   
348  C CB  . GLU A 59  ? 0.7046 1.4000 1.0600 0.2373  0.0126  0.0444  76  GLU A CB  
349  N N   . GLY A 61  ? 1.3744 1.0767 1.6771 0.1845  0.1257  0.1496  78  GLY A N   
350  C CA  . GLY A 61  ? 1.3102 1.0777 1.6774 0.1997  0.1502  0.1949  78  GLY A CA  
351  C C   . GLY A 61  ? 1.2073 1.0970 1.6269 0.1978  0.1109  0.2105  78  GLY A C   
352  O O   . GLY A 61  ? 1.1650 1.1155 1.6191 0.1894  0.1021  0.2264  78  GLY A O   
353  N N   . VAL A 62  ? 0.7799 0.7063 1.2020 0.2013  0.0882  0.2044  79  VAL A N   
354  C CA  . VAL A 62  ? 0.6903 0.7300 1.1521 0.1948  0.0520  0.2171  79  VAL A CA  
355  C C   . VAL A 62  ? 0.6865 0.7165 1.1072 0.1743  0.0063  0.1709  79  VAL A C   
356  O O   . VAL A 62  ? 0.7255 0.6913 1.1088 0.1780  0.0064  0.1454  79  VAL A O   
357  C CB  . VAL A 62  ? 0.6331 0.7469 1.1497 0.2235  0.0742  0.2675  79  VAL A CB  
358  C CG1 . VAL A 62  ? 0.5577 0.8001 1.1131 0.2113  0.0359  0.2855  79  VAL A CG1 
359  C CG2 . VAL A 62  ? 0.6414 0.7520 1.2011 0.2517  0.1307  0.3178  79  VAL A CG2 
360  N N   . ARG A 63  ? 0.5293 0.6242 0.9573 0.1505  -0.0293 0.1607  80  ARG A N   
361  C CA  . ARG A 63  ? 0.5192 0.6058 0.9117 0.1307  -0.0663 0.1194  80  ARG A CA  
362  C C   . ARG A 63  ? 0.4951 0.6417 0.9045 0.1372  -0.0781 0.1283  80  ARG A C   
363  O O   . ARG A 63  ? 0.4807 0.7195 0.9332 0.1409  -0.0765 0.1658  80  ARG A O   
364  C CB  . ARG A 63  ? 0.5232 0.6400 0.9075 0.0974  -0.0901 0.1011  80  ARG A CB  
365  C CG  . ARG A 63  ? 0.5524 0.5941 0.9075 0.0888  -0.0811 0.0832  80  ARG A CG  
366  C CD  . ARG A 63  ? 0.5591 0.6569 0.9360 0.0632  -0.0821 0.0934  80  ARG A CD  
367  N NE  . ARG A 63  ? 0.5557 0.7127 0.9264 0.0291  -0.1094 0.0747  80  ARG A NE  
368  C CZ  . ARG A 63  ? 0.5380 0.8085 0.9469 0.0144  -0.1204 0.0996  80  ARG A CZ  
369  N NH1 . ARG A 63  ? 0.5183 0.8597 0.9824 0.0379  -0.1064 0.1499  80  ARG A NH1 
370  N NH2 . ARG A 63  ? 0.5470 0.8597 0.9368 -0.0245 -0.1427 0.0761  80  ARG A NH2 
371  N N   . MET A 64  ? 0.4933 0.5919 0.8700 0.1386  -0.0899 0.0966  81  MET A N   
372  C CA  . MET A 64  ? 0.4745 0.6188 0.8611 0.1432  -0.0997 0.0998  81  MET A CA  
373  C C   . MET A 64  ? 0.4724 0.6083 0.8278 0.1206  -0.1307 0.0584  81  MET A C   
374  O O   . MET A 64  ? 0.4859 0.5519 0.8079 0.1158  -0.1379 0.0255  81  MET A O   
375  C CB  . MET A 64  ? 0.4789 0.5752 0.8616 0.1686  -0.0751 0.1046  81  MET A CB  
376  N N   . LYS A 65  ? 0.4962 0.7036 0.8616 0.1072  -0.1459 0.0628  82  LYS A N   
377  C CA  . LYS A 65  ? 0.5061 0.7034 0.8412 0.0843  -0.1671 0.0246  82  LYS A CA  
378  C C   . LYS A 65  ? 0.5021 0.6830 0.8324 0.0999  -0.1668 0.0142  82  LYS A C   
379  O O   . LYS A 65  ? 0.4976 0.7338 0.8351 0.0942  -0.1722 0.0225  82  LYS A O   
380  C CB  . LYS A 65  ? 0.5077 0.7878 0.8451 0.0501  -0.1822 0.0294  82  LYS A CB  
381  C CG  . LYS A 65  ? 0.5436 0.7956 0.8403 0.0181  -0.1946 -0.0147 82  LYS A CG  
382  C CD  . LYS A 65  ? 0.5612 0.8915 0.8509 -0.0268 -0.2058 -0.0130 82  LYS A CD  
383  C CE  . LYS A 65  ? 0.6309 0.9108 0.8719 -0.0632 -0.2064 -0.0607 82  LYS A CE  
384  N NZ  . LYS A 65  ? 0.6605 0.8627 0.8853 -0.0628 -0.1965 -0.0798 82  LYS A NZ  
385  N N   . LEU A 66  ? 0.4603 0.5681 0.7769 0.1167  -0.1605 -0.0034 83  LEU A N   
386  C CA  . LEU A 66  ? 0.4521 0.5424 0.7672 0.1305  -0.1574 -0.0136 83  LEU A CA  
387  C C   . LEU A 66  ? 0.4559 0.5452 0.7551 0.1166  -0.1733 -0.0443 83  LEU A C   
388  O O   . LEU A 66  ? 0.4718 0.5219 0.7512 0.1074  -0.1820 -0.0697 83  LEU A O   
389  C CB  . LEU A 66  ? 0.4601 0.4812 0.7631 0.1447  -0.1478 -0.0238 83  LEU A CB  
390  C CG  . LEU A 66  ? 0.4561 0.4586 0.7582 0.1550  -0.1419 -0.0348 83  LEU A CG  
391  C CD1 . LEU A 66  ? 0.4469 0.4893 0.7703 0.1660  -0.1225 -0.0089 83  LEU A CD1 
392  C CD2 . LEU A 66  ? 0.4735 0.4162 0.7579 0.1593  -0.1326 -0.0427 83  LEU A CD2 
393  N N   . THR A 67  ? 0.6137 0.7421 0.9207 0.1169  -0.1725 -0.0399 84  THR A N   
394  C CA  . THR A 67  ? 0.6316 0.7536 0.9238 0.1055  -0.1805 -0.0687 84  THR A CA  
395  C C   . THR A 67  ? 0.6159 0.7226 0.9172 0.1237  -0.1725 -0.0742 84  THR A C   
396  O O   . THR A 67  ? 0.6080 0.7439 0.9234 0.1343  -0.1611 -0.0521 84  THR A O   
397  C CB  . THR A 67  ? 0.6635 0.8470 0.9474 0.0795  -0.1866 -0.0644 84  THR A CB  
398  O OG1 . THR A 67  ? 0.6832 0.8840 0.9564 0.0549  -0.1937 -0.0635 84  THR A OG1 
399  C CG2 . THR A 67  ? 0.7058 0.8703 0.9691 0.0666  -0.1871 -0.0964 84  THR A CG2 
400  N N   . VAL A 68  ? 0.4500 0.5130 0.7454 0.1278  -0.1763 -0.1012 85  VAL A N   
401  C CA  . VAL A 68  ? 0.4416 0.4957 0.7480 0.1403  -0.1698 -0.1096 85  VAL A CA  
402  C C   . VAL A 68  ? 0.4514 0.5092 0.7540 0.1323  -0.1708 -0.1316 85  VAL A C   
403  O O   . VAL A 68  ? 0.4697 0.5016 0.7627 0.1265  -0.1750 -0.1505 85  VAL A O   
404  C CB  . VAL A 68  ? 0.4423 0.4551 0.7516 0.1516  -0.1723 -0.1187 85  VAL A CB  
405  C CG1 . VAL A 68  ? 0.4356 0.4496 0.7583 0.1585  -0.1648 -0.1270 85  VAL A CG1 
406  C CG2 . VAL A 68  ? 0.4435 0.4413 0.7478 0.1551  -0.1661 -0.1004 85  VAL A CG2 
407  N N   . ILE A 69  ? 0.4459 0.5301 0.7541 0.1330  -0.1619 -0.1279 86  ILE A N   
408  C CA  . ILE A 69  ? 0.4605 0.5469 0.7618 0.1235  -0.1577 -0.1480 86  ILE A CA  
409  C C   . ILE A 69  ? 0.4542 0.5212 0.7756 0.1380  -0.1506 -0.1629 86  ILE A C   
410  O O   . ILE A 69  ? 0.4414 0.5197 0.7750 0.1465  -0.1414 -0.1547 86  ILE A O   
411  C CB  . ILE A 69  ? 0.4658 0.5990 0.7555 0.1106  -0.1526 -0.1340 86  ILE A CB  
412  C CG1 . ILE A 69  ? 0.4722 0.6432 0.7480 0.0933  -0.1625 -0.1144 86  ILE A CG1 
413  C CG2 . ILE A 69  ? 0.4908 0.6183 0.7641 0.0955  -0.1452 -0.1581 86  ILE A CG2 
414  C CD1 . ILE A 69  ? 0.4611 0.6889 0.7469 0.0998  -0.1591 -0.0756 86  ILE A CD1 
415  N N   . ASP A 70  ? 0.4676 0.5066 0.7943 0.1411  -0.1518 -0.1828 87  ASP A N   
416  C CA  . ASP A 70  ? 0.4630 0.4952 0.8167 0.1547  -0.1467 -0.1942 87  ASP A CA  
417  C C   . ASP A 70  ? 0.4758 0.5151 0.8292 0.1486  -0.1302 -0.2072 87  ASP A C   
418  O O   . ASP A 70  ? 0.5021 0.5343 0.8308 0.1331  -0.1227 -0.2163 87  ASP A O   
419  C CB  . ASP A 70  ? 0.4754 0.4820 0.8423 0.1663  -0.1530 -0.2015 87  ASP A CB  
420  C CG  . ASP A 70  ? 0.4648 0.4825 0.8677 0.1812  -0.1555 -0.2034 87  ASP A CG  
421  O OD1 . ASP A 70  ? 0.4473 0.4854 0.8598 0.1786  -0.1531 -0.2016 87  ASP A OD1 
422  O OD2 . ASP A 70  ? 0.4782 0.4868 0.9007 0.1948  -0.1580 -0.2047 87  ASP A OD2 
423  N N   . THR A 71  ? 0.4634 0.5143 0.8400 0.1566  -0.1221 -0.2100 88  THR A N   
424  C CA  . THR A 71  ? 0.4769 0.5322 0.8536 0.1516  -0.1036 -0.2220 88  THR A CA  
425  C C   . THR A 71  ? 0.4768 0.5288 0.8924 0.1647  -0.0953 -0.2352 88  THR A C   
426  O O   . THR A 71  ? 0.4587 0.5217 0.9023 0.1745  -0.1053 -0.2309 88  THR A O   
427  C CB  . THR A 71  ? 0.4677 0.5458 0.8346 0.1474  -0.0946 -0.2096 88  THR A CB  
428  O OG1 . THR A 71  ? 0.4476 0.5293 0.8367 0.1574  -0.0937 -0.2032 88  THR A OG1 
429  C CG2 . THR A 71  ? 0.4699 0.5660 0.8063 0.1372  -0.1021 -0.1890 88  THR A CG2 
430  N N   . PRO A 72  ? 0.5019 0.5419 0.9189 0.1623  -0.0755 -0.2504 89  PRO A N   
431  C CA  . PRO A 72  ? 0.5032 0.5481 0.9647 0.1763  -0.0629 -0.2595 89  PRO A CA  
432  C C   . PRO A 72  ? 0.4820 0.5536 0.9622 0.1750  -0.0583 -0.2591 89  PRO A C   
433  O O   . PRO A 72  ? 0.4835 0.5568 0.9357 0.1638  -0.0494 -0.2570 89  PRO A O   
434  C CB  . PRO A 72  ? 0.5445 0.5607 0.9907 0.1696  -0.0349 -0.2760 89  PRO A CB  
435  C CG  . PRO A 72  ? 0.5602 0.5705 0.9487 0.1446  -0.0345 -0.2767 89  PRO A CG  
436  C CD  . PRO A 72  ? 0.5374 0.5592 0.9123 0.1431  -0.0616 -0.2600 89  PRO A CD  
437  N N   . GLY A 73  ? 0.5017 0.5966 1.0276 0.1847  -0.0632 -0.2591 90  GLY A N   
438  C CA  . GLY A 73  ? 0.4887 0.6062 1.0311 0.1779  -0.0555 -0.2625 90  GLY A CA  
439  C C   . GLY A 73  ? 0.5038 0.6167 1.0480 0.1740  -0.0267 -0.2750 90  GLY A C   
440  O O   . GLY A 73  ? 0.5247 0.6244 1.0767 0.1795  -0.0116 -0.2838 90  GLY A O   
441  N N   . PHE A 74  ? 0.5762 0.6936 1.1102 0.1641  -0.0140 -0.2758 91  PHE A N   
442  C CA  . PHE A 74  ? 0.5808 0.6929 1.1143 0.1595  0.0152  -0.2869 91  PHE A CA  
443  C C   . PHE A 74  ? 0.5650 0.7009 1.1385 0.1543  0.0267  -0.2962 91  PHE A C   
444  O O   . PHE A 74  ? 0.5542 0.7157 1.1552 0.1515  0.0096  -0.2947 91  PHE A O   
445  C CB  . PHE A 74  ? 0.5987 0.6937 1.0799 0.1521  0.0268  -0.2768 91  PHE A CB  
446  C CG  . PHE A 74  ? 0.5895 0.6855 1.0538 0.1506  0.0209  -0.2596 91  PHE A CG  
447  C CD1 . PHE A 74  ? 0.5795 0.6738 1.0513 0.1453  0.0410  -0.2613 91  PHE A CD1 
448  C CD2 . PHE A 74  ? 0.5967 0.6904 1.0366 0.1531  0.0008  -0.2422 91  PHE A CD2 
449  C CE1 . PHE A 74  ? 0.5810 0.6641 1.0336 0.1439  0.0453  -0.2457 91  PHE A CE1 
450  C CE2 . PHE A 74  ? 0.5927 0.6820 1.0192 0.1540  0.0021  -0.2246 91  PHE A CE2 
451  C CZ  . PHE A 74  ? 0.5870 0.6674 1.0185 0.1500  0.0265  -0.2261 91  PHE A CZ  
452  N N   . GLY A 75  ? 0.8852 1.0145 1.4589 0.1492  0.0560  -0.3065 92  GLY A N   
453  C CA  . GLY A 75  ? 0.8856 1.0369 1.4953 0.1393  0.0718  -0.3182 92  GLY A CA  
454  C C   . GLY A 75  ? 0.8795 1.0688 1.5546 0.1459  0.0685  -0.3265 92  GLY A C   
455  O O   . GLY A 75  ? 0.8786 1.1039 1.5948 0.1349  0.0742  -0.3348 92  GLY A O   
456  N N   . ASP A 76  ? 0.6647 0.8459 1.3450 0.1612  0.0617  -0.3202 93  ASP A N   
457  C CA  . ASP A 76  ? 0.6704 0.8826 1.4056 0.1719  0.0607  -0.3149 93  ASP A CA  
458  C C   . ASP A 76  ? 0.7011 0.8947 1.4404 0.1724  0.0959  -0.3208 93  ASP A C   
459  O O   . ASP A 76  ? 0.7062 0.9303 1.4988 0.1810  0.1040  -0.3156 93  ASP A O   
460  C CB  . ASP A 76  ? 0.6778 0.8817 1.4097 0.1886  0.0401  -0.2985 93  ASP A CB  
461  C CG  . ASP A 76  ? 0.6993 0.8457 1.3707 0.1889  0.0486  -0.3011 93  ASP A CG  
462  O OD1 . ASP A 76  ? 0.7178 0.8363 1.3538 0.1783  0.0707  -0.3133 93  ASP A OD1 
463  O OD2 . ASP A 76  ? 0.7107 0.8427 1.3705 0.1984  0.0339  -0.2916 93  ASP A OD2 
464  N N   . HIS A 77  ? 0.5522 0.6987 1.2357 0.1638  0.1171  -0.3293 94  HIS A N   
465  C CA  . HIS A 77  ? 0.5910 0.7109 1.2667 0.1613  0.1524  -0.3366 94  HIS A CA  
466  C C   . HIS A 77  ? 0.5968 0.7215 1.2730 0.1466  0.1748  -0.3467 94  HIS A C   
467  O O   . HIS A 77  ? 0.5732 0.7207 1.2583 0.1378  0.1664  -0.3494 94  HIS A O   
468  C CB  . HIS A 77  ? 0.6232 0.6894 1.2346 0.1575  0.1649  -0.3425 94  HIS A CB  
469  C CG  . HIS A 77  ? 0.6336 0.6826 1.2415 0.1687  0.1553  -0.3371 94  HIS A CG  
470  N ND1 . HIS A 77  ? 0.6081 0.6615 1.2026 0.1724  0.1243  -0.3309 94  HIS A ND1 
471  C CD2 . HIS A 77  ? 0.6738 0.6951 1.2874 0.1770  0.1773  -0.3363 94  HIS A CD2 
472  C CE1 . HIS A 77  ? 0.6311 0.6605 1.2224 0.1813  0.1268  -0.3277 94  HIS A CE1 
473  N NE2 . HIS A 77  ? 0.6734 0.6808 1.2751 0.1847  0.1606  -0.3304 94  HIS A NE2 
474  N N   . ILE A 78  ? 1.0651 1.1627 1.7284 0.1423  0.2074  -0.3533 95  ILE A N   
475  C CA  . ILE A 78  ? 1.0818 1.1748 1.7375 0.1279  0.2328  -0.3619 95  ILE A CA  
476  C C   . ILE A 78  ? 1.0993 1.1547 1.6818 0.1184  0.2407  -0.3629 95  ILE A C   
477  O O   . ILE A 78  ? 1.1034 1.1566 1.6717 0.1088  0.2533  -0.3636 95  ILE A O   
478  C CB  . ILE A 78  ? 1.1220 1.2010 1.7945 0.1274  0.2663  -0.3670 95  ILE A CB  
479  N N   . ASN A 79  ? 1.1795 1.2069 1.7174 0.1213  0.2363  -0.3631 96  ASN A N   
480  C CA  . ASN A 79  ? 1.1921 1.1977 1.6690 0.1158  0.2406  -0.3635 96  ASN A CA  
481  C C   . ASN A 79  ? 1.1669 1.1812 1.6318 0.1229  0.2093  -0.3575 96  ASN A C   
482  O O   . ASN A 79  ? 1.1743 1.1818 1.6423 0.1259  0.1977  -0.3609 96  ASN A O   
483  C CB  . ASN A 79  ? 1.2474 1.2137 1.6739 0.1044  0.2715  -0.3765 96  ASN A CB  
484  C CG  . ASN A 79  ? 1.2767 1.2302 1.6912 0.0957  0.3027  -0.3775 96  ASN A CG  
485  O OD1 . ASN A 79  ? 1.2541 1.2272 1.7077 0.0968  0.3040  -0.3718 96  ASN A OD1 
486  N ND2 . ASN A 79  ? 1.3302 1.2501 1.6866 0.0832  0.3299  -0.3874 96  ASN A ND2 
487  N N   . ASN A 80  ? 1.2090 1.2346 1.6491 0.1224  0.1941  -0.3380 97  ASN A N   
488  C CA  . ASN A 80  ? 1.1936 1.2329 1.6218 0.1266  0.1584  -0.3204 97  ASN A CA  
489  C C   . ASN A 80  ? 1.2469 1.2842 1.6094 0.1193  0.1495  -0.2985 97  ASN A C   
490  O O   . ASN A 80  ? 1.2389 1.2910 1.5913 0.1228  0.1231  -0.2798 97  ASN A O   
491  C CB  . ASN A 80  ? 1.1498 1.2089 1.6122 0.1328  0.1470  -0.3129 97  ASN A CB  
492  C CG  . ASN A 80  ? 1.1295 1.2095 1.6588 0.1356  0.1466  -0.3302 97  ASN A CG  
493  O OD1 . ASN A 80  ? 1.1137 1.2079 1.6728 0.1432  0.1255  -0.3317 97  ASN A OD1 
494  N ND2 . ASN A 80  ? 1.1361 1.2214 1.6846 0.1269  0.1688  -0.3371 97  ASN A ND2 
495  N N   . GLU A 81  ? 0.6163 1.4277 0.8833 -0.1373 0.0760  -0.4347 98  GLU A N   
496  C CA  . GLU A 81  ? 0.6323 1.3713 0.8410 -0.1237 0.0739  -0.4645 98  GLU A CA  
497  C C   . GLU A 81  ? 0.6142 1.3553 0.9512 -0.0912 0.0627  -0.4590 98  GLU A C   
498  O O   . GLU A 81  ? 0.6194 1.3205 0.9369 -0.0791 0.0468  -0.4531 98  GLU A O   
499  C CB  . GLU A 81  ? 0.6768 1.3677 0.8153 -0.1332 0.0976  -0.5155 98  GLU A CB  
500  N N   . ASN A 82  ? 0.9979 1.7862 1.4666 -0.0774 0.0728  -0.4597 99  ASN A N   
501  C CA  . ASN A 82  ? 0.9713 1.7595 1.5661 -0.0473 0.0665  -0.4529 99  ASN A CA  
502  C C   . ASN A 82  ? 0.9244 1.7378 1.5758 -0.0366 0.0370  -0.3892 99  ASN A C   
503  O O   . ASN A 82  ? 0.8912 1.7011 1.6408 -0.0131 0.0291  -0.3769 99  ASN A O   
504  C CB  . ASN A 82  ? 0.9662 1.7920 1.6812 -0.0328 0.0926  -0.4715 99  ASN A CB  
505  C CG  . ASN A 82  ? 1.0205 1.8050 1.6929 -0.0391 0.1256  -0.5399 99  ASN A CG  
506  O OD1 . ASN A 82  ? 1.0577 1.7767 1.6572 -0.0430 0.1245  -0.5759 99  ASN A OD1 
507  N ND2 . ASN A 82  ? 1.0277 1.8518 1.7453 -0.0414 0.1550  -0.5570 99  ASN A ND2 
508  N N   . CYS A 83  ? 1.4267 2.2591 2.0090 -0.0566 0.0226  -0.3494 100 CYS A N   
509  C CA  . CYS A 83  ? 1.3880 2.2354 2.0013 -0.0522 -0.0043 -0.2884 100 CYS A CA  
510  C C   . CYS A 83  ? 1.4166 2.2072 1.9184 -0.0583 -0.0164 -0.2788 100 CYS A C   
511  O O   . CYS A 83  ? 1.3986 2.1797 1.9315 -0.0468 -0.0347 -0.2420 100 CYS A O   
512  C CB  . CYS A 83  ? 1.3744 2.2822 1.9916 -0.0732 -0.0125 -0.2439 100 CYS A CB  
513  S SG  . CYS A 83  ? 1.3435 2.3230 2.1102 -0.0588 -0.0030 -0.2326 100 CYS A SG  
514  N N   . TRP A 84  ? 0.6128 1.3649 0.9851 -0.0752 -0.0040 -0.3109 101 TRP A N   
515  C CA  . TRP A 84  ? 0.6534 1.3508 0.9146 -0.0776 -0.0106 -0.3026 101 TRP A CA  
516  C C   . TRP A 84  ? 0.6546 1.3156 0.9395 -0.0561 -0.0146 -0.3307 101 TRP A C   
517  O O   . TRP A 84  ? 0.6671 1.2924 0.8916 -0.0509 -0.0229 -0.3180 101 TRP A O   
518  C CB  . TRP A 84  ? 0.6681 1.3342 0.7761 -0.1029 0.0055  -0.3233 101 TRP A CB  
519  N N   . GLN A 85  ? 0.4452 1.1152 0.8175 -0.0449 -0.0072 -0.3677 102 GLN A N   
520  C CA  . GLN A 85  ? 0.4560 1.0905 0.8470 -0.0319 -0.0111 -0.3994 102 GLN A CA  
521  C C   . GLN A 85  ? 0.4297 1.0691 0.9221 -0.0131 -0.0298 -0.3694 102 GLN A C   
522  O O   . GLN A 85  ? 0.4336 1.0455 0.9018 -0.0082 -0.0420 -0.3696 102 GLN A O   
523  C CB  . GLN A 85  ? 0.4821 1.1098 0.9070 -0.0329 0.0095  -0.4565 102 GLN A CB  
524  N N   . PRO A 86  ? 0.4060 1.0818 1.0131 -0.0026 -0.0321 -0.3423 103 PRO A N   
525  C CA  . PRO A 86  ? 0.3881 1.0607 1.0850 0.0138  -0.0479 -0.3162 103 PRO A CA  
526  C C   . PRO A 86  ? 0.3716 1.0352 1.0243 0.0134  -0.0665 -0.2701 103 PRO A C   
527  O O   . PRO A 86  ? 0.3654 1.0146 1.0599 0.0228  -0.0784 -0.2604 103 PRO A O   
528  C CB  . PRO A 86  ? 0.3712 1.0850 1.1842 0.0251  -0.0456 -0.2896 103 PRO A CB  
529  C CG  . PRO A 86  ? 0.3861 1.1214 1.1950 0.0188  -0.0236 -0.3213 103 PRO A CG  
530  C CD  . PRO A 86  ? 0.3994 1.1204 1.0685 -0.0033 -0.0199 -0.3362 103 PRO A CD  
531  N N   . ILE A 87  ? 0.3704 1.0394 0.9374 0.0008  -0.0663 -0.2424 104 ILE A N   
532  C CA  . ILE A 87  ? 0.3642 1.0170 0.8791 0.0001  -0.0770 -0.1980 104 ILE A CA  
533  C C   . ILE A 87  ? 0.3825 0.9980 0.8101 0.0020  -0.0758 -0.2178 104 ILE A C   
534  O O   . ILE A 87  ? 0.3757 0.9789 0.8107 0.0115  -0.0853 -0.1936 104 ILE A O   
535  C CB  . ILE A 87  ? 0.3698 1.0309 0.8099 -0.0179 -0.0740 -0.1614 104 ILE A CB  
536  C CG1 . ILE A 87  ? 0.3513 1.0573 0.8868 -0.0195 -0.0822 -0.1295 104 ILE A CG1 
537  C CG2 . ILE A 87  ? 0.3775 1.0064 0.7409 -0.0195 -0.0770 -0.1211 104 ILE A CG2 
538  C CD1 . ILE A 87  ? 0.3615 1.0773 0.8283 -0.0430 -0.0849 -0.0864 104 ILE A CD1 
539  N N   . MET A 88  ? 0.5909 1.1903 0.9387 -0.0067 -0.0639 -0.2604 105 MET A N   
540  C CA  . MET A 88  ? 0.6219 1.1881 0.8870 -0.0038 -0.0642 -0.2804 105 MET A CA  
541  C C   . MET A 88  ? 0.6108 1.1763 0.9525 0.0068  -0.0780 -0.2997 105 MET A C   
542  O O   . MET A 88  ? 0.6240 1.1764 0.9345 0.0134  -0.0873 -0.2924 105 MET A O   
543  C CB  . MET A 88  ? 0.6240 1.1702 0.7900 -0.0171 -0.0487 -0.3247 105 MET A CB  
544  C CG  . MET A 88  ? 0.6176 1.1561 0.6827 -0.0329 -0.0341 -0.3078 105 MET A CG  
545  S SD  . MET A 88  ? 0.6296 1.1323 0.5864 -0.0287 -0.0317 -0.2582 105 MET A SD  
546  C CE  . MET A 88  ? 0.6204 1.0892 0.5145 -0.0140 -0.0344 -0.2867 105 MET A CE  
547  N N   . LYS A 89  ? 0.4215 1.0008 0.8624 0.0074  -0.0781 -0.3230 106 LYS A N   
548  C CA  . LYS A 89  ? 0.4274 0.9997 0.9379 0.0113  -0.0895 -0.3437 106 LYS A CA  
549  C C   . LYS A 89  ? 0.4011 0.9851 0.9807 0.0215  -0.1053 -0.2984 106 LYS A C   
550  O O   . LYS A 89  ? 0.4072 0.9857 0.9975 0.0222  -0.1187 -0.3002 106 LYS A O   
551  C CB  . LYS A 89  ? 0.4390 1.0114 1.0305 0.0094  -0.0786 -0.3807 106 LYS A CB  
552  C CG  . LYS A 89  ? 0.4610 1.0134 1.1053 0.0064  -0.0870 -0.4091 106 LYS A CG  
553  C CD  . LYS A 89  ? 0.4855 1.0249 1.1986 0.0051  -0.0688 -0.4477 106 LYS A CD  
554  C CE  . LYS A 89  ? 0.5170 1.0275 1.2756 -0.0029 -0.0763 -0.4733 106 LYS A CE  
555  N NZ  . LYS A 89  ? 0.5481 1.0361 1.3799 -0.0012 -0.0532 -0.5053 106 LYS A NZ  
556  N N   . PHE A 90  ? 0.3753 0.9772 1.0008 0.0272  -0.1043 -0.2568 107 PHE A N   
557  C CA  . PHE A 90  ? 0.3541 0.9629 1.0412 0.0355  -0.1166 -0.2117 107 PHE A CA  
558  C C   . PHE A 90  ? 0.3546 0.9549 0.9693 0.0382  -0.1213 -0.1849 107 PHE A C   
559  O O   . PHE A 90  ? 0.3492 0.9521 1.0051 0.0430  -0.1323 -0.1703 107 PHE A O   
560  C CB  . PHE A 90  ? 0.3341 0.9601 1.0659 0.0383  -0.1150 -0.1697 107 PHE A CB  
561  C CG  . PHE A 90  ? 0.3198 0.9451 1.1120 0.0451  -0.1255 -0.1232 107 PHE A CG  
562  C CD1 . PHE A 90  ? 0.3364 0.9415 1.2020 0.0493  -0.1258 -0.1179 107 PHE A CD1 
563  C CD2 . PHE A 90  ? 0.3131 0.9335 1.0530 0.0450  -0.1270 -0.0801 107 PHE A CD2 
564  C CE1 . PHE A 90  ? 0.3391 0.9297 1.2317 0.0524  -0.1306 -0.0757 107 PHE A CE1 
565  C CE2 . PHE A 90  ? 0.3063 0.9211 1.0944 0.0494  -0.1330 -0.0379 107 PHE A CE2 
566  C CZ  . PHE A 90  ? 0.3246 0.9198 1.1755 0.0519  -0.1335 -0.0365 107 PHE A CZ  
567  N N   . ILE A 91  ? 0.3659 0.9549 0.8723 0.0351  -0.1105 -0.1779 108 ILE A N   
568  C CA  . ILE A 91  ? 0.3757 0.9498 0.8025 0.0416  -0.1081 -0.1516 108 ILE A CA  
569  C C   . ILE A 91  ? 0.3896 0.9635 0.8091 0.0462  -0.1184 -0.1770 108 ILE A C   
570  O O   . ILE A 91  ? 0.3843 0.9661 0.8254 0.0556  -0.1260 -0.1505 108 ILE A O   
571  C CB  . ILE A 91  ? 0.3989 0.9497 0.6973 0.0353  -0.0903 -0.1472 108 ILE A CB  
572  C CG1 . ILE A 91  ? 0.3910 0.9432 0.6865 0.0262  -0.0835 -0.1100 108 ILE A CG1 
573  C CG2 . ILE A 91  ? 0.4212 0.9484 0.6298 0.0463  -0.0830 -0.1280 108 ILE A CG2 
574  C CD1 . ILE A 91  ? 0.4198 0.9494 0.5923 0.0113  -0.0662 -0.1110 108 ILE A CD1 
575  N N   . ASN A 92  ? 0.4312 0.9978 0.8205 0.0379  -0.1188 -0.2271 109 ASN A N   
576  C CA  . ASN A 92  ? 0.4531 1.0187 0.8252 0.0372  -0.1318 -0.2533 109 ASN A CA  
577  C C   . ASN A 92  ? 0.4444 1.0288 0.9252 0.0331  -0.1509 -0.2591 109 ASN A C   
578  O O   . ASN A 92  ? 0.4555 1.0511 0.9383 0.0332  -0.1668 -0.2580 109 ASN A O   
579  C CB  . ASN A 92  ? 0.4863 1.0317 0.7920 0.0248  -0.1261 -0.3073 109 ASN A CB  
580  C CG  . ASN A 92  ? 0.5068 1.0286 0.6860 0.0264  -0.1086 -0.3043 109 ASN A CG  
581  O OD1 . ASN A 92  ? 0.5147 1.0280 0.6300 0.0386  -0.1056 -0.2720 109 ASN A OD1 
582  N ND2 . ASN A 92  ? 0.5207 1.0292 0.6620 0.0137  -0.0940 -0.3376 109 ASN A ND2 
583  N N   . ASP A 93  ? 0.4257 1.0138 0.9959 0.0288  -0.1493 -0.2636 110 ASP A N   
584  C CA  . ASP A 93  ? 0.4251 1.0217 1.0946 0.0225  -0.1637 -0.2690 110 ASP A CA  
585  C C   . ASP A 93  ? 0.4028 1.0201 1.1135 0.0311  -0.1736 -0.2190 110 ASP A C   
586  O O   . ASP A 93  ? 0.4100 1.0404 1.1685 0.0235  -0.1899 -0.2209 110 ASP A O   
587  C CB  . ASP A 93  ? 0.4204 1.0093 1.1723 0.0203  -0.1547 -0.2813 110 ASP A CB  
588  C CG  . ASP A 93  ? 0.4529 1.0203 1.1893 0.0094  -0.1443 -0.3385 110 ASP A CG  
589  O OD1 . ASP A 93  ? 0.4832 1.0385 1.1535 -0.0018 -0.1491 -0.3723 110 ASP A OD1 
590  O OD2 . ASP A 93  ? 0.4522 1.0141 1.2425 0.0125  -0.1301 -0.3481 110 ASP A OD2 
591  N N   . GLN A 94  ? 0.3642 0.9833 1.0527 0.0439  -0.1628 -0.1745 111 GLN A N   
592  C CA  . GLN A 94  ? 0.3483 0.9819 1.0642 0.0531  -0.1660 -0.1253 111 GLN A CA  
593  C C   . GLN A 94  ? 0.3623 1.0076 1.0187 0.0600  -0.1710 -0.1191 111 GLN A C   
594  O O   . GLN A 94  ? 0.3575 1.0271 1.0595 0.0629  -0.1812 -0.0960 111 GLN A O   
595  C CB  . GLN A 94  ? 0.3332 0.9557 1.0257 0.0618  -0.1501 -0.0805 111 GLN A CB  
596  C CG  . GLN A 94  ? 0.3221 0.9389 1.0667 0.0567  -0.1471 -0.0813 111 GLN A CG  
597  C CD  . GLN A 94  ? 0.3350 0.9402 1.1615 0.0495  -0.1529 -0.0919 111 GLN A CD  
598  O OE1 . GLN A 94  ? 0.3424 0.9439 1.2025 0.0479  -0.1571 -0.0714 111 GLN A OE1 
599  N NE2 . GLN A 94  ? 0.3450 0.9407 1.1976 0.0450  -0.1497 -0.1249 111 GLN A NE2 
600  N N   . TYR A 95  ? 0.4663 1.0958 1.0221 0.0630  -0.1631 -0.1381 112 TYR A N   
601  C CA  . TYR A 95  ? 0.4990 1.1369 0.9927 0.0717  -0.1685 -0.1356 112 TYR A CA  
602  C C   . TYR A 95  ? 0.5061 1.1665 1.0453 0.0568  -0.1948 -0.1689 112 TYR A C   
603  O O   . TYR A 95  ? 0.5192 1.2057 1.0534 0.0621  -0.2085 -0.1553 112 TYR A O   
604  C CB  . TYR A 95  ? 0.5539 1.1608 0.9233 0.0758  -0.1530 -0.1526 112 TYR A CB  
605  C CG  . TYR A 95  ? 0.5937 1.1746 0.8898 0.0888  -0.1266 -0.1140 112 TYR A CG  
606  C CD1 . TYR A 95  ? 0.5758 1.1623 0.9033 0.1011  -0.1177 -0.0624 112 TYR A CD1 
607  C CD2 . TYR A 95  ? 0.6509 1.1966 0.8396 0.0852  -0.1087 -0.1299 112 TYR A CD2 
608  C CE1 . TYR A 95  ? 0.6299 1.1824 0.8788 0.1087  -0.0911 -0.0280 112 TYR A CE1 
609  C CE2 . TYR A 95  ? 0.6826 1.1974 0.7934 0.0911  -0.0837 -0.0956 112 TYR A CE2 
610  C CZ  . TYR A 95  ? 0.6860 1.2018 0.8247 0.1025  -0.0747 -0.0449 112 TYR A CZ  
611  O OH  . TYR A 95  ? 0.7105 1.1858 0.7610 0.1043  -0.0475 -0.0116 112 TYR A OH  
612  N N   . GLU A 96  ? 0.4249 1.0743 1.0073 0.0372  -0.2009 -0.2111 113 GLU A N   
613  C CA  . GLU A 96  ? 0.4510 1.1096 1.0694 0.0155  -0.2238 -0.2472 113 GLU A CA  
614  C C   . GLU A 96  ? 0.4377 1.1245 1.1619 0.0071  -0.2390 -0.2256 113 GLU A C   
615  O O   . GLU A 96  ? 0.4557 1.1695 1.2007 -0.0060 -0.2620 -0.2283 113 GLU A O   
616  C CB  . GLU A 96  ? 0.4736 1.0984 1.0901 -0.0024 -0.2173 -0.3022 113 GLU A CB  
617  C CG  . GLU A 96  ? 0.5140 1.1335 1.1571 -0.0305 -0.2368 -0.3439 113 GLU A CG  
618  C CD  . GLU A 96  ? 0.5529 1.1749 1.1125 -0.0401 -0.2537 -0.3646 113 GLU A CD  
619  O OE1 . GLU A 96  ? 0.5493 1.1736 1.0287 -0.0215 -0.2475 -0.3483 113 GLU A OE1 
620  O OE2 . GLU A 96  ? 0.5939 1.2114 1.1633 -0.0678 -0.2730 -0.3964 113 GLU A OE2 
621  N N   . LYS A 97  ? 0.5221 1.2020 1.3098 0.0125  -0.2268 -0.2028 114 LYS A N   
622  C CA  . LYS A 97  ? 0.5075 1.1889 1.3672 0.0035  -0.2303 -0.1739 114 LYS A CA  
623  C C   . LYS A 97  ? 0.4979 1.2150 1.3565 0.0137  -0.2349 -0.1253 114 LYS A C   
624  O O   . LYS A 97  ? 0.5018 1.2371 1.4066 -0.0002 -0.2459 -0.1122 114 LYS A O   
625  C CB  . LYS A 97  ? 0.4813 1.1343 1.3809 0.0099  -0.2113 -0.1529 114 LYS A CB  
626  C CG  . LYS A 97  ? 0.4950 1.1180 1.4256 0.0004  -0.2062 -0.1963 114 LYS A CG  
627  C CD  . LYS A 97  ? 0.4851 1.0852 1.4439 0.0123  -0.1884 -0.1691 114 LYS A CD  
628  C CE  . LYS A 97  ? 0.4928 1.0841 1.5067 0.0094  -0.1884 -0.1338 114 LYS A CE  
629  N NZ  . LYS A 97  ? 0.4954 1.0616 1.5339 0.0198  -0.1743 -0.1091 114 LYS A NZ  
630  N N   . TYR A 98  ? 0.3860 1.1153 1.1936 0.0383  -0.2248 -0.0999 115 TYR A N   
631  C CA  . TYR A 98  ? 0.3787 1.1429 1.1872 0.0547  -0.2235 -0.0524 115 TYR A CA  
632  C C   . TYR A 98  ? 0.4001 1.2019 1.1895 0.0520  -0.2468 -0.0636 115 TYR A C   
633  O O   . TYR A 98  ? 0.4049 1.2459 1.2258 0.0545  -0.2537 -0.0291 115 TYR A O   
634  C CB  . TYR A 98  ? 0.3593 1.1134 1.1131 0.0838  -0.2000 -0.0218 115 TYR A CB  
635  C CG  . TYR A 98  ? 0.3501 1.1268 1.1263 0.1029  -0.1873 0.0350  115 TYR A CG  
636  C CD1 . TYR A 98  ? 0.3659 1.1727 1.1182 0.1192  -0.1896 0.0553  115 TYR A CD1 
637  C CD2 . TYR A 98  ? 0.3477 1.0926 1.1386 0.1038  -0.1660 0.0621  115 TYR A CD2 
638  C CE1 . TYR A 98  ? 0.3779 1.1786 1.1321 0.1362  -0.1689 0.0988  115 TYR A CE1 
639  C CE2 . TYR A 98  ? 0.3581 1.0986 1.1474 0.1179  -0.1476 0.1046  115 TYR A CE2 
640  C CZ  . TYR A 98  ? 0.3729 1.1413 1.1460 0.1344  -0.1473 0.1222  115 TYR A CZ  
641  O OH  . TYR A 98  ? 0.3877 1.1510 1.1621 0.1488  -0.1247 0.1659  115 TYR A OH  
642  N N   . LEU A 99  ? 0.4182 1.2097 1.1503 0.0457  -0.2578 -0.1109 116 LEU A N   
643  C CA  . LEU A 99  ? 0.4495 1.2684 1.1436 0.0411  -0.2809 -0.1224 116 LEU A CA  
644  C C   . LEU A 99  ? 0.4784 1.3120 1.2287 0.0046  -0.3087 -0.1422 116 LEU A C   
645  O O   . LEU A 99  ? 0.5021 1.3745 1.2543 -0.0025 -0.3315 -0.1290 116 LEU A O   
646  C CB  . LEU A 99  ? 0.4783 1.2559 1.0618 0.0424  -0.2745 -0.1604 116 LEU A CB  
647  C CG  . LEU A 99  ? 0.5179 1.3169 1.0464 0.0396  -0.2982 -0.1701 116 LEU A CG  
648  C CD1 . LEU A 99  ? 0.5130 1.3475 1.0255 0.0734  -0.2929 -0.1140 116 LEU A CD1 
649  C CD2 . LEU A 99  ? 0.5520 1.3010 0.9719 0.0347  -0.2910 -0.2148 116 LEU A CD2 
650  N N   . GLN A 100 ? 0.4838 1.2834 1.2753 -0.0190 -0.3049 -0.1706 117 GLN A N   
651  C CA  . GLN A 100 ? 0.5221 1.3234 1.3560 -0.0569 -0.3262 -0.1928 117 GLN A CA  
652  C C   . GLN A 100 ? 0.5171 1.3566 1.4201 -0.0625 -0.3301 -0.1456 117 GLN A C   
653  O O   . GLN A 100 ? 0.5521 1.4098 1.4866 -0.0949 -0.3514 -0.1536 117 GLN A O   
654  C CB  . GLN A 100 ? 0.5355 1.2836 1.3909 -0.0759 -0.3158 -0.2392 117 GLN A CB  
655  N N   . GLU A 101 ? 0.4794 1.3304 1.3986 -0.0336 -0.3075 -0.0983 118 GLU A N   
656  C CA  . GLU A 101 ? 0.4765 1.3662 1.4492 -0.0345 -0.3040 -0.0562 118 GLU A CA  
657  C C   . GLU A 101 ? 0.4723 1.4261 1.4310 -0.0128 -0.3090 -0.0189 118 GLU A C   
658  O O   . GLU A 101 ? 0.4827 1.4809 1.4826 -0.0157 -0.3121 0.0005  118 GLU A O   
659  C CB  . GLU A 101 ? 0.4503 1.3082 1.4437 -0.0170 -0.2734 -0.0326 118 GLU A CB  
660  C CG  . GLU A 101 ? 0.4610 1.2672 1.4907 -0.0378 -0.2701 -0.0611 118 GLU A CG  
661  C CD  . GLU A 101 ? 0.4520 1.2390 1.5214 -0.0315 -0.2503 -0.0310 118 GLU A CD  
662  O OE1 . GLU A 101 ? 0.4567 1.2758 1.5519 -0.0315 -0.2493 -0.0013 118 GLU A OE1 
663  O OE2 . GLU A 101 ? 0.4440 1.1835 1.5196 -0.0268 -0.2363 -0.0376 118 GLU A OE2 
664  N N   . GLU A 102 ? 0.6669 1.6203 1.5693 0.0115  -0.3090 -0.0138 119 GLU A N   
665  C CA  . GLU A 102 ? 0.6788 1.6814 1.5595 0.0406  -0.3116 0.0121  119 GLU A CA  
666  C C   . GLU A 102 ? 0.7239 1.7402 1.6236 0.0099  -0.3577 0.0137  119 GLU A C   
667  O O   . GLU A 102 ? 0.7266 1.7823 1.6573 0.0299  -0.3716 0.0073  119 GLU A O   
668  C CB  . GLU A 102 ? 0.6841 1.6360 1.5085 0.0762  -0.3002 0.0234  119 GLU A CB  
669  C CG  . GLU A 102 ? 0.6584 1.5884 1.4698 0.1113  -0.2595 0.0599  119 GLU A CG  
670  C CD  . GLU A 102 ? 0.6831 1.5961 1.3946 0.1457  -0.2352 0.0809  119 GLU A CD  
671  O OE1 . GLU A 102 ? 0.7174 1.6359 1.3630 0.1458  -0.2493 0.0532  119 GLU A OE1 
672  O OE2 . GLU A 102 ? 0.6782 1.5690 1.3664 0.1724  -0.2000 0.1203  119 GLU A OE2 
673  N N   . VAL A 103 ? 0.6937 1.2185 0.9822 -0.3263 -0.2955 0.0308  120 VAL A N   
674  C CA  . VAL A 103 ? 0.7462 1.2689 1.0028 -0.3406 -0.3299 0.0290  120 VAL A CA  
675  C C   . VAL A 103 ? 0.7832 1.2991 1.0277 -0.3765 -0.3376 0.0122  120 VAL A C   
676  O O   . VAL A 103 ? 0.8271 1.3504 1.0564 -0.3940 -0.3696 0.0079  120 VAL A O   
677  C CB  . VAL A 103 ? 0.7843 1.2500 0.9608 -0.3284 -0.3301 0.0345  120 VAL A CB  
678  C CG1 . VAL A 103 ? 0.8224 1.2261 0.9300 -0.3448 -0.3119 0.0222  120 VAL A CG1 
679  C CG2 . VAL A 103 ? 0.8268 1.3025 0.9842 -0.3290 -0.3690 0.0400  120 VAL A CG2 
680  N N   . ASN A 104 ? 0.8624 1.3624 1.1119 -0.3873 -0.3083 0.0023  121 ASN A N   
681  C CA  . ASN A 104 ? 0.8934 1.3769 1.1253 -0.4219 -0.3085 -0.0144 121 ASN A CA  
682  C C   . ASN A 104 ? 0.8462 1.3965 1.1548 -0.4417 -0.3282 -0.0186 121 ASN A C   
683  O O   . ASN A 104 ? 0.8001 1.3771 1.1629 -0.4449 -0.3081 -0.0213 121 ASN A O   
684  C CB  . ASN A 104 ? 0.9033 1.3443 1.1127 -0.4238 -0.2682 -0.0224 121 ASN A CB  
685  C CG  . ASN A 104 ? 0.9441 1.3570 1.1247 -0.4594 -0.2649 -0.0398 121 ASN A CG  
686  O OD1 . ASN A 104 ? 0.9657 1.3892 1.1408 -0.4849 -0.2937 -0.0469 121 ASN A OD1 
687  N ND2 . ASN A 104 ? 0.9561 1.3312 1.1164 -0.4613 -0.2301 -0.0470 121 ASN A ND2 
688  N N   . ILE A 105 ? 0.8291 1.4021 1.1405 -0.4504 -0.3647 -0.0193 122 ILE A N   
689  C CA  . ILE A 105 ? 0.8269 1.4526 1.2100 -0.4490 -0.3763 -0.0236 122 ILE A CA  
690  C C   . ILE A 105 ? 0.8431 1.4666 1.2469 -0.4762 -0.3613 -0.0404 122 ILE A C   
691  O O   . ILE A 105 ? 0.8343 1.5031 1.3061 -0.4755 -0.3636 -0.0445 122 ILE A O   
692  C CB  . ILE A 105 ? 0.8727 1.5131 1.2440 -0.4488 -0.4171 -0.0233 122 ILE A CB  
693  N N   . ASN A 106 ? 0.8703 1.4393 1.2142 -0.5000 -0.3452 -0.0502 123 ASN A N   
694  C CA  . ASN A 106 ? 0.8917 1.4496 1.2465 -0.5268 -0.3284 -0.0658 123 ASN A CA  
695  C C   . ASN A 106 ? 0.8433 1.4054 1.2358 -0.5197 -0.2893 -0.0648 123 ASN A C   
696  O O   . ASN A 106 ? 0.8516 1.4164 1.2726 -0.5361 -0.2731 -0.0749 123 ASN A O   
697  C CB  . ASN A 106 ? 0.9537 1.4436 1.2195 -0.5557 -0.3278 -0.0782 123 ASN A CB  
698  C CG  . ASN A 106 ? 1.0131 1.4945 1.2403 -0.5662 -0.3661 -0.0820 123 ASN A CG  
699  O OD1 . ASN A 106 ? 1.0423 1.5512 1.3028 -0.5799 -0.3849 -0.0906 123 ASN A OD1 
700  N ND2 . ASN A 106 ? 1.0345 1.4765 1.1900 -0.5598 -0.3777 -0.0759 123 ASN A ND2 
701  N N   . ARG A 107 ? 0.9330 1.4940 1.3245 -0.4952 -0.2743 -0.0526 124 ARG A N   
702  C CA  . ARG A 107 ? 0.9030 1.4610 1.3195 -0.4860 -0.2371 -0.0512 124 ARG A CA  
703  C C   . ARG A 107 ? 0.8346 1.4433 1.3381 -0.4732 -0.2277 -0.0490 124 ARG A C   
704  O O   . ARG A 107 ? 0.7879 1.4404 1.3397 -0.4485 -0.2403 -0.0385 124 ARG A O   
705  C CB  . ARG A 107 ? 0.9002 1.4438 1.2941 -0.4584 -0.2258 -0.0385 124 ARG A CB  
706  C CG  . ARG A 107 ? 0.8597 1.4094 1.2901 -0.4381 -0.1920 -0.0343 124 ARG A CG  
707  C CD  . ARG A 107 ? 0.8508 1.3872 1.2657 -0.4008 -0.1838 -0.0212 124 ARG A CD  
708  N NE  . ARG A 107 ? 0.8173 1.3979 1.2646 -0.3853 -0.2124 -0.0083 124 ARG A NE  
709  C CZ  . ARG A 107 ? 0.7549 1.3930 1.2745 -0.3763 -0.2211 -0.0016 124 ARG A CZ  
710  N NH1 . ARG A 107 ? 0.7234 1.3757 1.2887 -0.3776 -0.2008 -0.0077 124 ARG A NH1 
711  N NH2 . ARG A 107 ? 0.7334 1.3986 1.2700 -0.3564 -0.2442 0.0094  124 ARG A NH2 
712  N N   . LYS A 108 ? 1.0924 1.6908 1.6117 -0.4901 -0.2039 -0.0591 125 LYS A N   
713  C CA  . LYS A 108 ? 1.0335 1.6724 1.6310 -0.4810 -0.1903 -0.0577 125 LYS A CA  
714  C C   . LYS A 108 ? 1.0023 1.6323 1.6127 -0.4609 -0.1554 -0.0511 125 LYS A C   
715  O O   . LYS A 108 ? 0.9585 1.6187 1.6306 -0.4482 -0.1420 -0.0474 125 LYS A O   
716  C CB  . LYS A 108 ? 1.0581 1.6922 1.6699 -0.5115 -0.1846 -0.0712 125 LYS A CB  
717  N N   . LYS A 109 ? 0.6482 1.2364 1.2000 -0.4574 -0.1412 -0.0498 126 LYS A N   
718  C CA  . LYS A 109 ? 0.6146 1.1854 1.1666 -0.4425 -0.1067 -0.0469 126 LYS A CA  
719  C C   . LYS A 109 ? 0.5679 1.1535 1.1285 -0.4096 -0.1081 -0.0327 126 LYS A C   
720  O O   . LYS A 109 ? 0.5645 1.1638 1.1164 -0.3998 -0.1339 -0.0248 126 LYS A O   
721  C CB  . LYS A 109 ? 0.6439 1.1513 1.1232 -0.4602 -0.0837 -0.0582 126 LYS A CB  
722  N N   . ARG A 110 ? 0.5353 1.1164 1.1120 -0.3922 -0.0799 -0.0294 127 ARG A N   
723  C CA  . ARG A 110 ? 0.4973 1.0798 1.0763 -0.3566 -0.0772 -0.0170 127 ARG A CA  
724  C C   . ARG A 110 ? 0.5127 1.0426 1.0178 -0.3460 -0.0775 -0.0173 127 ARG A C   
725  O O   . ARG A 110 ? 0.5468 1.0280 0.9965 -0.3594 -0.0657 -0.0276 127 ARG A O   
726  C CB  . ARG A 110 ? 0.4704 1.0437 1.0688 -0.3384 -0.0449 -0.0158 127 ARG A CB  
727  C CG  . ARG A 110 ? 0.4669 1.0688 1.1231 -0.3471 -0.0316 -0.0180 127 ARG A CG  
728  C CD  . ARG A 110 ? 0.4502 1.0278 1.1042 -0.3326 0.0038  -0.0191 127 ARG A CD  
729  N NE  . ARG A 110 ? 0.4198 1.0294 1.1303 -0.3090 0.0092  -0.0074 127 ARG A NE  
730  C CZ  . ARG A 110 ? 0.3871 1.0015 1.1028 -0.2809 0.0107  0.0012  127 ARG A CZ  
731  N NH1 . ARG A 110 ? 0.3843 0.9659 1.0496 -0.2673 0.0058  0.0021  127 ARG A NH1 
732  N NH2 . ARG A 110 ? 0.3730 1.0117 1.1169 -0.2612 0.0176  0.0077  127 ARG A NH2 
733  N N   . ILE A 111 ? 0.4903 1.0285 0.9939 -0.3217 -0.0894 -0.0058 128 ILE A N   
734  C CA  . ILE A 111 ? 0.5033 0.9956 0.9424 -0.3101 -0.0882 -0.0048 128 ILE A CA  
735  C C   . ILE A 111 ? 0.4831 0.9429 0.9048 -0.2881 -0.0591 -0.0050 128 ILE A C   
736  O O   . ILE A 111 ? 0.4472 0.9283 0.9079 -0.2686 -0.0518 0.0020  128 ILE A O   
737  C CB  . ILE A 111 ? 0.4937 1.0057 0.9353 -0.2951 -0.1128 0.0074  128 ILE A CB  
738  C CG1 . ILE A 111 ? 0.5107 1.0635 0.9796 -0.3132 -0.1442 0.0088  128 ILE A CG1 
739  C CG2 . ILE A 111 ? 0.5155 0.9790 0.8884 -0.2878 -0.1109 0.0076  128 ILE A CG2 
740  C CD1 . ILE A 111 ? 0.5066 1.0775 0.9765 -0.2976 -0.1689 0.0213  128 ILE A CD1 
741  N N   . PRO A 112 ? 0.6046 1.0112 0.9657 -0.2904 -0.0428 -0.0129 129 PRO A N   
742  C CA  . PRO A 112 ? 0.6027 0.9793 0.9453 -0.2675 -0.0179 -0.0130 129 PRO A CA  
743  C C   . PRO A 112 ? 0.5884 0.9668 0.9247 -0.2426 -0.0246 -0.0026 129 PRO A C   
744  O O   . PRO A 112 ? 0.6233 0.9881 0.9249 -0.2434 -0.0365 0.0001  129 PRO A O   
745  C CB  . PRO A 112 ? 0.6680 0.9889 0.9461 -0.2778 -0.0014 -0.0241 129 PRO A CB  
746  C CG  . PRO A 112 ? 0.7107 1.0258 0.9602 -0.2998 -0.0212 -0.0268 129 PRO A CG  
747  C CD  . PRO A 112 ? 0.6695 1.0401 0.9764 -0.3133 -0.0458 -0.0225 129 PRO A CD  
748  N N   . ASP A 113 ? 0.4336 0.8264 0.8018 -0.2212 -0.0162 0.0031  130 ASP A N   
749  C CA  . ASP A 113 ? 0.4107 0.8095 0.7811 -0.1994 -0.0227 0.0131  130 ASP A CA  
750  C C   . ASP A 113 ? 0.4143 0.7732 0.7410 -0.1842 -0.0058 0.0102  130 ASP A C   
751  O O   . ASP A 113 ? 0.4010 0.7482 0.7310 -0.1712 0.0115  0.0071  130 ASP A O   
752  C CB  . ASP A 113 ? 0.3736 0.8070 0.7995 -0.1843 -0.0235 0.0208  130 ASP A CB  
753  C CG  . ASP A 113 ? 0.3556 0.8045 0.7921 -0.1685 -0.0372 0.0325  130 ASP A CG  
754  O OD1 . ASP A 113 ? 0.3690 0.7988 0.7689 -0.1666 -0.0421 0.0345  130 ASP A OD1 
755  O OD2 . ASP A 113 ? 0.3311 0.8090 0.8111 -0.1577 -0.0415 0.0400  130 ASP A OD2 
756  N N   . THR A 114 ? 0.4347 0.7729 0.7200 -0.1848 -0.0110 0.0116  131 THR A N   
757  C CA  . THR A 114 ? 0.4400 0.7445 0.6859 -0.1697 0.0040  0.0099  131 THR A CA  
758  C C   . THR A 114 ? 0.4194 0.7370 0.6755 -0.1532 -0.0036 0.0204  131 THR A C   
759  O O   . THR A 114 ? 0.4213 0.7187 0.6519 -0.1401 0.0062  0.0210  131 THR A O   
760  C CB  . THR A 114 ? 0.4839 0.7488 0.6699 -0.1809 0.0090  0.0036  131 THR A CB  
761  O OG1 . THR A 114 ? 0.5025 0.7729 0.6756 -0.1914 -0.0097 0.0088  131 THR A OG1 
762  C CG2 . THR A 114 ? 0.5092 0.7566 0.6820 -0.1992 0.0182  -0.0075 131 THR A CG2 
763  N N   . ARG A 115 ? 0.4020 0.7536 0.6963 -0.1539 -0.0204 0.0289  132 ARG A N   
764  C CA  . ARG A 115 ? 0.3853 0.7489 0.6914 -0.1398 -0.0275 0.0395  132 ARG A CA  
765  C C   . ARG A 115 ? 0.3562 0.7205 0.6811 -0.1210 -0.0146 0.0398  132 ARG A C   
766  O O   . ARG A 115 ? 0.3408 0.7112 0.6888 -0.1177 -0.0071 0.0354  132 ARG A O   
767  C CB  . ARG A 115 ? 0.3760 0.7743 0.7187 -0.1432 -0.0475 0.0484  132 ARG A CB  
768  C CG  . ARG A 115 ? 0.4062 0.8083 0.7338 -0.1618 -0.0648 0.0481  132 ARG A CG  
769  C CD  . ARG A 115 ? 0.3953 0.8368 0.7659 -0.1626 -0.0848 0.0564  132 ARG A CD  
770  N NE  . ARG A 115 ? 0.3686 0.8363 0.7877 -0.1602 -0.0796 0.0548  132 ARG A NE  
771  C CZ  . ARG A 115 ? 0.3572 0.8626 0.8208 -0.1597 -0.0934 0.0612  132 ARG A CZ  
772  N NH1 . ARG A 115 ? 0.3706 0.8922 0.8354 -0.1612 -0.1153 0.0694  132 ARG A NH1 
773  N NH2 . ARG A 115 ? 0.3354 0.8610 0.8407 -0.1563 -0.0849 0.0598  132 ARG A NH2 
774  N N   . VAL A 116 ? 0.4108 0.7678 0.7253 -0.1090 -0.0118 0.0449  133 VAL A N   
775  C CA  . VAL A 116 ? 0.3646 0.7244 0.6985 -0.0924 -0.0028 0.0452  133 VAL A CA  
776  C C   . VAL A 116 ? 0.3388 0.7257 0.7171 -0.0871 -0.0120 0.0525  133 VAL A C   
777  O O   . VAL A 116 ? 0.3381 0.7365 0.7253 -0.0862 -0.0226 0.0620  133 VAL A O   
778  C CB  . VAL A 116 ? 0.3784 0.7261 0.6927 -0.0830 0.0029  0.0484  133 VAL A CB  
779  C CG1 . VAL A 116 ? 0.3415 0.6949 0.6791 -0.0677 0.0096  0.0477  133 VAL A CG1 
780  C CG2 . VAL A 116 ? 0.4373 0.7565 0.7057 -0.0855 0.0137  0.0421  133 VAL A CG2 
781  N N   . HIS A 117 ? 0.3307 0.7244 0.7335 -0.0827 -0.0068 0.0484  134 HIS A N   
782  C CA  . HIS A 117 ? 0.3050 0.7208 0.7479 -0.0759 -0.0130 0.0550  134 HIS A CA  
783  C C   . HIS A 117 ? 0.2903 0.7022 0.7409 -0.0615 -0.0095 0.0579  134 HIS A C   
784  O O   . HIS A 117 ? 0.2836 0.7072 0.7522 -0.0572 -0.0173 0.0670  134 HIS A O   
785  C CB  . HIS A 117 ? 0.2978 0.7194 0.7621 -0.0759 -0.0064 0.0498  134 HIS A CB  
786  C CG  . HIS A 117 ? 0.3132 0.7392 0.7735 -0.0923 -0.0079 0.0455  134 HIS A CG  
787  N ND1 . HIS A 117 ? 0.3205 0.7325 0.7727 -0.0965 0.0058  0.0358  134 HIS A ND1 
788  C CD2 . HIS A 117 ? 0.3258 0.7676 0.7883 -0.1064 -0.0217 0.0490  134 HIS A CD2 
789  C CE1 . HIS A 117 ? 0.3363 0.7559 0.7880 -0.1141 0.0013  0.0334  134 HIS A CE1 
790  N NE2 . HIS A 117 ? 0.3394 0.7784 0.7979 -0.1206 -0.0166 0.0410  134 HIS A NE2 
791  N N   . CYS A 118 ? 0.3815 0.7759 0.8173 -0.0543 0.0020  0.0499  135 CYS A N   
792  C CA  . CYS A 118 ? 0.3540 0.7452 0.7986 -0.0419 0.0049  0.0502  135 CYS A CA  
793  C C   . CYS A 118 ? 0.3785 0.7558 0.7970 -0.0387 0.0116  0.0459  135 CYS A C   
794  O O   . CYS A 118 ? 0.4112 0.7742 0.8028 -0.0410 0.0187  0.0392  135 CYS A O   
795  C CB  . CYS A 118 ? 0.3237 0.7103 0.7827 -0.0323 0.0110  0.0444  135 CYS A CB  
796  S SG  . CYS A 118 ? 0.2968 0.6778 0.7655 -0.0185 0.0121  0.0427  135 CYS A SG  
797  N N   . CYS A 119 ? 0.4264 0.8076 0.8531 -0.0335 0.0103  0.0500  136 CYS A N   
798  C CA  . CYS A 119 ? 0.4468 0.8203 0.8554 -0.0295 0.0171  0.0471  136 CYS A CA  
799  C C   . CYS A 119 ? 0.4139 0.7918 0.8413 -0.0197 0.0181  0.0448  136 CYS A C   
800  O O   . CYS A 119 ? 0.4004 0.7875 0.8479 -0.0208 0.0137  0.0513  136 CYS A O   
801  C CB  . CYS A 119 ? 0.4854 0.8597 0.8804 -0.0368 0.0157  0.0554  136 CYS A CB  
802  S SG  . CYS A 119 ? 0.5095 0.8780 0.8884 -0.0308 0.0264  0.0543  136 CYS A SG  
803  N N   . LEU A 120 ? 0.2856 0.6554 0.7049 -0.0104 0.0236  0.0352  137 LEU A N   
804  C CA  . LEU A 120 ? 0.2771 0.6520 0.7125 -0.0014 0.0226  0.0313  137 LEU A CA  
805  C C   . LEU A 120 ? 0.2802 0.6638 0.7159 -0.0017 0.0260  0.0343  137 LEU A C   
806  O O   . LEU A 120 ? 0.2922 0.6702 0.7045 -0.0005 0.0332  0.0335  137 LEU A O   
807  C CB  . LEU A 120 ? 0.2806 0.6431 0.7037 0.0104  0.0259  0.0200  137 LEU A CB  
808  C CG  . LEU A 120 ? 0.2810 0.6314 0.7025 0.0126  0.0260  0.0161  137 LEU A CG  
809  C CD1 . LEU A 120 ? 0.2895 0.6237 0.6947 0.0265  0.0298  0.0052  137 LEU A CD1 
810  C CD2 . LEU A 120 ? 0.2698 0.6279 0.7195 0.0104  0.0188  0.0212  137 LEU A CD2 
811  N N   . TYR A 121 ? 0.2189 0.6148 0.6805 -0.0033 0.0222  0.0380  138 TYR A N   
812  C CA  . TYR A 121 ? 0.2219 0.6286 0.6900 -0.0040 0.0272  0.0410  138 TYR A CA  
813  C C   . TYR A 121 ? 0.2151 0.6323 0.7030 0.0040  0.0248  0.0328  138 TYR A C   
814  O O   . TYR A 121 ? 0.2077 0.6275 0.7167 0.0034  0.0172  0.0305  138 TYR A O   
815  C CB  . TYR A 121 ? 0.2234 0.6354 0.7050 -0.0143 0.0265  0.0522  138 TYR A CB  
816  C CG  . TYR A 121 ? 0.2324 0.6514 0.7137 -0.0166 0.0359  0.0573  138 TYR A CG  
817  C CD1 . TYR A 121 ? 0.2274 0.6618 0.7346 -0.0152 0.0383  0.0548  138 TYR A CD1 
818  C CD2 . TYR A 121 ? 0.2486 0.6586 0.7035 -0.0204 0.0427  0.0642  138 TYR A CD2 
819  C CE1 . TYR A 121 ? 0.2366 0.6792 0.7468 -0.0171 0.0493  0.0600  138 TYR A CE1 
820  C CE2 . TYR A 121 ? 0.2604 0.6740 0.7126 -0.0213 0.0539  0.0695  138 TYR A CE2 
821  C CZ  . TYR A 121 ? 0.2534 0.6844 0.7350 -0.0194 0.0582  0.0677  138 TYR A CZ  
822  O OH  . TYR A 121 ? 0.2659 0.7024 0.7484 -0.0202 0.0716  0.0734  138 TYR A OH  
823  N N   . PHE A 122 ? 0.2205 0.6431 0.7003 0.0121  0.0308  0.0285  139 PHE A N   
824  C CA  . PHE A 122 ? 0.2165 0.6521 0.7142 0.0215  0.0266  0.0199  139 PHE A CA  
825  C C   . PHE A 122 ? 0.2127 0.6714 0.7430 0.0156  0.0277  0.0235  139 PHE A C   
826  O O   . PHE A 122 ? 0.2188 0.6859 0.7481 0.0136  0.0381  0.0296  139 PHE A O   
827  C CB  . PHE A 122 ? 0.2267 0.6579 0.7003 0.0360  0.0323  0.0132  139 PHE A CB  
828  C CG  . PHE A 122 ? 0.2327 0.6408 0.6789 0.0441  0.0303  0.0061  139 PHE A CG  
829  C CD1 . PHE A 122 ? 0.2383 0.6271 0.6598 0.0377  0.0350  0.0095  139 PHE A CD1 
830  C CD2 . PHE A 122 ? 0.2356 0.6407 0.6805 0.0577  0.0239  -0.0042 139 PHE A CD2 
831  C CE1 . PHE A 122 ? 0.2458 0.6132 0.6441 0.0437  0.0357  0.0030  139 PHE A CE1 
832  C CE2 . PHE A 122 ? 0.2454 0.6252 0.6621 0.0656  0.0247  -0.0104 139 PHE A CE2 
833  C CZ  . PHE A 122 ? 0.2500 0.6111 0.6446 0.0580  0.0318  -0.0066 139 PHE A CZ  
834  N N   . ILE A 123 ? 0.2214 0.6882 0.7794 0.0122  0.0179  0.0195  140 ILE A N   
835  C CA  . ILE A 123 ? 0.2195 0.7083 0.8124 0.0042  0.0183  0.0214  140 ILE A CA  
836  C C   . ILE A 123 ? 0.2199 0.7283 0.8291 0.0137  0.0119  0.0107  140 ILE A C   
837  O O   . ILE A 123 ? 0.2195 0.7225 0.8277 0.0210  -0.0003 0.0009  140 ILE A O   
838  C CB  . ILE A 123 ? 0.2199 0.7003 0.8269 -0.0081 0.0114  0.0235  140 ILE A CB  
839  C CG1 . ILE A 123 ? 0.2206 0.6856 0.8152 -0.0158 0.0168  0.0354  140 ILE A CG1 
840  C CG2 . ILE A 123 ? 0.2282 0.7226 0.8581 -0.0181 0.0124  0.0231  140 ILE A CG2 
841  C CD1 . ILE A 123 ? 0.2231 0.6773 0.8296 -0.0249 0.0114  0.0388  140 ILE A CD1 
842  N N   . PRO A 124 ? 0.2091 0.7387 0.8300 0.0144  0.0200  0.0124  141 PRO A N   
843  C CA  . PRO A 124 ? 0.2136 0.7655 0.8490 0.0237  0.0131  0.0033  141 PRO A CA  
844  C C   . PRO A 124 ? 0.2188 0.7759 0.8740 0.0135  -0.0006 -0.0024 141 PRO A C   
845  O O   . PRO A 124 ? 0.2225 0.7773 0.8898 -0.0031 0.0026  0.0026  141 PRO A O   
846  C CB  . PRO A 124 ? 0.2191 0.7921 0.8649 0.0238  0.0285  0.0095  141 PRO A CB  
847  C CG  . PRO A 124 ? 0.2205 0.7812 0.8640 0.0083  0.0403  0.0211  141 PRO A CG  
848  C CD  . PRO A 124 ? 0.2130 0.7473 0.8347 0.0074  0.0366  0.0241  141 PRO A CD  
849  N N   . ALA A 125 ? 0.2219 0.7835 0.8800 0.0237  -0.0154 -0.0127 142 ALA A N   
850  C CA  . ALA A 125 ? 0.2294 0.7933 0.9060 0.0144  -0.0303 -0.0195 142 ALA A CA  
851  C C   . ALA A 125 ? 0.2385 0.8328 0.9446 0.0046  -0.0293 -0.0187 142 ALA A C   
852  O O   . ALA A 125 ? 0.2462 0.8608 0.9666 0.0111  -0.0408 -0.0258 142 ALA A O   
853  C CB  . ALA A 125 ? 0.2334 0.7906 0.9021 0.0295  -0.0474 -0.0318 142 ALA A CB  
854  N N   . THR A 126 ? 0.2397 0.8371 0.9557 -0.0107 -0.0154 -0.0102 143 THR A N   
855  C CA  . THR A 126 ? 0.2502 0.8752 0.9962 -0.0223 -0.0112 -0.0091 143 THR A CA  
856  C C   . THR A 126 ? 0.2607 0.8840 1.0277 -0.0383 -0.0245 -0.0155 143 THR A C   
857  O O   . THR A 126 ? 0.2719 0.9215 1.0671 -0.0465 -0.0279 -0.0186 143 THR A O   
858  C CB  . THR A 126 ? 0.2520 0.8763 1.0004 -0.0329 0.0102  0.0019  143 THR A CB  
859  O OG1 . THR A 126 ? 0.2525 0.8481 0.9939 -0.0467 0.0126  0.0070  143 THR A OG1 
860  C CG2 . THR A 126 ? 0.2445 0.8668 0.9717 -0.0183 0.0234  0.0074  143 THR A CG2 
861  N N   . GLY A 127 ? 0.2585 0.8514 1.0133 -0.0428 -0.0315 -0.0174 144 GLY A N   
862  C CA  . GLY A 127 ? 0.2702 0.8553 1.0428 -0.0580 -0.0434 -0.0239 144 GLY A CA  
863  C C   . GLY A 127 ? 0.2796 0.8604 1.0685 -0.0794 -0.0307 -0.0164 144 GLY A C   
864  O O   . GLY A 127 ? 0.2934 0.8702 1.1014 -0.0952 -0.0380 -0.0214 144 GLY A O   
865  N N   . HIS A 128 ? 0.2751 0.8541 1.0556 -0.0803 -0.0116 -0.0048 145 HIS A N   
866  C CA  . HIS A 128 ? 0.2864 0.8575 1.0790 -0.0988 0.0030  0.0039  145 HIS A CA  
867  C C   . HIS A 128 ? 0.2795 0.8236 1.0488 -0.0966 0.0150  0.0160  145 HIS A C   
868  O O   . HIS A 128 ? 0.2661 0.7971 1.0116 -0.0830 0.0102  0.0164  145 HIS A O   
869  C CB  . HIS A 128 ? 0.2954 0.8963 1.1089 -0.1047 0.0165  0.0072  145 HIS A CB  
870  C CG  . HIS A 128 ? 0.3046 0.9372 1.1462 -0.1083 0.0047  -0.0030 145 HIS A CG  
871  N ND1 . HIS A 128 ? 0.3188 0.9491 1.1803 -0.1240 -0.0078 -0.0109 145 HIS A ND1 
872  C CD2 . HIS A 128 ? 0.3037 0.9718 1.1579 -0.0982 0.0029  -0.0064 145 HIS A CD2 
873  C CE1 . HIS A 128 ? 0.3263 0.9906 1.2118 -0.1242 -0.0180 -0.0188 145 HIS A CE1 
874  N NE2 . HIS A 128 ? 0.3168 1.0057 1.1992 -0.1079 -0.0116 -0.0155 145 HIS A NE2 
875  N N   . SER A 129 ? 0.6019 1.1379 1.3786 -0.1103 0.0307  0.0262  146 SER A N   
876  C CA  . SER A 129 ? 0.6132 1.1253 1.3704 -0.1091 0.0421  0.0397  146 SER A CA  
877  C C   . SER A 129 ? 0.5986 1.1171 1.3348 -0.0941 0.0491  0.0446  146 SER A C   
878  O O   . SER A 129 ? 0.5871 1.1290 1.3277 -0.0871 0.0518  0.0402  146 SER A O   
879  C CB  . SER A 129 ? 0.6429 1.1464 1.4128 -0.1259 0.0596  0.0505  146 SER A CB  
880  O OG  . SER A 129 ? 0.6444 1.1705 1.4267 -0.1290 0.0734  0.0521  146 SER A OG  
881  N N   . LEU A 130 ? 0.4446 0.9429 1.1593 -0.0892 0.0518  0.0541  147 LEU A N   
882  C CA  . LEU A 130 ? 0.4400 0.9407 1.1339 -0.0774 0.0588  0.0598  147 LEU A CA  
883  C C   . LEU A 130 ? 0.4542 0.9657 1.1540 -0.0812 0.0785  0.0685  147 LEU A C   
884  O O   . LEU A 130 ? 0.4782 0.9833 1.1890 -0.0939 0.0907  0.0770  147 LEU A O   
885  C CB  . LEU A 130 ? 0.4561 0.9353 1.1298 -0.0746 0.0574  0.0700  147 LEU A CB  
886  C CG  . LEU A 130 ? 0.4363 0.9064 1.0968 -0.0649 0.0411  0.0624  147 LEU A CG  
887  C CD1 . LEU A 130 ? 0.4589 0.9079 1.0975 -0.0633 0.0401  0.0728  147 LEU A CD1 
888  C CD2 . LEU A 130 ? 0.4087 0.8905 1.0566 -0.0515 0.0375  0.0536  147 LEU A CD2 
889  N N   . ARG A 131 ? 0.9251 1.4507 1.6165 -0.0697 0.0834  0.0668  148 ARG A N   
890  C CA  . ARG A 131 ? 0.9422 1.4770 1.6364 -0.0701 0.1041  0.0756  148 ARG A CA  
891  C C   . ARG A 131 ? 0.9746 1.4895 1.6470 -0.0707 0.1169  0.0926  148 ARG A C   
892  O O   . ARG A 131 ? 0.9825 1.4784 1.6248 -0.0649 0.1061  0.0928  148 ARG A O   
893  C CB  . ARG A 131 ? 0.9223 1.4784 1.6154 -0.0555 0.1052  0.0683  148 ARG A CB  
894  C CG  . ARG A 131 ? 0.9016 1.4819 1.6175 -0.0538 0.0919  0.0531  148 ARG A CG  
895  C CD  . ARG A 131 ? 0.8868 1.4843 1.5967 -0.0353 0.0896  0.0464  148 ARG A CD  
896  N NE  . ARG A 131 ? 0.8806 1.4593 1.5611 -0.0244 0.0847  0.0477  148 ARG A NE  
897  C CZ  . ARG A 131 ? 0.8731 1.4564 1.5391 -0.0078 0.0882  0.0464  148 ARG A CZ  
898  N NH1 . ARG A 131 ? 0.8723 1.4785 1.5499 0.0020  0.0961  0.0437  148 ARG A NH1 
899  N NH2 . ARG A 131 ? 0.8737 1.4389 1.5141 -0.0008 0.0844  0.0484  148 ARG A NH2 
900  N N   . PRO A 132 ? 0.3065 0.8167 0.9785 -0.0771 0.1378  0.1042  149 PRO A N   
901  C CA  . PRO A 132 ? 0.3309 0.8076 0.9573 -0.0763 0.1476  0.1169  149 PRO A CA  
902  C C   . PRO A 132 ? 0.3302 0.7936 0.9134 -0.0632 0.1417  0.1162  149 PRO A C   
903  O O   . PRO A 132 ? 0.3449 0.7798 0.8896 -0.0630 0.1385  0.1232  149 PRO A O   
904  C CB  . PRO A 132 ? 0.3537 0.8347 0.9889 -0.0806 0.1736  0.1258  149 PRO A CB  
905  C CG  . PRO A 132 ? 0.3448 0.8542 1.0344 -0.0917 0.1754  0.1198  149 PRO A CG  
906  C CD  . PRO A 132 ? 0.3205 0.8472 1.0200 -0.0850 0.1505  0.1019  149 PRO A CD  
907  N N   . LEU A 133 ? 0.3164 0.7993 0.9051 -0.0525 0.1401  0.1076  150 LEU A N   
908  C CA  . LEU A 133 ? 0.3189 0.7871 0.8660 -0.0410 0.1361  0.1056  150 LEU A CA  
909  C C   . LEU A 133 ? 0.3053 0.7604 0.8369 -0.0407 0.1152  0.1006  150 LEU A C   
910  O O   . LEU A 133 ? 0.3179 0.7487 0.8115 -0.0406 0.1118  0.1055  150 LEU A O   
911  C CB  . LEU A 133 ? 0.3095 0.8003 0.8670 -0.0282 0.1396  0.0972  150 LEU A CB  
912  C CG  . LEU A 133 ? 0.3144 0.7883 0.8286 -0.0161 0.1366  0.0935  150 LEU A CG  
913  C CD1 . LEU A 133 ? 0.3461 0.7904 0.8135 -0.0159 0.1507  0.1039  150 LEU A CD1 
914  C CD2 . LEU A 133 ? 0.3062 0.8025 0.8337 -0.0017 0.1392  0.0850  150 LEU A CD2 
915  N N   . ASP A 134 ? 0.5840 1.0552 1.1450 -0.0405 0.1013  0.0908  151 ASP A N   
916  C CA  . ASP A 134 ? 0.5706 1.0309 1.1207 -0.0389 0.0836  0.0856  151 ASP A CA  
917  C C   . ASP A 134 ? 0.6006 1.0416 1.1417 -0.0477 0.0790  0.0944  151 ASP A C   
918  O O   . ASP A 134 ? 0.6109 1.0377 1.1300 -0.0459 0.0691  0.0951  151 ASP A O   
919  C CB  . ASP A 134 ? 0.5219 1.0001 1.1036 -0.0363 0.0713  0.0736  151 ASP A CB  
920  C CG  . ASP A 134 ? 0.4988 0.9932 1.0829 -0.0239 0.0719  0.0641  151 ASP A CG  
921  O OD1 . ASP A 134 ? 0.5180 1.0025 1.0705 -0.0157 0.0778  0.0650  151 ASP A OD1 
922  O OD2 . ASP A 134 ? 0.4698 0.9854 1.0856 -0.0219 0.0657  0.0556  151 ASP A OD2 
923  N N   . ILE A 135 ? 0.3503 0.7911 0.9092 -0.0568 0.0869  0.1012  152 ILE A N   
924  C CA  . ILE A 135 ? 0.3645 0.7843 0.9126 -0.0634 0.0846  0.1109  152 ILE A CA  
925  C C   . ILE A 135 ? 0.4083 0.8065 0.9136 -0.0609 0.0872  0.1205  152 ILE A C   
926  O O   . ILE A 135 ? 0.4255 0.8108 0.9132 -0.0596 0.0754  0.1236  152 ILE A O   
927  C CB  . ILE A 135 ? 0.3794 0.7986 0.9498 -0.0740 0.0969  0.1171  152 ILE A CB  
928  C CG1 . ILE A 135 ? 0.3620 0.7999 0.9743 -0.0791 0.0907  0.1070  152 ILE A CG1 
929  C CG2 . ILE A 135 ? 0.4297 0.8213 0.9795 -0.0782 0.0970  0.1290  152 ILE A CG2 
930  C CD1 . ILE A 135 ? 0.3770 0.8176 1.0160 -0.0922 0.1040  0.1111  152 ILE A CD1 
931  N N   . GLU A 136 ? 0.4027 0.7976 0.8914 -0.0599 0.1024  0.1252  153 GLU A N   
932  C CA  . GLU A 136 ? 0.4294 0.8003 0.8725 -0.0580 0.1053  0.1338  153 GLU A CA  
933  C C   . GLU A 136 ? 0.4228 0.7910 0.8418 -0.0522 0.0923  0.1273  153 GLU A C   
934  O O   . GLU A 136 ? 0.4619 0.8124 0.8495 -0.0527 0.0841  0.1323  153 GLU A O   
935  C CB  . GLU A 136 ? 0.4532 0.8187 0.8824 -0.0570 0.1270  0.1394  153 GLU A CB  
936  N N   . PHE A 137 ? 0.5129 0.8983 0.9462 -0.0469 0.0902  0.1160  154 PHE A N   
937  C CA  . PHE A 137 ? 0.5076 0.8884 0.9181 -0.0421 0.0808  0.1090  154 PHE A CA  
938  C C   . PHE A 137 ? 0.4863 0.8665 0.9024 -0.0441 0.0629  0.1069  154 PHE A C   
939  O O   . PHE A 137 ? 0.5122 0.8811 0.9023 -0.0452 0.0547  0.1079  154 PHE A O   
940  C CB  . PHE A 137 ? 0.4634 0.8599 0.8865 -0.0340 0.0844  0.0978  154 PHE A CB  
941  C CG  . PHE A 137 ? 0.4902 0.8735 0.8762 -0.0284 0.0862  0.0935  154 PHE A CG  
942  C CD1 . PHE A 137 ? 0.4994 0.8715 0.8657 -0.0304 0.0739  0.0900  154 PHE A CD1 
943  C CD2 . PHE A 137 ? 0.5066 0.8880 0.8776 -0.0212 0.1015  0.0929  154 PHE A CD2 
944  C CE1 . PHE A 137 ? 0.5294 0.8861 0.8600 -0.0274 0.0765  0.0853  154 PHE A CE1 
945  C CE2 . PHE A 137 ? 0.5369 0.9007 0.8691 -0.0160 0.1044  0.0888  154 PHE A CE2 
946  C CZ  . PHE A 137 ? 0.5518 0.9020 0.8629 -0.0201 0.0918  0.0847  154 PHE A CZ  
947  N N   . MET A 138 ? 0.4976 0.8902 0.9482 -0.0448 0.0571  0.1039  155 MET A N   
948  C CA  . MET A 138 ? 0.4733 0.8652 0.9316 -0.0449 0.0425  0.1026  155 MET A CA  
949  C C   . MET A 138 ? 0.5203 0.8992 0.9650 -0.0488 0.0372  0.1143  155 MET A C   
950  O O   . MET A 138 ? 0.5139 0.8916 0.9543 -0.0478 0.0253  0.1150  155 MET A O   
951  C CB  . MET A 138 ? 0.4253 0.8284 0.9190 -0.0441 0.0387  0.0967  155 MET A CB  
952  C CG  . MET A 138 ? 0.3798 0.7946 0.8843 -0.0377 0.0376  0.0837  155 MET A CG  
953  S SD  . MET A 138 ? 0.3376 0.7604 0.8772 -0.0368 0.0300  0.0759  155 MET A SD  
954  C CE  . MET A 138 ? 0.3496 0.7847 0.9138 -0.0435 0.0404  0.0780  155 MET A CE  
955  N N   . LYS A 139 ? 0.4480 0.8174 0.8863 -0.0524 0.0466  0.1239  156 LYS A N   
956  C CA  . LYS A 139 ? 0.4711 0.8244 0.8911 -0.0539 0.0420  0.1358  156 LYS A CA  
957  C C   . LYS A 139 ? 0.4942 0.8380 0.8777 -0.0535 0.0350  0.1381  156 LYS A C   
958  O O   . LYS A 139 ? 0.5145 0.8535 0.8877 -0.0528 0.0222  0.1437  156 LYS A O   
959  C CB  . LYS A 139 ? 0.5114 0.8517 0.9274 -0.0576 0.0565  0.1456  156 LYS A CB  
960  C CG  . LYS A 139 ? 0.5116 0.8497 0.9527 -0.0599 0.0569  0.1493  156 LYS A CG  
961  C CD  . LYS A 139 ? 0.5804 0.8973 1.0072 -0.0637 0.0704  0.1616  156 LYS A CD  
962  C CE  . LYS A 139 ? 0.5726 0.8921 1.0007 -0.0679 0.0900  0.1611  156 LYS A CE  
963  N NZ  . LYS A 139 ? 0.6134 0.9106 1.0301 -0.0725 0.1063  0.1731  156 LYS A NZ  
964  N N   . ARG A 140 ? 0.5174 0.8584 0.8812 -0.0536 0.0430  0.1336  157 ARG A N   
965  C CA  . ARG A 140 ? 0.5656 0.8945 0.8917 -0.0549 0.0365  0.1337  157 ARG A CA  
966  C C   . ARG A 140 ? 0.5150 0.8560 0.8497 -0.0552 0.0219  0.1252  157 ARG A C   
967  O O   . ARG A 140 ? 0.5386 0.8762 0.8579 -0.0580 0.0085  0.1277  157 ARG A O   
968  C CB  . ARG A 140 ? 0.5961 0.9149 0.8963 -0.0540 0.0512  0.1306  157 ARG A CB  
969  C CG  . ARG A 140 ? 0.6343 0.9387 0.9209 -0.0536 0.0685  0.1398  157 ARG A CG  
970  C CD  . ARG A 140 ? 0.6697 0.9542 0.9130 -0.0522 0.0792  0.1397  157 ARG A CD  
971  N NE  . ARG A 140 ? 0.6669 0.9446 0.9072 -0.0494 0.1018  0.1454  157 ARG A NE  
972  C CZ  . ARG A 140 ? 0.6655 0.9367 0.8875 -0.0446 0.1174  0.1427  157 ARG A CZ  
973  N NH1 . ARG A 140 ? 0.6687 0.9356 0.8698 -0.0424 0.1125  0.1341  157 ARG A NH1 
974  N NH2 . ARG A 140 ? 0.6598 0.9278 0.8840 -0.0417 0.1392  0.1489  157 ARG A NH2 
975  N N   . LEU A 141 ? 0.5824 0.9375 0.9419 -0.0522 0.0246  0.1151  158 LEU A N   
976  C CA  . LEU A 141 ? 0.5382 0.9018 0.9045 -0.0521 0.0150  0.1063  158 LEU A CA  
977  C C   . LEU A 141 ? 0.5072 0.8806 0.8953 -0.0521 0.0014  0.1098  158 LEU A C   
978  O O   . LEU A 141 ? 0.5019 0.8794 0.8862 -0.0547 -0.0088 0.1078  158 LEU A O   
979  C CB  . LEU A 141 ? 0.4831 0.8555 0.8675 -0.0466 0.0221  0.0954  158 LEU A CB  
980  C CG  . LEU A 141 ? 0.5054 0.8697 0.8660 -0.0441 0.0334  0.0891  158 LEU A CG  
981  C CD1 . LEU A 141 ? 0.4509 0.8253 0.8312 -0.0362 0.0379  0.0789  158 LEU A CD1 
982  C CD2 . LEU A 141 ? 0.5464 0.8972 0.8731 -0.0488 0.0296  0.0862  158 LEU A CD2 
983  N N   . SER A 142 ? 0.4691 0.8460 0.8803 -0.0491 0.0021  0.1152  159 SER A N   
984  C CA  . SER A 142 ? 0.4436 0.8275 0.8751 -0.0465 -0.0087 0.1194  159 SER A CA  
985  C C   . SER A 142 ? 0.4875 0.8685 0.9017 -0.0482 -0.0202 0.1289  159 SER A C   
986  O O   . SER A 142 ? 0.4640 0.8554 0.8923 -0.0457 -0.0315 0.1313  159 SER A O   
987  C CB  . SER A 142 ? 0.4382 0.8198 0.8912 -0.0435 -0.0039 0.1237  159 SER A CB  
988  O OG  . SER A 142 ? 0.5028 0.8714 0.9408 -0.0454 0.0003  0.1346  159 SER A OG  
989  N N   . LYS A 143 ? 0.4444 0.8111 0.8275 -0.0516 -0.0174 0.1345  160 LYS A N   
990  C CA  . LYS A 143 ? 0.4939 0.8545 0.8542 -0.0528 -0.0299 0.1435  160 LYS A CA  
991  C C   . LYS A 143 ? 0.5081 0.8754 0.8550 -0.0587 -0.0415 0.1376  160 LYS A C   
992  O O   . LYS A 143 ? 0.5512 0.9199 0.8857 -0.0602 -0.0564 0.1433  160 LYS A O   
993  C CB  . LYS A 143 ? 0.5432 0.8804 0.8694 -0.0539 -0.0215 0.1517  160 LYS A CB  
994  C CG  . LYS A 143 ? 0.5549 0.8812 0.8823 -0.0487 -0.0202 0.1642  160 LYS A CG  
995  C CD  . LYS A 143 ? 0.6042 0.9221 0.9058 -0.0462 -0.0362 0.1742  160 LYS A CD  
996  C CE  . LYS A 143 ? 0.5883 0.9294 0.9150 -0.0425 -0.0549 0.1737  160 LYS A CE  
997  N NZ  . LYS A 143 ? 0.6339 0.9736 0.9360 -0.0415 -0.0742 0.1804  160 LYS A NZ  
998  N N   . VAL A 144 ? 0.3639 0.7346 0.7125 -0.0623 -0.0351 0.1260  161 VAL A N   
999  C CA  . VAL A 144 ? 0.3717 0.7444 0.7045 -0.0702 -0.0433 0.1192  161 VAL A CA  
1000 C C   . VAL A 144 ? 0.3441 0.7315 0.7023 -0.0710 -0.0419 0.1085  161 VAL A C   
1001 O O   . VAL A 144 ? 0.3495 0.7400 0.7000 -0.0789 -0.0479 0.1024  161 VAL A O   
1002 C CB  . VAL A 144 ? 0.3965 0.7463 0.6866 -0.0754 -0.0344 0.1156  161 VAL A CB  
1003 C CG1 . VAL A 144 ? 0.4319 0.7626 0.6892 -0.0753 -0.0360 0.1263  161 VAL A CG1 
1004 C CG2 . VAL A 144 ? 0.3808 0.7258 0.6754 -0.0704 -0.0156 0.1092  161 VAL A CG2 
1005 N N   . VAL A 145 ? 0.3184 0.7124 0.7046 -0.0634 -0.0337 0.1060  162 VAL A N   
1006 C CA  . VAL A 145 ? 0.2963 0.6989 0.7019 -0.0621 -0.0302 0.0959  162 VAL A CA  
1007 C C   . VAL A 145 ? 0.2736 0.6829 0.7108 -0.0525 -0.0260 0.0960  162 VAL A C   
1008 O O   . VAL A 145 ? 0.2740 0.6791 0.7158 -0.0484 -0.0224 0.1014  162 VAL A O   
1009 C CB  . VAL A 145 ? 0.2997 0.6883 0.6817 -0.0641 -0.0185 0.0855  162 VAL A CB  
1010 C CG1 . VAL A 145 ? 0.2893 0.6727 0.6759 -0.0558 -0.0063 0.0832  162 VAL A CG1 
1011 C CG2 . VAL A 145 ? 0.2903 0.6827 0.6796 -0.0665 -0.0175 0.0758  162 VAL A CG2 
1012 N N   . ASN A 146 ? 0.3696 0.7870 0.8269 -0.0497 -0.0257 0.0899  163 ASN A N   
1013 C CA  . ASN A 146 ? 0.3456 0.7645 0.8276 -0.0405 -0.0215 0.0885  163 ASN A CA  
1014 C C   . ASN A 146 ? 0.3422 0.7507 0.8176 -0.0366 -0.0110 0.0796  163 ASN A C   
1015 O O   . ASN A 146 ? 0.3423 0.7452 0.8052 -0.0368 -0.0055 0.0703  163 ASN A O   
1016 C CB  . ASN A 146 ? 0.3245 0.7527 0.8274 -0.0375 -0.0233 0.0855  163 ASN A CB  
1017 C CG  . ASN A 146 ? 0.3291 0.7734 0.8467 -0.0389 -0.0346 0.0950  163 ASN A CG  
1018 O OD1 . ASN A 146 ? 0.3419 0.7881 0.8633 -0.0358 -0.0406 0.1051  163 ASN A OD1 
1019 N ND2 . ASN A 146 ? 0.3267 0.7831 0.8532 -0.0433 -0.0371 0.0918  163 ASN A ND2 
1020 N N   . ILE A 147 ? 0.2650 0.6708 0.7488 -0.0331 -0.0084 0.0823  164 ILE A N   
1021 C CA  . ILE A 147 ? 0.2593 0.6603 0.7418 -0.0292 -0.0006 0.0742  164 ILE A CA  
1022 C C   . ILE A 147 ? 0.2477 0.6476 0.7510 -0.0220 -0.0010 0.0691  164 ILE A C   
1023 O O   . ILE A 147 ? 0.2469 0.6470 0.7664 -0.0205 -0.0049 0.0749  164 ILE A O   
1024 C CB  . ILE A 147 ? 0.2675 0.6675 0.7456 -0.0320 0.0041  0.0791  164 ILE A CB  
1025 C CG1 . ILE A 147 ? 0.2717 0.6718 0.7648 -0.0335 0.0008  0.0892  164 ILE A CG1 
1026 C CG2 . ILE A 147 ? 0.2837 0.6790 0.7337 -0.0374 0.0069  0.0823  164 ILE A CG2 
1027 C CD1 . ILE A 147 ? 0.2826 0.6799 0.7727 -0.0373 0.0080  0.0944  164 ILE A CD1 
1028 N N   . VAL A 148 ? 0.2088 0.6044 0.7079 -0.0164 0.0031  0.0583  165 VAL A N   
1029 C CA  . VAL A 148 ? 0.2030 0.5938 0.7159 -0.0091 0.0020  0.0519  165 VAL A CA  
1030 C C   . VAL A 148 ? 0.2024 0.5952 0.7153 -0.0065 0.0044  0.0451  165 VAL A C   
1031 O O   . VAL A 148 ? 0.2039 0.5942 0.7018 -0.0015 0.0080  0.0373  165 VAL A O   
1032 C CB  . VAL A 148 ? 0.2015 0.5833 0.7092 -0.0023 0.0034  0.0446  165 VAL A CB  
1033 C CG1 . VAL A 148 ? 0.2012 0.5731 0.7166 0.0063  0.0020  0.0373  165 VAL A CG1 
1034 C CG2 . VAL A 148 ? 0.2014 0.5866 0.7163 -0.0048 0.0015  0.0516  165 VAL A CG2 
1035 N N   . PRO A 149 ? 0.2026 0.6002 0.7327 -0.0098 0.0026  0.0481  166 PRO A N   
1036 C CA  . PRO A 149 ? 0.2022 0.6080 0.7400 -0.0091 0.0042  0.0425  166 PRO A CA  
1037 C C   . PRO A 149 ? 0.2004 0.6020 0.7397 0.0003  -0.0001 0.0300  166 PRO A C   
1038 O O   . PRO A 149 ? 0.2016 0.5916 0.7441 0.0038  -0.0049 0.0271  166 PRO A O   
1039 C CB  . PRO A 149 ? 0.2057 0.6149 0.7638 -0.0174 0.0034  0.0493  166 PRO A CB  
1040 C CG  . PRO A 149 ? 0.2101 0.6113 0.7646 -0.0210 0.0024  0.0601  166 PRO A CG  
1041 C CD  . PRO A 149 ? 0.2058 0.6007 0.7498 -0.0144 -0.0005 0.0570  166 PRO A CD  
1042 N N   . VAL A 150 ? 0.2461 0.6555 0.7808 0.0058  0.0017  0.0230  167 VAL A N   
1043 C CA  . VAL A 150 ? 0.2487 0.6532 0.7797 0.0171  -0.0036 0.0109  167 VAL A CA  
1044 C C   . VAL A 150 ? 0.2489 0.6721 0.7975 0.0187  -0.0068 0.0055  167 VAL A C   
1045 O O   . VAL A 150 ? 0.2475 0.6866 0.8018 0.0154  -0.0003 0.0098  167 VAL A O   
1046 C CB  . VAL A 150 ? 0.2537 0.6456 0.7546 0.0270  0.0016  0.0061  167 VAL A CB  
1047 C CG1 . VAL A 150 ? 0.2599 0.6559 0.7525 0.0393  0.0009  -0.0033 167 VAL A CG1 
1048 C CG2 . VAL A 150 ? 0.2571 0.6285 0.7471 0.0312  0.0005  0.0035  167 VAL A CG2 
1049 N N   . ILE A 151 ? 0.2079 0.6291 0.7653 0.0239  -0.0169 -0.0040 168 ILE A N   
1050 C CA  . ILE A 151 ? 0.2094 0.6516 0.7861 0.0265  -0.0228 -0.0110 168 ILE A CA  
1051 C C   . ILE A 151 ? 0.2151 0.6577 0.7712 0.0433  -0.0224 -0.0187 168 ILE A C   
1052 O O   . ILE A 151 ? 0.2247 0.6502 0.7626 0.0553  -0.0292 -0.0276 168 ILE A O   
1053 C CB  . ILE A 151 ? 0.2161 0.6556 0.8101 0.0238  -0.0365 -0.0189 168 ILE A CB  
1054 C CG1 . ILE A 151 ? 0.2153 0.6507 0.8271 0.0075  -0.0353 -0.0110 168 ILE A CG1 
1055 C CG2 . ILE A 151 ? 0.2185 0.6846 0.8358 0.0261  -0.0448 -0.0271 168 ILE A CG2 
1056 C CD1 . ILE A 151 ? 0.2271 0.6529 0.8509 0.0032  -0.0478 -0.0187 168 ILE A CD1 
1057 N N   . ALA A 152 ? 0.2524 0.7108 0.8074 0.0455  -0.0132 -0.0147 169 ALA A N   
1058 C CA  . ALA A 152 ? 0.2614 0.7185 0.7939 0.0628  -0.0105 -0.0206 169 ALA A CA  
1059 C C   . ALA A 152 ? 0.2679 0.7391 0.8144 0.0743  -0.0241 -0.0318 169 ALA A C   
1060 O O   . ALA A 152 ? 0.2627 0.7606 0.8459 0.0668  -0.0311 -0.0329 169 ALA A O   
1061 C CB  . ALA A 152 ? 0.2613 0.7319 0.7910 0.0627  0.0032  -0.0133 169 ALA A CB  
1062 N N   . LYS A 153 ? 0.2427 0.6954 0.7591 0.0923  -0.0278 -0.0402 170 LYS A N   
1063 C CA  . LYS A 153 ? 0.2543 0.7166 0.7763 0.1067  -0.0428 -0.0515 170 LYS A CA  
1064 C C   . LYS A 153 ? 0.2528 0.7219 0.8033 0.0962  -0.0592 -0.0569 170 LYS A C   
1065 O O   . LYS A 153 ? 0.2497 0.7508 0.8365 0.0916  -0.0687 -0.0600 170 LYS A O   
1066 C CB  . LYS A 153 ? 0.2540 0.7508 0.7948 0.1151  -0.0408 -0.0512 170 LYS A CB  
1067 C CG  . LYS A 153 ? 0.2623 0.7478 0.7693 0.1280  -0.0242 -0.0467 170 LYS A CG  
1068 C CD  . LYS A 153 ? 0.2627 0.7835 0.7912 0.1365  -0.0197 -0.0446 170 LYS A CD  
1069 C CE  . LYS A 153 ? 0.2791 0.7819 0.7660 0.1536  -0.0041 -0.0420 170 LYS A CE  
1070 N NZ  . LYS A 153 ? 0.2831 0.8193 0.7891 0.1659  0.0014  -0.0397 170 LYS A NZ  
1071 N N   . ALA A 154 ? 0.2574 0.6957 0.7914 0.0921  -0.0618 -0.0580 171 ALA A N   
1072 C CA  . ALA A 154 ? 0.2605 0.6965 0.8146 0.0811  -0.0752 -0.0623 171 ALA A CA  
1073 C C   . ALA A 154 ? 0.2795 0.7179 0.8340 0.0927  -0.0952 -0.0762 171 ALA A C   
1074 O O   . ALA A 154 ? 0.2863 0.7259 0.8593 0.0830  -0.1089 -0.0817 171 ALA A O   
1075 C CB  . ALA A 154 ? 0.2640 0.6639 0.7965 0.0770  -0.0705 -0.0591 171 ALA A CB  
1076 N N   . ASP A 155 ? 0.3201 0.7569 0.8514 0.1137  -0.0974 -0.0821 172 ASP A N   
1077 C CA  . ASP A 155 ? 0.3412 0.7827 0.8706 0.1278  -0.1182 -0.0953 172 ASP A CA  
1078 C C   . ASP A 155 ? 0.3325 0.8251 0.9117 0.1211  -0.1290 -0.0976 172 ASP A C   
1079 O O   . ASP A 155 ? 0.3482 0.8539 0.9387 0.1273  -0.1501 -0.1088 172 ASP A O   
1080 C CB  . ASP A 155 ? 0.3610 0.7819 0.8460 0.1547  -0.1158 -0.0998 172 ASP A CB  
1081 C CG  . ASP A 155 ? 0.3496 0.7869 0.8320 0.1611  -0.0983 -0.0917 172 ASP A CG  
1082 O OD1 . ASP A 155 ? 0.3285 0.7727 0.8237 0.1453  -0.0823 -0.0808 172 ASP A OD1 
1083 O OD2 . ASP A 155 ? 0.3654 0.8060 0.8298 0.1829  -0.1007 -0.0962 172 ASP A OD2 
1084 N N   . THR A 156 ? 0.4281 0.9493 1.0369 0.1084  -0.1144 -0.0870 173 THR A N   
1085 C CA  . THR A 156 ? 0.4110 0.9679 1.0528 0.0962  -0.1157 -0.0820 173 THR A CA  
1086 C C   . THR A 156 ? 0.4138 0.9756 1.0829 0.0751  -0.1293 -0.0863 173 THR A C   
1087 O O   . THR A 156 ? 0.4058 0.9931 1.0984 0.0701  -0.1411 -0.0901 173 THR A O   
1088 C CB  . THR A 156 ? 0.3984 0.9697 1.0500 0.0852  -0.0923 -0.0661 173 THR A CB  
1089 O OG1 . THR A 156 ? 0.4025 0.9668 1.0280 0.1040  -0.0795 -0.0635 173 THR A OG1 
1090 C CG2 . THR A 156 ? 0.3794 0.9881 1.0643 0.0754  -0.0913 -0.0605 173 THR A CG2 
1091 N N   . LEU A 157 ? 0.2822 0.8193 0.9489 0.0630  -0.1275 -0.0858 174 LEU A N   
1092 C CA  . LEU A 157 ? 0.2889 0.8251 0.9798 0.0414  -0.1369 -0.0888 174 LEU A CA  
1093 C C   . LEU A 157 ? 0.3063 0.8221 0.9903 0.0481  -0.1611 -0.1054 174 LEU A C   
1094 O O   . LEU A 157 ? 0.3192 0.8019 0.9587 0.0672  -0.1625 -0.1089 174 LEU A O   
1095 C CB  . LEU A 157 ? 0.2749 0.7949 0.9684 0.0244  -0.1202 -0.0771 174 LEU A CB  
1096 C CG  . LEU A 157 ? 0.2613 0.7963 0.9573 0.0174  -0.0975 -0.0613 174 LEU A CG  
1097 C CD1 . LEU A 157 ? 0.2511 0.7641 0.9409 0.0058  -0.0838 -0.0508 174 LEU A CD1 
1098 C CD2 . LEU A 157 ? 0.2686 0.8357 0.9936 0.0036  -0.0960 -0.0583 174 LEU A CD2 
1099 N N   . THR A 158 ? 0.3626 0.8837 1.0701 0.0307  -0.1753 -0.1120 175 THR A N   
1100 C CA  . THR A 158 ? 0.3911 0.8792 1.0771 0.0329  -0.1956 -0.1251 175 THR A CA  
1101 C C   . THR A 158 ? 0.3959 0.8367 1.0548 0.0246  -0.1835 -0.1181 175 THR A C   
1102 O O   . THR A 158 ? 0.3748 0.8154 1.0390 0.0166  -0.1628 -0.1044 175 THR A O   
1103 C CB  . THR A 158 ? 0.4074 0.9200 1.1318 0.0158  -0.2180 -0.1370 175 THR A CB  
1104 O OG1 . THR A 158 ? 0.4014 0.9167 1.1542 -0.0121 -0.2073 -0.1296 175 THR A OG1 
1105 C CG2 . THR A 158 ? 0.4116 0.9663 1.1518 0.0210  -0.2213 -0.1365 175 THR A CG2 
1106 N N   . LEU A 159 ? 0.7530 0.7528 0.9730 0.2636  -0.1698 0.1187  176 LEU A N   
1107 C CA  . LEU A 159 ? 0.7852 0.7437 0.9478 0.2563  -0.1566 0.1234  176 LEU A CA  
1108 C C   . LEU A 159 ? 0.7905 0.7748 0.9796 0.2239  -0.1564 0.1206  176 LEU A C   
1109 O O   . LEU A 159 ? 0.7890 0.7699 0.9648 0.2116  -0.1298 0.1243  176 LEU A O   
1110 C CB  . LEU A 159 ? 0.8426 0.7367 0.9306 0.2770  -0.1829 0.1260  176 LEU A CB  
1111 N N   . GLU A 160 ? 0.6668 0.6767 0.8945 0.2097  -0.1870 0.1149  177 GLU A N   
1112 C CA  . GLU A 160 ? 0.6763 0.7094 0.9324 0.1767  -0.1882 0.1136  177 GLU A CA  
1113 C C   . GLU A 160 ? 0.6155 0.7034 0.9256 0.1576  -0.1523 0.1148  177 GLU A C   
1114 O O   . GLU A 160 ? 0.6216 0.7093 0.9238 0.1378  -0.1341 0.1186  177 GLU A O   
1115 C CB  . GLU A 160 ? 0.6907 0.7433 0.9849 0.1640  -0.2292 0.1072  177 GLU A CB  
1116 N N   . GLU A 161 ? 0.8238 0.9559 1.1850 0.1655  -0.1427 0.1114  178 GLU A N   
1117 C CA  . GLU A 161 ? 0.7673 0.9516 1.1784 0.1503  -0.1088 0.1103  178 GLU A CA  
1118 C C   . GLU A 161 ? 0.7583 0.9230 1.1322 0.1528  -0.0732 0.1138  178 GLU A C   
1119 O O   . GLU A 161 ? 0.7331 0.9241 1.1240 0.1330  -0.0486 0.1145  178 GLU A O   
1120 C CB  . GLU A 161 ? 0.7200 0.9498 1.1892 0.1645  -0.1070 0.1045  178 GLU A CB  
1121 C CG  . GLU A 161 ? 0.7110 0.9803 1.2381 0.1571  -0.1389 0.1005  178 GLU A CG  
1122 C CD  . GLU A 161 ? 0.6679 0.9840 1.2549 0.1758  -0.1374 0.0949  178 GLU A CD  
1123 O OE1 . GLU A 161 ? 0.6610 0.9627 1.2307 0.1998  -0.1182 0.0941  178 GLU A OE1 
1124 O OE2 . GLU A 161 ? 0.6437 1.0111 1.2973 0.1667  -0.1554 0.0913  178 GLU A OE2 
1125 N N   . ARG A 162 ? 0.4798 0.5991 0.8034 0.1765  -0.0709 0.1165  179 ARG A N   
1126 C CA  . ARG A 162 ? 0.4647 0.5665 0.7573 0.1788  -0.0395 0.1198  179 ARG A CA  
1127 C C   . ARG A 162 ? 0.4606 0.5474 0.7242 0.1606  -0.0345 0.1248  179 ARG A C   
1128 O O   . ARG A 162 ? 0.4364 0.5364 0.7013 0.1490  -0.0092 0.1259  179 ARG A O   
1129 C CB  . ARG A 162 ? 0.4912 0.5455 0.7367 0.2066  -0.0386 0.1236  179 ARG A CB  
1130 N N   . VAL A 163 ? 0.7610 0.8173 0.9961 0.1593  -0.0607 0.1274  180 VAL A N   
1131 C CA  . VAL A 163 ? 0.7962 0.8315 1.0010 0.1450  -0.0597 0.1324  180 VAL A CA  
1132 C C   . VAL A 163 ? 0.7766 0.8533 1.0226 0.1153  -0.0515 0.1327  180 VAL A C   
1133 O O   . VAL A 163 ? 0.7725 0.8499 1.0060 0.1039  -0.0334 0.1374  180 VAL A O   
1134 C CB  . VAL A 163 ? 0.8670 0.8556 1.0310 0.1508  -0.0920 0.1329  180 VAL A CB  
1135 C CG1 . VAL A 163 ? 0.9119 0.8774 1.0477 0.1363  -0.0914 0.1377  180 VAL A CG1 
1136 C CG2 . VAL A 163 ? 0.8821 0.8243 0.9940 0.1815  -0.0965 0.1341  180 VAL A CG2 
1137 N N   . HIS A 164 ? 0.5867 0.6992 0.8827 0.1034  -0.0645 0.1286  181 HIS A N   
1138 C CA  . HIS A 164 ? 0.5604 0.7148 0.8987 0.0744  -0.0542 0.1302  181 HIS A CA  
1139 C C   . HIS A 164 ? 0.4979 0.6892 0.8571 0.0709  -0.0184 0.1289  181 HIS A C   
1140 O O   . HIS A 164 ? 0.4837 0.6905 0.8462 0.0506  -0.0017 0.1333  181 HIS A O   
1141 C CB  . HIS A 164 ? 0.5463 0.7368 0.9414 0.0636  -0.0749 0.1260  181 HIS A CB  
1142 C CG  . HIS A 164 ? 0.5119 0.7514 0.9570 0.0340  -0.0591 0.1287  181 HIS A CG  
1143 N ND1 . HIS A 164 ? 0.5459 0.7734 0.9808 0.0074  -0.0615 0.1365  181 HIS A ND1 
1144 C CD2 . HIS A 164 ? 0.4490 0.7474 0.9520 0.0277  -0.0385 0.1253  181 HIS A CD2 
1145 C CE1 . HIS A 164 ? 0.5017 0.7790 0.9853 -0.0156 -0.0422 0.1391  181 HIS A CE1 
1146 N NE2 . HIS A 164 ? 0.4437 0.7663 0.9697 -0.0032 -0.0273 0.1318  181 HIS A NE2 
1147 N N   . PHE A 165 ? 0.5846 0.7854 0.9536 0.0911  -0.0076 0.1228  182 PHE A N   
1148 C CA  . PHE A 165 ? 0.5359 0.7664 0.9218 0.0897  0.0244  0.1185  182 PHE A CA  
1149 C C   . PHE A 165 ? 0.5382 0.7440 0.8795 0.0881  0.0415  0.1224  182 PHE A C   
1150 O O   . PHE A 165 ? 0.5109 0.7383 0.8568 0.0736  0.0622  0.1221  182 PHE A O   
1151 C CB  . PHE A 165 ? 0.5132 0.7513 0.9176 0.1132  0.0294  0.1107  182 PHE A CB  
1152 C CG  . PHE A 165 ? 0.4712 0.7427 0.9009 0.1112  0.0599  0.1030  182 PHE A CG  
1153 C CD1 . PHE A 165 ? 0.4433 0.7593 0.9081 0.0911  0.0748  0.1011  182 PHE A CD1 
1154 C CD2 . PHE A 165 ? 0.4667 0.7218 0.8823 0.1291  0.0746  0.0976  182 PHE A CD2 
1155 C CE1 . PHE A 165 ? 0.4151 0.7578 0.8962 0.0911  0.1036  0.0924  182 PHE A CE1 
1156 C CE2 . PHE A 165 ? 0.4408 0.7206 0.8750 0.1275  0.1013  0.0882  182 PHE A CE2 
1157 C CZ  . PHE A 165 ? 0.4161 0.7395 0.8811 0.1097  0.1156  0.0848  182 PHE A CZ  
1158 N N   . LYS A 166 ? 0.7071 0.8690 1.0055 0.1037  0.0324  0.1262  183 LYS A N   
1159 C CA  . LYS A 166 ? 0.7066 0.8471 0.9673 0.1041  0.0457  0.1307  183 LYS A CA  
1160 C C   . LYS A 166 ? 0.7184 0.8605 0.9675 0.0837  0.0450  0.1376  183 LYS A C   
1161 O O   . LYS A 166 ? 0.6904 0.8421 0.9308 0.0757  0.0616  0.1390  183 LYS A O   
1162 C CB  . LYS A 166 ? 0.7405 0.8347 0.9596 0.1250  0.0357  0.1350  183 LYS A CB  
1163 C CG  . LYS A 166 ? 0.7218 0.8065 0.9390 0.1448  0.0463  0.1316  183 LYS A CG  
1164 C CD  . LYS A 166 ? 0.7477 0.7867 0.9188 0.1635  0.0429  0.1383  183 LYS A CD  
1165 C CE  . LYS A 166 ? 0.7300 0.7585 0.8969 0.1780  0.0609  0.1378  183 LYS A CE  
1166 N NZ  . LYS A 166 ? 0.7468 0.7345 0.8698 0.1942  0.0642  0.1462  183 LYS A NZ  
1167 N N   . GLN A 167 ? 0.6328 0.7626 0.8801 0.0755  0.0238  0.1420  184 GLN A N   
1168 C CA  . GLN A 167 ? 0.6545 0.7778 0.8885 0.0561  0.0209  0.1502  184 GLN A CA  
1169 C C   . GLN A 167 ? 0.6088 0.7745 0.8715 0.0345  0.0406  0.1506  184 GLN A C   
1170 O O   . GLN A 167 ? 0.6048 0.7672 0.8475 0.0226  0.0490  0.1577  184 GLN A O   
1171 C CB  . GLN A 167 ? 0.7183 0.8194 0.9506 0.0487  -0.0067 0.1529  184 GLN A CB  
1172 C CG  . GLN A 167 ? 0.7850 0.8325 0.9711 0.0686  -0.0263 0.1538  184 GLN A CG  
1173 C CD  . GLN A 167 ? 0.8607 0.8818 1.0416 0.0600  -0.0566 0.1539  184 GLN A CD  
1174 O OE1 . GLN A 167 ? 0.8560 0.9021 1.0741 0.0367  -0.0633 0.1543  184 GLN A OE1 
1175 N NE2 . GLN A 167 ? 0.9297 0.8994 1.0641 0.0782  -0.0746 0.1530  184 GLN A NE2 
1176 N N   . ARG A 168 ? 0.6522 0.8568 0.9595 0.0316  0.0482  0.1432  185 ARG A N   
1177 C CA  . ARG A 168 ? 0.6228 0.8695 0.9587 0.0127  0.0695  0.1426  185 ARG A CA  
1178 C C   . ARG A 168 ? 0.5907 0.8490 0.9131 0.0175  0.0945  0.1372  185 ARG A C   
1179 O O   . ARG A 168 ? 0.5853 0.8554 0.8965 0.0025  0.1095  0.1411  185 ARG A O   
1180 C CB  . ARG A 168 ? 0.6599 0.9474 1.0528 0.0105  0.0697  0.1358  185 ARG A CB  
1181 C CG  . ARG A 168 ? 0.6340 0.9664 1.0560 -0.0077 0.0959  0.1355  185 ARG A CG  
1182 C CD  . ARG A 168 ? 0.6546 0.9807 1.0630 -0.0340 0.0959  0.1489  185 ARG A CD  
1183 N NE  . ARG A 168 ? 0.6364 0.9997 1.0598 -0.0512 0.1251  0.1507  185 ARG A NE  
1184 C CZ  . ARG A 168 ? 0.6394 0.9954 1.0236 -0.0547 0.1434  0.1532  185 ARG A CZ  
1185 N NH1 . ARG A 168 ? 0.6523 0.9696 0.9886 -0.0438 0.1337  0.1550  185 ARG A NH1 
1186 N NH2 . ARG A 168 ? 0.6312 1.0181 1.0224 -0.0688 0.1707  0.1545  185 ARG A NH2 
1187 N N   . ILE A 169 ? 0.3549 0.6060 0.6749 0.0378  0.0977  0.1286  186 ILE A N   
1188 C CA  . ILE A 169 ? 0.3457 0.6025 0.6531 0.0420  0.1179  0.1215  186 ILE A CA  
1189 C C   . ILE A 169 ? 0.3515 0.5884 0.6183 0.0362  0.1173  0.1294  186 ILE A C   
1190 O O   . ILE A 169 ? 0.3525 0.6031 0.6086 0.0271  0.1318  0.1271  186 ILE A O   
1191 C CB  . ILE A 169 ? 0.3393 0.5819 0.6482 0.0639  0.1188  0.1132  186 ILE A CB  
1192 C CG1 . ILE A 169 ? 0.3376 0.5996 0.6864 0.0734  0.1181  0.1056  186 ILE A CG1 
1193 C CG2 . ILE A 169 ? 0.3345 0.5793 0.6307 0.0646  0.1374  0.1053  186 ILE A CG2 
1194 C CD1 . ILE A 169 ? 0.3339 0.6378 0.7146 0.0637  0.1382  0.0974  186 ILE A CD1 
1195 N N   . THR A 170 ? 0.3423 0.5461 0.5854 0.0434  0.0997  0.1380  187 THR A N   
1196 C CA  . THR A 170 ? 0.3509 0.5350 0.5586 0.0418  0.0965  0.1468  187 THR A CA  
1197 C C   . THR A 170 ? 0.3637 0.5590 0.5625 0.0214  0.1004  0.1544  187 THR A C   
1198 O O   . THR A 170 ? 0.3675 0.5661 0.5454 0.0177  0.1073  0.1566  187 THR A O   
1199 C CB  . THR A 170 ? 0.3655 0.5105 0.5497 0.0537  0.0770  0.1548  187 THR A CB  
1200 O OG1 . THR A 170 ? 0.3607 0.4920 0.5467 0.0734  0.0750  0.1495  187 THR A OG1 
1201 C CG2 . THR A 170 ? 0.3756 0.5025 0.5268 0.0564  0.0751  0.1635  187 THR A CG2 
1202 N N   . ALA A 171 ? 0.3843 0.5853 0.5992 0.0078  0.0954  0.1591  188 ALA A N   
1203 C CA  . ALA A 171 ? 0.4034 0.6116 0.6097 -0.0136 0.1010  0.1690  188 ALA A CA  
1204 C C   . ALA A 171 ? 0.3999 0.6420 0.6110 -0.0223 0.1249  0.1630  188 ALA A C   
1205 O O   . ALA A 171 ? 0.4188 0.6595 0.6028 -0.0333 0.1313  0.1710  188 ALA A O   
1206 C CB  . ALA A 171 ? 0.4159 0.6274 0.6477 -0.0286 0.0927  0.1742  188 ALA A CB  
1207 N N   . ASP A 172 ? 0.7739 1.0432 1.0154 -0.0160 0.1377  0.1489  189 ASP A N   
1208 C CA  . ASP A 172 ? 0.7607 1.0586 1.0034 -0.0216 0.1616  0.1399  189 ASP A CA  
1209 C C   . ASP A 172 ? 0.7529 1.0412 0.9607 -0.0160 0.1644  0.1352  189 ASP A C   
1210 O O   . ASP A 172 ? 0.7654 1.0632 0.9503 -0.0261 0.1762  0.1355  189 ASP A O   
1211 C CB  . ASP A 172 ? 0.7436 1.0678 1.0268 -0.0121 0.1737  0.1243  189 ASP A CB  
1212 C CG  . ASP A 172 ? 0.7490 1.1040 1.0735 -0.0228 0.1815  0.1262  189 ASP A CG  
1213 O OD1 . ASP A 172 ? 0.7696 1.1332 1.0893 -0.0423 0.1880  0.1374  189 ASP A OD1 
1214 O OD2 . ASP A 172 ? 0.7353 1.1066 1.0990 -0.0113 0.1812  0.1171  189 ASP A OD2 
1215 N N   . LEU A 173 ? 0.4395 0.7102 0.6441 -0.0002 0.1539  0.1309  190 LEU A N   
1216 C CA  . LEU A 173 ? 0.4406 0.7056 0.6211 0.0043  0.1541  0.1262  190 LEU A CA  
1217 C C   . LEU A 173 ? 0.4607 0.7145 0.6061 -0.0036 0.1451  0.1404  190 LEU A C   
1218 O O   . LEU A 173 ? 0.4751 0.7359 0.5971 -0.0086 0.1487  0.1380  190 LEU A O   
1219 C CB  . LEU A 173 ? 0.4235 0.6711 0.6113 0.0211  0.1454  0.1231  190 LEU A CB  
1220 C CG  . LEU A 173 ? 0.4107 0.6637 0.6286 0.0305  0.1536  0.1107  190 LEU A CG  
1221 C CD1 . LEU A 173 ? 0.4013 0.6320 0.6206 0.0467  0.1467  0.1108  190 LEU A CD1 
1222 C CD2 . LEU A 173 ? 0.4155 0.6884 0.6403 0.0262  0.1720  0.0944  190 LEU A CD2 
1223 N N   . LEU A 174 ? 0.4994 0.7324 0.6390 -0.0035 0.1313  0.1549  191 LEU A N   
1224 C CA  . LEU A 174 ? 0.5173 0.7328 0.6227 -0.0087 0.1214  0.1703  191 LEU A CA  
1225 C C   . LEU A 174 ? 0.5407 0.7671 0.6298 -0.0277 0.1328  0.1770  191 LEU A C   
1226 O O   . LEU A 174 ? 0.5545 0.7786 0.6101 -0.0311 0.1321  0.1825  191 LEU A O   
1227 C CB  . LEU A 174 ? 0.5296 0.7135 0.6312 -0.0034 0.1044  0.1824  191 LEU A CB  
1228 C CG  . LEU A 174 ? 0.5166 0.6830 0.6209 0.0176  0.0938  0.1794  191 LEU A CG  
1229 C CD1 . LEU A 174 ? 0.5435 0.6741 0.6377 0.0235  0.0774  0.1891  191 LEU A CD1 
1230 C CD2 . LEU A 174 ? 0.5003 0.6686 0.5875 0.0276  0.0917  0.1799  191 LEU A CD2 
1231 N N   . SER A 175 ? 0.4421 0.6815 0.5552 -0.0397 0.1433  0.1773  192 SER A N   
1232 C CA  . SER A 175 ? 0.4724 0.7225 0.5727 -0.0592 0.1583  0.1859  192 SER A CA  
1233 C C   . SER A 175 ? 0.4816 0.7566 0.5686 -0.0616 0.1783  0.1740  192 SER A C   
1234 O O   . SER A 175 ? 0.5169 0.7921 0.5704 -0.0732 0.1880  0.1824  192 SER A O   
1235 C CB  . SER A 175 ? 0.4705 0.7346 0.6099 -0.0722 0.1656  0.1888  192 SER A CB  
1236 O OG  . SER A 175 ? 0.4409 0.7328 0.6227 -0.0637 0.1743  0.1716  192 SER A OG  
1237 N N   . ASN A 176 ? 0.8312 0.9193 1.0991 -0.1136 -0.0187 0.1162  193 ASN A N   
1238 C CA  . ASN A 176 ? 0.8087 0.9072 1.0511 -0.1311 -0.0455 0.1337  193 ASN A CA  
1239 C C   . ASN A 176 ? 0.8092 0.9327 1.0976 -0.1236 -0.0642 0.1616  193 ASN A C   
1240 O O   . ASN A 176 ? 0.7876 0.9231 1.0619 -0.1364 -0.0873 0.1785  193 ASN A O   
1241 C CB  . ASN A 176 ? 0.7508 0.8660 0.9507 -0.1442 -0.0404 0.1133  193 ASN A CB  
1242 C CG  . ASN A 176 ? 0.7446 0.8340 0.8865 -0.1587 -0.0326 0.0923  193 ASN A CG  
1243 O OD1 . ASN A 176 ? 0.7451 0.8175 0.8513 -0.1752 -0.0506 0.1024  193 ASN A OD1 
1244 N ND2 . ASN A 176 ? 0.7256 0.8122 0.8577 -0.1529 -0.0055 0.0628  193 ASN A ND2 
1245 N N   . GLY A 177 ? 0.4678 0.5996 0.8112 -0.1027 -0.0541 0.1661  194 GLY A N   
1246 C CA  . GLY A 177 ? 0.4683 0.6239 0.8600 -0.0934 -0.0700 0.1919  194 GLY A CA  
1247 C C   . GLY A 177 ? 0.4375 0.6312 0.8325 -0.0971 -0.0745 0.1914  194 GLY A C   
1248 O O   . GLY A 177 ? 0.4364 0.6497 0.8533 -0.0981 -0.0951 0.2150  194 GLY A O   
1249 N N   . ILE A 178 ? 0.4103 0.6143 0.7829 -0.0993 -0.0550 0.1642  195 ILE A N   
1250 C CA  . ILE A 178 ? 0.3806 0.6197 0.7541 -0.1026 -0.0566 0.1608  195 ILE A CA  
1251 C C   . ILE A 178 ? 0.3704 0.6366 0.8038 -0.0821 -0.0453 0.1627  195 ILE A C   
1252 O O   . ILE A 178 ? 0.3625 0.6298 0.8109 -0.0692 -0.0197 0.1415  195 ILE A O   
1253 C CB  . ILE A 178 ? 0.3582 0.5980 0.6839 -0.1125 -0.0401 0.1304  195 ILE A CB  
1254 C CG1 . ILE A 178 ? 0.3677 0.5819 0.6330 -0.1330 -0.0511 0.1275  195 ILE A CG1 
1255 C CG2 . ILE A 178 ? 0.3287 0.6041 0.6553 -0.1157 -0.0422 0.1274  195 ILE A CG2 
1256 C CD1 . ILE A 178 ? 0.3489 0.5599 0.5655 -0.1421 -0.0340 0.0963  195 ILE A CD1 
1257 N N   . ASP A 179 ? 1.0648 1.3532 1.5323 -0.0793 -0.0645 0.1881  196 ASP A N   
1258 C CA  . ASP A 179 ? 1.0508 1.3668 1.5770 -0.0604 -0.0564 0.1926  196 ASP A CA  
1259 C C   . ASP A 179 ? 0.9850 1.3333 1.5075 -0.0623 -0.0469 0.1778  196 ASP A C   
1260 O O   . ASP A 179 ? 0.9538 1.3216 1.4629 -0.0745 -0.0641 0.1885  196 ASP A O   
1261 C CB  . ASP A 179 ? 1.0694 1.3966 1.6346 -0.0563 -0.0809 0.2259  196 ASP A CB  
1262 C CG  . ASP A 179 ? 1.1465 1.4423 1.7213 -0.0517 -0.0894 0.2411  196 ASP A CG  
1263 O OD1 . ASP A 179 ? 1.1885 1.4563 1.7503 -0.0477 -0.0728 0.2251  196 ASP A OD1 
1264 O OD2 . ASP A 179 ? 1.1695 1.4682 1.7642 -0.0523 -0.1127 0.2689  196 ASP A OD2 
1265 N N   . VAL A 180 ? 0.4356 0.7890 0.9699 -0.0504 -0.0194 0.1533  197 VAL A N   
1266 C CA  . VAL A 180 ? 0.3790 0.7615 0.9109 -0.0507 -0.0075 0.1371  197 VAL A CA  
1267 C C   . VAL A 180 ? 0.3597 0.7718 0.9538 -0.0320 -0.0002 0.1433  197 VAL A C   
1268 O O   . VAL A 180 ? 0.3842 0.7905 1.0214 -0.0160 0.0034  0.1523  197 VAL A O   
1269 C CB  . VAL A 180 ? 0.3678 0.7380 0.8662 -0.0513 0.0191  0.1030  197 VAL A CB  
1270 C CG1 . VAL A 180 ? 0.3884 0.7301 0.8248 -0.0698 0.0124  0.0957  197 VAL A CG1 
1271 C CG2 . VAL A 180 ? 0.3829 0.7409 0.9152 -0.0316 0.0428  0.0907  197 VAL A CG2 
1272 N N   . TYR A 181 ? 0.2221 0.6504 0.7988 -0.0329 0.0017  0.1331  198 TYR A N   
1273 C CA  . TYR A 181 ? 0.2273 0.6678 0.8341 -0.0159 0.0096  0.1304  198 TYR A CA  
1274 C C   . TYR A 181 ? 0.2251 0.6590 0.8410 -0.0011 0.0383  0.1045  198 TYR A C   
1275 O O   . TYR A 181 ? 0.2126 0.6379 0.7916 -0.0062 0.0536  0.0797  198 TYR A O   
1276 C CB  . TYR A 181 ? 0.2193 0.6716 0.7954 -0.0224 0.0033  0.1238  198 TYR A CB  
1277 C CG  . TYR A 181 ? 0.2250 0.6905 0.8287 -0.0074 0.0109  0.1201  198 TYR A CG  
1278 C CD1 . TYR A 181 ? 0.2408 0.7159 0.8789 -0.0016 -0.0040 0.1444  198 TYR A CD1 
1279 C CD2 . TYR A 181 ? 0.2165 0.6840 0.8086 0.0001  0.0323  0.0921  198 TYR A CD2 
1280 C CE1 . TYR A 181 ? 0.2471 0.7346 0.9090 0.0109  0.0029  0.1406  198 TYR A CE1 
1281 C CE2 . TYR A 181 ? 0.2234 0.7028 0.8372 0.0123  0.0378  0.0889  198 TYR A CE2 
1282 C CZ  . TYR A 181 ? 0.2382 0.7280 0.8880 0.0175  0.0236  0.1130  198 TYR A CZ  
1283 O OH  . TYR A 181 ? 0.2455 0.7479 0.9162 0.0287  0.0292  0.1094  198 TYR A OH  
1284 N N   . PRO A 182 ? 0.2402 0.6754 0.8998 0.0172  0.0450  0.1096  199 PRO A N   
1285 C CA  . PRO A 182 ? 0.2572 0.7011 0.9597 0.0240  0.0274  0.1382  199 PRO A CA  
1286 C C   . PRO A 182 ? 0.2705 0.7023 1.0058 0.0266  0.0183  0.1594  199 PRO A C   
1287 O O   . PRO A 182 ? 0.2763 0.6933 1.0294 0.0373  0.0348  0.1503  199 PRO A O   
1288 C CB  . PRO A 182 ? 0.2672 0.7162 0.9943 0.0421  0.0420  0.1281  199 PRO A CB  
1289 C CG  . PRO A 182 ? 0.2612 0.6966 0.9657 0.0473  0.0674  0.0977  199 PRO A CG  
1290 C CD  . PRO A 182 ? 0.2449 0.6701 0.9092 0.0323  0.0698  0.0866  199 PRO A CD  
1291 N N   . GLN A 183 ? 0.3238 0.7594 1.0627 0.0167  -0.0083 0.1867  200 GLN A N   
1292 C CA  . GLN A 183 ? 0.3388 0.7623 1.1048 0.0176  -0.0221 0.2093  200 GLN A CA  
1293 C C   . GLN A 183 ? 0.3584 0.7779 1.1777 0.0404  -0.0144 0.2159  200 GLN A C   
1294 O O   . GLN A 183 ? 0.3681 0.7985 1.2053 0.0501  -0.0150 0.2196  200 GLN A O   
1295 C CB  . GLN A 183 ? 0.3471 0.7742 1.1017 0.0033  -0.0543 0.2373  200 GLN A CB  
1296 C CG  . GLN A 183 ? 0.3326 0.7597 1.0282 -0.0199 -0.0644 0.2318  200 GLN A CG  
1297 C CD  . GLN A 183 ? 0.3223 0.7630 0.9901 -0.0224 -0.0601 0.2188  200 GLN A CD  
1298 O OE1 . GLN A 183 ? 0.3236 0.7754 1.0153 -0.0082 -0.0480 0.2115  200 GLN A OE1 
1299 N NE2 . GLN A 183 ? 0.3138 0.7515 0.9284 -0.0407 -0.0703 0.2150  200 GLN A NE2 
1300 N N   . LYS A 184 ? 0.3319 0.7198 1.1498 0.0464  -0.0063 0.2116  201 LYS A N   
1301 C CA  . LYS A 184 ? 0.3502 0.7321 1.2186 0.0686  0.0027  0.2163  201 LYS A CA  
1302 C C   . LYS A 184 ? 0.3670 0.7599 1.2771 0.0756  -0.0208 0.2480  201 LYS A C   
1303 O O   . LYS A 184 ? 0.3825 0.7775 1.3277 0.0928  -0.0144 0.2502  201 LYS A O   
1304 C CB  . LYS A 184 ? 0.3735 0.7126 1.2200 0.0704  0.0130  0.2061  201 LYS A CB  
1305 N N   . GLU A 185 ? 0.9701 1.3591 1.8563 0.0596  -0.0473 0.2683  202 GLU A N   
1306 C CA  . GLU A 185 ? 0.9855 1.3831 1.9067 0.0645  -0.0716 0.2993  202 GLU A CA  
1307 C C   . GLU A 185 ? 0.9484 1.3679 1.8736 0.0664  -0.0726 0.2997  202 GLU A C   
1308 O O   . GLU A 185 ? 0.9661 1.3882 1.9090 0.0694  -0.0888 0.3199  202 GLU A O   
1309 C CB  . GLU A 185 ? 1.0187 1.3991 1.8994 0.0443  -0.0985 0.3175  202 GLU A CB  
1310 C CG  . GLU A 185 ? 0.9794 1.3738 1.8152 0.0228  -0.1060 0.3121  202 GLU A CG  
1311 C CD  . GLU A 185 ? 0.9984 1.3676 1.7771 0.0098  -0.0919 0.2871  202 GLU A CD  
1312 O OE1 . GLU A 185 ? 1.0276 1.3751 1.8060 0.0193  -0.0709 0.2694  202 GLU A OE1 
1313 O OE2 . GLU A 185 ? 0.9814 1.3526 1.7150 -0.0099 -0.1019 0.2852  202 GLU A OE2 
1314 N N   . PHE A 186 ? 0.3748 0.8083 1.2810 0.0645  -0.0553 0.2766  203 PHE A N   
1315 C CA  . PHE A 186 ? 0.3749 0.8285 1.2805 0.0655  -0.0560 0.2750  203 PHE A CA  
1316 C C   . PHE A 186 ? 0.3766 0.8364 1.3024 0.0823  -0.0323 0.2551  203 PHE A C   
1317 O O   . PHE A 186 ? 0.3730 0.8501 1.2945 0.0829  -0.0292 0.2483  203 PHE A O   
1318 C CB  . PHE A 186 ? 0.3533 0.8175 1.2121 0.0474  -0.0599 0.2660  203 PHE A CB  
1319 C CG  . PHE A 186 ? 0.3546 0.8122 1.1857 0.0290  -0.0844 0.2848  203 PHE A CG  
1320 C CD1 . PHE A 186 ? 0.3776 0.8285 1.2262 0.0287  -0.1061 0.3121  203 PHE A CD1 
1321 C CD2 . PHE A 186 ? 0.3351 0.7912 1.1182 0.0116  -0.0859 0.2741  203 PHE A CD2 
1322 C CE1 . PHE A 186 ? 0.3820 0.8235 1.1991 0.0110  -0.1286 0.3282  203 PHE A CE1 
1323 C CE2 . PHE A 186 ? 0.3394 0.7864 1.0908 -0.0060 -0.1085 0.2902  203 PHE A CE2 
1324 C CZ  . PHE A 186 ? 0.3631 0.8023 1.1310 -0.0065 -0.1297 0.3171  203 PHE A CZ  
1325 N N   . ASP A 187 ? 0.5613 1.0057 1.5065 0.0955  -0.0159 0.2454  204 ASP A N   
1326 C CA  . ASP A 187 ? 0.5658 1.0124 1.5265 0.1111  0.0057  0.2267  204 ASP A CA  
1327 C C   . ASP A 187 ? 0.5907 1.0431 1.5914 0.1245  -0.0017 0.2427  204 ASP A C   
1328 O O   . ASP A 187 ? 0.6094 1.0494 1.6357 0.1306  -0.0123 0.2612  204 ASP A O   
1329 C CB  . ASP A 187 ? 0.5691 0.9936 1.5294 0.1193  0.0268  0.2086  204 ASP A CB  
1330 C CG  . ASP A 187 ? 0.5448 0.9644 1.4634 0.1068  0.0376  0.1883  204 ASP A CG  
1331 O OD1 . ASP A 187 ? 0.5257 0.9607 1.4142 0.0950  0.0349  0.1809  204 ASP A OD1 
1332 O OD2 . ASP A 187 ? 0.5451 0.9445 1.4596 0.1087  0.0491  0.1790  204 ASP A OD2 
1333 N N   . GLU A 188 ? 0.4134 0.8844 1.4181 0.1289  0.0037  0.2349  205 GLU A N   
1334 C CA  . GLU A 188 ? 0.4361 0.9169 1.4769 0.1403  -0.0035 0.2489  205 GLU A CA  
1335 C C   . GLU A 188 ? 0.4553 0.9241 1.5240 0.1588  0.0118  0.2410  205 GLU A C   
1336 O O   . GLU A 188 ? 0.4757 0.9301 1.5697 0.1668  0.0051  0.2558  205 GLU A O   
1337 C CB  . GLU A 188 ? 0.4293 0.9355 1.4637 0.1376  -0.0040 0.2434  205 GLU A CB  
1338 N N   . ASP A 189 ? 0.5066 0.9801 1.5675 0.1651  0.0317  0.2174  206 ASP A N   
1339 C CA  . ASP A 189 ? 0.5255 0.9881 1.6080 0.1817  0.0467  0.2080  206 ASP A CA  
1340 C C   . ASP A 189 ? 0.5156 0.9616 1.5714 0.1823  0.0689  0.1814  206 ASP A C   
1341 O O   . ASP A 189 ? 0.4952 0.9353 1.5186 0.1705  0.0720  0.1720  206 ASP A O   
1342 C CB  . ASP A 189 ? 0.5361 1.0198 1.6377 0.1908  0.0486  0.2059  206 ASP A CB  
1343 C CG  . ASP A 189 ? 0.5157 1.0197 1.5900 0.1822  0.0534  0.1907  206 ASP A CG  
1344 O OD1 . ASP A 189 ? 0.5050 1.0040 1.5537 0.1818  0.0706  0.1669  206 ASP A OD1 
1345 O OD2 . ASP A 189 ? 0.5116 1.0355 1.5884 0.1757  0.0394  0.2024  206 ASP A OD2 
1346 N N   . SER A 190 ? 0.5494 0.9301 1.0822 0.3843  0.0109  0.1067  207 SER A N   
1347 C CA  . SER A 190 ? 0.5507 0.9022 1.0394 0.3731  0.0372  0.1149  207 SER A CA  
1348 C C   . SER A 190 ? 0.5078 0.9023 1.0388 0.3492  0.0580  0.1258  207 SER A C   
1349 O O   . SER A 190 ? 0.5030 0.8715 0.9976 0.3314  0.0679  0.1265  207 SER A O   
1350 C CB  . SER A 190 ? 0.5875 0.9265 1.0464 0.4026  0.0500  0.1119  207 SER A CB  
1351 O OG  . SER A 190 ? 0.5800 0.9715 1.0898 0.4058  0.0580  0.1112  207 SER A OG  
1352 N N   . GLU A 191 ? 0.4948 0.9365 1.0843 0.3395  0.0625  0.1238  208 GLU A N   
1353 C CA  . GLU A 191 ? 0.4750 0.9400 1.0878 0.3175  0.0880  0.1343  208 GLU A CA  
1354 C C   . GLU A 191 ? 0.4406 0.9072 1.0705 0.2870  0.0789  0.1373  208 GLU A C   
1355 O O   . GLU A 191 ? 0.4278 0.8920 1.0463 0.2713  0.0967  0.1482  208 GLU A O   
1356 C CB  . GLU A 191 ? 0.4836 0.9883 1.1546 0.3181  0.1045  0.1313  208 GLU A CB  
1357 N N   . ASP A 192 ? 0.7905 1.2590 1.4418 0.2828  0.0493  0.1259  209 ASP A N   
1358 C CA  . ASP A 192 ? 0.7647 1.2300 1.4264 0.2553  0.0359  0.1264  209 ASP A CA  
1359 C C   . ASP A 192 ? 0.7593 1.1815 1.3678 0.2521  0.0337  0.1364  209 ASP A C   
1360 O O   . ASP A 192 ? 0.7367 1.1550 1.3452 0.2257  0.0360  0.1419  209 ASP A O   
1361 C CB  . ASP A 192 ? 0.7695 1.2475 1.4607 0.2607  0.0016  0.1069  209 ASP A CB  
1362 C CG  . ASP A 192 ? 0.7493 1.2220 1.4461 0.2338  -0.0139 0.1054  209 ASP A CG  
1363 O OD1 . ASP A 192 ? 0.7254 1.2054 1.4345 0.2034  0.0054  0.1147  209 ASP A OD1 
1364 O OD2 . ASP A 192 ? 0.7648 1.2208 1.4459 0.2471  -0.0452 0.0953  209 ASP A OD2 
1365 N N   . ARG A 193 ? 0.5763 0.9502 1.1219 0.2712  0.0296  0.1294  210 ARG A N   
1366 C CA  . ARG A 193 ? 0.6091 0.9176 1.0854 0.2579  0.0298  0.1232  210 ARG A CA  
1367 C C   . ARG A 193 ? 0.6134 0.9206 1.0721 0.2465  0.0501  0.1218  210 ARG A C   
1368 O O   . ARG A 193 ? 0.6279 0.9075 1.0641 0.2235  0.0494  0.1150  210 ARG A O   
1369 C CB  . ARG A 193 ? 0.6744 0.9253 1.0934 0.2829  0.0272  0.1142  210 ARG A CB  
1370 C CG  . ARG A 193 ? 0.7330 0.9078 1.0938 0.2683  0.0324  0.1058  210 ARG A CG  
1371 C CD  . ARG A 193 ? 0.8026 0.9150 1.1096 0.2940  0.0431  0.0980  210 ARG A CD  
1372 N NE  . ARG A 193 ? 0.8114 0.9417 1.1215 0.3072  0.0574  0.0912  210 ARG A NE  
1373 C CZ  . ARG A 193 ? 0.8287 0.9501 1.1330 0.2940  0.0719  0.0766  210 ARG A CZ  
1374 N NH1 . ARG A 193 ? 0.8354 0.9323 1.1368 0.2646  0.0748  0.0661  210 ARG A NH1 
1375 N NH2 . ARG A 193 ? 0.8401 0.9789 1.1432 0.3131  0.0813  0.0687  210 ARG A NH2 
1376 N N   . LEU A 194 ? 0.4538 0.7905 0.9213 0.2669  0.0671  0.1255  211 LEU A N   
1377 C CA  . LEU A 194 ? 0.4594 0.7947 0.8998 0.2698  0.0829  0.1202  211 LEU A CA  
1378 C C   . LEU A 194 ? 0.4278 0.7862 0.8864 0.2492  0.0883  0.1295  211 LEU A C   
1379 O O   . LEU A 194 ? 0.4291 0.7674 0.8557 0.2400  0.0865  0.1163  211 LEU A O   
1380 C CB  . LEU A 194 ? 0.4810 0.8433 0.9234 0.3029  0.1019  0.1261  211 LEU A CB  
1381 C CG  . LEU A 194 ? 0.5201 0.8530 0.9272 0.3271  0.1001  0.1115  211 LEU A CG  
1382 C CD1 . LEU A 194 ? 0.5393 0.9041 0.9519 0.3603  0.1199  0.1203  211 LEU A CD1 
1383 C CD2 . LEU A 194 ? 0.5407 0.8253 0.9003 0.3216  0.0954  0.0845  211 LEU A CD2 
1384 N N   . VAL A 195 ? 0.6855 1.0866 1.2010 0.2432  0.0957  0.1489  212 VAL A N   
1385 C CA  . VAL A 195 ? 0.6536 1.0749 1.1909 0.2246  0.1061  0.1612  212 VAL A CA  
1386 C C   . VAL A 195 ? 0.6369 1.0327 1.1648 0.1919  0.0826  0.1522  212 VAL A C   
1387 O O   . VAL A 195 ? 0.6294 1.0209 1.1427 0.1774  0.0853  0.1523  212 VAL A O   
1388 C CB  . VAL A 195 ? 0.6500 1.0988 1.2379 0.2131  0.1189  0.1715  212 VAL A CB  
1389 C CG1 . VAL A 195 ? 0.6247 1.0764 1.2355 0.1800  0.1160  0.1756  212 VAL A CG1 
1390 C CG2 . VAL A 195 ? 0.6859 1.1424 1.2631 0.2357  0.1533  0.1829  212 VAL A CG2 
1391 N N   . ASN A 196 ? 0.3851 0.7596 0.9140 0.1851  0.0605  0.1441  213 ASN A N   
1392 C CA  . ASN A 196 ? 0.3726 0.7141 0.8856 0.1584  0.0417  0.1369  213 ASN A CA  
1393 C C   . ASN A 196 ? 0.3927 0.6828 0.8493 0.1516  0.0424  0.1177  213 ASN A C   
1394 O O   . ASN A 196 ? 0.3773 0.6495 0.8253 0.1269  0.0369  0.1114  213 ASN A O   
1395 C CB  . ASN A 196 ? 0.3838 0.7100 0.9028 0.1640  0.0207  0.1344  213 ASN A CB  
1396 C CG  . ASN A 196 ? 0.3537 0.7323 0.9439 0.1601  0.0100  0.1420  213 ASN A CG  
1397 O OD1 . ASN A 196 ? 0.3340 0.7486 0.9600 0.1475  0.0252  0.1478  213 ASN A OD1 
1398 N ND2 . ASN A 196 ? 0.3668 0.7359 0.9605 0.1706  -0.0155 0.1344  213 ASN A ND2 
1399 N N   . GLU A 197 ? 0.6891 0.9570 1.1153 0.1733  0.0496  0.1050  214 GLU A N   
1400 C CA  . GLU A 197 ? 0.7472 0.9718 1.1375 0.1687  0.0529  0.0781  214 GLU A CA  
1401 C C   . GLU A 197 ? 0.7381 0.9859 1.1260 0.1653  0.0552  0.0676  214 GLU A C   
1402 O O   . GLU A 197 ? 0.7608 0.9843 1.1398 0.1471  0.0500  0.0450  214 GLU A O   
1403 C CB  . GLU A 197 ? 0.7983 1.0009 1.1656 0.1956  0.0613  0.0643  214 GLU A CB  
1404 C CG  . GLU A 197 ? 0.8340 0.9896 1.1845 0.2019  0.0612  0.0669  214 GLU A CG  
1405 C CD  . GLU A 197 ? 0.8711 0.9639 1.2032 0.1784  0.0637  0.0559  214 GLU A CD  
1406 O OE1 . GLU A 197 ? 0.8866 0.9620 1.2205 0.1601  0.0696  0.0319  214 GLU A OE1 
1407 O OE2 . GLU A 197 ? 0.8837 0.9430 1.1992 0.1819  0.0604  0.0689  214 GLU A OE2 
1408 N N   . LYS A 198 ? 0.6529 0.9449 1.0476 0.1866  0.0651  0.0831  215 LYS A N   
1409 C CA  . LYS A 198 ? 0.6524 0.9629 1.0303 0.1963  0.0694  0.0769  215 LYS A CA  
1410 C C   . LYS A 198 ? 0.6145 0.9294 1.0067 0.1659  0.0627  0.0837  215 LYS A C   
1411 O O   . LYS A 198 ? 0.6278 0.9425 0.9991 0.1678  0.0583  0.0673  215 LYS A O   
1412 C CB  . LYS A 198 ? 0.6367 0.9835 1.0136 0.2299  0.0912  0.1006  215 LYS A CB  
1413 C CG  . LYS A 198 ? 0.6588 1.0126 0.9929 0.2599  0.0982  0.0911  215 LYS A CG  
1414 C CD  . LYS A 198 ? 0.6706 1.0412 0.9843 0.3056  0.1230  0.1070  215 LYS A CD  
1415 C CE  . LYS A 198 ? 0.6413 1.0390 1.0029 0.3014  0.1522  0.1492  215 LYS A CE  
1416 N NZ  . LYS A 198 ? 0.6878 1.0903 1.0270 0.3405  0.1808  0.1637  215 LYS A NZ  
1417 N N   . PHE A 199 ? 0.5500 0.8702 0.9775 0.1414  0.0591  0.1046  216 PHE A N   
1418 C CA  . PHE A 199 ? 0.5067 0.8293 0.9510 0.1104  0.0511  0.1110  216 PHE A CA  
1419 C C   . PHE A 199 ? 0.5361 0.8136 0.9633 0.0859  0.0358  0.0856  216 PHE A C   
1420 O O   . PHE A 199 ? 0.5319 0.8048 0.9531 0.0697  0.0300  0.0733  216 PHE A O   
1421 C CB  . PHE A 199 ? 0.4442 0.7913 0.9384 0.0970  0.0501  0.1364  216 PHE A CB  
1422 C CG  . PHE A 199 ? 0.4005 0.7612 0.9198 0.0697  0.0463  0.1468  216 PHE A CG  
1423 C CD1 . PHE A 199 ? 0.3905 0.7217 0.9006 0.0419  0.0275  0.1361  216 PHE A CD1 
1424 C CD2 . PHE A 199 ? 0.3813 0.7691 0.9199 0.0708  0.0648  0.1644  216 PHE A CD2 
1425 C CE1 . PHE A 199 ? 0.3505 0.6874 0.8728 0.0168  0.0226  0.1427  216 PHE A CE1 
1426 C CE2 . PHE A 199 ? 0.3684 0.7442 0.9020 0.0439  0.0603  0.1658  216 PHE A CE2 
1427 C CZ  . PHE A 199 ? 0.3497 0.7002 0.8702 0.0179  0.0371  0.1535  216 PHE A CZ  
1428 N N   . ARG A 200 ? 0.3311 0.5719 0.7506 0.0853  0.0331  0.0778  217 ARG A N   
1429 C CA  . ARG A 200 ? 0.3414 0.5279 0.7474 0.0635  0.0296  0.0574  217 ARG A CA  
1430 C C   . ARG A 200 ? 0.3574 0.5261 0.7530 0.0634  0.0327  0.0185  217 ARG A C   
1431 O O   . ARG A 200 ? 0.3553 0.4925 0.7554 0.0394  0.0320  -0.0027 217 ARG A O   
1432 C CB  . ARG A 200 ? 0.3756 0.5174 0.7660 0.0726  0.0341  0.0611  217 ARG A CB  
1433 C CG  . ARG A 200 ? 0.3658 0.5159 0.7658 0.0726  0.0227  0.0877  217 ARG A CG  
1434 C CD  . ARG A 200 ? 0.4143 0.5082 0.7816 0.0895  0.0257  0.0891  217 ARG A CD  
1435 N NE  . ARG A 200 ? 0.4397 0.5440 0.8014 0.1209  0.0301  0.0907  217 ARG A NE  
1436 C CZ  . ARG A 200 ? 0.4378 0.5778 0.8166 0.1426  0.0178  0.1056  217 ARG A CZ  
1437 N NH1 . ARG A 200 ? 0.4119 0.5823 0.8194 0.1366  -0.0008 0.1168  217 ARG A NH1 
1438 N NH2 . ARG A 200 ? 0.4622 0.6100 0.8361 0.1709  0.0231  0.1050  217 ARG A NH2 
1439 N N   . GLU A 201 ? 0.6699 0.8600 1.0559 0.0925  0.0356  0.0054  218 GLU A N   
1440 C CA  . GLU A 201 ? 0.7042 0.8871 1.0861 0.1010  0.0324  -0.0405 218 GLU A CA  
1441 C C   . GLU A 201 ? 0.6781 0.8878 1.0602 0.0955  0.0200  -0.0523 218 GLU A C   
1442 O O   . GLU A 201 ? 0.6832 0.8864 1.0713 0.0963  0.0110  -0.0980 218 GLU A O   
1443 C CB  . GLU A 201 ? 0.7334 0.9345 1.0986 0.1411  0.0353  -0.0516 218 GLU A CB  
1444 C CG  . GLU A 201 ? 0.7654 0.9326 1.1296 0.1481  0.0472  -0.0524 218 GLU A CG  
1445 C CD  . GLU A 201 ? 0.7837 0.9748 1.1305 0.1886  0.0502  -0.0543 218 GLU A CD  
1446 O OE1 . GLU A 201 ? 0.7747 1.0044 1.1054 0.2145  0.0449  -0.0556 218 GLU A OE1 
1447 O OE2 . GLU A 201 ? 0.8082 0.9750 1.1518 0.1981  0.0597  -0.0534 218 GLU A OE2 
1448 N N   . MET A 202 ? 0.6087 0.8489 0.9889 0.0918  0.0199  -0.0143 219 MET A N   
1449 C CA  . MET A 202 ? 0.5888 0.8513 0.9619 0.0903  0.0114  -0.0185 219 MET A CA  
1450 C C   . MET A 202 ? 0.5494 0.7916 0.9439 0.0478  0.0039  -0.0221 219 MET A C   
1451 O O   . MET A 202 ? 0.5401 0.7895 0.9324 0.0422  -0.0069 -0.0426 219 MET A O   
1452 C CB  . MET A 202 ? 0.5490 0.8482 0.9136 0.1074  0.0237  0.0251  219 MET A CB  
1453 C CG  . MET A 202 ? 0.5741 0.8914 0.9138 0.1529  0.0375  0.0335  219 MET A CG  
1454 S SD  . MET A 202 ? 0.6141 0.9402 0.8994 0.2022  0.0290  -0.0024 219 MET A SD  
1455 C CE  . MET A 202 ? 0.5885 0.9294 0.8607 0.1987  0.0368  0.0262  219 MET A CE  
1456 N N   . ILE A 203 ? 0.2836 0.4985 0.6939 0.0227  0.0089  -0.0032 220 ILE A N   
1457 C CA  . ILE A 203 ? 0.2625 0.4500 0.6868 -0.0142 0.0049  -0.0039 220 ILE A CA  
1458 C C   . ILE A 203 ? 0.2796 0.4287 0.7139 -0.0280 0.0063  -0.0518 220 ILE A C   
1459 O O   . ILE A 203 ? 0.3116 0.4301 0.7488 -0.0197 0.0173  -0.0749 220 ILE A O   
1460 C CB  . ILE A 203 ? 0.2625 0.4237 0.6892 -0.0255 0.0097  0.0256  220 ILE A CB  
1461 C CG1 . ILE A 203 ? 0.2407 0.4473 0.6792 -0.0156 0.0061  0.0640  220 ILE A CG1 
1462 C CG2 . ILE A 203 ? 0.2537 0.3758 0.6843 -0.0576 0.0084  0.0236  220 ILE A CG2 
1463 C CD1 . ILE A 203 ? 0.2464 0.4367 0.6894 -0.0159 0.0030  0.0847  220 ILE A CD1 
1464 N N   . PRO A 204 ? 0.3042 0.4545 0.7510 -0.0495 -0.0024 -0.0696 221 PRO A N   
1465 C CA  . PRO A 204 ? 0.2691 0.4519 0.7126 -0.0598 -0.0136 -0.0444 221 PRO A CA  
1466 C C   . PRO A 204 ? 0.2725 0.5020 0.6968 -0.0284 -0.0228 -0.0495 221 PRO A C   
1467 O O   . PRO A 204 ? 0.2944 0.5291 0.7141 -0.0092 -0.0321 -0.0939 221 PRO A O   
1468 C CB  . PRO A 204 ? 0.2620 0.4126 0.7143 -0.0907 -0.0161 -0.0682 221 PRO A CB  
1469 C CG  . PRO A 204 ? 0.2891 0.4170 0.7678 -0.0882 -0.0110 -0.1235 221 PRO A CG  
1470 C CD  . PRO A 204 ? 0.3178 0.4310 0.7917 -0.0688 0.0025  -0.1186 221 PRO A CD  
1471 N N   . PHE A 205 ? 0.4479 0.7080 0.8622 -0.0194 -0.0181 -0.0067 222 PHE A N   
1472 C CA  . PHE A 205 ? 0.4764 0.7695 0.8611 0.0170  -0.0163 -0.0016 222 PHE A CA  
1473 C C   . PHE A 205 ? 0.4796 0.7776 0.8497 0.0201  -0.0325 -0.0332 222 PHE A C   
1474 O O   . PHE A 205 ? 0.4189 0.7105 0.8064 -0.0130 -0.0391 -0.0308 222 PHE A O   
1475 C CB  . PHE A 205 ? 0.4251 0.7419 0.8162 0.0180  0.0013  0.0512  222 PHE A CB  
1476 C CG  . PHE A 205 ? 0.4283 0.7531 0.8324 0.0310  0.0171  0.0764  222 PHE A CG  
1477 C CD1 . PHE A 205 ? 0.3940 0.7061 0.8294 0.0066  0.0140  0.0863  222 PHE A CD1 
1478 C CD2 . PHE A 205 ? 0.4688 0.8116 0.8499 0.0724  0.0356  0.0894  222 PHE A CD2 
1479 C CE1 . PHE A 205 ? 0.4006 0.7233 0.8502 0.0218  0.0250  0.1049  222 PHE A CE1 
1480 C CE2 . PHE A 205 ? 0.4648 0.8171 0.8643 0.0837  0.0511  0.1104  222 PHE A CE2 
1481 C CZ  . PHE A 205 ? 0.4277 0.7729 0.8648 0.0575  0.0437  0.1163  222 PHE A CZ  
1482 N N   . ALA A 206 ? 0.3131 0.6231 0.6491 0.0643  -0.0411 -0.0656 223 ALA A N   
1483 C CA  . ALA A 206 ? 0.3262 0.6449 0.6428 0.0798  -0.0617 -0.1032 223 ALA A CA  
1484 C C   . ALA A 206 ? 0.3436 0.6786 0.6127 0.1093  -0.0507 -0.0662 223 ALA A C   
1485 O O   . ALA A 206 ? 0.3944 0.7378 0.6116 0.1641  -0.0423 -0.0607 223 ALA A O   
1486 C CB  . ALA A 206 ? 0.3698 0.6935 0.6738 0.1202  -0.0818 -0.1666 223 ALA A CB  
1487 N N   . VAL A 207 ? 0.3005 0.6349 0.5848 0.0756  -0.0471 -0.0400 224 VAL A N   
1488 C CA  . VAL A 207 ? 0.3176 0.6605 0.5648 0.0980  -0.0282 0.0001  224 VAL A CA  
1489 C C   . VAL A 207 ? 0.3370 0.6817 0.5480 0.1175  -0.0487 -0.0298 224 VAL A C   
1490 O O   . VAL A 207 ? 0.3168 0.6604 0.5529 0.0958  -0.0780 -0.0777 224 VAL A O   
1491 C CB  . VAL A 207 ? 0.2692 0.6135 0.5612 0.0519  -0.0073 0.0522  224 VAL A CB  
1492 C CG1 . VAL A 207 ? 0.2497 0.5949 0.5827 0.0337  0.0056  0.0738  224 VAL A CG1 
1493 C CG2 . VAL A 207 ? 0.2216 0.5593 0.5472 0.0028  -0.0280 0.0379  224 VAL A CG2 
1494 N N   . VAL A 208 ? 0.3515 0.6959 0.5037 0.1615  -0.0295 -0.0019 225 VAL A N   
1495 C CA  . VAL A 208 ? 0.3808 0.7241 0.4855 0.1895  -0.0464 -0.0241 225 VAL A CA  
1496 C C   . VAL A 208 ? 0.3940 0.7273 0.4722 0.1952  -0.0091 0.0353  225 VAL A C   
1497 O O   . VAL A 208 ? 0.4371 0.7606 0.4838 0.2287  0.0319  0.0791  225 VAL A O   
1498 C CB  . VAL A 208 ? 0.4615 0.8066 0.4905 0.2691  -0.0666 -0.0705 225 VAL A CB  
1499 C CG1 . VAL A 208 ? 0.5061 0.8474 0.4713 0.3107  -0.0805 -0.0861 225 VAL A CG1 
1500 C CG2 . VAL A 208 ? 0.4483 0.8060 0.5180 0.2615  -0.1062 -0.1419 225 VAL A CG2 
1501 N N   . GLY A 209 ? 0.4489 0.7821 0.5455 0.1614  -0.0190 0.0365  226 GLY A N   
1502 C CA  . GLY A 209 ? 0.4598 0.7812 0.5367 0.1650  0.0168  0.0881  226 GLY A CA  
1503 C C   . GLY A 209 ? 0.5562 0.8585 0.5278 0.2475  0.0302  0.0894  226 GLY A C   
1504 O O   . GLY A 209 ? 0.5937 0.8990 0.5112 0.2956  -0.0059 0.0364  226 GLY A O   
1505 N N   . SER A 210 ? 1.0745 1.3546 1.0176 0.2680  0.0840  0.1474  227 SER A N   
1506 C CA  . SER A 210 ? 1.1750 1.4232 1.0032 0.3556  0.1093  0.1592  227 SER A CA  
1507 C C   . SER A 210 ? 1.1990 1.4326 0.9822 0.3687  0.1019  0.1566  227 SER A C   
1508 O O   . SER A 210 ? 1.1637 1.3895 0.9880 0.3269  0.1322  0.1975  227 SER A O   
1509 C CB  . SER A 210 ? 1.2177 1.4381 1.0332 0.3802  0.1849  0.2259  227 SER A CB  
1510 O OG  . SER A 210 ? 1.1625 1.3784 1.0464 0.3273  0.2257  0.2734  227 SER A OG  
1511 N N   . ASP A 211 ? 1.8731 2.1924 2.3530 0.1098  0.1651  0.1440  228 ASP A N   
1512 C CA  . ASP A 211 ? 1.8938 2.2220 2.3685 0.1304  0.1721  0.1486  228 ASP A CA  
1513 C C   . ASP A 211 ? 1.9180 2.2196 2.3824 0.1456  0.1796  0.1516  228 ASP A C   
1514 O O   . ASP A 211 ? 1.9154 2.2240 2.3852 0.1458  0.1722  0.1571  228 ASP A O   
1515 C CB  . ASP A 211 ? 1.8732 2.2479 2.3600 0.1317  0.1618  0.1553  228 ASP A CB  
1516 N N   . HIS A 212 ? 0.9858 1.2550 1.4338 0.1573  0.1955  0.1483  229 HIS A N   
1517 C CA  . HIS A 212 ? 1.0208 1.2563 1.4529 0.1723  0.2071  0.1506  229 HIS A CA  
1518 C C   . HIS A 212 ? 1.0097 1.2281 1.4460 0.1580  0.2057  0.1471  229 HIS A C   
1519 O O   . HIS A 212 ? 0.9869 1.2084 1.4328 0.1378  0.1997  0.1399  229 HIS A O   
1520 C CB  . HIS A 212 ? 1.0288 1.2802 1.4568 0.1956  0.2030  0.1609  229 HIS A CB  
1521 C CG  . HIS A 212 ? 1.0336 1.3111 1.4602 0.2106  0.2023  0.1631  229 HIS A CG  
1522 N ND1 . HIS A 212 ? 1.0781 1.3290 1.4808 0.2330  0.2169  0.1629  229 HIS A ND1 
1523 C CD2 . HIS A 212 ? 1.0009 1.3280 1.4454 0.2061  0.1900  0.1645  229 HIS A CD2 
1524 C CE1 . HIS A 212 ? 1.0654 1.3512 1.4739 0.2430  0.2126  0.1638  229 HIS A CE1 
1525 N NE2 . HIS A 212 ? 1.0194 1.3536 1.4544 0.2261  0.1968  0.1644  229 HIS A NE2 
1526 N N   . GLU A 213 ? 1.0192 1.2186 1.4461 0.1704  0.2112  0.1519  230 GLU A N   
1527 C CA  . GLU A 213 ? 1.0124 1.1950 1.4426 0.1586  0.2126  0.1480  230 GLU A CA  
1528 C C   . GLU A 213 ? 1.0279 1.2033 1.4482 0.1711  0.2084  0.1566  230 GLU A C   
1529 O O   . GLU A 213 ? 1.0015 1.1900 1.4325 0.1602  0.1957  0.1583  230 GLU A O   
1530 C CB  . GLU A 213 ? 1.0507 1.1907 1.4607 0.1508  0.2310  0.1358  230 GLU A CB  
1531 C CG  . GLU A 213 ? 1.0629 1.1788 1.4611 0.1356  0.2306  0.1277  230 GLU A CG  
1532 C CD  . GLU A 213 ? 1.1122 1.1900 1.4852 0.1228  0.2479  0.1133  230 GLU A CD  
1533 O OE1 . GLU A 213 ? 1.1269 1.2016 1.4974 0.1213  0.2577  0.1087  230 GLU A OE1 
1534 O OE2 . GLU A 213 ? 1.1414 1.1935 1.4958 0.1123  0.2521  0.1061  230 GLU A OE2 
1535 N N   . ILE A 221 ? 0.7534 0.9071 1.1893 0.1035  0.1917  0.1259  238 ILE A N   
1536 C CA  . ILE A 221 ? 0.7116 0.8942 1.1725 0.0948  0.1813  0.1244  238 ILE A CA  
1537 C C   . ILE A 221 ? 0.7023 0.9065 1.1735 0.1008  0.1805  0.1302  238 ILE A C   
1538 O O   . ILE A 221 ? 0.7157 0.9300 1.1851 0.1136  0.1802  0.1407  238 ILE A O   
1539 C CB  . ILE A 221 ? 0.6941 0.8907 1.1622 0.0894  0.1644  0.1310  238 ILE A CB  
1540 N N   . LEU A 222 ? 0.6773 0.8845 1.1494 0.0908  0.1770  0.1213  239 LEU A N   
1541 C CA  . LEU A 222 ? 0.6736 0.8954 1.1458 0.0917  0.1730  0.1240  239 LEU A CA  
1542 C C   . LEU A 222 ? 0.6555 0.9054 1.1388 0.0890  0.1579  0.1342  239 LEU A C   
1543 O O   . LEU A 222 ? 0.6421 0.8997 1.1328 0.0780  0.1478  0.1330  239 LEU A O   
1544 C CB  . LEU A 222 ? 0.6692 0.8870 1.1400 0.0815  0.1731  0.1123  239 LEU A CB  
1545 C CG  . LEU A 222 ? 0.6929 0.8896 1.1528 0.0802  0.1890  0.1011  239 LEU A CG  
1546 C CD1 . LEU A 222 ? 0.6840 0.8854 1.1454 0.0698  0.1855  0.0899  239 LEU A CD1 
1547 C CD2 . LEU A 222 ? 0.7279 0.9137 1.1769 0.0916  0.2032  0.1061  239 LEU A CD2 
1548 N N   . GLY A 223 ? 0.6593 0.9258 1.1435 0.0995  0.1573  0.1445  240 GLY A N   
1549 C CA  . GLY A 223 ? 0.6479 0.9469 1.1431 0.0947  0.1443  0.1541  240 GLY A CA  
1550 C C   . GLY A 223 ? 0.6454 0.9723 1.1429 0.0955  0.1419  0.1570  240 GLY A C   
1551 O O   . GLY A 223 ? 0.6565 0.9760 1.1467 0.1021  0.1504  0.1521  240 GLY A O   
1552 N N   . ARG A 224 ? 0.6770 1.0375 1.1845 0.0871  0.1310  0.1646  241 ARG A N   
1553 C CA  . ARG A 224 ? 0.6718 1.0666 1.1834 0.0850  0.1286  0.1667  241 ARG A CA  
1554 C C   . ARG A 224 ? 0.6651 1.1011 1.1856 0.0845  0.1198  0.1761  241 ARG A C   
1555 O O   . ARG A 224 ? 0.6625 1.1110 1.1893 0.0681  0.1104  0.1817  241 ARG A O   
1556 C CB  . ARG A 224 ? 0.6712 1.0689 1.1855 0.0654  0.1245  0.1636  241 ARG A CB  
1557 C CG  . ARG A 224 ? 0.6661 1.0972 1.1836 0.0608  0.1245  0.1639  241 ARG A CG  
1558 C CD  . ARG A 224 ? 0.6735 1.0927 1.1839 0.0749  0.1358  0.1569  241 ARG A CD  
1559 N NE  . ARG A 224 ? 0.6701 1.1261 1.1851 0.0764  0.1375  0.1570  241 ARG A NE  
1560 C CZ  . ARG A 224 ? 0.6833 1.1361 1.1936 0.0870  0.1472  0.1518  241 ARG A CZ  
1561 N NH1 . ARG A 224 ? 0.6803 1.1702 1.1967 0.0884  0.1487  0.1512  241 ARG A NH1 
1562 N NH2 . ARG A 224 ? 0.7013 1.1152 1.2009 0.0951  0.1562  0.1469  241 ARG A NH2 
1563 N N   . LYS A 225 ? 0.3309 0.7890 0.8509 0.1026  0.1229  0.1780  242 LYS A N   
1564 C CA  . LYS A 225 ? 0.3358 0.8386 0.8642 0.1052  0.1142  0.1858  242 LYS A CA  
1565 C C   . LYS A 225 ? 0.3301 0.8761 0.8678 0.0819  0.1057  0.1868  242 LYS A C   
1566 O O   . LYS A 225 ? 0.3246 0.8649 0.8612 0.0670  0.1078  0.1818  242 LYS A O   
1567 C CB  . LYS A 225 ? 0.3545 0.8710 0.8789 0.1337  0.1196  0.1864  242 LYS A CB  
1568 N N   . THR A 230 ? 0.6826 1.1786 1.2221 0.0525  0.0836  0.2094  247 THR A N   
1569 C CA  . THR A 230 ? 0.6811 1.1362 1.2174 0.0651  0.0960  0.2004  247 THR A CA  
1570 C C   . THR A 230 ? 0.6890 1.1108 1.2171 0.0460  0.0940  0.1936  247 THR A C   
1571 O O   . THR A 230 ? 0.7105 1.1183 1.2243 0.0273  0.0835  0.1941  247 THR A O   
1572 C CB  . THR A 230 ? 0.6933 1.1130 1.2205 0.0854  0.1035  0.1985  247 THR A CB  
1573 O OG1 . THR A 230 ? 0.6884 1.0699 1.2105 0.0913  0.1156  0.1885  247 THR A OG1 
1574 C CG2 . THR A 230 ? 0.7168 1.1100 1.2274 0.0738  0.0945  0.1985  247 THR A CG2 
1575 N N   . ILE A 231 ? 0.9442 1.3482 1.4741 0.0513  0.1032  0.1860  248 ILE A N   
1576 C CA  . ILE A 231 ? 0.9548 1.3324 1.4777 0.0370  0.1006  0.1796  248 ILE A CA  
1577 C C   . ILE A 231 ? 0.9512 1.2933 1.4722 0.0489  0.1108  0.1690  248 ILE A C   
1578 O O   . ILE A 231 ? 0.9481 1.2843 1.4643 0.0576  0.1187  0.1623  248 ILE A O   
1583 N N   . GLU A 232 ? 0.9322 1.2417 1.4407 0.0464  0.1075  0.1628  249 GLU A N   
1584 C CA  . GLU A 232 ? 0.9264 1.2088 1.4334 0.0542  0.1165  0.1510  249 GLU A CA  
1585 C C   . GLU A 232 ? 0.9331 1.2101 1.4407 0.0485  0.1149  0.1444  249 GLU A C   
1586 O O   . GLU A 232 ? 0.9637 1.2282 1.4599 0.0388  0.1038  0.1432  249 GLU A O   
1587 C CB  . GLU A 232 ? 0.9371 1.1926 1.4315 0.0532  0.1137  0.1453  249 GLU A CB  
1588 N N   . VAL A 233 ? 0.5324 0.8113 1.0432 0.0546  0.1242  0.1391  250 VAL A N   
1589 C CA  . VAL A 233 ? 0.5379 0.8143 1.0492 0.0501  0.1228  0.1334  250 VAL A CA  
1590 C C   . VAL A 233 ? 0.5439 0.8018 1.0545 0.0515  0.1212  0.1226  250 VAL A C   
1591 O O   . VAL A 233 ? 0.5669 0.8180 1.0712 0.0477  0.1133  0.1190  250 VAL A O   
1592 C CB  . VAL A 233 ? 0.5327 0.8076 1.0345 0.0545  0.1313  0.1275  250 VAL A CB  
1593 C CG1 . VAL A 233 ? 0.5316 0.8256 1.0323 0.0576  0.1330  0.1359  250 VAL A CG1 
1594 C CG2 . VAL A 233 ? 0.5287 0.7834 1.0213 0.0614  0.1415  0.1164  250 VAL A CG2 
1595 N N   . GLU A 234 ? 0.5587 0.8056 1.0681 0.0573  0.1274  0.1157  251 GLU A N   
1596 C CA  . GLU A 234 ? 0.5618 0.7961 1.0681 0.0595  0.1262  0.1025  251 GLU A CA  
1597 C C   . GLU A 234 ? 0.5919 0.8111 1.0847 0.0573  0.1126  0.1032  251 GLU A C   
1598 O O   . GLU A 234 ? 0.6000 0.8098 1.0885 0.0618  0.1099  0.0922  251 GLU A O   
1599 C CB  . GLU A 234 ? 0.5444 0.7705 1.0460 0.0625  0.1386  0.0924  251 GLU A CB  
1600 N N   . ASN A 235 ? 0.6831 0.9013 1.1678 0.0502  0.1043  0.1156  252 ASN A N   
1601 C CA  . ASN A 235 ? 0.7326 0.9307 1.1979 0.0454  0.0917  0.1172  252 ASN A CA  
1602 C C   . ASN A 235 ? 0.7851 0.9699 1.2341 0.0409  0.0797  0.1178  252 ASN A C   
1603 O O   . ASN A 235 ? 0.7898 0.9854 1.2402 0.0337  0.0782  0.1244  252 ASN A O   
1604 C CB  . ASN A 235 ? 0.7425 0.9451 1.2021 0.0366  0.0879  0.1297  252 ASN A CB  
1605 C CG  . ASN A 235 ? 0.7922 0.9697 1.2298 0.0318  0.0786  0.1295  252 ASN A CG  
1606 O OD1 . ASN A 235 ? 0.8456 0.9992 1.2653 0.0326  0.0708  0.1239  252 ASN A OD1 
1607 N ND2 . ASN A 235 ? 0.7850 0.9655 1.2208 0.0283  0.0792  0.1357  252 ASN A ND2 
1608 N N   . THR A 236 ? 0.6521 0.8114 1.0826 0.0460  0.0715  0.1106  253 THR A N   
1609 C CA  . THR A 236 ? 0.7199 0.8567 1.1267 0.0454  0.0594  0.1101  253 THR A CA  
1610 C C   . THR A 236 ? 0.7880 0.9048 1.1657 0.0278  0.0488  0.1223  253 THR A C   
1611 O O   . THR A 236 ? 0.8449 0.9416 1.1984 0.0218  0.0400  0.1248  253 THR A O   
1612 C CB  . THR A 236 ? 0.7501 0.8646 1.1429 0.0613  0.0539  0.0975  253 THR A CB  
1613 O OG1 . THR A 236 ? 0.7838 0.8775 1.1597 0.0599  0.0508  0.0982  253 THR A OG1 
1614 C CG2 . THR A 236 ? 0.6770 0.8176 1.0981 0.0750  0.0647  0.0837  253 THR A CG2 
1615 N N   . THR A 237 ? 0.8194 0.9409 1.1964 0.0179  0.0496  0.1295  254 THR A N   
1616 C CA  . THR A 237 ? 0.8644 0.9710 1.2128 -0.0028 0.0401  0.1402  254 THR A CA  
1617 C C   . THR A 237 ? 0.8194 0.9629 1.1834 -0.0182 0.0433  0.1506  254 THR A C   
1618 O O   . THR A 237 ? 0.8454 0.9828 1.1865 -0.0382 0.0362  0.1577  254 THR A O   
1619 C CB  . THR A 237 ? 0.8722 0.9656 1.2078 -0.0075 0.0377  0.1424  254 THR A CB  
1620 O OG1 . THR A 237 ? 0.8058 0.9343 1.1730 -0.0040 0.0472  0.1449  254 THR A OG1 
1621 C CG2 . THR A 237 ? 0.9135 0.9720 1.2327 0.0086  0.0354  0.1311  254 THR A CG2 
1622 N N   . HIS A 238 ? 0.8707 1.0518 1.2708 -0.0089 0.0546  0.1508  255 HIS A N   
1623 C CA  . HIS A 238 ? 0.8267 1.0482 1.2451 -0.0177 0.0591  0.1595  255 HIS A CA  
1624 C C   . HIS A 238 ? 0.8264 1.0530 1.2463 -0.0204 0.0606  0.1583  255 HIS A C   
1625 O O   . HIS A 238 ? 0.8324 1.0719 1.2434 -0.0384 0.0571  0.1650  255 HIS A O   
1626 C CB  . HIS A 238 ? 0.7626 1.0141 1.2120 -0.0029 0.0708  0.1598  255 HIS A CB  
1627 C CG  . HIS A 238 ? 0.7599 1.0142 1.2069 -0.0040 0.0686  0.1644  255 HIS A CG  
1628 N ND1 . HIS A 238 ? 0.7166 0.9918 1.1828 0.0087  0.0771  0.1664  255 HIS A ND1 
1629 C CD2 . HIS A 238 ? 0.8007 1.0358 1.2242 -0.0164 0.0587  0.1673  255 HIS A CD2 
1630 C CE1 . HIS A 238 ? 0.7282 0.9996 1.1848 0.0044  0.0719  0.1707  255 HIS A CE1 
1631 N NE2 . HIS A 238 ? 0.7760 1.0244 1.2077 -0.0117 0.0610  0.1711  255 HIS A NE2 
1632 N N   . CYS A 239 ? 0.5531 0.7711 0.9831 -0.0045 0.0659  0.1491  256 CYS A N   
1633 C CA  . CYS A 239 ? 0.5593 0.7763 0.9871 -0.0061 0.0663  0.1469  256 CYS A CA  
1634 C C   . CYS A 239 ? 0.5874 0.7763 1.0067 0.0082  0.0632  0.1356  256 CYS A C   
1635 O O   . CYS A 239 ? 0.6055 0.7769 1.0194 0.0180  0.0606  0.1295  256 CYS A O   
1636 C CB  . CYS A 239 ? 0.4964 0.7508 0.9541 -0.0012 0.0795  0.1483  256 CYS A CB  
1637 S SG  . CYS A 239 ? 0.4433 0.7025 0.9257 0.0208  0.0932  0.1378  256 CYS A SG  
1638 N N   . GLU A 240 ? 0.3939 0.5816 0.8121 0.0098  0.0634  0.1322  257 GLU A N   
1639 C CA  . GLU A 240 ? 0.4238 0.5898 0.8324 0.0238  0.0581  0.1216  257 GLU A CA  
1640 C C   . GLU A 240 ? 0.3606 0.5499 0.7969 0.0356  0.0690  0.1127  257 GLU A C   
1641 O O   . GLU A 240 ? 0.3752 0.5563 0.8057 0.0447  0.0645  0.1044  257 GLU A O   
1642 C CB  . GLU A 240 ? 0.5033 0.6381 0.8759 0.0161  0.0454  0.1241  257 GLU A CB  
1643 C CG  . GLU A 240 ? 0.5752 0.6772 0.9101 0.0017  0.0344  0.1316  257 GLU A CG  
1644 C CD  . GLU A 240 ? 0.6499 0.7126 0.9403 -0.0081 0.0227  0.1344  257 GLU A CD  
1645 O OE1 . GLU A 240 ? 0.6378 0.7088 0.9317 -0.0104 0.0247  0.1340  257 GLU A OE1 
1646 O OE2 . GLU A 240 ? 0.7188 0.7377 0.9662 -0.0141 0.0117  0.1368  257 GLU A OE2 
1647 N N   . PHE A 241 ? 0.4681 0.6849 0.9307 0.0357  0.0831  0.1142  258 PHE A N   
1648 C CA  . PHE A 241 ? 0.4209 0.6551 0.9039 0.0432  0.0953  0.1060  258 PHE A CA  
1649 C C   . PHE A 241 ? 0.4056 0.6377 0.8944 0.0552  0.0970  0.0926  258 PHE A C   
1650 O O   . PHE A 241 ? 0.3925 0.6330 0.8881 0.0602  0.1005  0.0825  258 PHE A O   
1651 C CB  . PHE A 241 ? 0.3764 0.6322 0.8779 0.0418  0.1103  0.1113  258 PHE A CB  
1652 C CG  . PHE A 241 ? 0.3472 0.6114 0.8606 0.0479  0.1242  0.1021  258 PHE A CG  
1653 C CD1 . PHE A 241 ? 0.3521 0.6200 0.8638 0.0452  0.1274  0.0990  258 PHE A CD1 
1654 C CD2 . PHE A 241 ? 0.3344 0.5897 0.8392 0.0522  0.1304  0.0937  258 PHE A CD2 
1655 C CE1 . PHE A 241 ? 0.3464 0.6099 0.8483 0.0463  0.1362  0.0877  258 PHE A CE1 
1656 C CE2 . PHE A 241 ? 0.3311 0.5819 0.8265 0.0523  0.1399  0.0830  258 PHE A CE2 
1657 C CZ  . PHE A 241 ? 0.3381 0.5934 0.8321 0.0492  0.1427  0.0800  258 PHE A CZ  
1658 N N   . ALA A 242 ? 0.5160 0.7399 1.0017 0.0584  0.0950  0.0919  259 ALA A N   
1659 C CA  . ALA A 242 ? 0.5007 0.7258 0.9915 0.0685  0.0972  0.0784  259 ALA A CA  
1660 C C   . ALA A 242 ? 0.5322 0.7501 1.0120 0.0783  0.0852  0.0691  259 ALA A C   
1661 O O   . ALA A 242 ? 0.5092 0.7439 1.0003 0.0862  0.0890  0.0556  259 ALA A O   
1662 C CB  . ALA A 242 ? 0.5064 0.7202 0.9914 0.0690  0.0960  0.0804  259 ALA A CB  
1663 N N   . TYR A 243 ? 0.4684 0.6613 0.9234 0.0776  0.0705  0.0763  260 TYR A N   
1664 C CA  . TYR A 243 ? 0.5135 0.6916 0.9500 0.0901  0.0570  0.0693  260 TYR A CA  
1665 C C   . TYR A 243 ? 0.4975 0.6917 0.9420 0.0910  0.0581  0.0651  260 TYR A C   
1666 O O   . TYR A 243 ? 0.4873 0.6941 0.9364 0.1046  0.0546  0.0526  260 TYR A O   
1667 C CB  . TYR A 243 ? 0.6014 0.7388 0.9997 0.0859  0.0420  0.0794  260 TYR A CB  
1668 C CG  . TYR A 243 ? 0.6368 0.7498 1.0168 0.0902  0.0365  0.0796  260 TYR A CG  
1669 C CD1 . TYR A 243 ? 0.6099 0.7300 0.9978 0.1076  0.0375  0.0665  260 TYR A CD1 
1670 C CD2 . TYR A 243 ? 0.6986 0.7832 1.0520 0.0750  0.0308  0.0920  260 TYR A CD2 
1671 C CE1 . TYR A 243 ? 0.6391 0.7348 1.0082 0.1117  0.0333  0.0662  260 TYR A CE1 
1672 C CE2 . TYR A 243 ? 0.7308 0.7898 1.0638 0.0772  0.0261  0.0921  260 TYR A CE2 
1673 C CZ  . TYR A 243 ? 0.7005 0.7632 1.0411 0.0965  0.0274  0.0794  260 TYR A CZ  
1674 O OH  . TYR A 243 ? 0.7302 0.7655 1.0486 0.0989  0.0235  0.0792  260 TYR A OH  
1675 N N   . LEU A 244 ? 0.4454 0.6426 0.8922 0.0767  0.0631  0.0750  261 LEU A N   
1676 C CA  . LEU A 244 ? 0.4358 0.6445 0.8868 0.0748  0.0648  0.0724  261 LEU A CA  
1677 C C   . LEU A 244 ? 0.3778 0.6186 0.8554 0.0795  0.0769  0.0593  261 LEU A C   
1678 O O   . LEU A 244 ? 0.3797 0.6312 0.8579 0.0858  0.0728  0.0503  261 LEU A O   
1679 C CB  . LEU A 244 ? 0.4327 0.6429 0.8841 0.0580  0.0715  0.0847  261 LEU A CB  
1680 C CG  . LEU A 244 ? 0.4245 0.6450 0.8791 0.0538  0.0754  0.0828  261 LEU A CG  
1681 C CD1 . LEU A 244 ? 0.4848 0.6829 0.9120 0.0594  0.0585  0.0807  261 LEU A CD1 
1682 C CD2 . LEU A 244 ? 0.4133 0.6408 0.8718 0.0386  0.0850  0.0938  261 LEU A CD2 
1683 N N   . ARG A 245 ? 0.5509 0.8057 1.0470 0.0751  0.0917  0.0582  262 ARG A N   
1684 C CA  . ARG A 245 ? 0.5090 0.7890 1.0240 0.0747  0.1056  0.0456  262 ARG A CA  
1685 C C   . ARG A 245 ? 0.5065 0.8022 1.0254 0.0868  0.0993  0.0296  262 ARG A C   
1686 O O   . ARG A 245 ? 0.4986 0.8161 1.0245 0.0880  0.1002  0.0187  262 ARG A O   
1687 C CB  . ARG A 245 ? 0.4818 0.7617 1.0028 0.0682  0.1204  0.0476  262 ARG A CB  
1688 C CG  . ARG A 245 ? 0.4661 0.7542 0.9788 0.0617  0.1312  0.0329  262 ARG A CG  
1689 C CD  . ARG A 245 ? 0.4589 0.7342 0.9621 0.0573  0.1402  0.0337  262 ARG A CD  
1690 N NE  . ARG A 245 ? 0.4585 0.7316 0.9670 0.0648  0.1337  0.0336  262 ARG A NE  
1691 C CZ  . ARG A 245 ? 0.4557 0.7158 0.9599 0.0633  0.1379  0.0390  262 ARG A CZ  
1692 N NH1 . ARG A 245 ? 0.4560 0.7042 0.9506 0.0570  0.1478  0.0451  262 ARG A NH1 
1693 N NH2 . ARG A 245 ? 0.4580 0.7162 0.9677 0.0700  0.1324  0.0384  262 ARG A NH2 
1694 N N   . ASP A 246 ? 0.5453 0.8324 1.0592 0.0958  0.0929  0.0277  263 ASP A N   
1695 C CA  . ASP A 246 ? 0.5414 0.8470 1.0598 0.1101  0.0875  0.0116  263 ASP A CA  
1696 C C   . ASP A 246 ? 0.5738 0.8808 1.0808 0.1250  0.0705  0.0070  263 ASP A C   
1697 O O   . ASP A 246 ? 0.5599 0.8995 1.0782 0.1342  0.0691  -0.0084 263 ASP A O   
1698 C CB  . ASP A 246 ? 0.5548 0.8442 1.0652 0.1178  0.0835  0.0121  263 ASP A CB  
1699 C CG  . ASP A 246 ? 0.5218 0.8150 1.0435 0.1059  0.1001  0.0124  263 ASP A CG  
1700 O OD1 . ASP A 246 ? 0.4938 0.8031 1.0215 0.0937  0.1135  0.0065  263 ASP A OD1 
1701 O OD2 . ASP A 246 ? 0.5346 0.8075 1.0469 0.1069  0.0979  0.0182  263 ASP A OD2 
1702 N N   . LEU A 247 ? 0.3015 0.5738 0.7837 0.1267  0.0575  0.0199  264 LEU A N   
1703 C CA  . LEU A 247 ? 0.3271 0.5903 0.7897 0.1413  0.0402  0.0175  264 LEU A CA  
1704 C C   . LEU A 247 ? 0.3155 0.6075 0.7916 0.1361  0.0439  0.0115  264 LEU A C   
1705 O O   . LEU A 247 ? 0.3252 0.6380 0.8019 0.1512  0.0345  -0.0002 264 LEU A O   
1706 C CB  . LEU A 247 ? 0.3568 0.5702 0.7834 0.1380  0.0277  0.0335  264 LEU A CB  
1707 C CG  . LEU A 247 ? 0.3821 0.5596 0.7838 0.1456  0.0193  0.0380  264 LEU A CG  
1708 C CD1 . LEU A 247 ? 0.4148 0.5428 0.7770 0.1351  0.0092  0.0537  264 LEU A CD1 
1709 C CD2 . LEU A 247 ? 0.4051 0.5839 0.7969 0.1740  0.0074  0.0246  264 LEU A CD2 
1710 N N   . LEU A 248 ? 0.3958 0.6900 0.8815 0.1156  0.0576  0.0191  265 LEU A N   
1711 C CA  . LEU A 248 ? 0.3831 0.6984 0.8771 0.1076  0.0626  0.0146  265 LEU A CA  
1712 C C   . LEU A 248 ? 0.3482 0.7080 0.8678 0.1047  0.0750  -0.0023 265 LEU A C   
1713 O O   . LEU A 248 ? 0.3483 0.7334 0.8724 0.1053  0.0725  -0.0119 265 LEU A O   
1714 C CB  . LEU A 248 ? 0.3791 0.6802 0.8720 0.0880  0.0744  0.0278  265 LEU A CB  
1715 C CG  . LEU A 248 ? 0.4265 0.6919 0.8936 0.0840  0.0639  0.0430  265 LEU A CG  
1716 C CD1 . LEU A 248 ? 0.4126 0.6768 0.8850 0.0657  0.0785  0.0531  265 LEU A CD1 
1717 C CD2 . LEU A 248 ? 0.4748 0.7291 0.9194 0.0936  0.0464  0.0406  265 LEU A CD2 
1718 N N   . ILE A 249 ? 0.4883 0.8571 1.0218 0.0995  0.0883  -0.0063 266 ILE A N   
1719 C CA  . ILE A 249 ? 0.4524 0.8587 1.0050 0.0902  0.1034  -0.0221 266 ILE A CA  
1720 C C   . ILE A 249 ? 0.4459 0.8852 1.0050 0.1052  0.0952  -0.0391 266 ILE A C   
1721 O O   . ILE A 249 ? 0.4349 0.9103 0.9966 0.1008  0.0974  -0.0527 266 ILE A O   
1722 C CB  . ILE A 249 ? 0.4405 0.8277 0.9800 0.0735  0.1194  -0.0180 266 ILE A CB  
1723 C CG1 . ILE A 249 ? 0.4503 0.8101 0.9815 0.0616  0.1276  -0.0031 266 ILE A CG1 
1724 C CG2 . ILE A 249 ? 0.4242 0.8350 0.9586 0.0601  0.1313  -0.0328 266 ILE A CG2 
1725 C CD1 . ILE A 249 ? 0.4555 0.8261 0.9879 0.0525  0.1324  -0.0056 266 ILE A CD1 
1726 N N   . ARG A 250 ? 0.2670 0.6923 0.8228 0.1221  0.0855  -0.0371 267 ARG A N   
1727 C CA  . ARG A 250 ? 0.2756 0.7302 0.8342 0.1391  0.0785  -0.0526 267 ARG A CA  
1728 C C   . ARG A 250 ? 0.2970 0.7518 0.8469 0.1676  0.0555  -0.0554 267 ARG A C   
1729 O O   . ARG A 250 ? 0.3014 0.7965 0.8593 0.1779  0.0487  -0.0690 267 ARG A O   
1730 C CB  . ARG A 250 ? 0.2776 0.7141 0.8300 0.1406  0.0831  -0.0507 267 ARG A CB  
1731 N N   . THR A 251 ? 0.3526 0.7570 0.8761 0.1789  0.0428  -0.0412 268 THR A N   
1732 C CA  . THR A 251 ? 0.3920 0.7791 0.8907 0.2078  0.0203  -0.0420 268 THR A CA  
1733 C C   . THR A 251 ? 0.4110 0.7991 0.8978 0.2133  0.0076  -0.0405 268 THR A C   
1734 O O   . THR A 251 ? 0.4223 0.8381 0.9085 0.2367  -0.0055 -0.0528 268 THR A O   
1735 C CB  . THR A 251 ? 0.4299 0.7527 0.8942 0.2124  0.0115  -0.0258 268 THR A CB  
1736 O OG1 . THR A 251 ? 0.4141 0.7346 0.8875 0.2073  0.0223  -0.0268 268 THR A OG1 
1737 C CG2 . THR A 251 ? 0.4843 0.7801 0.9143 0.2441  -0.0110 -0.0277 268 THR A CG2 
1738 N N   . HIS A 252 ? 0.3517 0.7117 0.8285 0.1928  0.0113  -0.0260 269 HIS A N   
1739 C CA  . HIS A 252 ? 0.3714 0.7206 0.8293 0.1963  -0.0015 -0.0220 269 HIS A CA  
1740 C C   . HIS A 252 ? 0.3472 0.7385 0.8290 0.1788  0.0093  -0.0290 269 HIS A C   
1741 O O   . HIS A 252 ? 0.3610 0.7435 0.8281 0.1771  0.0012  -0.0250 269 HIS A O   
1742 C CB  . HIS A 252 ? 0.3913 0.6792 0.8159 0.1846  -0.0058 -0.0018 269 HIS A CB  
1743 C CG  . HIS A 252 ? 0.4298 0.6668 0.8173 0.2009  -0.0205 0.0054  269 HIS A CG  
1744 N ND1 . HIS A 252 ? 0.4784 0.6744 0.8223 0.2183  -0.0410 0.0095  269 HIS A ND1 
1745 C CD2 . HIS A 252 ? 0.4324 0.6479 0.8145 0.2016  -0.0174 0.0092  269 HIS A CD2 
1746 C CE1 . HIS A 252 ? 0.5116 0.6603 0.8226 0.2285  -0.0493 0.0153  269 HIS A CE1 
1747 N NE2 . HIS A 252 ? 0.4829 0.6444 0.8178 0.2181  -0.0353 0.0152  269 HIS A NE2 
1748 N N   . MET A 253 ? 0.3160 0.7487 0.8297 0.1644  0.0279  -0.0394 270 MET A N   
1749 C CA  . MET A 253 ? 0.2969 0.7612 0.8278 0.1423  0.0419  -0.0452 270 MET A CA  
1750 C C   . MET A 253 ? 0.3084 0.8091 0.8401 0.1523  0.0292  -0.0569 270 MET A C   
1751 O O   . MET A 253 ? 0.3131 0.8057 0.8354 0.1411  0.0283  -0.0518 270 MET A O   
1752 C CB  . MET A 253 ? 0.2716 0.7702 0.8288 0.1261  0.0632  -0.0567 270 MET A CB  
1753 C CG  . MET A 253 ? 0.2578 0.7726 0.8239 0.0981  0.0819  -0.0600 270 MET A CG  
1754 S SD  . MET A 253 ? 0.2594 0.8401 0.8388 0.0938  0.0808  -0.0820 270 MET A SD  
1755 C CE  . MET A 253 ? 0.2697 0.8700 0.8470 0.1028  0.0796  -0.0915 270 MET A CE  
1756 N N   . GLN A 254 ? 0.3142 0.8575 0.8570 0.1741  0.0192  -0.0731 271 GLN A N   
1757 C CA  . GLN A 254 ? 0.3243 0.9142 0.8718 0.1853  0.0067  -0.0865 271 GLN A CA  
1758 C C   . GLN A 254 ? 0.3597 0.9119 0.8734 0.2066  -0.0173 -0.0763 271 GLN A C   
1759 O O   . GLN A 254 ? 0.3687 0.9401 0.8783 0.2057  -0.0253 -0.0799 271 GLN A O   
1760 C CB  . GLN A 254 ? 0.3299 0.9694 0.8906 0.2017  0.0026  -0.1041 271 GLN A CB  
1761 C CG  . GLN A 254 ? 0.3428 1.0330 0.9064 0.2038  -0.0061 -0.1175 271 GLN A CG  
1762 C CD  . GLN A 254 ? 0.3229 1.0379 0.8993 0.1674  0.0111  -0.1215 271 GLN A CD  
1763 O OE1 . GLN A 254 ? 0.3081 1.0218 0.8911 0.1382  0.0333  -0.1225 271 GLN A OE1 
1764 N NE2 . GLN A 254 ? 0.3273 1.0604 0.9024 0.1694  0.0004  -0.1234 271 GLN A NE2 
1765 N N   . ASN A 255 ? 0.3896 0.8849 0.8749 0.2240  -0.0287 -0.0637 272 ASN A N   
1766 C CA  . ASN A 255 ? 0.4323 0.8797 0.8758 0.2423  -0.0508 -0.0532 272 ASN A CA  
1767 C C   . ASN A 255 ? 0.4325 0.8450 0.8601 0.2153  -0.0454 -0.0388 272 ASN A C   
1768 O O   . ASN A 255 ? 0.4604 0.8587 0.8632 0.2223  -0.0602 -0.0359 272 ASN A O   
1769 C CB  . ASN A 255 ? 0.4641 0.8519 0.8744 0.2620  -0.0617 -0.0431 272 ASN A CB  
1770 C CG  . ASN A 255 ? 0.5200 0.8535 0.8782 0.2837  -0.0859 -0.0343 272 ASN A CG  
1771 O OD1 . ASN A 255 ? 0.5388 0.8930 0.8895 0.2989  -0.1001 -0.0410 272 ASN A OD1 
1772 N ND2 . ASN A 255 ? 0.5511 0.8129 0.8693 0.2838  -0.0908 -0.0194 272 ASN A ND2 
1773 N N   . ILE A 256 ? 0.3983 0.7976 0.8391 0.1860  -0.0242 -0.0301 273 ILE A N   
1774 C CA  . ILE A 256 ? 0.3950 0.7684 0.8256 0.1598  -0.0154 -0.0179 273 ILE A CA  
1775 C C   . ILE A 256 ? 0.3857 0.8009 0.8301 0.1487  -0.0116 -0.0279 273 ILE A C   
1776 O O   . ILE A 256 ? 0.4051 0.8006 0.8274 0.1435  -0.0189 -0.0218 273 ILE A O   
1777 C CB  . ILE A 256 ? 0.3654 0.7261 0.8114 0.1345  0.0077  -0.0089 273 ILE A CB  
1778 C CG1 . ILE A 256 ? 0.3796 0.6920 0.8049 0.1397  0.0029  0.0043  273 ILE A CG1 
1779 C CG2 . ILE A 256 ? 0.3583 0.7080 0.8011 0.1089  0.0201  -0.0007 273 ILE A CG2 
1780 C CD1 . ILE A 256 ? 0.3513 0.6589 0.7941 0.1201  0.0232  0.0117  273 ILE A CD1 
1781 N N   . LYS A 257 ? 0.3591 0.8311 0.8371 0.1429  0.0002  -0.0436 274 LYS A N   
1782 C CA  . LYS A 257 ? 0.3514 0.8674 0.8422 0.1284  0.0055  -0.0550 274 LYS A CA  
1783 C C   . LYS A 257 ? 0.3800 0.9147 0.8563 0.1510  -0.0193 -0.0617 274 LYS A C   
1784 O O   . LYS A 257 ? 0.3883 0.9297 0.8562 0.1396  -0.0214 -0.0623 274 LYS A O   
1785 C CB  . LYS A 257 ? 0.3240 0.8970 0.8488 0.1165  0.0226  -0.0721 274 LYS A CB  
1786 C CG  . LYS A 257 ? 0.3008 0.8541 0.8357 0.0927  0.0482  -0.0663 274 LYS A CG  
1787 C CD  . LYS A 257 ? 0.2828 0.8864 0.8417 0.0738  0.0668  -0.0838 274 LYS A CD  
1788 C CE  . LYS A 257 ? 0.2877 0.9269 0.8473 0.0567  0.0692  -0.0945 274 LYS A CE  
1789 N NZ  . LYS A 257 ? 0.2762 0.9554 0.8513 0.0302  0.0909  -0.1107 274 LYS A NZ  
1790 N N   . ASP A 258 ? 0.4180 0.9597 0.8890 0.1846  -0.0382 -0.0669 275 ASP A N   
1791 C CA  . ASP A 258 ? 0.4517 1.0104 0.9059 0.2132  -0.0641 -0.0736 275 ASP A CA  
1792 C C   . ASP A 258 ? 0.5100 1.0034 0.9186 0.2156  -0.0785 -0.0571 275 ASP A C   
1793 O O   . ASP A 258 ? 0.5390 1.0440 0.9331 0.2220  -0.0928 -0.0602 275 ASP A O   
1794 C CB  . ASP A 258 ? 0.4635 1.0353 0.9167 0.2526  -0.0804 -0.0818 275 ASP A CB  
1795 C CG  . ASP A 258 ? 0.4307 1.0830 0.9285 0.2536  -0.0701 -0.1028 275 ASP A CG  
1796 O OD1 . ASP A 258 ? 0.4027 1.1041 0.9277 0.2250  -0.0541 -0.1127 275 ASP A OD1 
1797 O OD2 . ASP A 258 ? 0.4383 1.1030 0.9407 0.2815  -0.0773 -0.1101 275 ASP A OD2 
1798 N N   . ILE A 259 ? 0.4784 0.9046 0.8630 0.2086  -0.0745 -0.0399 276 ILE A N   
1799 C CA  . ILE A 259 ? 0.5162 0.8768 0.8544 0.2050  -0.0853 -0.0240 276 ILE A CA  
1800 C C   . ILE A 259 ? 0.4985 0.8594 0.8422 0.1697  -0.0691 -0.0189 276 ILE A C   
1801 O O   . ILE A 259 ? 0.5279 0.8621 0.8407 0.1662  -0.0792 -0.0130 276 ILE A O   
1802 C CB  . ILE A 259 ? 0.5342 0.8269 0.8437 0.2052  -0.0853 -0.0084 276 ILE A CB  
1803 C CG1 . ILE A 259 ? 0.5610 0.8441 0.8565 0.2417  -0.1021 -0.0132 276 ILE A CG1 
1804 C CG2 . ILE A 259 ? 0.5756 0.8016 0.8348 0.1952  -0.0940 0.0072  276 ILE A CG2 
1805 C CD1 . ILE A 259 ? 0.5802 0.7989 0.8468 0.2397  -0.1012 0.0005  276 ILE A CD1 
1806 N N   . THR A 260 ? 0.4546 0.8432 0.8342 0.1444  -0.0438 -0.0217 277 THR A N   
1807 C CA  . THR A 260 ? 0.4395 0.8290 0.8241 0.1127  -0.0260 -0.0183 277 THR A CA  
1808 C C   . THR A 260 ? 0.4468 0.8774 0.8340 0.1110  -0.0330 -0.0303 277 THR A C   
1809 O O   . THR A 260 ? 0.4601 0.8729 0.8287 0.0950  -0.0317 -0.0251 277 THR A O   
1810 C CB  . THR A 260 ? 0.3980 0.8072 0.8162 0.0901  0.0022  -0.0205 277 THR A CB  
1811 O OG1 . THR A 260 ? 0.3917 0.7659 0.8078 0.0917  0.0077  -0.0091 277 THR A OG1 
1812 C CG2 . THR A 260 ? 0.3898 0.7932 0.8071 0.0603  0.0210  -0.0169 277 THR A CG2 
1813 N N   . SER A 261 ? 0.5080 0.9965 0.9178 0.1272  -0.0405 -0.0471 278 SER A N   
1814 C CA  . SER A 261 ? 0.5131 1.0533 0.9297 0.1251  -0.0476 -0.0608 278 SER A CA  
1815 C C   . SER A 261 ? 0.5576 1.0830 0.9401 0.1518  -0.0777 -0.0588 278 SER A C   
1816 O O   . SER A 261 ? 0.6095 1.1251 0.9720 0.1401  -0.0822 -0.0559 278 SER A O   
1817 C CB  . SER A 261 ? 0.4895 1.1057 0.9445 0.1305  -0.0437 -0.0812 278 SER A CB  
1818 O OG  . SER A 261 ? 0.4551 1.0804 0.9353 0.1040  -0.0156 -0.0836 278 SER A OG  
1819 N N   . SER A 262 ? 0.5111 1.0314 0.8831 0.1887  -0.0982 -0.0603 279 SER A N   
1820 C CA  . SER A 262 ? 0.5600 1.0694 0.8971 0.2212  -0.1288 -0.0606 279 SER A CA  
1821 C C   . SER A 262 ? 0.6392 1.0622 0.9214 0.2188  -0.1386 -0.0414 279 SER A C   
1822 O O   . SER A 262 ? 0.7125 1.1202 0.9598 0.2344  -0.1604 -0.0402 279 SER A O   
1823 C CB  . SER A 262 ? 0.5767 1.1012 0.9145 0.2644  -0.1466 -0.0683 279 SER A CB  
1824 O OG  . SER A 262 ? 0.5817 1.0465 0.9040 0.2691  -0.1419 -0.0561 279 SER A OG  
1825 N N   . ILE A 263 ? 0.5944 0.9626 0.8673 0.1986  -0.1229 -0.0269 280 ILE A N   
1826 C CA  . ILE A 263 ? 0.6374 0.9243 0.8568 0.1931  -0.1305 -0.0094 280 ILE A CA  
1827 C C   . ILE A 263 ? 0.6201 0.8888 0.8399 0.1519  -0.1094 -0.0005 280 ILE A C   
1828 O O   . ILE A 263 ? 0.6482 0.8961 0.8386 0.1428  -0.1164 0.0034  280 ILE A O   
1829 C CB  . ILE A 263 ? 0.6542 0.8848 0.8512 0.2034  -0.1323 0.0013  280 ILE A CB  
1830 C CG1 . ILE A 263 ? 0.6749 0.9192 0.8687 0.2463  -0.1519 -0.0078 280 ILE A CG1 
1831 C CG2 . ILE A 263 ? 0.7055 0.8523 0.8416 0.1941  -0.1404 0.0182  280 ILE A CG2 
1832 C CD1 . ILE A 263 ? 0.7304 0.9675 0.8858 0.2802  -0.1816 -0.0122 280 ILE A CD1 
1833 N N   . HIS A 264 ? 0.5769 0.8529 0.8281 0.1286  -0.0837 0.0025  281 HIS A N   
1834 C CA  . HIS A 264 ? 0.5627 0.8190 0.8135 0.0934  -0.0622 0.0115  281 HIS A CA  
1835 C C   . HIS A 264 ? 0.5465 0.8435 0.8148 0.0744  -0.0518 0.0024  281 HIS A C   
1836 O O   . HIS A 264 ? 0.5841 0.8561 0.8311 0.0543  -0.0465 0.0089  281 HIS A O   
1837 C CB  . HIS A 264 ? 0.5240 0.7801 0.8032 0.0787  -0.0388 0.0164  281 HIS A CB  
1838 C CG  . HIS A 264 ? 0.5412 0.7530 0.7998 0.0897  -0.0463 0.0268  281 HIS A CG  
1839 N ND1 . HIS A 264 ? 0.5790 0.7308 0.7931 0.0817  -0.0527 0.0406  281 HIS A ND1 
1840 C CD2 . HIS A 264 ? 0.5291 0.7465 0.8024 0.1056  -0.0476 0.0249  281 HIS A CD2 
1841 C CE1 . HIS A 264 ? 0.5905 0.7125 0.7917 0.0913  -0.0579 0.0468  281 HIS A CE1 
1842 N NE2 . HIS A 264 ? 0.5602 0.7204 0.7971 0.1068  -0.0552 0.0377  281 HIS A NE2 
1843 N N   . PHE A 265 ? 0.5192 0.8783 0.8239 0.0786  -0.0479 -0.0130 282 PHE A N   
1844 C CA  . PHE A 265 ? 0.5067 0.9053 0.8258 0.0573  -0.0368 -0.0229 282 PHE A CA  
1845 C C   . PHE A 265 ? 0.5436 0.9475 0.8354 0.0666  -0.0596 -0.0266 282 PHE A C   
1846 O O   . PHE A 265 ? 0.5559 0.9602 0.8379 0.0443  -0.0527 -0.0272 282 PHE A O   
1847 C CB  . PHE A 265 ? 0.4718 0.9358 0.8337 0.0552  -0.0255 -0.0396 282 PHE A CB  
1848 C CG  . PHE A 265 ? 0.4654 0.9713 0.8373 0.0316  -0.0151 -0.0516 282 PHE A CG  
1849 C CD1 . PHE A 265 ? 0.4541 0.9430 0.8256 -0.0009 0.0111  -0.0481 282 PHE A CD1 
1850 C CD2 . PHE A 265 ? 0.4744 1.0372 0.8537 0.0423  -0.0317 -0.0670 282 PHE A CD2 
1851 C CE1 . PHE A 265 ? 0.4546 0.9756 0.8290 -0.0247 0.0215  -0.0594 282 PHE A CE1 
1852 C CE2 . PHE A 265 ? 0.4716 1.0739 0.8574 0.0169  -0.0222 -0.0786 282 PHE A CE2 
1853 C CZ  . PHE A 265 ? 0.4630 1.0410 0.8443 -0.0178 0.0049  -0.0747 282 PHE A CZ  
1854 N N   . GLU A 266 ? 0.7760 1.1820 1.0529 0.1009  -0.0871 -0.0292 283 GLU A N   
1855 C CA  . GLU A 266 ? 0.8689 1.2777 1.1157 0.1161  -0.1126 -0.0322 283 GLU A CA  
1856 C C   . GLU A 266 ? 0.9959 1.3313 1.1917 0.1049  -0.1175 -0.0162 283 GLU A C   
1857 O O   . GLU A 266 ? 1.0809 1.4140 1.2522 0.1004  -0.1284 -0.0171 283 GLU A O   
1858 C CB  . GLU A 266 ? 0.8603 1.2842 1.0995 0.1609  -0.1409 -0.0384 283 GLU A CB  
1859 C CG  . GLU A 266 ? 0.7528 1.2638 1.0410 0.1723  -0.1393 -0.0580 283 GLU A CG  
1860 C CD  . GLU A 266 ? 0.7407 1.3167 1.0506 0.1505  -0.1335 -0.0718 283 GLU A CD  
1861 O OE1 . GLU A 266 ? 0.8240 1.3952 1.1058 0.1527  -0.1499 -0.0711 283 GLU A OE1 
1862 O OE2 . GLU A 266 ? 0.6482 1.2772 0.9992 0.1294  -0.1123 -0.0834 283 GLU A OE2 
1863 N N   . ALA A 267 ? 0.6572 0.9346 0.8362 0.0989  -0.1093 -0.0020 284 ALA A N   
1864 C CA  . ALA A 267 ? 0.6933 0.9028 0.8254 0.0820  -0.1095 0.0127  284 ALA A CA  
1865 C C   . ALA A 267 ? 0.6733 0.8935 0.8162 0.0454  -0.0866 0.0126  284 ALA A C   
1866 O O   . ALA A 267 ? 0.7069 0.8944 0.8133 0.0325  -0.0911 0.0182  284 ALA A O   
1867 C CB  . ALA A 267 ? 0.6971 0.8539 0.8149 0.0787  -0.1024 0.0259  284 ALA A CB  
1868 N N   . TYR A 268 ? 0.6600 0.9221 0.8493 0.0290  -0.0616 0.0060  285 TYR A N   
1869 C CA  . TYR A 268 ? 0.6186 0.8912 0.8177 -0.0035 -0.0380 0.0042  285 TYR A CA  
1870 C C   . TYR A 268 ? 0.6707 0.9823 0.8683 -0.0072 -0.0467 -0.0079 285 TYR A C   
1871 O O   . TYR A 268 ? 0.7104 1.0067 0.8877 -0.0292 -0.0399 -0.0060 285 TYR A O   
1872 C CB  . TYR A 268 ? 0.5576 0.8574 0.7997 -0.0172 -0.0095 0.0004  285 TYR A CB  
1873 C CG  . TYR A 268 ? 0.5460 0.8526 0.7940 -0.0481 0.0161  -0.0024 285 TYR A CG  
1874 C CD1 . TYR A 268 ? 0.5515 0.8174 0.7836 -0.0673 0.0337  0.0088  285 TYR A CD1 
1875 C CD2 . TYR A 268 ? 0.5335 0.8872 0.8002 -0.0587 0.0235  -0.0170 285 TYR A CD2 
1876 C CE1 . TYR A 268 ? 0.5461 0.8143 0.7797 -0.0926 0.0577  0.0059  285 TYR A CE1 
1877 C CE2 . TYR A 268 ? 0.5305 0.8825 0.7953 -0.0872 0.0476  -0.0197 285 TYR A CE2 
1878 C CZ  . TYR A 268 ? 0.5375 0.8447 0.7852 -0.1023 0.0645  -0.0080 285 TYR A CZ  
1879 O OH  . TYR A 268 ? 0.5393 0.8411 0.7816 -0.1279 0.0891  -0.0110 285 TYR A OH  
1880 N N   . ARG A 269 ? 0.9159 1.2810 1.1351 0.0134  -0.0612 -0.0211 286 ARG A N   
1881 C CA  . ARG A 269 ? 0.9461 1.3610 1.1683 0.0101  -0.0707 -0.0346 286 ARG A CA  
1882 C C   . ARG A 269 ? 1.1049 1.4867 1.2794 0.0169  -0.0943 -0.0288 286 ARG A C   
1883 O O   . ARG A 269 ? 1.1531 1.5457 1.3162 -0.0032 -0.0920 -0.0329 286 ARG A O   
1884 C CB  . ARG A 269 ? 0.8777 1.3611 1.1316 0.0351  -0.0848 -0.0503 286 ARG A CB  
1885 C CG  . ARG A 269 ? 0.8804 1.4290 1.1437 0.0271  -0.0918 -0.0666 286 ARG A CG  
1886 C CD  . ARG A 269 ? 0.7561 1.3863 1.0644 0.0338  -0.0897 -0.0853 286 ARG A CD  
1887 N NE  . ARG A 269 ? 0.7416 1.3972 1.0566 0.0775  -0.1157 -0.0899 286 ARG A NE  
1888 C CZ  . ARG A 269 ? 0.6487 1.3823 1.0002 0.0899  -0.1196 -0.1076 286 ARG A CZ  
1889 N NH1 . ARG A 269 ? 0.6202 1.4112 1.0021 0.0584  -0.0988 -0.1222 286 ARG A NH1 
1890 N NH2 . ARG A 269 ? 0.6616 1.4145 1.0160 0.1331  -0.1433 -0.1115 286 ARG A NH2 
1891 N N   . VAL A 270 ? 0.8725 1.2101 1.0148 0.0446  -0.1168 -0.0193 287 VAL A N   
1892 C CA  . VAL A 270 ? 0.9970 1.2939 1.0857 0.0550  -0.1419 -0.0130 287 VAL A CA  
1893 C C   . VAL A 270 ? 1.0482 1.2895 1.1040 0.0213  -0.1269 -0.0015 287 VAL A C   
1894 O O   . VAL A 270 ? 1.0890 1.3186 1.1122 0.0138  -0.1378 -0.0013 287 VAL A O   
1895 C CB  . VAL A 270 ? 1.0017 1.2509 1.0548 0.0917  -0.1673 -0.0047 287 VAL A CB  
1896 C CG1 . VAL A 270 ? 1.0839 1.2694 1.0695 0.0971  -0.1894 0.0052  287 VAL A CG1 
1897 C CG2 . VAL A 270 ? 0.9181 1.2245 0.9959 0.1308  -0.1872 -0.0177 287 VAL A CG2 
1898 N N   . LYS A 271 ? 1.0707 1.2816 1.1359 0.0010  -0.1016 0.0074  288 LYS A N   
1899 C CA  . LYS A 271 ? 1.0509 1.2147 1.0890 -0.0307 -0.0845 0.0175  288 LYS A CA  
1900 C C   . LYS A 271 ? 1.0005 1.1953 1.0509 -0.0585 -0.0675 0.0093  288 LYS A C   
1901 O O   . LYS A 271 ? 1.0362 1.2022 1.0505 -0.0750 -0.0694 0.0129  288 LYS A O   
1902 C CB  . LYS A 271 ? 0.9538 1.0928 1.0071 -0.0438 -0.0604 0.0267  288 LYS A CB  
1903 N N   . ARG A 272 ? 0.8004 1.0500 0.8975 -0.0654 -0.0504 -0.0019 289 ARG A N   
1904 C CA  . ARG A 272 ? 0.7565 1.0318 0.8626 -0.0943 -0.0311 -0.0104 289 ARG A CA  
1905 C C   . ARG A 272 ? 0.8214 1.1339 0.9162 -0.0900 -0.0530 -0.0213 289 ARG A C   
1906 O O   . ARG A 272 ? 0.8006 1.1733 0.9250 -0.0937 -0.0500 -0.0357 289 ARG A O   
1907 C CB  . ARG A 272 ? 0.7088 1.0232 0.8608 -0.1047 -0.0050 -0.0188 289 ARG A CB  
1908 N N   . LYS B 2   ? 0.5647 1.2733 1.7677 -0.0687 -0.2935 -0.2393 19  LYS B N   
1909 C CA  . LYS B 2   ? 0.5499 1.2050 1.7393 -0.0792 -0.2665 -0.2498 19  LYS B CA  
1910 C C   . LYS B 2   ? 0.5175 1.1178 1.7493 -0.0836 -0.2152 -0.2076 19  LYS B C   
1911 O O   . LYS B 2   ? 0.5367 1.1118 1.8340 -0.1005 -0.1973 -0.2185 19  LYS B O   
1912 C CB  . LYS B 2   ? 0.5985 1.2511 1.8109 -0.1016 -0.2818 -0.3123 19  LYS B CB  
1913 N N   . GLN B 3   ? 0.6644 1.2447 1.8543 -0.0670 -0.1914 -0.1593 20  GLN B N   
1914 C CA  . GLN B 3   ? 0.6364 1.1645 1.8469 -0.0684 -0.1444 -0.1158 20  GLN B CA  
1915 C C   . GLN B 3   ? 0.6204 1.1081 1.7818 -0.0637 -0.1219 -0.0991 20  GLN B C   
1916 O O   . GLN B 3   ? 0.6482 1.1438 1.7370 -0.0526 -0.1357 -0.1056 20  GLN B O   
1917 C CB  . GLN B 3   ? 0.6166 1.1543 1.8248 -0.0541 -0.1300 -0.0694 20  GLN B CB  
1918 C CG  . GLN B 3   ? 0.6384 1.2274 1.8910 -0.0540 -0.1566 -0.0835 20  GLN B CG  
1919 C CD  . GLN B 3   ? 0.6302 1.2138 1.9064 -0.0457 -0.1296 -0.0409 20  GLN B CD  
1920 O OE1 . GLN B 3   ? 0.6090 1.1489 1.8605 -0.0402 -0.0912 -0.0012 20  GLN B OE1 
1921 N NE2 . GLN B 3   ? 0.6520 1.2813 1.9751 -0.0447 -0.1497 -0.0504 20  GLN B NE2 
1922 N N   . GLY B 4   ? 0.4236 0.8598 1.6073 -0.0695 -0.0857 -0.0752 21  GLY B N   
1923 C CA  . GLY B 4   ? 0.4044 0.8031 1.5499 -0.0653 -0.0645 -0.0579 21  GLY B CA  
1924 C C   . GLY B 4   ? 0.3739 0.7635 1.4620 -0.0490 -0.0443 -0.0072 21  GLY B C   
1925 O O   . GLY B 4   ? 0.3738 0.7425 1.4698 -0.0464 -0.0191 0.0304  21  GLY B O   
1926 N N   . PHE B 5   ? 0.3723 0.7566 1.3634 -0.0366 -0.0513 -0.0076 22  PHE B N   
1927 C CA  . PHE B 5   ? 0.3572 0.7218 1.2724 -0.0219 -0.0304 0.0351  22  PHE B CA  
1928 C C   . PHE B 5   ? 0.3530 0.6789 1.2205 -0.0204 -0.0129 0.0451  22  PHE B C   
1929 O O   . PHE B 5   ? 0.3627 0.6839 1.1986 -0.0213 -0.0240 0.0161  22  PHE B O   
1930 C CB  . PHE B 5   ? 0.3639 0.7503 1.2032 -0.0073 -0.0477 0.0322  22  PHE B CB  
1931 N N   . GLU B 6   ? 0.6133 0.9137 1.4760 -0.0177 0.0145  0.0859  23  GLU B N   
1932 C CA  . GLU B 6   ? 0.6248 0.8942 1.4512 -0.0154 0.0287  0.0997  23  GLU B CA  
1933 C C   . GLU B 6   ? 0.6472 0.9109 1.3745 -0.0054 0.0312  0.1072  23  GLU B C   
1934 O O   . GLU B 6   ? 0.6462 0.9175 1.3314 0.0014  0.0350  0.1213  23  GLU B O   
1935 C CB  . GLU B 6   ? 0.6055 0.8516 1.4646 -0.0165 0.0549  0.1408  23  GLU B CB  
1936 C CG  . GLU B 6   ? 0.5896 0.8357 1.5522 -0.0273 0.0601  0.1380  23  GLU B CG  
1937 C CD  . GLU B 6   ? 0.5889 0.8057 1.5679 -0.0259 0.0899  0.1836  23  GLU B CD  
1938 O OE1 . GLU B 6   ? 0.5902 0.7951 1.6203 -0.0309 0.0986  0.1863  23  GLU B OE1 
1939 O OE2 . GLU B 6   ? 0.5985 0.7983 1.5241 -0.0182 0.1031  0.2142  23  GLU B OE2 
1940 N N   . PHE B 7   ? 0.3375 0.5872 1.0345 -0.0047 0.0312  0.0971  24  PHE B N   
1941 C CA  . PHE B 7   ? 0.3350 0.5780 0.9474 0.0019  0.0366  0.1015  24  PHE B CA  
1942 C C   . PHE B 7   ? 0.3342 0.5615 0.9421 0.0016  0.0425  0.1037  24  PHE B C   
1943 O O   . PHE B 7   ? 0.3394 0.5650 0.9883 -0.0014 0.0352  0.0805  24  PHE B O   
1944 C CB  . PHE B 7   ? 0.3445 0.6018 0.9127 0.0048  0.0218  0.0701  24  PHE B CB  
1945 C CG  . PHE B 7   ? 0.3465 0.5950 0.8303 0.0110  0.0325  0.0772  24  PHE B CG  
1946 C CD1 . PHE B 7   ? 0.3430 0.5852 0.7900 0.0158  0.0475  0.1068  24  PHE B CD1 
1947 C CD2 . PHE B 7   ? 0.3563 0.6007 0.8007 0.0110  0.0311  0.0524  24  PHE B CD2 
1948 C CE1 . PHE B 7   ? 0.3491 0.5800 0.7239 0.0195  0.0605  0.1108  24  PHE B CE1 
1949 C CE2 . PHE B 7   ? 0.3615 0.5960 0.7346 0.0148  0.0447  0.0581  24  PHE B CE2 
1950 C CZ  . PHE B 7   ? 0.3580 0.5851 0.6973 0.0185  0.0591  0.0869  24  PHE B CZ  
1951 N N   . ASN B 8   ? 0.5081 0.7256 1.0692 0.0049  0.0555  0.1299  25  ASN B N   
1952 C CA  . ASN B 8   ? 0.5109 0.7201 1.0725 0.0063  0.0581  0.1369  25  ASN B CA  
1953 C C   . ASN B 8   ? 0.5269 0.7385 1.0230 0.0071  0.0609  0.1271  25  ASN B C   
1954 O O   . ASN B 8   ? 0.5285 0.7378 0.9689 0.0069  0.0707  0.1403  25  ASN B O   
1955 C CB  . ASN B 8   ? 0.5024 0.7008 1.0753 0.0084  0.0689  0.1781  25  ASN B CB  
1956 C CG  . ASN B 8   ? 0.4956 0.6874 1.1400 0.0066  0.0722  0.1905  25  ASN B CG  
1957 O OD1 . ASN B 8   ? 0.4934 0.6862 1.1978 0.0036  0.0641  0.1677  25  ASN B OD1 
1958 N ND2 . ASN B 8   ? 0.4939 0.6775 1.1338 0.0072  0.0872  0.2247  25  ASN B ND2 
1959 N N   . ILE B 9   ? 0.3313 0.5460 0.8390 0.0071  0.0555  0.1022  26  ILE B N   
1960 C CA  . ILE B 9   ? 0.3313 0.5496 0.7896 0.0062  0.0608  0.0903  26  ILE B CA  
1961 C C   . ILE B 9   ? 0.3307 0.5538 0.8147 0.0085  0.0588  0.0986  26  ILE B C   
1962 O O   . ILE B 9   ? 0.3329 0.5558 0.8766 0.0122  0.0527  0.0927  26  ILE B O   
1963 C CB  . ILE B 9   ? 0.3385 0.5593 0.7820 0.0048  0.0599  0.0516  26  ILE B CB  
1964 C CG1 . ILE B 9   ? 0.3458 0.5671 0.7662 0.0054  0.0559  0.0446  26  ILE B CG1 
1965 C CG2 . ILE B 9   ? 0.3419 0.5637 0.7359 0.0025  0.0715  0.0408  26  ILE B CG2 
1966 C CD1 . ILE B 9   ? 0.3644 0.5882 0.7608 0.0054  0.0529  0.0083  26  ILE B CD1 
1967 N N   . MET B 10  ? 0.3314 0.5599 0.7737 0.0067  0.0635  0.1115  27  MET B N   
1968 C CA  . MET B 10  ? 0.3340 0.5753 0.7984 0.0099  0.0570  0.1191  27  MET B CA  
1969 C C   . MET B 10  ? 0.3320 0.5860 0.7737 0.0047  0.0621  0.0929  27  MET B C   
1970 O O   . MET B 10  ? 0.3340 0.5857 0.7193 -0.0030 0.0731  0.0867  27  MET B O   
1971 C CB  . MET B 10  ? 0.3447 0.5880 0.7855 0.0111  0.0548  0.1556  27  MET B CB  
1972 C CG  . MET B 10  ? 0.3527 0.6174 0.7969 0.0133  0.0446  0.1616  27  MET B CG  
1973 S SD  . MET B 10  ? 0.3789 0.6473 0.7854 0.0154  0.0387  0.2038  27  MET B SD  
1974 C CE  . MET B 10  ? 0.3915 0.6457 0.8608 0.0302  0.0330  0.2379  27  MET B CE  
1975 N N   . VAL B 11  ? 0.3310 0.5967 0.8220 0.0090  0.0573  0.0775  28  VAL B N   
1976 C CA  . VAL B 11  ? 0.3306 0.6116 0.8133 0.0038  0.0645  0.0528  28  VAL B CA  
1977 C C   . VAL B 11  ? 0.3331 0.6401 0.8294 0.0051  0.0530  0.0688  28  VAL B C   
1978 O O   . VAL B 11  ? 0.3374 0.6543 0.8807 0.0162  0.0374  0.0906  28  VAL B O   
1979 C CB  . VAL B 11  ? 0.3322 0.6132 0.8619 0.0071  0.0699  0.0209  28  VAL B CB  
1980 C CG1 . VAL B 11  ? 0.3390 0.5997 0.8359 0.0032  0.0808  -0.0023 28  VAL B CG1 
1981 C CG2 . VAL B 11  ? 0.3336 0.6165 0.9401 0.0191  0.0576  0.0321  28  VAL B CG2 
1982 N N   . VAL B 12  ? 0.3355 0.6538 0.7904 -0.0061 0.0605  0.0584  29  VAL B N   
1983 C CA  . VAL B 12  ? 0.3423 0.6916 0.8045 -0.0081 0.0469  0.0676  29  VAL B CA  
1984 C C   . VAL B 12  ? 0.3413 0.7090 0.8047 -0.0201 0.0595  0.0349  29  VAL B C   
1985 O O   . VAL B 12  ? 0.3421 0.6906 0.7664 -0.0305 0.0832  0.0138  29  VAL B O   
1986 C CB  . VAL B 12  ? 0.3557 0.7019 0.7596 -0.0138 0.0423  0.0925  29  VAL B CB  
1987 C CG1 . VAL B 12  ? 0.3624 0.6940 0.7731 -0.0014 0.0316  0.1286  29  VAL B CG1 
1988 C CG2 . VAL B 12  ? 0.3570 0.6791 0.6959 -0.0273 0.0661  0.0791  29  VAL B CG2 
1989 N N   . GLY B 13  ? 0.4742 0.8797 0.9859 -0.0177 0.0444  0.0320  30  GLY B N   
1990 C CA  . GLY B 13  ? 0.4630 0.8915 0.9903 -0.0302 0.0568  0.0000  30  GLY B CA  
1991 C C   . GLY B 13  ? 0.4499 0.9256 1.0541 -0.0218 0.0353  -0.0008 30  GLY B C   
1992 O O   . GLY B 13  ? 0.4490 0.9362 1.0924 -0.0037 0.0111  0.0261  30  GLY B O   
1993 N N   . GLN B 14  ? 0.4758 0.9795 1.1060 -0.0342 0.0455  -0.0303 31  GLN B N   
1994 C CA  . GLN B 14  ? 0.4576 1.0144 1.1694 -0.0266 0.0247  -0.0342 31  GLN B CA  
1995 C C   . GLN B 14  ? 0.4224 0.9769 1.2100 -0.0071 0.0283  -0.0367 31  GLN B C   
1996 O O   . GLN B 14  ? 0.4168 0.9299 1.1902 -0.0048 0.0512  -0.0459 31  GLN B O   
1997 C CB  . GLN B 14  ? 0.4431 1.0302 1.1710 -0.0478 0.0398  -0.0698 31  GLN B CB  
1998 C CG  . GLN B 14  ? 0.4747 1.0852 1.1584 -0.0654 0.0242  -0.0686 31  GLN B CG  
1999 C CD  . GLN B 14  ? 0.4530 1.1101 1.1833 -0.0844 0.0293  -0.1035 31  GLN B CD  
2000 O OE1 . GLN B 14  ? 0.4254 1.1264 1.2436 -0.0760 0.0190  -0.1134 31  GLN B OE1 
2001 N NE2 . GLN B 14  ? 0.4619 1.1094 1.1396 -0.1105 0.0473  -0.1232 31  GLN B NE2 
2002 N N   . SER B 15  ? 0.3389 0.9392 1.2081 0.0074  0.0049  -0.0293 32  SER B N   
2003 C CA  . SER B 15  ? 0.3363 0.9355 1.2878 0.0286  0.0077  -0.0290 32  SER B CA  
2004 C C   . SER B 15  ? 0.3341 0.9180 1.3091 0.0202  0.0469  -0.0717 32  SER B C   
2005 O O   . SER B 15  ? 0.3403 0.9439 1.3182 0.0052  0.0603  -0.0979 32  SER B O   
2006 C CB  . SER B 15  ? 0.3486 1.0006 1.3771 0.0478  -0.0263 -0.0092 32  SER B CB  
2007 O OG  . SER B 15  ? 0.3598 1.0312 1.3564 0.0541  -0.0629 0.0298  32  SER B OG  
2008 N N   . GLY B 16  ? 0.3391 0.8781 1.3132 0.0286  0.0654  -0.0780 33  GLY B N   
2009 C CA  . GLY B 16  ? 0.3552 0.8687 1.3349 0.0233  0.1006  -0.1154 33  GLY B CA  
2010 C C   . GLY B 16  ? 0.3517 0.8410 1.2639 0.0025  0.1348  -0.1426 33  GLY B C   
2011 O O   . GLY B 16  ? 0.3712 0.8497 1.2787 -0.0066 0.1645  -0.1729 33  GLY B O   
2012 N N   . LEU B 17  ? 0.3416 0.8104 1.1830 -0.0044 0.1301  -0.1272 34  LEU B N   
2013 C CA  . LEU B 17  ? 0.3520 0.7868 1.1082 -0.0212 0.1592  -0.1446 34  LEU B CA  
2014 C C   . LEU B 17  ? 0.3652 0.7556 1.0857 -0.0161 0.1744  -0.1550 34  LEU B C   
2015 O O   . LEU B 17  ? 0.3806 0.7410 1.0271 -0.0258 0.1963  -0.1662 34  LEU B O   
2016 C CB  . LEU B 17  ? 0.3470 0.7761 1.0306 -0.0315 0.1460  -0.1218 34  LEU B CB  
2017 C CG  . LEU B 17  ? 0.3446 0.8125 1.0399 -0.0447 0.1390  -0.1232 34  LEU B CG  
2018 C CD1 . LEU B 17  ? 0.3472 0.7998 0.9626 -0.0561 0.1327  -0.1055 34  LEU B CD1 
2019 C CD2 . LEU B 17  ? 0.3555 0.8323 1.0714 -0.0594 0.1743  -0.1592 34  LEU B CD2 
2020 N N   . GLY B 18  ? 0.3642 0.7509 1.1383 -0.0007 0.1623  -0.1514 35  GLY B N   
2021 C CA  . GLY B 18  ? 0.3813 0.7309 1.1315 0.0024  0.1742  -0.1677 35  GLY B CA  
2022 C C   . GLY B 18  ? 0.3746 0.7020 1.0777 0.0045  0.1529  -0.1422 35  GLY B C   
2023 O O   . GLY B 18  ? 0.3901 0.6891 1.0442 0.0015  0.1610  -0.1552 35  GLY B O   
2024 N N   . LYS B 19  ? 0.3857 0.7283 1.1037 0.0098  0.1257  -0.1061 36  LYS B N   
2025 C CA  . LYS B 19  ? 0.3799 0.7035 1.0602 0.0115  0.1083  -0.0789 36  LYS B CA  
2026 C C   . LYS B 19  ? 0.3879 0.6906 1.1076 0.0203  0.1041  -0.0833 36  LYS B C   
2027 O O   . LYS B 19  ? 0.3985 0.6782 1.0775 0.0161  0.1050  -0.0889 36  LYS B O   
2028 C CB  . LYS B 19  ? 0.3671 0.7111 1.0549 0.0158  0.0838  -0.0394 36  LYS B CB  
2029 C CG  . LYS B 19  ? 0.3634 0.7262 1.0052 0.0036  0.0857  -0.0368 36  LYS B CG  
2030 C CD  . LYS B 19  ? 0.3603 0.7392 0.9931 0.0068  0.0605  0.0008  36  LYS B CD  
2031 C CE  . LYS B 19  ? 0.3628 0.7675 1.0726 0.0238  0.0383  0.0207  36  LYS B CE  
2032 N NZ  . LYS B 19  ? 0.3626 0.8071 1.1235 0.0236  0.0370  0.0029  36  LYS B NZ  
2033 N N   . SER B 20  ? 0.3603 0.6723 1.1639 0.0326  0.0993  -0.0814 37  SER B N   
2034 C CA  . SER B 20  ? 0.3724 0.6622 1.2265 0.0402  0.0987  -0.0875 37  SER B CA  
2035 C C   . SER B 20  ? 0.3943 0.6633 1.2311 0.0324  0.1201  -0.1350 37  SER B C   
2036 O O   . SER B 20  ? 0.4069 0.6536 1.2430 0.0300  0.1181  -0.1462 37  SER B O   
2037 C CB  . SER B 20  ? 0.3762 0.6785 1.3284 0.0571  0.0935  -0.0749 37  SER B CB  
2038 O OG  . SER B 20  ? 0.3648 0.6913 1.3252 0.0658  0.0715  -0.0311 37  SER B OG  
2039 N N   . THR B 21  ? 0.5297 0.8073 1.3524 0.0275  0.1412  -0.1640 38  THR B N   
2040 C CA  . THR B 21  ? 0.5742 0.8325 1.3702 0.0207  0.1651  -0.2099 38  THR B CA  
2041 C C   . THR B 21  ? 0.6270 0.8677 1.3290 0.0107  0.1617  -0.2146 38  THR B C   
2042 O O   . THR B 21  ? 0.6766 0.8990 1.3559 0.0068  0.1686  -0.2461 38  THR B O   
2043 C CB  . THR B 21  ? 0.5695 0.8404 1.3646 0.0172  0.1932  -0.2351 38  THR B CB  
2044 O OG1 . THR B 21  ? 0.5296 0.8230 1.4219 0.0283  0.1940  -0.2304 38  THR B OG1 
2045 C CG2 . THR B 21  ? 0.6191 0.8670 1.3797 0.0110  0.2214  -0.2823 38  THR B CG2 
2046 N N   . LEU B 22  ? 0.5510 0.7985 1.1991 0.0072  0.1505  -0.1840 39  LEU B N   
2047 C CA  . LEU B 22  ? 0.5975 0.8310 1.1614 0.0010  0.1469  -0.1830 39  LEU B CA  
2048 C C   . LEU B 22  ? 0.6067 0.8315 1.1859 0.0029  0.1244  -0.1728 39  LEU B C   
2049 O O   . LEU B 22  ? 0.6598 0.8748 1.1908 -0.0008 0.1200  -0.1860 39  LEU B O   
2050 C CB  . LEU B 22  ? 0.5818 0.8224 1.0901 -0.0031 0.1465  -0.1545 39  LEU B CB  
2051 C CG  . LEU B 22  ? 0.6311 0.8562 1.0483 -0.0073 0.1516  -0.1551 39  LEU B CG  
2052 C CD1 . LEU B 22  ? 0.6633 0.8784 1.0330 -0.0114 0.1811  -0.1843 39  LEU B CD1 
2053 C CD2 . LEU B 22  ? 0.6065 0.8344 0.9861 -0.0094 0.1457  -0.1201 39  LEU B CD2 
2054 N N   . ILE B 23  ? 0.4113 0.6411 1.0594 0.0091  0.1104  -0.1484 40  ILE B N   
2055 C CA  . ILE B 23  ? 0.4077 0.6285 1.0808 0.0097  0.0930  -0.1348 40  ILE B CA  
2056 C C   . ILE B 23  ? 0.4363 0.6431 1.1389 0.0061  0.0947  -0.1741 40  ILE B C   
2057 O O   . ILE B 23  ? 0.4470 0.6496 1.1208 0.0002  0.0842  -0.1833 40  ILE B O   
2058 C CB  . ILE B 23  ? 0.3887 0.6137 1.1294 0.0186  0.0827  -0.0970 40  ILE B CB  
2059 C CG1 . ILE B 23  ? 0.3671 0.6075 1.0699 0.0201  0.0768  -0.0595 40  ILE B CG1 
2060 C CG2 . ILE B 23  ? 0.3907 0.6022 1.1663 0.0180  0.0714  -0.0846 40  ILE B CG2 
2061 C CD1 . ILE B 23  ? 0.3582 0.6044 1.1114 0.0302  0.0648  -0.0189 40  ILE B CD1 
2062 N N   . ASN B 24  ? 0.6439 0.8452 1.4068 0.0094  0.1077  -0.1991 41  ASN B N   
2063 C CA  . ASN B 24  ? 0.6941 0.8798 1.4852 0.0040  0.1127  -0.2434 41  ASN B CA  
2064 C C   . ASN B 24  ? 0.7730 0.9572 1.4797 -0.0044 0.1197  -0.2823 41  ASN B C   
2065 O O   . ASN B 24  ? 0.8334 1.0101 1.5309 -0.0120 0.1142  -0.3165 41  ASN B O   
2066 C CB  . ASN B 24  ? 0.6736 0.8505 1.5514 0.0108  0.1299  -0.2618 41  ASN B CB  
2067 C CG  . ASN B 24  ? 0.6770 0.8614 1.5386 0.0134  0.1528  -0.2825 41  ASN B CG  
2068 O OD1 . ASN B 24  ? 0.6823 0.8801 1.4792 0.0117  0.1554  -0.2708 41  ASN B OD1 
2069 N ND2 . ASN B 24  ? 0.6724 0.8466 1.5982 0.0171  0.1730  -0.3144 41  ASN B ND2 
2070 N N   . THR B 25  ? 0.8004 0.9921 1.4454 -0.0033 0.1323  -0.2769 42  THR B N   
2071 C CA  . THR B 25  ? 0.8660 1.0539 1.4181 -0.0085 0.1413  -0.3030 42  THR B CA  
2072 C C   . THR B 25  ? 0.9084 1.1005 1.4028 -0.0109 0.1174  -0.2878 42  THR B C   
2073 O O   . THR B 25  ? 0.9650 1.1546 1.4099 -0.0148 0.1112  -0.3163 42  THR B O   
2074 C CB  . THR B 25  ? 0.8493 1.0413 1.3542 -0.0071 0.1638  -0.2935 42  THR B CB  
2075 O OG1 . THR B 25  ? 0.8141 1.0076 1.3809 -0.0046 0.1861  -0.3099 42  THR B OG1 
2076 C CG2 . THR B 25  ? 0.9049 1.0874 1.3085 -0.0106 0.1766  -0.3149 42  THR B CG2 
2077 N N   . LEU B 26  ? 0.5854 0.7857 1.0871 -0.0077 0.1036  -0.2430 43  LEU B N   
2078 C CA  . LEU B 26  ? 0.6024 0.8086 1.0609 -0.0081 0.0834  -0.2229 43  LEU B CA  
2079 C C   . LEU B 26  ? 0.6234 0.8321 1.1237 -0.0128 0.0627  -0.2416 43  LEU B C   
2080 O O   . LEU B 26  ? 0.6652 0.8821 1.1224 -0.0145 0.0464  -0.2499 43  LEU B O   
2081 C CB  . LEU B 26  ? 0.5282 0.7401 0.9953 -0.0044 0.0782  -0.1733 43  LEU B CB  
2082 C CG  . LEU B 26  ? 0.5237 0.7415 0.9613 -0.0034 0.0610  -0.1471 43  LEU B CG  
2083 C CD1 . LEU B 26  ? 0.5013 0.7187 0.8858 -0.0003 0.0703  -0.1133 43  LEU B CD1 
2084 C CD2 . LEU B 26  ? 0.4735 0.6940 0.9858 -0.0045 0.0465  -0.1294 43  LEU B CD2 
2085 N N   . PHE B 27  ? 0.7302 0.9327 1.3189 -0.0147 0.0635  -0.2482 44  PHE B N   
2086 C CA  . PHE B 27  ? 0.7241 0.9261 1.3685 -0.0220 0.0480  -0.2676 44  PHE B CA  
2087 C C   . PHE B 27  ? 0.7903 0.9893 1.4186 -0.0300 0.0486  -0.3268 44  PHE B C   
2088 O O   . PHE B 27  ? 0.7891 0.9965 1.4260 -0.0384 0.0296  -0.3507 44  PHE B O   
2089 C CB  . PHE B 27  ? 0.6568 0.8471 1.4029 -0.0203 0.0535  -0.2512 44  PHE B CB  
2090 C CG  . PHE B 27  ? 0.5858 0.7799 1.3546 -0.0162 0.0447  -0.1982 44  PHE B CG  
2091 C CD1 . PHE B 27  ? 0.5787 0.7846 1.3238 -0.0202 0.0281  -0.1852 44  PHE B CD1 
2092 C CD2 . PHE B 27  ? 0.5312 0.7185 1.3438 -0.0072 0.0532  -0.1612 44  PHE B CD2 
2093 C CE1 . PHE B 27  ? 0.5223 0.7294 1.2867 -0.0168 0.0250  -0.1378 44  PHE B CE1 
2094 C CE2 . PHE B 27  ? 0.4819 0.6708 1.3055 -0.0035 0.0472  -0.1128 44  PHE B CE2 
2095 C CZ  . PHE B 27  ? 0.4789 0.6756 1.2778 -0.0090 0.0355  -0.1020 44  PHE B CZ  
2096 N N   . LYS B 28  ? 0.9459 1.1348 1.5519 -0.0282 0.0711  -0.3525 45  LYS B N   
2097 C CA  . LYS B 28  ? 0.9774 1.1601 1.5587 -0.0359 0.0770  -0.4113 45  LYS B CA  
2098 C C   . LYS B 28  ? 1.0244 1.2179 1.4913 -0.0354 0.0679  -0.4219 45  LYS B C   
2099 O O   . LYS B 28  ? 1.0313 1.2419 1.4692 -0.0355 0.0412  -0.4073 45  LYS B O   
2100 C CB  . LYS B 28  ? 0.9700 1.1358 1.5767 -0.0333 0.1100  -0.4349 45  LYS B CB  
2101 N N   . ARG B 43  ? 0.6488 0.8222 2.0212 0.0763  0.2543  -0.3056 60  ARG B N   
2102 C CA  . ARG B 43  ? 0.6097 0.8195 1.9608 0.0853  0.2285  -0.2626 60  ARG B CA  
2103 C C   . ARG B 43  ? 0.5778 0.7901 1.9108 0.0913  0.1976  -0.2192 60  ARG B C   
2104 O O   . ARG B 43  ? 0.5919 0.7848 1.9723 0.1006  0.1877  -0.1937 60  ARG B O   
2105 C CB  . ARG B 43  ? 0.6258 0.8539 2.0430 0.1005  0.2229  -0.2383 60  ARG B CB  
2106 C CG  . ARG B 43  ? 0.5927 0.8655 1.9898 0.1083  0.1952  -0.2003 60  ARG B CG  
2107 C CD  . ARG B 43  ? 0.6076 0.8966 2.0712 0.1301  0.1725  -0.1561 60  ARG B CD  
2108 N NE  . ARG B 43  ? 0.5821 0.9205 2.0266 0.1364  0.1443  -0.1248 60  ARG B NE  
2109 C CZ  . ARG B 43  ? 0.5850 0.9457 2.0530 0.1546  0.1128  -0.0763 60  ARG B CZ  
2110 N NH1 . ARG B 43  ? 0.6128 0.9464 2.1242 0.1690  0.1079  -0.0496 60  ARG B NH1 
2111 N NH2 . ARG B 43  ? 0.5652 0.9756 2.0126 0.1576  0.0872  -0.0553 60  ARG B NH2 
2112 N N   . ILE B 44  ? 0.5395 0.7740 1.8040 0.0849  0.1853  -0.2099 61  ILE B N   
2113 C CA  . ILE B 44  ? 0.5101 0.7523 1.7531 0.0899  0.1563  -0.1649 61  ILE B CA  
2114 C C   . ILE B 44  ? 0.5053 0.7762 1.7719 0.1051  0.1317  -0.1172 61  ILE B C   
2115 O O   . ILE B 44  ? 0.4937 0.7987 1.7448 0.1040  0.1284  -0.1177 61  ILE B O   
2116 C CB  . ILE B 44  ? 0.4742 0.7323 1.6375 0.0771  0.1531  -0.1709 61  ILE B CB  
2117 C CG1 . ILE B 44  ? 0.4843 0.7200 1.6211 0.0646  0.1744  -0.2182 61  ILE B CG1 
2118 C CG2 . ILE B 44  ? 0.4478 0.7142 1.5907 0.0816  0.1248  -0.1224 61  ILE B CG2 
2119 C CD1 . ILE B 44  ? 0.4577 0.7058 1.5125 0.0529  0.1709  -0.2214 61  ILE B CD1 
2120 N N   . PRO B 45  ? 0.5193 0.7778 1.8240 0.1189  0.1152  -0.0767 62  PRO B N   
2121 C CA  . PRO B 45  ? 0.5261 0.8132 1.8539 0.1364  0.0903  -0.0302 62  PRO B CA  
2122 C C   . PRO B 45  ? 0.4918 0.8176 1.7593 0.1340  0.0660  -0.0043 62  PRO B C   
2123 O O   . PRO B 45  ? 0.4623 0.7863 1.6722 0.1197  0.0682  -0.0142 62  PRO B O   
2124 C CB  . PRO B 45  ? 0.5545 0.8098 1.9235 0.1488  0.0844  0.0058  62  PRO B CB  
2125 C CG  . PRO B 45  ? 0.5440 0.7641 1.8904 0.1343  0.0968  -0.0131 62  PRO B CG  
2126 C CD  . PRO B 45  ? 0.5352 0.7525 1.8635 0.1181  0.1202  -0.0731 62  PRO B CD  
2127 N N   . LYS B 46  ? 0.5366 0.8995 1.8200 0.1477  0.0428  0.0274  63  LYS B N   
2128 C CA  . LYS B 46  ? 0.5116 0.9153 1.7446 0.1451  0.0178  0.0512  63  LYS B CA  
2129 C C   . LYS B 46  ? 0.5073 0.8942 1.7048 0.1481  0.0032  0.0914  63  LYS B C   
2130 O O   . LYS B 46  ? 0.5379 0.9039 1.7649 0.1636  -0.0039 0.1263  63  LYS B O   
2131 C CB  . LYS B 46  ? 0.5299 0.9819 1.7964 0.1601  -0.0058 0.0717  63  LYS B CB  
2132 C CG  . LYS B 46  ? 0.5119 1.0123 1.7329 0.1570  -0.0347 0.0933  63  LYS B CG  
2133 C CD  . LYS B 46  ? 0.5287 1.0856 1.7879 0.1664  -0.0548 0.0951  63  LYS B CD  
2134 C CE  . LYS B 46  ? 0.5756 1.1284 1.9003 0.1934  -0.0644 0.1218  63  LYS B CE  
2135 N NZ  . LYS B 46  ? 0.6026 1.1470 1.9107 0.2115  -0.0893 0.1765  63  LYS B NZ  
2136 N N   . THR B 47  ? 0.4373 0.8316 1.5725 0.1327  0.0019  0.0875  64  THR B N   
2137 C CA  . THR B 47  ? 0.4323 0.8103 1.5306 0.1330  -0.0078 0.1231  64  THR B CA  
2138 C C   . THR B 47  ? 0.4485 0.8573 1.5324 0.1466  -0.0381 0.1727  64  THR B C   
2139 O O   . THR B 47  ? 0.4322 0.8841 1.4832 0.1401  -0.0535 0.1733  64  THR B O   
2140 C CB  . THR B 47  ? 0.3941 0.7722 1.4321 0.1124  0.0021  0.1033  64  THR B CB  
2141 O OG1 . THR B 47  ? 0.3854 0.7431 1.4283 0.1003  0.0281  0.0542  64  THR B OG1 
2142 C CG2 . THR B 47  ? 0.3928 0.7463 1.4035 0.1126  -0.0013 0.1361  64  THR B CG2 
2143 N N   . ILE B 48  ? 0.4855 0.8718 1.5930 0.1643  -0.0455 0.2135  65  ILE B N   
2144 C CA  . ILE B 48  ? 0.5161 0.9289 1.6064 0.1806  -0.0744 0.2633  65  ILE B CA  
2145 C C   . ILE B 48  ? 0.5221 0.9162 1.5580 0.1796  -0.0784 0.3040  65  ILE B C   
2146 O O   . ILE B 48  ? 0.5410 0.9630 1.5341 0.1865  -0.1022 0.3392  65  ILE B O   
2147 C CB  . ILE B 48  ? 0.5686 0.9720 1.7168 0.2042  -0.0799 0.2891  65  ILE B CB  
2148 N N   . GLU B 49  ? 0.5625 0.9107 1.5992 0.1706  -0.0548 0.2980  66  GLU B N   
2149 C CA  . GLU B 49  ? 0.5914 0.9178 1.5829 0.1689  -0.0526 0.3350  66  GLU B CA  
2150 C C   . GLU B 49  ? 0.5789 0.8908 1.5407 0.1478  -0.0349 0.3060  66  GLU B C   
2151 O O   . GLU B 49  ? 0.5541 0.8575 1.5399 0.1361  -0.0196 0.2591  66  GLU B O   
2152 C CB  . GLU B 49  ? 0.6168 0.8969 1.6435 0.1808  -0.0405 0.3685  66  GLU B CB  
2153 C CG  . GLU B 49  ? 0.6701 0.9604 1.6850 0.2020  -0.0591 0.4215  66  GLU B CG  
2154 C CD  . GLU B 49  ? 0.7179 0.9599 1.7558 0.2099  -0.0406 0.4583  66  GLU B CD  
2155 O OE1 . GLU B 49  ? 0.7028 0.9059 1.7740 0.1973  -0.0145 0.4400  66  GLU B OE1 
2156 O OE2 . GLU B 49  ? 0.7738 1.0191 1.7974 0.2280  -0.0519 0.5041  66  GLU B OE2 
2157 N N   . ILE B 50  ? 0.4832 0.7843 1.3704 0.1387  -0.0347 0.3290  67  ILE B N   
2158 C CA  . ILE B 50  ? 0.4587 0.7366 1.2989 0.1163  -0.0168 0.3034  67  ILE B CA  
2159 C C   . ILE B 50  ? 0.4610 0.6985 1.3594 0.1162  0.0025  0.2991  67  ILE B C   
2160 O O   . ILE B 50  ? 0.4917 0.7052 1.4194 0.1279  0.0076  0.3391  67  ILE B O   
2161 C CB  . ILE B 50  ? 0.4722 0.7478 1.2261 0.1087  -0.0182 0.3317  67  ILE B CB  
2162 C CG1 . ILE B 50  ? 0.4729 0.7882 1.1666 0.1040  -0.0363 0.3270  67  ILE B CG1 
2163 C CG2 . ILE B 50  ? 0.4494 0.7009 1.1689 0.0894  0.0010  0.3095  67  ILE B CG2 
2164 C CD1 . ILE B 50  ? 0.4969 0.8100 1.1043 0.0975  -0.0372 0.3539  67  ILE B CD1 
2165 N N   . LYS B 51  ? 0.4342 0.6640 1.3480 0.1023  0.0141  0.2499  68  LYS B N   
2166 C CA  . LYS B 51  ? 0.4385 0.6351 1.4120 0.0989  0.0301  0.2348  68  LYS B CA  
2167 C C   . LYS B 51  ? 0.4166 0.6047 1.3495 0.0778  0.0384  0.2023  68  LYS B C   
2168 O O   . LYS B 51  ? 0.3947 0.5989 1.2828 0.0670  0.0367  0.1668  68  LYS B O   
2169 C CB  . LYS B 51  ? 0.4406 0.6357 1.4910 0.1059  0.0352  0.2026  68  LYS B CB  
2170 N N   . SER B 52  ? 0.4266 0.5900 1.3781 0.0729  0.0480  0.2162  69  SER B N   
2171 C CA  . SER B 52  ? 0.4099 0.5688 1.3379 0.0551  0.0531  0.1867  69  SER B CA  
2172 C C   . SER B 52  ? 0.4129 0.5592 1.4050 0.0479  0.0591  0.1415  69  SER B C   
2173 O O   . SER B 52  ? 0.4348 0.5598 1.5046 0.0539  0.0675  0.1471  69  SER B O   
2174 C CB  . SER B 52  ? 0.4197 0.5641 1.3384 0.0516  0.0610  0.2222  69  SER B CB  
2175 O OG  . SER B 52  ? 0.4212 0.5768 1.2674 0.0552  0.0574  0.2563  69  SER B OG  
2176 N N   . ILE B 53  ? 0.6568 0.8145 1.6137 0.0352  0.0557  0.0967  70  ILE B N   
2177 C CA  . ILE B 53  ? 0.6700 0.8191 1.6728 0.0261  0.0591  0.0474  70  ILE B CA  
2178 C C   . ILE B 53  ? 0.6771 0.8316 1.6552 0.0111  0.0540  0.0262  70  ILE B C   
2179 O O   . ILE B 53  ? 0.6765 0.8481 1.5805 0.0075  0.0470  0.0215  70  ILE B O   
2180 C CB  . ILE B 53  ? 0.6829 0.8430 1.6678 0.0268  0.0594  0.0062  70  ILE B CB  
2181 C CG1 . ILE B 53  ? 0.6678 0.8305 1.6844 0.0430  0.0625  0.0268  70  ILE B CG1 
2182 C CG2 . ILE B 53  ? 0.7162 0.8654 1.7423 0.0167  0.0644  -0.0478 70  ILE B CG2 
2183 C CD1 . ILE B 53  ? 0.6659 0.8049 1.7780 0.0532  0.0712  0.0419  70  ILE B CD1 
2184 N N   . THR B 54  ? 0.4173 0.5579 1.4626 0.0027  0.0577  0.0134  71  THR B N   
2185 C CA  . THR B 54  ? 0.4143 0.5656 1.4519 -0.0110 0.0501  -0.0030 71  THR B CA  
2186 C C   . THR B 54  ? 0.4342 0.5875 1.5088 -0.0243 0.0443  -0.0629 71  THR B C   
2187 O O   . THR B 54  ? 0.4566 0.5899 1.6052 -0.0270 0.0540  -0.0823 71  THR B O   
2188 C CB  . THR B 54  ? 0.4180 0.5569 1.5041 -0.0130 0.0593  0.0364  71  THR B CB  
2189 O OG1 . THR B 54  ? 0.4077 0.5452 1.4474 -0.0012 0.0646  0.0901  71  THR B OG1 
2190 C CG2 . THR B 54  ? 0.4135 0.5700 1.5025 -0.0267 0.0506  0.0186  71  THR B CG2 
2191 N N   . HIS B 55  ? 0.4340 0.6109 1.4550 -0.0320 0.0287  -0.0921 72  HIS B N   
2192 C CA  . HIS B 55  ? 0.4602 0.6455 1.5016 -0.0456 0.0179  -0.1510 72  HIS B CA  
2193 C C   . HIS B 55  ? 0.4581 0.6729 1.4698 -0.0533 -0.0025 -0.1611 72  HIS B C   
2194 O O   . HIS B 55  ? 0.4396 0.6700 1.3787 -0.0455 -0.0089 -0.1372 72  HIS B O   
2195 C CB  . HIS B 55  ? 0.4765 0.6624 1.4688 -0.0431 0.0184  -0.1902 72  HIS B CB  
2196 C CG  . HIS B 55  ? 0.4882 0.6485 1.5338 -0.0377 0.0375  -0.1963 72  HIS B CG  
2197 N ND1 . HIS B 55  ? 0.4718 0.6266 1.4947 -0.0230 0.0483  -0.1668 72  HIS B ND1 
2198 C CD2 . HIS B 55  ? 0.5176 0.6574 1.6436 -0.0446 0.0480  -0.2293 72  HIS B CD2 
2199 C CE1 . HIS B 55  ? 0.4891 0.6234 1.5778 -0.0187 0.0635  -0.1785 72  HIS B CE1 
2200 N NE2 . HIS B 55  ? 0.5178 0.6395 1.6691 -0.0314 0.0657  -0.2161 72  HIS B NE2 
2201 N N   . ASP B 56  ? 0.4779 0.7014 1.5509 -0.0686 -0.0126 -0.1976 73  ASP B N   
2202 C CA  . ASP B 56  ? 0.4812 0.7401 1.5383 -0.0757 -0.0367 -0.2124 73  ASP B CA  
2203 C C   . ASP B 56  ? 0.5086 0.7882 1.4896 -0.0761 -0.0570 -0.2586 73  ASP B C   
2204 O O   . ASP B 56  ? 0.5424 0.8148 1.5369 -0.0848 -0.0577 -0.3079 73  ASP B O   
2205 C CB  . ASP B 56  ? 0.4965 0.7615 1.6586 -0.0937 -0.0407 -0.2341 73  ASP B CB  
2206 C CG  . ASP B 56  ? 0.4758 0.7214 1.7062 -0.0928 -0.0184 -0.1830 73  ASP B CG  
2207 O OD1 . ASP B 56  ? 0.4497 0.6848 1.6344 -0.0778 -0.0058 -0.1303 73  ASP B OD1 
2208 O OD2 . ASP B 56  ? 0.5040 0.7327 1.8048 -0.1025 -0.0111 -0.1935 73  ASP B OD2 
2209 N N   . ILE B 57  ? 0.7571 1.0599 1.6566 -0.0660 -0.0710 -0.2418 74  ILE B N   
2210 C CA  . ILE B 57  ? 0.8255 1.1455 1.6392 -0.0628 -0.0883 -0.2764 74  ILE B CA  
2211 C C   . ILE B 57  ? 0.8306 1.1923 1.6255 -0.0627 -0.1198 -0.2836 74  ILE B C   
2212 O O   . ILE B 57  ? 0.7937 1.1688 1.5982 -0.0560 -0.1223 -0.2435 74  ILE B O   
2213 C CB  . ILE B 57  ? 0.8607 1.1660 1.5794 -0.0468 -0.0728 -0.2490 74  ILE B CB  
2214 C CG1 . ILE B 57  ? 0.8450 1.1167 1.5903 -0.0450 -0.0446 -0.2368 74  ILE B CG1 
2215 C CG2 . ILE B 57  ? 0.9413 1.2572 1.5700 -0.0434 -0.0841 -0.2841 74  ILE B CG2 
2216 C CD1 . ILE B 57  ? 0.8779 1.1350 1.6575 -0.0540 -0.0378 -0.2867 74  ILE B CD1 
2217 N N   . GLU B 58  ? 0.9742 1.3579 1.7422 -0.0692 -0.1440 -0.3352 75  GLU B N   
2218 C CA  . GLU B 58  ? 0.9845 1.4148 1.7338 -0.0675 -0.1804 -0.3460 75  GLU B CA  
2219 C C   . GLU B 58  ? 1.0543 1.4939 1.6784 -0.0500 -0.1911 -0.3424 75  GLU B C   
2220 O O   . GLU B 58  ? 1.1134 1.5400 1.6752 -0.0507 -0.1873 -0.3756 75  GLU B O   
2221 C CB  . GLU B 58  ? 0.9787 1.4348 1.7902 -0.0883 -0.2062 -0.4086 75  GLU B CB  
2222 N N   . LYS B 60  ? 1.0906 1.5270 1.4528 -0.0081 -0.1919 -0.3072 77  LYS B N   
2223 C CA  . LYS B 60  ? 1.1360 1.6106 1.4569 -0.0068 -0.2309 -0.3444 77  LYS B CA  
2224 C C   . LYS B 60  ? 1.1103 1.6321 1.4632 0.0022  -0.2656 -0.3225 77  LYS B C   
2225 O O   . LYS B 60  ? 1.1200 1.6864 1.4878 -0.0028 -0.3060 -0.3578 77  LYS B O   
2226 C CB  . LYS B 60  ? 1.2135 1.6743 1.4025 0.0085  -0.2243 -0.3458 77  LYS B CB  
2227 N N   . GLY B 61  ? 1.4874 2.0014 1.8537 0.0151  -0.2496 -0.2664 78  GLY B N   
2228 C CA  . GLY B 61  ? 1.4570 2.0133 1.8563 0.0268  -0.2762 -0.2401 78  GLY B CA  
2229 C C   . GLY B 61  ? 1.3685 1.9332 1.8907 0.0145  -0.2697 -0.2254 78  GLY B C   
2230 O O   . GLY B 61  ? 1.3299 1.9414 1.9228 0.0102  -0.3003 -0.2368 78  GLY B O   
2231 N N   . VAL B 62  ? 1.3439 1.8651 1.8922 0.0089  -0.2297 -0.1996 79  VAL B N   
2232 C CA  . VAL B 62  ? 1.2571 1.7782 1.9111 -0.0013 -0.2164 -0.1792 79  VAL B CA  
2233 C C   . VAL B 62  ? 1.2225 1.7081 1.9324 -0.0206 -0.1914 -0.1947 79  VAL B C   
2234 O O   . VAL B 62  ? 1.2555 1.7049 1.9144 -0.0202 -0.1705 -0.1981 79  VAL B O   
2235 C CB  . VAL B 62  ? 1.2293 1.7334 1.8652 0.0146  -0.1902 -0.1195 79  VAL B CB  
2236 N N   . ARG B 63  ? 0.5173 1.0131 1.3366 -0.0367 -0.1921 -0.2027 80  ARG B N   
2237 C CA  . ARG B 63  ? 0.5022 0.9622 1.3833 -0.0527 -0.1668 -0.2117 80  ARG B CA  
2238 C C   . ARG B 63  ? 0.4593 0.8834 1.3386 -0.0446 -0.1304 -0.1554 80  ARG B C   
2239 O O   . ARG B 63  ? 0.4364 0.8699 1.3457 -0.0399 -0.1233 -0.1193 80  ARG B O   
2240 C CB  . ARG B 63  ? 0.5102 0.9922 1.5098 -0.0738 -0.1791 -0.2433 80  ARG B CB  
2241 C CG  . ARG B 63  ? 0.5028 0.9464 1.5811 -0.0900 -0.1518 -0.2516 80  ARG B CG  
2242 C CD  . ARG B 63  ? 0.5260 0.9904 1.7111 -0.1119 -0.1649 -0.2904 80  ARG B CD  
2243 N NE  . ARG B 63  ? 0.5190 0.9866 1.7477 -0.1101 -0.1557 -0.2535 80  ARG B NE  
2244 C CZ  . ARG B 63  ? 0.5123 0.9364 1.7878 -0.1122 -0.1198 -0.2190 80  ARG B CZ  
2245 N NH1 . ARG B 63  ? 0.5114 0.8867 1.7992 -0.1142 -0.0923 -0.2131 80  ARG B NH1 
2246 N NH2 . ARG B 63  ? 0.5117 0.9412 1.8220 -0.1110 -0.1113 -0.1903 80  ARG B NH2 
2247 N N   . MET B 64  ? 0.6928 1.0781 1.5374 -0.0430 -0.1076 -0.1498 81  MET B N   
2248 C CA  . MET B 64  ? 0.6594 1.0129 1.4908 -0.0354 -0.0769 -0.1004 81  MET B CA  
2249 C C   . MET B 64  ? 0.6381 0.9571 1.5181 -0.0426 -0.0550 -0.0981 81  MET B C   
2250 O O   . MET B 64  ? 0.6652 0.9743 1.5538 -0.0488 -0.0571 -0.1345 81  MET B O   
2251 C CB  . MET B 64  ? 0.7021 1.0456 1.4262 -0.0202 -0.0700 -0.0826 81  MET B CB  
2252 C CG  . MET B 64  ? 0.7636 1.0936 1.4358 -0.0204 -0.0696 -0.1144 81  MET B CG  
2253 S SD  . MET B 64  ? 0.8021 1.1111 1.3705 -0.0062 -0.0490 -0.0852 81  MET B SD  
2254 C CE  . MET B 64  ? 0.7229 1.0110 1.3276 -0.0058 -0.0244 -0.0355 81  MET B CE  
2255 N N   . LYS B 65  ? 0.3917 0.6919 1.3025 -0.0405 -0.0330 -0.0542 82  LYS B N   
2256 C CA  . LYS B 65  ? 0.3897 0.6569 1.3414 -0.0424 -0.0122 -0.0410 82  LYS B CA  
2257 C C   . LYS B 65  ? 0.3773 0.6262 1.2549 -0.0299 0.0006  -0.0145 82  LYS B C   
2258 O O   . LYS B 65  ? 0.3638 0.6004 1.2280 -0.0236 0.0163  0.0294  82  LYS B O   
2259 C CB  . LYS B 65  ? 0.3841 0.6402 1.4107 -0.0469 0.0052  -0.0067 82  LYS B CB  
2260 C CG  . LYS B 65  ? 0.3949 0.6175 1.4836 -0.0493 0.0242  0.0033  82  LYS B CG  
2261 C CD  . LYS B 65  ? 0.4056 0.6104 1.5585 -0.0535 0.0432  0.0350  82  LYS B CD  
2262 C CE  . LYS B 65  ? 0.4334 0.5978 1.6483 -0.0543 0.0609  0.0394  82  LYS B CE  
2263 N NZ  . LYS B 65  ? 0.4576 0.6215 1.7277 -0.0667 0.0503  -0.0174 82  LYS B NZ  
2264 N N   . LEU B 66  ? 0.4794 0.7280 1.3097 -0.0275 -0.0053 -0.0438 83  LEU B N   
2265 C CA  . LEU B 66  ? 0.4789 0.7163 1.2421 -0.0178 0.0052  -0.0270 83  LEU B CA  
2266 C C   . LEU B 66  ? 0.4667 0.6822 1.2661 -0.0142 0.0201  -0.0060 83  LEU B C   
2267 O O   . LEU B 66  ? 0.4781 0.6826 1.3364 -0.0174 0.0223  -0.0268 83  LEU B O   
2268 C CB  . LEU B 66  ? 0.5283 0.7720 1.2362 -0.0172 -0.0019 -0.0665 83  LEU B CB  
2269 C CG  . LEU B 66  ? 0.5407 0.7761 1.1820 -0.0096 0.0106  -0.0554 83  LEU B CG  
2270 C CD1 . LEU B 66  ? 0.5192 0.7564 1.1079 -0.0037 0.0168  -0.0159 83  LEU B CD1 
2271 C CD2 . LEU B 66  ? 0.6062 0.8461 1.1927 -0.0097 0.0078  -0.0944 83  LEU B CD2 
2272 N N   . THR B 67  ? 0.4597 0.6695 1.2236 -0.0067 0.0300  0.0349  84  THR B N   
2273 C CA  . THR B 67  ? 0.4517 0.6471 1.2372 0.0001  0.0394  0.0591  84  THR B CA  
2274 C C   . THR B 67  ? 0.4551 0.6562 1.1744 0.0060  0.0412  0.0627  84  THR B C   
2275 O O   . THR B 67  ? 0.4543 0.6616 1.1102 0.0066  0.0434  0.0784  84  THR B O   
2276 C CB  . THR B 67  ? 0.4387 0.6230 1.2472 0.0033  0.0492  0.1075  84  THR B CB  
2277 O OG1 . THR B 67  ? 0.4432 0.6201 1.3256 -0.0038 0.0520  0.1040  84  THR B OG1 
2278 C CG2 . THR B 67  ? 0.4446 0.6172 1.2672 0.0135  0.0547  0.1358  84  THR B CG2 
2279 N N   . VAL B 68  ? 0.4501 0.6492 1.1907 0.0096  0.0424  0.0466  85  VAL B N   
2280 C CA  . VAL B 68  ? 0.4513 0.6594 1.1452 0.0139  0.0450  0.0480  85  VAL B CA  
2281 C C   . VAL B 68  ? 0.4370 0.6443 1.1641 0.0235  0.0453  0.0800  85  VAL B C   
2282 O O   . VAL B 68  ? 0.4361 0.6348 1.2318 0.0294  0.0460  0.0794  85  VAL B O   
2283 C CB  . VAL B 68  ? 0.4769 0.6888 1.1646 0.0116  0.0478  0.0030  85  VAL B CB  
2284 C CG1 . VAL B 68  ? 0.4764 0.6993 1.1226 0.0140  0.0537  0.0043  85  VAL B CG1 
2285 C CG2 . VAL B 68  ? 0.5125 0.7263 1.1603 0.0043  0.0446  -0.0269 85  VAL B CG2 
2286 N N   . ILE B 69  ? 0.4078 0.6244 1.0858 0.0257  0.0444  0.1076  86  ILE B N   
2287 C CA  . ILE B 69  ? 0.4109 0.6325 1.1086 0.0360  0.0397  0.1416  86  ILE B CA  
2288 C C   . ILE B 69  ? 0.4073 0.6500 1.0970 0.0390  0.0356  0.1279  86  ILE B C   
2289 O O   . ILE B 69  ? 0.4084 0.6641 1.0390 0.0322  0.0368  0.1211  86  ILE B O   
2290 C CB  . ILE B 69  ? 0.4216 0.6422 1.0705 0.0360  0.0399  0.1816  86  ILE B CB  
2291 C CG1 . ILE B 69  ? 0.4225 0.6245 1.0826 0.0320  0.0479  0.1945  86  ILE B CG1 
2292 C CG2 . ILE B 69  ? 0.4414 0.6684 1.1055 0.0484  0.0317  0.2189  86  ILE B CG2 
2293 C CD1 . ILE B 69  ? 0.4254 0.6279 1.0178 0.0248  0.0549  0.2039  86  ILE B CD1 
2294 N N   . ASP B 70  ? 0.4448 0.6907 1.2009 0.0491  0.0329  0.1231  87  ASP B N   
2295 C CA  . ASP B 70  ? 0.4379 0.7083 1.2040 0.0531  0.0294  0.1096  87  ASP B CA  
2296 C C   . ASP B 70  ? 0.4445 0.7361 1.2051 0.0629  0.0141  0.1489  87  ASP B C   
2297 O O   . ASP B 70  ? 0.4560 0.7384 1.2382 0.0741  0.0074  0.1877  87  ASP B O   
2298 C CB  . ASP B 70  ? 0.4276 0.6939 1.2730 0.0612  0.0351  0.0856  87  ASP B CB  
2299 C CG  . ASP B 70  ? 0.4204 0.7110 1.2742 0.0610  0.0391  0.0571  87  ASP B CG  
2300 O OD1 . ASP B 70  ? 0.4263 0.7329 1.2203 0.0507  0.0403  0.0483  87  ASP B OD1 
2301 O OD2 . ASP B 70  ? 0.4122 0.7045 1.3369 0.0707  0.0441  0.0427  87  ASP B OD2 
2302 N N   . THR B 71  ? 0.3608 0.6811 1.0914 0.0583  0.0090  0.1384  88  THR B N   
2303 C CA  . THR B 71  ? 0.3752 0.7233 1.0937 0.0654  -0.0100 0.1695  88  THR B CA  
2304 C C   . THR B 71  ? 0.3744 0.7593 1.1424 0.0720  -0.0195 0.1547  88  THR B C   
2305 O O   . THR B 71  ? 0.3589 0.7498 1.1398 0.0636  -0.0061 0.1148  88  THR B O   
2306 C CB  . THR B 71  ? 0.3749 0.7286 1.0053 0.0501  -0.0096 0.1724  88  THR B CB  
2307 O OG1 . THR B 71  ? 0.3572 0.7179 0.9612 0.0346  0.0036  0.1319  88  THR B OG1 
2308 C CG2 . THR B 71  ? 0.3777 0.6984 0.9657 0.0455  0.0008  0.1901  88  THR B CG2 
2309 N N   . PRO B 72  ? 0.4745 0.8858 1.2712 0.0883  -0.0424 0.1879  89  PRO B N   
2310 C CA  . PRO B 72  ? 0.4570 0.9131 1.3060 0.0957  -0.0560 0.1764  89  PRO B CA  
2311 C C   . PRO B 72  ? 0.4657 0.9524 1.2654 0.0755  -0.0570 0.1487  89  PRO B C   
2312 O O   . PRO B 72  ? 0.4991 0.9849 1.2236 0.0635  -0.0617 0.1590  89  PRO B O   
2313 C CB  . PRO B 72  ? 0.4885 0.9651 1.3616 0.1188  -0.0846 0.2269  89  PRO B CB  
2314 C CG  . PRO B 72  ? 0.5179 0.9668 1.3170 0.1152  -0.0852 0.2605  89  PRO B CG  
2315 C CD  . PRO B 72  ? 0.5061 0.9080 1.2894 0.1020  -0.0564 0.2397  89  PRO B CD  
2316 N N   . GLY B 73  ? 0.3714 0.8825 1.2164 0.0708  -0.0488 0.1125  90  GLY B N   
2317 C CA  . GLY B 73  ? 0.3636 0.9014 1.1743 0.0498  -0.0443 0.0826  90  GLY B CA  
2318 C C   . GLY B 73  ? 0.3832 0.9683 1.1794 0.0497  -0.0761 0.1012  90  GLY B C   
2319 O O   . GLY B 73  ? 0.4029 1.0155 1.2419 0.0708  -0.1049 0.1327  90  GLY B O   
2320 N N   . PHE B 74  ? 0.3837 0.9777 1.1182 0.0262  -0.0710 0.0814  91  PHE B N   
2321 C CA  . PHE B 74  ? 0.4073 1.0491 1.1225 0.0206  -0.1008 0.0889  91  PHE B CA  
2322 C C   . PHE B 74  ? 0.3994 1.0834 1.1466 0.0016  -0.0957 0.0459  91  PHE B C   
2323 O O   . PHE B 74  ? 0.3775 1.0520 1.1642 -0.0046 -0.0673 0.0144  91  PHE B O   
2324 C CB  . PHE B 74  ? 0.4259 1.0427 1.0393 0.0075  -0.1000 0.1035  91  PHE B CB  
2325 C CG  . PHE B 74  ? 0.4078 0.9771 0.9641 -0.0129 -0.0617 0.0789  91  PHE B CG  
2326 C CD1 . PHE B 74  ? 0.4051 0.9825 0.9382 -0.0380 -0.0439 0.0413  91  PHE B CD1 
2327 C CD2 . PHE B 74  ? 0.3979 0.9151 0.9267 -0.0065 -0.0434 0.0946  91  PHE B CD2 
2328 C CE1 . PHE B 74  ? 0.3953 0.9266 0.8753 -0.0531 -0.0081 0.0240  91  PHE B CE1 
2329 C CE2 . PHE B 74  ? 0.3857 0.8634 0.8636 -0.0218 -0.0119 0.0754  91  PHE B CE2 
2330 C CZ  . PHE B 74  ? 0.3857 0.8690 0.8370 -0.0437 0.0061  0.0423  91  PHE B CZ  
2331 N N   . GLY B 75  ? 0.4225 1.1531 1.1523 -0.0088 -0.1221 0.0431  92  GLY B N   
2332 C CA  . GLY B 75  ? 0.4192 1.1952 1.1864 -0.0297 -0.1191 0.0009  92  GLY B CA  
2333 C C   . GLY B 75  ? 0.4143 1.2477 1.2945 -0.0126 -0.1395 -0.0030 92  GLY B C   
2334 O O   . GLY B 75  ? 0.4066 1.2787 1.3419 -0.0278 -0.1315 -0.0404 92  GLY B O   
2335 N N   . ASP B 76  ? 0.4322 1.2703 1.3524 0.0195  -0.1633 0.0364  93  ASP B N   
2336 C CA  . ASP B 76  ? 0.4300 1.3179 1.4652 0.0418  -0.1813 0.0387  93  ASP B CA  
2337 C C   . ASP B 76  ? 0.4639 1.4274 1.5277 0.0546  -0.2366 0.0602  93  ASP B C   
2338 O O   . ASP B 76  ? 0.4828 1.4861 1.6107 0.0669  -0.2475 0.0495  93  ASP B O   
2339 C CB  . ASP B 76  ? 0.4258 1.2700 1.4959 0.0714  -0.1709 0.0675  93  ASP B CB  
2340 C CG  . ASP B 76  ? 0.4462 1.2561 1.4540 0.0869  -0.1875 0.1180  93  ASP B CG  
2341 O OD1 . ASP B 76  ? 0.4727 1.2976 1.4085 0.0795  -0.2121 0.1347  93  ASP B OD1 
2342 O OD2 . ASP B 76  ? 0.4421 1.2067 1.4699 0.1052  -0.1731 0.1387  93  ASP B OD2 
2343 N N   . HIS B 77  ? 0.5125 1.4755 1.4873 0.0518  -0.2629 0.0861  94  HIS B N   
2344 C CA  . HIS B 77  ? 0.5569 1.5896 1.5400 0.0657  -0.3196 0.1110  94  HIS B CA  
2345 C C   . HIS B 77  ? 0.5738 1.6585 1.5247 0.0329  -0.3363 0.0717  94  HIS B C   
2346 O O   . HIS B 77  ? 0.5497 1.6138 1.4803 -0.0003 -0.3000 0.0257  94  HIS B O   
2347 C CB  . HIS B 77  ? 0.5975 1.5997 1.5017 0.0867  -0.3402 0.1686  94  HIS B CB  
2348 C CG  . HIS B 77  ? 0.5982 1.5546 1.5420 0.1216  -0.3300 0.2089  94  HIS B CG  
2349 N ND1 . HIS B 77  ? 0.5634 1.4488 1.4956 0.1198  -0.2879 0.2125  94  HIS B ND1 
2350 C CD2 . HIS B 77  ? 0.6456 1.6011 1.6245 0.1571  -0.3497 0.2387  94  HIS B CD2 
2351 C CE1 . HIS B 77  ? 0.5832 1.4329 1.5513 0.1504  -0.2841 0.2434  94  HIS B CE1 
2352 N NE2 . HIS B 77  ? 0.6351 1.5223 1.6285 0.1734  -0.3186 0.2605  94  HIS B NE2 
2353 N N   . ILE B 78  ? 0.8049 1.9563 1.7505 0.0426  -0.3913 0.0903  95  ILE B N   
2354 C CA  . ILE B 78  ? 0.8292 2.0352 1.7413 0.0110  -0.4140 0.0523  95  ILE B CA  
2355 C C   . ILE B 78  ? 0.8871 2.0443 1.6586 -0.0086 -0.4048 0.0576  95  ILE B C   
2356 O O   . ILE B 78  ? 0.9015 2.0636 1.6269 -0.0454 -0.3935 0.0138  95  ILE B O   
2357 C CB  . ILE B 78  ? 0.8800 2.1423 1.8229 0.0308  -0.4730 0.0603  95  ILE B CB  
2358 C CG1 . ILE B 78  ? 0.8717 2.1464 1.9296 0.0668  -0.4766 0.0647  95  ILE B CG1 
2359 C CG2 . ILE B 78  ? 0.9052 2.2175 1.8472 -0.0072 -0.4898 0.0093  95  ILE B CG2 
2360 C CD1 . ILE B 78  ? 0.8244 2.1214 1.9756 0.0482  -0.4406 0.0093  95  ILE B CD1 
2361 N N   . ASN B 79  ? 0.9681 2.0760 1.6768 0.0160  -0.4059 0.1109  96  ASN B N   
2362 C CA  . ASN B 79  ? 1.0261 2.0781 1.6066 0.0013  -0.3889 0.1209  96  ASN B CA  
2363 C C   . ASN B 79  ? 1.0205 1.9831 1.5787 0.0111  -0.3419 0.1443  96  ASN B C   
2364 O O   . ASN B 79  ? 1.0035 1.9489 1.6055 0.0431  -0.3449 0.1852  96  ASN B O   
2365 C CB  . ASN B 79  ? 1.0834 2.1655 1.5941 0.0192  -0.4374 0.1642  96  ASN B CB  
2366 N N   . ASN B 80  ? 0.7239 1.6307 1.2178 -0.0164 -0.2987 0.1178  97  ASN B N   
2367 C CA  . ASN B 80  ? 0.7101 1.5401 1.1955 -0.0110 -0.2538 0.1295  97  ASN B CA  
2368 C C   . ASN B 80  ? 0.7725 1.5448 1.1543 -0.0128 -0.2368 0.1566  97  ASN B C   
2369 O O   . ASN B 80  ? 0.7588 1.4697 1.1268 -0.0126 -0.1997 0.1618  97  ASN B O   
2370 C CB  . ASN B 80  ? 0.6668 1.4745 1.1787 -0.0364 -0.2114 0.0791  97  ASN B CB  
2371 C CG  . ASN B 80  ? 0.6062 1.4629 1.2274 -0.0338 -0.2182 0.0526  97  ASN B CG  
2372 O OD1 . ASN B 80  ? 0.5677 1.4188 1.2596 -0.0105 -0.2152 0.0681  97  ASN B OD1 
2373 N ND2 . ASN B 80  ? 0.5976 1.5022 1.2376 -0.0589 -0.2246 0.0103  97  ASN B ND2 
2374 N N   . GLU B 81  ? 0.6061 2.0234 1.0987 -0.1304 -0.0096 0.0912  98  GLU B N   
2375 C CA  . GLU B 81  ? 0.5971 1.9429 1.0779 -0.0910 -0.0253 0.1109  98  GLU B CA  
2376 C C   . GLU B 81  ? 0.5628 1.8995 1.0534 -0.0316 -0.0088 0.1424  98  GLU B C   
2377 O O   . GLU B 81  ? 0.5602 1.8121 1.0327 -0.0153 -0.0125 0.1645  98  GLU B O   
2378 C CB  . GLU B 81  ? 0.5919 1.9979 1.0863 -0.0679 -0.0435 0.0922  98  GLU B CB  
2379 N N   . ASN B 82  ? 0.9952 2.3837 1.4929 0.0004  0.0067  0.1387  99  ASN B N   
2380 C CA  . ASN B 82  ? 0.9901 2.3407 1.4736 0.0529  0.0188  0.1649  99  ASN B CA  
2381 C C   . ASN B 82  ? 0.9775 2.2815 1.4611 0.0343  0.0355  0.1879  99  ASN B C   
2382 O O   . ASN B 82  ? 0.9686 2.2328 1.4374 0.0720  0.0453  0.2124  99  ASN B O   
2383 C CB  . ASN B 82  ? 1.0097 2.4108 1.4894 0.0917  0.0214  0.1485  99  ASN B CB  
2384 N N   . CYS B 83  ? 1.1095 2.4067 1.5993 -0.0293 0.0377  0.1800  100 CYS B N   
2385 C CA  . CYS B 83  ? 1.1181 2.3353 1.5886 -0.0566 0.0519  0.1988  100 CYS B CA  
2386 C C   . CYS B 83  ? 1.1353 2.2258 1.5709 -0.0803 0.0369  0.2141  100 CYS B C   
2387 O O   . CYS B 83  ? 1.1330 2.1423 1.5513 -0.0792 0.0451  0.2391  100 CYS B O   
2388 C CB  . CYS B 83  ? 1.1405 2.3973 1.6142 -0.1173 0.0636  0.1743  100 CYS B CB  
2389 S SG  . CYS B 83  ? 1.1415 2.5043 1.6381 -0.0833 0.0778  0.1437  100 CYS B SG  
2390 N N   . TRP B 84  ? 0.5051 1.5802 0.9308 -0.0995 0.0124  0.1960  101 TRP B N   
2391 C CA  . TRP B 84  ? 0.5311 1.4913 0.9255 -0.1160 -0.0104 0.2011  101 TRP B CA  
2392 C C   . TRP B 84  ? 0.5029 1.4475 0.9052 -0.0579 -0.0141 0.2164  101 TRP B C   
2393 O O   . TRP B 84  ? 0.5171 1.3751 0.9008 -0.0593 -0.0303 0.2197  101 TRP B O   
2394 C CB  . TRP B 84  ? 0.5740 1.5193 0.9497 -0.1584 -0.0399 0.1714  101 TRP B CB  
2395 N N   . GLN B 85  ? 0.5182 1.5470 0.9444 -0.0085 -0.0008 0.2229  102 GLN B N   
2396 C CA  . GLN B 85  ? 0.4992 1.5242 0.9254 0.0395  -0.0023 0.2355  102 GLN B CA  
2397 C C   . GLN B 85  ? 0.4875 1.4567 0.8996 0.0608  0.0162  0.2684  102 GLN B C   
2398 O O   . GLN B 85  ? 0.4946 1.4136 0.8956 0.0721  0.0107  0.2740  102 GLN B O   
2399 C CB  . GLN B 85  ? 0.4828 1.6095 0.9266 0.0792  0.0001  0.2300  102 GLN B CB  
2400 N N   . PRO B 86  ? 0.4865 1.4684 0.8993 0.0669  0.0376  0.2867  103 PRO B N   
2401 C CA  . PRO B 86  ? 0.4804 1.4029 0.8744 0.0862  0.0539  0.3188  103 PRO B CA  
2402 C C   . PRO B 86  ? 0.4954 1.3160 0.8735 0.0542  0.0499  0.3248  103 PRO B C   
2403 O O   . PRO B 86  ? 0.5008 1.2709 0.8638 0.0704  0.0571  0.3448  103 PRO B O   
2404 C CB  . PRO B 86  ? 0.4777 1.4335 0.8773 0.0947  0.0727  0.3298  103 PRO B CB  
2405 C CG  . PRO B 86  ? 0.4764 1.5340 0.9008 0.1020  0.0661  0.3040  103 PRO B CG  
2406 C CD  . PRO B 86  ? 0.4847 1.5434 0.9160 0.0638  0.0474  0.2768  103 PRO B CD  
2407 N N   . ILE B 87  ? 0.4579 1.2458 0.8337 0.0074  0.0367  0.3068  104 ILE B N   
2408 C CA  . ILE B 87  ? 0.4804 1.1613 0.8337 -0.0239 0.0260  0.3106  104 ILE B CA  
2409 C C   . ILE B 87  ? 0.4896 1.1321 0.8390 -0.0131 -0.0010 0.2941  104 ILE B C   
2410 O O   . ILE B 87  ? 0.4928 1.0663 0.8309 -0.0075 -0.0051 0.3020  104 ILE B O   
2411 C CB  . ILE B 87  ? 0.5175 1.1639 0.8550 -0.0841 0.0167  0.2966  104 ILE B CB  
2412 C CG1 . ILE B 87  ? 0.5082 1.1965 0.8526 -0.0974 0.0459  0.3078  104 ILE B CG1 
2413 C CG2 . ILE B 87  ? 0.5559 1.0775 0.8599 -0.1160 -0.0045 0.2978  104 ILE B CG2 
2414 C CD1 . ILE B 87  ? 0.5497 1.2033 0.8713 -0.1661 0.0424  0.2951  104 ILE B CD1 
2415 N N   . MET B 88  ? 0.5843 1.2775 0.9455 -0.0086 -0.0200 0.2675  105 MET B N   
2416 C CA  . MET B 88  ? 0.5948 1.2697 0.9580 0.0075  -0.0466 0.2447  105 MET B CA  
2417 C C   . MET B 88  ? 0.5670 1.2735 0.9396 0.0511  -0.0302 0.2566  105 MET B C   
2418 O O   . MET B 88  ? 0.5837 1.2587 0.9564 0.0627  -0.0443 0.2425  105 MET B O   
2419 C CB  . MET B 88  ? 0.5886 1.3202 0.9625 0.0042  -0.0679 0.2141  105 MET B CB  
2420 C CG  . MET B 88  ? 0.6393 1.3285 0.9923 -0.0471 -0.0903 0.1969  105 MET B CG  
2421 S SD  . MET B 88  ? 0.7330 1.2744 1.0462 -0.0773 -0.1311 0.1834  105 MET B SD  
2422 C CE  . MET B 88  ? 0.7156 1.2701 1.0481 -0.0304 -0.1602 0.1515  105 MET B CE  
2423 N N   . LYS B 89  ? 0.4457 1.2145 0.8223 0.0738  -0.0024 0.2796  106 LYS B N   
2424 C CA  . LYS B 89  ? 0.4289 1.2222 0.7992 0.1076  0.0142  0.2947  106 LYS B CA  
2425 C C   . LYS B 89  ? 0.4278 1.1497 0.7812 0.1055  0.0280  0.3173  106 LYS B C   
2426 O O   . LYS B 89  ? 0.4244 1.1400 0.7725 0.1183  0.0297  0.3137  106 LYS B O   
2427 C CB  . LYS B 89  ? 0.4201 1.2817 0.7860 0.1320  0.0331  0.3143  106 LYS B CB  
2428 N N   . PHE B 90  ? 0.4319 1.1056 0.7772 0.0869  0.0387  0.3379  107 PHE B N   
2429 C CA  . PHE B 90  ? 0.4320 1.0341 0.7605 0.0825  0.0520  0.3608  107 PHE B CA  
2430 C C   . PHE B 90  ? 0.4447 0.9840 0.7744 0.0703  0.0286  0.3386  107 PHE B C   
2431 O O   . PHE B 90  ? 0.4396 0.9544 0.7626 0.0810  0.0353  0.3437  107 PHE B O   
2432 C CB  . PHE B 90  ? 0.4369 1.0024 0.7579 0.0609  0.0657  0.3820  107 PHE B CB  
2433 C CG  . PHE B 90  ? 0.4372 0.9296 0.7394 0.0568  0.0812  0.4082  107 PHE B CG  
2434 C CD1 . PHE B 90  ? 0.4287 0.9290 0.7143 0.0805  0.1070  0.4389  107 PHE B CD1 
2435 C CD2 . PHE B 90  ? 0.4537 0.8624 0.7487 0.0290  0.0668  0.4021  107 PHE B CD2 
2436 C CE1 . PHE B 90  ? 0.4327 0.8579 0.7002 0.0766  0.1140  0.4446  107 PHE B CE1 
2437 C CE2 . PHE B 90  ? 0.4537 0.7968 0.7321 0.0251  0.0808  0.4257  107 PHE B CE2 
2438 C CZ  . PHE B 90  ? 0.4411 0.7934 0.7073 0.0495  0.1022  0.4339  107 PHE B CZ  
2439 N N   . ILE B 91  ? 0.4680 0.9799 0.8027 0.0476  -0.0013 0.3118  108 ILE B N   
2440 C CA  . ILE B 91  ? 0.4938 0.9373 0.8254 0.0401  -0.0343 0.2847  108 ILE B CA  
2441 C C   . ILE B 91  ? 0.4812 0.9722 0.8307 0.0715  -0.0435 0.2574  108 ILE B C   
2442 O O   . ILE B 91  ? 0.4829 0.9412 0.8334 0.0808  -0.0494 0.2476  108 ILE B O   
2443 C CB  . ILE B 91  ? 0.5364 0.9385 0.8582 0.0098  -0.0708 0.2592  108 ILE B CB  
2444 C CG1 . ILE B 91  ? 0.5600 0.9016 0.8563 -0.0327 -0.0635 0.2813  108 ILE B CG1 
2445 C CG2 . ILE B 91  ? 0.5729 0.9087 0.8893 0.0138  -0.1149 0.2235  108 ILE B CG2 
2446 C CD1 . ILE B 91  ? 0.6099 0.9191 0.8851 -0.0735 -0.0933 0.2603  108 ILE B CD1 
2447 N N   . ASN B 92  ? 0.5068 1.0810 0.8710 0.0863  -0.0442 0.2422  109 ASN B N   
2448 C CA  . ASN B 92  ? 0.4952 1.1280 0.8762 0.1117  -0.0515 0.2116  109 ASN B CA  
2449 C C   . ASN B 92  ? 0.4865 1.1533 0.8599 0.1270  -0.0179 0.2318  109 ASN B C   
2450 O O   . ASN B 92  ? 0.4913 1.1865 0.8744 0.1394  -0.0219 0.2047  109 ASN B O   
2451 C CB  . ASN B 92  ? 0.4885 1.2016 0.8825 0.1200  -0.0583 0.1938  109 ASN B CB  
2452 C CG  . ASN B 92  ? 0.5197 1.2010 0.9175 0.1040  -0.0973 0.1639  109 ASN B CG  
2453 O OD1 . ASN B 92  ? 0.5497 1.1675 0.9458 0.1006  -0.1316 0.1351  109 ASN B OD1 
2454 N ND2 . ASN B 92  ? 0.5199 1.2419 0.9184 0.0938  -0.0950 0.1688  109 ASN B ND2 
2455 N N   . ASP B 93  ? 0.6586 1.3232 1.0113 0.1247  0.0138  0.2761  110 ASP B N   
2456 C CA  . ASP B 93  ? 0.6566 1.3358 0.9869 0.1338  0.0441  0.3007  110 ASP B CA  
2457 C C   . ASP B 93  ? 0.6658 1.2847 0.9928 0.1265  0.0457  0.2997  110 ASP B C   
2458 O O   . ASP B 93  ? 0.6630 1.3056 0.9803 0.1308  0.0602  0.2957  110 ASP B O   
2459 C CB  . ASP B 93  ? 0.6423 1.3186 0.9458 0.1366  0.0703  0.3468  110 ASP B CB  
2460 C CG  . ASP B 93  ? 0.6556 1.4050 0.9547 0.1518  0.0722  0.3481  110 ASP B CG  
2461 O OD1 . ASP B 93  ? 0.6775 1.4833 0.9878 0.1582  0.0607  0.3187  110 ASP B OD1 
2462 O OD2 . ASP B 93  ? 0.6538 1.4061 0.9387 0.1591  0.0833  0.3756  110 ASP B OD2 
2463 N N   . GLN B 94  ? 0.6745 1.2160 1.0057 0.1121  0.0306  0.3021  111 GLN B N   
2464 C CA  . GLN B 94  ? 0.7054 1.1827 1.0346 0.1062  0.0257  0.2977  111 GLN B CA  
2465 C C   . GLN B 94  ? 0.7125 1.2079 1.0672 0.1180  -0.0058 0.2433  111 GLN B C   
2466 O O   . GLN B 94  ? 0.7203 1.2156 1.0789 0.1233  -0.0024 0.2290  111 GLN B O   
2467 C CB  . GLN B 94  ? 0.7498 1.1335 1.0693 0.0844  0.0146  0.3145  111 GLN B CB  
2468 C CG  . GLN B 94  ? 0.7230 1.0997 1.0244 0.0735  0.0427  0.3588  111 GLN B CG  
2469 C CD  . GLN B 94  ? 0.6531 1.0614 0.9352 0.0875  0.0799  0.3924  111 GLN B CD  
2470 O OE1 . GLN B 94  ? 0.6524 1.0372 0.9224 0.0889  0.0923  0.4003  111 GLN B OE1 
2471 N NE2 . GLN B 94  ? 0.5991 1.0575 0.8734 0.0975  0.0951  0.4107  111 GLN B NE2 
2472 N N   . TYR B 95  ? 0.5649 1.0790 0.9371 0.1226  -0.0377 0.2095  112 TYR B N   
2473 C CA  . TYR B 95  ? 0.5678 1.1098 0.9664 0.1401  -0.0717 0.1513  112 TYR B CA  
2474 C C   . TYR B 95  ? 0.5398 1.1886 0.9497 0.1543  -0.0480 0.1345  112 TYR B C   
2475 O O   . TYR B 95  ? 0.5412 1.2273 0.9738 0.1680  -0.0629 0.0871  112 TYR B O   
2476 C CB  . TYR B 95  ? 0.5794 1.1137 0.9867 0.1405  -0.1113 0.1218  112 TYR B CB  
2477 C CG  . TYR B 95  ? 0.6260 1.0445 1.0141 0.1219  -0.1477 0.1216  112 TYR B CG  
2478 C CD1 . TYR B 95  ? 0.6590 0.9907 1.0329 0.1147  -0.1549 0.1306  112 TYR B CD1 
2479 C CD2 . TYR B 95  ? 0.6444 1.0365 1.0215 0.1073  -0.1758 0.1124  112 TYR B CD2 
2480 C CE1 . TYR B 95  ? 0.7115 0.9278 1.0565 0.0927  -0.1904 0.1315  112 TYR B CE1 
2481 C CE2 . TYR B 95  ? 0.7018 0.9793 1.0472 0.0816  -0.2102 0.1130  112 TYR B CE2 
2482 C CZ  . TYR B 95  ? 0.7361 0.9233 1.0634 0.0740  -0.2182 0.1231  112 TYR B CZ  
2483 O OH  . TYR B 95  ? 0.8033 0.8672 1.0883 0.0436  -0.2546 0.1247  112 TYR B OH  
2484 N N   . GLU B 96  ? 0.4298 1.1277 0.8203 0.1497  -0.0129 0.1708  113 GLU B N   
2485 C CA  . GLU B 96  ? 0.4206 1.2101 0.8049 0.1544  0.0117  0.1623  113 GLU B CA  
2486 C C   . GLU B 96  ? 0.4189 1.2013 0.7800 0.1447  0.0422  0.1807  113 GLU B C   
2487 O O   . GLU B 96  ? 0.4192 1.2658 0.7847 0.1437  0.0507  0.1493  113 GLU B O   
2488 C CB  . GLU B 96  ? 0.4186 1.2495 0.7799 0.1538  0.0311  0.1948  113 GLU B CB  
2489 N N   . LYS B 97  ? 0.5104 1.2186 0.8455 0.1347  0.0594  0.2295  114 LYS B N   
2490 C CA  . LYS B 97  ? 0.5126 1.2007 0.8199 0.1230  0.0879  0.2520  114 LYS B CA  
2491 C C   . LYS B 97  ? 0.5177 1.1978 0.8541 0.1248  0.0711  0.2086  114 LYS B C   
2492 O O   . LYS B 97  ? 0.5169 1.2277 0.8417 0.1154  0.0916  0.2007  114 LYS B O   
2493 C CB  . LYS B 97  ? 0.5171 1.1222 0.7944 0.1150  0.1050  0.3098  114 LYS B CB  
2494 N N   . TYR B 98  ? 0.4667 0.9450 0.8057 -0.0359 0.1933  -0.0109 115 TYR B N   
2495 C CA  . TYR B 98  ? 0.4404 0.9194 0.8566 -0.0508 0.1908  -0.0300 115 TYR B CA  
2496 C C   . TYR B 98  ? 0.4282 0.9755 0.9030 -0.0779 0.2130  -0.0705 115 TYR B C   
2497 O O   . TYR B 98  ? 0.4259 0.9818 0.9436 -0.0954 0.2167  -0.0793 115 TYR B O   
2498 C CB  . TYR B 98  ? 0.3989 0.8705 0.8813 -0.0293 0.1786  -0.0335 115 TYR B CB  
2499 C CG  . TYR B 98  ? 0.3849 0.8426 0.9262 -0.0335 0.1675  -0.0276 115 TYR B CG  
2500 C CD1 . TYR B 98  ? 0.3625 0.8723 0.9959 -0.0439 0.1816  -0.0534 115 TYR B CD1 
2501 C CD2 . TYR B 98  ? 0.3995 0.7988 0.9044 -0.0279 0.1454  0.0059  115 TYR B CD2 
2502 C CE1 . TYR B 98  ? 0.3513 0.8675 1.0441 -0.0434 0.1702  -0.0397 115 TYR B CE1 
2503 C CE2 . TYR B 98  ? 0.3893 0.7955 0.9463 -0.0359 0.1323  0.0154  115 TYR B CE2 
2504 C CZ  . TYR B 98  ? 0.3632 0.8342 1.0168 -0.0411 0.1429  -0.0043 115 TYR B CZ  
2505 O OH  . TYR B 98  ? 0.3544 0.8506 1.0658 -0.0448 0.1287  0.0131  115 TYR B OH  
2506 N N   . LEU B 99  ? 0.3856 0.9881 0.8609 -0.0844 0.2296  -0.0954 116 LEU B N   
2507 C CA  . LEU B 99  ? 0.3990 1.0335 0.9026 -0.1079 0.2456  -0.1300 116 LEU B CA  
2508 C C   . LEU B 99  ? 0.4300 1.0853 0.8885 -0.1364 0.2586  -0.1294 116 LEU B C   
2509 O O   . LEU B 99  ? 0.4477 1.1068 0.9287 -0.1549 0.2660  -0.1499 116 LEU B O   
2510 C CB  . LEU B 99  ? 0.4135 1.0685 0.9006 -0.1099 0.2497  -0.1510 116 LEU B CB  
2511 C CG  . LEU B 99  ? 0.4468 1.1114 0.9475 -0.1343 0.2654  -0.1887 116 LEU B CG  
2512 C CD1 . LEU B 99  ? 0.4437 1.0720 1.0131 -0.1242 0.2707  -0.2021 116 LEU B CD1 
2513 C CD2 . LEU B 99  ? 0.4707 1.1658 0.9374 -0.1488 0.2709  -0.2107 116 LEU B CD2 
2514 N N   . GLN B 100 ? 0.5159 1.1535 0.8871 -0.1315 0.2542  -0.0951 117 GLN B N   
2515 C CA  . GLN B 100 ? 0.5667 1.1965 0.8701 -0.1546 0.2650  -0.0840 117 GLN B CA  
2516 C C   . GLN B 100 ? 0.5846 1.1590 0.8853 -0.1685 0.2612  -0.0737 117 GLN B C   
2517 O O   . GLN B 100 ? 0.6235 1.1958 0.8879 -0.1978 0.2752  -0.0768 117 GLN B O   
2518 C CB  . GLN B 100 ? 0.6157 1.2210 0.8138 -0.1342 0.2617  -0.0390 117 GLN B CB  
2519 N N   . GLU B 101 ? 0.7303 1.2665 1.0668 -0.1522 0.2429  -0.0621 118 GLU B N   
2520 C CA  . GLU B 101 ? 0.7368 1.2425 1.0799 -0.1726 0.2371  -0.0548 118 GLU B CA  
2521 C C   . GLU B 101 ? 0.6380 1.2104 1.0994 -0.1833 0.2398  -0.0856 118 GLU B C   
2522 O O   . GLU B 101 ? 0.6310 1.2155 1.1107 -0.2086 0.2395  -0.0862 118 GLU B O   
2523 C CB  . GLU B 101 ? 0.8089 1.2400 1.1139 -0.1557 0.2165  -0.0201 118 GLU B CB  
2524 C CG  . GLU B 101 ? 0.8937 1.2337 1.0719 -0.1560 0.2239  0.0154  118 GLU B CG  
2525 C CD  . GLU B 101 ? 0.8912 1.2238 1.0096 -0.1277 0.2341  0.0327  118 GLU B CD  
2526 O OE1 . GLU B 101 ? 0.9169 1.1915 0.9840 -0.0966 0.2297  0.0648  118 GLU B OE1 
2527 O OE2 . GLU B 101 ? 0.8631 1.2530 0.9840 -0.1376 0.2475  0.0166  118 GLU B OE2 
2528 N N   . GLU B 102 ? 0.9512 1.5685 1.4926 -0.1646 0.2467  -0.1101 119 GLU B N   
2529 C CA  . GLU B 102 ? 0.9321 1.5688 1.5511 -0.1561 0.2439  -0.1239 119 GLU B CA  
2530 C C   . GLU B 102 ? 0.9654 1.6227 1.5664 -0.1793 0.2620  -0.1494 119 GLU B C   
2531 O O   . GLU B 102 ? 0.9801 1.6567 1.6215 -0.1867 0.2658  -0.1567 119 GLU B O   
2532 C CB  . GLU B 102 ? 0.9183 1.5410 1.5792 -0.1217 0.2388  -0.1285 119 GLU B CB  
2533 C CG  . GLU B 102 ? 0.8913 1.5002 1.5972 -0.0980 0.2186  -0.1025 119 GLU B CG  
2534 C CD  . GLU B 102 ? 0.8915 1.4806 1.6342 -0.0677 0.2193  -0.1085 119 GLU B CD  
2535 O OE1 . GLU B 102 ? 0.9105 1.4928 1.6410 -0.0694 0.2372  -0.1355 119 GLU B OE1 
2536 O OE2 . GLU B 102 ? 0.8782 1.4573 1.6578 -0.0467 0.2043  -0.0872 119 GLU B OE2 
2537 N N   . VAL B 103 ? 0.7410 1.4009 1.2806 -0.1903 0.2732  -0.1603 120 VAL B N   
2538 C CA  . VAL B 103 ? 0.7678 1.4464 1.2716 -0.2195 0.2894  -0.1807 120 VAL B CA  
2539 C C   . VAL B 103 ? 0.7864 1.4559 1.2389 -0.2464 0.2924  -0.1611 120 VAL B C   
2540 O O   . VAL B 103 ? 0.7940 1.4411 1.2273 -0.2429 0.2861  -0.1350 120 VAL B O   
2541 C CB  . VAL B 103 ? 0.7955 1.4901 1.2436 -0.2255 0.2976  -0.1922 120 VAL B CB  
2542 N N   . ASN B 104 ? 1.1423 1.8213 1.5635 -0.2775 0.3054  -0.1739 121 ASN B N   
2543 C CA  . ASN B 104 ? 1.1706 1.8289 1.5379 -0.3106 0.3117  -0.1582 121 ASN B CA  
2544 C C   . ASN B 104 ? 1.1424 1.8060 1.5742 -0.3084 0.2953  -0.1503 121 ASN B C   
2545 O O   . ASN B 104 ? 1.1487 1.7869 1.5633 -0.3100 0.2869  -0.1259 121 ASN B O   
2546 C CB  . ASN B 104 ? 1.2205 1.8244 1.4809 -0.3116 0.3178  -0.1223 121 ASN B CB  
2547 C CG  . ASN B 104 ? 1.2824 1.8197 1.4555 -0.3426 0.3243  -0.1017 121 ASN B CG  
2548 O OD1 . ASN B 104 ? 1.2825 1.8490 1.4837 -0.3808 0.3324  -0.1213 121 ASN B OD1 
2549 N ND2 . ASN B 104 ? 1.3616 1.8076 1.4275 -0.3272 0.3248  -0.0621 121 ASN B ND2 
2550 N N   . ILE B 105 ? 1.0467 1.7467 1.5496 -0.3050 0.2924  -0.1678 122 ILE B N   
2551 C CA  . ILE B 105 ? 1.0259 1.7536 1.6018 -0.2971 0.2760  -0.1544 122 ILE B CA  
2552 C C   . ILE B 105 ? 1.0639 1.7914 1.5931 -0.3411 0.2734  -0.1442 122 ILE B C   
2553 O O   . ILE B 105 ? 1.0502 1.8068 1.6226 -0.3436 0.2561  -0.1272 122 ILE B O   
2554 C CB  . ILE B 105 ? 1.0170 1.7871 1.6786 -0.2772 0.2816  -0.1691 122 ILE B CB  
2555 N N   . ASN B 106 ? 1.4919 2.1854 1.9251 -0.3781 0.2917  -0.1524 123 ASN B N   
2556 C CA  . ASN B 106 ? 1.5506 2.2267 1.9166 -0.4274 0.2965  -0.1486 123 ASN B CA  
2557 C C   . ASN B 106 ? 1.5850 2.1958 1.8670 -0.4521 0.2946  -0.1215 123 ASN B C   
2558 O O   . ASN B 106 ? 1.6412 2.2319 1.8683 -0.4943 0.2955  -0.1187 123 ASN B O   
2559 C CB  . ASN B 106 ? 1.5313 2.1832 1.8197 -0.4567 0.3216  -0.1670 123 ASN B CB  
2560 N N   . ARG B 107 ? 1.0107 1.5824 1.2751 -0.4276 0.2942  -0.1025 124 ARG B N   
2561 C CA  . ARG B 107 ? 1.0763 1.5457 1.2387 -0.4332 0.2887  -0.0715 124 ARG B CA  
2562 C C   . ARG B 107 ? 1.0591 1.5661 1.2639 -0.4578 0.2670  -0.0650 124 ARG B C   
2563 O O   . ARG B 107 ? 0.9839 1.5581 1.2944 -0.4274 0.2421  -0.0613 124 ARG B O   
2564 C CB  . ARG B 107 ? 1.1109 1.5220 1.2524 -0.3763 0.2778  -0.0487 124 ARG B CB  
2565 N N   . LYS B 108 ? 1.5599 2.0225 1.6769 -0.5138 0.2780  -0.0620 125 LYS B N   
2566 C CA  . LYS B 108 ? 1.5572 2.0640 1.7021 -0.5381 0.2514  -0.0568 125 LYS B CA  
2567 C C   . LYS B 108 ? 1.5482 2.0267 1.6917 -0.5274 0.2328  -0.0305 125 LYS B C   
2568 O O   . LYS B 108 ? 1.5431 2.0672 1.7122 -0.5444 0.2071  -0.0219 125 LYS B O   
2569 C CB  . LYS B 108 ? 1.6594 2.1133 1.6935 -0.5970 0.2658  -0.0670 125 LYS B CB  
2570 N N   . LYS B 109 ? 0.8840 1.2708 0.9838 -0.4802 0.2361  -0.0155 126 LYS B N   
2571 C CA  . LYS B 109 ? 0.8769 1.2181 0.9646 -0.4589 0.2152  0.0084  126 LYS B CA  
2572 C C   . LYS B 109 ? 0.7797 1.1729 0.9783 -0.3904 0.1895  0.0143  126 LYS B C   
2573 O O   . LYS B 109 ? 0.7401 1.1571 0.9826 -0.3546 0.1973  0.0015  126 LYS B O   
2574 C CB  . LYS B 109 ? 0.9659 1.1524 0.9115 -0.4575 0.2418  0.0245  126 LYS B CB  
2575 N N   . ARG B 110 ? 0.8276 1.2339 1.0629 -0.3771 0.1621  0.0327  127 ARG B N   
2576 C CA  . ARG B 110 ? 0.7728 1.2150 1.1047 -0.3160 0.1412  0.0397  127 ARG B CA  
2577 C C   . ARG B 110 ? 0.8169 1.1669 1.0932 -0.2714 0.1495  0.0461  127 ARG B C   
2578 O O   . ARG B 110 ? 0.8932 1.1414 1.0548 -0.2815 0.1658  0.0573  127 ARG B O   
2579 C CB  . ARG B 110 ? 0.7654 1.2548 1.1515 -0.3180 0.1098  0.0615  127 ARG B CB  
2580 C CG  . ARG B 110 ? 0.8576 1.2572 1.1503 -0.3333 0.1020  0.0817  127 ARG B CG  
2581 C CD  . ARG B 110 ? 0.8352 1.3077 1.2068 -0.3265 0.0675  0.1042  127 ARG B CD  
2582 N NE  . ARG B 110 ? 0.7450 1.2924 1.2489 -0.2683 0.0573  0.1049  127 ARG B NE  
2583 C CZ  . ARG B 110 ? 0.6864 1.2824 1.2717 -0.2383 0.0328  0.1280  127 ARG B CZ  
2584 N NH1 . ARG B 110 ? 0.7127 1.3037 1.2629 -0.2630 0.0098  0.1534  127 ARG B NH1 
2585 N NH2 . ARG B 110 ? 0.5989 1.2454 1.2971 -0.1862 0.0354  0.1255  127 ARG B NH2 
2586 N N   . ILE B 111 ? 0.5429 0.9326 0.9028 -0.2226 0.1426  0.0394  128 ILE B N   
2587 C CA  . ILE B 111 ? 0.5376 0.8719 0.8618 -0.1813 0.1490  0.0428  128 ILE B CA  
2588 C C   . ILE B 111 ? 0.5365 0.8127 0.8360 -0.1576 0.1319  0.0663  128 ILE B C   
2589 O O   . ILE B 111 ? 0.4947 0.8074 0.8662 -0.1466 0.1101  0.0725  128 ILE B O   
2590 C CB  . ILE B 111 ? 0.4736 0.8780 0.8936 -0.1492 0.1533  0.0192  128 ILE B CB  
2591 C CG1 . ILE B 111 ? 0.4700 0.9427 0.9325 -0.1745 0.1715  -0.0077 128 ILE B CG1 
2592 C CG2 . ILE B 111 ? 0.4747 0.8431 0.8497 -0.1173 0.1616  0.0202  128 ILE B CG2 
2593 C CD1 . ILE B 111 ? 0.4196 0.9568 0.9751 -0.1519 0.1847  -0.0367 128 ILE B CD1 
2594 N N   . PRO B 112 ? 0.6775 0.8624 0.8750 -0.1473 0.1446  0.0823  129 PRO B N   
2595 C CA  . PRO B 112 ? 0.7028 0.8251 0.8682 -0.1217 0.1347  0.1034  129 PRO B CA  
2596 C C   . PRO B 112 ? 0.6428 0.8025 0.8728 -0.0735 0.1253  0.0975  129 PRO B C   
2597 O O   . PRO B 112 ? 0.6156 0.7989 0.8439 -0.0552 0.1387  0.0879  129 PRO B O   
2598 C CB  . PRO B 112 ? 0.7575 0.7751 0.7959 -0.1237 0.1628  0.1223  129 PRO B CB  
2599 C CG  . PRO B 112 ? 0.7549 0.7945 0.7740 -0.1292 0.1845  0.1123  129 PRO B CG  
2600 C CD  . PRO B 112 ? 0.7205 0.8535 0.8237 -0.1598 0.1741  0.0851  129 PRO B CD  
2601 N N   . ASP B 113 ? 0.7928 0.9610 1.0749 -0.0580 0.1041  0.1029  130 ASP B N   
2602 C CA  . ASP B 113 ? 0.7168 0.9205 1.0640 -0.0200 0.0987  0.0924  130 ASP B CA  
2603 C C   . ASP B 113 ? 0.7247 0.8711 1.0081 0.0089  0.1019  0.1084  130 ASP B C   
2604 O O   . ASP B 113 ? 0.7425 0.8353 0.9974 0.0137  0.0915  0.1268  130 ASP B O   
2605 C CB  . ASP B 113 ? 0.6638 0.9032 1.1011 -0.0145 0.0788  0.0932  130 ASP B CB  
2606 C CG  . ASP B 113 ? 0.5565 0.8433 1.0785 0.0142  0.0848  0.0714  130 ASP B CG  
2607 O OD1 . ASP B 113 ? 0.5399 0.8339 1.0428 0.0265  0.0999  0.0552  130 ASP B OD1 
2608 O OD2 . ASP B 113 ? 0.4866 0.8053 1.0924 0.0228  0.0777  0.0719  130 ASP B OD2 
2609 N N   . THR B 114 ? 0.5890 0.7554 0.8510 0.0272  0.1169  0.1028  131 THR B N   
2610 C CA  . THR B 114 ? 0.5673 0.7016 0.7763 0.0593  0.1216  0.1219  131 THR B CA  
2611 C C   . THR B 114 ? 0.4740 0.6750 0.7456 0.0807  0.1168  0.1021  131 THR B C   
2612 O O   . THR B 114 ? 0.4777 0.6800 0.7189 0.1068  0.1194  0.1147  131 THR B O   
2613 C CB  . THR B 114 ? 0.5876 0.7023 0.7141 0.0673  0.1441  0.1413  131 THR B CB  
2614 O OG1 . THR B 114 ? 0.5897 0.7864 0.7490 0.0589  0.1513  0.1192  131 THR B OG1 
2615 C CG2 . THR B 114 ? 0.6571 0.6882 0.7084 0.0416  0.1583  0.1585  131 THR B CG2 
2616 N N   . ARG B 115 ? 0.4159 0.6728 0.7743 0.0681  0.1142  0.0710  132 ARG B N   
2617 C CA  . ARG B 115 ? 0.3581 0.6697 0.7756 0.0783  0.1184  0.0443  132 ARG B CA  
2618 C C   . ARG B 115 ? 0.3449 0.6202 0.7695 0.0978  0.1054  0.0550  132 ARG B C   
2619 O O   . ARG B 115 ? 0.3508 0.5742 0.7764 0.0973  0.0908  0.0731  132 ARG B O   
2620 C CB  . ARG B 115 ? 0.3286 0.6873 0.8367 0.0614  0.1287  0.0101  132 ARG B CB  
2621 C CG  . ARG B 115 ? 0.3399 0.7402 0.8488 0.0385  0.1442  -0.0063 132 ARG B CG  
2622 C CD  . ARG B 115 ? 0.3170 0.7536 0.9213 0.0262  0.1579  -0.0352 132 ARG B CD  
2623 N NE  . ARG B 115 ? 0.3101 0.7179 0.9550 0.0320  0.1412  -0.0139 132 ARG B NE  
2624 C CZ  . ARG B 115 ? 0.3136 0.7348 1.0097 0.0286  0.1430  -0.0223 132 ARG B CZ  
2625 N NH1 . ARG B 115 ? 0.3306 0.7751 1.0359 0.0194  0.1625  -0.0522 132 ARG B NH1 
2626 N NH2 . ARG B 115 ? 0.3114 0.7204 1.0379 0.0345  0.1245  0.0041  132 ARG B NH2 
2627 N N   . VAL B 116 ? 0.2988 0.6087 0.7263 0.1103  0.1111  0.0431  133 VAL B N   
2628 C CA  . VAL B 116 ? 0.2860 0.5670 0.7242 0.1256  0.1019  0.0478  133 VAL B CA  
2629 C C   . VAL B 116 ? 0.2597 0.5426 0.7825 0.1178  0.1047  0.0245  133 VAL B C   
2630 O O   . VAL B 116 ? 0.2600 0.5770 0.8019 0.1029  0.1182  -0.0110 133 VAL B O   
2631 C CB  . VAL B 116 ? 0.2802 0.6110 0.6986 0.1368  0.1092  0.0400  133 VAL B CB  
2632 C CG1 . VAL B 116 ? 0.2690 0.5681 0.6987 0.1492  0.1015  0.0421  133 VAL B CG1 
2633 C CG2 . VAL B 116 ? 0.3127 0.6493 0.6533 0.1543  0.1099  0.0731  133 VAL B CG2 
2634 N N   . HIS B 117 ? 0.2781 0.5068 0.8095 0.1206  0.0874  0.0461  134 HIS B N   
2635 C CA  . HIS B 117 ? 0.2826 0.4934 0.8504 0.1121  0.0837  0.0349  134 HIS B CA  
2636 C C   . HIS B 117 ? 0.2880 0.4734 0.8422 0.1160  0.0843  0.0246  134 HIS B C   
2637 O O   . HIS B 117 ? 0.2969 0.4861 0.8785 0.1090  0.1001  0.0007  134 HIS B O   
2638 C CB  . HIS B 117 ? 0.2871 0.4708 0.8715 0.1107  0.0644  0.0675  134 HIS B CB  
2639 C CG  . HIS B 117 ? 0.2842 0.4965 0.8827 0.1008  0.0642  0.0796  134 HIS B CG  
2640 N ND1 . HIS B 117 ? 0.3136 0.4863 0.8504 0.0866  0.0462  0.1084  134 HIS B ND1 
2641 C CD2 . HIS B 117 ? 0.2805 0.5390 0.9034 0.0889  0.0798  0.0602  134 HIS B CD2 
2642 C CE1 . HIS B 117 ? 0.3876 0.5810 0.9111 0.0662  0.0509  0.1063  134 HIS B CE1 
2643 N NE2 . HIS B 117 ? 0.3534 0.6005 0.9302 0.0691  0.0694  0.0785  134 HIS B NE2 
2644 N N   . CYS B 118 ? 0.3557 0.8457 0.9918 0.0947  0.0549  -0.0533 135 CYS B N   
2645 C CA  . CYS B 118 ? 0.3494 0.8336 0.9723 0.0938  0.0438  -0.0564 135 CYS B CA  
2646 C C   . CYS B 118 ? 0.3494 0.8306 0.9570 0.1009  0.0366  -0.0648 135 CYS B C   
2647 O O   . CYS B 118 ? 0.3500 0.8321 0.9565 0.1032  0.0347  -0.0646 135 CYS B O   
2648 C CB  . CYS B 118 ? 0.3400 0.8239 0.9625 0.0830  0.0341  -0.0463 135 CYS B CB  
2649 S SG  . CYS B 118 ? 0.3333 0.8135 0.9419 0.0811  0.0229  -0.0466 135 CYS B SG  
2650 N N   . CYS B 119 ? 0.3993 0.8765 0.9976 0.1042  0.0322  -0.0726 136 CYS B N   
2651 C CA  . CYS B 119 ? 0.3995 0.8746 0.9835 0.1109  0.0242  -0.0816 136 CYS B CA  
2652 C C   . CYS B 119 ? 0.3919 0.8610 0.9670 0.1067  0.0141  -0.0819 136 CYS B C   
2653 O O   . CYS B 119 ? 0.3938 0.8613 0.9721 0.1062  0.0149  -0.0867 136 CYS B O   
2654 C CB  . CYS B 119 ? 0.4124 0.8937 0.9946 0.1218  0.0302  -0.0959 136 CYS B CB  
2655 S SG  . CYS B 119 ? 0.4177 0.9001 0.9815 0.1310  0.0178  -0.1087 136 CYS B SG  
2656 N N   . LEU B 120 ? 0.2345 0.7012 0.8007 0.1038  0.0056  -0.0774 137 LEU B N   
2657 C CA  . LEU B 120 ? 0.2300 0.6937 0.7879 0.1004  -0.0024 -0.0768 137 LEU B CA  
2658 C C   . LEU B 120 ? 0.2367 0.6986 0.7860 0.1083  -0.0070 -0.0897 137 LEU B C   
2659 O O   . LEU B 120 ? 0.2426 0.7058 0.7855 0.1162  -0.0094 -0.0964 137 LEU B O   
2660 C CB  . LEU B 120 ? 0.2241 0.6885 0.7761 0.0957  -0.0084 -0.0702 137 LEU B CB  
2661 C CG  . LEU B 120 ? 0.2184 0.6885 0.7783 0.0869  -0.0069 -0.0590 137 LEU B CG  
2662 C CD1 . LEU B 120 ? 0.2148 0.6882 0.7694 0.0825  -0.0138 -0.0567 137 LEU B CD1 
2663 C CD2 . LEU B 120 ? 0.2152 0.6896 0.7818 0.0811  -0.0043 -0.0507 137 LEU B CD2 
2664 N N   . TYR B 121 ? 0.2369 0.6977 0.7879 0.1063  -0.0091 -0.0931 138 TYR B N   
2665 C CA  . TYR B 121 ? 0.2437 0.7051 0.7885 0.1123  -0.0153 -0.1063 138 TYR B CA  
2666 C C   . TYR B 121 ? 0.2388 0.6986 0.7779 0.1082  -0.0226 -0.1020 138 TYR B C   
2667 O O   . TYR B 121 ? 0.2331 0.6931 0.7786 0.1009  -0.0219 -0.0936 138 TYR B O   
2668 C CB  . TYR B 121 ? 0.2509 0.7142 0.8060 0.1139  -0.0122 -0.1182 138 TYR B CB  
2669 C CG  . TYR B 121 ? 0.2613 0.7305 0.8105 0.1218  -0.0191 -0.1362 138 TYR B CG  
2670 C CD1 . TYR B 121 ? 0.2611 0.7299 0.8088 0.1199  -0.0278 -0.1399 138 TYR B CD1 
2671 C CD2 . TYR B 121 ? 0.2726 0.7517 0.8180 0.1318  -0.0171 -0.1494 138 TYR B CD2 
2672 C CE1 . TYR B 121 ? 0.2716 0.7487 0.8148 0.1271  -0.0359 -0.1568 138 TYR B CE1 
2673 C CE2 . TYR B 121 ? 0.2840 0.7739 0.8222 0.1401  -0.0255 -0.1666 138 TYR B CE2 
2674 C CZ  . TYR B 121 ? 0.2832 0.7716 0.8208 0.1373  -0.0357 -0.1705 138 TYR B CZ  
2675 O OH  . TYR B 121 ? 0.2954 0.7972 0.8269 0.1455  -0.0458 -0.1877 138 TYR B OH  
2676 N N   . PHE B 122 ? 0.3090 0.7694 0.8373 0.1138  -0.0291 -0.1071 139 PHE B N   
2677 C CA  . PHE B 122 ? 0.3058 0.7665 0.8295 0.1110  -0.0345 -0.1035 139 PHE B CA  
2678 C C   . PHE B 122 ? 0.3107 0.7741 0.8372 0.1122  -0.0396 -0.1123 139 PHE B C   
2679 O O   . PHE B 122 ? 0.3199 0.7865 0.8426 0.1200  -0.0447 -0.1250 139 PHE B O   
2680 C CB  . PHE B 122 ? 0.3087 0.7689 0.8226 0.1168  -0.0386 -0.1052 139 PHE B CB  
2681 C CG  . PHE B 122 ? 0.3033 0.7622 0.8177 0.1130  -0.0352 -0.0971 139 PHE B CG  
2682 C CD1 . PHE B 122 ? 0.3034 0.7613 0.8222 0.1138  -0.0305 -0.0954 139 PHE B CD1 
2683 C CD2 . PHE B 122 ? 0.2994 0.7606 0.8118 0.1088  -0.0368 -0.0926 139 PHE B CD2 
2684 C CE1 . PHE B 122 ? 0.2994 0.7577 0.8215 0.1095  -0.0286 -0.0896 139 PHE B CE1 
2685 C CE2 . PHE B 122 ? 0.2962 0.7589 0.8107 0.1052  -0.0351 -0.0887 139 PHE B CE2 
2686 C CZ  . PHE B 122 ? 0.2961 0.7569 0.8158 0.1051  -0.0317 -0.0873 139 PHE B CZ  
2687 N N   . ILE B 123 ? 0.3155 0.7802 0.8500 0.1048  -0.0389 -0.1051 140 ILE B N   
2688 C CA  . ILE B 123 ? 0.3199 0.7881 0.8618 0.1045  -0.0437 -0.1125 140 ILE B CA  
2689 C C   . ILE B 123 ? 0.3184 0.7912 0.8562 0.1038  -0.0479 -0.1075 140 ILE B C   
2690 O O   . ILE B 123 ? 0.3111 0.7870 0.8490 0.0985  -0.0448 -0.0939 140 ILE B O   
2691 C CB  . ILE B 123 ? 0.3175 0.7860 0.8761 0.0974  -0.0399 -0.1081 140 ILE B CB  
2692 C CG1 . ILE B 123 ? 0.3212 0.7856 0.8873 0.0988  -0.0348 -0.1155 140 ILE B CG1 
2693 C CG2 . ILE B 123 ? 0.3229 0.7955 0.8930 0.0963  -0.0453 -0.1161 140 ILE B CG2 
2694 C CD1 . ILE B 123 ? 0.3208 0.7841 0.9066 0.0928  -0.0307 -0.1120 140 ILE B CD1 
2695 N N   . PRO B 124 ? 0.2499 0.7260 0.7854 0.1096  -0.0550 -0.1188 141 PRO B N   
2696 C CA  . PRO B 124 ? 0.2501 0.7320 0.7847 0.1099  -0.0584 -0.1150 141 PRO B CA  
2697 C C   . PRO B 124 ? 0.2456 0.7342 0.7943 0.1018  -0.0566 -0.1059 141 PRO B C   
2698 O O   . PRO B 124 ? 0.2483 0.7377 0.8099 0.0989  -0.0577 -0.1110 141 PRO B O   
2699 C CB  . PRO B 124 ? 0.2616 0.7476 0.7937 0.1182  -0.0674 -0.1298 141 PRO B CB  
2700 C CG  . PRO B 124 ? 0.2672 0.7529 0.8042 0.1195  -0.0691 -0.1424 141 PRO B CG  
2701 C CD  . PRO B 124 ? 0.2606 0.7388 0.7954 0.1169  -0.0607 -0.1361 141 PRO B CD  
2702 N N   . ALA B 125 ? 0.2402 0.7354 0.7887 0.0987  -0.0539 -0.0935 142 ALA B N   
2703 C CA  . ALA B 125 ? 0.2362 0.7425 0.7986 0.0916  -0.0515 -0.0813 142 ALA B CA  
2704 C C   . ALA B 125 ? 0.2426 0.7567 0.8163 0.0925  -0.0568 -0.0873 142 ALA B C   
2705 O O   . ALA B 125 ? 0.2426 0.7676 0.8197 0.0926  -0.0567 -0.0812 142 ALA B O   
2706 C CB  . ALA B 125 ? 0.2299 0.7456 0.7897 0.0887  -0.0470 -0.0670 142 ALA B CB  
2707 N N   . THR B 126 ? 0.2493 0.7593 0.8310 0.0934  -0.0615 -0.1006 143 THR B N   
2708 C CA  . THR B 126 ? 0.2570 0.7753 0.8525 0.0936  -0.0681 -0.1086 143 THR B CA  
2709 C C   . THR B 126 ? 0.2546 0.7835 0.8706 0.0855  -0.0653 -0.0974 143 THR B C   
2710 O O   . THR B 126 ? 0.2589 0.7994 0.8882 0.0843  -0.0688 -0.0975 143 THR B O   
2711 C CB  . THR B 126 ? 0.2674 0.7805 0.8669 0.0973  -0.0756 -0.1302 143 THR B CB  
2712 O OG1 . THR B 126 ? 0.2669 0.7737 0.8783 0.0926  -0.0722 -0.1334 143 THR B OG1 
2713 C CG2 . THR B 126 ? 0.2712 0.7786 0.8506 0.1063  -0.0787 -0.1397 143 THR B CG2 
2714 N N   . GLY B 127 ? 0.2487 0.7759 0.8688 0.0801  -0.0592 -0.0871 144 GLY B N   
2715 C CA  . GLY B 127 ? 0.2484 0.7879 0.8899 0.0729  -0.0569 -0.0768 144 GLY B CA  
2716 C C   . GLY B 127 ? 0.2572 0.7913 0.9212 0.0701  -0.0610 -0.0904 144 GLY B C   
2717 O O   . GLY B 127 ? 0.2598 0.8032 0.9462 0.0642  -0.0604 -0.0846 144 GLY B O   
2718 N N   . HIS B 128 ? 0.2675 0.7882 0.9296 0.0745  -0.0657 -0.1112 145 HIS B N   
2719 C CA  . HIS B 128 ? 0.2788 0.7938 0.9661 0.0726  -0.0705 -0.1305 145 HIS B CA  
2720 C C   . HIS B 128 ? 0.2816 0.7824 0.9673 0.0752  -0.0686 -0.1443 145 HIS B C   
2721 O O   . HIS B 128 ? 0.2737 0.7693 0.9404 0.0773  -0.0627 -0.1351 145 HIS B O   
2722 C CB  . HIS B 128 ? 0.2893 0.8103 0.9817 0.0760  -0.0809 -0.1484 145 HIS B CB  
2723 C CG  . HIS B 128 ? 0.2883 0.8248 0.9870 0.0735  -0.0826 -0.1360 145 HIS B CG  
2724 N ND1 . HIS B 128 ? 0.2881 0.8337 1.0103 0.0659  -0.0796 -0.1239 145 HIS B ND1 
2725 C CD2 . HIS B 128 ? 0.2885 0.8348 0.9753 0.0780  -0.0865 -0.1338 145 HIS B CD2 
2726 C CE1 . HIS B 128 ? 0.2876 0.8499 1.0114 0.0656  -0.0812 -0.1147 145 HIS B CE1 
2727 N NE2 . HIS B 128 ? 0.2878 0.8499 0.9911 0.0730  -0.0852 -0.1207 145 HIS B NE2 
2728 N N   . SER B 129 ? 0.4661 0.9624 1.1742 0.0751  -0.0734 -0.1675 146 SER B N   
2729 C CA  . SER B 129 ? 0.4738 0.9603 1.1847 0.0782  -0.0710 -0.1844 146 SER B CA  
2730 C C   . SER B 129 ? 0.4722 0.9603 1.1525 0.0867  -0.0726 -0.1915 146 SER B C   
2731 O O   . SER B 129 ? 0.4712 0.9670 1.1340 0.0910  -0.0788 -0.1914 146 SER B O   
2732 C CB  . SER B 129 ? 0.4932 0.9788 1.2358 0.0772  -0.0772 -0.2134 146 SER B CB  
2733 O OG  . SER B 129 ? 0.5056 1.0027 1.2440 0.0812  -0.0887 -0.2316 146 SER B OG  
2734 N N   . LEU B 130 ? 0.3085 0.7901 0.9846 0.0894  -0.0666 -0.1969 147 LEU B N   
2735 C CA  . LEU B 130 ? 0.3088 0.7934 0.9590 0.0978  -0.0671 -0.2034 147 LEU B CA  
2736 C C   . LEU B 130 ? 0.3228 0.8204 0.9702 0.1050  -0.0785 -0.2302 147 LEU B C   
2737 O O   . LEU B 130 ? 0.3351 0.8376 1.0046 0.1042  -0.0836 -0.2532 147 LEU B O   
2738 C CB  . LEU B 130 ? 0.3084 0.7864 0.9602 0.0991  -0.0575 -0.2054 147 LEU B CB  
2739 C CG  . LEU B 130 ? 0.2945 0.7641 0.9373 0.0951  -0.0480 -0.1777 147 LEU B CG  
2740 C CD1 . LEU B 130 ? 0.2964 0.7606 0.9463 0.0962  -0.0386 -0.1810 147 LEU B CD1 
2741 C CD2 . LEU B 130 ? 0.2863 0.7585 0.9003 0.0987  -0.0494 -0.1644 147 LEU B CD2 
2742 N N   . ARG B 131 ? 0.3082 0.8126 0.9295 0.1124  -0.0833 -0.2278 148 ARG B N   
2743 C CA  . ARG B 131 ? 0.3227 0.8440 0.9367 0.1211  -0.0957 -0.2503 148 ARG B CA  
2744 C C   . ARG B 131 ? 0.3329 0.8638 0.9433 0.1285  -0.0943 -0.2716 148 ARG B C   
2745 O O   . ARG B 131 ? 0.3263 0.8497 0.9303 0.1292  -0.0831 -0.2625 148 ARG B O   
2746 C CB  . ARG B 131 ? 0.3205 0.8463 0.9100 0.1275  -0.1012 -0.2376 148 ARG B CB  
2747 N N   . PRO B 132 ? 0.3503 0.9012 0.9654 0.1344  -0.1056 -0.3008 149 PRO B N   
2748 C CA  . PRO B 132 ? 0.3637 0.9330 0.9743 0.1433  -0.1050 -0.3258 149 PRO B CA  
2749 C C   . PRO B 132 ? 0.3608 0.9348 0.9432 0.1529  -0.0990 -0.3136 149 PRO B C   
2750 O O   . PRO B 132 ? 0.3664 0.9484 0.9473 0.1579  -0.0897 -0.3244 149 PRO B O   
2751 C CB  . PRO B 132 ? 0.3831 0.9794 0.9931 0.1496  -0.1234 -0.3533 149 PRO B CB  
2752 C CG  . PRO B 132 ? 0.3806 0.9656 1.0133 0.1391  -0.1291 -0.3498 149 PRO B CG  
2753 C CD  . PRO B 132 ? 0.3599 0.9204 0.9871 0.1324  -0.1196 -0.3128 149 PRO B CD  
2754 N N   . LEU B 133 ? 0.3537 0.9231 0.9165 0.1556  -0.1031 -0.2917 150 LEU B N   
2755 C CA  . LEU B 133 ? 0.3518 0.9239 0.8916 0.1645  -0.0983 -0.2784 150 LEU B CA  
2756 C C   . LEU B 133 ? 0.3378 0.8899 0.8825 0.1581  -0.0804 -0.2619 150 LEU B C   
2757 O O   . LEU B 133 ? 0.3424 0.9019 0.8817 0.1640  -0.0714 -0.2662 150 LEU B O   
2758 C CB  . LEU B 133 ? 0.3483 0.9162 0.8724 0.1678  -0.1062 -0.2593 150 LEU B CB  
2759 C CG  . LEU B 133 ? 0.3468 0.9142 0.8517 0.1767  -0.1020 -0.2434 150 LEU B CG  
2760 C CD1 . LEU B 133 ? 0.3654 0.9621 0.8551 0.1922  -0.1076 -0.2582 150 LEU B CD1 
2761 C CD2 . LEU B 133 ? 0.3434 0.9022 0.8400 0.1781  -0.1085 -0.2257 150 LEU B CD2 
2762 N N   . ASP B 134 ? 0.3222 0.8519 0.8764 0.1464  -0.0752 -0.2422 151 ASP B N   
2763 C CA  . ASP B 134 ? 0.3093 0.8221 0.8679 0.1397  -0.0608 -0.2240 151 ASP B CA  
2764 C C   . ASP B 134 ? 0.3136 0.8252 0.8914 0.1365  -0.0512 -0.2362 151 ASP B C   
2765 O O   . ASP B 134 ? 0.3102 0.8162 0.8886 0.1361  -0.0392 -0.2280 151 ASP B O   
2766 C CB  . ASP B 134 ? 0.2944 0.7908 0.8573 0.1292  -0.0593 -0.2016 151 ASP B CB  
2767 C CG  . ASP B 134 ? 0.2900 0.7853 0.8351 0.1323  -0.0644 -0.1882 151 ASP B CG  
2768 O OD1 . ASP B 134 ? 0.2942 0.7946 0.8248 0.1410  -0.0653 -0.1881 151 ASP B OD1 
2769 O OD2 . ASP B 134 ? 0.2836 0.7741 0.8311 0.1266  -0.0669 -0.1778 151 ASP B OD2 
2770 N N   . ILE B 135 ? 0.3226 0.8392 0.9185 0.1343  -0.0563 -0.2564 152 ILE B N   
2771 C CA  . ILE B 135 ? 0.3303 0.8458 0.9488 0.1320  -0.0473 -0.2724 152 ILE B CA  
2772 C C   . ILE B 135 ? 0.3435 0.8756 0.9514 0.1426  -0.0400 -0.2892 152 ILE B C   
2773 O O   . ILE B 135 ? 0.3436 0.8686 0.9583 0.1415  -0.0252 -0.2848 152 ILE B O   
2774 C CB  . ILE B 135 ? 0.3412 0.8619 0.9839 0.1288  -0.0559 -0.2966 152 ILE B CB  
2775 C CG1 . ILE B 135 ? 0.3298 0.8342 0.9869 0.1179  -0.0592 -0.2776 152 ILE B CG1 
2776 C CG2 . ILE B 135 ? 0.3539 0.8753 1.0212 0.1285  -0.0462 -0.3192 152 ILE B CG2 
2777 C CD1 . ILE B 135 ? 0.3407 0.8499 1.0234 0.1144  -0.0688 -0.2991 152 ILE B CD1 
2778 N N   . GLU B 136 ? 0.5121 1.0689 1.1025 0.1537  -0.0499 -0.3074 153 GLU B N   
2779 C CA  . GLU B 136 ? 0.5388 1.1188 1.1137 0.1664  -0.0427 -0.3242 153 GLU B CA  
2780 C C   . GLU B 136 ? 0.5283 1.1027 1.0855 0.1700  -0.0314 -0.2996 153 GLU B C   
2781 O O   . GLU B 136 ? 0.5405 1.1219 1.0933 0.1752  -0.0160 -0.3047 153 GLU B O   
2782 C CB  . GLU B 136 ? 0.5702 1.1839 1.1274 0.1790  -0.0589 -0.3463 153 GLU B CB  
2783 C CG  . GLU B 136 ? 0.5936 1.2225 1.1696 0.1781  -0.0677 -0.3811 153 GLU B CG  
2784 C CD  . GLU B 136 ? 0.6083 1.2373 1.1998 0.1776  -0.0501 -0.4045 153 GLU B CD  
2785 O OE1 . GLU B 136 ? 0.6332 1.2616 1.1933 0.1830  -0.0352 -0.4034 153 GLU B OE1 
2786 O OE2 . GLU B 136 ? 0.6073 1.2234 1.2308 0.1680  -0.0503 -0.4182 153 GLU B OE2 
2787 N N   . PHE B 137 ? 0.3495 0.9112 0.8975 0.1670  -0.0380 -0.2740 154 PHE B N   
2788 C CA  . PHE B 137 ? 0.3423 0.8985 0.8776 0.1697  -0.0294 -0.2518 154 PHE B CA  
2789 C C   . PHE B 137 ? 0.3322 0.8686 0.8839 0.1598  -0.0130 -0.2378 154 PHE B C   
2790 O O   . PHE B 137 ? 0.3360 0.8764 0.8846 0.1637  0.0004  -0.2331 154 PHE B O   
2791 C CB  . PHE B 137 ? 0.3302 0.8757 0.8553 0.1680  -0.0401 -0.2311 154 PHE B CB  
2792 C CG  . PHE B 137 ? 0.3324 0.8851 0.8408 0.1780  -0.0385 -0.2187 154 PHE B CG  
2793 C CD1 . PHE B 137 ? 0.3272 0.8731 0.8391 0.1762  -0.0237 -0.2055 154 PHE B CD1 
2794 C CD2 . PHE B 137 ? 0.3410 0.9074 0.8327 0.1892  -0.0524 -0.2189 154 PHE B CD2 
2795 C CE1 . PHE B 137 ? 0.3303 0.8831 0.8310 0.1854  -0.0221 -0.1941 154 PHE B CE1 
2796 C CE2 . PHE B 137 ? 0.3450 0.9174 0.8245 0.1995  -0.0514 -0.2058 154 PHE B CE2 
2797 C CZ  . PHE B 137 ? 0.3395 0.9052 0.8242 0.1976  -0.0359 -0.1940 154 PHE B CZ  
2798 N N   . MET B 138 ? 0.5594 1.0769 1.1287 0.1477  -0.0143 -0.2296 155 MET B N   
2799 C CA  . MET B 138 ? 0.5491 1.0504 1.1347 0.1389  -0.0018 -0.2145 155 MET B CA  
2800 C C   . MET B 138 ? 0.5637 1.0704 1.1638 0.1415  0.0110  -0.2326 155 MET B C   
2801 O O   . MET B 138 ? 0.5635 1.0634 1.1726 0.1390  0.0245  -0.2218 155 MET B O   
2802 C CB  . MET B 138 ? 0.5360 1.0214 1.1349 0.1276  -0.0073 -0.2015 155 MET B CB  
2803 C CG  . MET B 138 ? 0.5219 1.0006 1.1064 0.1238  -0.0146 -0.1801 155 MET B CG  
2804 S SD  . MET B 138 ? 0.5118 0.9783 1.1090 0.1118  -0.0177 -0.1634 155 MET B SD  
2805 C CE  . MET B 138 ? 0.5096 0.9692 1.1212 0.1065  -0.0051 -0.1485 155 MET B CE  
2806 N N   . LYS B 139 ? 0.4016 0.9217 1.0046 0.1466  0.0068  -0.2615 156 LYS B N   
2807 C CA  . LYS B 139 ? 0.4209 0.9476 1.0360 0.1500  0.0199  -0.2844 156 LYS B CA  
2808 C C   . LYS B 139 ? 0.4335 0.9752 1.0290 0.1599  0.0344  -0.2864 156 LYS B C   
2809 O O   . LYS B 139 ? 0.4442 0.9828 1.0487 0.1600  0.0520  -0.2893 156 LYS B O   
2810 C CB  . LYS B 139 ? 0.4380 0.9798 1.0585 0.1538  0.0107  -0.3190 156 LYS B CB  
2811 N N   . ARG B 140 ? 0.4544 1.0128 1.0234 0.1689  0.0276  -0.2837 157 ARG B N   
2812 C CA  . ARG B 140 ? 0.4667 1.0415 1.0150 0.1790  0.0414  -0.2813 157 ARG B CA  
2813 C C   . ARG B 140 ? 0.4503 1.0079 1.0081 0.1722  0.0522  -0.2509 157 ARG B C   
2814 O O   . ARG B 140 ? 0.4604 1.0214 1.0196 0.1740  0.0713  -0.2488 157 ARG B O   
2815 C CB  . ARG B 140 ? 0.4792 1.0675 0.9888 0.1883  0.0283  -0.2786 157 ARG B CB  
2816 C CG  . ARG B 140 ? 0.5093 1.1079 0.9913 0.1924  0.0157  -0.3028 157 ARG B CG  
2817 C CD  . ARG B 140 ? 0.5431 1.1451 0.9675 0.1992  0.0094  -0.2921 157 ARG B CD  
2818 N NE  . ARG B 140 ? 0.5623 1.1762 0.9650 0.2027  -0.0111 -0.3080 157 ARG B NE  
2819 C CZ  . ARG B 140 ? 0.5952 1.2130 0.9653 0.2084  -0.0266 -0.2943 157 ARG B CZ  
2820 N NH1 . ARG B 140 ? 0.5972 1.2056 0.9532 0.2111  -0.0231 -0.2652 157 ARG B NH1 
2821 N NH2 . ARG B 140 ? 0.6319 1.2632 0.9864 0.2113  -0.0461 -0.3095 157 ARG B NH2 
2822 N N   . LEU B 141 ? 0.3856 0.9261 0.9492 0.1640  0.0404  -0.2283 158 LEU B N   
2823 C CA  . LEU B 141 ? 0.3702 0.8976 0.9409 0.1576  0.0470  -0.2009 158 LEU B CA  
2824 C C   . LEU B 141 ? 0.3669 0.8805 0.9606 0.1488  0.0593  -0.1924 158 LEU B C   
2825 O O   . LEU B 141 ? 0.3656 0.8790 0.9652 0.1476  0.0718  -0.1786 158 LEU B O   
2826 C CB  . LEU B 141 ? 0.3509 0.8650 0.9180 0.1512  0.0313  -0.1830 158 LEU B CB  
2827 C CG  . LEU B 141 ? 0.3519 0.8761 0.8993 0.1599  0.0213  -0.1810 158 LEU B CG  
2828 C CD1 . LEU B 141 ? 0.3357 0.8442 0.8810 0.1525  0.0083  -0.1656 158 LEU B CD1 
2829 C CD2 . LEU B 141 ? 0.3570 0.8918 0.9007 0.1666  0.0330  -0.1725 158 LEU B CD2 
2830 N N   . SER B 142 ? 0.4935 0.9971 1.1022 0.1430  0.0552  -0.2000 159 SER B N   
2831 C CA  . SER B 142 ? 0.4909 0.9824 1.1230 0.1359  0.0644  -0.1911 159 SER B CA  
2832 C C   . SER B 142 ? 0.5097 1.0092 1.1483 0.1417  0.0843  -0.2024 159 SER B C   
2833 O O   . SER B 142 ? 0.5090 1.0018 1.1647 0.1377  0.0946  -0.1900 159 SER B O   
2834 C CB  . SER B 142 ? 0.4890 0.9703 1.1382 0.1301  0.0561  -0.1993 159 SER B CB  
2835 O OG  . SER B 142 ? 0.5087 0.9979 1.1631 0.1358  0.0595  -0.2301 159 SER B OG  
2836 N N   . LYS B 143 ? 0.3672 0.8835 0.9899 0.1516  0.0899  -0.2263 160 LYS B N   
2837 C CA  . LYS B 143 ? 0.3919 0.9186 1.0137 0.1581  0.1114  -0.2403 160 LYS B CA  
2838 C C   . LYS B 143 ? 0.3924 0.9283 1.0048 0.1612  0.1255  -0.2228 160 LYS B C   
2839 O O   . LYS B 143 ? 0.4117 0.9544 1.0256 0.1647  0.1462  -0.2273 160 LYS B O   
2840 C CB  . LYS B 143 ? 0.4185 0.9640 1.0196 0.1679  0.1123  -0.2749 160 LYS B CB  
2841 N N   . VAL B 144 ? 0.3734 0.9096 0.9776 0.1596  0.1151  -0.2033 161 VAL B N   
2842 C CA  . VAL B 144 ? 0.3741 0.9208 0.9730 0.1623  0.1274  -0.1879 161 VAL B CA  
2843 C C   . VAL B 144 ? 0.3487 0.8825 0.9615 0.1529  0.1195  -0.1587 161 VAL B C   
2844 O O   . VAL B 144 ? 0.3477 0.8884 0.9639 0.1528  0.1293  -0.1446 161 VAL B O   
2845 C CB  . VAL B 144 ? 0.3872 0.9546 0.9535 0.1733  0.1246  -0.1963 161 VAL B CB  
2846 C CG1 . VAL B 144 ? 0.4277 1.0025 0.9591 0.1803  0.1330  -0.2192 161 VAL B CG1 
2847 C CG2 . VAL B 144 ? 0.3697 0.9328 0.9286 0.1734  0.0997  -0.1942 161 VAL B CG2 
2848 N N   . VAL B 145 ? 0.3915 0.9087 1.0114 0.1445  0.1027  -0.1506 162 VAL B N   
2849 C CA  . VAL B 145 ? 0.3712 0.8790 0.9967 0.1355  0.0937  -0.1267 162 VAL B CA  
2850 C C   . VAL B 145 ? 0.3583 0.8514 0.9909 0.1262  0.0810  -0.1199 162 VAL B C   
2851 O O   . VAL B 145 ? 0.3618 0.8504 0.9949 0.1269  0.0756  -0.1328 162 VAL B O   
2852 C CB  . VAL B 145 ? 0.3638 0.8750 0.9740 0.1385  0.0827  -0.1227 162 VAL B CB  
2853 C CG1 . VAL B 145 ? 0.3562 0.8594 0.9544 0.1376  0.0641  -0.1288 162 VAL B CG1 
2854 C CG2 . VAL B 145 ? 0.3511 0.8586 0.9693 0.1311  0.0811  -0.1018 162 VAL B CG2 
2855 N N   . ASN B 146 ? 0.2842 0.7725 0.9227 0.1175  0.0764  -0.1005 163 ASN B N   
2856 C CA  . ASN B 146 ? 0.2733 0.7523 0.9153 0.1090  0.0650  -0.0923 163 ASN B CA  
2857 C C   . ASN B 146 ? 0.2636 0.7383 0.8886 0.1077  0.0499  -0.0920 163 ASN B C   
2858 O O   . ASN B 146 ? 0.2569 0.7332 0.8714 0.1070  0.0446  -0.0854 163 ASN B O   
2859 C CB  . ASN B 146 ? 0.2656 0.7454 0.9168 0.1004  0.0646  -0.0744 163 ASN B CB  
2860 C CG  . ASN B 146 ? 0.2761 0.7594 0.9468 0.1009  0.0789  -0.0737 163 ASN B CG  
2861 O OD1 . ASN B 146 ? 0.2867 0.7674 0.9688 0.1045  0.0860  -0.0838 163 ASN B OD1 
2862 N ND2 . ASN B 146 ? 0.2747 0.7636 0.9517 0.0969  0.0834  -0.0627 163 ASN B ND2 
2863 N N   . ILE B 147 ? 0.2643 0.7336 0.8895 0.1072  0.0436  -0.0999 164 ILE B N   
2864 C CA  . ILE B 147 ? 0.2573 0.7234 0.8679 0.1061  0.0307  -0.1004 164 ILE B CA  
2865 C C   . ILE B 147 ? 0.2469 0.7094 0.8590 0.0971  0.0232  -0.0864 164 ILE B C   
2866 O O   . ILE B 147 ? 0.2485 0.7091 0.8756 0.0934  0.0254  -0.0837 164 ILE B O   
2867 C CB  . ILE B 147 ? 0.2667 0.7330 0.8761 0.1118  0.0278  -0.1207 164 ILE B CB  
2868 C CG1 . ILE B 147 ? 0.2774 0.7533 0.8770 0.1220  0.0317  -0.1351 164 ILE B CG1 
2869 C CG2 . ILE B 147 ? 0.2599 0.7224 0.8597 0.1087  0.0148  -0.1195 164 ILE B CG2 
2870 C CD1 . ILE B 147 ? 0.2718 0.7499 0.8546 0.1247  0.0246  -0.1283 164 ILE B CD1 
2871 N N   . VAL B 148 ? 0.2381 0.7014 0.8356 0.0943  0.0148  -0.0782 165 VAL B N   
2872 C CA  . VAL B 148 ? 0.2301 0.6948 0.8254 0.0870  0.0079  -0.0666 165 VAL B CA  
2873 C C   . VAL B 148 ? 0.2281 0.6913 0.8107 0.0884  -0.0003 -0.0708 165 VAL B C   
2874 O O   . VAL B 148 ? 0.2253 0.6890 0.7951 0.0899  -0.0042 -0.0701 165 VAL B O   
2875 C CB  . VAL B 148 ? 0.2226 0.6943 0.8145 0.0809  0.0063  -0.0524 165 VAL B CB  
2876 C CG1 . VAL B 148 ? 0.2161 0.6950 0.8039 0.0744  -0.0006 -0.0419 165 VAL B CG1 
2877 C CG2 . VAL B 148 ? 0.2254 0.6996 0.8320 0.0788  0.0135  -0.0481 165 VAL B CG2 
2878 N N   . PRO B 149 ? 0.2309 0.6922 0.8199 0.0879  -0.0028 -0.0761 166 PRO B N   
2879 C CA  . PRO B 149 ? 0.2305 0.6916 0.8107 0.0891  -0.0101 -0.0808 166 PRO B CA  
2880 C C   . PRO B 149 ? 0.2219 0.6893 0.7930 0.0838  -0.0146 -0.0661 166 PRO B C   
2881 O O   . PRO B 149 ? 0.2174 0.6920 0.7935 0.0778  -0.0136 -0.0532 166 PRO B O   
2882 C CB  . PRO B 149 ? 0.2365 0.6954 0.8327 0.0882  -0.0106 -0.0892 166 PRO B CB  
2883 C CG  . PRO B 149 ? 0.2421 0.6980 0.8555 0.0885  -0.0027 -0.0928 166 PRO B CG  
2884 C CD  . PRO B 149 ? 0.2360 0.6952 0.8448 0.0860  0.0013  -0.0784 166 PRO B CD  
2885 N N   . VAL B 150 ? 0.2213 0.6884 0.7798 0.0864  -0.0196 -0.0694 167 VAL B N   
2886 C CA  . VAL B 150 ? 0.2152 0.6897 0.7665 0.0823  -0.0228 -0.0582 167 VAL B CA  
2887 C C   . VAL B 150 ? 0.2171 0.6927 0.7646 0.0841  -0.0277 -0.0627 167 VAL B C   
2888 O O   . VAL B 150 ? 0.2233 0.6931 0.7672 0.0902  -0.0306 -0.0762 167 VAL B O   
2889 C CB  . VAL B 150 ? 0.2135 0.6871 0.7562 0.0835  -0.0229 -0.0576 167 VAL B CB  
2890 C CG1 . VAL B 150 ? 0.2141 0.6886 0.7476 0.0856  -0.0277 -0.0611 167 VAL B CG1 
2891 C CG2 . VAL B 150 ? 0.2080 0.6906 0.7553 0.0766  -0.0207 -0.0445 167 VAL B CG2 
2892 N N   . ILE B 151 ? 0.2127 0.6993 0.7620 0.0790  -0.0289 -0.0510 168 ILE B N   
2893 C CA  . ILE B 151 ? 0.2144 0.7049 0.7622 0.0803  -0.0326 -0.0532 168 ILE B CA  
2894 C C   . ILE B 151 ? 0.2148 0.7048 0.7518 0.0834  -0.0346 -0.0566 168 ILE B C   
2895 O O   . ILE B 151 ? 0.2110 0.7099 0.7478 0.0795  -0.0339 -0.0477 168 ILE B O   
2896 C CB  . ILE B 151 ? 0.2109 0.7176 0.7682 0.0740  -0.0320 -0.0388 168 ILE B CB  
2897 C CG1 . ILE B 151 ? 0.2131 0.7199 0.7839 0.0717  -0.0306 -0.0390 168 ILE B CG1 
2898 C CG2 . ILE B 151 ? 0.2131 0.7257 0.7712 0.0754  -0.0350 -0.0402 168 ILE B CG2 
2899 C CD1 . ILE B 151 ? 0.2134 0.7389 0.7992 0.0660  -0.0309 -0.0290 168 ILE B CD1 
2900 N N   . ALA B 152 ? 0.3219 0.8032 0.8516 0.0909  -0.0377 -0.0708 169 ALA B N   
2901 C CA  . ALA B 152 ? 0.3250 0.8055 0.8458 0.0958  -0.0399 -0.0773 169 ALA B CA  
2902 C C   . ALA B 152 ? 0.3248 0.8157 0.8478 0.0944  -0.0409 -0.0738 169 ALA B C   
2903 O O   . ALA B 152 ? 0.3257 0.8217 0.8548 0.0935  -0.0421 -0.0719 169 ALA B O   
2904 C CB  . ALA B 152 ? 0.3334 0.8065 0.8478 0.1053  -0.0439 -0.0912 169 ALA B CB  
2905 N N   . LYS B 153 ? 0.3144 0.8100 0.8344 0.0942  -0.0403 -0.0747 170 LYS B N   
2906 C CA  . LYS B 153 ? 0.3159 0.8241 0.8392 0.0938  -0.0402 -0.0740 170 LYS B CA  
2907 C C   . LYS B 153 ? 0.3105 0.8317 0.8458 0.0860  -0.0381 -0.0582 170 LYS B C   
2908 O O   . LYS B 153 ? 0.3124 0.8397 0.8539 0.0870  -0.0387 -0.0567 170 LYS B O   
2909 C CB  . LYS B 153 ? 0.3240 0.8301 0.8440 0.1026  -0.0433 -0.0857 170 LYS B CB  
2910 C CG  . LYS B 153 ? 0.3313 0.8276 0.8426 0.1117  -0.0459 -0.0991 170 LYS B CG  
2911 C CD  . LYS B 153 ? 0.3403 0.8361 0.8508 0.1210  -0.0500 -0.1075 170 LYS B CD  
2912 C CE  . LYS B 153 ? 0.3495 0.8383 0.8551 0.1312  -0.0526 -0.1183 170 LYS B CE  
2913 N NZ  . LYS B 153 ? 0.3598 0.8503 0.8671 0.1412  -0.0573 -0.1243 170 LYS B NZ  
2914 N N   . ALA B 154 ? 0.2142 0.7418 0.7552 0.0785  -0.0360 -0.0450 171 ALA B N   
2915 C CA  . ALA B 154 ? 0.2095 0.7523 0.7644 0.0715  -0.0344 -0.0264 171 ALA B CA  
2916 C C   . ALA B 154 ? 0.2110 0.7714 0.7765 0.0692  -0.0336 -0.0209 171 ALA B C   
2917 O O   . ALA B 154 ? 0.2086 0.7844 0.7895 0.0642  -0.0324 -0.0046 171 ALA B O   
2918 C CB  . ALA B 154 ? 0.2040 0.7524 0.7628 0.0649  -0.0332 -0.0126 171 ALA B CB  
2919 N N   . ASP B 155 ? 0.5976 1.1588 1.1559 0.0735  -0.0339 -0.0360 172 ASP B N   
2920 C CA  . ASP B 155 ? 0.6045 1.1843 1.1717 0.0729  -0.0322 -0.0369 172 ASP B CA  
2921 C C   . ASP B 155 ? 0.6065 1.1886 1.1792 0.0774  -0.0316 -0.0380 172 ASP B C   
2922 O O   . ASP B 155 ? 0.6135 1.2130 1.1986 0.0765  -0.0291 -0.0351 172 ASP B O   
2923 C CB  . ASP B 155 ? 0.6130 1.1983 1.1681 0.0773  -0.0321 -0.0569 172 ASP B CB  
2924 C CG  . ASP B 155 ? 0.6169 1.1849 1.1571 0.0870  -0.0340 -0.0747 172 ASP B CG  
2925 O OD1 . ASP B 155 ? 0.6136 1.1633 1.1490 0.0882  -0.0360 -0.0724 172 ASP B OD1 
2926 O OD2 . ASP B 155 ? 0.6245 1.1987 1.1594 0.0940  -0.0333 -0.0915 172 ASP B OD2 
2927 N N   . THR B 156 ? 0.3320 0.8984 0.8971 0.0821  -0.0341 -0.0435 173 THR B N   
2928 C CA  . THR B 156 ? 0.3356 0.9044 0.9070 0.0856  -0.0353 -0.0449 173 THR B CA  
2929 C C   . THR B 156 ? 0.3325 0.9173 0.9239 0.0787  -0.0342 -0.0276 173 THR B C   
2930 O O   . THR B 156 ? 0.3367 0.9356 0.9417 0.0792  -0.0335 -0.0251 173 THR B O   
2931 C CB  . THR B 156 ? 0.3384 0.8887 0.8992 0.0913  -0.0399 -0.0566 173 THR B CB  
2932 O OG1 . THR B 156 ? 0.3429 0.8817 0.8889 0.0984  -0.0415 -0.0716 173 THR B OG1 
2933 C CG2 . THR B 156 ? 0.3437 0.8988 0.9127 0.0948  -0.0429 -0.0601 173 THR B CG2 
2934 N N   . LEU B 157 ? 0.3142 0.9003 0.9092 0.0727  -0.0339 -0.0165 174 LEU B N   
2935 C CA  . LEU B 157 ? 0.3134 0.9185 0.9261 0.0671  -0.0334 -0.0024 174 LEU B CA  
2936 C C   . LEU B 157 ? 0.3172 0.9362 0.9377 0.0593  -0.0300 0.0159  174 LEU B C   
2937 O O   . LEU B 157 ? 0.3178 0.9303 0.9361 0.0570  -0.0290 0.0182  174 LEU B O   
2938 C CB  . LEU B 157 ? 0.3136 0.9096 0.9212 0.0656  -0.0351 -0.0055 174 LEU B CB  
2939 C CG  . LEU B 157 ? 0.3178 0.8882 0.9155 0.0712  -0.0387 -0.0247 174 LEU B CG  
2940 C CD1 . LEU B 157 ? 0.3165 0.8757 0.9130 0.0694  -0.0386 -0.0276 174 LEU B CD1 
2941 C CD2 . LEU B 157 ? 0.3259 0.8999 0.9345 0.0730  -0.0420 -0.0322 174 LEU B CD2 
2942 N N   . THR B 158 ? 0.5683 1.2050 1.1974 0.0549  -0.0287 0.0267  175 THR B N   
2943 C CA  . THR B 158 ? 0.5772 1.2255 1.2116 0.0469  -0.0256 0.0469  175 THR B CA  
2944 C C   . THR B 158 ? 0.5784 1.2489 1.1847 0.0438  -0.0264 0.0427  175 THR B C   
2945 O O   . THR B 158 ? 0.5724 1.2304 1.1782 0.0468  -0.0289 0.0283  175 THR B O   
2946 C CB  . THR B 158 ? 0.5845 1.2605 1.2266 0.0447  -0.0234 0.0551  175 THR B CB  
2947 O OG1 . THR B 158 ? 0.5808 1.2849 1.2109 0.0456  -0.0264 0.0303  175 THR B OG1 
2948 C CG2 . THR B 158 ? 0.5829 1.2466 1.2486 0.0499  -0.0229 0.0464  175 THR B CG2 
2949 N N   . LEU B 159 ? 0.7923 0.8380 0.7176 0.1611  0.0017  0.0614  176 LEU B N   
2950 C CA  . LEU B 159 ? 0.7686 0.8186 0.7480 0.1282  -0.0352 0.0192  176 LEU B CA  
2951 C C   . LEU B 159 ? 0.6572 0.7800 0.6889 0.1172  -0.0620 0.0182  176 LEU B C   
2952 O O   . LEU B 159 ? 0.6106 0.7475 0.6850 0.0975  -0.0729 -0.0106 176 LEU B O   
2953 C CB  . LEU B 159 ? 0.7596 0.7739 0.7332 0.1190  -0.0641 0.0058  176 LEU B CB  
2954 C CG  . LEU B 159 ? 0.6718 0.6971 0.7030 0.0881  -0.1040 -0.0332 176 LEU B CG  
2955 C CD1 . LEU B 159 ? 0.6866 0.6842 0.7335 0.0688  -0.0923 -0.0638 176 LEU B CD1 
2956 C CD2 . LEU B 159 ? 0.6804 0.6794 0.7054 0.0813  -0.1337 -0.0401 176 LEU B CD2 
2957 N N   . GLU B 160 ? 0.7362 0.9032 0.7601 0.1296  -0.0717 0.0514  177 GLU B N   
2958 C CA  . GLU B 160 ? 0.6194 0.8496 0.6797 0.1167  -0.0974 0.0550  177 GLU B CA  
2959 C C   . GLU B 160 ? 0.6237 0.8832 0.6941 0.1157  -0.0740 0.0582  177 GLU B C   
2960 O O   . GLU B 160 ? 0.5609 0.8426 0.6673 0.0965  -0.0911 0.0363  177 GLU B O   
2961 C CB  . GLU B 160 ? 0.5556 0.8283 0.5978 0.1283  -0.1104 0.0963  177 GLU B CB  
2962 N N   . GLU B 161 ? 0.9966 1.2533 1.0318 0.1382  -0.0336 0.0867  178 GLU B N   
2963 C CA  . GLU B 161 ? 0.9860 1.2710 1.0270 0.1395  -0.0081 0.0938  178 GLU B CA  
2964 C C   . GLU B 161 ? 1.0289 1.2813 1.0955 0.1234  -0.0008 0.0510  178 GLU B C   
2965 O O   . GLU B 161 ? 0.9901 1.2714 1.0822 0.1125  0.0011  0.0412  178 GLU B O   
2966 C CB  . GLU B 161 ? 1.0115 1.2963 1.0060 0.1709  0.0362  0.1354  178 GLU B CB  
2967 C CG  . GLU B 161 ? 0.9470 1.2833 0.9203 0.1890  0.0335  0.1867  178 GLU B CG  
2968 C CD  . GLU B 161 ? 0.9446 1.2808 0.8710 0.2254  0.0811  0.2307  178 GLU B CD  
2969 O OE1 . GLU B 161 ? 0.9965 1.2737 0.8966 0.2377  0.1149  0.2182  178 GLU B OE1 
2970 O OE2 . GLU B 161 ? 0.8660 1.2612 0.7795 0.2416  0.0851  0.2796  178 GLU B OE2 
2971 N N   . ARG B 162 ? 0.8572 1.0499 0.9144 0.1209  0.0031  0.0273  179 ARG B N   
2972 C CA  . ARG B 162 ? 0.8831 1.0468 0.9637 0.1039  0.0094  -0.0100 179 ARG B CA  
2973 C C   . ARG B 162 ? 0.7942 0.9846 0.9310 0.0801  -0.0259 -0.0420 179 ARG B C   
2974 O O   . ARG B 162 ? 0.7664 0.9681 0.9317 0.0697  -0.0190 -0.0616 179 ARG B O   
2975 C CB  . ARG B 162 ? 0.9648 1.0589 1.0174 0.1015  0.0168  -0.0247 179 ARG B CB  
2976 C CG  . ARG B 162 ? 0.9710 1.0402 1.0515 0.0779  0.0157  -0.0625 179 ARG B CG  
2977 C CD  . ARG B 162 ? 1.0171 1.0147 1.0603 0.0707  0.0222  -0.0731 179 ARG B CD  
2978 N NE  . ARG B 162 ? 1.0783 1.0281 1.0524 0.0927  0.0625  -0.0477 179 ARG B NE  
2979 C CZ  . ARG B 162 ? 1.1112 1.0255 1.0326 0.1118  0.0688  -0.0251 179 ARG B CZ  
2980 N NH1 . ARG B 162 ? 1.1033 1.0276 1.0362 0.1091  0.0356  -0.0253 179 ARG B NH1 
2981 N NH2 . ARG B 162 ? 1.1358 1.0027 0.9904 0.1355  0.1098  -0.0013 179 ARG B NH2 
2982 N N   . VAL B 163 ? 0.7602 0.9593 0.9104 0.0734  -0.0622 -0.0458 180 VAL B N   
2983 C CA  . VAL B 163 ? 0.6409 0.8599 0.8380 0.0547  -0.0957 -0.0736 180 VAL B CA  
2984 C C   . VAL B 163 ? 0.5850 0.8496 0.7950 0.0520  -0.0976 -0.0664 180 VAL B C   
2985 O O   . VAL B 163 ? 0.5407 0.8138 0.7826 0.0410  -0.1024 -0.0910 180 VAL B O   
2986 C CB  . VAL B 163 ? 0.5686 0.7845 0.7709 0.0499  -0.1336 -0.0758 180 VAL B CB  
2987 C CG1 . VAL B 163 ? 0.4546 0.6897 0.6993 0.0344  -0.1658 -0.1011 180 VAL B CG1 
2988 C CG2 . VAL B 163 ? 0.6122 0.7800 0.8022 0.0483  -0.1346 -0.0866 180 VAL B CG2 
2989 N N   . HIS B 164 ? 0.6285 0.9228 0.8111 0.0617  -0.0933 -0.0307 181 HIS B N   
2990 C CA  . HIS B 164 ? 0.5850 0.9219 0.7707 0.0554  -0.0957 -0.0190 181 HIS B CA  
2991 C C   . HIS B 164 ? 0.6229 0.9649 0.8127 0.0577  -0.0621 -0.0234 181 HIS B C   
2992 O O   . HIS B 164 ? 0.5861 0.9472 0.7914 0.0466  -0.0662 -0.0343 181 HIS B O   
2993 C CB  . HIS B 164 ? 0.5728 0.9472 0.7269 0.0633  -0.0980 0.0264  181 HIS B CB  
2994 C CG  . HIS B 164 ? 0.5338 0.9531 0.6835 0.0535  -0.0982 0.0441  181 HIS B CG  
2995 N ND1 . HIS B 164 ? 0.5635 1.0055 0.6998 0.0626  -0.0642 0.0657  181 HIS B ND1 
2996 C CD2 . HIS B 164 ? 0.4734 0.9151 0.6252 0.0334  -0.1285 0.0436  181 HIS B CD2 
2997 C CE1 . HIS B 164 ? 0.5230 1.0031 0.6556 0.0472  -0.0746 0.0783  181 HIS B CE1 
2998 N NE2 . HIS B 164 ? 0.4757 0.9533 0.6145 0.0285  -0.1135 0.0649  181 HIS B NE2 
2999 N N   . PHE B 165 ? 0.3825 0.7027 0.5536 0.0724  -0.0280 -0.0148 182 PHE B N   
3000 C CA  . PHE B 165 ? 0.3892 0.7126 0.5607 0.0758  0.0062  -0.0164 182 PHE B CA  
3001 C C   . PHE B 165 ? 0.3841 0.6900 0.5938 0.0611  0.0026  -0.0583 182 PHE B C   
3002 O O   . PHE B 165 ? 0.3752 0.7007 0.6005 0.0556  0.0120  -0.0666 182 PHE B O   
3003 C CB  . PHE B 165 ? 0.4207 0.7161 0.5555 0.0960  0.0441  0.0036  182 PHE B CB  
3004 C CG  . PHE B 165 ? 0.4286 0.7347 0.5556 0.1032  0.0813  0.0128  182 PHE B CG  
3005 C CD1 . PHE B 165 ? 0.4093 0.7670 0.5405 0.1015  0.0838  0.0317  182 PHE B CD1 
3006 C CD2 . PHE B 165 ? 0.4593 0.7220 0.5709 0.1095  0.1131  0.0035  182 PHE B CD2 
3007 C CE1 . PHE B 165 ? 0.4160 0.7854 0.5407 0.1080  0.1179  0.0410  182 PHE B CE1 
3008 C CE2 . PHE B 165 ? 0.4674 0.7392 0.5711 0.1165  0.1476  0.0123  182 PHE B CE2 
3009 C CZ  . PHE B 165 ? 0.4436 0.7706 0.5559 0.1168  0.1503  0.0311  182 PHE B CZ  
3010 N N   . LYS B 166 ? 0.5823 0.8544 0.8066 0.0546  -0.0113 -0.0825 183 LYS B N   
3011 C CA  . LYS B 166 ? 0.5530 0.8166 0.8178 0.0408  -0.0177 -0.1185 183 LYS B CA  
3012 C C   . LYS B 166 ? 0.4703 0.7627 0.7643 0.0324  -0.0413 -0.1323 183 LYS B C   
3013 O O   . LYS B 166 ? 0.4545 0.7566 0.7727 0.0279  -0.0322 -0.1498 183 LYS B O   
3014 C CB  . LYS B 166 ? 0.5581 0.7883 0.8331 0.0328  -0.0349 -0.1368 183 LYS B CB  
3015 C CG  . LYS B 166 ? 0.6563 0.8443 0.9058 0.0331  -0.0092 -0.1362 183 LYS B CG  
3016 C CD  . LYS B 166 ? 0.6301 0.7892 0.8940 0.0180  -0.0307 -0.1572 183 LYS B CD  
3017 C CE  . LYS B 166 ? 0.7038 0.8188 0.9454 0.0092  -0.0068 -0.1631 183 LYS B CE  
3018 N NZ  . LYS B 166 ? 0.8208 0.8994 0.9996 0.0258  0.0241  -0.1373 183 LYS B NZ  
3019 N N   . GLN B 167 ? 0.3528 0.6549 0.6399 0.0306  -0.0710 -0.1238 184 GLN B N   
3020 C CA  . GLN B 167 ? 0.3417 0.6601 0.6433 0.0222  -0.0951 -0.1351 184 GLN B CA  
3021 C C   . GLN B 167 ? 0.3420 0.6844 0.6302 0.0210  -0.0787 -0.1238 184 GLN B C   
3022 O O   . GLN B 167 ? 0.3428 0.6881 0.6447 0.0148  -0.0840 -0.1418 184 GLN B O   
3023 C CB  . GLN B 167 ? 0.3372 0.6583 0.6240 0.0188  -0.1290 -0.1231 184 GLN B CB  
3024 N N   . ARG B 168 ? 0.3999 0.7590 0.6588 0.0279  -0.0578 -0.0925 185 ARG B N   
3025 C CA  . ARG B 168 ? 0.4094 0.7967 0.6522 0.0248  -0.0438 -0.0761 185 ARG B CA  
3026 C C   . ARG B 168 ? 0.4297 0.8136 0.6889 0.0280  -0.0118 -0.0917 185 ARG B C   
3027 O O   . ARG B 168 ? 0.4265 0.8217 0.6889 0.0212  -0.0079 -0.0995 185 ARG B O   
3028 C CB  . ARG B 168 ? 0.4256 0.8405 0.6335 0.0326  -0.0326 -0.0318 185 ARG B CB  
3029 C CG  . ARG B 168 ? 0.4236 0.8753 0.6126 0.0258  -0.0228 -0.0089 185 ARG B CG  
3030 C CD  . ARG B 168 ? 0.4034 0.8604 0.5864 0.0047  -0.0566 -0.0168 185 ARG B CD  
3031 N NE  . ARG B 168 ? 0.4108 0.8997 0.5697 -0.0077 -0.0511 0.0051  185 ARG B NE  
3032 C CZ  . ARG B 168 ? 0.4339 0.9173 0.5963 -0.0151 -0.0394 -0.0130 185 ARG B CZ  
3033 N NH1 . ARG B 168 ? 0.4475 0.8991 0.6398 -0.0093 -0.0311 -0.0519 185 ARG B NH1 
3034 N NH2 . ARG B 168 ? 0.4450 0.9570 0.5803 -0.0290 -0.0362 0.0097  185 ARG B NH2 
3035 N N   . ILE B 169 ? 0.4492 0.8142 0.7141 0.0372  0.0112  -0.0956 186 ILE B N   
3036 C CA  . ILE B 169 ? 0.4544 0.8138 0.7354 0.0385  0.0408  -0.1108 186 ILE B CA  
3037 C C   . ILE B 169 ? 0.4287 0.7836 0.7483 0.0297  0.0286  -0.1460 186 ILE B C   
3038 O O   . ILE B 169 ? 0.4192 0.7853 0.7498 0.0282  0.0442  -0.1554 186 ILE B O   
3039 C CB  . ILE B 169 ? 0.4912 0.8209 0.7652 0.0457  0.0634  -0.1105 186 ILE B CB  
3040 C CG1 . ILE B 169 ? 0.5215 0.8515 0.7519 0.0608  0.0828  -0.0733 186 ILE B CG1 
3041 C CG2 . ILE B 169 ? 0.4854 0.8092 0.7771 0.0432  0.0910  -0.1275 186 ILE B CG2 
3042 C CD1 . ILE B 169 ? 0.4981 0.8619 0.7119 0.0672  0.1060  -0.0481 186 ILE B CD1 
3043 N N   . THR B 170 ? 0.3517 0.6918 0.6911 0.0256  0.0017  -0.1635 187 THR B N   
3044 C CA  . THR B 170 ? 0.3487 0.6875 0.7255 0.0211  -0.0110 -0.1932 187 THR B CA  
3045 C C   . THR B 170 ? 0.3508 0.7014 0.7214 0.0195  -0.0176 -0.1968 187 THR B C   
3046 O O   . THR B 170 ? 0.3549 0.7094 0.7456 0.0209  -0.0059 -0.2140 187 THR B O   
3047 C CB  . THR B 170 ? 0.3454 0.6705 0.7395 0.0181  -0.0427 -0.2054 187 THR B CB  
3048 O OG1 . THR B 170 ? 0.3507 0.6585 0.7430 0.0167  -0.0374 -0.2019 187 THR B OG1 
3049 C CG2 . THR B 170 ? 0.3446 0.6729 0.7794 0.0174  -0.0522 -0.2325 187 THR B CG2 
3050 N N   . ALA B 171 ? 0.3527 0.7070 0.6914 0.0155  -0.0361 -0.1792 188 ALA B N   
3051 C CA  . ALA B 171 ? 0.3651 0.7218 0.6844 0.0091  -0.0455 -0.1805 188 ALA B CA  
3052 C C   . ALA B 171 ? 0.3705 0.7426 0.6780 0.0087  -0.0159 -0.1729 188 ALA B C   
3053 O O   . ALA B 171 ? 0.3853 0.7519 0.6900 0.0062  -0.0128 -0.1865 188 ALA B O   
3054 C CB  . ALA B 171 ? 0.3692 0.7287 0.6522 0.0000  -0.0723 -0.1586 188 ALA B CB  
3055 N N   . ASP B 172 ? 0.5759 0.9647 0.8732 0.0125  0.0071  -0.1503 189 ASP B N   
3056 C CA  . ASP B 172 ? 0.5862 0.9928 0.8723 0.0127  0.0365  -0.1396 189 ASP B CA  
3057 C C   . ASP B 172 ? 0.5695 0.9696 0.8887 0.0180  0.0593  -0.1658 189 ASP B C   
3058 O O   . ASP B 172 ? 0.5743 0.9805 0.8898 0.0158  0.0726  -0.1715 189 ASP B O   
3059 C CB  . ASP B 172 ? 0.5820 1.0065 0.8487 0.0196  0.0576  -0.1070 189 ASP B CB  
3060 C CG  . ASP B 172 ? 0.5946 1.0421 0.8255 0.0138  0.0417  -0.0723 189 ASP B CG  
3061 O OD1 . ASP B 172 ? 0.6105 1.0622 0.8248 -0.0007 0.0191  -0.0721 189 ASP B OD1 
3062 O OD2 . ASP B 172 ? 0.5911 1.0513 0.8068 0.0236  0.0522  -0.0436 189 ASP B OD2 
3063 N N   . LEU B 173 ? 0.3606 0.7490 0.7098 0.0233  0.0634  -0.1802 190 LEU B N   
3064 C CA  . LEU B 173 ? 0.3615 0.7490 0.7457 0.0260  0.0822  -0.2028 190 LEU B CA  
3065 C C   . LEU B 173 ? 0.3691 0.7543 0.7704 0.0266  0.0705  -0.2254 190 LEU B C   
3066 O O   . LEU B 173 ? 0.3752 0.7677 0.7880 0.0296  0.0903  -0.2356 190 LEU B O   
3067 C CB  . LEU B 173 ? 0.3583 0.7333 0.7680 0.0258  0.0813  -0.2123 190 LEU B CB  
3068 C CG  . LEU B 173 ? 0.3632 0.7278 0.7492 0.0274  0.0990  -0.1925 190 LEU B CG  
3069 C CD1 . LEU B 173 ? 0.3700 0.7137 0.7737 0.0222  0.0956  -0.2042 190 LEU B CD1 
3070 C CD2 . LEU B 173 ? 0.3687 0.7431 0.7421 0.0309  0.1348  -0.1817 190 LEU B CD2 
3071 N N   . LEU B 174 ? 0.3725 0.7449 0.7721 0.0255  0.0396  -0.2321 191 LEU B N   
3072 C CA  . LEU B 174 ? 0.3884 0.7501 0.7963 0.0298  0.0281  -0.2521 191 LEU B CA  
3073 C C   . LEU B 174 ? 0.4102 0.7663 0.7795 0.0261  0.0341  -0.2476 191 LEU B C   
3074 O O   . LEU B 174 ? 0.4274 0.7781 0.8026 0.0326  0.0470  -0.2627 191 LEU B O   
3075 C CB  . LEU B 174 ? 0.3912 0.7361 0.7983 0.0293  -0.0066 -0.2575 191 LEU B CB  
3076 C CG  . LEU B 174 ? 0.3751 0.7232 0.8219 0.0318  -0.0166 -0.2656 191 LEU B CG  
3077 C CD1 . LEU B 174 ? 0.3783 0.7102 0.8195 0.0311  -0.0515 -0.2684 191 LEU B CD1 
3078 C CD2 . LEU B 174 ? 0.3752 0.7361 0.8684 0.0397  -0.0016 -0.2840 191 LEU B CD2 
3079 N N   . SER B 175 ? 0.4128 0.7707 0.7403 0.0149  0.0247  -0.2248 192 SER B N   
3080 C CA  . SER B 175 ? 0.4385 0.7904 0.7213 0.0050  0.0254  -0.2167 192 SER B CA  
3081 C C   . SER B 175 ? 0.4386 0.8078 0.7223 0.0064  0.0595  -0.2132 192 SER B C   
3082 O O   . SER B 175 ? 0.4657 0.8237 0.7228 0.0018  0.0656  -0.2177 192 SER B O   
3083 C CB  . SER B 175 ? 0.4392 0.7993 0.6802 -0.0104 0.0055  -0.1876 192 SER B CB  
3084 O OG  . SER B 175 ? 0.4126 0.8024 0.6608 -0.0080 0.0200  -0.1636 192 SER B OG  
3085 N N   . ASN B 176 ? 0.4511 0.8429 0.7607 0.0124  0.0819  -0.2053 193 ASN B N   
3086 C CA  . ASN B 176 ? 0.4271 0.8360 0.7392 0.0144  0.1154  -0.2010 193 ASN B CA  
3087 C C   . ASN B 176 ? 0.4266 0.8335 0.7799 0.0253  0.1345  -0.2269 193 ASN B C   
3088 O O   . ASN B 176 ? 0.4253 0.8458 0.7859 0.0277  0.1631  -0.2263 193 ASN B O   
3089 C CB  . ASN B 176 ? 0.4072 0.8376 0.7173 0.0159  0.1329  -0.1759 193 ASN B CB  
3090 C CG  . ASN B 176 ? 0.4098 0.8574 0.6770 0.0065  0.1254  -0.1425 193 ASN B CG  
3091 O OD1 . ASN B 176 ? 0.4204 0.8825 0.6630 -0.0009 0.1366  -0.1296 193 ASN B OD1 
3092 N ND2 . ASN B 176 ? 0.4123 0.8615 0.6702 0.0062  0.1064  -0.1261 193 ASN B ND2 
3093 N N   . GLY B 177 ? 0.6008 0.9946 0.9819 0.0320  0.1188  -0.2473 194 GLY B N   
3094 C CA  . GLY B 177 ? 0.5733 0.9726 0.9968 0.0429  0.1342  -0.2684 194 GLY B CA  
3095 C C   . GLY B 177 ? 0.5234 0.9428 0.9801 0.0427  0.1560  -0.2660 194 GLY B C   
3096 O O   . GLY B 177 ? 0.4986 0.9315 0.9839 0.0478  0.1774  -0.2764 194 GLY B O   
3097 N N   . ILE B 178 ? 0.3805 0.7989 0.8292 0.0366  0.1512  -0.2512 195 ILE B N   
3098 C CA  . ILE B 178 ? 0.3718 0.7966 0.8395 0.0343  0.1707  -0.2481 195 ILE B CA  
3099 C C   . ILE B 178 ? 0.3681 0.7928 0.8770 0.0328  0.1581  -0.2639 195 ILE B C   
3100 O O   . ILE B 178 ? 0.3646 0.7774 0.8729 0.0298  0.1343  -0.2630 195 ILE B O   
3101 C CB  . ILE B 178 ? 0.3687 0.7850 0.8035 0.0311  0.1732  -0.2245 195 ILE B CB  
3102 C CG1 . ILE B 178 ? 0.3714 0.7979 0.7681 0.0319  0.1849  -0.2036 195 ILE B CG1 
3103 C CG2 . ILE B 178 ? 0.3722 0.7819 0.8155 0.0283  0.1950  -0.2224 195 ILE B CG2 
3104 C CD1 . ILE B 178 ? 0.3701 0.7948 0.7330 0.0333  0.1869  -0.1750 195 ILE B CD1 
3105 N N   . ASP B 179 ? 0.6117 1.0531 1.1566 0.0341  0.1737  -0.2765 196 ASP B N   
3106 C CA  . ASP B 179 ? 0.6094 1.0611 1.1976 0.0308  0.1623  -0.2883 196 ASP B CA  
3107 C C   . ASP B 179 ? 0.6249 1.0686 1.2144 0.0157  0.1680  -0.2820 196 ASP B C   
3108 O O   . ASP B 179 ? 0.6253 1.0709 1.2132 0.0092  0.1920  -0.2778 196 ASP B O   
3109 C CB  . ASP B 179 ? 0.6045 1.0689 1.2135 0.0366  0.1712  -0.2929 196 ASP B CB  
3110 N N   . VAL B 180 ? 0.3688 0.7956 0.9525 0.0092  0.1446  -0.2798 197 VAL B N   
3111 C CA  . VAL B 180 ? 0.3809 0.7888 0.9556 -0.0067 0.1473  -0.2744 197 VAL B CA  
3112 C C   . VAL B 180 ? 0.3828 0.8060 1.0001 -0.0194 0.1306  -0.2845 197 VAL B C   
3113 O O   . VAL B 180 ? 0.3716 0.8172 1.0223 -0.0119 0.1116  -0.2932 197 VAL B O   
3114 C CB  . VAL B 180 ? 0.3858 0.7601 0.9167 -0.0065 0.1350  -0.2616 197 VAL B CB  
3115 C CG1 . VAL B 180 ? 0.3838 0.7527 0.8748 0.0054  0.1511  -0.2460 197 VAL B CG1 
3116 C CG2 . VAL B 180 ? 0.3750 0.7501 0.9181 -0.0038 0.0999  -0.2672 197 VAL B CG2 
3117 N N   . TYR B 181 ? 0.4016 0.8117 1.0142 -0.0393 0.1382  -0.2817 198 TYR B N   
3118 C CA  . TYR B 181 ? 0.4077 0.8336 1.0561 -0.0576 0.1205  -0.2872 198 TYR B CA  
3119 C C   . TYR B 181 ? 0.4074 0.8138 1.0469 -0.0612 0.0891  -0.2870 198 TYR B C   
3120 O O   . TYR B 181 ? 0.4180 0.7831 1.0103 -0.0607 0.0874  -0.2795 198 TYR B O   
3121 C CB  . TYR B 181 ? 0.4371 0.8474 1.0726 -0.0836 0.1369  -0.2831 198 TYR B CB  
3122 C CG  . TYR B 181 ? 0.4483 0.8774 1.1170 -0.1091 0.1171  -0.2853 198 TYR B CG  
3123 C CD1 . TYR B 181 ? 0.4385 0.9244 1.1645 -0.1141 0.1183  -0.2878 198 TYR B CD1 
3124 C CD2 . TYR B 181 ? 0.4706 0.8635 1.1127 -0.1285 0.0971  -0.2826 198 TYR B CD2 
3125 C CE1 . TYR B 181 ? 0.4484 0.9608 1.2074 -0.1392 0.0991  -0.2853 198 TYR B CE1 
3126 C CE2 . TYR B 181 ? 0.4830 0.8959 1.1540 -0.1557 0.0772  -0.2825 198 TYR B CE2 
3127 C CZ  . TYR B 181 ? 0.4707 0.9466 1.2017 -0.1617 0.0777  -0.2828 198 TYR B CZ  
3128 O OH  . TYR B 181 ? 0.4830 0.9877 1.2452 -0.1906 0.0569  -0.2785 198 TYR B OH  
3129 N N   . PRO B 182 ? 0.3966 0.8346 1.0815 -0.0633 0.0651  -0.2933 199 PRO B N   
3130 C CA  . PRO B 182 ? 0.3859 0.8777 1.1281 -0.0590 0.0681  -0.2984 199 PRO B CA  
3131 C C   . PRO B 182 ? 0.3678 0.8773 1.1234 -0.0287 0.0692  -0.3043 199 PRO B C   
3132 O O   . PRO B 182 ? 0.3602 0.8589 1.1093 -0.0166 0.0477  -0.3070 199 PRO B O   
3133 C CB  . PRO B 182 ? 0.3878 0.9011 1.1649 -0.0747 0.0399  -0.2980 199 PRO B CB  
3134 C CG  . PRO B 182 ? 0.4029 0.8660 1.1353 -0.0905 0.0235  -0.2948 199 PRO B CG  
3135 C CD  . PRO B 182 ? 0.3991 0.8229 1.0820 -0.0723 0.0342  -0.2931 199 PRO B CD  
3136 N N   . GLN B 183 ? 0.3660 0.8978 1.1349 -0.0178 0.0940  -0.3063 200 GLN B N   
3137 C CA  . GLN B 183 ? 0.3596 0.9010 1.1334 0.0096  0.0981  -0.3123 200 GLN B CA  
3138 C C   . GLN B 183 ? 0.3600 0.9251 1.1694 0.0224  0.0773  -0.3149 200 GLN B C   
3139 O O   . GLN B 183 ? 0.3652 0.9626 1.2107 0.0142  0.0732  -0.3091 200 GLN B O   
3140 C CB  . GLN B 183 ? 0.3714 0.9217 1.1396 0.0166  0.1272  -0.3086 200 GLN B CB  
3141 C CG  . GLN B 183 ? 0.3739 0.9022 1.1061 0.0065  0.1505  -0.3039 200 GLN B CG  
3142 C CD  . GLN B 183 ? 0.3769 0.9148 1.1247 -0.0193 0.1608  -0.3017 200 GLN B CD  
3143 O OE1 . GLN B 183 ? 0.3796 0.9361 1.1581 -0.0345 0.1455  -0.3013 200 GLN B OE1 
3144 N NE2 . GLN B 183 ? 0.3854 0.9029 1.1009 -0.0260 0.1852  -0.2966 200 GLN B NE2 
3145 N N   . LYS B 184 ? 0.6052 1.1529 1.3998 0.0417  0.0639  -0.3211 201 LYS B N   
3146 C CA  . LYS B 184 ? 0.6038 1.1648 1.4228 0.0576  0.0451  -0.3225 201 LYS B CA  
3147 C C   . LYS B 184 ? 0.6190 1.2095 1.4620 0.0740  0.0627  -0.3171 201 LYS B C   
3148 O O   . LYS B 184 ? 0.6232 1.2413 1.4990 0.0828  0.0526  -0.3114 201 LYS B O   
3149 C CB  . LYS B 184 ? 0.5981 1.1255 1.3855 0.0753  0.0307  -0.3304 201 LYS B CB  
3150 C CG  . LYS B 184 ? 0.6004 1.0919 1.3503 0.0603  0.0083  -0.3273 201 LYS B CG  
3151 C CD  . LYS B 184 ? 0.6167 1.0798 1.3414 0.0749  -0.0139 -0.3317 201 LYS B CD  
3152 C CE  . LYS B 184 ? 0.6217 1.0513 1.3044 0.0614  -0.0335 -0.3260 201 LYS B CE  
3153 N NZ  . LYS B 184 ? 0.6446 1.0538 1.2812 0.0568  -0.0176 -0.3200 201 LYS B NZ  
3154 N N   . GLU B 185 ? 0.3935 0.9791 1.2180 0.0789  0.0894  -0.3163 202 GLU B N   
3155 C CA  . GLU B 185 ? 0.4141 1.0245 1.2549 0.0966  0.1088  -0.3094 202 GLU B CA  
3156 C C   . GLU B 185 ? 0.4126 1.0716 1.2967 0.0818  0.1129  -0.2955 202 GLU B C   
3157 O O   . GLU B 185 ? 0.4285 1.1189 1.3335 0.0961  0.1278  -0.2855 202 GLU B O   
3158 C CB  . GLU B 185 ? 0.4267 1.0143 1.2299 0.1029  0.1345  -0.3109 202 GLU B CB  
3159 N N   . PHE B 186 ? 0.3968 1.0626 1.2930 0.0524  0.0999  -0.2939 203 PHE B N   
3160 C CA  . PHE B 186 ? 0.3985 1.1096 1.3327 0.0310  0.1015  -0.2809 203 PHE B CA  
3161 C C   . PHE B 186 ? 0.3941 1.1302 1.3602 0.0189  0.0734  -0.2745 203 PHE B C   
3162 O O   . PHE B 186 ? 0.3966 1.1669 1.3898 -0.0077 0.0680  -0.2632 203 PHE B O   
3163 C CB  . PHE B 186 ? 0.3940 1.0912 1.3117 0.0010  0.1136  -0.2827 203 PHE B CB  
3164 C CG  . PHE B 186 ? 0.4009 1.0772 1.2867 0.0106  0.1415  -0.2846 203 PHE B CG  
3165 C CD1 . PHE B 186 ? 0.4154 1.1067 1.3042 0.0355  0.1573  -0.2787 203 PHE B CD1 
3166 C CD2 . PHE B 186 ? 0.3965 1.0373 1.2465 -0.0042 0.1526  -0.2899 203 PHE B CD2 
3167 C CE1 . PHE B 186 ? 0.4249 1.0943 1.2801 0.0424  0.1806  -0.2786 203 PHE B CE1 
3168 C CE2 . PHE B 186 ? 0.4053 1.0267 1.2224 0.0042  0.1766  -0.2880 203 PHE B CE2 
3169 C CZ  . PHE B 186 ? 0.4191 1.0542 1.2383 0.0260  0.1889  -0.2826 203 PHE B CZ  
3170 N N   . ASP B 187 ? 0.4180 1.1354 1.3771 0.0362  0.0544  -0.2806 204 ASP B N   
3171 C CA  . ASP B 187 ? 0.4171 1.1546 1.4012 0.0282  0.0268  -0.2726 204 ASP B CA  
3172 C C   . ASP B 187 ? 0.4305 1.2244 1.4574 0.0477  0.0300  -0.2552 204 ASP B C   
3173 O O   . ASP B 187 ? 0.4420 1.2356 1.4675 0.0830  0.0428  -0.2565 204 ASP B O   
3174 C CB  . ASP B 187 ? 0.4107 1.1055 1.3688 0.0399  0.0053  -0.2844 204 ASP B CB  
3175 C CG  . ASP B 187 ? 0.3977 1.0451 1.3167 0.0209  0.0003  -0.2961 204 ASP B CG  
3176 O OD1 . ASP B 187 ? 0.3955 1.0434 1.3119 -0.0070 0.0067  -0.2940 204 ASP B OD1 
3177 O OD2 . ASP B 187 ? 0.3922 1.0031 1.2827 0.0339  -0.0096 -0.3061 204 ASP B OD2 
3178 N N   . GLU B 188 ? 0.5287 1.3710 1.5910 0.0245  0.0188  -0.2370 205 GLU B N   
3179 C CA  . GLU B 188 ? 0.5406 1.4497 1.6490 0.0410  0.0230  -0.2140 205 GLU B CA  
3180 C C   . GLU B 188 ? 0.5457 1.4591 1.6643 0.0659  0.0050  -0.2097 205 GLU B C   
3181 O O   . GLU B 188 ? 0.5578 1.4669 1.6749 0.1064  0.0171  -0.2117 205 GLU B O   
3182 C CB  . GLU B 188 ? 0.5439 1.5092 1.6862 0.0027  0.0156  -0.1923 205 GLU B CB  
3183 N N   . ASP B 189 ? 0.4945 1.4120 1.6185 0.0414  -0.0233 -0.2033 206 ASP B N   
3184 C CA  . ASP B 189 ? 0.4997 1.4218 1.6324 0.0614  -0.0421 -0.1973 206 ASP B CA  
3185 C C   . ASP B 189 ? 0.4907 1.3493 1.5832 0.0471  -0.0669 -0.2145 206 ASP B C   
3186 O O   . ASP B 189 ? 0.4808 1.2895 1.5370 0.0303  -0.0657 -0.2322 206 ASP B O   
3187 C CB  . ASP B 189 ? 0.5080 1.5065 1.6884 0.0486  -0.0539 -0.1656 206 ASP B CB  
3188 C CG  . ASP B 189 ? 0.5063 1.5181 1.6874 -0.0052 -0.0691 -0.1566 206 ASP B CG  
3189 O OD1 . ASP B 189 ? 0.5047 1.4744 1.6562 -0.0300 -0.0924 -0.1645 206 ASP B OD1 
3190 O OD2 . ASP B 189 ? 0.5111 1.5723 1.7185 -0.0234 -0.0576 -0.1408 206 ASP B OD2 
3191 N N   . SER B 190 ? 0.6947 1.3221 1.3273 0.3149  -0.0841 -0.0169 207 SER B N   
3192 C CA  . SER B 190 ? 0.7253 1.3203 1.3370 0.3234  -0.0807 0.0005  207 SER B CA  
3193 C C   . SER B 190 ? 0.7018 1.3281 1.3147 0.3136  -0.0897 -0.0108 207 SER B C   
3194 O O   . SER B 190 ? 0.7159 1.3088 1.3181 0.3077  -0.0817 0.0028  207 SER B O   
3195 C CB  . SER B 190 ? 0.7514 1.3463 1.3356 0.3689  -0.0756 0.0196  207 SER B CB  
3196 O OG  . SER B 190 ? 0.7824 1.3405 1.3627 0.3807  -0.0703 0.0287  207 SER B OG  
3197 N N   . GLU B 191 ? 0.4446 1.1192 1.0673 0.3070  -0.1054 -0.0331 208 GLU B N   
3198 C CA  . GLU B 191 ? 0.4471 1.1417 1.0654 0.2999  -0.1224 -0.0503 208 GLU B CA  
3199 C C   . GLU B 191 ? 0.4073 1.0919 1.0549 0.2581  -0.1215 -0.0612 208 GLU B C   
3200 O O   . GLU B 191 ? 0.4078 1.0875 1.0438 0.2550  -0.1292 -0.0679 208 GLU B O   
3201 C CB  . GLU B 191 ? 0.4681 1.2074 1.0981 0.3032  -0.1461 -0.0735 208 GLU B CB  
3202 N N   . ASP B 192 ? 0.7198 1.3980 1.3978 0.2321  -0.1106 -0.0623 209 ASP B N   
3203 C CA  . ASP B 192 ? 0.6978 1.3559 1.3955 0.1960  -0.1053 -0.0699 209 ASP B CA  
3204 C C   . ASP B 192 ? 0.7218 1.3180 1.3925 0.1920  -0.0948 -0.0533 209 ASP B C   
3205 O O   . ASP B 192 ? 0.7101 1.2846 1.3805 0.1687  -0.0945 -0.0573 209 ASP B O   
3206 C CB  . ASP B 192 ? 0.6809 1.3432 1.4059 0.1818  -0.0913 -0.0706 209 ASP B CB  
3207 C CG  . ASP B 192 ? 0.6652 1.3018 1.4031 0.1512  -0.0827 -0.0766 209 ASP B CG  
3208 O OD1 . ASP B 192 ? 0.6511 1.2865 1.3906 0.1297  -0.0916 -0.0863 209 ASP B OD1 
3209 O OD2 . ASP B 192 ? 0.6783 1.2827 1.4047 0.1521  -0.0663 -0.0691 209 ASP B OD2 
3210 N N   . ARG B 193 ? 0.3746 0.9394 1.0285 0.2138  -0.0867 -0.0334 210 ARG B N   
3211 C CA  . ARG B 193 ? 0.3826 0.8864 1.0322 0.2087  -0.0786 -0.0148 210 ARG B CA  
3212 C C   . ARG B 193 ? 0.3931 0.8950 1.0329 0.2180  -0.0718 0.0020  210 ARG B C   
3213 O O   . ARG B 193 ? 0.3869 0.8548 1.0380 0.2015  -0.0654 0.0116  210 ARG B O   
3214 C CB  . ARG B 193 ? 0.4102 0.8783 1.0582 0.2303  -0.0748 0.0011  210 ARG B CB  
3215 N N   . LEU B 194 ? 0.4898 1.0280 1.1057 0.2509  -0.0731 0.0060  211 LEU B N   
3216 C CA  . LEU B 194 ? 0.5140 1.0485 1.1030 0.2771  -0.0622 0.0264  211 LEU B CA  
3217 C C   . LEU B 194 ? 0.5088 1.0490 1.0910 0.2583  -0.0700 0.0108  211 LEU B C   
3218 O O   . LEU B 194 ? 0.5167 1.0295 1.0944 0.2612  -0.0526 0.0337  211 LEU B O   
3219 C CB  . LEU B 194 ? 0.5393 1.1111 1.0883 0.3273  -0.0685 0.0265  211 LEU B CB  
3220 C CG  . LEU B 194 ? 0.5721 1.1275 1.1108 0.3631  -0.0503 0.0570  211 LEU B CG  
3221 C CD1 . LEU B 194 ? 0.6184 1.2134 1.1077 0.4174  -0.0616 0.0506  211 LEU B CD1 
3222 C CD2 . LEU B 194 ? 0.5967 1.0992 1.1458 0.3721  -0.0153 0.1044  211 LEU B CD2 
3223 N N   . VAL B 195 ? 0.5191 1.0948 1.1080 0.2400  -0.0945 -0.0259 212 VAL B N   
3224 C CA  . VAL B 195 ? 0.5137 1.0914 1.0971 0.2221  -0.1061 -0.0450 212 VAL B CA  
3225 C C   . VAL B 195 ? 0.4841 1.0213 1.0904 0.1820  -0.0928 -0.0386 212 VAL B C   
3226 O O   . VAL B 195 ? 0.4921 1.0136 1.0864 0.1748  -0.0905 -0.0378 212 VAL B O   
3227 C CB  . VAL B 195 ? 0.4784 1.1018 1.0847 0.2088  -0.1374 -0.0856 212 VAL B CB  
3228 C CG1 . VAL B 195 ? 0.4297 1.0613 1.0861 0.1741  -0.1325 -0.0931 212 VAL B CG1 
3229 C CG2 . VAL B 195 ? 0.4814 1.1007 1.0793 0.1958  -0.1539 -0.1072 212 VAL B CG2 
3230 N N   . ASN B 196 ? 0.3505 0.8686 0.9838 0.1625  -0.0866 -0.0357 213 ASN B N   
3231 C CA  . ASN B 196 ? 0.3313 0.8066 0.9812 0.1333  -0.0806 -0.0340 213 ASN B CA  
3232 C C   . ASN B 196 ? 0.3429 0.7796 1.0040 0.1403  -0.0664 -0.0043 213 ASN B C   
3233 O O   . ASN B 196 ? 0.3322 0.7429 1.0062 0.1215  -0.0645 -0.0029 213 ASN B O   
3234 C CB  . ASN B 196 ? 0.3239 0.7848 0.9869 0.1237  -0.0826 -0.0428 213 ASN B CB  
3235 C CG  . ASN B 196 ? 0.3096 0.7982 0.9790 0.1070  -0.0863 -0.0654 213 ASN B CG  
3236 O OD1 . ASN B 196 ? 0.3030 0.8237 0.9783 0.0985  -0.0933 -0.0786 213 ASN B OD1 
3237 N ND2 . ASN B 196 ? 0.3131 0.7860 0.9841 0.1063  -0.0810 -0.0687 213 ASN B ND2 
3238 N N   . GLU B 197 ? 0.8654 1.2992 1.5301 0.1682  -0.0548 0.0219  214 GLU B N   
3239 C CA  . GLU B 197 ? 0.8711 1.2718 1.5669 0.1769  -0.0348 0.0588  214 GLU B CA  
3240 C C   . GLU B 197 ? 0.8805 1.2900 1.5600 0.1878  -0.0190 0.0752  214 GLU B C   
3241 O O   . GLU B 197 ? 0.8674 1.2520 1.5852 0.1767  -0.0062 0.0952  214 GLU B O   
3242 C CB  . GLU B 197 ? 0.8960 1.2921 1.5973 0.2098  -0.0195 0.0885  214 GLU B CB  
3243 C CG  . GLU B 197 ? 0.8957 1.2649 1.6227 0.2023  -0.0328 0.0800  214 GLU B CG  
3244 C CD  . GLU B 197 ? 0.8830 1.2010 1.6670 0.1749  -0.0440 0.0775  214 GLU B CD  
3245 O OE1 . GLU B 197 ? 0.8752 1.1751 1.7059 0.1682  -0.0305 0.1024  214 GLU B OE1 
3246 O OE2 . GLU B 197 ? 0.8847 1.1804 1.6672 0.1650  -0.0677 0.0504  214 GLU B OE2 
3247 N N   . LYS B 198 ? 0.4134 0.8581 1.0376 0.2134  -0.0233 0.0646  215 LYS B N   
3248 C CA  . LYS B 198 ? 0.4380 0.8883 1.0270 0.2356  -0.0123 0.0756  215 LYS B CA  
3249 C C   . LYS B 198 ? 0.4062 0.8444 1.0076 0.1980  -0.0223 0.0556  215 LYS B C   
3250 O O   . LYS B 198 ? 0.4211 0.8502 1.0136 0.2089  -0.0064 0.0740  215 LYS B O   
3251 C CB  . LYS B 198 ? 0.4732 0.9584 0.9956 0.2738  -0.0306 0.0537  215 LYS B CB  
3252 N N   . PHE B 199 ? 0.3690 0.8061 0.9872 0.1591  -0.0449 0.0211  216 PHE B N   
3253 C CA  . PHE B 199 ? 0.3433 0.7634 0.9705 0.1253  -0.0531 0.0025  216 PHE B CA  
3254 C C   . PHE B 199 ? 0.3305 0.7136 1.0088 0.1083  -0.0432 0.0217  216 PHE B C   
3255 O O   . PHE B 199 ? 0.3269 0.6960 1.0159 0.1002  -0.0370 0.0288  216 PHE B O   
3256 C CB  . PHE B 199 ? 0.3201 0.7499 0.9464 0.0979  -0.0738 -0.0347 216 PHE B CB  
3257 C CG  . PHE B 199 ? 0.3059 0.7211 0.9266 0.0711  -0.0804 -0.0547 216 PHE B CG  
3258 C CD1 . PHE B 199 ? 0.2921 0.6711 0.9313 0.0516  -0.0774 -0.0530 216 PHE B CD1 
3259 C CD2 . PHE B 199 ? 0.3135 0.7476 0.9120 0.0684  -0.0937 -0.0779 216 PHE B CD2 
3260 C CE1 . PHE B 199 ? 0.2852 0.6482 0.9122 0.0319  -0.0816 -0.0700 216 PHE B CE1 
3261 C CE2 . PHE B 199 ? 0.3058 0.7215 0.8997 0.0447  -0.0976 -0.0942 216 PHE B CE2 
3262 C CZ  . PHE B 199 ? 0.2912 0.6717 0.8950 0.0274  -0.0886 -0.0882 216 PHE B CZ  
3263 N N   . ARG B 200 ? 0.3286 0.6950 1.0418 0.1052  -0.0461 0.0274  217 ARG B N   
3264 C CA  . ARG B 200 ? 0.3242 0.6510 1.0970 0.0900  -0.0500 0.0359  217 ARG B CA  
3265 C C   . ARG B 200 ? 0.3392 0.6585 1.1654 0.1017  -0.0252 0.0793  217 ARG B C   
3266 O O   . ARG B 200 ? 0.3334 0.6276 1.2181 0.0854  -0.0298 0.0844  217 ARG B O   
3267 C CB  . ARG B 200 ? 0.3323 0.6377 1.1259 0.0917  -0.0643 0.0289  217 ARG B CB  
3268 C CG  . ARG B 200 ? 0.3242 0.6256 1.0793 0.0821  -0.0850 -0.0086 217 ARG B CG  
3269 C CD  . ARG B 200 ? 0.3447 0.6141 1.1147 0.0919  -0.1010 -0.0153 217 ARG B CD  
3270 N NE  . ARG B 200 ? 0.3567 0.6486 1.1159 0.1127  -0.0908 -0.0016 217 ARG B NE  
3271 C CZ  . ARG B 200 ? 0.3564 0.6744 1.0761 0.1220  -0.0920 -0.0165 217 ARG B CZ  
3272 N NH1 . ARG B 200 ? 0.3468 0.6701 1.0385 0.1120  -0.0976 -0.0407 217 ARG B NH1 
3273 N NH2 . ARG B 200 ? 0.3698 0.7091 1.0825 0.1439  -0.0845 -0.0038 217 ARG B NH2 
3274 N N   . GLU B 201 ? 0.8480 1.1889 1.6562 0.1343  0.0024  0.1121  218 GLU B N   
3275 C CA  . GLU B 201 ? 0.8497 1.1857 1.7088 0.1545  0.0388  0.1650  218 GLU B CA  
3276 C C   . GLU B 201 ? 0.8457 1.1894 1.6970 0.1550  0.0517  0.1733  218 GLU B C   
3277 O O   . GLU B 201 ? 0.8469 1.1740 1.7423 0.1575  0.0792  0.2120  218 GLU B O   
3278 C CB  . GLU B 201 ? 0.8876 1.2415 1.7081 0.2023  0.0694  0.2002  218 GLU B CB  
3279 C CG  . GLU B 201 ? 0.8984 1.2399 1.7428 0.2080  0.0666  0.2069  218 GLU B CG  
3280 C CD  . GLU B 201 ? 0.9439 1.3059 1.7257 0.2605  0.0907  0.2316  218 GLU B CD  
3281 O OE1 . GLU B 201 ? 0.9723 1.3551 1.6903 0.2969  0.1077  0.2431  218 GLU B OE1 
3282 O OE2 . GLU B 201 ? 0.9617 1.3144 1.7481 0.2700  0.0896  0.2366  218 GLU B OE2 
3283 N N   . MET B 202 ? 0.4215 0.7785 1.1997 0.1478  0.0315  0.1345  219 MET B N   
3284 C CA  . MET B 202 ? 0.4303 0.7911 1.1867 0.1513  0.0401  0.1372  219 MET B CA  
3285 C C   . MET B 202 ? 0.3889 0.7284 1.1901 0.1110  0.0192  0.1142  219 MET B C   
3286 O O   . MET B 202 ? 0.3906 0.7287 1.2051 0.1119  0.0306  0.1265  219 MET B O   
3287 C CB  . MET B 202 ? 0.4771 0.8570 1.1350 0.1681  0.0257  0.1061  219 MET B CB  
3288 C CG  . MET B 202 ? 0.5238 0.9235 1.1262 0.2184  0.0383  0.1224  219 MET B CG  
3289 S SD  . MET B 202 ? 0.5949 1.0040 1.1003 0.2708  0.0433  0.1220  219 MET B SD  
3290 C CE  . MET B 202 ? 0.5764 0.9737 1.1280 0.2927  0.0969  0.1874  219 MET B CE  
3291 N N   . ILE B 203 ? 0.3206 0.6424 1.1379 0.0827  -0.0111 0.0809  220 ILE B N   
3292 C CA  . ILE B 203 ? 0.3008 0.5958 1.1487 0.0541  -0.0358 0.0549  220 ILE B CA  
3293 C C   . ILE B 203 ? 0.3221 0.5830 1.2380 0.0464  -0.0296 0.0805  220 ILE B C   
3294 O O   . ILE B 203 ? 0.3418 0.5870 1.3067 0.0492  -0.0233 0.1029  220 ILE B O   
3295 C CB  . ILE B 203 ? 0.2931 0.5675 1.1228 0.0392  -0.0665 0.0167  220 ILE B CB  
3296 C CG1 . ILE B 203 ? 0.2883 0.5833 1.0387 0.0391  -0.0689 -0.0084 220 ILE B CG1 
3297 C CG2 . ILE B 203 ? 0.2980 0.5286 1.1341 0.0221  -0.0924 -0.0097 220 ILE B CG2 
3298 C CD1 . ILE B 203 ? 0.2874 0.5687 1.0204 0.0326  -0.0873 -0.0356 220 ILE B CD1 
3299 N N   . PRO B 204 ? 0.3219 0.5702 1.2491 0.0363  -0.0327 0.0773  221 PRO B N   
3300 C CA  . PRO B 204 ? 0.3026 0.5649 1.1780 0.0335  -0.0395 0.0525  221 PRO B CA  
3301 C C   . PRO B 204 ? 0.3044 0.6076 1.1543 0.0596  -0.0082 0.0787  221 PRO B C   
3302 O O   . PRO B 204 ? 0.3275 0.6373 1.2089 0.0781  0.0233  0.1222  221 PRO B O   
3303 C CB  . PRO B 204 ? 0.3120 0.5386 1.2203 0.0186  -0.0559 0.0431  221 PRO B CB  
3304 C CG  . PRO B 204 ? 0.3388 0.5501 1.3281 0.0198  -0.0408 0.0816  221 PRO B CG  
3305 C CD  . PRO B 204 ? 0.3456 0.5587 1.3496 0.0255  -0.0349 0.0947  221 PRO B CD  
3306 N N   . PHE B 205 ? 0.3456 0.6543 1.1030 0.0615  -0.0164 0.0501  222 PHE B N   
3307 C CA  . PHE B 205 ? 0.3737 0.7003 1.0655 0.0911  0.0021  0.0619  222 PHE B CA  
3308 C C   . PHE B 205 ? 0.3845 0.7090 1.0863 0.1019  0.0191  0.0818  222 PHE B C   
3309 O O   . PHE B 205 ? 0.3672 0.6747 1.0794 0.0790  0.0030  0.0603  222 PHE B O   
3310 C CB  . PHE B 205 ? 0.3765 0.7028 0.9885 0.0837  -0.0216 0.0182  222 PHE B CB  
3311 C CG  . PHE B 205 ? 0.3772 0.7186 0.9736 0.0862  -0.0319 0.0057  222 PHE B CG  
3312 C CD1 . PHE B 205 ? 0.3508 0.6846 0.9773 0.0603  -0.0464 -0.0113 222 PHE B CD1 
3313 C CD2 . PHE B 205 ? 0.4361 0.7983 0.9829 0.1210  -0.0291 0.0096  222 PHE B CD2 
3314 C CE1 . PHE B 205 ? 0.3519 0.7035 0.9678 0.0647  -0.0538 -0.0206 222 PHE B CE1 
3315 C CE2 . PHE B 205 ? 0.4427 0.8227 0.9808 0.1252  -0.0418 -0.0037 222 PHE B CE2 
3316 C CZ  . PHE B 205 ? 0.3870 0.7643 0.9640 0.0947  -0.0520 -0.0171 222 PHE B CZ  
3317 N N   . ALA B 206 ? 0.3825 0.7237 1.0761 0.1432  0.0543  0.1251  223 ALA B N   
3318 C CA  . ALA B 206 ? 0.4014 0.7455 1.1019 0.1633  0.0784  0.1522  223 ALA B CA  
3319 C C   . ALA B 206 ? 0.4355 0.7732 1.0218 0.1869  0.0690  0.1265  223 ALA B C   
3320 O O   . ALA B 206 ? 0.4866 0.8321 1.0023 0.2350  0.0833  0.1402  223 ALA B O   
3321 C CB  . ALA B 206 ? 0.4342 0.7974 1.1880 0.2041  0.1297  0.2208  223 ALA B CB  
3322 N N   . VAL B 207 ? 0.4163 0.7351 0.9816 0.1579  0.0426  0.0878  224 VAL B N   
3323 C CA  . VAL B 207 ? 0.4505 0.7551 0.9163 0.1740  0.0268  0.0570  224 VAL B CA  
3324 C C   . VAL B 207 ? 0.4767 0.7759 0.9252 0.1987  0.0459  0.0764  224 VAL B C   
3325 O O   . VAL B 207 ? 0.4536 0.7595 0.9790 0.1881  0.0634  0.1029  224 VAL B O   
3326 C CB  . VAL B 207 ? 0.4236 0.7056 0.8685 0.1293  -0.0117 0.0020  224 VAL B CB  
3327 C CG1 . VAL B 207 ? 0.3967 0.6872 0.8677 0.1057  -0.0265 -0.0133 224 VAL B CG1 
3328 C CG2 . VAL B 207 ? 0.3935 0.6572 0.8784 0.0990  -0.0164 -0.0057 224 VAL B CG2 
3329 N N   . VAL B 208 ? 0.5359 0.8219 0.8861 0.2343  0.0387  0.0608  225 VAL B N   
3330 C CA  . VAL B 208 ? 0.5719 0.8484 0.8849 0.2651  0.0546  0.0749  225 VAL B CA  
3331 C C   . VAL B 208 ? 0.6056 0.8472 0.8238 0.2656  0.0174  0.0223  225 VAL B C   
3332 O O   . VAL B 208 ? 0.6481 0.8799 0.7978 0.2876  -0.0072 -0.0052 225 VAL B O   
3333 C CB  . VAL B 208 ? 0.6361 0.9302 0.9182 0.3381  0.0991  0.1302  225 VAL B CB  
3334 C CG1 . VAL B 208 ? 0.6872 0.9675 0.9068 0.3792  0.1122  0.1390  225 VAL B CG1 
3335 C CG2 . VAL B 208 ? 0.6072 0.9337 1.0063 0.3364  0.1440  0.1917  225 VAL B CG2 
3336 N N   . GLY B 209 ? 1.0163 1.2371 1.2365 0.2427  0.0102  0.0069  226 GLY B N   
3337 C CA  . GLY B 209 ? 1.0884 1.2698 1.2288 0.2417  -0.0217 -0.0390 226 GLY B CA  
3338 C C   . GLY B 209 ? 1.1441 1.3119 1.1868 0.3098  -0.0187 -0.0338 226 GLY B C   
3339 O O   . GLY B 209 ? 1.1528 1.3083 1.1651 0.3346  -0.0039 -0.0207 226 GLY B O   
3340 N N   . GLU B 240 ? 0.7591 1.1086 1.0697 0.3425  0.0685  0.1202  257 GLU B N   
3341 C CA  . GLU B 240 ? 0.7554 1.1141 1.0793 0.3176  0.0403  0.0913  257 GLU B CA  
3342 C C   . GLU B 240 ? 0.7788 1.1270 1.0931 0.2677  -0.0105 0.0265  257 GLU B C   
3343 O O   . GLU B 240 ? 0.7584 1.1155 1.1065 0.2329  -0.0314 0.0028  257 GLU B O   
3344 C CB  . GLU B 240 ? 0.6816 1.0503 1.1103 0.2822  0.0623  0.1224  257 GLU B CB  
3345 C CG  . GLU B 240 ? 0.6527 1.0310 1.1198 0.3250  0.1177  0.1933  257 GLU B CG  
3346 C CD  . GLU B 240 ? 0.5845 0.9654 1.1700 0.2850  0.1307  0.2179  257 GLU B CD  
3347 O OE1 . GLU B 240 ? 0.5458 0.9173 1.1840 0.2270  0.1004  0.1841  257 GLU B OE1 
3348 O OE2 . GLU B 240 ? 0.5822 0.9700 1.2054 0.3163  0.1706  0.2711  257 GLU B OE2 
3349 N N   . PHE B 241 ? 0.5597 1.1524 1.3753 -0.0373 0.1450  0.0267  258 PHE B N   
3350 C CA  . PHE B 241 ? 0.5464 1.1179 1.3602 -0.0248 0.1290  0.0189  258 PHE B CA  
3351 C C   . PHE B 241 ? 0.5418 1.1158 1.3497 -0.0111 0.1269  0.0139  258 PHE B C   
3352 O O   . PHE B 241 ? 0.5350 1.0851 1.3379 -0.0045 0.1179  0.0167  258 PHE B O   
3353 C CB  . PHE B 241 ? 0.5449 1.1287 1.3691 -0.0203 0.1221  0.0049  258 PHE B CB  
3354 C CG  . PHE B 241 ? 0.5392 1.0996 1.3649 -0.0082 0.1110  -0.0018 258 PHE B CG  
3355 C CD1 . PHE B 241 ? 0.5341 1.0646 1.3571 -0.0083 0.1020  0.0077  258 PHE B CD1 
3356 C CD2 . PHE B 241 ? 0.5406 1.1098 1.3736 0.0013  0.1117  -0.0176 258 PHE B CD2 
3357 C CE1 . PHE B 241 ? 0.5290 1.0380 1.3555 0.0014  0.0946  0.0040  258 PHE B CE1 
3358 C CE2 . PHE B 241 ? 0.5394 1.0843 1.3790 0.0085  0.1047  -0.0231 258 PHE B CE2 
3359 C CZ  . PHE B 241 ? 0.5335 1.0479 1.3694 0.0087  0.0966  -0.0110 258 PHE B CZ  
3360 N N   . ALA B 242 ? 0.3775 0.9871 1.1871 -0.0076 0.1355  0.0064  259 ALA B N   
3361 C CA  . ALA B 242 ? 0.3825 1.0098 1.1892 0.0035  0.1333  -0.0001 259 ALA B CA  
3362 C C   . ALA B 242 ? 0.3913 1.0040 1.1889 0.0098  0.1351  0.0208  259 ALA B C   
3363 O O   . ALA B 242 ? 0.3826 0.9932 1.1768 0.0184  0.1260  0.0191  259 ALA B O   
3364 C CB  . ALA B 242 ? 0.4035 1.0800 1.2145 0.0057  0.1445  -0.0102 259 ALA B CB  
3365 N N   . TYR B 243 ? 0.5146 1.1174 1.3096 0.0055  0.1496  0.0435  260 TYR B N   
3366 C CA  . TYR B 243 ? 0.5576 1.1294 1.3244 0.0147  0.1533  0.0683  260 TYR B CA  
3367 C C   . TYR B 243 ? 0.5215 1.0591 1.3005 0.0148  0.1442  0.0721  260 TYR B C   
3368 O O   . TYR B 243 ? 0.5257 1.0540 1.2940 0.0291  0.1397  0.0807  260 TYR B O   
3369 C CB  . TYR B 243 ? 0.6321 1.1731 1.3596 0.0066  0.1691  0.0887  260 TYR B CB  
3370 C CG  . TYR B 243 ? 0.7043 1.2108 1.3843 0.0229  0.1767  0.1145  260 TYR B CG  
3371 C CD1 . TYR B 243 ? 0.7287 1.2668 1.3901 0.0444  0.1772  0.1215  260 TYR B CD1 
3372 C CD2 . TYR B 243 ? 0.7538 1.1977 1.4061 0.0180  0.1843  0.1316  260 TYR B CD2 
3373 C CE1 . TYR B 243 ? 0.7913 1.3013 1.4098 0.0649  0.1855  0.1486  260 TYR B CE1 
3374 C CE2 . TYR B 243 ? 0.8252 1.2312 1.4321 0.0372  0.1946  0.1560  260 TYR B CE2 
3375 C CZ  . TYR B 243 ? 0.8396 1.2799 1.4309 0.0627  0.1954  0.1664  260 TYR B CZ  
3376 O OH  . TYR B 243 ? 0.9089 1.3150 1.4559 0.0872  0.2068  0.1941  260 TYR B OH  
3377 N N   . LEU B 244 ? 0.3085 0.8284 1.0998 -0.0002 0.1398  0.0655  261 LEU B N   
3378 C CA  . LEU B 244 ? 0.3028 0.7884 1.0933 -0.0012 0.1296  0.0682  261 LEU B CA  
3379 C C   . LEU B 244 ? 0.2923 0.7764 1.0776 0.0103  0.1142  0.0567  261 LEU B C   
3380 O O   . LEU B 244 ? 0.2905 0.7543 1.0711 0.0178  0.1107  0.0663  261 LEU B O   
3381 C CB  . LEU B 244 ? 0.3026 0.7807 1.0998 -0.0180 0.1246  0.0612  261 LEU B CB  
3382 C CG  . LEU B 244 ? 0.2977 0.7490 1.0950 -0.0186 0.1137  0.0640  261 LEU B CG  
3383 C CD1 . LEU B 244 ? 0.3055 0.7307 1.1032 -0.0198 0.1239  0.0834  261 LEU B CD1 
3384 C CD2 . LEU B 244 ? 0.2984 0.7576 1.1029 -0.0319 0.1073  0.0572  261 LEU B CD2 
3385 N N   . ARG B 245 ? 0.5344 1.0405 1.3228 0.0103  0.1078  0.0368  262 ARG B N   
3386 C CA  . ARG B 245 ? 0.5288 1.0337 1.3174 0.0159  0.0973  0.0256  262 ARG B CA  
3387 C C   . ARG B 245 ? 0.5283 1.0468 1.3106 0.0261  0.0968  0.0323  262 ARG B C   
3388 O O   . ARG B 245 ? 0.5240 1.0265 1.3028 0.0303  0.0908  0.0373  262 ARG B O   
3389 C CB  . ARG B 245 ? 0.5316 1.0595 1.3311 0.0135  0.0963  0.0042  262 ARG B CB  
3390 C CG  . ARG B 245 ? 0.5318 1.0577 1.3399 0.0152  0.0896  -0.0079 262 ARG B CG  
3391 C CD  . ARG B 245 ? 0.5417 1.0933 1.3663 0.0128  0.0931  -0.0303 262 ARG B CD  
3392 N NE  . ARG B 245 ? 0.5491 1.1444 1.3697 0.0140  0.0986  -0.0344 262 ARG B NE  
3393 C CZ  . ARG B 245 ? 0.5587 1.1829 1.3905 0.0123  0.1050  -0.0525 262 ARG B CZ  
3394 N NH1 . ARG B 245 ? 0.5628 1.1733 1.4123 0.0105  0.1075  -0.0694 262 ARG B NH1 
3395 N NH2 . ARG B 245 ? 0.5710 1.2393 1.3984 0.0146  0.1106  -0.0538 262 ARG B NH2 
3396 N N   . ASP B 246 ? 0.4774 1.0308 1.2590 0.0315  0.1040  0.0340  263 ASP B N   
3397 C CA  . ASP B 246 ? 0.4873 1.0667 1.2640 0.0448  0.1037  0.0426  263 ASP B CA  
3398 C C   . ASP B 246 ? 0.4934 1.0432 1.2595 0.0568  0.1082  0.0691  263 ASP B C   
3399 O O   . ASP B 246 ? 0.4917 1.0490 1.2526 0.0670  0.1030  0.0743  263 ASP B O   
3400 C CB  . ASP B 246 ? 0.5169 1.1430 1.2943 0.0519  0.1131  0.0457  263 ASP B CB  
3401 C CG  . ASP B 246 ? 0.5161 1.1830 1.3061 0.0430  0.1091  0.0171  263 ASP B CG  
3402 O OD1 . ASP B 246 ? 0.4955 1.1572 1.2928 0.0348  0.0990  -0.0013 263 ASP B OD1 
3403 O OD2 . ASP B 246 ? 0.5403 1.2429 1.3331 0.0451  0.1187  0.0164  263 ASP B OD2 
3404 N N   . LEU B 247 ? 0.3244 0.8439 1.0897 0.0548  0.1198  0.0859  264 LEU B N   
3405 C CA  . LEU B 247 ? 0.3375 0.8217 1.0891 0.0662  0.1278  0.1104  264 LEU B CA  
3406 C C   . LEU B 247 ? 0.3256 0.7885 1.0832 0.0646  0.1169  0.1061  264 LEU B C   
3407 O O   . LEU B 247 ? 0.3315 0.7883 1.0800 0.0803  0.1185  0.1201  264 LEU B O   
3408 C CB  . LEU B 247 ? 0.3678 0.8038 1.0897 0.0546  0.1388  0.1190  264 LEU B CB  
3409 C CG  . LEU B 247 ? 0.4038 0.8346 1.0900 0.0568  0.1523  0.1299  264 LEU B CG  
3410 C CD1 . LEU B 247 ? 0.4352 0.8160 1.0984 0.0373  0.1633  0.1351  264 LEU B CD1 
3411 C CD2 . LEU B 247 ? 0.4345 0.8599 1.0839 0.0843  0.1598  0.1518  264 LEU B CD2 
3412 N N   . LEU B 248 ? 0.2912 0.7415 1.0557 0.0478  0.1065  0.0885  265 LEU B N   
3413 C CA  . LEU B 248 ? 0.2863 0.7134 1.0500 0.0459  0.0975  0.0872  265 LEU B CA  
3414 C C   . LEU B 248 ? 0.2822 0.7260 1.0438 0.0498  0.0881  0.0778  265 LEU B C   
3415 O O   . LEU B 248 ? 0.2825 0.7142 1.0408 0.0548  0.0855  0.0852  265 LEU B O   
3416 C CB  . LEU B 248 ? 0.2820 0.6951 1.0534 0.0311  0.0915  0.0764  265 LEU B CB  
3417 C CG  . LEU B 248 ? 0.2864 0.6862 1.0643 0.0214  0.0987  0.0846  265 LEU B CG  
3418 C CD1 . LEU B 248 ? 0.2830 0.6816 1.0675 0.0100  0.0899  0.0741  265 LEU B CD1 
3419 C CD2 . LEU B 248 ? 0.2925 0.6702 1.0710 0.0272  0.1065  0.1033  265 LEU B CD2 
3420 N N   . ILE B 249 ? 0.2799 0.7552 1.0467 0.0458  0.0848  0.0613  266 ILE B N   
3421 C CA  . ILE B 249 ? 0.2778 0.7746 1.0513 0.0434  0.0777  0.0490  266 ILE B CA  
3422 C C   . ILE B 249 ? 0.2802 0.8161 1.0496 0.0549  0.0779  0.0549  266 ILE B C   
3423 O O   . ILE B 249 ? 0.2801 0.8271 1.0525 0.0558  0.0735  0.0552  266 ILE B O   
3424 C CB  . ILE B 249 ? 0.2777 0.7921 1.0655 0.0319  0.0754  0.0264  266 ILE B CB  
3425 C CG1 . ILE B 249 ? 0.2786 0.7576 1.0729 0.0249  0.0752  0.0222  266 ILE B CG1 
3426 C CG2 . ILE B 249 ? 0.2796 0.8187 1.0820 0.0258  0.0708  0.0136  266 ILE B CG2 
3427 C CD1 . ILE B 249 ? 0.2789 0.7253 1.0763 0.0248  0.0719  0.0309  266 ILE B CD1 
3428 N N   . ARG B 250 ? 0.2844 0.8449 1.0486 0.0647  0.0839  0.0616  267 ARG B N   
3429 C CA  . ARG B 250 ? 0.2904 0.8958 1.0506 0.0797  0.0839  0.0693  267 ARG B CA  
3430 C C   . ARG B 250 ? 0.3042 0.8899 1.0454 0.1030  0.0936  0.1010  267 ARG B C   
3431 O O   . ARG B 250 ? 0.3090 0.8971 1.0440 0.1132  0.0916  0.1102  267 ARG B O   
3432 C CB  . ARG B 250 ? 0.2926 0.9465 1.0580 0.0807  0.0857  0.0607  267 ARG B CB  
3433 N N   . THR B 251 ? 0.3363 0.9029 1.0688 0.1119  0.1069  0.1190  268 THR B N   
3434 C CA  . THR B 251 ? 0.3595 0.9080 1.0710 0.1392  0.1224  0.1526  268 THR B CA  
3435 C C   . THR B 251 ? 0.3641 0.8639 1.0706 0.1438  0.1269  0.1634  268 THR B C   
3436 O O   . THR B 251 ? 0.3804 0.8796 1.0695 0.1656  0.1307  0.1798  268 THR B O   
3437 C CB  . THR B 251 ? 0.3875 0.9058 1.0719 0.1411  0.1371  0.1645  268 THR B CB  
3438 O OG1 . THR B 251 ? 0.3853 0.9531 1.0726 0.1386  0.1347  0.1564  268 THR B OG1 
3439 C CG2 . THR B 251 ? 0.4373 0.9134 1.0713 0.1684  0.1529  0.1942  268 THR B CG2 
3440 N N   . HIS B 252 ? 0.3308 0.7943 1.0511 0.1242  0.1264  0.1541  269 HIS B N   
3441 C CA  . HIS B 252 ? 0.3420 0.7577 1.0516 0.1273  0.1318  0.1636  269 HIS B CA  
3442 C C   . HIS B 252 ? 0.3221 0.7388 1.0452 0.1155  0.1176  0.1509  269 HIS B C   
3443 O O   . HIS B 252 ? 0.3260 0.7128 1.0485 0.1169  0.1215  0.1581  269 HIS B O   
3444 C CB  . HIS B 252 ? 0.3629 0.7252 1.0510 0.1089  0.1373  0.1594  269 HIS B CB  
3445 C CG  . HIS B 252 ? 0.4103 0.7369 1.0515 0.1156  0.1523  0.1717  269 HIS B CG  
3446 N ND1 . HIS B 252 ? 0.4618 0.7239 1.0551 0.1249  0.1671  0.1855  269 HIS B ND1 
3447 C CD2 . HIS B 252 ? 0.4203 0.7629 1.0528 0.1142  0.1569  0.1728  269 HIS B CD2 
3448 C CE1 . HIS B 252 ? 0.5035 0.7391 1.0615 0.1286  0.1810  0.1961  269 HIS B CE1 
3449 N NE2 . HIS B 252 ? 0.4776 0.7642 1.0587 0.1226  0.1748  0.1900  269 HIS B NE2 
3450 N N   . MET B 253 ? 0.3083 0.7559 1.0380 0.1038  0.1031  0.1318  270 MET B N   
3451 C CA  . MET B 253 ? 0.2979 0.7389 1.0352 0.0904  0.0924  0.1200  270 MET B CA  
3452 C C   . MET B 253 ? 0.3058 0.7383 1.0346 0.1033  0.0955  0.1351  270 MET B C   
3453 O O   . MET B 253 ? 0.3050 0.7101 1.0356 0.0992  0.0957  0.1391  270 MET B O   
3454 C CB  . MET B 253 ? 0.2893 0.7664 1.0380 0.0785  0.0822  0.0991  270 MET B CB  
3455 C CG  . MET B 253 ? 0.2836 0.7475 1.0449 0.0634  0.0755  0.0883  270 MET B CG  
3456 S SD  . MET B 253 ? 0.2870 0.7668 1.0524 0.0672  0.0743  0.0957  270 MET B SD  
3457 C CE  . MET B 253 ? 0.2884 0.8325 1.0578 0.0716  0.0715  0.0871  270 MET B CE  
3458 N N   . GLN B 254 ? 0.3156 0.7764 1.0349 0.1202  0.0981  0.1441  271 GLN B N   
3459 C CA  . GLN B 254 ? 0.3259 0.7858 1.0361 0.1338  0.1018  0.1578  271 GLN B CA  
3460 C C   . GLN B 254 ? 0.3453 0.7643 1.0375 0.1529  0.1169  0.1786  271 GLN B C   
3461 O O   . GLN B 254 ? 0.3516 0.7554 1.0390 0.1582  0.1205  0.1864  271 GLN B O   
3462 C CB  . GLN B 254 ? 0.3350 0.8426 1.0399 0.1481  0.1006  0.1618  271 GLN B CB  
3463 C CG  . GLN B 254 ? 0.3443 0.8623 1.0450 0.1582  0.1028  0.1722  271 GLN B CG  
3464 C CD  . GLN B 254 ? 0.3291 0.8440 1.0502 0.1358  0.0956  0.1607  271 GLN B CD  
3465 O OE1 . GLN B 254 ? 0.3153 0.8516 1.0578 0.1146  0.0863  0.1416  271 GLN B OE1 
3466 N NE2 . GLN B 254 ? 0.3361 0.8239 1.0502 0.1421  0.1022  0.1739  271 GLN B NE2 
3467 N N   . ASN B 255 ? 0.3584 0.7596 1.0419 0.1640  0.1283  0.1875  272 ASN B N   
3468 C CA  . ASN B 255 ? 0.3854 0.7408 1.0525 0.1834  0.1477  0.2052  272 ASN B CA  
3469 C C   . ASN B 255 ? 0.3802 0.6998 1.0522 0.1616  0.1440  0.1949  272 ASN B C   
3470 O O   . ASN B 255 ? 0.4093 0.6885 1.0513 0.1683  0.1514  0.1999  272 ASN B O   
3471 C CB  . ASN B 255 ? 0.4214 0.7455 1.0524 0.1910  0.1589  0.2109  272 ASN B CB  
3472 C CG  . ASN B 255 ? 0.4825 0.7296 1.0555 0.2036  0.1767  0.2205  272 ASN B CG  
3473 O OD1 . ASN B 255 ? 0.5017 0.7318 1.0586 0.2212  0.1841  0.2288  272 ASN B OD1 
3474 N ND2 . ASN B 255 ? 0.5186 0.7169 1.0586 0.1935  0.1854  0.2186  272 ASN B ND2 
3475 N N   . ILE B 256 ? 0.3483 0.6844 1.0535 0.1362  0.1321  0.1795  273 ILE B N   
3476 C CA  . ILE B 256 ? 0.3407 0.6570 1.0549 0.1159  0.1252  0.1705  273 ILE B CA  
3477 C C   . ILE B 256 ? 0.3317 0.6568 1.0546 0.1189  0.1201  0.1747  273 ILE B C   
3478 O O   . ILE B 256 ? 0.3439 0.6467 1.0580 0.1193  0.1231  0.1791  273 ILE B O   
3479 C CB  . ILE B 256 ? 0.3138 0.6491 1.0565 0.0923  0.1132  0.1537  273 ILE B CB  
3480 C CG1 . ILE B 256 ? 0.3296 0.6495 1.0569 0.0843  0.1194  0.1496  273 ILE B CG1 
3481 C CG2 . ILE B 256 ? 0.3050 0.6323 1.0596 0.0768  0.1039  0.1478  273 ILE B CG2 
3482 C CD1 . ILE B 256 ? 0.3027 0.6514 1.0625 0.0667  0.1111  0.1346  273 ILE B CD1 
3483 N N   . LYS B 257 ? 0.3240 0.6728 1.0445 0.1162  0.1105  0.1692  274 LYS B N   
3484 C CA  . LYS B 257 ? 0.3228 0.6773 1.0445 0.1153  0.1064  0.1727  274 LYS B CA  
3485 C C   . LYS B 257 ? 0.3432 0.6901 1.0476 0.1384  0.1194  0.1908  274 LYS B C   
3486 O O   . LYS B 257 ? 0.3464 0.6868 1.0520 0.1394  0.1208  0.1977  274 LYS B O   
3487 C CB  . LYS B 257 ? 0.3147 0.6999 1.0435 0.1077  0.0980  0.1629  274 LYS B CB  
3488 C CG  . LYS B 257 ? 0.3011 0.6906 1.0457 0.0873  0.0878  0.1437  274 LYS B CG  
3489 C CD  . LYS B 257 ? 0.2977 0.7161 1.0561 0.0786  0.0826  0.1339  274 LYS B CD  
3490 C CE  . LYS B 257 ? 0.3025 0.7209 1.0686 0.0786  0.0847  0.1447  274 LYS B CE  
3491 N NZ  . LYS B 257 ? 0.3023 0.6903 1.0767 0.0718  0.0840  0.1494  274 LYS B NZ  
3492 N N   . ASP B 258 ? 0.3617 0.7092 1.0471 0.1599  0.1304  0.1997  275 ASP B N   
3493 C CA  . ASP B 258 ? 0.3916 0.7264 1.0514 0.1878  0.1460  0.2166  275 ASP B CA  
3494 C C   . ASP B 258 ? 0.4151 0.7033 1.0589 0.1944  0.1580  0.2204  275 ASP B C   
3495 O O   . ASP B 258 ? 0.4378 0.7121 1.0604 0.2073  0.1660  0.2278  275 ASP B O   
3496 C CB  . ASP B 258 ? 0.4164 0.7556 1.0516 0.2125  0.1562  0.2262  275 ASP B CB  
3497 C CG  . ASP B 258 ? 0.4042 0.7956 1.0467 0.2090  0.1445  0.2226  275 ASP B CG  
3498 O OD1 . ASP B 258 ? 0.3835 0.7998 1.0466 0.1906  0.1330  0.2141  275 ASP B OD1 
3499 O OD2 . ASP B 258 ? 0.4193 0.8270 1.0477 0.2255  0.1483  0.2290  275 ASP B OD2 
3500 N N   . ILE B 259 ? 0.4266 0.6789 1.0534 0.1756  0.1545  0.2075  276 ILE B N   
3501 C CA  . ILE B 259 ? 0.4674 0.6626 1.0506 0.1651  0.1584  0.1994  276 ILE B CA  
3502 C C   . ILE B 259 ? 0.4438 0.6564 1.0509 0.1472  0.1456  0.1947  276 ILE B C   
3503 O O   . ILE B 259 ? 0.4755 0.6597 1.0499 0.1457  0.1485  0.1926  276 ILE B O   
3504 C CB  . ILE B 259 ? 0.4888 0.6469 1.0500 0.1464  0.1591  0.1874  276 ILE B CB  
3505 C CG1 . ILE B 259 ? 0.5219 0.6571 1.0536 0.1675  0.1745  0.1965  276 ILE B CG1 
3506 C CG2 . ILE B 259 ? 0.5336 0.6385 1.0523 0.1285  0.1617  0.1755  276 ILE B CG2 
3507 C CD1 . ILE B 259 ? 0.5448 0.6460 1.0570 0.1490  0.1777  0.1883  276 ILE B CD1 
3508 N N   . THR B 260 ? 0.3932 0.6525 1.0555 0.1351  0.1324  0.1936  277 THR B N   
3509 C CA  . THR B 260 ? 0.3723 0.6508 1.0617 0.1227  0.1215  0.1940  277 THR B CA  
3510 C C   . THR B 260 ? 0.3809 0.6684 1.0652 0.1388  0.1276  0.2085  277 THR B C   
3511 O O   . THR B 260 ? 0.3937 0.6747 1.0659 0.1346  0.1246  0.2108  277 THR B O   
3512 C CB  . THR B 260 ? 0.3293 0.6444 1.0699 0.1094  0.1095  0.1897  277 THR B CB  
3513 O OG1 . THR B 260 ? 0.3201 0.6336 1.0696 0.0968  0.1059  0.1771  277 THR B OG1 
3514 C CG2 . THR B 260 ? 0.3229 0.6446 1.0760 0.0988  0.0994  0.1917  277 THR B CG2 
3515 N N   . SER B 261 ? 0.5715 0.8797 1.2645 0.1576  0.1365  0.2191  278 SER B N   
3516 C CA  . SER B 261 ? 0.5731 0.8947 1.2595 0.1719  0.1434  0.2331  278 SER B CA  
3517 C C   . SER B 261 ? 0.6652 0.9498 1.2964 0.1928  0.1586  0.2370  278 SER B C   
3518 O O   . SER B 261 ? 0.7092 0.9837 1.3197 0.1939  0.1605  0.2403  278 SER B O   
3519 C CB  . SER B 261 ? 0.5590 0.9049 1.2431 0.1717  0.1406  0.2334  278 SER B CB  
3520 O OG  . SER B 261 ? 0.5382 0.8980 1.2458 0.1469  0.1254  0.2215  278 SER B OG  
3521 N N   . SER B 262 ? 0.5036 0.7632 1.1029 0.2092  0.1699  0.2356  279 SER B N   
3522 C CA  . SER B 262 ? 0.5622 0.7788 1.1025 0.2332  0.1883  0.2387  279 SER B CA  
3523 C C   . SER B 262 ? 0.6300 0.7838 1.1167 0.2189  0.1896  0.2222  279 SER B C   
3524 O O   . SER B 262 ? 0.7224 0.8409 1.1603 0.2333  0.2034  0.2212  279 SER B O   
3525 C CB  . SER B 262 ? 0.5843 0.7898 1.1065 0.2582  0.2018  0.2449  279 SER B CB  
3526 O OG  . SER B 262 ? 0.5885 0.7648 1.1022 0.2429  0.1974  0.2336  279 SER B OG  
3527 N N   . ILE B 263 ? 0.5936 0.7364 1.0888 0.1896  0.1761  0.2078  280 ILE B N   
3528 C CA  . ILE B 263 ? 0.6412 0.7312 1.0882 0.1701  0.1761  0.1897  280 ILE B CA  
3529 C C   . ILE B 263 ? 0.6190 0.7362 1.0854 0.1449  0.1577  0.1836  280 ILE B C   
3530 O O   . ILE B 263 ? 0.6752 0.7804 1.1087 0.1434  0.1588  0.1796  280 ILE B O   
3531 C CB  . ILE B 263 ? 0.6606 0.7131 1.0927 0.1546  0.1778  0.1777  280 ILE B CB  
3532 C CG1 . ILE B 263 ? 0.6875 0.7122 1.0969 0.1835  0.1972  0.1877  280 ILE B CG1 
3533 C CG2 . ILE B 263 ? 0.7974 0.7962 1.1797 0.1292  0.1789  0.1570  280 ILE B CG2 
3534 C CD1 . ILE B 263 ? 0.7728 0.7475 1.1242 0.2107  0.2193  0.1906  280 ILE B CD1 
3535 N N   . HIS B 264 ? 0.5310 0.6867 1.0494 0.1273  0.1415  0.1833  281 HIS B N   
3536 C CA  . HIS B 264 ? 0.5121 0.6960 1.0515 0.1063  0.1243  0.1798  281 HIS B CA  
3537 C C   . HIS B 264 ? 0.4948 0.7156 1.0550 0.1183  0.1212  0.1967  281 HIS B C   
3538 O O   . HIS B 264 ? 0.5117 0.7401 1.0562 0.1108  0.1141  0.1961  281 HIS B O   
3539 C CB  . HIS B 264 ? 0.4649 0.6790 1.0555 0.0899  0.1112  0.1765  281 HIS B CB  
3540 C CG  . HIS B 264 ? 0.4820 0.6660 1.0543 0.0743  0.1137  0.1613  281 HIS B CG  
3541 N ND1 . HIS B 264 ? 0.5225 0.6777 1.0571 0.0515  0.1119  0.1452  281 HIS B ND1 
3542 C CD2 . HIS B 264 ? 0.4678 0.6482 1.0535 0.0766  0.1185  0.1602  281 HIS B CD2 
3543 C CE1 . HIS B 264 ? 0.5330 0.6644 1.0599 0.0399  0.1170  0.1363  281 HIS B CE1 
3544 N NE2 . HIS B 264 ? 0.5000 0.6465 1.0563 0.0567  0.1211  0.1462  281 HIS B NE2 
3545 N N   . PHE B 265 ? 0.4646 0.7114 1.0596 0.1358  0.1269  0.2125  282 PHE B N   
3546 C CA  . PHE B 265 ? 0.4496 0.7308 1.0690 0.1453  0.1267  0.2314  282 PHE B CA  
3547 C C   . PHE B 265 ? 0.4946 0.7598 1.0647 0.1625  0.1395  0.2369  282 PHE B C   
3548 O O   . PHE B 265 ? 0.5016 0.7856 1.0695 0.1646  0.1374  0.2481  282 PHE B O   
3549 C CB  . PHE B 265 ? 0.4086 0.7237 1.0812 0.1533  0.1300  0.2440  282 PHE B CB  
3550 C CG  . PHE B 265 ? 0.3989 0.7459 1.0975 0.1609  0.1336  0.2650  282 PHE B CG  
3551 C CD1 . PHE B 265 ? 0.3826 0.7483 1.1135 0.1504  0.1240  0.2739  282 PHE B CD1 
3552 C CD2 . PHE B 265 ? 0.4095 0.7690 1.1014 0.1800  0.1482  0.2780  282 PHE B CD2 
3553 C CE1 . PHE B 265 ? 0.3873 0.7690 1.1278 0.1536  0.1281  0.2928  282 PHE B CE1 
3554 C CE2 . PHE B 265 ? 0.4098 0.7924 1.1150 0.1810  0.1514  0.2956  282 PHE B CE2 
3555 C CZ  . PHE B 265 ? 0.4008 0.7905 1.1282 0.1667  0.1417  0.3030  282 PHE B CZ  
3556 N N   . GLU B 266 ? 0.5766 0.8064 1.1053 0.1771  0.1544  0.2303  283 GLU B N   
3557 C CA  . GLU B 266 ? 0.6697 0.8775 1.1459 0.1964  0.1700  0.2326  283 GLU B CA  
3558 C C   . GLU B 266 ? 0.7967 0.9753 1.2223 0.1805  0.1646  0.2158  283 GLU B C   
3559 O O   . GLU B 266 ? 0.8617 1.0404 1.2534 0.1898  0.1707  0.2190  283 GLU B O   
3560 C CB  . GLU B 266 ? 0.7136 0.8851 1.1565 0.2192  0.1894  0.2297  283 GLU B CB  
3561 N N   . ALA B 267 ? 0.7478 0.9063 1.1681 0.1550  0.1531  0.1974  284 ALA B N   
3562 C CA  . ALA B 267 ? 0.8671 1.0094 1.2465 0.1326  0.1442  0.1791  284 ALA B CA  
3563 C C   . ALA B 267 ? 0.8187 1.0166 1.2255 0.1269  0.1281  0.1924  284 ALA B C   
3564 O O   . ALA B 267 ? 0.9153 1.1153 1.2825 0.1216  0.1248  0.1864  284 ALA B O   
3565 C CB  . ALA B 267 ? 0.8991 1.0193 1.2778 0.1042  0.1353  0.1591  284 ALA B CB  
3566 N N   . TYR B 268 ? 0.8862 1.1275 1.3588 0.1284  0.1190  0.2105  285 TYR B N   
3567 C CA  . TYR B 268 ? 0.8277 1.1180 1.3315 0.1283  0.1072  0.2293  285 TYR B CA  
3568 C C   . TYR B 268 ? 0.8279 1.1320 1.3208 0.1510  0.1196  0.2500  285 TYR B C   
3569 O O   . TYR B 268 ? 0.8637 1.1923 1.3426 0.1526  0.1145  0.2604  285 TYR B O   
3570 C CB  . TYR B 268 ? 0.6845 1.0058 1.2600 0.1246  0.0983  0.2415  285 TYR B CB  
3571 C CG  . TYR B 268 ? 0.6239 0.9878 1.2337 0.1286  0.0901  0.2651  285 TYR B CG  
3572 C CD1 . TYR B 268 ? 0.6419 1.0309 1.2535 0.1171  0.0736  0.2644  285 TYR B CD1 
3573 C CD2 . TYR B 268 ? 0.5554 0.9364 1.1967 0.1443  0.0999  0.2899  285 TYR B CD2 
3574 C CE1 . TYR B 268 ? 0.5917 1.0182 1.2331 0.1256  0.0678  0.2901  285 TYR B CE1 
3575 C CE2 . TYR B 268 ? 0.5245 0.9366 1.1951 0.1490  0.0956  0.3144  285 TYR B CE2 
3576 C CZ  . TYR B 268 ? 0.5406 0.9736 1.2102 0.1420  0.0798  0.3157  285 TYR B CZ  
3577 O OH  . TYR B 268 ? 0.5223 0.9849 1.2196 0.1513  0.0771  0.3441  285 TYR B OH  
3578 N N   . ARG B 269 ? 0.6749 0.9693 1.1750 0.1692  0.1361  0.2574  286 ARG B N   
3579 C CA  . ARG B 269 ? 0.6614 0.9747 1.1575 0.1911  0.1505  0.2786  286 ARG B CA  
3580 C C   . ARG B 269 ? 0.7953 1.0907 1.2213 0.1994  0.1585  0.2713  286 ARG B C   
3581 O O   . ARG B 269 ? 0.7983 1.1224 1.2180 0.2080  0.1608  0.2890  286 ARG B O   
3582 C CB  . ARG B 269 ? 0.6103 0.9217 1.1245 0.2085  0.1667  0.2846  286 ARG B CB  
3583 N N   . VAL B 270 ? 0.8883 1.1339 1.2596 0.1966  0.1644  0.2449  287 VAL B N   
3584 C CA  . VAL B 270 ? 1.0360 1.2551 1.3338 0.2030  0.1743  0.2315  287 VAL B CA  
3585 C C   . VAL B 270 ? 1.1110 1.3530 1.3885 0.1827  0.1559  0.2253  287 VAL B C   
3586 O O   . VAL B 270 ? 1.1925 1.4442 1.4270 0.1908  0.1608  0.2271  287 VAL B O   
3587 C CB  . VAL B 270 ? 1.1503 1.2989 1.3919 0.2026  0.1875  0.2025  287 VAL B CB  
3588 C CG1 . VAL B 270 ? 1.0864 1.2187 1.3387 0.2317  0.2086  0.2131  287 VAL B CG1 
3589 C CG2 . VAL B 270 ? 1.1830 1.3091 1.4310 0.1711  0.1719  0.1812  287 VAL B CG2 
3590 N N   . LYS B 271 ? 1.2792 1.5356 1.5874 0.1576  0.1350  0.2185  288 LYS B N   
3591 C CA  . LYS B 271 ? 1.3305 1.6210 1.6266 0.1387  0.1150  0.2146  288 LYS B CA  
3592 C C   . LYS B 271 ? 1.2531 1.6015 1.5778 0.1536  0.1104  0.2488  288 LYS B C   
3593 O O   . LYS B 271 ? 1.3362 1.7087 1.6221 0.1542  0.1057  0.2508  288 LYS B O   
3594 C CB  . LYS B 271 ? 1.2872 1.5881 1.6191 0.1121  0.0954  0.2035  288 LYS B CB  
3595 N N   . ARG B 272 ? 0.7975 1.1671 1.1879 0.1646  0.1127  0.2755  289 ARG B N   
3596 C CA  . ARG B 272 ? 0.7209 1.1378 1.1444 0.1773  0.1110  0.3110  289 ARG B CA  
3597 C C   . ARG B 272 ? 0.7506 1.1716 1.1474 0.2001  0.1312  0.3283  289 ARG B C   
3598 O O   . ARG B 272 ? 0.7282 1.1860 1.1347 0.2109  0.1326  0.3578  289 ARG B O   
3599 C CB  . ARG B 272 ? 0.6150 1.0449 1.1166 0.1775  0.1091  0.3302  289 ARG B CB  
3600 N N   . LEU B 273 ? 0.7161 1.0999 1.0788 0.2094  0.1485  0.3120  290 LEU B N   
3601 C CA  . LEU B 273 ? 0.7431 1.1328 1.0823 0.2338  0.1706  0.3274  290 LEU B CA  
3602 C C   . LEU B 273 ? 0.8134 1.1669 1.0693 0.2399  0.1815  0.3001  290 LEU B C   
3603 O O   . LEU B 273 ? 0.8322 1.1472 1.0663 0.2527  0.1991  0.2866  290 LEU B O   
3604 C CB  . LEU B 273 ? 0.7061 1.0936 1.0911 0.2468  0.1866  0.3397  290 LEU B CB  
3605 N N   . LYS C 2   ? 0.5917 0.9232 1.2042 -0.0946 -0.0187 -0.0112 19  LYS C N   
3606 C CA  . LYS C 2   ? 0.6130 0.9475 1.1646 -0.0595 -0.0238 -0.0104 19  LYS C CA  
3607 C C   . LYS C 2   ? 0.6318 0.9024 1.1597 -0.0587 -0.0247 0.0192  19  LYS C C   
3608 O O   . LYS C 2   ? 0.6550 0.9219 1.1359 -0.0326 -0.0301 0.0214  19  LYS C O   
3609 C CB  . LYS C 2   ? 0.6225 1.0459 1.1656 -0.0533 -0.0105 -0.0012 19  LYS C CB  
3610 N N   . GLN C 3   ? 0.6898 0.9114 1.2534 -0.0864 -0.0209 0.0397  20  GLN C N   
3611 C CA  . GLN C 3   ? 0.7000 0.8620 1.2480 -0.0859 -0.0225 0.0685  20  GLN C CA  
3612 C C   . GLN C 3   ? 0.6765 0.7608 1.2366 -0.0874 -0.0346 0.0543  20  GLN C C   
3613 O O   . GLN C 3   ? 0.6576 0.7308 1.2513 -0.0993 -0.0382 0.0303  20  GLN C O   
3614 C CB  . GLN C 3   ? 0.7113 0.8849 1.2873 -0.1142 -0.0055 0.1170  20  GLN C CB  
3615 C CG  . GLN C 3   ? 0.7309 0.9909 1.3002 -0.1170 0.0108  0.1358  20  GLN C CG  
3616 C CD  . GLN C 3   ? 0.7536 1.0186 1.3275 -0.1344 0.0261  0.1921  20  GLN C CD  
3617 O OE1 . GLN C 3   ? 0.7504 0.9504 1.3364 -0.1446 0.0232  0.2167  20  GLN C OE1 
3618 N NE2 . GLN C 3   ? 0.7707 1.1158 1.3327 -0.1350 0.0423  0.2134  20  GLN C NE2 
3619 N N   . GLY C 4   ? 0.6031 0.6398 1.1354 -0.0737 -0.0412 0.0673  21  GLY C N   
3620 C CA  . GLY C 4   ? 0.5719 0.5403 1.1096 -0.0704 -0.0517 0.0557  21  GLY C CA  
3621 C C   . GLY C 4   ? 0.5665 0.5234 1.0757 -0.0463 -0.0644 0.0174  21  GLY C C   
3622 O O   . GLY C 4   ? 0.5632 0.5371 1.0842 -0.0468 -0.0671 -0.0110 21  GLY C O   
3623 N N   . PHE C 5   ? 0.7271 0.6562 1.1999 -0.0255 -0.0726 0.0184  22  PHE C N   
3624 C CA  . PHE C 5   ? 0.7138 0.6224 1.1596 -0.0039 -0.0839 -0.0102 22  PHE C CA  
3625 C C   . PHE C 5   ? 0.6579 0.5560 1.0655 -0.0017 -0.0802 -0.0069 22  PHE C C   
3626 O O   . PHE C 5   ? 0.6374 0.5269 1.0313 -0.0025 -0.0785 0.0115  22  PHE C O   
3627 C CB  . PHE C 5   ? 0.7245 0.6538 1.1266 0.0203  -0.0903 -0.0150 22  PHE C CB  
3628 C CG  . PHE C 5   ? 0.7584 0.7493 1.1536 0.0259  -0.0868 -0.0239 22  PHE C CG  
3629 C CD1 . PHE C 5   ? 0.7626 0.7848 1.1849 0.0147  -0.0821 -0.0377 22  PHE C CD1 
3630 C CD2 . PHE C 5   ? 0.7705 0.7928 1.1343 0.0437  -0.0891 -0.0218 22  PHE C CD2 
3631 C CE1 . PHE C 5   ? 0.7679 0.8538 1.1876 0.0207  -0.0786 -0.0470 22  PHE C CE1 
3632 C CE2 . PHE C 5   ? 0.7898 0.8746 1.1485 0.0517  -0.0854 -0.0324 22  PHE C CE2 
3633 C CZ  . PHE C 5   ? 0.7869 0.9046 1.1743 0.0400  -0.0795 -0.0439 22  PHE C CZ  
3634 N N   . GLU C 6   ? 0.7615 0.6635 1.1539 0.0011  -0.0792 -0.0246 23  GLU C N   
3635 C CA  . GLU C 6   ? 0.7227 0.6181 1.0852 0.0022  -0.0745 -0.0219 23  GLU C CA  
3636 C C   . GLU C 6   ? 0.7090 0.6020 1.0259 0.0113  -0.0763 -0.0234 23  GLU C C   
3637 O O   . GLU C 6   ? 0.7065 0.6026 1.0076 0.0190  -0.0813 -0.0330 23  GLU C O   
3638 C CB  . GLU C 6   ? 0.7196 0.6185 1.0890 0.0013  -0.0724 -0.0371 23  GLU C CB  
3639 C CG  . GLU C 6   ? 0.7355 0.6354 1.1498 -0.0088 -0.0705 -0.0404 23  GLU C CG  
3640 C CD  . GLU C 6   ? 0.7358 0.6403 1.1580 -0.0074 -0.0712 -0.0612 23  GLU C CD  
3641 O OE1 . GLU C 6   ? 0.7490 0.6590 1.2063 -0.0147 -0.0717 -0.0732 23  GLU C OE1 
3642 O OE2 . GLU C 6   ? 0.7237 0.6266 1.1185 -0.0005 -0.0710 -0.0659 23  GLU C OE2 
3643 N N   . PHE C 7   ? 0.3581 0.2452 0.6574 0.0105  -0.0726 -0.0149 24  PHE C N   
3644 C CA  . PHE C 7   ? 0.3531 0.2411 0.6330 0.0157  -0.0770 -0.0165 24  PHE C CA  
3645 C C   . PHE C 7   ? 0.3541 0.2438 0.6475 0.0132  -0.0768 -0.0135 24  PHE C C   
3646 O O   . PHE C 7   ? 0.3612 0.2484 0.6710 0.0097  -0.0758 -0.0043 24  PHE C O   
3647 C CB  . PHE C 7   ? 0.3567 0.2391 0.6190 0.0196  -0.0801 -0.0099 24  PHE C CB  
3648 C CG  . PHE C 7   ? 0.3560 0.2374 0.5997 0.0248  -0.0860 -0.0151 24  PHE C CG  
3649 C CD1 . PHE C 7   ? 0.3555 0.2369 0.5845 0.0299  -0.0883 -0.0251 24  PHE C CD1 
3650 C CD2 . PHE C 7   ? 0.3599 0.2387 0.6023 0.0247  -0.0901 -0.0095 24  PHE C CD2 
3651 C CE1 . PHE C 7   ? 0.3610 0.2378 0.5762 0.0335  -0.0938 -0.0280 24  PHE C CE1 
3652 C CE2 . PHE C 7   ? 0.3622 0.2389 0.5931 0.0279  -0.0965 -0.0150 24  PHE C CE2 
3653 C CZ  . PHE C 7   ? 0.3638 0.2386 0.5819 0.0318  -0.0980 -0.0235 24  PHE C CZ  
3654 N N   . ASN C 8   ? 0.4258 0.3176 0.7121 0.0157  -0.0774 -0.0203 25  ASN C N   
3655 C CA  . ASN C 8   ? 0.4246 0.3182 0.7252 0.0144  -0.0758 -0.0194 25  ASN C CA  
3656 C C   . ASN C 8   ? 0.4209 0.3138 0.7117 0.0157  -0.0784 -0.0170 25  ASN C C   
3657 O O   . ASN C 8   ? 0.4217 0.3108 0.6946 0.0186  -0.0789 -0.0206 25  ASN C O   
3658 C CB  . ASN C 8   ? 0.4268 0.3208 0.7323 0.0157  -0.0719 -0.0297 25  ASN C CB  
3659 C CG  . ASN C 8   ? 0.4329 0.3277 0.7545 0.0138  -0.0707 -0.0351 25  ASN C CG  
3660 O OD1 . ASN C 8   ? 0.4400 0.3331 0.7795 0.0099  -0.0704 -0.0283 25  ASN C OD1 
3661 N ND2 . ASN C 8   ? 0.4347 0.3300 0.7505 0.0165  -0.0701 -0.0473 25  ASN C ND2 
3662 N N   . ILE C 9   ? 0.3170 0.2116 0.6214 0.0139  -0.0804 -0.0105 26  ILE C N   
3663 C CA  . ILE C 9   ? 0.3164 0.2116 0.6193 0.0142  -0.0837 -0.0090 26  ILE C CA  
3664 C C   . ILE C 9   ? 0.3173 0.2162 0.6412 0.0134  -0.0801 -0.0