data_5CZV
# 
_entry.id   5CZV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5CZV         
WWPDB D_1000212442 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5CZX 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'same antigen (Notch3 NRR) complexed with 20358 Fab' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5CZV 
_pdbx_database_status.recvd_initial_deposition_date   2015-08-01 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hu, T.'     1 
'Fryer, C.'  2 
'Chopra, R.' 3 
'Clark, K.'  4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Oncogene 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           0950-9232 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            35 
_citation.language                  ? 
_citation.page_first                6077 
_citation.page_last                 6086 
_citation.title                     
;Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/onc.2016.133 
_citation.pdbx_database_id_PubMed   27157619 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bernasconi-Elias, P.' 1  ? 
primary 'Hu, T.'               2  ? 
primary 'Jenkins, D.'          3  ? 
primary 'Firestone, B.'        4  ? 
primary 'Gans, S.'             5  ? 
primary 'Kurth, E.'            6  ? 
primary 'Capodieci, P.'        7  ? 
primary 'Deplazes-Lauber, J.'  8  ? 
primary 'Petropoulos, K.'      9  ? 
primary 'Thiel, P.'            10 ? 
primary 'Ponsel, D.'           11 ? 
primary 'Hee Choi, S.'         12 ? 
primary 'LeMotte, P.'          13 ? 
primary 'London, A.'           14 ? 
primary 'Goetcshkes, M.'       15 ? 
primary 'Nolin, E.'            16 ? 
primary 'Jones, M.D.'          17 ? 
primary 'Slocum, K.'           18 ? 
primary 'Kluk, M.J.'           19 ? 
primary 'Weinstock, D.M.'      20 ? 
primary 'Christodoulou, A.'    21 ? 
primary 'Weinberg, O.'         22 ? 
primary 'Jaehrling, J.'        23 ? 
primary 'Ettenberg, S.A.'      24 ? 
primary 'Buckler, A.'          25 ? 
primary 'Blacklow, S.C.'       26 ? 
primary 'Aster, J.C.'          27 ? 
primary 'Fryer, C.J.'          28 ? 
# 
_cell.length_a           91.917 
_cell.length_b           104.349 
_cell.length_c           92.849 
_cell.angle_alpha        90.000 
_cell.angle_beta         113.170 
_cell.angle_gamma        90.000 
_cell.entry_id           5CZV 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         5CZV 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Neurogenic locus notch homolog protein 3' 30096.623 1 ? ? 'negative regulatory region (UNP residues 1378-1640)' 
? 
2 polymer     man 'Fab 20350 heavy chain'                    23794.674 1 ? ? ?                                                     
? 
3 polymer     man 'Fab 20350 light chain'                    23557.186 1 ? ? ?                                                     
? 
4 non-polymer syn 'CALCIUM ION'                              40.078    3 ? ? ?                                                     
? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose   221.208   1 ? ? ?                                                     
? 
6 water       nat water                                      18.015    7 ? ? ?                                                     
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Notch 3'                                      
2 'IgG20350 heavy chain, NVP-LMW976 heavy chain' 
3 'IgG20350 light chain, NVP-LMW976 light chain' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;APEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFD
CHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSA
ILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAV
ERLDFPYPLRDVRGEPLEPPEPSGSHHHHHH
;
;APEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFD
CHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSA
ILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAV
ERLDFPYPLRDVRGEPLEPPEPSGSHHHHHH
;
A ? 
2 'polypeptide(L)' no no 
;QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGWIKPRWGAAHYAQKFQGRVTITADESTSTAY
MELSSLRSEDTAVYYCARGSFWFGYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
;
;QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGWIKPRWGAAHYAQKFQGRVTITADESTSTAY
MELSSLRSEDTAVYYCARGSFWFGYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
;
H ? 
3 'polypeptide(L)' no no 
;DIQMTQSPSSLSASVGDRVTITCRASQGINNYLNWYQQKPGKAPKLLIYDASKLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQYLQYPMTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
;DIQMTQSPSSLSASVGDRVTITCRASQGINNYLNWYQQKPGKAPKLLIYDASKLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQYLQYPMTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   GLU n 
1 4   VAL n 
1 5   SER n 
1 6   GLU n 
1 7   GLU n 
1 8   PRO n 
1 9   ARG n 
1 10  CYS n 
1 11  PRO n 
1 12  ARG n 
1 13  ALA n 
1 14  ALA n 
1 15  CYS n 
1 16  GLN n 
1 17  ALA n 
1 18  LYS n 
1 19  ARG n 
1 20  GLY n 
1 21  ASP n 
1 22  GLN n 
1 23  ARG n 
1 24  CYS n 
1 25  ASP n 
1 26  ARG n 
1 27  GLU n 
1 28  CYS n 
1 29  ASN n 
1 30  SER n 
1 31  PRO n 
1 32  GLY n 
1 33  CYS n 
1 34  GLY n 
1 35  TRP n 
1 36  ASP n 
1 37  GLY n 
1 38  GLY n 
1 39  ASP n 
1 40  CYS n 
1 41  SER n 
1 42  LEU n 
1 43  SER n 
1 44  VAL n 
1 45  GLY n 
1 46  ASP n 
1 47  PRO n 
1 48  TRP n 
1 49  ARG n 
1 50  GLN n 
1 51  CYS n 
1 52  GLU n 
1 53  ALA n 
1 54  LEU n 
1 55  GLN n 
1 56  CYS n 
1 57  TRP n 
1 58  ARG n 
1 59  LEU n 
1 60  PHE n 
1 61  ASN n 
1 62  ASN n 
1 63  SER n 
1 64  ARG n 
1 65  CYS n 
1 66  ASP n 
1 67  PRO n 
1 68  ALA n 
1 69  CYS n 
1 70  SER n 
1 71  SER n 
1 72  PRO n 
1 73  ALA n 
1 74  CYS n 
1 75  LEU n 
1 76  TYR n 
1 77  ASP n 
1 78  ASN n 
1 79  PHE n 
1 80  ASP n 
1 81  CYS n 
1 82  HIS n 
1 83  ALA n 
1 84  GLY n 
1 85  GLY n 
1 86  ARG n 
1 87  GLU n 
1 88  ARG n 
1 89  THR n 
1 90  CYS n 
1 91  ASN n 
1 92  PRO n 
1 93  VAL n 
1 94  TYR n 
1 95  GLU n 
1 96  LYS n 
1 97  TYR n 
1 98  CYS n 
1 99  ALA n 
1 100 ASP n 
1 101 HIS n 
1 102 PHE n 
1 103 ALA n 
1 104 ASP n 
1 105 GLY n 
1 106 ARG n 
1 107 CYS n 
1 108 ASP n 
1 109 GLN n 
1 110 GLY n 
1 111 CYS n 
1 112 ASN n 
1 113 THR n 
1 114 GLU n 
1 115 GLU n 
1 116 CYS n 
1 117 GLY n 
1 118 TRP n 
1 119 ASP n 
1 120 GLY n 
1 121 LEU n 
1 122 ASP n 
1 123 CYS n 
1 124 ALA n 
1 125 SER n 
1 126 GLU n 
1 127 VAL n 
1 128 PRO n 
1 129 ALA n 
1 130 LEU n 
1 131 LEU n 
1 132 ALA n 
1 133 ARG n 
1 134 GLY n 
1 135 VAL n 
1 136 LEU n 
1 137 VAL n 
1 138 LEU n 
1 139 THR n 
1 140 VAL n 
1 141 LEU n 
1 142 LEU n 
1 143 PRO n 
1 144 PRO n 
1 145 GLU n 
1 146 GLU n 
1 147 LEU n 
1 148 LEU n 
1 149 ARG n 
1 150 SER n 
1 151 SER n 
1 152 ALA n 
1 153 ASP n 
1 154 PHE n 
1 155 LEU n 
1 156 GLN n 
1 157 ARG n 
1 158 LEU n 
1 159 SER n 
1 160 ALA n 
1 161 ILE n 
1 162 LEU n 
1 163 ARG n 
1 164 THR n 
1 165 SER n 
1 166 LEU n 
1 167 ARG n 
1 168 PHE n 
1 169 ARG n 
1 170 LEU n 
1 171 ASP n 
1 172 ALA n 
1 173 HIS n 
1 174 GLY n 
1 175 GLN n 
1 176 ALA n 
1 177 MET n 
1 178 VAL n 
1 179 PHE n 
1 180 PRO n 
1 181 TYR n 
1 182 HIS n 
1 183 ARG n 
1 184 PRO n 
1 185 SER n 
1 186 PRO n 
1 187 GLY n 
1 188 SER n 
1 189 GLU n 
1 190 PRO n 
1 191 ARG n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 GLU n 
1 196 LEU n 
1 197 ALA n 
1 198 PRO n 
1 199 GLU n 
1 200 VAL n 
1 201 ILE n 
1 202 GLY n 
1 203 SER n 
1 204 VAL n 
1 205 VAL n 
1 206 MET n 
1 207 LEU n 
1 208 GLU n 
1 209 ILE n 
1 210 ASP n 
1 211 ASN n 
1 212 ARG n 
1 213 LEU n 
1 214 CYS n 
1 215 LEU n 
1 216 GLN n 
1 217 SER n 
1 218 PRO n 
1 219 GLU n 
1 220 ASN n 
1 221 ASP n 
1 222 HIS n 
1 223 CYS n 
1 224 PHE n 
1 225 PRO n 
1 226 ASP n 
1 227 ALA n 
1 228 GLN n 
1 229 SER n 
1 230 ALA n 
1 231 ALA n 
1 232 ASP n 
1 233 TYR n 
1 234 LEU n 
1 235 GLY n 
1 236 ALA n 
1 237 LEU n 
1 238 SER n 
1 239 ALA n 
1 240 VAL n 
1 241 GLU n 
1 242 ARG n 
1 243 LEU n 
1 244 ASP n 
1 245 PHE n 
1 246 PRO n 
1 247 TYR n 
1 248 PRO n 
1 249 LEU n 
1 250 ARG n 
1 251 ASP n 
1 252 VAL n 
1 253 ARG n 
1 254 GLY n 
1 255 GLU n 
1 256 PRO n 
1 257 LEU n 
1 258 GLU n 
1 259 PRO n 
1 260 PRO n 
1 261 GLU n 
1 262 PRO n 
1 263 SER n 
1 264 GLY n 
1 265 SER n 
1 266 HIS n 
1 267 HIS n 
1 268 HIS n 
1 269 HIS n 
1 270 HIS n 
1 271 HIS n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   VAL n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   ALA n 
2 10  GLU n 
2 11  VAL n 
2 12  LYS n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  SER n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  VAL n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  GLY n 
2 28  THR n 
2 29  PHE n 
2 30  SER n 
2 31  SER n 
2 32  TYR n 
2 33  THR n 
2 34  ILE n 
2 35  SER n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  GLN n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  MET n 
2 49  GLY n 
2 50  TRP n 
2 51  ILE n 
2 52  LYS n 
2 53  PRO n 
2 54  ARG n 
2 55  TRP n 
2 56  GLY n 
2 57  ALA n 
2 58  ALA n 
2 59  HIS n 
2 60  TYR n 
2 61  ALA n 
2 62  GLN n 
2 63  LYS n 
2 64  PHE n 
2 65  GLN n 
2 66  GLY n 
2 67  ARG n 
2 68  VAL n 
2 69  THR n 
2 70  ILE n 
2 71  THR n 
2 72  ALA n 
2 73  ASP n 
2 74  GLU n 
2 75  SER n 
2 76  THR n 
2 77  SER n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  MET n 
2 82  GLU n 
2 83  LEU n 
2 84  SER n 
2 85  SER n 
2 86  LEU n 
2 87  ARG n 
2 88  SER n 
2 89  GLU n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  ALA n 
2 98  ARG n 
2 99  GLY n 
2 100 SER n 
2 101 PHE n 
2 102 TRP n 
2 103 PHE n 
2 104 GLY n 
2 105 TYR n 
2 106 TRP n 
2 107 GLY n 
2 108 GLN n 
2 109 GLY n 
2 110 THR n 
2 111 LEU n 
2 112 VAL n 
2 113 THR n 
2 114 VAL n 
2 115 SER n 
2 116 SER n 
2 117 ALA n 
2 118 SER n 
2 119 THR n 
2 120 LYS n 
2 121 GLY n 
2 122 PRO n 
2 123 SER n 
2 124 VAL n 
2 125 PHE n 
2 126 PRO n 
2 127 LEU n 
2 128 ALA n 
2 129 PRO n 
2 130 SER n 
2 131 SER n 
2 132 LYS n 
2 133 SER n 
2 134 THR n 
2 135 SER n 
2 136 GLY n 
2 137 GLY n 
2 138 THR n 
2 139 ALA n 
2 140 ALA n 
2 141 LEU n 
2 142 GLY n 
2 143 CYS n 
2 144 LEU n 
2 145 VAL n 
2 146 LYS n 
2 147 ASP n 
2 148 TYR n 
2 149 PHE n 
2 150 PRO n 
2 151 GLU n 
2 152 PRO n 
2 153 VAL n 
2 154 THR n 
2 155 VAL n 
2 156 SER n 
2 157 TRP n 
2 158 ASN n 
2 159 SER n 
2 160 GLY n 
2 161 ALA n 
2 162 LEU n 
2 163 THR n 
2 164 SER n 
2 165 GLY n 
2 166 VAL n 
2 167 HIS n 
2 168 THR n 
2 169 PHE n 
2 170 PRO n 
2 171 ALA n 
2 172 VAL n 
2 173 LEU n 
2 174 GLN n 
2 175 SER n 
2 176 SER n 
2 177 GLY n 
2 178 LEU n 
2 179 TYR n 
2 180 SER n 
2 181 LEU n 
2 182 SER n 
2 183 SER n 
2 184 VAL n 
2 185 VAL n 
2 186 THR n 
2 187 VAL n 
2 188 PRO n 
2 189 SER n 
2 190 SER n 
2 191 SER n 
2 192 LEU n 
2 193 GLY n 
2 194 THR n 
2 195 GLN n 
2 196 THR n 
2 197 TYR n 
2 198 ILE n 
2 199 CYS n 
2 200 ASN n 
2 201 VAL n 
2 202 ASN n 
2 203 HIS n 
2 204 LYS n 
2 205 PRO n 
2 206 SER n 
2 207 ASN n 
2 208 THR n 
2 209 LYS n 
2 210 VAL n 
2 211 ASP n 
2 212 LYS n 
2 213 ARG n 
2 214 VAL n 
2 215 GLU n 
2 216 PRO n 
2 217 LYS n 
2 218 SER n 
2 219 CYS n 
2 220 ASP n 
2 221 LYS n 
2 222 THR n 
2 223 HIS n 
3 1   ASP n 
3 2   ILE n 
3 3   GLN n 
3 4   MET n 
3 5   THR n 
3 6   GLN n 
3 7   SER n 
3 8   PRO n 
3 9   SER n 
3 10  SER n 
3 11  LEU n 
3 12  SER n 
3 13  ALA n 
3 14  SER n 
3 15  VAL n 
3 16  GLY n 
3 17  ASP n 
3 18  ARG n 
3 19  VAL n 
3 20  THR n 
3 21  ILE n 
3 22  THR n 
3 23  CYS n 
3 24  ARG n 
3 25  ALA n 
3 26  SER n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  ASN n 
3 31  ASN n 
3 32  TYR n 
3 33  LEU n 
3 34  ASN n 
3 35  TRP n 
3 36  TYR n 
3 37  GLN n 
3 38  GLN n 
3 39  LYS n 
3 40  PRO n 
3 41  GLY n 
3 42  LYS n 
3 43  ALA n 
3 44  PRO n 
3 45  LYS n 
3 46  LEU n 
3 47  LEU n 
3 48  ILE n 
3 49  TYR n 
3 50  ASP n 
3 51  ALA n 
3 52  SER n 
3 53  LYS n 
3 54  LEU n 
3 55  GLN n 
3 56  SER n 
3 57  GLY n 
3 58  VAL n 
3 59  PRO n 
3 60  SER n 
3 61  ARG n 
3 62  PHE n 
3 63  SER n 
3 64  GLY n 
3 65  SER n 
3 66  GLY n 
3 67  SER n 
3 68  GLY n 
3 69  THR n 
3 70  ASP n 
3 71  PHE n 
3 72  THR n 
3 73  LEU n 
3 74  THR n 
3 75  ILE n 
3 76  SER n 
3 77  SER n 
3 78  LEU n 
3 79  GLN n 
3 80  PRO n 
3 81  GLU n 
3 82  ASP n 
3 83  PHE n 
3 84  ALA n 
3 85  THR n 
3 86  TYR n 
3 87  TYR n 
3 88  CYS n 
3 89  GLN n 
3 90  GLN n 
3 91  TYR n 
3 92  LEU n 
3 93  GLN n 
3 94  TYR n 
3 95  PRO n 
3 96  MET n 
3 97  THR n 
3 98  PHE n 
3 99  GLY n 
3 100 GLN n 
3 101 GLY n 
3 102 THR n 
3 103 LYS n 
3 104 VAL n 
3 105 GLU n 
3 106 ILE n 
3 107 LYS n 
3 108 ARG n 
3 109 THR n 
3 110 VAL n 
3 111 ALA n 
3 112 ALA n 
3 113 PRO n 
3 114 SER n 
3 115 VAL n 
3 116 PHE n 
3 117 ILE n 
3 118 PHE n 
3 119 PRO n 
3 120 PRO n 
3 121 SER n 
3 122 ASP n 
3 123 GLU n 
3 124 GLN n 
3 125 LEU n 
3 126 LYS n 
3 127 SER n 
3 128 GLY n 
3 129 THR n 
3 130 ALA n 
3 131 SER n 
3 132 VAL n 
3 133 VAL n 
3 134 CYS n 
3 135 LEU n 
3 136 LEU n 
3 137 ASN n 
3 138 ASN n 
3 139 PHE n 
3 140 TYR n 
3 141 PRO n 
3 142 ARG n 
3 143 GLU n 
3 144 ALA n 
3 145 LYS n 
3 146 VAL n 
3 147 GLN n 
3 148 TRP n 
3 149 LYS n 
3 150 VAL n 
3 151 ASP n 
3 152 ASN n 
3 153 ALA n 
3 154 LEU n 
3 155 GLN n 
3 156 SER n 
3 157 GLY n 
3 158 ASN n 
3 159 SER n 
3 160 GLN n 
3 161 GLU n 
3 162 SER n 
3 163 VAL n 
3 164 THR n 
3 165 GLU n 
3 166 GLN n 
3 167 ASP n 
3 168 SER n 
3 169 LYS n 
3 170 ASP n 
3 171 SER n 
3 172 THR n 
3 173 TYR n 
3 174 SER n 
3 175 LEU n 
3 176 SER n 
3 177 SER n 
3 178 THR n 
3 179 LEU n 
3 180 THR n 
3 181 LEU n 
3 182 SER n 
3 183 LYS n 
3 184 ALA n 
3 185 ASP n 
3 186 TYR n 
3 187 GLU n 
3 188 LYS n 
3 189 HIS n 
3 190 LYS n 
3 191 VAL n 
3 192 TYR n 
3 193 ALA n 
3 194 CYS n 
3 195 GLU n 
3 196 VAL n 
3 197 THR n 
3 198 HIS n 
3 199 GLN n 
3 200 GLY n 
3 201 LEU n 
3 202 SER n 
3 203 SER n 
3 204 PRO n 
3 205 VAL n 
3 206 THR n 
3 207 LYS n 
3 208 SER n 
3 209 PHE n 
3 210 ASN n 
3 211 ARG n 
3 212 GLY n 
3 213 GLU n 
3 214 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 271 Human ? NOTCH3 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? ? 
? ? ? ? ? ? HEK293-FS ? ? ? ? ? plasmid ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 223 Human ? ?      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? ? 
? ? ? ? ? ? HEK293    ? ? ? ? ? plasmid ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 214 Human ? ?      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? ? 
? ? ? ? ? ? HEK293    ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NOTC3_HUMAN Q9UM47 ? 1 
;APEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFD
CHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSA
ILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAV
ERLDFPYPLRDVRGEPLEPPEPS
;
1378 
2 PDB 5CZV        5CZV   ? 2 ? 1    
3 PDB 5CZV        5CZV   ? 3 ? 1    
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5CZV A 1 ? 263 ? Q9UM47 1378 ? 1640 ? 1378 1640 
2 2 5CZV H 1 ? 223 ? 5CZV   1    ? 223  ? 1    223  
3 3 5CZV L 1 ? 214 ? 5CZV   1    ? 214  ? 1    214  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5CZV GLY A 264 ? UNP Q9UM47 ? ? 'expression tag' 1641 1 
1 5CZV SER A 265 ? UNP Q9UM47 ? ? 'expression tag' 1642 2 
1 5CZV HIS A 266 ? UNP Q9UM47 ? ? 'expression tag' 1643 3 
1 5CZV HIS A 267 ? UNP Q9UM47 ? ? 'expression tag' 1644 4 
1 5CZV HIS A 268 ? UNP Q9UM47 ? ? 'expression tag' 1645 5 
1 5CZV HIS A 269 ? UNP Q9UM47 ? ? 'expression tag' 1646 6 
1 5CZV HIS A 270 ? UNP Q9UM47 ? ? 'expression tag' 1647 7 
1 5CZV HIS A 271 ? UNP Q9UM47 ? ? 'expression tag' 1648 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CA  non-polymer                  . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5CZV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.64 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.46 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M NaAc, pH 5.6, 17.5% (v/v) PEG3000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-11-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.d_resolution_high            3.19 
_reflns.d_resolution_low             30.000 
_reflns.pdbx_number_measured_all     29800 
_reflns.number_obs                   11614 
_reflns.pdbx_Rmerge_I_obs            0.126 
_reflns.pdbx_netI_over_av_sigmaI     6.412 
_reflns.pdbx_netI_over_sigmaI        4.800 
_reflns.pdbx_chi_squared             1.043 
_reflns.pdbx_redundancy              2.600 
_reflns.percent_possible_obs         86.400 
_reflns.B_iso_Wilson_estimate        57.680 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5CZV 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  3.19  3.260  ? ? ? 0 0.272 ? ? 0.459 2.400 ? ? ? 539 ? ? ? ? 79.100 ? ? ? 
1 2  3.260 3.310  ? ? ? 0 0.243 ? ? 0.526 2.500 ? ? ? 540 ? ? ? ? 79.800 ? ? ? 
1 3  3.310 3.380  ? ? ? 0 0.247 ? ? 0.615 2.400 ? ? ? 515 ? ? ? ? 80.700 ? ? ? 
1 4  3.380 3.450  ? ? ? 0 0.206 ? ? 0.656 2.400 ? ? ? 532 ? ? ? ? 79.400 ? ? ? 
1 5  3.450 3.520  ? ? ? 0 0.184 ? ? 0.631 2.500 ? ? ? 560 ? ? ? ? 82.700 ? ? ? 
1 6  3.520 3.600  ? ? ? 0 0.177 ? ? 0.655 2.600 ? ? ? 574 ? ? ? ? 85.300 ? ? ? 
1 7  3.600 3.690  ? ? ? 0 0.173 ? ? 0.768 2.600 ? ? ? 565 ? ? ? ? 85.200 ? ? ? 
1 8  3.690 3.790  ? ? ? 0 0.193 ? ? 0.655 2.600 ? ? ? 564 ? ? ? ? 85.200 ? ? ? 
1 9  3.790 3.900  ? ? ? 0 0.158 ? ? 0.738 2.600 ? ? ? 569 ? ? ? ? 85.100 ? ? ? 
1 10 3.900 4.030  ? ? ? 0 0.132 ? ? 0.719 2.600 ? ? ? 598 ? ? ? ? 88.500 ? ? ? 
1 11 4.030 4.170  ? ? ? 0 0.125 ? ? 0.790 2.600 ? ? ? 579 ? ? ? ? 86.400 ? ? ? 
1 12 4.170 4.340  ? ? ? 0 0.108 ? ? 0.893 2.600 ? ? ? 596 ? ? ? ? 88.000 ? ? ? 
1 13 4.340 4.540  ? ? ? 0 0.112 ? ? 1.007 2.400 ? ? ? 565 ? ? ? ? 85.700 ? ? ? 
1 14 4.540 4.780  ? ? ? 0 0.111 ? ? 1.087 2.500 ? ? ? 576 ? ? ? ? 86.500 ? ? ? 
1 15 4.780 5.070  ? ? ? 0 0.102 ? ? 0.873 2.500 ? ? ? 603 ? ? ? ? 89.300 ? ? ? 
1 16 5.070 5.460  ? ? ? 0 0.115 ? ? 1.523 2.600 ? ? ? 605 ? ? ? ? 90.600 ? ? ? 
1 17 5.460 6.010  ? ? ? 0 0.119 ? ? 1.067 2.800 ? ? ? 626 ? ? ? ? 93.400 ? ? ? 
1 18 6.010 6.870  ? ? ? 0 0.122 ? ? 1.180 2.700 ? ? ? 635 ? ? ? ? 92.600 ? ? ? 
1 19 6.870 8.620  ? ? ? 0 0.103 ? ? 2.314 2.500 ? ? ? 627 ? ? ? ? 91.300 ? ? ? 
1 20 8.620 30.000 ? ? ? 0 0.078 ? ? 2.979 2.600 ? ? ? 646 ? ? ? ? 93.200 ? ? ? 
# 
_refine.entry_id                                 5CZV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            3.1900 
_refine.ls_d_res_low                             29.6200 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    85.9400 
_refine.ls_number_reflns_obs                     11612 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2062 
_refine.ls_R_factor_R_work                       0.2036 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2565 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.8800 
_refine.ls_number_reflns_R_free                  567 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               68.6500 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            8.2877 
_refine.aniso_B[2][2]                            4.8788 
_refine.aniso_B[3][3]                            -13.1665 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -2.4135 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.8811 
_refine.correlation_coeff_Fo_to_Fc_free          0.8090 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.5390 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entry 3ETO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                181.560 
_refine.B_iso_min                                9.190 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_analyze.entry_id                        5CZV 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_obs    0.577 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.1900 
_refine_hist.d_res_low                        29.6200 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             7 
_refine_hist.number_atoms_total               4939 
_refine_hist.pdbx_number_residues_total       642 
_refine_hist.pdbx_B_iso_mean_ligand           102.76 
_refine_hist.pdbx_B_iso_mean_solvent          16.34 
_refine_hist.pdbx_number_atoms_protein        4915 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' t_dihedral_angle_d        1684 ?      ? 2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' t_trig_c_planes           117  ?      ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_gen_planes              741  ?      ? 5.000  HARMONIC     
'X-RAY DIFFRACTION' t_it                      5060 ?      ? 20.000 HARMONIC     
'X-RAY DIFFRACTION' t_nbd                     1    ?      ? 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' t_improper_torsion        ?    ?      ? ?      ?            
'X-RAY DIFFRACTION' t_pseud_angle             ?    ?      ? ?      ?            
'X-RAY DIFFRACTION' t_chiral_improper_torsion 650  ?      ? 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' t_sum_occupancies         ?    ?      ? ?      ?            
'X-RAY DIFFRACTION' t_utility_distance        ?    ?      ? ?      ?            
'X-RAY DIFFRACTION' t_utility_angle           ?    ?      ? ?      ?            
'X-RAY DIFFRACTION' t_utility_torsion         ?    ?      ? ?      ?            
'X-RAY DIFFRACTION' t_ideal_dist_contact      5599 ?      ? 4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' t_bond_d                  5060 0.010  ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_angle_deg               6887 1.230  ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_omega_torsion           ?    3.190  ? ?      ?            
'X-RAY DIFFRACTION' t_other_torsion           ?    21.340 ? ?      ?            
# 
_refine_ls_shell.d_res_high                       3.1900 
_refine_ls_shell.d_res_low                        3.4900 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.percent_reflns_obs               85.9400 
_refine_ls_shell.number_reflns_R_work             2391 
_refine_ls_shell.R_factor_all                     0.2145 
_refine_ls_shell.R_factor_R_work                  0.2124 
_refine_ls_shell.R_factor_R_free                  0.2511 
_refine_ls_shell.percent_reflns_R_free            5.2300 
_refine_ls_shell.number_reflns_R_free             132 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2523 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_obs                     ? 
# 
_struct.entry_id                     5CZV 
_struct.title                        'Crystal structure of Notch3 NRR in complex with 20350 Fab' 
_struct.pdbx_descriptor              'Neurogenic locus notch homolog protein 3, Fab 20350 heavy chain, Fab 20350 light chain' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5CZV 
_struct_keywords.text            'ANTIBODY, NOTCH3, ONCOLOGY, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 15  ? ARG A 19  ? CYS A 1392 ARG A 1396 5 ? 5  
HELX_P HELX_P2  AA2 CYS A 33  ? GLY A 38  ? CYS A 1410 GLY A 1415 1 ? 6  
HELX_P HELX_P3  AA3 CYS A 56  ? PHE A 60  ? CYS A 1433 PHE A 1437 5 ? 5  
HELX_P HELX_P4  AA4 ASP A 66  ? SER A 70  ? ASP A 1443 SER A 1447 5 ? 5  
HELX_P HELX_P5  AA5 SER A 71  ? ASP A 80  ? SER A 1448 ASP A 1457 5 ? 10 
HELX_P HELX_P6  AA6 GLY A 85  ? THR A 89  ? GLY A 1462 THR A 1466 5 ? 5  
HELX_P HELX_P7  AA7 ASN A 91  ? PHE A 102 ? ASN A 1468 PHE A 1479 1 ? 12 
HELX_P HELX_P8  AA8 ASP A 108 ? ASN A 112 ? ASP A 1485 ASN A 1489 5 ? 5  
HELX_P HELX_P9  AA9 THR A 113 ? ASP A 122 ? THR A 1490 ASP A 1499 5 ? 10 
HELX_P HELX_P10 AB1 PRO A 143 ? SER A 150 ? PRO A 1520 SER A 1527 1 ? 8  
HELX_P HELX_P11 AB2 SER A 150 ? ARG A 163 ? SER A 1527 ARG A 1540 1 ? 14 
HELX_P HELX_P12 AB3 ASP A 226 ? VAL A 240 ? ASP A 1603 VAL A 1617 1 ? 15 
HELX_P HELX_P13 AB4 THR B 28  ? TYR B 32  ? THR H 28   TYR H 32   5 ? 5  
HELX_P HELX_P14 AB5 GLN B 62  ? GLN B 65  ? GLN H 62   GLN H 65   5 ? 4  
HELX_P HELX_P15 AB6 ARG B 87  ? THR B 91  ? ARG H 87   THR H 91   5 ? 5  
HELX_P HELX_P16 AB7 SER B 159 ? ALA B 161 ? SER H 159  ALA H 161  5 ? 3  
HELX_P HELX_P17 AB8 SER B 190 ? THR B 194 ? SER H 190  THR H 194  5 ? 5  
HELX_P HELX_P18 AB9 GLN C 79  ? PHE C 83  ? GLN L 79   PHE L 83   5 ? 5  
HELX_P HELX_P19 AC1 SER C 121 ? SER C 127 ? SER L 121  SER L 127  1 ? 7  
HELX_P HELX_P20 AC2 LYS C 183 ? LYS C 188 ? LYS L 183  LYS L 188  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 15  SG  ? ? ? 1_555 A CYS 28  SG ? ? A CYS 1392 A CYS 1405 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf2  disulf ?   ? A CYS 24  SG  ? ? ? 1_555 A CYS 40  SG ? ? A CYS 1401 A CYS 1417 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf3  disulf ?   ? A CYS 51  SG  ? ? ? 1_555 A CYS 74  SG ? ? A CYS 1428 A CYS 1451 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf4  disulf ?   ? A CYS 56  SG  ? ? ? 1_555 A CYS 69  SG ? ? A CYS 1433 A CYS 1446 1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf5  disulf ?   ? A CYS 65  SG  ? ? ? 1_555 A CYS 81  SG ? ? A CYS 1442 A CYS 1458 1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf6  disulf ?   ? A CYS 90  SG  ? ? ? 1_555 A CYS 116 SG ? ? A CYS 1467 A CYS 1493 1_555 ? ? ? ? ? ? ? 2.069 ? ?               
disulf7  disulf ?   ? A CYS 98  SG  ? ? ? 1_555 A CYS 111 SG ? ? A CYS 1475 A CYS 1488 1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf8  disulf ?   ? A CYS 107 SG  ? ? ? 1_555 A CYS 123 SG ? ? A CYS 1484 A CYS 1500 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf9  disulf ?   ? A CYS 214 SG  ? ? ? 1_555 A CYS 223 SG ? ? A CYS 1591 A CYS 1600 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf10 disulf ?   ? B CYS 22  SG  ? ? ? 1_555 B CYS 96  SG ? ? H CYS 22   H CYS 96   1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf11 disulf ?   ? B CYS 143 SG  ? ? ? 1_555 B CYS 199 SG ? ? H CYS 143  H CYS 199  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf12 disulf ?   ? C CYS 23  SG  ? ? ? 1_555 C CYS 88  SG ? ? L CYS 23   L CYS 88   1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf13 disulf ?   ? C CYS 134 SG  ? ? ? 1_555 C CYS 194 SG ? ? L CYS 134  L CYS 194  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
covale1  covale one ? A ASN 61  ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 1438 A NAG 5004 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
metalc1  metalc ?   ? A LYS 18  O   ? ? ? 1_555 D CA  .   CA ? ? A LYS 1395 A CA  5001 1_555 ? ? ? ? ? ? ? 2.580 ? ?               
metalc2  metalc ?   ? A ASP 21  OD1 ? ? ? 1_555 D CA  .   CA ? ? A ASP 1398 A CA  5001 1_555 ? ? ? ? ? ? ? 2.325 ? ?               
metalc3  metalc ?   ? A ARG 23  O   ? ? ? 1_555 D CA  .   CA ? ? A ARG 1400 A CA  5001 1_555 ? ? ? ? ? ? ? 2.205 ? ?               
metalc4  metalc ?   ? A ASP 25  OD2 ? ? ? 1_555 D CA  .   CA ? ? A ASP 1402 A CA  5001 1_555 ? ? ? ? ? ? ? 2.675 ? ?               
metalc5  metalc ?   ? A ASP 36  OD1 ? ? ? 1_555 D CA  .   CA ? ? A ASP 1413 A CA  5001 1_555 ? ? ? ? ? ? ? 2.671 ? ?               
metalc6  metalc ?   ? A ASP 36  OD2 ? ? ? 1_555 D CA  .   CA ? ? A ASP 1413 A CA  5001 1_555 ? ? ? ? ? ? ? 2.125 ? ?               
metalc7  metalc ?   ? A ASP 39  OD2 ? ? ? 1_555 D CA  .   CA ? ? A ASP 1416 A CA  5001 1_555 ? ? ? ? ? ? ? 2.428 ? ?               
metalc8  metalc ?   ? A LEU 59  O   ? ? ? 1_555 E CA  .   CA ? ? A LEU 1436 A CA  5002 1_555 ? ? ? ? ? ? ? 2.307 ? ?               
metalc9  metalc ?   ? A ASN 62  OD1 ? ? ? 1_555 E CA  .   CA ? ? A ASN 1439 A CA  5002 1_555 ? ? ? ? ? ? ? 2.435 ? ?               
metalc10 metalc ?   ? A ARG 64  O   ? ? ? 1_555 E CA  .   CA ? ? A ARG 1441 A CA  5002 1_555 ? ? ? ? ? ? ? 2.409 ? ?               
metalc11 metalc ?   ? A ASP 66  OD2 ? ? ? 1_555 E CA  .   CA ? ? A ASP 1443 A CA  5002 1_555 ? ? ? ? ? ? ? 2.534 ? ?               
metalc12 metalc ?   ? A ASP 77  OD1 ? ? ? 1_555 E CA  .   CA ? ? A ASP 1454 A CA  5002 1_555 ? ? ? ? ? ? ? 2.396 ? ?               
metalc13 metalc ?   ? A ASP 77  OD2 ? ? ? 1_555 E CA  .   CA ? ? A ASP 1454 A CA  5002 1_555 ? ? ? ? ? ? ? 2.402 ? ?               
metalc14 metalc ?   ? A HIS 101 O   ? ? ? 1_555 F CA  .   CA ? ? A HIS 1478 A CA  5003 1_555 ? ? ? ? ? ? ? 2.342 ? ?               
metalc15 metalc ?   ? A ASP 104 OD1 ? ? ? 1_555 F CA  .   CA ? ? A ASP 1481 A CA  5003 1_555 ? ? ? ? ? ? ? 2.486 ? ?               
metalc16 metalc ?   ? A ARG 106 O   ? ? ? 1_555 F CA  .   CA ? ? A ARG 1483 A CA  5003 1_555 ? ? ? ? ? ? ? 2.291 ? ?               
metalc17 metalc ?   ? A ASP 108 OD2 ? ? ? 1_555 F CA  .   CA ? ? A ASP 1485 A CA  5003 1_555 ? ? ? ? ? ? ? 2.247 ? ?               
metalc18 metalc ?   ? A ASP 119 OD1 ? ? ? 1_555 F CA  .   CA ? ? A ASP 1496 A CA  5003 1_555 ? ? ? ? ? ? ? 2.434 ? ?               
metalc19 metalc ?   ? A ASP 119 OD2 ? ? ? 1_555 F CA  .   CA ? ? A ASP 1496 A CA  5003 1_555 ? ? ? ? ? ? ? 2.535 ? ?               
metalc20 metalc ?   ? A ASP 122 OD2 ? ? ? 1_555 F CA  .   CA ? ? A ASP 1499 A CA  5003 1_555 ? ? ? ? ? ? ? 2.263 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 217 A . ? SER 1594 A PRO 218 A ? PRO 1595 A 1 -0.12 
2 PHE 149 B . ? PHE 149  H PRO 150 B ? PRO 150  H 1 -3.87 
3 GLU 151 B . ? GLU 151  H PRO 152 B ? PRO 152  H 1 9.84  
4 SER 7   C . ? SER 7    L PRO 8   C ? PRO 8    L 1 -4.91 
5 TYR 94  C . ? TYR 94   L PRO 95  C ? PRO 95   L 1 -3.08 
6 TYR 140 C . ? TYR 140  L PRO 141 C ? PRO 141  L 1 3.52  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 6 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 3 ? 
AA8 ? 4 ? 
AA9 ? 6 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AA9 5 6 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 165 ? PHE A 168 ? SER A 1542 PHE A 1545 
AA1 2 GLY A 202 ? ASP A 210 ? GLY A 1579 ASP A 1587 
AA1 3 VAL A 178 ? TYR A 181 ? VAL A 1555 TYR A 1558 
AA2 1 SER A 165 ? PHE A 168 ? SER A 1542 PHE A 1545 
AA2 2 GLY A 202 ? ASP A 210 ? GLY A 1579 ASP A 1587 
AA2 3 VAL A 135 ? VAL A 140 ? VAL A 1512 VAL A 1517 
AA2 4 LEU A 249 ? GLU A 255 ? LEU A 1626 GLU A 1632 
AA3 1 GLN B 3   ? GLN B 6   ? GLN H 3    GLN H 6    
AA3 2 VAL B 18  ? SER B 25  ? VAL H 18   SER H 25   
AA3 3 THR B 78  ? LEU B 83  ? THR H 78   LEU H 83   
AA3 4 VAL B 68  ? ASP B 73  ? VAL H 68   ASP H 73   
AA4 1 GLU B 10  ? LYS B 12  ? GLU H 10   LYS H 12   
AA4 2 THR B 110 ? VAL B 114 ? THR H 110  VAL H 114  
AA4 3 ALA B 92  ? ARG B 98  ? ALA H 92   ARG H 98   
AA4 4 ILE B 34  ? GLN B 39  ? ILE H 34   GLN H 39   
AA4 5 GLU B 46  ? ILE B 51  ? GLU H 46   ILE H 51   
AA4 6 ALA B 58  ? TYR B 60  ? ALA H 58   TYR H 60   
AA5 1 GLU B 10  ? LYS B 12  ? GLU H 10   LYS H 12   
AA5 2 THR B 110 ? VAL B 114 ? THR H 110  VAL H 114  
AA5 3 ALA B 92  ? ARG B 98  ? ALA H 92   ARG H 98   
AA5 4 TYR B 105 ? TRP B 106 ? TYR H 105  TRP H 106  
AA6 1 SER B 123 ? LEU B 127 ? SER H 123  LEU H 127  
AA6 2 LEU B 141 ? TYR B 148 ? LEU H 141  TYR H 148  
AA6 3 TYR B 179 ? VAL B 185 ? TYR H 179  VAL H 185  
AA6 4 HIS B 167 ? LEU B 173 ? HIS H 167  LEU H 173  
AA7 1 SER B 156 ? TRP B 157 ? SER H 156  TRP H 157  
AA7 2 ILE B 198 ? ASN B 200 ? ILE H 198  ASN H 200  
AA7 3 ASP B 211 ? ARG B 213 ? ASP H 211  ARG H 213  
AA8 1 MET C 4   ? SER C 7   ? MET L 4    SER L 7    
AA8 2 VAL C 19  ? ALA C 25  ? VAL L 19   ALA L 25   
AA8 3 ASP C 70  ? ILE C 75  ? ASP L 70   ILE L 75   
AA8 4 PHE C 62  ? SER C 67  ? PHE L 62   SER L 67   
AA9 1 SER C 10  ? ALA C 13  ? SER L 10   ALA L 13   
AA9 2 THR C 102 ? ILE C 106 ? THR L 102  ILE L 106  
AA9 3 THR C 85  ? GLN C 90  ? THR L 85   GLN L 90   
AA9 4 LEU C 33  ? GLN C 38  ? LEU L 33   GLN L 38   
AA9 5 LYS C 45  ? TYR C 49  ? LYS L 45   TYR L 49   
AA9 6 LYS C 53  ? LEU C 54  ? LYS L 53   LEU L 54   
AB1 1 SER C 10  ? ALA C 13  ? SER L 10   ALA L 13   
AB1 2 THR C 102 ? ILE C 106 ? THR L 102  ILE L 106  
AB1 3 THR C 85  ? GLN C 90  ? THR L 85   GLN L 90   
AB1 4 THR C 97  ? PHE C 98  ? THR L 97   PHE L 98   
AB2 1 SER C 114 ? PHE C 118 ? SER L 114  PHE L 118  
AB2 2 THR C 129 ? PHE C 139 ? THR L 129  PHE L 139  
AB2 3 TYR C 173 ? SER C 182 ? TYR L 173  SER L 182  
AB2 4 SER C 159 ? VAL C 163 ? SER L 159  VAL L 163  
AB3 1 ALA C 153 ? LEU C 154 ? ALA L 153  LEU L 154  
AB3 2 LYS C 145 ? VAL C 150 ? LYS L 145  VAL L 150  
AB3 3 VAL C 191 ? THR C 197 ? VAL L 191  THR L 197  
AB3 4 VAL C 205 ? ASN C 210 ? VAL L 205  ASN L 210  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 165 ? N SER A 1542 O ASP A 210 ? O ASP A 1587 
AA1 2 3 O VAL A 204 ? O VAL A 1581 N PHE A 179 ? N PHE A 1556 
AA2 1 2 N SER A 165 ? N SER A 1542 O ASP A 210 ? O ASP A 1587 
AA2 2 3 O LEU A 207 ? O LEU A 1584 N LEU A 136 ? N LEU A 1513 
AA2 3 4 N VAL A 137 ? N VAL A 1514 O ARG A 253 ? O ARG A 1630 
AA3 1 2 N VAL B 5   ? N VAL H 5    O LYS B 23  ? O LYS H 23   
AA3 2 3 N VAL B 20  ? N VAL H 20   O MET B 81  ? O MET H 81   
AA3 3 4 O TYR B 80  ? O TYR H 80   N THR B 71  ? N THR H 71   
AA4 1 2 N LYS B 12  ? N LYS H 12   O THR B 113 ? O THR H 113  
AA4 2 3 O VAL B 112 ? O VAL H 112  N ALA B 92  ? N ALA H 92   
AA4 3 4 O TYR B 95  ? O TYR H 95   N VAL B 37  ? N VAL H 37   
AA4 4 5 N TRP B 36  ? N TRP H 36   O MET B 48  ? O MET H 48   
AA4 5 6 N TRP B 50  ? N TRP H 50   O HIS B 59  ? O HIS H 59   
AA5 1 2 N LYS B 12  ? N LYS H 12   O THR B 113 ? O THR H 113  
AA5 2 3 O VAL B 112 ? O VAL H 112  N ALA B 92  ? N ALA H 92   
AA5 3 4 N ARG B 98  ? N ARG H 98   O TYR B 105 ? O TYR H 105  
AA6 1 2 N PHE B 125 ? N PHE H 125  O LEU B 144 ? O LEU H 144  
AA6 2 3 N VAL B 145 ? N VAL H 145  O LEU B 181 ? O LEU H 181  
AA6 3 4 O VAL B 184 ? O VAL H 184  N HIS B 167 ? N HIS H 167  
AA7 1 2 N SER B 156 ? N SER H 156  O ASN B 200 ? O ASN H 200  
AA7 2 3 N CYS B 199 ? N CYS H 199  O LYS B 212 ? O LYS H 212  
AA8 1 2 N THR C 5   ? N THR L 5    O ARG C 24  ? O ARG L 24   
AA8 2 3 N VAL C 19  ? N VAL L 19   O ILE C 75  ? O ILE L 75   
AA8 3 4 O THR C 74  ? O THR L 74   N SER C 63  ? N SER L 63   
AA9 1 2 N LEU C 11  ? N LEU L 11   O GLU C 105 ? O GLU L 105  
AA9 2 3 O THR C 102 ? O THR L 102  N TYR C 86  ? N TYR L 86   
AA9 3 4 O THR C 85  ? O THR L 85   N GLN C 38  ? N GLN L 38   
AA9 4 5 N TRP C 35  ? N TRP L 35   O LEU C 47  ? O LEU L 47   
AA9 5 6 N TYR C 49  ? N TYR L 49   O LYS C 53  ? O LYS L 53   
AB1 1 2 N LEU C 11  ? N LEU L 11   O GLU C 105 ? O GLU L 105  
AB1 2 3 O THR C 102 ? O THR L 102  N TYR C 86  ? N TYR L 86   
AB1 3 4 N GLN C 90  ? N GLN L 90   O THR C 97  ? O THR L 97   
AB2 1 2 N PHE C 118 ? N PHE L 118  O VAL C 133 ? O VAL L 133  
AB2 2 3 N LEU C 136 ? N LEU L 136  O LEU C 175 ? O LEU L 175  
AB2 3 4 O THR C 178 ? O THR L 178  N GLN C 160 ? N GLN L 160  
AB3 1 2 O ALA C 153 ? O ALA L 153  N VAL C 150 ? N VAL L 150  
AB3 2 3 N GLN C 147 ? N GLN L 147  O GLU C 195 ? O GLU L 195  
AB3 3 4 N VAL C 196 ? N VAL L 196  O VAL C 205 ? O VAL L 205  
# 
_atom_sites.entry_id                    5CZV 
_atom_sites.fract_transf_matrix[1][1]   0.010879 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004656 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009583 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011715 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 14  ? 14.863  -42.058 -43.946 1.00 108.16 ? 1391 ALA A N   1 
ATOM   2    C  CA  . ALA A 1 14  ? 13.434  -42.254 -43.734 1.00 107.40 ? 1391 ALA A CA  1 
ATOM   3    C  C   . ALA A 1 14  ? 12.603  -41.983 -45.008 1.00 113.12 ? 1391 ALA A C   1 
ATOM   4    O  O   . ALA A 1 14  ? 12.196  -42.940 -45.661 1.00 114.78 ? 1391 ALA A O   1 
ATOM   5    C  CB  . ALA A 1 14  ? 12.950  -41.407 -42.568 1.00 105.34 ? 1391 ALA A CB  1 
ATOM   6    N  N   . CYS A 1 15  ? 12.348  -40.701 -45.359 1.00 108.84 ? 1392 CYS A N   1 
ATOM   7    C  CA  . CYS A 1 15  ? 11.576  -40.305 -46.552 1.00 108.06 ? 1392 CYS A CA  1 
ATOM   8    C  C   . CYS A 1 15  ? 12.131  -39.031 -47.243 1.00 112.23 ? 1392 CYS A C   1 
ATOM   9    O  O   . CYS A 1 15  ? 11.419  -38.040 -47.438 1.00 107.36 ? 1392 CYS A O   1 
ATOM   10   C  CB  . CYS A 1 15  ? 10.090  -40.179 -46.232 1.00 106.15 ? 1392 CYS A CB  1 
ATOM   11   S  SG  . CYS A 1 15  ? 9.704   -38.975 -44.933 1.00 106.79 ? 1392 CYS A SG  1 
ATOM   12   N  N   . GLN A 1 16  ? 13.407  -39.088 -47.649 1.00 113.99 ? 1393 GLN A N   1 
ATOM   13   C  CA  . GLN A 1 16  ? 14.093  -37.993 -48.351 1.00 113.85 ? 1393 GLN A CA  1 
ATOM   14   C  C   . GLN A 1 16  ? 13.544  -37.799 -49.773 1.00 116.98 ? 1393 GLN A C   1 
ATOM   15   O  O   . GLN A 1 16  ? 13.613  -36.685 -50.295 1.00 114.13 ? 1393 GLN A O   1 
ATOM   16   C  CB  . GLN A 1 16  ? 15.610  -38.266 -48.435 1.00 118.70 ? 1393 GLN A CB  1 
ATOM   17   C  CG  . GLN A 1 16  ? 16.420  -37.833 -47.221 1.00 144.95 ? 1393 GLN A CG  1 
ATOM   18   C  CD  . GLN A 1 16  ? 16.411  -38.869 -46.130 1.00 170.35 ? 1393 GLN A CD  1 
ATOM   19   O  OE1 . GLN A 1 16  ? 17.198  -39.828 -46.123 1.00 165.65 ? 1393 GLN A OE1 1 
ATOM   20   N  NE2 . GLN A 1 16  ? 15.515  -38.685 -45.178 1.00 166.70 ? 1393 GLN A NE2 1 
ATOM   21   N  N   . ALA A 1 17  ? 13.020  -38.896 -50.396 1.00 115.34 ? 1394 ALA A N   1 
ATOM   22   C  CA  . ALA A 1 17  ? 12.451  -38.952 -51.752 1.00 114.68 ? 1394 ALA A CA  1 
ATOM   23   C  C   . ALA A 1 17  ? 11.082  -38.241 -51.862 1.00 113.52 ? 1394 ALA A C   1 
ATOM   24   O  O   . ALA A 1 17  ? 10.592  -38.003 -52.975 1.00 112.84 ? 1394 ALA A O   1 
ATOM   25   C  CB  . ALA A 1 17  ? 12.340  -40.403 -52.206 1.00 118.47 ? 1394 ALA A CB  1 
ATOM   26   N  N   . LYS A 1 18  ? 10.479  -37.895 -50.709 1.00 105.97 ? 1395 LYS A N   1 
ATOM   27   C  CA  . LYS A 1 18  ? 9.198   -37.204 -50.651 1.00 101.99 ? 1395 LYS A CA  1 
ATOM   28   C  C   . LYS A 1 18  ? 9.308   -35.725 -50.236 1.00 101.11 ? 1395 LYS A C   1 
ATOM   29   O  O   . LYS A 1 18  ? 8.336   -34.987 -50.382 1.00 98.45  ? 1395 LYS A O   1 
ATOM   30   C  CB  . LYS A 1 18  ? 8.229   -37.976 -49.759 1.00 104.38 ? 1395 LYS A CB  1 
ATOM   31   C  CG  . LYS A 1 18  ? 7.373   -38.953 -50.553 1.00 119.68 ? 1395 LYS A CG  1 
ATOM   32   C  CD  . LYS A 1 18  ? 6.983   -40.203 -49.742 1.00 126.57 ? 1395 LYS A CD  1 
ATOM   33   C  CE  . LYS A 1 18  ? 7.889   -41.396 -49.988 1.00 136.57 ? 1395 LYS A CE  1 
ATOM   34   N  NZ  . LYS A 1 18  ? 9.250   -41.217 -49.405 1.00 143.77 ? 1395 LYS A NZ  1 
ATOM   35   N  N   . ARG A 1 19  ? 10.489  -35.286 -49.746 1.00 96.58  ? 1396 ARG A N   1 
ATOM   36   C  CA  . ARG A 1 19  ? 10.726  -33.895 -49.348 1.00 93.48  ? 1396 ARG A CA  1 
ATOM   37   C  C   . ARG A 1 19  ? 10.732  -32.982 -50.584 1.00 95.97  ? 1396 ARG A C   1 
ATOM   38   O  O   . ARG A 1 19  ? 11.558  -33.169 -51.481 1.00 98.26  ? 1396 ARG A O   1 
ATOM   39   C  CB  . ARG A 1 19  ? 12.037  -33.765 -48.551 1.00 93.58  ? 1396 ARG A CB  1 
ATOM   40   C  CG  . ARG A 1 19  ? 11.899  -34.142 -47.079 1.00 99.82  ? 1396 ARG A CG  1 
ATOM   41   C  CD  . ARG A 1 19  ? 12.074  -32.947 -46.169 1.00 103.41 ? 1396 ARG A CD  1 
ATOM   42   N  NE  . ARG A 1 19  ? 13.480  -32.625 -45.945 1.00 110.32 ? 1396 ARG A NE  1 
ATOM   43   C  CZ  . ARG A 1 19  ? 13.940  -31.643 -45.170 1.00 116.54 ? 1396 ARG A CZ  1 
ATOM   44   N  NH1 . ARG A 1 19  ? 15.245  -31.447 -45.043 1.00 102.20 ? 1396 ARG A NH1 1 
ATOM   45   N  NH2 . ARG A 1 19  ? 13.101  -30.824 -44.553 1.00 96.71  ? 1396 ARG A NH2 1 
ATOM   46   N  N   . GLY A 1 20  ? 9.779   -32.048 -50.639 1.00 88.15  ? 1397 GLY A N   1 
ATOM   47   C  CA  . GLY A 1 20  ? 9.635   -31.110 -51.747 1.00 86.64  ? 1397 GLY A CA  1 
ATOM   48   C  C   . GLY A 1 20  ? 9.147   -31.733 -53.039 1.00 91.69  ? 1397 GLY A C   1 
ATOM   49   O  O   . GLY A 1 20  ? 9.461   -31.225 -54.117 1.00 90.74  ? 1397 GLY A O   1 
ATOM   50   N  N   . ASP A 1 21  ? 8.355   -32.828 -52.943 1.00 90.86  ? 1398 ASP A N   1 
ATOM   51   C  CA  . ASP A 1 21  ? 7.837   -33.565 -54.108 1.00 92.90  ? 1398 ASP A CA  1 
ATOM   52   C  C   . ASP A 1 21  ? 6.465   -33.035 -54.615 1.00 95.32  ? 1398 ASP A C   1 
ATOM   53   O  O   . ASP A 1 21  ? 5.811   -33.696 -55.427 1.00 96.07  ? 1398 ASP A O   1 
ATOM   54   C  CB  . ASP A 1 21  ? 7.816   -35.095 -53.842 1.00 97.08  ? 1398 ASP A CB  1 
ATOM   55   C  CG  . ASP A 1 21  ? 6.672   -35.627 -53.003 1.00 106.91 ? 1398 ASP A CG  1 
ATOM   56   O  OD1 . ASP A 1 21  ? 6.122   -34.856 -52.183 1.00 104.46 ? 1398 ASP A OD1 1 
ATOM   57   O  OD2 . ASP A 1 21  ? 6.338   -36.820 -53.151 1.00 115.56 ? 1398 ASP A OD2 1 
ATOM   58   N  N   . GLN A 1 22  ? 6.066   -31.829 -54.155 1.00 89.80  ? 1399 GLN A N   1 
ATOM   59   C  CA  . GLN A 1 22  ? 4.818   -31.126 -54.494 1.00 88.17  ? 1399 GLN A CA  1 
ATOM   60   C  C   . GLN A 1 22  ? 3.540   -31.949 -54.160 1.00 91.74  ? 1399 GLN A C   1 
ATOM   61   O  O   . GLN A 1 22  ? 2.481   -31.743 -54.763 1.00 90.93  ? 1399 GLN A O   1 
ATOM   62   C  CB  . GLN A 1 22  ? 4.820   -30.620 -55.953 1.00 90.26  ? 1399 GLN A CB  1 
ATOM   63   C  CG  . GLN A 1 22  ? 5.297   -29.181 -56.106 1.00 99.15  ? 1399 GLN A CG  1 
ATOM   64   C  CD  . GLN A 1 22  ? 6.774   -29.109 -56.387 1.00 122.28 ? 1399 GLN A CD  1 
ATOM   65   O  OE1 . GLN A 1 22  ? 7.616   -29.323 -55.510 1.00 115.09 ? 1399 GLN A OE1 1 
ATOM   66   N  NE2 . GLN A 1 22  ? 7.123   -28.804 -57.625 1.00 121.54 ? 1399 GLN A NE2 1 
ATOM   67   N  N   . ARG A 1 23  ? 3.653   -32.850 -53.161 1.00 87.43  ? 1400 ARG A N   1 
ATOM   68   C  CA  . ARG A 1 23  ? 2.571   -33.691 -52.659 1.00 85.99  ? 1400 ARG A CA  1 
ATOM   69   C  C   . ARG A 1 23  ? 2.740   -33.859 -51.149 1.00 88.06  ? 1400 ARG A C   1 
ATOM   70   O  O   . ARG A 1 23  ? 3.810   -34.307 -50.717 1.00 88.91  ? 1400 ARG A O   1 
ATOM   71   C  CB  . ARG A 1 23  ? 2.564   -35.044 -53.387 1.00 87.16  ? 1400 ARG A CB  1 
ATOM   72   C  CG  . ARG A 1 23  ? 2.033   -34.968 -54.839 1.00 96.94  ? 1400 ARG A CG  1 
ATOM   73   C  CD  . ARG A 1 23  ? 0.515   -34.869 -54.944 1.00 108.70 ? 1400 ARG A CD  1 
ATOM   74   N  NE  . ARG A 1 23  ? 0.076   -33.820 -55.874 1.00 119.23 ? 1400 ARG A NE  1 
ATOM   75   C  CZ  . ARG A 1 23  ? -1.189  -33.425 -56.024 1.00 131.41 ? 1400 ARG A CZ  1 
ATOM   76   N  NH1 . ARG A 1 23  ? -2.157  -33.988 -55.310 1.00 120.89 ? 1400 ARG A NH1 1 
ATOM   77   N  NH2 . ARG A 1 23  ? -1.493  -32.467 -56.888 1.00 112.97 ? 1400 ARG A NH2 1 
ATOM   78   N  N   . CYS A 1 24  ? 1.726   -33.436 -50.332 1.00 81.39  ? 1401 CYS A N   1 
ATOM   79   C  CA  . CYS A 1 24  ? 1.857   -33.577 -48.878 1.00 79.68  ? 1401 CYS A CA  1 
ATOM   80   C  C   . CYS A 1 24  ? 1.705   -35.039 -48.415 1.00 85.02  ? 1401 CYS A C   1 
ATOM   81   O  O   . CYS A 1 24  ? 0.716   -35.709 -48.727 1.00 84.23  ? 1401 CYS A O   1 
ATOM   82   C  CB  . CYS A 1 24  ? 0.974   -32.637 -48.058 1.00 76.46  ? 1401 CYS A CB  1 
ATOM   83   S  SG  . CYS A 1 24  ? 0.725   -33.233 -46.354 1.00 79.80  ? 1401 CYS A SG  1 
ATOM   84   N  N   . ASP A 1 25  ? 2.693   -35.487 -47.619 1.00 83.28  ? 1402 ASP A N   1 
ATOM   85   C  CA  . ASP A 1 25  ? 2.791   -36.815 -47.013 1.00 85.61  ? 1402 ASP A CA  1 
ATOM   86   C  C   . ASP A 1 25  ? 2.866   -36.651 -45.472 1.00 89.80  ? 1402 ASP A C   1 
ATOM   87   O  O   . ASP A 1 25  ? 3.925   -36.288 -44.944 1.00 89.75  ? 1402 ASP A O   1 
ATOM   88   C  CB  . ASP A 1 25  ? 4.023   -37.550 -47.573 1.00 89.69  ? 1402 ASP A CB  1 
ATOM   89   C  CG  . ASP A 1 25  ? 4.044   -37.629 -49.095 1.00 94.63  ? 1402 ASP A CG  1 
ATOM   90   O  OD1 . ASP A 1 25  ? 3.226   -38.382 -49.665 1.00 95.85  ? 1402 ASP A OD1 1 
ATOM   91   O  OD2 . ASP A 1 25  ? 4.871   -36.934 -49.712 1.00 95.97  ? 1402 ASP A OD2 1 
ATOM   92   N  N   . ARG A 1 26  ? 1.726   -36.887 -44.763 1.00 85.52  ? 1403 ARG A N   1 
ATOM   93   C  CA  . ARG A 1 26  ? 1.590   -36.693 -43.310 1.00 84.62  ? 1403 ARG A CA  1 
ATOM   94   C  C   . ARG A 1 26  ? 2.598   -37.483 -42.448 1.00 90.50  ? 1403 ARG A C   1 
ATOM   95   O  O   . ARG A 1 26  ? 2.879   -37.063 -41.319 1.00 88.17  ? 1403 ARG A O   1 
ATOM   96   C  CB  . ARG A 1 26  ? 0.147   -36.937 -42.828 1.00 85.64  ? 1403 ARG A CB  1 
ATOM   97   C  CG  . ARG A 1 26  ? -0.433  -38.351 -43.048 1.00 104.70 ? 1403 ARG A CG  1 
ATOM   98   C  CD  . ARG A 1 26  ? -0.667  -39.186 -41.779 1.00 115.08 ? 1403 ARG A CD  1 
ATOM   99   N  NE  . ARG A 1 26  ? -1.366  -38.449 -40.728 1.00 122.08 ? 1403 ARG A NE  1 
ATOM   100  C  CZ  . ARG A 1 26  ? -1.167  -38.625 -39.428 1.00 132.09 ? 1403 ARG A CZ  1 
ATOM   101  N  NH1 . ARG A 1 26  ? -0.302  -39.537 -38.998 1.00 110.22 ? 1403 ARG A NH1 1 
ATOM   102  N  NH2 . ARG A 1 26  ? -1.831  -37.887 -38.543 1.00 120.57 ? 1403 ARG A NH2 1 
ATOM   103  N  N   . GLU A 1 27  ? 3.159   -38.593 -42.989 1.00 91.35  ? 1404 GLU A N   1 
ATOM   104  C  CA  . GLU A 1 27  ? 4.179   -39.417 -42.327 1.00 93.95  ? 1404 GLU A CA  1 
ATOM   105  C  C   . GLU A 1 27  ? 5.495   -38.686 -42.208 1.00 100.11 ? 1404 GLU A C   1 
ATOM   106  O  O   . GLU A 1 27  ? 6.267   -38.975 -41.292 1.00 101.96 ? 1404 GLU A O   1 
ATOM   107  C  CB  . GLU A 1 27  ? 4.366   -40.740 -43.067 1.00 97.89  ? 1404 GLU A CB  1 
ATOM   108  C  CG  . GLU A 1 27  ? 3.732   -41.907 -42.327 1.00 110.42 ? 1404 GLU A CG  1 
ATOM   109  C  CD  . GLU A 1 27  ? 2.290   -41.756 -41.863 1.00 118.66 ? 1404 GLU A CD  1 
ATOM   110  O  OE1 . GLU A 1 27  ? 1.489   -41.119 -42.589 1.00 106.19 ? 1404 GLU A OE1 1 
ATOM   111  O  OE2 . GLU A 1 27  ? 1.958   -42.304 -40.785 1.00 98.86  ? 1404 GLU A OE2 1 
ATOM   112  N  N   . CYS A 1 28  ? 5.733   -37.719 -43.125 1.00 95.47  ? 1405 CYS A N   1 
ATOM   113  C  CA  . CYS A 1 28  ? 6.930   -36.873 -43.207 1.00 94.70  ? 1405 CYS A CA  1 
ATOM   114  C  C   . CYS A 1 28  ? 6.657   -35.452 -42.729 1.00 93.13  ? 1405 CYS A C   1 
ATOM   115  O  O   . CYS A 1 28  ? 7.567   -34.616 -42.700 1.00 92.36  ? 1405 CYS A O   1 
ATOM   116  C  CB  . CYS A 1 28  ? 7.489   -36.892 -44.626 1.00 96.19  ? 1405 CYS A CB  1 
ATOM   117  S  SG  . CYS A 1 28  ? 7.745   -38.558 -45.286 1.00 103.82 ? 1405 CYS A SG  1 
ATOM   118  N  N   . ASN A 1 29  ? 5.401   -35.182 -42.341 1.00 85.82  ? 1406 ASN A N   1 
ATOM   119  C  CA  . ASN A 1 29  ? 5.010   -33.869 -41.852 1.00 81.86  ? 1406 ASN A CA  1 
ATOM   120  C  C   . ASN A 1 29  ? 5.344   -33.723 -40.361 1.00 84.25  ? 1406 ASN A C   1 
ATOM   121  O  O   . ASN A 1 29  ? 4.541   -34.065 -39.486 1.00 83.60  ? 1406 ASN A O   1 
ATOM   122  C  CB  . ASN A 1 29  ? 3.551   -33.569 -42.172 1.00 76.08  ? 1406 ASN A CB  1 
ATOM   123  C  CG  . ASN A 1 29  ? 3.130   -32.224 -41.689 1.00 79.99  ? 1406 ASN A CG  1 
ATOM   124  O  OD1 . ASN A 1 29  ? 3.780   -31.199 -41.946 1.00 62.24  ? 1406 ASN A OD1 1 
ATOM   125  N  ND2 . ASN A 1 29  ? 2.055   -32.216 -40.936 1.00 74.07  ? 1406 ASN A ND2 1 
ATOM   126  N  N   . SER A 1 30  ? 6.562   -33.229 -40.092 1.00 79.70  ? 1407 SER A N   1 
ATOM   127  C  CA  . SER A 1 30  ? 7.122   -33.018 -38.759 1.00 79.43  ? 1407 SER A CA  1 
ATOM   128  C  C   . SER A 1 30  ? 8.153   -31.895 -38.859 1.00 81.14  ? 1407 SER A C   1 
ATOM   129  O  O   . SER A 1 30  ? 8.678   -31.683 -39.954 1.00 79.39  ? 1407 SER A O   1 
ATOM   130  C  CB  . SER A 1 30  ? 7.782   -34.307 -38.270 1.00 87.17  ? 1407 SER A CB  1 
ATOM   131  O  OG  . SER A 1 30  ? 8.470   -34.181 -37.037 1.00 98.00  ? 1407 SER A OG  1 
ATOM   132  N  N   . PRO A 1 31  ? 8.469   -31.155 -37.763 1.00 78.69  ? 1408 PRO A N   1 
ATOM   133  C  CA  . PRO A 1 31  ? 9.468   -30.079 -37.877 1.00 78.78  ? 1408 PRO A CA  1 
ATOM   134  C  C   . PRO A 1 31  ? 10.855  -30.573 -38.296 1.00 88.59  ? 1408 PRO A C   1 
ATOM   135  O  O   . PRO A 1 31  ? 11.552  -29.852 -39.013 1.00 89.41  ? 1408 PRO A O   1 
ATOM   136  C  CB  . PRO A 1 31  ? 9.476   -29.460 -36.480 1.00 79.92  ? 1408 PRO A CB  1 
ATOM   137  C  CG  . PRO A 1 31  ? 8.983   -30.534 -35.584 1.00 85.57  ? 1408 PRO A CG  1 
ATOM   138  C  CD  . PRO A 1 31  ? 7.949   -31.242 -36.380 1.00 80.48  ? 1408 PRO A CD  1 
ATOM   139  N  N   . GLY A 1 32  ? 11.217  -31.796 -37.870 1.00 87.51  ? 1409 GLY A N   1 
ATOM   140  C  CA  . GLY A 1 32  ? 12.474  -32.446 -38.219 1.00 89.36  ? 1409 GLY A CA  1 
ATOM   141  C  C   . GLY A 1 32  ? 12.621  -32.611 -39.721 1.00 92.51  ? 1409 GLY A C   1 
ATOM   142  O  O   . GLY A 1 32  ? 13.645  -32.220 -40.302 1.00 92.57  ? 1409 GLY A O   1 
ATOM   143  N  N   . CYS A 1 33  ? 11.549  -33.119 -40.367 1.00 87.86  ? 1410 CYS A N   1 
ATOM   144  C  CA  . CYS A 1 33  ? 11.506  -33.325 -41.811 1.00 87.86  ? 1410 CYS A CA  1 
ATOM   145  C  C   . CYS A 1 33  ? 11.052  -32.070 -42.597 1.00 86.19  ? 1410 CYS A C   1 
ATOM   146  O  O   . CYS A 1 33  ? 10.748  -32.157 -43.786 1.00 85.28  ? 1410 CYS A O   1 
ATOM   147  C  CB  . CYS A 1 33  ? 10.673  -34.554 -42.151 1.00 90.04  ? 1410 CYS A CB  1 
ATOM   148  S  SG  . CYS A 1 33  ? 11.472  -36.130 -41.728 1.00 98.50  ? 1410 CYS A SG  1 
ATOM   149  N  N   . GLY A 1 34  ? 11.070  -30.917 -41.922 1.00 78.92  ? 1411 GLY A N   1 
ATOM   150  C  CA  . GLY A 1 34  ? 10.744  -29.599 -42.460 1.00 75.62  ? 1411 GLY A CA  1 
ATOM   151  C  C   . GLY A 1 34  ? 9.367   -29.465 -43.057 1.00 76.11  ? 1411 GLY A C   1 
ATOM   152  O  O   . GLY A 1 34  ? 9.205   -28.798 -44.091 1.00 75.94  ? 1411 GLY A O   1 
ATOM   153  N  N   . TRP A 1 35  ? 8.367   -30.094 -42.384 1.00 68.88  ? 1412 TRP A N   1 
ATOM   154  C  CA  . TRP A 1 35  ? 6.952   -30.131 -42.758 1.00 64.64  ? 1412 TRP A CA  1 
ATOM   155  C  C   . TRP A 1 35  ? 6.797   -30.763 -44.149 1.00 66.76  ? 1412 TRP A C   1 
ATOM   156  O  O   . TRP A 1 35  ? 6.047   -30.263 -44.985 1.00 64.73  ? 1412 TRP A O   1 
ATOM   157  C  CB  . TRP A 1 35  ? 6.322   -28.726 -42.628 1.00 59.78  ? 1412 TRP A CB  1 
ATOM   158  C  CG  . TRP A 1 35  ? 6.581   -28.060 -41.303 1.00 59.53  ? 1412 TRP A CG  1 
ATOM   159  C  CD1 . TRP A 1 35  ? 7.381   -26.976 -41.061 1.00 61.74  ? 1412 TRP A CD1 1 
ATOM   160  C  CD2 . TRP A 1 35  ? 6.087   -28.489 -40.027 1.00 59.41  ? 1412 TRP A CD2 1 
ATOM   161  N  NE1 . TRP A 1 35  ? 7.389   -26.686 -39.717 1.00 61.15  ? 1412 TRP A NE1 1 
ATOM   162  C  CE2 . TRP A 1 35  ? 6.603   -27.601 -39.060 1.00 63.16  ? 1412 TRP A CE2 1 
ATOM   163  C  CE3 . TRP A 1 35  ? 5.239   -29.533 -39.608 1.00 60.94  ? 1412 TRP A CE3 1 
ATOM   164  C  CZ2 . TRP A 1 35  ? 6.318   -27.740 -37.695 1.00 62.48  ? 1412 TRP A CZ2 1 
ATOM   165  C  CZ3 . TRP A 1 35  ? 4.954   -29.660 -38.258 1.00 62.39  ? 1412 TRP A CZ3 1 
ATOM   166  C  CH2 . TRP A 1 35  ? 5.494   -28.772 -37.317 1.00 62.53  ? 1412 TRP A CH2 1 
ATOM   167  N  N   . ASP A 1 36  ? 7.527   -31.881 -44.374 1.00 64.24  ? 1413 ASP A N   1 
ATOM   168  C  CA  . ASP A 1 36  ? 7.608   -32.647 -45.620 1.00 65.24  ? 1413 ASP A CA  1 
ATOM   169  C  C   . ASP A 1 36  ? 8.223   -31.773 -46.724 1.00 68.06  ? 1413 ASP A C   1 
ATOM   170  O  O   . ASP A 1 36  ? 7.741   -31.734 -47.846 1.00 67.17  ? 1413 ASP A O   1 
ATOM   171  C  CB  . ASP A 1 36  ? 6.246   -33.288 -45.998 1.00 67.10  ? 1413 ASP A CB  1 
ATOM   172  C  CG  . ASP A 1 36  ? 6.198   -34.106 -47.281 1.00 84.89  ? 1413 ASP A CG  1 
ATOM   173  O  OD1 . ASP A 1 36  ? 7.219   -34.730 -47.628 1.00 88.35  ? 1413 ASP A OD1 1 
ATOM   174  O  OD2 . ASP A 1 36  ? 5.139   -34.116 -47.937 1.00 93.01  ? 1413 ASP A OD2 1 
ATOM   175  N  N   . GLY A 1 37  ? 9.280   -31.061 -46.376 1.00 66.11  ? 1414 GLY A N   1 
ATOM   176  C  CA  . GLY A 1 37  ? 9.968   -30.158 -47.294 1.00 67.30  ? 1414 GLY A CA  1 
ATOM   177  C  C   . GLY A 1 37  ? 9.114   -29.005 -47.796 1.00 72.06  ? 1414 GLY A C   1 
ATOM   178  O  O   . GLY A 1 37  ? 9.242   -28.587 -48.952 1.00 71.85  ? 1414 GLY A O   1 
ATOM   179  N  N   . GLY A 1 38  ? 8.222   -28.521 -46.930 1.00 68.05  ? 1415 GLY A N   1 
ATOM   180  C  CA  . GLY A 1 38  ? 7.308   -27.430 -47.228 1.00 65.57  ? 1415 GLY A CA  1 
ATOM   181  C  C   . GLY A 1 38  ? 6.006   -27.850 -47.894 1.00 69.47  ? 1415 GLY A C   1 
ATOM   182  O  O   . GLY A 1 38  ? 5.081   -27.033 -47.932 1.00 67.89  ? 1415 GLY A O   1 
ATOM   183  N  N   . ASP A 1 39  ? 5.896   -29.117 -48.422 1.00 67.29  ? 1416 ASP A N   1 
ATOM   184  C  CA  . ASP A 1 39  ? 4.690   -29.646 -49.119 1.00 67.37  ? 1416 ASP A CA  1 
ATOM   185  C  C   . ASP A 1 39  ? 3.436   -29.680 -48.264 1.00 70.78  ? 1416 ASP A C   1 
ATOM   186  O  O   . ASP A 1 39  ? 2.326   -29.644 -48.792 1.00 70.21  ? 1416 ASP A O   1 
ATOM   187  C  CB  . ASP A 1 39  ? 4.911   -31.051 -49.714 1.00 71.14  ? 1416 ASP A CB  1 
ATOM   188  C  CG  . ASP A 1 39  ? 6.131   -31.210 -50.578 1.00 79.66  ? 1416 ASP A CG  1 
ATOM   189  O  OD1 . ASP A 1 39  ? 6.436   -30.276 -51.353 1.00 80.26  ? 1416 ASP A OD1 1 
ATOM   190  O  OD2 . ASP A 1 39  ? 6.763   -32.284 -50.509 1.00 83.85  ? 1416 ASP A OD2 1 
ATOM   191  N  N   . CYS A 1 40  ? 3.614   -29.790 -46.962 1.00 67.47  ? 1417 CYS A N   1 
ATOM   192  C  CA  . CYS A 1 40  ? 2.500   -29.831 -46.053 1.00 67.17  ? 1417 CYS A CA  1 
ATOM   193  C  C   . CYS A 1 40  ? 2.263   -28.480 -45.358 1.00 61.31  ? 1417 CYS A C   1 
ATOM   194  O  O   . CYS A 1 40  ? 1.260   -28.330 -44.675 1.00 57.39  ? 1417 CYS A O   1 
ATOM   195  C  CB  . CYS A 1 40  ? 2.644   -30.991 -45.070 1.00 71.64  ? 1417 CYS A CB  1 
ATOM   196  S  SG  . CYS A 1 40  ? 1.113   -31.947 -44.825 1.00 77.25  ? 1417 CYS A SG  1 
ATOM   197  N  N   . SER A 1 41  ? 3.158   -27.491 -45.576 1.00 54.75  ? 1418 SER A N   1 
ATOM   198  C  CA  . SER A 1 41  ? 3.043   -26.131 -45.022 1.00 51.07  ? 1418 SER A CA  1 
ATOM   199  C  C   . SER A 1 41  ? 2.874   -25.061 -46.108 1.00 52.26  ? 1418 SER A C   1 
ATOM   200  O  O   . SER A 1 41  ? 3.271   -23.904 -45.940 1.00 50.19  ? 1418 SER A O   1 
ATOM   201  C  CB  . SER A 1 41  ? 4.206   -25.797 -44.098 1.00 53.35  ? 1418 SER A CB  1 
ATOM   202  O  OG  . SER A 1 41  ? 5.436   -25.887 -44.796 1.00 62.88  ? 1418 SER A OG  1 
ATOM   203  N  N   . LEU A 1 42  ? 2.233   -25.452 -47.214 1.00 48.14  ? 1419 LEU A N   1 
ATOM   204  C  CA  . LEU A 1 42  ? 1.902   -24.593 -48.347 1.00 45.23  ? 1419 LEU A CA  1 
ATOM   205  C  C   . LEU A 1 42  ? 3.113   -23.863 -48.948 1.00 46.68  ? 1419 LEU A C   1 
ATOM   206  O  O   . LEU A 1 42  ? 2.958   -22.739 -49.388 1.00 45.61  ? 1419 LEU A O   1 
ATOM   207  C  CB  . LEU A 1 42  ? 0.773   -23.619 -47.960 1.00 42.61  ? 1419 LEU A CB  1 
ATOM   208  C  CG  . LEU A 1 42  ? -0.562  -24.236 -47.558 1.00 46.55  ? 1419 LEU A CG  1 
ATOM   209  C  CD1 . LEU A 1 42  ? -1.414  -23.247 -46.850 1.00 44.37  ? 1419 LEU A CD1 1 
ATOM   210  C  CD2 . LEU A 1 42  ? -1.288  -24.871 -48.737 1.00 51.25  ? 1419 LEU A CD2 1 
ATOM   211  N  N   . SER A 1 43  ? 4.294   -24.530 -49.021 1.00 43.28  ? 1420 SER A N   1 
ATOM   212  C  CA  . SER A 1 43  ? 5.598   -24.051 -49.543 1.00 44.23  ? 1420 SER A CA  1 
ATOM   213  C  C   . SER A 1 43  ? 6.332   -23.071 -48.610 1.00 49.77  ? 1420 SER A C   1 
ATOM   214  O  O   . SER A 1 43  ? 7.390   -22.535 -48.966 1.00 50.65  ? 1420 SER A O   1 
ATOM   215  C  CB  . SER A 1 43  ? 5.502   -23.478 -50.955 1.00 46.46  ? 1420 SER A CB  1 
ATOM   216  O  OG  . SER A 1 43  ? 5.106   -22.114 -50.958 1.00 46.27  ? 1420 SER A OG  1 
ATOM   217  N  N   . VAL A 1 44  ? 5.784   -22.862 -47.408 1.00 45.55  ? 1421 VAL A N   1 
ATOM   218  C  CA  . VAL A 1 44  ? 6.411   -22.022 -46.405 1.00 44.57  ? 1421 VAL A CA  1 
ATOM   219  C  C   . VAL A 1 44  ? 7.413   -22.931 -45.723 1.00 48.01  ? 1421 VAL A C   1 
ATOM   220  O  O   . VAL A 1 44  ? 7.025   -23.940 -45.145 1.00 46.20  ? 1421 VAL A O   1 
ATOM   221  C  CB  . VAL A 1 44  ? 5.388   -21.372 -45.432 1.00 47.48  ? 1421 VAL A CB  1 
ATOM   222  C  CG1 . VAL A 1 44  ? 6.088   -20.479 -44.402 1.00 47.45  ? 1421 VAL A CG1 1 
ATOM   223  C  CG2 . VAL A 1 44  ? 4.341   -20.560 -46.203 1.00 46.17  ? 1421 VAL A CG2 1 
ATOM   224  N  N   . GLY A 1 45  ? 8.693   -22.595 -45.860 1.00 47.29  ? 1422 GLY A N   1 
ATOM   225  C  CA  . GLY A 1 45  ? 9.785   -23.373 -45.284 1.00 50.31  ? 1422 GLY A CA  1 
ATOM   226  C  C   . GLY A 1 45  ? 9.601   -23.655 -43.802 1.00 55.54  ? 1422 GLY A C   1 
ATOM   227  O  O   . GLY A 1 45  ? 9.409   -24.821 -43.403 1.00 57.02  ? 1422 GLY A O   1 
ATOM   228  N  N   . ASP A 1 46  ? 9.640   -22.559 -42.989 1.00 49.23  ? 1423 ASP A N   1 
ATOM   229  C  CA  . ASP A 1 46  ? 9.429   -22.593 -41.545 1.00 46.87  ? 1423 ASP A CA  1 
ATOM   230  C  C   . ASP A 1 46  ? 8.486   -21.467 -41.175 1.00 45.82  ? 1423 ASP A C   1 
ATOM   231  O  O   . ASP A 1 46  ? 8.920   -20.319 -41.098 1.00 43.20  ? 1423 ASP A O   1 
ATOM   232  C  CB  . ASP A 1 46  ? 10.762  -22.504 -40.756 1.00 49.60  ? 1423 ASP A CB  1 
ATOM   233  C  CG  . ASP A 1 46  ? 10.630  -22.663 -39.252 1.00 52.78  ? 1423 ASP A CG  1 
ATOM   234  O  OD1 . ASP A 1 46  ? 9.612   -23.235 -38.801 1.00 57.17  ? 1423 ASP A OD1 1 
ATOM   235  O  OD2 . ASP A 1 46  ? 11.566  -22.263 -38.529 1.00 46.22  ? 1423 ASP A OD2 1 
ATOM   236  N  N   . PRO A 1 47  ? 7.172   -21.756 -40.981 1.00 41.44  ? 1424 PRO A N   1 
ATOM   237  C  CA  . PRO A 1 47  ? 6.235   -20.681 -40.613 1.00 39.69  ? 1424 PRO A CA  1 
ATOM   238  C  C   . PRO A 1 47  ? 6.641   -19.975 -39.314 1.00 48.77  ? 1424 PRO A C   1 
ATOM   239  O  O   . PRO A 1 47  ? 6.382   -18.783 -39.165 1.00 48.24  ? 1424 PRO A O   1 
ATOM   240  C  CB  . PRO A 1 47  ? 4.891   -21.412 -40.500 1.00 39.65  ? 1424 PRO A CB  1 
ATOM   241  C  CG  . PRO A 1 47  ? 5.033   -22.580 -41.403 1.00 44.85  ? 1424 PRO A CG  1 
ATOM   242  C  CD  . PRO A 1 47  ? 6.454   -23.037 -41.127 1.00 42.67  ? 1424 PRO A CD  1 
ATOM   243  N  N   . TRP A 1 48  ? 7.364   -20.688 -38.425 1.00 50.09  ? 1425 TRP A N   1 
ATOM   244  C  CA  . TRP A 1 48  ? 7.841   -20.182 -37.129 1.00 51.74  ? 1425 TRP A CA  1 
ATOM   245  C  C   . TRP A 1 48  ? 9.279   -19.663 -37.164 1.00 57.02  ? 1425 TRP A C   1 
ATOM   246  O  O   . TRP A 1 48  ? 9.830   -19.449 -36.097 1.00 56.14  ? 1425 TRP A O   1 
ATOM   247  C  CB  . TRP A 1 48  ? 7.714   -21.296 -36.052 1.00 52.50  ? 1425 TRP A CB  1 
ATOM   248  C  CG  . TRP A 1 48  ? 6.302   -21.715 -35.741 1.00 53.29  ? 1425 TRP A CG  1 
ATOM   249  C  CD1 . TRP A 1 48  ? 5.499   -21.213 -34.759 1.00 55.35  ? 1425 TRP A CD1 1 
ATOM   250  C  CD2 . TRP A 1 48  ? 5.540   -22.742 -36.396 1.00 53.59  ? 1425 TRP A CD2 1 
ATOM   251  N  NE1 . TRP A 1 48  ? 4.276   -21.833 -34.782 1.00 54.36  ? 1425 TRP A NE1 1 
ATOM   252  C  CE2 . TRP A 1 48  ? 4.266   -22.766 -35.788 1.00 56.66  ? 1425 TRP A CE2 1 
ATOM   253  C  CE3 . TRP A 1 48  ? 5.810   -23.645 -37.445 1.00 56.11  ? 1425 TRP A CE3 1 
ATOM   254  C  CZ2 . TRP A 1 48  ? 3.254   -23.642 -36.200 1.00 56.29  ? 1425 TRP A CZ2 1 
ATOM   255  C  CZ3 . TRP A 1 48  ? 4.802   -24.508 -37.858 1.00 58.11  ? 1425 TRP A CZ3 1 
ATOM   256  C  CH2 . TRP A 1 48  ? 3.541   -24.501 -37.238 1.00 57.91  ? 1425 TRP A CH2 1 
ATOM   257  N  N   . ARG A 1 49  ? 9.873   -19.422 -38.364 1.00 55.88  ? 1426 ARG A N   1 
ATOM   258  C  CA  . ARG A 1 49  ? 11.299  -19.035 -38.555 1.00 56.72  ? 1426 ARG A CA  1 
ATOM   259  C  C   . ARG A 1 49  ? 11.777  -17.811 -37.743 1.00 56.14  ? 1426 ARG A C   1 
ATOM   260  O  O   . ARG A 1 49  ? 12.971  -17.716 -37.472 1.00 56.34  ? 1426 ARG A O   1 
ATOM   261  C  CB  . ARG A 1 49  ? 11.684  -18.894 -40.052 1.00 59.43  ? 1426 ARG A CB  1 
ATOM   262  C  CG  . ARG A 1 49  ? 11.781  -17.477 -40.647 1.00 69.29  ? 1426 ARG A CG  1 
ATOM   263  C  CD  . ARG A 1 49  ? 10.538  -17.025 -41.398 1.00 84.07  ? 1426 ARG A CD  1 
ATOM   264  N  NE  . ARG A 1 49  ? 10.170  -17.969 -42.467 1.00 112.73 ? 1426 ARG A NE  1 
ATOM   265  C  CZ  . ARG A 1 49  ? 9.216   -17.769 -43.379 1.00 130.33 ? 1426 ARG A CZ  1 
ATOM   266  N  NH1 . ARG A 1 49  ? 8.950   -18.703 -44.291 1.00 124.91 ? 1426 ARG A NH1 1 
ATOM   267  N  NH2 . ARG A 1 49  ? 8.531   -16.629 -43.394 1.00 104.76 ? 1426 ARG A NH2 1 
ATOM   268  N  N   . GLN A 1 50  ? 10.876  -16.925 -37.331 1.00 49.40  ? 1427 GLN A N   1 
ATOM   269  C  CA  . GLN A 1 50  ? 11.251  -15.737 -36.540 1.00 48.04  ? 1427 GLN A CA  1 
ATOM   270  C  C   . GLN A 1 50  ? 10.838  -15.886 -35.068 1.00 49.32  ? 1427 GLN A C   1 
ATOM   271  O  O   . GLN A 1 50  ? 11.211  -15.064 -34.230 1.00 47.03  ? 1427 GLN A O   1 
ATOM   272  C  CB  . GLN A 1 50  ? 10.635  -14.458 -37.157 1.00 47.86  ? 1427 GLN A CB  1 
ATOM   273  C  CG  . GLN A 1 50  ? 11.060  -14.227 -38.605 1.00 62.01  ? 1427 GLN A CG  1 
ATOM   274  C  CD  . GLN A 1 50  ? 10.608  -12.926 -39.219 1.00 86.34  ? 1427 GLN A CD  1 
ATOM   275  O  OE1 . GLN A 1 50  ? 9.655   -12.267 -38.779 1.00 79.83  ? 1427 GLN A OE1 1 
ATOM   276  N  NE2 . GLN A 1 50  ? 11.255  -12.572 -40.320 1.00 84.85  ? 1427 GLN A NE2 1 
ATOM   277  N  N   . CYS A 1 51  ? 10.049  -16.944 -34.766 1.00 46.31  ? 1428 CYS A N   1 
ATOM   278  C  CA  . CYS A 1 51  ? 9.541   -17.243 -33.425 1.00 45.04  ? 1428 CYS A CA  1 
ATOM   279  C  C   . CYS A 1 51  ? 10.708  -17.476 -32.501 1.00 52.76  ? 1428 CYS A C   1 
ATOM   280  O  O   . CYS A 1 51  ? 11.623  -18.206 -32.864 1.00 54.54  ? 1428 CYS A O   1 
ATOM   281  C  CB  . CYS A 1 51  ? 8.574   -18.421 -33.455 1.00 43.36  ? 1428 CYS A CB  1 
ATOM   282  S  SG  . CYS A 1 51  ? 7.821   -18.800 -31.859 1.00 46.89  ? 1428 CYS A SG  1 
ATOM   283  N  N   . GLU A 1 52  ? 10.739  -16.750 -31.376 1.00 51.46  ? 1429 GLU A N   1 
ATOM   284  C  CA  . GLU A 1 52  ? 11.850  -16.797 -30.430 1.00 55.21  ? 1429 GLU A CA  1 
ATOM   285  C  C   . GLU A 1 52  ? 11.874  -18.076 -29.570 1.00 66.76  ? 1429 GLU A C   1 
ATOM   286  O  O   . GLU A 1 52  ? 12.956  -18.452 -29.109 1.00 68.85  ? 1429 GLU A O   1 
ATOM   287  C  CB  . GLU A 1 52  ? 11.944  -15.521 -29.576 1.00 56.27  ? 1429 GLU A CB  1 
ATOM   288  C  CG  . GLU A 1 52  ? 10.736  -15.194 -28.712 1.00 62.43  ? 1429 GLU A CG  1 
ATOM   289  C  CD  . GLU A 1 52  ? 9.560   -14.488 -29.355 1.00 63.87  ? 1429 GLU A CD  1 
ATOM   290  O  OE1 . GLU A 1 52  ? 9.613   -14.214 -30.574 1.00 76.64  ? 1429 GLU A OE1 1 
ATOM   291  O  OE2 . GLU A 1 52  ? 8.561   -14.247 -28.639 1.00 33.27  ? 1429 GLU A OE2 1 
ATOM   292  N  N   . ALA A 1 53  ? 10.724  -18.773 -29.413 1.00 65.90  ? 1430 ALA A N   1 
ATOM   293  C  CA  . ALA A 1 53  ? 10.642  -20.031 -28.667 1.00 68.65  ? 1430 ALA A CA  1 
ATOM   294  C  C   . ALA A 1 53  ? 10.468  -21.210 -29.636 1.00 75.20  ? 1430 ALA A C   1 
ATOM   295  O  O   . ALA A 1 53  ? 9.549   -21.213 -30.463 1.00 73.44  ? 1430 ALA A O   1 
ATOM   296  C  CB  . ALA A 1 53  ? 9.508   -19.971 -27.665 1.00 69.13  ? 1430 ALA A CB  1 
ATOM   297  N  N   . LEU A 1 54  ? 11.361  -22.200 -29.537 1.00 75.62  ? 1431 LEU A N   1 
ATOM   298  C  CA  . LEU A 1 54  ? 11.424  -23.320 -30.470 1.00 76.66  ? 1431 LEU A CA  1 
ATOM   299  C  C   . LEU A 1 54  ? 10.252  -24.298 -30.425 1.00 79.43  ? 1431 LEU A C   1 
ATOM   300  O  O   . LEU A 1 54  ? 9.902   -24.840 -31.478 1.00 80.48  ? 1431 LEU A O   1 
ATOM   301  C  CB  . LEU A 1 54  ? 12.762  -24.086 -30.348 1.00 79.37  ? 1431 LEU A CB  1 
ATOM   302  C  CG  . LEU A 1 54  ? 13.997  -23.502 -31.123 1.00 84.93  ? 1431 LEU A CG  1 
ATOM   303  C  CD1 . LEU A 1 54  ? 13.881  -23.652 -32.656 1.00 84.65  ? 1431 LEU A CD1 1 
ATOM   304  C  CD2 . LEU A 1 54  ? 14.335  -22.059 -30.728 1.00 85.68  ? 1431 LEU A CD2 1 
ATOM   305  N  N   . GLN A 1 55  ? 9.650   -24.547 -29.264 1.00 72.15  ? 1432 GLN A N   1 
ATOM   306  C  CA  . GLN A 1 55  ? 8.606   -25.567 -29.252 1.00 70.32  ? 1432 GLN A CA  1 
ATOM   307  C  C   . GLN A 1 55  ? 7.179   -24.981 -29.293 1.00 66.63  ? 1432 GLN A C   1 
ATOM   308  O  O   . GLN A 1 55  ? 6.230   -25.590 -28.771 1.00 66.24  ? 1432 GLN A O   1 
ATOM   309  C  CB  . GLN A 1 55  ? 8.843   -26.533 -28.067 1.00 74.59  ? 1432 GLN A CB  1 
ATOM   310  C  CG  . GLN A 1 55  ? 9.884   -27.701 -28.261 1.00 88.79  ? 1432 GLN A CG  1 
ATOM   311  C  CD  . GLN A 1 55  ? 11.082  -27.633 -29.225 1.00 104.94 ? 1432 GLN A CD  1 
ATOM   312  O  OE1 . GLN A 1 55  ? 12.250  -27.512 -28.815 1.00 105.14 ? 1432 GLN A OE1 1 
ATOM   313  N  NE2 . GLN A 1 55  ? 10.851  -27.961 -30.485 1.00 86.96  ? 1432 GLN A NE2 1 
ATOM   314  N  N   . CYS A 1 56  ? 7.018   -23.854 -30.021 1.00 57.97  ? 1433 CYS A N   1 
ATOM   315  C  CA  . CYS A 1 56  ? 5.709   -23.194 -30.139 1.00 54.63  ? 1433 CYS A CA  1 
ATOM   316  C  C   . CYS A 1 56  ? 4.701   -23.939 -31.048 1.00 61.00  ? 1433 CYS A C   1 
ATOM   317  O  O   . CYS A 1 56  ? 3.512   -23.992 -30.706 1.00 59.58  ? 1433 CYS A O   1 
ATOM   318  C  CB  . CYS A 1 56  ? 5.844   -21.720 -30.516 1.00 51.27  ? 1433 CYS A CB  1 
ATOM   319  S  SG  . CYS A 1 56  ? 6.255   -20.653 -29.107 1.00 54.27  ? 1433 CYS A SG  1 
ATOM   320  N  N   . TRP A 1 57  ? 5.178   -24.569 -32.138 1.00 60.18  ? 1434 TRP A N   1 
ATOM   321  C  CA  . TRP A 1 57  ? 4.330   -25.344 -33.041 1.00 60.96  ? 1434 TRP A CA  1 
ATOM   322  C  C   . TRP A 1 57  ? 3.531   -26.444 -32.331 1.00 65.23  ? 1434 TRP A C   1 
ATOM   323  O  O   . TRP A 1 57  ? 2.419   -26.749 -32.765 1.00 64.93  ? 1434 TRP A O   1 
ATOM   324  C  CB  . TRP A 1 57  ? 5.136   -25.950 -34.188 1.00 61.80  ? 1434 TRP A CB  1 
ATOM   325  C  CG  . TRP A 1 57  ? 6.209   -26.913 -33.764 1.00 66.19  ? 1434 TRP A CG  1 
ATOM   326  C  CD1 . TRP A 1 57  ? 6.048   -28.179 -33.277 1.00 70.94  ? 1434 TRP A CD1 1 
ATOM   327  C  CD2 . TRP A 1 57  ? 7.618   -26.709 -33.893 1.00 67.68  ? 1434 TRP A CD2 1 
ATOM   328  N  NE1 . TRP A 1 57  ? 7.272   -28.737 -32.996 1.00 72.78  ? 1434 TRP A NE1 1 
ATOM   329  C  CE2 . TRP A 1 57  ? 8.256   -27.869 -33.394 1.00 74.27  ? 1434 TRP A CE2 1 
ATOM   330  C  CE3 . TRP A 1 57  ? 8.412   -25.634 -34.355 1.00 68.43  ? 1434 TRP A CE3 1 
ATOM   331  C  CZ2 . TRP A 1 57  ? 9.654   -27.983 -33.331 1.00 75.67  ? 1434 TRP A CZ2 1 
ATOM   332  C  CZ3 . TRP A 1 57  ? 9.792   -25.770 -34.346 1.00 71.69  ? 1434 TRP A CZ3 1 
ATOM   333  C  CH2 . TRP A 1 57  ? 10.402  -26.928 -33.829 1.00 74.96  ? 1434 TRP A CH2 1 
ATOM   334  N  N   . ARG A 1 58  ? 4.099   -27.040 -31.248 1.00 62.31  ? 1435 ARG A N   1 
ATOM   335  C  CA  . ARG A 1 58  ? 3.463   -28.102 -30.456 1.00 63.44  ? 1435 ARG A CA  1 
ATOM   336  C  C   . ARG A 1 58  ? 2.227   -27.575 -29.725 1.00 66.89  ? 1435 ARG A C   1 
ATOM   337  O  O   . ARG A 1 58  ? 1.299   -28.345 -29.423 1.00 66.99  ? 1435 ARG A O   1 
ATOM   338  C  CB  . ARG A 1 58  ? 4.423   -28.667 -29.398 1.00 65.11  ? 1435 ARG A CB  1 
ATOM   339  C  CG  . ARG A 1 58  ? 5.744   -29.203 -29.901 1.00 74.28  ? 1435 ARG A CG  1 
ATOM   340  C  CD  . ARG A 1 58  ? 6.260   -30.288 -28.959 1.00 80.16  ? 1435 ARG A CD  1 
ATOM   341  N  NE  . ARG A 1 58  ? 7.718   -30.310 -28.853 1.00 84.53  ? 1435 ARG A NE  1 
ATOM   342  C  CZ  . ARG A 1 58  ? 8.531   -30.916 -29.714 1.00 98.03  ? 1435 ARG A CZ  1 
ATOM   343  N  NH1 . ARG A 1 58  ? 8.037   -31.554 -30.769 1.00 87.24  ? 1435 ARG A NH1 1 
ATOM   344  N  NH2 . ARG A 1 58  ? 9.845   -30.873 -29.539 1.00 83.66  ? 1435 ARG A NH2 1 
ATOM   345  N  N   . LEU A 1 59  ? 2.256   -26.266 -29.407 1.00 61.63  ? 1436 LEU A N   1 
ATOM   346  C  CA  . LEU A 1 59  ? 1.221   -25.553 -28.668 1.00 60.19  ? 1436 LEU A CA  1 
ATOM   347  C  C   . LEU A 1 59  ? 0.275   -24.748 -29.590 1.00 63.40  ? 1436 LEU A C   1 
ATOM   348  O  O   . LEU A 1 59  ? -0.662  -24.107 -29.101 1.00 61.92  ? 1436 LEU A O   1 
ATOM   349  C  CB  . LEU A 1 59  ? 1.908   -24.622 -27.648 1.00 60.05  ? 1436 LEU A CB  1 
ATOM   350  C  CG  . LEU A 1 59  ? 2.761   -25.271 -26.557 1.00 65.62  ? 1436 LEU A CG  1 
ATOM   351  C  CD1 . LEU A 1 59  ? 3.833   -24.319 -26.083 1.00 66.15  ? 1436 LEU A CD1 1 
ATOM   352  C  CD2 . LEU A 1 59  ? 1.922   -25.717 -25.399 1.00 66.88  ? 1436 LEU A CD2 1 
ATOM   353  N  N   . PHE A 1 60  ? 0.532   -24.767 -30.912 1.00 60.53  ? 1437 PHE A N   1 
ATOM   354  C  CA  . PHE A 1 60  ? -0.245  -24.003 -31.900 1.00 58.63  ? 1437 PHE A CA  1 
ATOM   355  C  C   . PHE A 1 60  ? -1.653  -24.554 -32.126 1.00 63.54  ? 1437 PHE A C   1 
ATOM   356  O  O   . PHE A 1 60  ? -2.601  -23.781 -32.317 1.00 62.01  ? 1437 PHE A O   1 
ATOM   357  C  CB  . PHE A 1 60  ? 0.537   -23.918 -33.215 1.00 59.34  ? 1437 PHE A CB  1 
ATOM   358  C  CG  . PHE A 1 60  ? -0.032  -23.023 -34.289 1.00 57.64  ? 1437 PHE A CG  1 
ATOM   359  C  CD1 . PHE A 1 60  ? 0.231   -21.666 -34.294 1.00 57.91  ? 1437 PHE A CD1 1 
ATOM   360  C  CD2 . PHE A 1 60  ? -0.768  -23.554 -35.338 1.00 59.19  ? 1437 PHE A CD2 1 
ATOM   361  C  CE1 . PHE A 1 60  ? -0.249  -20.850 -35.322 1.00 57.69  ? 1437 PHE A CE1 1 
ATOM   362  C  CE2 . PHE A 1 60  ? -1.269  -22.737 -36.352 1.00 60.33  ? 1437 PHE A CE2 1 
ATOM   363  C  CZ  . PHE A 1 60  ? -1.005  -21.390 -36.340 1.00 57.23  ? 1437 PHE A CZ  1 
ATOM   364  N  N   . ASN A 1 61  ? -1.783  -25.890 -32.040 1.00 61.92  ? 1438 ASN A N   1 
ATOM   365  C  CA  . ASN A 1 61  ? -2.988  -26.688 -32.297 1.00 61.96  ? 1438 ASN A CA  1 
ATOM   366  C  C   . ASN A 1 61  ? -3.869  -26.987 -31.064 1.00 65.13  ? 1438 ASN A C   1 
ATOM   367  O  O   . ASN A 1 61  ? -5.004  -27.431 -31.251 1.00 64.87  ? 1438 ASN A O   1 
ATOM   368  C  CB  . ASN A 1 61  ? -2.525  -27.994 -32.976 1.00 69.22  ? 1438 ASN A CB  1 
ATOM   369  C  CG  . ASN A 1 61  ? -3.537  -29.115 -33.261 1.00 116.61 ? 1438 ASN A CG  1 
ATOM   370  O  OD1 . ASN A 1 61  ? -3.707  -30.011 -32.410 1.00 116.63 ? 1438 ASN A OD1 1 
ATOM   371  N  ND2 . ASN A 1 61  ? -4.176  -29.079 -34.489 1.00 112.45 ? 1438 ASN A ND2 1 
ATOM   372  N  N   . ASN A 1 62  ? -3.419  -26.639 -29.837 1.00 61.05  ? 1439 ASN A N   1 
ATOM   373  C  CA  . ASN A 1 62  ? -4.070  -26.997 -28.571 1.00 61.63  ? 1439 ASN A CA  1 
ATOM   374  C  C   . ASN A 1 62  ? -5.359  -26.234 -28.098 1.00 64.03  ? 1439 ASN A C   1 
ATOM   375  O  O   . ASN A 1 62  ? -5.843  -26.565 -27.010 1.00 65.07  ? 1439 ASN A O   1 
ATOM   376  C  CB  . ASN A 1 62  ? -3.041  -26.972 -27.432 1.00 64.13  ? 1439 ASN A CB  1 
ATOM   377  C  CG  . ASN A 1 62  ? -2.516  -25.631 -26.972 1.00 78.83  ? 1439 ASN A CG  1 
ATOM   378  O  OD1 . ASN A 1 62  ? -2.939  -24.561 -27.402 1.00 73.46  ? 1439 ASN A OD1 1 
ATOM   379  N  ND2 . ASN A 1 62  ? -1.587  -25.672 -26.040 1.00 71.18  ? 1439 ASN A ND2 1 
ATOM   380  N  N   . SER A 1 63  ? -5.927  -25.279 -28.873 1.00 58.91  ? 1440 SER A N   1 
ATOM   381  C  CA  . SER A 1 63  ? -7.148  -24.540 -28.489 1.00 58.43  ? 1440 SER A CA  1 
ATOM   382  C  C   . SER A 1 63  ? -7.035  -23.853 -27.110 1.00 62.80  ? 1440 SER A C   1 
ATOM   383  O  O   . SER A 1 63  ? -8.039  -23.713 -26.396 1.00 64.20  ? 1440 SER A O   1 
ATOM   384  C  CB  . SER A 1 63  ? -8.378  -25.450 -28.529 1.00 64.69  ? 1440 SER A CB  1 
ATOM   385  O  OG  . SER A 1 63  ? -8.689  -25.853 -29.851 1.00 77.70  ? 1440 SER A OG  1 
ATOM   386  N  N   . ARG A 1 64  ? -5.803  -23.458 -26.722 1.00 57.10  ? 1441 ARG A N   1 
ATOM   387  C  CA  . ARG A 1 64  ? -5.570  -22.783 -25.452 1.00 56.03  ? 1441 ARG A CA  1 
ATOM   388  C  C   . ARG A 1 64  ? -4.472  -21.740 -25.585 1.00 56.45  ? 1441 ARG A C   1 
ATOM   389  O  O   . ARG A 1 64  ? -3.577  -21.865 -26.425 1.00 54.01  ? 1441 ARG A O   1 
ATOM   390  C  CB  . ARG A 1 64  ? -5.344  -23.808 -24.302 1.00 56.60  ? 1441 ARG A CB  1 
ATOM   391  C  CG  . ARG A 1 64  ? -4.137  -23.603 -23.394 1.00 54.60  ? 1441 ARG A CG  1 
ATOM   392  C  CD  . ARG A 1 64  ? -3.621  -24.921 -22.904 1.00 48.39  ? 1441 ARG A CD  1 
ATOM   393  N  NE  . ARG A 1 64  ? -2.175  -24.868 -22.704 1.00 42.84  ? 1441 ARG A NE  1 
ATOM   394  C  CZ  . ARG A 1 64  ? -1.356  -25.909 -22.818 1.00 51.29  ? 1441 ARG A CZ  1 
ATOM   395  N  NH1 . ARG A 1 64  ? -1.829  -27.103 -23.150 1.00 44.78  ? 1441 ARG A NH1 1 
ATOM   396  N  NH2 . ARG A 1 64  ? -0.058  -25.760 -22.617 1.00 39.71  ? 1441 ARG A NH2 1 
ATOM   397  N  N   . CYS A 1 65  ? -4.583  -20.682 -24.780 1.00 53.23  ? 1442 CYS A N   1 
ATOM   398  C  CA  . CYS A 1 65  ? -3.622  -19.599 -24.788 1.00 52.29  ? 1442 CYS A CA  1 
ATOM   399  C  C   . CYS A 1 65  ? -2.299  -20.014 -24.156 1.00 51.84  ? 1442 CYS A C   1 
ATOM   400  O  O   . CYS A 1 65  ? -2.255  -20.514 -23.034 1.00 51.70  ? 1442 CYS A O   1 
ATOM   401  C  CB  . CYS A 1 65  ? -4.200  -18.346 -24.140 1.00 53.67  ? 1442 CYS A CB  1 
ATOM   402  S  SG  . CYS A 1 65  ? -3.036  -16.958 -24.033 1.00 58.44  ? 1442 CYS A SG  1 
ATOM   403  N  N   . ASP A 1 66  ? -1.228  -19.831 -24.919 1.00 45.76  ? 1443 ASP A N   1 
ATOM   404  C  CA  . ASP A 1 66  ? 0.148   -20.074 -24.510 1.00 45.98  ? 1443 ASP A CA  1 
ATOM   405  C  C   . ASP A 1 66  ? 0.860   -18.735 -24.707 1.00 47.34  ? 1443 ASP A C   1 
ATOM   406  O  O   . ASP A 1 66  ? 1.293   -18.407 -25.814 1.00 44.72  ? 1443 ASP A O   1 
ATOM   407  C  CB  . ASP A 1 66  ? 0.791   -21.228 -25.300 1.00 47.25  ? 1443 ASP A CB  1 
ATOM   408  C  CG  . ASP A 1 66  ? 0.154   -22.560 -25.032 1.00 39.33  ? 1443 ASP A CG  1 
ATOM   409  O  OD1 . ASP A 1 66  ? 0.198   -23.011 -23.876 1.00 36.95  ? 1443 ASP A OD1 1 
ATOM   410  O  OD2 . ASP A 1 66  ? -0.341  -23.167 -25.985 1.00 44.41  ? 1443 ASP A OD2 1 
ATOM   411  N  N   . PRO A 1 67  ? 0.863   -17.908 -23.644 1.00 44.92  ? 1444 PRO A N   1 
ATOM   412  C  CA  . PRO A 1 67  ? 1.384   -16.547 -23.766 1.00 44.42  ? 1444 PRO A CA  1 
ATOM   413  C  C   . PRO A 1 67  ? 2.804   -16.412 -24.313 1.00 48.47  ? 1444 PRO A C   1 
ATOM   414  O  O   . PRO A 1 67  ? 3.079   -15.436 -25.020 1.00 47.48  ? 1444 PRO A O   1 
ATOM   415  C  CB  . PRO A 1 67  ? 1.247   -16.014 -22.346 1.00 47.63  ? 1444 PRO A CB  1 
ATOM   416  C  CG  . PRO A 1 67  ? 0.095   -16.741 -21.785 1.00 52.54  ? 1444 PRO A CG  1 
ATOM   417  C  CD  . PRO A 1 67  ? 0.305   -18.129 -22.293 1.00 48.38  ? 1444 PRO A CD  1 
ATOM   418  N  N   . ALA A 1 68  ? 3.677   -17.396 -24.053 1.00 45.49  ? 1445 ALA A N   1 
ATOM   419  C  CA  . ALA A 1 68  ? 5.042   -17.352 -24.554 1.00 45.75  ? 1445 ALA A CA  1 
ATOM   420  C  C   . ALA A 1 68  ? 5.103   -17.515 -26.078 1.00 48.85  ? 1445 ALA A C   1 
ATOM   421  O  O   . ALA A 1 68  ? 6.085   -17.110 -26.699 1.00 49.01  ? 1445 ALA A O   1 
ATOM   422  C  CB  . ALA A 1 68  ? 5.873   -18.401 -23.863 1.00 48.97  ? 1445 ALA A CB  1 
ATOM   423  N  N   . CYS A 1 69  ? 4.020   -18.031 -26.682 1.00 44.67  ? 1446 CYS A N   1 
ATOM   424  C  CA  . CYS A 1 69  ? 3.897   -18.253 -28.122 1.00 43.74  ? 1446 CYS A CA  1 
ATOM   425  C  C   . CYS A 1 69  ? 2.945   -17.263 -28.800 1.00 42.01  ? 1446 CYS A C   1 
ATOM   426  O  O   . CYS A 1 69  ? 2.545   -17.499 -29.948 1.00 40.46  ? 1446 CYS A O   1 
ATOM   427  C  CB  . CYS A 1 69  ? 3.468   -19.696 -28.367 1.00 46.39  ? 1446 CYS A CB  1 
ATOM   428  S  SG  . CYS A 1 69  ? 4.687   -20.932 -27.819 1.00 53.98  ? 1446 CYS A SG  1 
ATOM   429  N  N   . SER A 1 70  ? 2.584   -16.156 -28.100 1.00 35.31  ? 1447 SER A N   1 
ATOM   430  C  CA  . SER A 1 70  ? 1.579   -15.219 -28.580 1.00 31.96  ? 1447 SER A CA  1 
ATOM   431  C  C   . SER A 1 70  ? 2.091   -14.050 -29.422 1.00 32.17  ? 1447 SER A C   1 
ATOM   432  O  O   . SER A 1 70  ? 1.260   -13.370 -30.029 1.00 32.80  ? 1447 SER A O   1 
ATOM   433  C  CB  . SER A 1 70  ? 0.717   -14.714 -27.428 1.00 35.71  ? 1447 SER A CB  1 
ATOM   434  O  OG  . SER A 1 70  ? 1.432   -13.902 -26.518 1.00 42.52  ? 1447 SER A OG  1 
ATOM   435  N  N   . SER A 1 71  ? 3.412   -13.860 -29.541 1.00 26.00  ? 1448 SER A N   1 
ATOM   436  C  CA  . SER A 1 71  ? 4.001   -12.773 -30.347 1.00 24.65  ? 1448 SER A CA  1 
ATOM   437  C  C   . SER A 1 71  ? 3.668   -12.886 -31.843 1.00 28.15  ? 1448 SER A C   1 
ATOM   438  O  O   . SER A 1 71  ? 3.313   -13.989 -32.282 1.00 28.64  ? 1448 SER A O   1 
ATOM   439  C  CB  . SER A 1 71  ? 5.515   -12.721 -30.158 1.00 29.26  ? 1448 SER A CB  1 
ATOM   440  O  OG  . SER A 1 71  ? 6.166   -13.817 -30.774 1.00 38.94  ? 1448 SER A OG  1 
ATOM   441  N  N   . PRO A 1 72  ? 3.739   -11.794 -32.663 1.00 24.48  ? 1449 PRO A N   1 
ATOM   442  C  CA  . PRO A 1 72  ? 3.453   -11.958 -34.105 1.00 23.72  ? 1449 PRO A CA  1 
ATOM   443  C  C   . PRO A 1 72  ? 4.417   -12.956 -34.786 1.00 28.33  ? 1449 PRO A C   1 
ATOM   444  O  O   . PRO A 1 72  ? 3.986   -13.688 -35.678 1.00 27.13  ? 1449 PRO A O   1 
ATOM   445  C  CB  . PRO A 1 72  ? 3.578   -10.535 -34.659 1.00 24.30  ? 1449 PRO A CB  1 
ATOM   446  C  CG  . PRO A 1 72  ? 3.504   -9.642  -33.496 1.00 27.87  ? 1449 PRO A CG  1 
ATOM   447  C  CD  . PRO A 1 72  ? 4.078   -10.388 -32.358 1.00 25.10  ? 1449 PRO A CD  1 
ATOM   448  N  N   . ALA A 1 73  ? 5.701   -13.019 -34.311 1.00 26.38  ? 1450 ALA A N   1 
ATOM   449  C  CA  . ALA A 1 73  ? 6.760   -13.918 -34.810 1.00 27.67  ? 1450 ALA A CA  1 
ATOM   450  C  C   . ALA A 1 73  ? 6.368   -15.374 -34.597 1.00 36.16  ? 1450 ALA A C   1 
ATOM   451  O  O   . ALA A 1 73  ? 6.705   -16.232 -35.407 1.00 35.68  ? 1450 ALA A O   1 
ATOM   452  C  CB  . ALA A 1 73  ? 8.078   -13.627 -34.108 1.00 29.00  ? 1450 ALA A CB  1 
ATOM   453  N  N   . CYS A 1 74  ? 5.624   -15.627 -33.503 1.00 35.85  ? 1451 CYS A N   1 
ATOM   454  C  CA  . CYS A 1 74  ? 5.114   -16.915 -33.054 1.00 36.39  ? 1451 CYS A CA  1 
ATOM   455  C  C   . CYS A 1 74  ? 3.653   -17.152 -33.492 1.00 39.69  ? 1451 CYS A C   1 
ATOM   456  O  O   . CYS A 1 74  ? 2.953   -18.000 -32.942 1.00 40.61  ? 1451 CYS A O   1 
ATOM   457  C  CB  . CYS A 1 74  ? 5.319   -17.086 -31.551 1.00 38.36  ? 1451 CYS A CB  1 
ATOM   458  S  SG  . CYS A 1 74  ? 7.057   -17.086 -31.050 1.00 44.99  ? 1451 CYS A SG  1 
ATOM   459  N  N   . LEU A 1 75  ? 3.237   -16.447 -34.542 1.00 35.47  ? 1452 LEU A N   1 
ATOM   460  C  CA  . LEU A 1 75  ? 1.949   -16.552 -35.238 1.00 35.17  ? 1452 LEU A CA  1 
ATOM   461  C  C   . LEU A 1 75  ? 0.713   -16.490 -34.300 1.00 42.99  ? 1452 LEU A C   1 
ATOM   462  O  O   . LEU A 1 75  ? -0.283  -17.212 -34.500 1.00 41.10  ? 1452 LEU A O   1 
ATOM   463  C  CB  . LEU A 1 75  ? 1.916   -17.779 -36.174 1.00 34.80  ? 1452 LEU A CB  1 
ATOM   464  C  CG  . LEU A 1 75  ? 3.120   -17.870 -37.115 1.00 39.58  ? 1452 LEU A CG  1 
ATOM   465  C  CD1 . LEU A 1 75  ? 3.319   -19.257 -37.623 1.00 40.70  ? 1452 LEU A CD1 1 
ATOM   466  C  CD2 . LEU A 1 75  ? 3.026   -16.871 -38.266 1.00 42.34  ? 1452 LEU A CD2 1 
ATOM   467  N  N   . TYR A 1 76  ? 0.785   -15.556 -33.307 1.00 43.07  ? 1453 TYR A N   1 
ATOM   468  C  CA  . TYR A 1 76  ? -0.282  -15.223 -32.351 1.00 44.30  ? 1453 TYR A CA  1 
ATOM   469  C  C   . TYR A 1 76  ? -0.853  -16.434 -31.598 1.00 47.15  ? 1453 TYR A C   1 
ATOM   470  O  O   . TYR A 1 76  ? -1.988  -16.359 -31.096 1.00 46.57  ? 1453 TYR A O   1 
ATOM   471  C  CB  . TYR A 1 76  ? -1.428  -14.435 -33.066 1.00 45.72  ? 1453 TYR A CB  1 
ATOM   472  C  CG  . TYR A 1 76  ? -0.949  -13.290 -33.939 1.00 47.36  ? 1453 TYR A CG  1 
ATOM   473  C  CD1 . TYR A 1 76  ? -0.366  -12.159 -33.377 1.00 48.78  ? 1453 TYR A CD1 1 
ATOM   474  C  CD2 . TYR A 1 76  ? -1.111  -13.324 -35.331 1.00 48.01  ? 1453 TYR A CD2 1 
ATOM   475  C  CE1 . TYR A 1 76  ? 0.060   -11.095 -34.174 1.00 48.95  ? 1453 TYR A CE1 1 
ATOM   476  C  CE2 . TYR A 1 76  ? -0.687  -12.264 -36.140 1.00 48.74  ? 1453 TYR A CE2 1 
ATOM   477  C  CZ  . TYR A 1 76  ? -0.064  -11.167 -35.558 1.00 55.33  ? 1453 TYR A CZ  1 
ATOM   478  O  OH  . TYR A 1 76  ? 0.371   -10.123 -36.349 1.00 52.22  ? 1453 TYR A OH  1 
ATOM   479  N  N   . ASP A 1 77  ? -0.069  -17.531 -31.514 1.00 43.43  ? 1454 ASP A N   1 
ATOM   480  C  CA  . ASP A 1 77  ? -0.478  -18.800 -30.917 1.00 45.49  ? 1454 ASP A CA  1 
ATOM   481  C  C   . ASP A 1 77  ? -1.850  -19.229 -31.516 1.00 52.59  ? 1454 ASP A C   1 
ATOM   482  O  O   . ASP A 1 77  ? -2.789  -19.568 -30.781 1.00 54.58  ? 1454 ASP A O   1 
ATOM   483  C  CB  . ASP A 1 77  ? -0.482  -18.764 -29.376 1.00 48.13  ? 1454 ASP A CB  1 
ATOM   484  C  CG  . ASP A 1 77  ? -0.747  -20.110 -28.710 1.00 61.62  ? 1454 ASP A CG  1 
ATOM   485  O  OD1 . ASP A 1 77  ? -0.307  -21.152 -29.259 1.00 61.75  ? 1454 ASP A OD1 1 
ATOM   486  O  OD2 . ASP A 1 77  ? -1.403  -20.123 -27.654 1.00 72.15  ? 1454 ASP A OD2 1 
ATOM   487  N  N   . ASN A 1 78  ? -1.977  -19.129 -32.869 1.00 46.88  ? 1455 ASN A N   1 
ATOM   488  C  CA  . ASN A 1 78  ? -3.187  -19.470 -33.624 1.00 44.48  ? 1455 ASN A CA  1 
ATOM   489  C  C   . ASN A 1 78  ? -4.429  -18.730 -33.092 1.00 47.76  ? 1455 ASN A C   1 
ATOM   490  O  O   . ASN A 1 78  ? -5.524  -19.300 -33.031 1.00 48.02  ? 1455 ASN A O   1 
ATOM   491  C  CB  . ASN A 1 78  ? -3.374  -20.990 -33.629 1.00 42.70  ? 1455 ASN A CB  1 
ATOM   492  C  CG  . ASN A 1 78  ? -4.384  -21.519 -34.601 1.00 53.87  ? 1455 ASN A CG  1 
ATOM   493  O  OD1 . ASN A 1 78  ? -5.025  -22.540 -34.367 1.00 54.07  ? 1455 ASN A OD1 1 
ATOM   494  N  ND2 . ASN A 1 78  ? -4.587  -20.824 -35.675 1.00 34.43  ? 1455 ASN A ND2 1 
ATOM   495  N  N   . PHE A 1 79  ? -4.239  -17.458 -32.675 1.00 43.37  ? 1456 PHE A N   1 
ATOM   496  C  CA  . PHE A 1 79  ? -5.258  -16.573 -32.128 1.00 42.26  ? 1456 PHE A CA  1 
ATOM   497  C  C   . PHE A 1 79  ? -5.929  -17.076 -30.853 1.00 44.62  ? 1456 PHE A C   1 
ATOM   498  O  O   . PHE A 1 79  ? -6.954  -16.526 -30.493 1.00 43.54  ? 1456 PHE A O   1 
ATOM   499  C  CB  . PHE A 1 79  ? -6.323  -16.221 -33.193 1.00 43.93  ? 1456 PHE A CB  1 
ATOM   500  C  CG  . PHE A 1 79  ? -5.810  -15.430 -34.363 1.00 46.16  ? 1456 PHE A CG  1 
ATOM   501  C  CD1 . PHE A 1 79  ? -5.365  -14.118 -34.196 1.00 50.75  ? 1456 PHE A CD1 1 
ATOM   502  C  CD2 . PHE A 1 79  ? -5.775  -15.990 -35.633 1.00 49.54  ? 1456 PHE A CD2 1 
ATOM   503  C  CE1 . PHE A 1 79  ? -4.881  -13.386 -35.281 1.00 52.62  ? 1456 PHE A CE1 1 
ATOM   504  C  CE2 . PHE A 1 79  ? -5.308  -15.260 -36.722 1.00 53.83  ? 1456 PHE A CE2 1 
ATOM   505  C  CZ  . PHE A 1 79  ? -4.876  -13.953 -36.544 1.00 52.70  ? 1456 PHE A CZ  1 
ATOM   506  N  N   . ASP A 1 80  ? -5.357  -18.057 -30.137 1.00 43.39  ? 1457 ASP A N   1 
ATOM   507  C  CA  . ASP A 1 80  ? -6.005  -18.612 -28.941 1.00 45.48  ? 1457 ASP A CA  1 
ATOM   508  C  C   . ASP A 1 80  ? -5.866  -17.749 -27.690 1.00 52.11  ? 1457 ASP A C   1 
ATOM   509  O  O   . ASP A 1 80  ? -6.548  -17.996 -26.690 1.00 52.06  ? 1457 ASP A O   1 
ATOM   510  C  CB  . ASP A 1 80  ? -5.589  -20.056 -28.685 1.00 49.06  ? 1457 ASP A CB  1 
ATOM   511  C  CG  . ASP A 1 80  ? -6.091  -20.999 -29.773 1.00 65.51  ? 1457 ASP A CG  1 
ATOM   512  O  OD1 . ASP A 1 80  ? -7.208  -20.731 -30.355 1.00 65.62  ? 1457 ASP A OD1 1 
ATOM   513  O  OD2 . ASP A 1 80  ? -5.375  -21.995 -30.062 1.00 71.44  ? 1457 ASP A OD2 1 
ATOM   514  N  N   . CYS A 1 81  ? -5.060  -16.696 -27.775 1.00 51.18  ? 1458 CYS A N   1 
ATOM   515  C  CA  . CYS A 1 81  ? -4.915  -15.731 -26.703 1.00 52.94  ? 1458 CYS A CA  1 
ATOM   516  C  C   . CYS A 1 81  ? -5.883  -14.563 -27.006 1.00 65.28  ? 1458 CYS A C   1 
ATOM   517  O  O   . CYS A 1 81  ? -6.538  -14.046 -26.101 1.00 65.83  ? 1458 CYS A O   1 
ATOM   518  C  CB  . CYS A 1 81  ? -3.457  -15.280 -26.569 1.00 51.94  ? 1458 CYS A CB  1 
ATOM   519  S  SG  . CYS A 1 81  ? -2.339  -16.556 -25.917 1.00 56.72  ? 1458 CYS A SG  1 
ATOM   520  N  N   . HIS A 1 82  ? -6.031  -14.234 -28.297 1.00 67.23  ? 1459 HIS A N   1 
ATOM   521  C  CA  . HIS A 1 82  ? -6.869  -13.148 -28.792 1.00 68.96  ? 1459 HIS A CA  1 
ATOM   522  C  C   . HIS A 1 82  ? -8.349  -13.502 -28.802 1.00 75.16  ? 1459 HIS A C   1 
ATOM   523  O  O   . HIS A 1 82  ? -9.153  -12.727 -28.293 1.00 74.78  ? 1459 HIS A O   1 
ATOM   524  C  CB  . HIS A 1 82  ? -6.361  -12.694 -30.169 1.00 69.30  ? 1459 HIS A CB  1 
ATOM   525  C  CG  . HIS A 1 82  ? -7.264  -11.771 -30.908 1.00 72.21  ? 1459 HIS A CG  1 
ATOM   526  N  ND1 . HIS A 1 82  ? -7.765  -12.114 -32.136 1.00 73.48  ? 1459 HIS A ND1 1 
ATOM   527  C  CD2 . HIS A 1 82  ? -7.655  -10.512 -30.610 1.00 74.20  ? 1459 HIS A CD2 1 
ATOM   528  C  CE1 . HIS A 1 82  ? -8.465  -11.067 -32.542 1.00 72.63  ? 1459 HIS A CE1 1 
ATOM   529  N  NE2 . HIS A 1 82  ? -8.446  -10.090 -31.644 1.00 73.34  ? 1459 HIS A NE2 1 
ATOM   530  N  N   . ALA A 1 83  ? -8.701  -14.659 -29.366 1.00 74.45  ? 1460 ALA A N   1 
ATOM   531  C  CA  . ALA A 1 83  ? -10.089 -15.135 -29.459 1.00 76.47  ? 1460 ALA A CA  1 
ATOM   532  C  C   . ALA A 1 83  ? -10.173 -16.470 -28.714 1.00 86.32  ? 1460 ALA A C   1 
ATOM   533  O  O   . ALA A 1 83  ? -10.028 -17.544 -29.305 1.00 85.34  ? 1460 ALA A O   1 
ATOM   534  C  CB  . ALA A 1 83  ? -10.528 -15.284 -30.923 1.00 76.11  ? 1460 ALA A CB  1 
ATOM   535  N  N   . GLY A 1 84  ? -10.336 -16.372 -27.398 1.00 87.57  ? 1461 GLY A N   1 
ATOM   536  C  CA  . GLY A 1 84  ? -10.404 -17.534 -26.514 1.00 89.97  ? 1461 GLY A CA  1 
ATOM   537  C  C   . GLY A 1 84  ? -11.704 -18.333 -26.508 1.00 95.81  ? 1461 GLY A C   1 
ATOM   538  O  O   . GLY A 1 84  ? -11.673 -19.571 -26.375 1.00 97.50  ? 1461 GLY A O   1 
ATOM   539  N  N   . GLY A 1 85  ? -12.841 -17.618 -26.631 1.00 90.04  ? 1462 GLY A N   1 
ATOM   540  C  CA  . GLY A 1 85  ? -14.192 -18.178 -26.601 1.00 88.56  ? 1462 GLY A CA  1 
ATOM   541  C  C   . GLY A 1 85  ? -14.773 -18.472 -27.961 1.00 87.03  ? 1462 GLY A C   1 
ATOM   542  O  O   . GLY A 1 85  ? -14.031 -18.533 -28.939 1.00 85.49  ? 1462 GLY A O   1 
ATOM   543  N  N   . ARG A 1 86  ? -16.113 -18.660 -28.015 1.00 80.99  ? 1463 ARG A N   1 
ATOM   544  C  CA  . ARG A 1 86  ? -16.931 -18.963 -29.210 1.00 78.30  ? 1463 ARG A CA  1 
ATOM   545  C  C   . ARG A 1 86  ? -16.634 -18.077 -30.423 1.00 77.39  ? 1463 ARG A C   1 
ATOM   546  O  O   . ARG A 1 86  ? -16.780 -18.515 -31.566 1.00 75.38  ? 1463 ARG A O   1 
ATOM   547  C  CB  . ARG A 1 86  ? -18.431 -18.918 -28.873 1.00 76.90  ? 1463 ARG A CB  1 
ATOM   548  C  CG  . ARG A 1 86  ? -18.900 -17.657 -28.142 1.00 79.88  ? 1463 ARG A CG  1 
ATOM   549  C  CD  . ARG A 1 86  ? -20.394 -17.700 -27.905 1.00 85.61  ? 1463 ARG A CD  1 
ATOM   550  N  NE  . ARG A 1 86  ? -20.924 -16.445 -27.377 1.00 86.50  ? 1463 ARG A NE  1 
ATOM   551  C  CZ  . ARG A 1 86  ? -21.503 -16.306 -26.186 1.00 99.75  ? 1463 ARG A CZ  1 
ATOM   552  N  NH1 . ARG A 1 86  ? -21.632 -17.349 -25.375 1.00 83.35  ? 1463 ARG A NH1 1 
ATOM   553  N  NH2 . ARG A 1 86  ? -21.965 -15.126 -25.802 1.00 90.71  ? 1463 ARG A NH2 1 
ATOM   554  N  N   . GLU A 1 87  ? -16.209 -16.829 -30.159 1.00 72.29  ? 1464 GLU A N   1 
ATOM   555  C  CA  . GLU A 1 87  ? -15.879 -15.860 -31.197 1.00 69.83  ? 1464 GLU A CA  1 
ATOM   556  C  C   . GLU A 1 87  ? -14.676 -16.314 -32.040 1.00 72.13  ? 1464 GLU A C   1 
ATOM   557  O  O   . GLU A 1 87  ? -14.412 -15.725 -33.083 1.00 71.31  ? 1464 GLU A O   1 
ATOM   558  C  CB  . GLU A 1 87  ? -15.721 -14.428 -30.635 1.00 70.66  ? 1464 GLU A CB  1 
ATOM   559  C  CG  . GLU A 1 87  ? -14.390 -14.130 -29.958 1.00 81.63  ? 1464 GLU A CG  1 
ATOM   560  C  CD  . GLU A 1 87  ? -13.873 -12.712 -30.113 1.00 100.32 ? 1464 GLU A CD  1 
ATOM   561  O  OE1 . GLU A 1 87  ? -14.105 -12.082 -31.174 1.00 90.77  ? 1464 GLU A OE1 1 
ATOM   562  O  OE2 . GLU A 1 87  ? -13.180 -12.248 -29.180 1.00 89.45  ? 1464 GLU A OE2 1 
ATOM   563  N  N   . ARG A 1 88  ? -14.023 -17.423 -31.644 1.00 67.98  ? 1465 ARG A N   1 
ATOM   564  C  CA  . ARG A 1 88  ? -12.909 -18.012 -32.381 1.00 66.91  ? 1465 ARG A CA  1 
ATOM   565  C  C   . ARG A 1 88  ? -13.358 -18.531 -33.739 1.00 65.72  ? 1465 ARG A C   1 
ATOM   566  O  O   . ARG A 1 88  ? -12.557 -18.556 -34.670 1.00 65.98  ? 1465 ARG A O   1 
ATOM   567  C  CB  . ARG A 1 88  ? -12.240 -19.133 -31.582 1.00 71.74  ? 1465 ARG A CB  1 
ATOM   568  C  CG  . ARG A 1 88  ? -10.732 -19.159 -31.813 1.00 91.46  ? 1465 ARG A CG  1 
ATOM   569  C  CD  . ARG A 1 88  ? -10.282 -20.429 -32.471 1.00 111.52 ? 1465 ARG A CD  1 
ATOM   570  N  NE  . ARG A 1 88  ? -8.973  -20.327 -33.117 1.00 123.69 ? 1465 ARG A NE  1 
ATOM   571  C  CZ  . ARG A 1 88  ? -8.760  -19.803 -34.324 1.00 138.61 ? 1465 ARG A CZ  1 
ATOM   572  N  NH1 . ARG A 1 88  ? -9.774  -19.313 -35.034 1.00 121.04 ? 1465 ARG A NH1 1 
ATOM   573  N  NH2 . ARG A 1 88  ? -7.561  -19.872 -34.877 1.00 128.70 ? 1465 ARG A NH2 1 
ATOM   574  N  N   . THR A 1 89  ? -14.633 -18.921 -33.866 1.00 57.80  ? 1466 THR A N   1 
ATOM   575  C  CA  . THR A 1 89  ? -15.159 -19.419 -35.130 1.00 55.52  ? 1466 THR A CA  1 
ATOM   576  C  C   . THR A 1 89  ? -16.530 -18.822 -35.465 1.00 55.92  ? 1466 THR A C   1 
ATOM   577  O  O   . THR A 1 89  ? -17.311 -18.449 -34.575 1.00 56.44  ? 1466 THR A O   1 
ATOM   578  C  CB  . THR A 1 89  ? -15.264 -20.967 -35.131 1.00 60.51  ? 1466 THR A CB  1 
ATOM   579  O  OG1 . THR A 1 89  ? -16.150 -21.422 -34.097 1.00 56.65  ? 1466 THR A OG1 1 
ATOM   580  C  CG2 . THR A 1 89  ? -13.928 -21.655 -35.045 1.00 62.00  ? 1466 THR A CG2 1 
ATOM   581  N  N   . CYS A 1 90  ? -16.832 -18.790 -36.770 1.00 47.58  ? 1467 CYS A N   1 
ATOM   582  C  CA  . CYS A 1 90  ? -18.144 -18.425 -37.284 1.00 45.23  ? 1467 CYS A CA  1 
ATOM   583  C  C   . CYS A 1 90  ? -19.096 -19.608 -36.980 1.00 46.95  ? 1467 CYS A C   1 
ATOM   584  O  O   . CYS A 1 90  ? -18.683 -20.787 -37.038 1.00 46.61  ? 1467 CYS A O   1 
ATOM   585  C  CB  . CYS A 1 90  ? -18.077 -18.157 -38.784 1.00 44.36  ? 1467 CYS A CB  1 
ATOM   586  S  SG  . CYS A 1 90  ? -19.554 -17.343 -39.457 1.00 48.00  ? 1467 CYS A SG  1 
ATOM   587  N  N   . ASN A 1 91  ? -20.365 -19.315 -36.657 1.00 41.23  ? 1468 ASN A N   1 
ATOM   588  C  CA  . ASN A 1 91  ? -21.295 -20.414 -36.380 1.00 40.23  ? 1468 ASN A CA  1 
ATOM   589  C  C   . ASN A 1 91  ? -21.551 -21.233 -37.666 1.00 40.52  ? 1468 ASN A C   1 
ATOM   590  O  O   . ASN A 1 91  ? -21.958 -20.611 -38.667 1.00 40.99  ? 1468 ASN A O   1 
ATOM   591  C  CB  . ASN A 1 91  ? -22.616 -19.912 -35.812 1.00 37.72  ? 1468 ASN A CB  1 
ATOM   592  C  CG  . ASN A 1 91  ? -23.354 -20.996 -35.070 1.00 63.94  ? 1468 ASN A CG  1 
ATOM   593  O  OD1 . ASN A 1 91  ? -23.705 -22.040 -35.617 1.00 48.73  ? 1468 ASN A OD1 1 
ATOM   594  N  ND2 . ASN A 1 91  ? -23.452 -20.853 -33.766 1.00 66.87  ? 1468 ASN A ND2 1 
ATOM   595  N  N   . PRO A 1 92  ? -21.339 -22.597 -37.658 1.00 31.02  ? 1469 PRO A N   1 
ATOM   596  C  CA  . PRO A 1 92  ? -21.582 -23.403 -38.872 1.00 29.84  ? 1469 PRO A CA  1 
ATOM   597  C  C   . PRO A 1 92  ? -23.000 -23.284 -39.445 1.00 31.12  ? 1469 PRO A C   1 
ATOM   598  O  O   . PRO A 1 92  ? -23.189 -23.408 -40.674 1.00 29.80  ? 1469 PRO A O   1 
ATOM   599  C  CB  . PRO A 1 92  ? -21.312 -24.820 -38.418 1.00 32.28  ? 1469 PRO A CB  1 
ATOM   600  C  CG  . PRO A 1 92  ? -20.454 -24.682 -37.252 1.00 36.59  ? 1469 PRO A CG  1 
ATOM   601  C  CD  . PRO A 1 92  ? -20.853 -23.442 -36.559 1.00 32.00  ? 1469 PRO A CD  1 
ATOM   602  N  N   . VAL A 1 93  ? -24.000 -22.999 -38.578 1.00 28.91  ? 1470 VAL A N   1 
ATOM   603  C  CA  . VAL A 1 93  ? -25.361 -22.848 -39.065 1.00 29.13  ? 1470 VAL A CA  1 
ATOM   604  C  C   . VAL A 1 93  ? -25.497 -21.564 -39.896 1.00 33.42  ? 1470 VAL A C   1 
ATOM   605  O  O   . VAL A 1 93  ? -26.393 -21.479 -40.737 1.00 35.55  ? 1470 VAL A O   1 
ATOM   606  C  CB  . VAL A 1 93  ? -26.501 -23.002 -38.023 1.00 32.14  ? 1470 VAL A CB  1 
ATOM   607  C  CG1 . VAL A 1 93  ? -27.312 -24.282 -38.250 1.00 33.62  ? 1470 VAL A CG1 1 
ATOM   608  C  CG2 . VAL A 1 93  ? -26.049 -22.870 -36.573 1.00 31.70  ? 1470 VAL A CG2 1 
ATOM   609  N  N   . TYR A 1 94  ? -24.584 -20.586 -39.710 1.00 29.49  ? 1471 TYR A N   1 
ATOM   610  C  CA  . TYR A 1 94  ? -24.596 -19.296 -40.436 1.00 28.69  ? 1471 TYR A CA  1 
ATOM   611  C  C   . TYR A 1 94  ? -23.542 -19.309 -41.550 1.00 31.07  ? 1471 TYR A C   1 
ATOM   612  O  O   . TYR A 1 94  ? -23.499 -18.375 -42.367 1.00 30.75  ? 1471 TYR A O   1 
ATOM   613  C  CB  . TYR A 1 94  ? -24.270 -18.131 -39.467 1.00 28.93  ? 1471 TYR A CB  1 
ATOM   614  C  CG  . TYR A 1 94  ? -25.090 -18.037 -38.188 1.00 29.92  ? 1471 TYR A CG  1 
ATOM   615  C  CD1 . TYR A 1 94  ? -26.304 -18.706 -38.057 1.00 32.02  ? 1471 TYR A CD1 1 
ATOM   616  C  CD2 . TYR A 1 94  ? -24.658 -17.268 -37.115 1.00 30.78  ? 1471 TYR A CD2 1 
ATOM   617  C  CE1 . TYR A 1 94  ? -27.006 -18.706 -36.854 1.00 31.59  ? 1471 TYR A CE1 1 
ATOM   618  C  CE2 . TYR A 1 94  ? -25.360 -17.247 -35.911 1.00 32.76  ? 1471 TYR A CE2 1 
ATOM   619  C  CZ  . TYR A 1 94  ? -26.543 -17.952 -35.790 1.00 41.07  ? 1471 TYR A CZ  1 
ATOM   620  O  OH  . TYR A 1 94  ? -27.208 -17.919 -34.591 1.00 46.57  ? 1471 TYR A OH  1 
ATOM   621  N  N   . GLU A 1 95  ? -22.649 -20.342 -41.551 1.00 27.01  ? 1472 GLU A N   1 
ATOM   622  C  CA  . GLU A 1 95  ? -21.557 -20.425 -42.505 1.00 26.32  ? 1472 GLU A CA  1 
ATOM   623  C  C   . GLU A 1 95  ? -22.021 -20.406 -43.964 1.00 31.87  ? 1472 GLU A C   1 
ATOM   624  O  O   . GLU A 1 95  ? -21.561 -19.466 -44.633 1.00 30.70  ? 1472 GLU A O   1 
ATOM   625  C  CB  . GLU A 1 95  ? -20.619 -21.571 -42.218 1.00 27.39  ? 1472 GLU A CB  1 
ATOM   626  C  CG  . GLU A 1 95  ? -19.299 -21.541 -42.966 1.00 29.73  ? 1472 GLU A CG  1 
ATOM   627  C  CD  . GLU A 1 95  ? -18.626 -20.191 -43.082 1.00 45.80  ? 1472 GLU A CD  1 
ATOM   628  O  OE1 . GLU A 1 95  ? -17.967 -19.731 -42.121 1.00 47.43  ? 1472 GLU A OE1 1 
ATOM   629  O  OE2 . GLU A 1 95  ? -18.796 -19.573 -44.152 1.00 37.28  ? 1472 GLU A OE2 1 
ATOM   630  N  N   . LYS A 1 96  ? -22.994 -21.293 -44.449 1.00 30.65  ? 1473 LYS A N   1 
ATOM   631  C  CA  . LYS A 1 96  ? -23.490 -21.166 -45.851 1.00 30.57  ? 1473 LYS A CA  1 
ATOM   632  C  C   . LYS A 1 96  ? -24.117 -19.782 -46.171 1.00 39.29  ? 1473 LYS A C   1 
ATOM   633  O  O   . LYS A 1 96  ? -23.803 -19.188 -47.217 1.00 38.67  ? 1473 LYS A O   1 
ATOM   634  C  CB  . LYS A 1 96  ? -24.461 -22.240 -46.264 1.00 31.34  ? 1473 LYS A CB  1 
ATOM   635  C  CG  . LYS A 1 96  ? -24.854 -22.170 -47.767 1.00 32.72  ? 1473 LYS A CG  1 
ATOM   636  C  CD  . LYS A 1 96  ? -23.918 -22.920 -48.752 1.00 44.52  ? 1473 LYS A CD  1 
ATOM   637  C  CE  . LYS A 1 96  ? -23.058 -21.997 -49.586 1.00 51.73  ? 1473 LYS A CE  1 
ATOM   638  N  NZ  . LYS A 1 96  ? -21.772 -22.637 -49.993 1.00 60.18  ? 1473 LYS A NZ  1 
ATOM   639  N  N   . TYR A 1 97  ? -24.985 -19.266 -45.266 1.00 38.16  ? 1474 TYR A N   1 
ATOM   640  C  CA  . TYR A 1 97  ? -25.591 -17.940 -45.418 1.00 37.72  ? 1474 TYR A CA  1 
ATOM   641  C  C   . TYR A 1 97  ? -24.525 -16.884 -45.628 1.00 41.63  ? 1474 TYR A C   1 
ATOM   642  O  O   . TYR A 1 97  ? -24.670 -16.098 -46.549 1.00 42.61  ? 1474 TYR A O   1 
ATOM   643  C  CB  . TYR A 1 97  ? -26.443 -17.568 -44.188 1.00 38.58  ? 1474 TYR A CB  1 
ATOM   644  C  CG  . TYR A 1 97  ? -27.135 -16.227 -44.304 1.00 38.01  ? 1474 TYR A CG  1 
ATOM   645  C  CD1 . TYR A 1 97  ? -26.458 -15.044 -44.024 1.00 39.19  ? 1474 TYR A CD1 1 
ATOM   646  C  CD2 . TYR A 1 97  ? -28.474 -16.142 -44.655 1.00 38.67  ? 1474 TYR A CD2 1 
ATOM   647  C  CE1 . TYR A 1 97  ? -27.069 -13.806 -44.178 1.00 40.61  ? 1474 TYR A CE1 1 
ATOM   648  C  CE2 . TYR A 1 97  ? -29.117 -14.910 -44.741 1.00 39.80  ? 1474 TYR A CE2 1 
ATOM   649  C  CZ  . TYR A 1 97  ? -28.404 -13.744 -44.511 1.00 45.81  ? 1474 TYR A CZ  1 
ATOM   650  O  OH  . TYR A 1 97  ? -28.980 -12.512 -44.548 1.00 45.80  ? 1474 TYR A OH  1 
ATOM   651  N  N   . CYS A 1 98  ? -23.473 -16.846 -44.776 1.00 37.57  ? 1475 CYS A N   1 
ATOM   652  C  CA  . CYS A 1 98  ? -22.422 -15.827 -44.868 1.00 36.14  ? 1475 CYS A CA  1 
ATOM   653  C  C   . CYS A 1 98  ? -21.629 -15.905 -46.172 1.00 38.56  ? 1475 CYS A C   1 
ATOM   654  O  O   . CYS A 1 98  ? -21.342 -14.857 -46.746 1.00 35.61  ? 1475 CYS A O   1 
ATOM   655  C  CB  . CYS A 1 98  ? -21.530 -15.836 -43.634 1.00 35.48  ? 1475 CYS A CB  1 
ATOM   656  S  SG  . CYS A 1 98  ? -22.384 -15.285 -42.139 1.00 39.37  ? 1475 CYS A SG  1 
ATOM   657  N  N   . ALA A 1 99  ? -21.411 -17.131 -46.702 1.00 36.88  ? 1476 ALA A N   1 
ATOM   658  C  CA  . ALA A 1 99  ? -20.742 -17.378 -47.980 1.00 37.99  ? 1476 ALA A CA  1 
ATOM   659  C  C   . ALA A 1 99  ? -21.611 -16.887 -49.135 1.00 46.01  ? 1476 ALA A C   1 
ATOM   660  O  O   . ALA A 1 99  ? -21.104 -16.262 -50.057 1.00 46.70  ? 1476 ALA A O   1 
ATOM   661  C  CB  . ALA A 1 99  ? -20.457 -18.860 -48.140 1.00 39.32  ? 1476 ALA A CB  1 
ATOM   662  N  N   . ASP A 1 100 ? -22.922 -17.129 -49.059 1.00 44.51  ? 1477 ASP A N   1 
ATOM   663  C  CA  . ASP A 1 100 ? -23.881 -16.697 -50.071 1.00 45.03  ? 1477 ASP A CA  1 
ATOM   664  C  C   . ASP A 1 100 ? -24.092 -15.177 -50.106 1.00 46.24  ? 1477 ASP A C   1 
ATOM   665  O  O   . ASP A 1 100 ? -24.371 -14.637 -51.171 1.00 47.43  ? 1477 ASP A O   1 
ATOM   666  C  CB  . ASP A 1 100 ? -25.212 -17.428 -49.856 1.00 48.27  ? 1477 ASP A CB  1 
ATOM   667  C  CG  . ASP A 1 100 ? -25.197 -18.904 -50.271 1.00 61.43  ? 1477 ASP A CG  1 
ATOM   668  O  OD1 . ASP A 1 100 ? -24.222 -19.329 -50.920 1.00 62.74  ? 1477 ASP A OD1 1 
ATOM   669  O  OD2 . ASP A 1 100 ? -26.185 -19.619 -49.984 1.00 65.52  ? 1477 ASP A OD2 1 
ATOM   670  N  N   . HIS A 1 101 ? -23.925 -14.494 -48.962 1.00 39.27  ? 1478 HIS A N   1 
ATOM   671  C  CA  . HIS A 1 101 ? -24.192 -13.061 -48.816 1.00 37.84  ? 1478 HIS A CA  1 
ATOM   672  C  C   . HIS A 1 101 ? -22.941 -12.166 -48.653 1.00 40.54  ? 1478 HIS A C   1 
ATOM   673  O  O   . HIS A 1 101 ? -23.080 -10.945 -48.498 1.00 40.30  ? 1478 HIS A O   1 
ATOM   674  C  CB  . HIS A 1 101 ? -25.196 -12.824 -47.665 1.00 37.69  ? 1478 HIS A CB  1 
ATOM   675  C  CG  . HIS A 1 101 ? -26.531 -13.473 -47.900 1.00 40.97  ? 1478 HIS A CG  1 
ATOM   676  N  ND1 . HIS A 1 101 ? -26.849 -14.670 -47.318 1.00 42.00  ? 1478 HIS A ND1 1 
ATOM   677  C  CD2 . HIS A 1 101 ? -27.542 -13.115 -48.725 1.00 43.27  ? 1478 HIS A CD2 1 
ATOM   678  C  CE1 . HIS A 1 101 ? -28.035 -14.998 -47.787 1.00 42.31  ? 1478 HIS A CE1 1 
ATOM   679  N  NE2 . HIS A 1 101 ? -28.492 -14.094 -48.634 1.00 43.34  ? 1478 HIS A NE2 1 
ATOM   680  N  N   . PHE A 1 102 ? -21.737 -12.753 -48.764 1.00 34.79  ? 1479 PHE A N   1 
ATOM   681  C  CA  . PHE A 1 102 ? -20.468 -12.030 -48.676 1.00 32.76  ? 1479 PHE A CA  1 
ATOM   682  C  C   . PHE A 1 102 ? -20.295 -11.113 -49.882 1.00 37.48  ? 1479 PHE A C   1 
ATOM   683  O  O   . PHE A 1 102 ? -20.494 -11.568 -51.014 1.00 40.68  ? 1479 PHE A O   1 
ATOM   684  C  CB  . PHE A 1 102 ? -19.322 -13.036 -48.649 1.00 33.42  ? 1479 PHE A CB  1 
ATOM   685  C  CG  . PHE A 1 102 ? -17.908 -12.486 -48.633 1.00 33.18  ? 1479 PHE A CG  1 
ATOM   686  C  CD1 . PHE A 1 102 ? -17.217 -12.254 -49.821 1.00 35.03  ? 1479 PHE A CD1 1 
ATOM   687  C  CD2 . PHE A 1 102 ? -17.243 -12.262 -47.432 1.00 32.79  ? 1479 PHE A CD2 1 
ATOM   688  C  CE1 . PHE A 1 102 ? -15.886 -11.826 -49.806 1.00 33.70  ? 1479 PHE A CE1 1 
ATOM   689  C  CE2 . PHE A 1 102 ? -15.908 -11.850 -47.423 1.00 33.75  ? 1479 PHE A CE2 1 
ATOM   690  C  CZ  . PHE A 1 102 ? -15.241 -11.657 -48.612 1.00 31.43  ? 1479 PHE A CZ  1 
ATOM   691  N  N   . ALA A 1 103 ? -19.902 -9.841  -49.649 1.00 30.38  ? 1480 ALA A N   1 
ATOM   692  C  CA  . ALA A 1 103 ? -19.659 -8.865  -50.704 1.00 29.98  ? 1480 ALA A CA  1 
ATOM   693  C  C   . ALA A 1 103 ? -20.725 -8.886  -51.821 1.00 33.71  ? 1480 ALA A C   1 
ATOM   694  O  O   . ALA A 1 103 ? -20.383 -8.968  -53.008 1.00 32.80  ? 1480 ALA A O   1 
ATOM   695  C  CB  . ALA A 1 103 ? -18.264 -9.051  -51.275 1.00 30.65  ? 1480 ALA A CB  1 
ATOM   696  N  N   . ASP A 1 104 ? -22.017 -8.887  -51.420 1.00 30.67  ? 1481 ASP A N   1 
ATOM   697  C  CA  . ASP A 1 104 ? -23.153 -8.855  -52.342 1.00 31.83  ? 1481 ASP A CA  1 
ATOM   698  C  C   . ASP A 1 104 ? -23.742 -7.441  -52.437 1.00 39.99  ? 1481 ASP A C   1 
ATOM   699  O  O   . ASP A 1 104 ? -24.822 -7.271  -53.003 1.00 41.34  ? 1481 ASP A O   1 
ATOM   700  C  CB  . ASP A 1 104 ? -24.237 -9.870  -51.942 1.00 32.77  ? 1481 ASP A CB  1 
ATOM   701  C  CG  . ASP A 1 104 ? -24.983 -9.623  -50.634 1.00 32.78  ? 1481 ASP A CG  1 
ATOM   702  O  OD1 . ASP A 1 104 ? -24.563 -8.739  -49.867 1.00 34.44  ? 1481 ASP A OD1 1 
ATOM   703  O  OD2 . ASP A 1 104 ? -25.974 -10.352 -50.363 1.00 31.24  ? 1481 ASP A OD2 1 
ATOM   704  N  N   . GLY A 1 105 ? -23.064 -6.462  -51.835 1.00 37.76  ? 1482 GLY A N   1 
ATOM   705  C  CA  . GLY A 1 105 ? -23.519 -5.077  -51.828 1.00 39.96  ? 1482 GLY A CA  1 
ATOM   706  C  C   . GLY A 1 105 ? -24.662 -4.765  -50.871 1.00 47.73  ? 1482 GLY A C   1 
ATOM   707  O  O   . GLY A 1 105 ? -25.236 -3.670  -50.930 1.00 50.19  ? 1482 GLY A O   1 
ATOM   708  N  N   . ARG A 1 106 ? -24.996 -5.709  -49.963 1.00 43.11  ? 1483 ARG A N   1 
ATOM   709  C  CA  . ARG A 1 106 ? -26.048 -5.510  -48.962 1.00 42.39  ? 1483 ARG A CA  1 
ATOM   710  C  C   . ARG A 1 106 ? -25.514 -5.893  -47.604 1.00 40.68  ? 1483 ARG A C   1 
ATOM   711  O  O   . ARG A 1 106 ? -24.920 -6.961  -47.462 1.00 36.83  ? 1483 ARG A O   1 
ATOM   712  C  CB  . ARG A 1 106 ? -27.309 -6.304  -49.312 1.00 46.56  ? 1483 ARG A CB  1 
ATOM   713  C  CG  . ARG A 1 106 ? -28.154 -5.675  -50.424 1.00 63.98  ? 1483 ARG A CG  1 
ATOM   714  C  CD  . ARG A 1 106 ? -27.932 -6.406  -51.737 1.00 77.66  ? 1483 ARG A CD  1 
ATOM   715  N  NE  . ARG A 1 106 ? -29.128 -7.129  -52.175 1.00 87.01  ? 1483 ARG A NE  1 
ATOM   716  C  CZ  . ARG A 1 106 ? -29.119 -8.313  -52.785 1.00 102.30 ? 1483 ARG A CZ  1 
ATOM   717  N  NH1 . ARG A 1 106 ? -30.257 -8.883  -53.159 1.00 93.76  ? 1483 ARG A NH1 1 
ATOM   718  N  NH2 . ARG A 1 106 ? -27.970 -8.935  -53.029 1.00 87.40  ? 1483 ARG A NH2 1 
ATOM   719  N  N   . CYS A 1 107 ? -25.672 -4.987  -46.618 1.00 38.04  ? 1484 CYS A N   1 
ATOM   720  C  CA  . CYS A 1 107 ? -25.186 -5.212  -45.264 1.00 37.11  ? 1484 CYS A CA  1 
ATOM   721  C  C   . CYS A 1 107 ? -25.988 -6.298  -44.534 1.00 41.78  ? 1484 CYS A C   1 
ATOM   722  O  O   . CYS A 1 107 ? -27.179 -6.128  -44.307 1.00 41.88  ? 1484 CYS A O   1 
ATOM   723  C  CB  . CYS A 1 107 ? -25.107 -3.926  -44.449 1.00 37.24  ? 1484 CYS A CB  1 
ATOM   724  S  SG  . CYS A 1 107 ? -24.563 -4.182  -42.733 1.00 40.14  ? 1484 CYS A SG  1 
ATOM   725  N  N   . ASP A 1 108 ? -25.304 -7.405  -44.167 1.00 37.34  ? 1485 ASP A N   1 
ATOM   726  C  CA  . ASP A 1 108 ? -25.829 -8.533  -43.404 1.00 36.49  ? 1485 ASP A CA  1 
ATOM   727  C  C   . ASP A 1 108 ? -25.077 -8.516  -42.043 1.00 39.25  ? 1485 ASP A C   1 
ATOM   728  O  O   . ASP A 1 108 ? -23.920 -8.936  -41.958 1.00 37.94  ? 1485 ASP A O   1 
ATOM   729  C  CB  . ASP A 1 108 ? -25.610 -9.838  -44.192 1.00 38.04  ? 1485 ASP A CB  1 
ATOM   730  C  CG  . ASP A 1 108 ? -26.280 -9.831  -45.548 1.00 48.40  ? 1485 ASP A CG  1 
ATOM   731  O  OD1 . ASP A 1 108 ? -27.511 -9.888  -45.590 1.00 48.66  ? 1485 ASP A OD1 1 
ATOM   732  O  OD2 . ASP A 1 108 ? -25.563 -9.711  -46.568 1.00 53.63  ? 1485 ASP A OD2 1 
ATOM   733  N  N   . GLN A 1 109 ? -25.707 -7.950  -41.004 1.00 35.99  ? 1486 GLN A N   1 
ATOM   734  C  CA  . GLN A 1 109 ? -25.096 -7.799  -39.681 1.00 34.80  ? 1486 GLN A CA  1 
ATOM   735  C  C   . GLN A 1 109 ? -24.666 -9.118  -39.009 1.00 37.58  ? 1486 GLN A C   1 
ATOM   736  O  O   . GLN A 1 109 ? -23.637 -9.127  -38.342 1.00 37.74  ? 1486 GLN A O   1 
ATOM   737  C  CB  . GLN A 1 109 ? -25.968 -6.960  -38.740 1.00 36.71  ? 1486 GLN A CB  1 
ATOM   738  C  CG  . GLN A 1 109 ? -25.915 -5.457  -39.026 1.00 39.94  ? 1486 GLN A CG  1 
ATOM   739  C  CD  . GLN A 1 109 ? -24.568 -4.799  -38.740 1.00 47.63  ? 1486 GLN A CD  1 
ATOM   740  O  OE1 . GLN A 1 109 ? -23.713 -5.337  -38.042 1.00 37.60  ? 1486 GLN A OE1 1 
ATOM   741  N  NE2 . GLN A 1 109 ? -24.340 -3.604  -39.256 1.00 38.43  ? 1486 GLN A NE2 1 
ATOM   742  N  N   . GLY A 1 110 ? -25.378 -10.207 -39.235 1.00 33.70  ? 1487 GLY A N   1 
ATOM   743  C  CA  . GLY A 1 110 ? -24.990 -11.506 -38.698 1.00 34.26  ? 1487 GLY A CA  1 
ATOM   744  C  C   . GLY A 1 110 ? -23.637 -12.014 -39.179 1.00 37.97  ? 1487 GLY A C   1 
ATOM   745  O  O   . GLY A 1 110 ? -22.992 -12.791 -38.484 1.00 37.13  ? 1487 GLY A O   1 
ATOM   746  N  N   . CYS A 1 111 ? -23.179 -11.541 -40.343 1.00 35.66  ? 1488 CYS A N   1 
ATOM   747  C  CA  . CYS A 1 111 ? -21.897 -11.887 -40.952 1.00 34.97  ? 1488 CYS A CA  1 
ATOM   748  C  C   . CYS A 1 111 ? -20.866 -10.794 -40.731 1.00 40.20  ? 1488 CYS A C   1 
ATOM   749  O  O   . CYS A 1 111 ? -19.712 -10.980 -41.094 1.00 42.30  ? 1488 CYS A O   1 
ATOM   750  C  CB  . CYS A 1 111 ? -22.092 -12.200 -42.433 1.00 35.22  ? 1488 CYS A CB  1 
ATOM   751  S  SG  . CYS A 1 111 ? -23.288 -13.550 -42.744 1.00 39.77  ? 1488 CYS A SG  1 
ATOM   752  N  N   . ASN A 1 112 ? -21.267 -9.671  -40.104 1.00 34.89  ? 1489 ASN A N   1 
ATOM   753  C  CA  . ASN A 1 112 ? -20.414 -8.517  -39.828 1.00 33.79  ? 1489 ASN A CA  1 
ATOM   754  C  C   . ASN A 1 112 ? -19.568 -8.664  -38.563 1.00 37.81  ? 1489 ASN A C   1 
ATOM   755  O  O   . ASN A 1 112 ? -19.683 -7.866  -37.635 1.00 35.80  ? 1489 ASN A O   1 
ATOM   756  C  CB  . ASN A 1 112 ? -21.245 -7.256  -39.785 1.00 39.22  ? 1489 ASN A CB  1 
ATOM   757  C  CG  . ASN A 1 112 ? -20.463 -5.965  -39.883 1.00 68.67  ? 1489 ASN A CG  1 
ATOM   758  O  OD1 . ASN A 1 112 ? -19.449 -5.879  -40.575 1.00 56.21  ? 1489 ASN A OD1 1 
ATOM   759  N  ND2 . ASN A 1 112 ? -20.953 -4.914  -39.234 1.00 64.35  ? 1489 ASN A ND2 1 
ATOM   760  N  N   . THR A 1 113 ? -18.727 -9.718  -38.528 1.00 37.06  ? 1490 THR A N   1 
ATOM   761  C  CA  . THR A 1 113 ? -17.785 -10.064 -37.445 1.00 37.51  ? 1490 THR A CA  1 
ATOM   762  C  C   . THR A 1 113 ? -16.540 -10.580 -38.120 1.00 41.91  ? 1490 THR A C   1 
ATOM   763  O  O   . THR A 1 113 ? -16.661 -11.154 -39.199 1.00 39.96  ? 1490 THR A O   1 
ATOM   764  C  CB  . THR A 1 113 ? -18.335 -11.163 -36.493 1.00 53.09  ? 1490 THR A CB  1 
ATOM   765  O  OG1 . THR A 1 113 ? -18.590 -12.376 -37.197 1.00 46.92  ? 1490 THR A OG1 1 
ATOM   766  C  CG2 . THR A 1 113 ? -19.576 -10.738 -35.729 1.00 60.30  ? 1490 THR A CG2 1 
ATOM   767  N  N   . GLU A 1 114 ? -15.347 -10.425 -37.492 1.00 41.46  ? 1491 GLU A N   1 
ATOM   768  C  CA  . GLU A 1 114 ? -14.071 -10.889 -38.080 1.00 40.96  ? 1491 GLU A CA  1 
ATOM   769  C  C   . GLU A 1 114 ? -14.026 -12.374 -38.313 1.00 42.66  ? 1491 GLU A C   1 
ATOM   770  O  O   . GLU A 1 114 ? -13.450 -12.770 -39.317 1.00 42.66  ? 1491 GLU A O   1 
ATOM   771  C  CB  . GLU A 1 114 ? -12.828 -10.423 -37.288 1.00 42.48  ? 1491 GLU A CB  1 
ATOM   772  C  CG  . GLU A 1 114 ? -12.665 -11.039 -35.909 1.00 53.45  ? 1491 GLU A CG  1 
ATOM   773  C  CD  . GLU A 1 114 ? -11.510 -10.433 -35.143 1.00 73.08  ? 1491 GLU A CD  1 
ATOM   774  O  OE1 . GLU A 1 114 ? -10.463 -11.098 -34.998 1.00 50.21  ? 1491 GLU A OE1 1 
ATOM   775  O  OE2 . GLU A 1 114 ? -11.643 -9.272  -34.703 1.00 82.40  ? 1491 GLU A OE2 1 
ATOM   776  N  N   . GLU A 1 115 ? -14.640 -13.182 -37.429 1.00 38.64  ? 1492 GLU A N   1 
ATOM   777  C  CA  . GLU A 1 115 ? -14.638 -14.644 -37.579 1.00 39.21  ? 1492 GLU A CA  1 
ATOM   778  C  C   . GLU A 1 115 ? -15.509 -15.171 -38.742 1.00 43.98  ? 1492 GLU A C   1 
ATOM   779  O  O   . GLU A 1 115 ? -15.269 -16.291 -39.185 1.00 44.25  ? 1492 GLU A O   1 
ATOM   780  C  CB  . GLU A 1 115 ? -14.986 -15.372 -36.271 1.00 40.84  ? 1492 GLU A CB  1 
ATOM   781  C  CG  . GLU A 1 115 ? -16.389 -15.122 -35.749 1.00 46.12  ? 1492 GLU A CG  1 
ATOM   782  C  CD  . GLU A 1 115 ? -16.581 -13.932 -34.816 1.00 55.12  ? 1492 GLU A CD  1 
ATOM   783  O  OE1 . GLU A 1 115 ? -15.795 -12.959 -34.878 1.00 28.46  ? 1492 GLU A OE1 1 
ATOM   784  O  OE2 . GLU A 1 115 ? -17.559 -13.961 -34.038 1.00 55.63  ? 1492 GLU A OE2 1 
ATOM   785  N  N   . CYS A 1 116 ? -16.500 -14.383 -39.213 1.00 40.42  ? 1493 CYS A N   1 
ATOM   786  C  CA  . CYS A 1 116 ? -17.424 -14.742 -40.296 1.00 40.71  ? 1493 CYS A CA  1 
ATOM   787  C  C   . CYS A 1 116 ? -17.031 -14.145 -41.651 1.00 45.96  ? 1493 CYS A C   1 
ATOM   788  O  O   . CYS A 1 116 ? -17.725 -14.396 -42.633 1.00 46.52  ? 1493 CYS A O   1 
ATOM   789  C  CB  . CYS A 1 116 ? -18.865 -14.386 -39.923 1.00 41.75  ? 1493 CYS A CB  1 
ATOM   790  S  SG  . CYS A 1 116 ? -19.586 -15.441 -38.643 1.00 46.94  ? 1493 CYS A SG  1 
ATOM   791  N  N   . GLY A 1 117 ? -15.969 -13.334 -41.684 1.00 42.82  ? 1494 GLY A N   1 
ATOM   792  C  CA  . GLY A 1 117 ? -15.487 -12.685 -42.899 1.00 43.04  ? 1494 GLY A CA  1 
ATOM   793  C  C   . GLY A 1 117 ? -15.917 -11.241 -43.127 1.00 50.32  ? 1494 GLY A C   1 
ATOM   794  O  O   . GLY A 1 117 ? -15.756 -10.729 -44.245 1.00 52.31  ? 1494 GLY A O   1 
ATOM   795  N  N   . TRP A 1 118 ? -16.454 -10.549 -42.083 1.00 45.54  ? 1495 TRP A N   1 
ATOM   796  C  CA  . TRP A 1 118 ? -16.835 -9.131  -42.142 1.00 45.09  ? 1495 TRP A CA  1 
ATOM   797  C  C   . TRP A 1 118 ? -17.864 -8.736  -43.237 1.00 48.96  ? 1495 TRP A C   1 
ATOM   798  O  O   . TRP A 1 118 ? -17.925 -7.559  -43.657 1.00 49.14  ? 1495 TRP A O   1 
ATOM   799  C  CB  . TRP A 1 118 ? -15.579 -8.260  -42.293 1.00 44.32  ? 1495 TRP A CB  1 
ATOM   800  C  CG  . TRP A 1 118 ? -14.730 -8.093  -41.059 1.00 45.76  ? 1495 TRP A CG  1 
ATOM   801  C  CD1 . TRP A 1 118 ? -13.384 -8.292  -40.969 1.00 48.60  ? 1495 TRP A CD1 1 
ATOM   802  C  CD2 . TRP A 1 118 ? -15.142 -7.570  -39.780 1.00 45.79  ? 1495 TRP A CD2 1 
ATOM   803  N  NE1 . TRP A 1 118 ? -12.928 -7.926  -39.719 1.00 48.28  ? 1495 TRP A NE1 1 
ATOM   804  C  CE2 . TRP A 1 118 ? -13.985 -7.479  -38.970 1.00 49.63  ? 1495 TRP A CE2 1 
ATOM   805  C  CE3 . TRP A 1 118 ? -16.372 -7.161  -39.242 1.00 47.30  ? 1495 TRP A CE3 1 
ATOM   806  C  CZ2 . TRP A 1 118 ? -14.030 -7.044  -37.644 1.00 48.95  ? 1495 TRP A CZ2 1 
ATOM   807  C  CZ3 . TRP A 1 118 ? -16.410 -6.701  -37.937 1.00 49.28  ? 1495 TRP A CZ3 1 
ATOM   808  C  CH2 . TRP A 1 118 ? -15.253 -6.671  -37.145 1.00 49.88  ? 1495 TRP A CH2 1 
ATOM   809  N  N   . ASP A 1 119 ? -18.673 -9.716  -43.699 1.00 44.60  ? 1496 ASP A N   1 
ATOM   810  C  CA  . ASP A 1 119 ? -19.674 -9.548  -44.762 1.00 42.98  ? 1496 ASP A CA  1 
ATOM   811  C  C   . ASP A 1 119 ? -19.046 -8.978  -46.052 1.00 41.33  ? 1496 ASP A C   1 
ATOM   812  O  O   . ASP A 1 119 ? -19.718 -8.311  -46.842 1.00 39.75  ? 1496 ASP A O   1 
ATOM   813  C  CB  . ASP A 1 119 ? -20.903 -8.725  -44.313 1.00 44.91  ? 1496 ASP A CB  1 
ATOM   814  C  CG  . ASP A 1 119 ? -22.075 -8.856  -45.265 1.00 53.55  ? 1496 ASP A CG  1 
ATOM   815  O  OD1 . ASP A 1 119 ? -22.183 -9.904  -45.926 1.00 60.10  ? 1496 ASP A OD1 1 
ATOM   816  O  OD2 . ASP A 1 119 ? -22.864 -7.917  -45.360 1.00 45.14  ? 1496 ASP A OD2 1 
ATOM   817  N  N   . GLY A 1 120 ? -17.762 -9.264  -46.248 1.00 35.30  ? 1497 GLY A N   1 
ATOM   818  C  CA  . GLY A 1 120 ? -17.005 -8.789  -47.394 1.00 35.34  ? 1497 GLY A CA  1 
ATOM   819  C  C   . GLY A 1 120 ? -16.960 -7.286  -47.517 1.00 38.75  ? 1497 GLY A C   1 
ATOM   820  O  O   . GLY A 1 120 ? -16.876 -6.772  -48.635 1.00 40.20  ? 1497 GLY A O   1 
ATOM   821  N  N   . LEU A 1 121 ? -17.055 -6.585  -46.350 1.00 31.64  ? 1498 LEU A N   1 
ATOM   822  C  CA  . LEU A 1 121 ? -17.062 -5.133  -46.163 1.00 29.92  ? 1498 LEU A CA  1 
ATOM   823  C  C   . LEU A 1 121 ? -18.354 -4.410  -46.639 1.00 34.47  ? 1498 LEU A C   1 
ATOM   824  O  O   . LEU A 1 121 ? -18.345 -3.180  -46.730 1.00 37.03  ? 1498 LEU A O   1 
ATOM   825  C  CB  . LEU A 1 121 ? -15.803 -4.459  -46.770 1.00 29.28  ? 1498 LEU A CB  1 
ATOM   826  C  CG  . LEU A 1 121 ? -14.477 -4.891  -46.212 1.00 30.27  ? 1498 LEU A CG  1 
ATOM   827  C  CD1 . LEU A 1 121 ? -13.354 -4.215  -46.942 1.00 28.89  ? 1498 LEU A CD1 1 
ATOM   828  C  CD2 . LEU A 1 121 ? -14.388 -4.633  -44.715 1.00 33.67  ? 1498 LEU A CD2 1 
ATOM   829  N  N   . ASP A 1 122 ? -19.460 -5.133  -46.857 1.00 29.55  ? 1499 ASP A N   1 
ATOM   830  C  CA  . ASP A 1 122 ? -20.748 -4.564  -47.247 1.00 30.59  ? 1499 ASP A CA  1 
ATOM   831  C  C   . ASP A 1 122 ? -21.304 -3.601  -46.197 1.00 35.19  ? 1499 ASP A C   1 
ATOM   832  O  O   . ASP A 1 122 ? -22.131 -2.775  -46.545 1.00 36.77  ? 1499 ASP A O   1 
ATOM   833  C  CB  . ASP A 1 122 ? -21.799 -5.677  -47.475 1.00 33.77  ? 1499 ASP A CB  1 
ATOM   834  C  CG  . ASP A 1 122 ? -21.611 -6.585  -48.678 1.00 41.59  ? 1499 ASP A CG  1 
ATOM   835  O  OD1 . ASP A 1 122 ? -21.019 -6.121  -49.691 1.00 43.95  ? 1499 ASP A OD1 1 
ATOM   836  O  OD2 . ASP A 1 122 ? -22.089 -7.745  -48.622 1.00 37.69  ? 1499 ASP A OD2 1 
ATOM   837  N  N   . CYS A 1 123 ? -20.899 -3.731  -44.925 1.00 32.26  ? 1500 CYS A N   1 
ATOM   838  C  CA  . CYS A 1 123 ? -21.376 -2.863  -43.843 1.00 33.91  ? 1500 CYS A CA  1 
ATOM   839  C  C   . CYS A 1 123 ? -20.455 -1.676  -43.581 1.00 40.56  ? 1500 CYS A C   1 
ATOM   840  O  O   . CYS A 1 123 ? -20.807 -0.763  -42.819 1.00 38.65  ? 1500 CYS A O   1 
ATOM   841  C  CB  . CYS A 1 123 ? -21.585 -3.676  -42.574 1.00 33.90  ? 1500 CYS A CB  1 
ATOM   842  S  SG  . CYS A 1 123 ? -22.724 -5.050  -42.774 1.00 37.96  ? 1500 CYS A SG  1 
ATOM   843  N  N   . ALA A 1 124 ? -19.266 -1.707  -44.204 1.00 40.91  ? 1501 ALA A N   1 
ATOM   844  C  CA  . ALA A 1 124 ? -18.228 -0.707  -44.016 1.00 41.98  ? 1501 ALA A CA  1 
ATOM   845  C  C   . ALA A 1 124 ? -17.782 -0.031  -45.310 1.00 51.01  ? 1501 ALA A C   1 
ATOM   846  O  O   . ALA A 1 124 ? -16.607 0.323   -45.440 1.00 51.61  ? 1501 ALA A O   1 
ATOM   847  C  CB  . ALA A 1 124 ? -17.046 -1.333  -43.308 1.00 41.22  ? 1501 ALA A CB  1 
ATOM   848  N  N   . SER A 1 125 ? -18.734 0.223   -46.234 1.00 49.99  ? 1502 SER A N   1 
ATOM   849  C  CA  . SER A 1 125 ? -18.471 0.919   -47.495 1.00 50.78  ? 1502 SER A CA  1 
ATOM   850  C  C   . SER A 1 125 ? -17.900 2.356   -47.287 1.00 51.26  ? 1502 SER A C   1 
ATOM   851  O  O   . SER A 1 125 ? -17.149 2.848   -48.145 1.00 48.98  ? 1502 SER A O   1 
ATOM   852  C  CB  . SER A 1 125 ? -19.732 0.953   -48.356 1.00 57.41  ? 1502 SER A CB  1 
ATOM   853  O  OG  . SER A 1 125 ? -20.794 1.653   -47.724 1.00 70.94  ? 1502 SER A OG  1 
ATOM   854  N  N   . GLU A 1 126 ? -18.202 2.983   -46.128 1.00 47.54  ? 1503 GLU A N   1 
ATOM   855  C  CA  . GLU A 1 126 ? -17.740 4.341   -45.824 1.00 48.97  ? 1503 GLU A CA  1 
ATOM   856  C  C   . GLU A 1 126 ? -16.409 4.395   -45.032 1.00 53.12  ? 1503 GLU A C   1 
ATOM   857  O  O   . GLU A 1 126 ? -15.926 5.490   -44.726 1.00 53.91  ? 1503 GLU A O   1 
ATOM   858  C  CB  . GLU A 1 126 ? -18.845 5.152   -45.130 1.00 51.32  ? 1503 GLU A CB  1 
ATOM   859  C  CG  . GLU A 1 126 ? -20.025 5.442   -46.042 1.00 64.82  ? 1503 GLU A CG  1 
ATOM   860  C  CD  . GLU A 1 126 ? -21.309 5.948   -45.397 1.00 87.81  ? 1503 GLU A CD  1 
ATOM   861  O  OE1 . GLU A 1 126 ? -21.379 6.028   -44.146 1.00 78.83  ? 1503 GLU A OE1 1 
ATOM   862  O  OE2 . GLU A 1 126 ? -22.267 6.218   -46.158 1.00 77.86  ? 1503 GLU A OE2 1 
ATOM   863  N  N   . VAL A 1 127 ? -15.804 3.228   -44.722 1.00 47.63  ? 1504 VAL A N   1 
ATOM   864  C  CA  . VAL A 1 127 ? -14.522 3.183   -44.005 1.00 45.76  ? 1504 VAL A CA  1 
ATOM   865  C  C   . VAL A 1 127 ? -13.456 3.012   -45.075 1.00 49.42  ? 1504 VAL A C   1 
ATOM   866  O  O   . VAL A 1 127 ? -13.554 2.038   -45.832 1.00 48.78  ? 1504 VAL A O   1 
ATOM   867  C  CB  . VAL A 1 127 ? -14.420 2.063   -42.934 1.00 47.15  ? 1504 VAL A CB  1 
ATOM   868  C  CG1 . VAL A 1 127 ? -13.103 2.164   -42.172 1.00 45.96  ? 1504 VAL A CG1 1 
ATOM   869  C  CG2 . VAL A 1 127 ? -15.589 2.097   -41.960 1.00 47.46  ? 1504 VAL A CG2 1 
ATOM   870  N  N   . PRO A 1 128 ? -12.450 3.923   -45.185 1.00 44.65  ? 1505 PRO A N   1 
ATOM   871  C  CA  . PRO A 1 128 ? -11.421 3.758   -46.222 1.00 43.99  ? 1505 PRO A CA  1 
ATOM   872  C  C   . PRO A 1 128 ? -10.582 2.490   -46.059 1.00 45.62  ? 1505 PRO A C   1 
ATOM   873  O  O   . PRO A 1 128 ? -10.359 2.009   -44.938 1.00 43.83  ? 1505 PRO A O   1 
ATOM   874  C  CB  . PRO A 1 128 ? -10.552 4.987   -46.038 1.00 46.70  ? 1505 PRO A CB  1 
ATOM   875  C  CG  . PRO A 1 128 ? -11.425 5.960   -45.355 1.00 51.89  ? 1505 PRO A CG  1 
ATOM   876  C  CD  . PRO A 1 128 ? -12.200 5.142   -44.402 1.00 46.21  ? 1505 PRO A CD  1 
ATOM   877  N  N   . ALA A 1 129 ? -10.117 1.962   -47.201 1.00 41.04  ? 1506 ALA A N   1 
ATOM   878  C  CA  . ALA A 1 129 ? -9.258  0.786   -47.252 1.00 38.99  ? 1506 ALA A CA  1 
ATOM   879  C  C   . ALA A 1 129 ? -7.945  1.078   -46.498 1.00 36.84  ? 1506 ALA A C   1 
ATOM   880  O  O   . ALA A 1 129 ? -7.410  2.194   -46.506 1.00 34.77  ? 1506 ALA A O   1 
ATOM   881  C  CB  . ALA A 1 129 ? -8.956  0.395   -48.705 1.00 40.72  ? 1506 ALA A CB  1 
ATOM   882  N  N   . LEU A 1 130 ? -7.482  0.056   -45.806 1.00 30.30  ? 1507 LEU A N   1 
ATOM   883  C  CA  . LEU A 1 130 ? -6.253  0.033   -45.051 1.00 28.25  ? 1507 LEU A CA  1 
ATOM   884  C  C   . LEU A 1 130 ? -5.645  -1.313  -45.433 1.00 28.25  ? 1507 LEU A C   1 
ATOM   885  O  O   . LEU A 1 130 ? -5.843  -2.299  -44.743 1.00 26.11  ? 1507 LEU A O   1 
ATOM   886  C  CB  . LEU A 1 130 ? -6.550  0.086   -43.542 1.00 27.33  ? 1507 LEU A CB  1 
ATOM   887  C  CG  . LEU A 1 130 ? -6.811  1.396   -42.848 1.00 30.07  ? 1507 LEU A CG  1 
ATOM   888  C  CD1 . LEU A 1 130 ? -6.397  1.273   -41.414 1.00 29.52  ? 1507 LEU A CD1 1 
ATOM   889  C  CD2 . LEU A 1 130 ? -6.095  2.566   -43.506 1.00 32.48  ? 1507 LEU A CD2 1 
ATOM   890  N  N   . LEU A 1 131 ? -4.997  -1.366  -46.602 1.00 25.61  ? 1508 LEU A N   1 
ATOM   891  C  CA  . LEU A 1 131 ? -4.404  -2.582  -47.133 1.00 23.84  ? 1508 LEU A CA  1 
ATOM   892  C  C   . LEU A 1 131 ? -3.125  -2.933  -46.439 1.00 27.51  ? 1508 LEU A C   1 
ATOM   893  O  O   . LEU A 1 131 ? -2.341  -2.043  -46.103 1.00 29.80  ? 1508 LEU A O   1 
ATOM   894  C  CB  . LEU A 1 131 ? -4.141  -2.474  -48.652 1.00 23.87  ? 1508 LEU A CB  1 
ATOM   895  C  CG  . LEU A 1 131 ? -5.274  -2.117  -49.612 1.00 26.63  ? 1508 LEU A CG  1 
ATOM   896  C  CD1 . LEU A 1 131 ? -4.776  -2.173  -51.033 1.00 26.73  ? 1508 LEU A CD1 1 
ATOM   897  C  CD2 . LEU A 1 131 ? -6.448  -3.073  -49.468 1.00 30.73  ? 1508 LEU A CD2 1 
ATOM   898  N  N   . ALA A 1 132 ? -2.892  -4.231  -46.245 1.00 24.85  ? 1509 ALA A N   1 
ATOM   899  C  CA  . ALA A 1 132 ? -1.628  -4.715  -45.720 1.00 25.35  ? 1509 ALA A CA  1 
ATOM   900  C  C   . ALA A 1 132 ? -0.566  -4.539  -46.870 1.00 29.80  ? 1509 ALA A C   1 
ATOM   901  O  O   . ALA A 1 132 ? -0.912  -4.328  -48.039 1.00 28.80  ? 1509 ALA A O   1 
ATOM   902  C  CB  . ALA A 1 132 ? -1.766  -6.188  -45.312 1.00 25.24  ? 1509 ALA A CB  1 
ATOM   903  N  N   . ARG A 1 133 ? 0.708   -4.587  -46.527 1.00 28.01  ? 1510 ARG A N   1 
ATOM   904  C  CA  . ARG A 1 133 ? 1.777   -4.527  -47.524 1.00 29.02  ? 1510 ARG A CA  1 
ATOM   905  C  C   . ARG A 1 133 ? 1.811   -5.837  -48.390 1.00 33.82  ? 1510 ARG A C   1 
ATOM   906  O  O   . ARG A 1 133 ? 1.714   -6.958  -47.875 1.00 30.21  ? 1510 ARG A O   1 
ATOM   907  C  CB  . ARG A 1 133 ? 3.143   -4.329  -46.837 1.00 26.62  ? 1510 ARG A CB  1 
ATOM   908  C  CG  . ARG A 1 133 ? 3.316   -2.956  -46.284 1.00 29.71  ? 1510 ARG A CG  1 
ATOM   909  C  CD  . ARG A 1 133 ? 4.495   -2.863  -45.370 1.00 31.35  ? 1510 ARG A CD  1 
ATOM   910  N  NE  . ARG A 1 133 ? 4.253   -1.862  -44.336 1.00 35.02  ? 1510 ARG A NE  1 
ATOM   911  C  CZ  . ARG A 1 133 ? 3.823   -2.138  -43.109 1.00 42.71  ? 1510 ARG A CZ  1 
ATOM   912  N  NH1 . ARG A 1 133 ? 3.654   -1.165  -42.228 1.00 15.77  ? 1510 ARG A NH1 1 
ATOM   913  N  NH2 . ARG A 1 133 ? 3.599   -3.396  -42.744 1.00 38.20  ? 1510 ARG A NH2 1 
ATOM   914  N  N   . GLY A 1 134 ? 1.959   -5.661  -49.691 1.00 34.11  ? 1511 GLY A N   1 
ATOM   915  C  CA  . GLY A 1 134 ? 2.094   -6.772  -50.614 1.00 35.72  ? 1511 GLY A CA  1 
ATOM   916  C  C   . GLY A 1 134 ? 0.813   -7.449  -51.042 1.00 43.48  ? 1511 GLY A C   1 
ATOM   917  O  O   . GLY A 1 134 ? -0.295  -7.011  -50.697 1.00 45.12  ? 1511 GLY A O   1 
ATOM   918  N  N   . VAL A 1 135 ? 0.983   -8.513  -51.854 1.00 39.83  ? 1512 VAL A N   1 
ATOM   919  C  CA  . VAL A 1 135 ? -0.078  -9.317  -52.434 1.00 39.60  ? 1512 VAL A CA  1 
ATOM   920  C  C   . VAL A 1 135 ? 0.073   -10.766 -51.974 1.00 42.30  ? 1512 VAL A C   1 
ATOM   921  O  O   . VAL A 1 135 ? 1.194   -11.266 -51.845 1.00 40.17  ? 1512 VAL A O   1 
ATOM   922  C  CB  . VAL A 1 135 ? -0.187  -9.121  -53.982 1.00 45.39  ? 1512 VAL A CB  1 
ATOM   923  C  CG1 . VAL A 1 135 ? 0.819   -9.953  -54.747 1.00 47.05  ? 1512 VAL A CG1 1 
ATOM   924  C  CG2 . VAL A 1 135 ? -1.592  -9.408  -54.489 1.00 44.96  ? 1512 VAL A CG2 1 
ATOM   925  N  N   . LEU A 1 136 ? -1.057  -11.392 -51.612 1.00 39.38  ? 1513 LEU A N   1 
ATOM   926  C  CA  . LEU A 1 136 ? -1.089  -12.772 -51.145 1.00 38.58  ? 1513 LEU A CA  1 
ATOM   927  C  C   . LEU A 1 136 ? -1.324  -13.605 -52.389 1.00 42.77  ? 1513 LEU A C   1 
ATOM   928  O  O   . LEU A 1 136 ? -2.317  -13.396 -53.086 1.00 43.99  ? 1513 LEU A O   1 
ATOM   929  C  CB  . LEU A 1 136 ? -2.201  -12.968 -50.094 1.00 37.55  ? 1513 LEU A CB  1 
ATOM   930  C  CG  . LEU A 1 136 ? -2.350  -14.359 -49.490 1.00 43.59  ? 1513 LEU A CG  1 
ATOM   931  C  CD1 . LEU A 1 136 ? -1.141  -14.754 -48.641 1.00 44.78  ? 1513 LEU A CD1 1 
ATOM   932  C  CD2 . LEU A 1 136 ? -3.606  -14.457 -48.686 1.00 45.17  ? 1513 LEU A CD2 1 
ATOM   933  N  N   . VAL A 1 137 ? -0.369  -14.481 -52.717 1.00 37.81  ? 1514 VAL A N   1 
ATOM   934  C  CA  . VAL A 1 137 ? -0.438  -15.296 -53.927 1.00 38.05  ? 1514 VAL A CA  1 
ATOM   935  C  C   . VAL A 1 137 ? -0.735  -16.726 -53.561 1.00 43.27  ? 1514 VAL A C   1 
ATOM   936  O  O   . VAL A 1 137 ? 0.010   -17.328 -52.784 1.00 44.63  ? 1514 VAL A O   1 
ATOM   937  C  CB  . VAL A 1 137 ? 0.818   -15.166 -54.827 1.00 42.96  ? 1514 VAL A CB  1 
ATOM   938  C  CG1 . VAL A 1 137 ? 0.637   -15.944 -56.119 1.00 43.23  ? 1514 VAL A CG1 1 
ATOM   939  C  CG2 . VAL A 1 137 ? 1.161   -13.695 -55.118 1.00 43.53  ? 1514 VAL A CG2 1 
ATOM   940  N  N   . LEU A 1 138 ? -1.837  -17.276 -54.116 1.00 38.04  ? 1515 LEU A N   1 
ATOM   941  C  CA  . LEU A 1 138 ? -2.281  -18.635 -53.840 1.00 36.10  ? 1515 LEU A CA  1 
ATOM   942  C  C   . LEU A 1 138 ? -2.411  -19.460 -55.088 1.00 41.39  ? 1515 LEU A C   1 
ATOM   943  O  O   . LEU A 1 138 ? -3.065  -19.037 -56.041 1.00 40.28  ? 1515 LEU A O   1 
ATOM   944  C  CB  . LEU A 1 138 ? -3.636  -18.646 -53.115 1.00 34.27  ? 1515 LEU A CB  1 
ATOM   945  C  CG  . LEU A 1 138 ? -3.927  -17.708 -51.949 1.00 36.92  ? 1515 LEU A CG  1 
ATOM   946  C  CD1 . LEU A 1 138 ? -2.853  -17.628 -50.933 1.00 36.10  ? 1515 LEU A CD1 1 
ATOM   947  C  CD2 . LEU A 1 138 ? -4.357  -16.350 -52.465 1.00 37.57  ? 1515 LEU A CD2 1 
ATOM   948  N  N   . THR A 1 139 ? -1.839  -20.668 -55.066 1.00 40.27  ? 1516 THR A N   1 
ATOM   949  C  CA  . THR A 1 139 ? -1.986  -21.610 -56.170 1.00 40.70  ? 1516 THR A CA  1 
ATOM   950  C  C   . THR A 1 139 ? -3.021  -22.613 -55.746 1.00 36.11  ? 1516 THR A C   1 
ATOM   951  O  O   . THR A 1 139 ? -2.846  -23.271 -54.729 1.00 31.49  ? 1516 THR A O   1 
ATOM   952  C  CB  . THR A 1 139 ? -0.668  -22.238 -56.554 1.00 59.00  ? 1516 THR A CB  1 
ATOM   953  O  OG1 . THR A 1 139 ? -0.234  -22.993 -55.445 1.00 68.28  ? 1516 THR A OG1 1 
ATOM   954  C  CG2 . THR A 1 139 ? 0.380   -21.190 -57.043 1.00 53.08  ? 1516 THR A CG2 1 
ATOM   955  N  N   . VAL A 1 140 ? -4.144  -22.630 -56.460 1.00 32.86  ? 1517 VAL A N   1 
ATOM   956  C  CA  . VAL A 1 140 ? -5.288  -23.512 -56.205 1.00 33.09  ? 1517 VAL A CA  1 
ATOM   957  C  C   . VAL A 1 140 ? -5.462  -24.421 -57.412 1.00 38.01  ? 1517 VAL A C   1 
ATOM   958  O  O   . VAL A 1 140 ? -5.613  -23.914 -58.527 1.00 37.68  ? 1517 VAL A O   1 
ATOM   959  C  CB  . VAL A 1 140 ? -6.582  -22.729 -55.906 1.00 35.91  ? 1517 VAL A CB  1 
ATOM   960  C  CG1 . VAL A 1 140 ? -7.694  -23.673 -55.466 1.00 35.67  ? 1517 VAL A CG1 1 
ATOM   961  C  CG2 . VAL A 1 140 ? -6.344  -21.656 -54.853 1.00 34.28  ? 1517 VAL A CG2 1 
ATOM   962  N  N   . LEU A 1 141 ? -5.472  -25.752 -57.196 1.00 34.97  ? 1518 LEU A N   1 
ATOM   963  C  CA  . LEU A 1 141 ? -5.544  -26.731 -58.281 1.00 36.67  ? 1518 LEU A CA  1 
ATOM   964  C  C   . LEU A 1 141 ? -6.954  -26.910 -58.826 1.00 39.60  ? 1518 LEU A C   1 
ATOM   965  O  O   . LEU A 1 141 ? -7.482  -28.015 -58.931 1.00 40.62  ? 1518 LEU A O   1 
ATOM   966  C  CB  . LEU A 1 141 ? -4.892  -28.058 -57.879 1.00 38.17  ? 1518 LEU A CB  1 
ATOM   967  C  CG  . LEU A 1 141 ? -3.454  -27.940 -57.373 1.00 43.36  ? 1518 LEU A CG  1 
ATOM   968  C  CD1 . LEU A 1 141 ? -2.968  -29.262 -56.780 1.00 45.98  ? 1518 LEU A CD1 1 
ATOM   969  C  CD2 . LEU A 1 141 ? -2.519  -27.436 -58.467 1.00 44.56  ? 1518 LEU A CD2 1 
ATOM   970  N  N   . LEU A 1 142 ? -7.515  -25.795 -59.253 1.00 34.58  ? 1519 LEU A N   1 
ATOM   971  C  CA  . LEU A 1 142 ? -8.838  -25.651 -59.818 1.00 34.58  ? 1519 LEU A CA  1 
ATOM   972  C  C   . LEU A 1 142 ? -8.734  -24.641 -60.980 1.00 45.55  ? 1519 LEU A C   1 
ATOM   973  O  O   . LEU A 1 142 ? -8.022  -23.646 -60.826 1.00 46.53  ? 1519 LEU A O   1 
ATOM   974  C  CB  . LEU A 1 142 ? -9.717  -25.098 -58.704 1.00 31.40  ? 1519 LEU A CB  1 
ATOM   975  C  CG  . LEU A 1 142 ? -11.040 -25.720 -58.420 1.00 35.85  ? 1519 LEU A CG  1 
ATOM   976  C  CD1 . LEU A 1 142 ? -10.951 -27.223 -58.201 1.00 37.89  ? 1519 LEU A CD1 1 
ATOM   977  C  CD2 . LEU A 1 142 ? -11.602 -25.098 -57.204 1.00 34.99  ? 1519 LEU A CD2 1 
ATOM   978  N  N   . PRO A 1 143 ? -9.377  -24.864 -62.153 1.00 46.61  ? 1520 PRO A N   1 
ATOM   979  C  CA  . PRO A 1 143 ? -9.251  -23.890 -63.258 1.00 47.67  ? 1520 PRO A CA  1 
ATOM   980  C  C   . PRO A 1 143 ? -9.856  -22.527 -62.918 1.00 49.09  ? 1520 PRO A C   1 
ATOM   981  O  O   . PRO A 1 143 ? -10.797 -22.487 -62.120 1.00 47.25  ? 1520 PRO A O   1 
ATOM   982  C  CB  . PRO A 1 143 ? -9.953  -24.568 -64.446 1.00 52.15  ? 1520 PRO A CB  1 
ATOM   983  C  CG  . PRO A 1 143 ? -10.260 -25.943 -64.022 1.00 57.52  ? 1520 PRO A CG  1 
ATOM   984  C  CD  . PRO A 1 143 ? -10.267 -25.980 -62.523 1.00 50.77  ? 1520 PRO A CD  1 
ATOM   985  N  N   . PRO A 1 144 ? -9.332  -21.410 -63.492 1.00 45.59  ? 1521 PRO A N   1 
ATOM   986  C  CA  . PRO A 1 144 ? -9.836  -20.078 -63.113 1.00 44.30  ? 1521 PRO A CA  1 
ATOM   987  C  C   . PRO A 1 144 ? -11.349 -19.892 -63.115 1.00 48.07  ? 1521 PRO A C   1 
ATOM   988  O  O   . PRO A 1 144 ? -11.873 -19.296 -62.189 1.00 44.72  ? 1521 PRO A O   1 
ATOM   989  C  CB  . PRO A 1 144 ? -9.143  -19.154 -64.113 1.00 47.73  ? 1521 PRO A CB  1 
ATOM   990  C  CG  . PRO A 1 144 ? -7.871  -19.835 -64.427 1.00 52.76  ? 1521 PRO A CG  1 
ATOM   991  C  CD  . PRO A 1 144 ? -8.186  -21.298 -64.425 1.00 48.70  ? 1521 PRO A CD  1 
ATOM   992  N  N   . GLU A 1 145 ? -12.027 -20.439 -64.124 1.00 49.86  ? 1522 GLU A N   1 
ATOM   993  C  CA  . GLU A 1 145 ? -13.474 -20.394 -64.323 1.00 52.47  ? 1522 GLU A CA  1 
ATOM   994  C  C   . GLU A 1 145 ? -14.230 -21.005 -63.119 1.00 56.52  ? 1522 GLU A C   1 
ATOM   995  O  O   . GLU A 1 145 ? -15.166 -20.381 -62.587 1.00 55.36  ? 1522 GLU A O   1 
ATOM   996  C  CB  . GLU A 1 145 ? -13.781 -21.137 -65.642 1.00 57.07  ? 1522 GLU A CB  1 
ATOM   997  C  CG  . GLU A 1 145 ? -15.217 -21.149 -66.105 1.00 74.25  ? 1522 GLU A CG  1 
ATOM   998  C  CD  . GLU A 1 145 ? -15.296 -21.675 -67.525 1.00 103.89 ? 1522 GLU A CD  1 
ATOM   999  O  OE1 . GLU A 1 145 ? -15.131 -20.864 -68.468 1.00 90.57  ? 1522 GLU A OE1 1 
ATOM   1000 O  OE2 . GLU A 1 145 ? -15.452 -22.907 -67.697 1.00 103.68 ? 1522 GLU A OE2 1 
ATOM   1001 N  N   . GLU A 1 146 ? -13.794 -22.225 -62.701 1.00 52.72  ? 1523 GLU A N   1 
ATOM   1002 C  CA  . GLU A 1 146 ? -14.342 -22.980 -61.573 1.00 50.87  ? 1523 GLU A CA  1 
ATOM   1003 C  C   . GLU A 1 146 ? -14.134 -22.209 -60.261 1.00 49.74  ? 1523 GLU A C   1 
ATOM   1004 O  O   . GLU A 1 146 ? -15.083 -22.005 -59.506 1.00 48.09  ? 1523 GLU A O   1 
ATOM   1005 C  CB  . GLU A 1 146 ? -13.722 -24.391 -61.522 1.00 53.40  ? 1523 GLU A CB  1 
ATOM   1006 C  CG  . GLU A 1 146 ? -14.413 -25.322 -60.541 1.00 66.72  ? 1523 GLU A CG  1 
ATOM   1007 C  CD  . GLU A 1 146 ? -14.028 -26.788 -60.536 1.00 90.57  ? 1523 GLU A CD  1 
ATOM   1008 O  OE1 . GLU A 1 146 ? -14.713 -27.557 -59.826 1.00 76.50  ? 1523 GLU A OE1 1 
ATOM   1009 O  OE2 . GLU A 1 146 ? -13.079 -27.178 -61.252 1.00 92.28  ? 1523 GLU A OE2 1 
ATOM   1010 N  N   . LEU A 1 147 ? -12.903 -21.744 -60.031 1.00 44.44  ? 1524 LEU A N   1 
ATOM   1011 C  CA  . LEU A 1 147 ? -12.507 -20.966 -58.855 1.00 41.75  ? 1524 LEU A CA  1 
ATOM   1012 C  C   . LEU A 1 147 ? -13.357 -19.732 -58.693 1.00 45.59  ? 1524 LEU A C   1 
ATOM   1013 O  O   . LEU A 1 147 ? -13.794 -19.465 -57.574 1.00 42.27  ? 1524 LEU A O   1 
ATOM   1014 C  CB  . LEU A 1 147 ? -11.014 -20.566 -58.953 1.00 41.25  ? 1524 LEU A CB  1 
ATOM   1015 C  CG  . LEU A 1 147 ? -10.241 -20.235 -57.656 1.00 43.09  ? 1524 LEU A CG  1 
ATOM   1016 C  CD1 . LEU A 1 147 ? -10.445 -18.813 -57.215 1.00 41.54  ? 1524 LEU A CD1 1 
ATOM   1017 C  CD2 . LEU A 1 147 ? -10.510 -21.231 -56.514 1.00 44.24  ? 1524 LEU A CD2 1 
ATOM   1018 N  N   . LEU A 1 148 ? -13.597 -18.980 -59.797 1.00 45.85  ? 1525 LEU A N   1 
ATOM   1019 C  CA  . LEU A 1 148 ? -14.384 -17.748 -59.704 1.00 45.79  ? 1525 LEU A CA  1 
ATOM   1020 C  C   . LEU A 1 148 ? -15.888 -17.993 -59.627 1.00 49.06  ? 1525 LEU A C   1 
ATOM   1021 O  O   . LEU A 1 148 ? -16.618 -17.104 -59.186 1.00 47.27  ? 1525 LEU A O   1 
ATOM   1022 C  CB  . LEU A 1 148 ? -14.056 -16.684 -60.745 1.00 47.49  ? 1525 LEU A CB  1 
ATOM   1023 C  CG  . LEU A 1 148 ? -13.470 -17.036 -62.071 1.00 55.73  ? 1525 LEU A CG  1 
ATOM   1024 C  CD1 . LEU A 1 148 ? -14.574 -17.161 -63.178 1.00 58.24  ? 1525 LEU A CD1 1 
ATOM   1025 C  CD2 . LEU A 1 148 ? -12.415 -16.017 -62.434 1.00 57.21  ? 1525 LEU A CD2 1 
ATOM   1026 N  N   . ARG A 1 149 ? -16.341 -19.213 -59.970 1.00 46.60  ? 1526 ARG A N   1 
ATOM   1027 C  CA  . ARG A 1 149 ? -17.737 -19.596 -59.868 1.00 46.92  ? 1526 ARG A CA  1 
ATOM   1028 C  C   . ARG A 1 149 ? -18.164 -19.710 -58.390 1.00 49.29  ? 1526 ARG A C   1 
ATOM   1029 O  O   . ARG A 1 149 ? -19.349 -19.635 -58.081 1.00 51.15  ? 1526 ARG A O   1 
ATOM   1030 C  CB  . ARG A 1 149 ? -17.984 -20.898 -60.624 1.00 50.88  ? 1526 ARG A CB  1 
ATOM   1031 C  CG  . ARG A 1 149 ? -19.452 -21.079 -60.998 1.00 71.47  ? 1526 ARG A CG  1 
ATOM   1032 C  CD  . ARG A 1 149 ? -20.058 -22.312 -60.375 1.00 87.65  ? 1526 ARG A CD  1 
ATOM   1033 N  NE  . ARG A 1 149 ? -19.837 -23.463 -61.256 1.00 100.57 ? 1526 ARG A NE  1 
ATOM   1034 C  CZ  . ARG A 1 149 ? -18.918 -24.396 -61.040 1.00 108.30 ? 1526 ARG A CZ  1 
ATOM   1035 N  NH1 . ARG A 1 149 ? -18.162 -24.354 -59.949 1.00 81.76  ? 1526 ARG A NH1 1 
ATOM   1036 N  NH2 . ARG A 1 149 ? -18.744 -25.380 -61.917 1.00 98.99  ? 1526 ARG A NH2 1 
ATOM   1037 N  N   . SER A 1 150 ? -17.206 -19.862 -57.480 1.00 42.69  ? 1527 SER A N   1 
ATOM   1038 C  CA  . SER A 1 150 ? -17.465 -19.869 -56.038 1.00 40.50  ? 1527 SER A CA  1 
ATOM   1039 C  C   . SER A 1 150 ? -16.483 -18.884 -55.324 1.00 45.00  ? 1527 SER A C   1 
ATOM   1040 O  O   . SER A 1 150 ? -16.005 -19.154 -54.214 1.00 44.11  ? 1527 SER A O   1 
ATOM   1041 C  CB  . SER A 1 150 ? -17.364 -21.283 -55.481 1.00 41.74  ? 1527 SER A CB  1 
ATOM   1042 O  OG  . SER A 1 150 ? -16.025 -21.664 -55.215 1.00 47.83  ? 1527 SER A OG  1 
ATOM   1043 N  N   . SER A 1 151 ? -16.194 -17.739 -55.974 1.00 41.61  ? 1528 SER A N   1 
ATOM   1044 C  CA  . SER A 1 151 ? -15.245 -16.758 -55.460 1.00 40.75  ? 1528 SER A CA  1 
ATOM   1045 C  C   . SER A 1 151 ? -15.662 -16.103 -54.147 1.00 42.07  ? 1528 SER A C   1 
ATOM   1046 O  O   . SER A 1 151 ? -14.785 -15.907 -53.299 1.00 41.21  ? 1528 SER A O   1 
ATOM   1047 C  CB  . SER A 1 151 ? -14.927 -15.708 -56.514 1.00 47.87  ? 1528 SER A CB  1 
ATOM   1048 O  OG  . SER A 1 151 ? -16.088 -15.001 -56.911 1.00 66.22  ? 1528 SER A OG  1 
ATOM   1049 N  N   . ALA A 1 152 ? -16.969 -15.772 -53.959 1.00 35.66  ? 1529 ALA A N   1 
ATOM   1050 C  CA  . ALA A 1 152 ? -17.441 -15.175 -52.709 1.00 32.71  ? 1529 ALA A CA  1 
ATOM   1051 C  C   . ALA A 1 152 ? -17.197 -16.150 -51.538 1.00 33.90  ? 1529 ALA A C   1 
ATOM   1052 O  O   . ALA A 1 152 ? -16.637 -15.751 -50.520 1.00 28.92  ? 1529 ALA A O   1 
ATOM   1053 C  CB  . ALA A 1 152 ? -18.898 -14.830 -52.823 1.00 34.10  ? 1529 ALA A CB  1 
ATOM   1054 N  N   . ASP A 1 153 ? -17.538 -17.456 -51.728 1.00 34.01  ? 1530 ASP A N   1 
ATOM   1055 C  CA  . ASP A 1 153 ? -17.312 -18.539 -50.755 1.00 33.13  ? 1530 ASP A CA  1 
ATOM   1056 C  C   . ASP A 1 153 ? -15.817 -18.649 -50.429 1.00 35.63  ? 1530 ASP A C   1 
ATOM   1057 O  O   . ASP A 1 153 ? -15.447 -18.719 -49.258 1.00 35.99  ? 1530 ASP A O   1 
ATOM   1058 C  CB  . ASP A 1 153 ? -17.858 -19.872 -51.291 1.00 35.85  ? 1530 ASP A CB  1 
ATOM   1059 C  CG  . ASP A 1 153 ? -17.660 -21.042 -50.355 1.00 50.81  ? 1530 ASP A CG  1 
ATOM   1060 O  OD1 . ASP A 1 153 ? -16.511 -21.553 -50.275 1.00 52.98  ? 1530 ASP A OD1 1 
ATOM   1061 O  OD2 . ASP A 1 153 ? -18.670 -21.504 -49.760 1.00 55.83  ? 1530 ASP A OD2 1 
ATOM   1062 N  N   . PHE A 1 154 ? -14.970 -18.613 -51.465 1.00 29.72  ? 1531 PHE A N   1 
ATOM   1063 C  CA  . PHE A 1 154 ? -13.526 -18.694 -51.354 1.00 28.52  ? 1531 PHE A CA  1 
ATOM   1064 C  C   . PHE A 1 154 ? -12.962 -17.536 -50.485 1.00 31.53  ? 1531 PHE A C   1 
ATOM   1065 O  O   . PHE A 1 154 ? -12.147 -17.758 -49.567 1.00 29.16  ? 1531 PHE A O   1 
ATOM   1066 C  CB  . PHE A 1 154 ? -12.934 -18.657 -52.775 1.00 31.26  ? 1531 PHE A CB  1 
ATOM   1067 C  CG  . PHE A 1 154 ? -11.428 -18.744 -52.859 1.00 32.88  ? 1531 PHE A CG  1 
ATOM   1068 C  CD1 . PHE A 1 154 ? -10.795 -19.973 -52.927 1.00 36.86  ? 1531 PHE A CD1 1 
ATOM   1069 C  CD2 . PHE A 1 154 ? -10.646 -17.586 -52.931 1.00 34.14  ? 1531 PHE A CD2 1 
ATOM   1070 C  CE1 . PHE A 1 154 ? -9.402  -20.049 -53.001 1.00 38.11  ? 1531 PHE A CE1 1 
ATOM   1071 C  CE2 . PHE A 1 154 ? -9.255  -17.661 -52.998 1.00 37.00  ? 1531 PHE A CE2 1 
ATOM   1072 C  CZ  . PHE A 1 154 ? -8.639  -18.890 -53.021 1.00 35.80  ? 1531 PHE A CZ  1 
ATOM   1073 N  N   . LEU A 1 155 ? -13.379 -16.298 -50.801 1.00 28.41  ? 1532 LEU A N   1 
ATOM   1074 C  CA  . LEU A 1 155 ? -12.885 -15.119 -50.094 1.00 27.57  ? 1532 LEU A CA  1 
ATOM   1075 C  C   . LEU A 1 155 ? -13.432 -15.073 -48.683 1.00 29.33  ? 1532 LEU A C   1 
ATOM   1076 O  O   . LEU A 1 155 ? -12.716 -14.686 -47.763 1.00 28.63  ? 1532 LEU A O   1 
ATOM   1077 C  CB  . LEU A 1 155 ? -13.252 -13.820 -50.857 1.00 27.89  ? 1532 LEU A CB  1 
ATOM   1078 C  CG  . LEU A 1 155 ? -12.580 -13.575 -52.173 1.00 33.01  ? 1532 LEU A CG  1 
ATOM   1079 C  CD1 . LEU A 1 155 ? -13.187 -12.390 -52.864 1.00 33.24  ? 1532 LEU A CD1 1 
ATOM   1080 C  CD2 . LEU A 1 155 ? -11.132 -13.366 -51.976 1.00 37.29  ? 1532 LEU A CD2 1 
ATOM   1081 N  N   . GLN A 1 156 ? -14.712 -15.430 -48.523 1.00 24.65  ? 1533 GLN A N   1 
ATOM   1082 C  CA  . GLN A 1 156 ? -15.358 -15.415 -47.218 1.00 24.26  ? 1533 GLN A CA  1 
ATOM   1083 C  C   . GLN A 1 156 ? -14.667 -16.374 -46.245 1.00 28.13  ? 1533 GLN A C   1 
ATOM   1084 O  O   . GLN A 1 156 ? -14.370 -16.003 -45.110 1.00 26.90  ? 1533 GLN A O   1 
ATOM   1085 C  CB  . GLN A 1 156 ? -16.858 -15.700 -47.356 1.00 24.95  ? 1533 GLN A CB  1 
ATOM   1086 C  CG  . GLN A 1 156 ? -17.660 -15.537 -46.068 1.00 24.64  ? 1533 GLN A CG  1 
ATOM   1087 C  CD  . GLN A 1 156 ? -17.768 -16.819 -45.289 1.00 33.25  ? 1533 GLN A CD  1 
ATOM   1088 O  OE1 . GLN A 1 156 ? -17.793 -17.905 -45.850 1.00 28.81  ? 1533 GLN A OE1 1 
ATOM   1089 N  NE2 . GLN A 1 156 ? -17.871 -16.729 -43.989 1.00 24.94  ? 1533 GLN A NE2 1 
ATOM   1090 N  N   . ARG A 1 157 ? -14.361 -17.586 -46.714 1.00 27.57  ? 1534 ARG A N   1 
ATOM   1091 C  CA  . ARG A 1 157 ? -13.680 -18.601 -45.919 1.00 27.47  ? 1534 ARG A CA  1 
ATOM   1092 C  C   . ARG A 1 157 ? -12.246 -18.180 -45.596 1.00 32.80  ? 1534 ARG A C   1 
ATOM   1093 O  O   . ARG A 1 157 ? -11.836 -18.321 -44.454 1.00 34.01  ? 1534 ARG A O   1 
ATOM   1094 C  CB  . ARG A 1 157 ? -13.762 -19.957 -46.607 1.00 24.44  ? 1534 ARG A CB  1 
ATOM   1095 C  CG  . ARG A 1 157 ? -15.180 -20.491 -46.640 1.00 25.23  ? 1534 ARG A CG  1 
ATOM   1096 C  CD  . ARG A 1 157 ? -15.328 -21.755 -47.463 1.00 39.95  ? 1534 ARG A CD  1 
ATOM   1097 N  NE  . ARG A 1 157 ? -16.558 -22.577 -47.309 1.00 46.93  ? 1534 ARG A NE  1 
ATOM   1098 C  CZ  . ARG A 1 157 ? -17.730 -22.241 -46.761 1.00 57.39  ? 1534 ARG A CZ  1 
ATOM   1099 N  NH1 . ARG A 1 157 ? -18.716 -23.125 -46.694 1.00 39.73  ? 1534 ARG A NH1 1 
ATOM   1100 N  NH2 . ARG A 1 157 ? -17.937 -21.014 -46.317 1.00 52.17  ? 1534 ARG A NH2 1 
ATOM   1101 N  N   . LEU A 1 158 ? -11.513 -17.596 -46.557 1.00 29.62  ? 1535 LEU A N   1 
ATOM   1102 C  CA  . LEU A 1 158 ? -10.152 -17.121 -46.284 1.00 30.32  ? 1535 LEU A CA  1 
ATOM   1103 C  C   . LEU A 1 158 ? -10.184 -15.911 -45.330 1.00 34.79  ? 1535 LEU A C   1 
ATOM   1104 O  O   . LEU A 1 158 ? -9.301  -15.777 -44.486 1.00 33.16  ? 1535 LEU A O   1 
ATOM   1105 C  CB  . LEU A 1 158 ? -9.473  -16.741 -47.606 1.00 31.22  ? 1535 LEU A CB  1 
ATOM   1106 C  CG  . LEU A 1 158 ? -8.113  -17.338 -48.019 1.00 36.17  ? 1535 LEU A CG  1 
ATOM   1107 C  CD1 . LEU A 1 158 ? -7.788  -18.638 -47.315 1.00 35.96  ? 1535 LEU A CD1 1 
ATOM   1108 C  CD2 . LEU A 1 158 ? -8.071  -17.550 -49.511 1.00 40.77  ? 1535 LEU A CD2 1 
ATOM   1109 N  N   . SER A 1 159 ? -11.206 -15.047 -45.459 1.00 33.17  ? 1536 SER A N   1 
ATOM   1110 C  CA  . SER A 1 159 ? -11.368 -13.880 -44.595 1.00 32.91  ? 1536 SER A CA  1 
ATOM   1111 C  C   . SER A 1 159 ? -11.615 -14.349 -43.162 1.00 34.53  ? 1536 SER A C   1 
ATOM   1112 O  O   . SER A 1 159 ? -11.012 -13.804 -42.225 1.00 34.73  ? 1536 SER A O   1 
ATOM   1113 C  CB  . SER A 1 159 ? -12.530 -13.005 -45.065 1.00 36.84  ? 1536 SER A CB  1 
ATOM   1114 O  OG  . SER A 1 159 ? -12.241 -12.420 -46.323 1.00 47.03  ? 1536 SER A OG  1 
ATOM   1115 N  N   . ALA A 1 160 ? -12.463 -15.398 -43.012 1.00 28.50  ? 1537 ALA A N   1 
ATOM   1116 C  CA  . ALA A 1 160 ? -12.826 -15.965 -41.729 1.00 27.85  ? 1537 ALA A CA  1 
ATOM   1117 C  C   . ALA A 1 160 ? -11.623 -16.575 -41.034 1.00 33.28  ? 1537 ALA A C   1 
ATOM   1118 O  O   . ALA A 1 160 ? -11.474 -16.389 -39.837 1.00 34.71  ? 1537 ALA A O   1 
ATOM   1119 C  CB  . ALA A 1 160 ? -13.902 -16.986 -41.918 1.00 28.56  ? 1537 ALA A CB  1 
ATOM   1120 N  N   . ILE A 1 161 ? -10.730 -17.252 -41.795 1.00 31.00  ? 1538 ILE A N   1 
ATOM   1121 C  CA  . ILE A 1 161 ? -9.495  -17.908 -41.311 1.00 30.12  ? 1538 ILE A CA  1 
ATOM   1122 C  C   . ILE A 1 161 ? -8.455  -16.896 -40.850 1.00 32.62  ? 1538 ILE A C   1 
ATOM   1123 O  O   . ILE A 1 161 ? -7.871  -17.065 -39.771 1.00 31.28  ? 1538 ILE A O   1 
ATOM   1124 C  CB  . ILE A 1 161 ? -8.930  -18.892 -42.380 1.00 32.39  ? 1538 ILE A CB  1 
ATOM   1125 C  CG1 . ILE A 1 161 ? -9.822  -20.153 -42.489 1.00 32.20  ? 1538 ILE A CG1 1 
ATOM   1126 C  CG2 . ILE A 1 161 ? -7.468  -19.257 -42.073 1.00 34.27  ? 1538 ILE A CG2 1 
ATOM   1127 C  CD1 . ILE A 1 161 ? -9.812  -20.828 -43.789 1.00 39.18  ? 1538 ILE A CD1 1 
ATOM   1128 N  N   . LEU A 1 162 ? -8.219  -15.858 -41.676 1.00 31.42  ? 1539 LEU A N   1 
ATOM   1129 C  CA  . LEU A 1 162 ? -7.211  -14.821 -41.386 1.00 32.22  ? 1539 LEU A CA  1 
ATOM   1130 C  C   . LEU A 1 162 ? -7.701  -13.769 -40.430 1.00 38.06  ? 1539 LEU A C   1 
ATOM   1131 O  O   . LEU A 1 162 ? -6.879  -13.005 -39.913 1.00 37.27  ? 1539 LEU A O   1 
ATOM   1132 C  CB  . LEU A 1 162 ? -6.625  -14.191 -42.662 1.00 32.04  ? 1539 LEU A CB  1 
ATOM   1133 C  CG  . LEU A 1 162 ? -5.841  -15.185 -43.510 1.00 37.85  ? 1539 LEU A CG  1 
ATOM   1134 C  CD1 . LEU A 1 162 ? -5.669  -14.701 -44.901 1.00 38.08  ? 1539 LEU A CD1 1 
ATOM   1135 C  CD2 . LEU A 1 162 ? -4.511  -15.547 -42.868 1.00 42.31  ? 1539 LEU A CD2 1 
ATOM   1136 N  N   . ARG A 1 163 ? -9.031  -13.776 -40.145 1.00 36.38  ? 1540 ARG A N   1 
ATOM   1137 C  CA  . ARG A 1 163 ? -9.722  -12.860 -39.238 1.00 36.75  ? 1540 ARG A CA  1 
ATOM   1138 C  C   . ARG A 1 163 ? -9.589  -11.420 -39.727 1.00 41.99  ? 1540 ARG A C   1 
ATOM   1139 O  O   . ARG A 1 163 ? -9.463  -10.493 -38.931 1.00 39.64  ? 1540 ARG A O   1 
ATOM   1140 C  CB  . ARG A 1 163 ? -9.212  -13.025 -37.788 1.00 36.86  ? 1540 ARG A CB  1 
ATOM   1141 C  CG  . ARG A 1 163 ? -9.370  -14.417 -37.236 1.00 37.88  ? 1540 ARG A CG  1 
ATOM   1142 C  CD  . ARG A 1 163 ? -9.100  -14.459 -35.743 1.00 46.11  ? 1540 ARG A CD  1 
ATOM   1143 N  NE  . ARG A 1 163 ? -10.223 -13.924 -34.955 1.00 61.05  ? 1540 ARG A NE  1 
ATOM   1144 C  CZ  . ARG A 1 163 ? -11.355 -14.577 -34.671 1.00 82.02  ? 1540 ARG A CZ  1 
ATOM   1145 N  NH1 . ARG A 1 163 ? -12.290 -14.004 -33.929 1.00 76.38  ? 1540 ARG A NH1 1 
ATOM   1146 N  NH2 . ARG A 1 163 ? -11.566 -15.798 -35.147 1.00 70.31  ? 1540 ARG A NH2 1 
ATOM   1147 N  N   . THR A 1 164 ? -9.585  -11.248 -41.052 1.00 42.71  ? 1541 THR A N   1 
ATOM   1148 C  CA  . THR A 1 164 ? -9.485  -9.945  -41.729 1.00 43.94  ? 1541 THR A CA  1 
ATOM   1149 C  C   . THR A 1 164 ? -10.191 -10.012 -43.074 1.00 48.36  ? 1541 THR A C   1 
ATOM   1150 O  O   . THR A 1 164 ? -10.710 -11.074 -43.421 1.00 47.67  ? 1541 THR A O   1 
ATOM   1151 C  CB  . THR A 1 164 ? -8.047  -9.442  -41.792 1.00 53.61  ? 1541 THR A CB  1 
ATOM   1152 O  OG1 . THR A 1 164 ? -8.089  -8.127  -42.314 1.00 54.81  ? 1541 THR A OG1 1 
ATOM   1153 C  CG2 . THR A 1 164 ? -7.162  -10.302 -42.660 1.00 53.79  ? 1541 THR A CG2 1 
ATOM   1154 N  N   . SER A 1 165 ? -10.248 -8.896  -43.814 1.00 45.26  ? 1542 SER A N   1 
ATOM   1155 C  CA  . SER A 1 165 ? -10.958 -8.892  -45.089 1.00 45.64  ? 1542 SER A CA  1 
ATOM   1156 C  C   . SER A 1 165 ? -10.059 -9.185  -46.267 1.00 46.05  ? 1542 SER A C   1 
ATOM   1157 O  O   . SER A 1 165 ? -9.068  -8.494  -46.471 1.00 45.20  ? 1542 SER A O   1 
ATOM   1158 C  CB  . SER A 1 165 ? -11.744 -7.598  -45.293 1.00 51.23  ? 1542 SER A CB  1 
ATOM   1159 O  OG  . SER A 1 165 ? -12.603 -7.768  -46.405 1.00 66.07  ? 1542 SER A OG  1 
ATOM   1160 N  N   . LEU A 1 166 ? -10.413 -10.205 -47.050 1.00 40.64  ? 1543 LEU A N   1 
ATOM   1161 C  CA  . LEU A 1 166 ? -9.671  -10.559 -48.256 1.00 39.29  ? 1543 LEU A CA  1 
ATOM   1162 C  C   . LEU A 1 166 ? -10.495 -10.294 -49.496 1.00 39.75  ? 1543 LEU A C   1 
ATOM   1163 O  O   . LEU A 1 166 ? -11.711 -10.459 -49.452 1.00 40.49  ? 1543 LEU A O   1 
ATOM   1164 C  CB  . LEU A 1 166 ? -9.108  -11.989 -48.185 1.00 38.90  ? 1543 LEU A CB  1 
ATOM   1165 C  CG  . LEU A 1 166 ? -7.788  -11.955 -47.482 1.00 43.01  ? 1543 LEU A CG  1 
ATOM   1166 C  CD1 . LEU A 1 166 ? -7.913  -12.342 -46.042 1.00 43.22  ? 1543 LEU A CD1 1 
ATOM   1167 C  CD2 . LEU A 1 166 ? -6.712  -12.595 -48.267 1.00 44.30  ? 1543 LEU A CD2 1 
ATOM   1168 N  N   . ARG A 1 167 ? -9.851  -9.806  -50.558 1.00 32.96  ? 1544 ARG A N   1 
ATOM   1169 C  CA  . ARG A 1 167 ? -10.463 -9.492  -51.849 1.00 33.05  ? 1544 ARG A CA  1 
ATOM   1170 C  C   . ARG A 1 167 ? -9.472  -9.810  -52.966 1.00 39.26  ? 1544 ARG A C   1 
ATOM   1171 O  O   . ARG A 1 167 ? -8.271  -9.845  -52.717 1.00 39.36  ? 1544 ARG A O   1 
ATOM   1172 C  CB  . ARG A 1 167 ? -10.884 -8.010  -51.917 1.00 30.39  ? 1544 ARG A CB  1 
ATOM   1173 C  CG  . ARG A 1 167 ? -9.686  -7.051  -51.914 1.00 52.21  ? 1544 ARG A CG  1 
ATOM   1174 C  CD  . ARG A 1 167 ? -10.042 -5.584  -52.082 1.00 65.70  ? 1544 ARG A CD  1 
ATOM   1175 N  NE  . ARG A 1 167 ? -8.912  -4.785  -52.566 1.00 69.93  ? 1544 ARG A NE  1 
ATOM   1176 C  CZ  . ARG A 1 167 ? -8.783  -3.479  -52.358 1.00 96.74  ? 1544 ARG A CZ  1 
ATOM   1177 N  NH1 . ARG A 1 167 ? -9.692  -2.818  -51.649 1.00 90.06  ? 1544 ARG A NH1 1 
ATOM   1178 N  NH2 . ARG A 1 167 ? -7.738  -2.824  -52.844 1.00 89.50  ? 1544 ARG A NH2 1 
ATOM   1179 N  N   . PHE A 1 168 ? -9.958  -9.997  -54.197 1.00 37.82  ? 1545 PHE A N   1 
ATOM   1180 C  CA  . PHE A 1 168 ? -9.072  -10.236 -55.335 1.00 38.86  ? 1545 PHE A CA  1 
ATOM   1181 C  C   . PHE A 1 168 ? -8.423  -8.956  -55.710 1.00 44.93  ? 1545 PHE A C   1 
ATOM   1182 O  O   . PHE A 1 168 ? -9.114  -7.944  -55.794 1.00 45.92  ? 1545 PHE A O   1 
ATOM   1183 C  CB  . PHE A 1 168 ? -9.840  -10.735 -56.567 1.00 41.84  ? 1545 PHE A CB  1 
ATOM   1184 C  CG  . PHE A 1 168 ? -10.412 -12.122 -56.469 1.00 43.40  ? 1545 PHE A CG  1 
ATOM   1185 C  CD1 . PHE A 1 168 ? -9.580  -13.226 -56.368 1.00 47.93  ? 1545 PHE A CD1 1 
ATOM   1186 C  CD2 . PHE A 1 168 ? -11.780 -12.333 -56.540 1.00 45.86  ? 1545 PHE A CD2 1 
ATOM   1187 C  CE1 . PHE A 1 168 ? -10.107 -14.515 -56.269 1.00 49.72  ? 1545 PHE A CE1 1 
ATOM   1188 C  CE2 . PHE A 1 168 ? -12.306 -13.621 -56.466 1.00 49.68  ? 1545 PHE A CE2 1 
ATOM   1189 C  CZ  . PHE A 1 168 ? -11.466 -14.709 -56.328 1.00 48.54  ? 1545 PHE A CZ  1 
ATOM   1190 N  N   . ARG A 1 169 ? -7.111  -8.982  -55.968 1.00 43.61  ? 1546 ARG A N   1 
ATOM   1191 C  CA  . ARG A 1 169 ? -6.414  -7.799  -56.476 1.00 45.37  ? 1546 ARG A CA  1 
ATOM   1192 C  C   . ARG A 1 169 ? -6.979  -7.564  -57.899 1.00 51.92  ? 1546 ARG A C   1 
ATOM   1193 O  O   . ARG A 1 169 ? -7.223  -8.542  -58.623 1.00 53.51  ? 1546 ARG A O   1 
ATOM   1194 C  CB  . ARG A 1 169 ? -4.898  -8.041  -56.513 1.00 45.79  ? 1546 ARG A CB  1 
ATOM   1195 C  CG  . ARG A 1 169 ? -4.097  -6.794  -56.897 1.00 58.17  ? 1546 ARG A CG  1 
ATOM   1196 C  CD  . ARG A 1 169 ? -2.632  -7.132  -57.058 1.00 66.71  ? 1546 ARG A CD  1 
ATOM   1197 N  NE  . ARG A 1 169 ? -1.893  -6.074  -57.740 1.00 72.42  ? 1546 ARG A NE  1 
ATOM   1198 C  CZ  . ARG A 1 169 ? -0.778  -6.276  -58.431 1.00 86.20  ? 1546 ARG A CZ  1 
ATOM   1199 N  NH1 . ARG A 1 169 ? -0.261  -7.499  -58.530 1.00 73.63  ? 1546 ARG A NH1 1 
ATOM   1200 N  NH2 . ARG A 1 169 ? -0.171  -5.259  -59.031 1.00 69.49  ? 1546 ARG A NH2 1 
ATOM   1201 N  N   . LEU A 1 170 ? -7.278  -6.313  -58.257 1.00 48.03  ? 1547 LEU A N   1 
ATOM   1202 C  CA  . LEU A 1 170 ? -7.834  -6.044  -59.582 1.00 50.40  ? 1547 LEU A CA  1 
ATOM   1203 C  C   . LEU A 1 170 ? -6.741  -5.480  -60.486 1.00 59.22  ? 1547 LEU A C   1 
ATOM   1204 O  O   . LEU A 1 170 ? -5.838  -4.807  -59.981 1.00 58.60  ? 1547 LEU A O   1 
ATOM   1205 C  CB  . LEU A 1 170 ? -9.019  -5.067  -59.497 1.00 50.71  ? 1547 LEU A CB  1 
ATOM   1206 C  CG  . LEU A 1 170 ? -10.334 -5.566  -58.869 1.00 55.06  ? 1547 LEU A CG  1 
ATOM   1207 C  CD1 . LEU A 1 170 ? -10.392 -5.389  -57.361 1.00 54.70  ? 1547 LEU A CD1 1 
ATOM   1208 C  CD2 . LEU A 1 170 ? -11.472 -4.774  -59.417 1.00 57.88  ? 1547 LEU A CD2 1 
ATOM   1209 N  N   . ASP A 1 171 ? -6.799  -5.772  -61.808 1.00 60.18  ? 1548 ASP A N   1 
ATOM   1210 C  CA  . ASP A 1 171 ? -5.823  -5.253  -62.773 1.00 63.26  ? 1548 ASP A CA  1 
ATOM   1211 C  C   . ASP A 1 171 ? -6.339  -3.940  -63.374 1.00 73.20  ? 1548 ASP A C   1 
ATOM   1212 O  O   . ASP A 1 171 ? -7.439  -3.514  -63.000 1.00 73.07  ? 1548 ASP A O   1 
ATOM   1213 C  CB  . ASP A 1 171 ? -5.457  -6.299  -63.850 1.00 66.31  ? 1548 ASP A CB  1 
ATOM   1214 C  CG  . ASP A 1 171 ? -6.586  -6.776  -64.749 1.00 79.31  ? 1548 ASP A CG  1 
ATOM   1215 O  OD1 . ASP A 1 171 ? -7.637  -6.110  -64.787 1.00 78.74  ? 1548 ASP A OD1 1 
ATOM   1216 O  OD2 . ASP A 1 171 ? -6.404  -7.806  -65.435 1.00 90.03  ? 1548 ASP A OD2 1 
ATOM   1217 N  N   . ALA A 1 172 ? -5.563  -3.307  -64.300 1.00 73.99  ? 1549 ALA A N   1 
ATOM   1218 C  CA  . ALA A 1 172 ? -5.897  -2.035  -64.960 1.00 76.84  ? 1549 ALA A CA  1 
ATOM   1219 C  C   . ALA A 1 172 ? -7.303  -1.987  -65.586 1.00 84.07  ? 1549 ALA A C   1 
ATOM   1220 O  O   . ALA A 1 172 ? -7.936  -0.930  -65.612 1.00 84.14  ? 1549 ALA A O   1 
ATOM   1221 C  CB  . ALA A 1 172 ? -4.849  -1.703  -66.005 1.00 80.14  ? 1549 ALA A CB  1 
ATOM   1222 N  N   . HIS A 1 173 ? -7.789  -3.139  -66.054 1.00 83.11  ? 1550 HIS A N   1 
ATOM   1223 C  CA  . HIS A 1 173 ? -9.099  -3.296  -66.686 1.00 85.14  ? 1550 HIS A CA  1 
ATOM   1224 C  C   . HIS A 1 173 ? -10.199 -3.683  -65.680 1.00 85.86  ? 1550 HIS A C   1 
ATOM   1225 O  O   . HIS A 1 173 ? -11.303 -4.056  -66.096 1.00 86.76  ? 1550 HIS A O   1 
ATOM   1226 C  CB  . HIS A 1 173 ? -9.002  -4.304  -67.851 1.00 88.72  ? 1550 HIS A CB  1 
ATOM   1227 C  CG  . HIS A 1 173 ? -7.817  -4.055  -68.739 1.00 95.36  ? 1550 HIS A CG  1 
ATOM   1228 N  ND1 . HIS A 1 173 ? -6.646  -4.794  -68.608 1.00 97.28  ? 1550 HIS A ND1 1 
ATOM   1229 C  CD2 . HIS A 1 173 ? -7.630  -3.102  -69.686 1.00 100.30 ? 1550 HIS A CD2 1 
ATOM   1230 C  CE1 . HIS A 1 173 ? -5.805  -4.292  -69.501 1.00 99.25  ? 1550 HIS A CE1 1 
ATOM   1231 N  NE2 . HIS A 1 173 ? -6.353  -3.273  -70.176 1.00 101.44 ? 1550 HIS A NE2 1 
ATOM   1232 N  N   . GLY A 1 174 ? -9.882  -3.577  -64.380 1.00 78.13  ? 1551 GLY A N   1 
ATOM   1233 C  CA  . GLY A 1 174 ? -10.786 -3.870  -63.272 1.00 74.95  ? 1551 GLY A CA  1 
ATOM   1234 C  C   . GLY A 1 174 ? -11.169 -5.328  -63.141 1.00 76.80  ? 1551 GLY A C   1 
ATOM   1235 O  O   . GLY A 1 174 ? -12.222 -5.644  -62.586 1.00 75.05  ? 1551 GLY A O   1 
ATOM   1236 N  N   . GLN A 1 175 ? -10.327 -6.228  -63.645 1.00 73.80  ? 1552 GLN A N   1 
ATOM   1237 C  CA  . GLN A 1 175 ? -10.580 -7.667  -63.571 1.00 72.76  ? 1552 GLN A CA  1 
ATOM   1238 C  C   . GLN A 1 175 ? -9.779  -8.308  -62.434 1.00 71.20  ? 1552 GLN A C   1 
ATOM   1239 O  O   . GLN A 1 175 ? -8.650  -7.902  -62.159 1.00 69.56  ? 1552 GLN A O   1 
ATOM   1240 C  CB  . GLN A 1 175 ? -10.224 -8.342  -64.912 1.00 76.51  ? 1552 GLN A CB  1 
ATOM   1241 C  CG  . GLN A 1 175 ? -11.115 -9.518  -65.306 1.00 88.17  ? 1552 GLN A CG  1 
ATOM   1242 C  CD  . GLN A 1 175 ? -10.336 -10.733 -65.781 1.00 104.61 ? 1552 GLN A CD  1 
ATOM   1243 O  OE1 . GLN A 1 175 ? -10.623 -11.866 -65.372 1.00 94.90  ? 1552 GLN A OE1 1 
ATOM   1244 N  NE2 . GLN A 1 175 ? -9.360  -10.545 -66.677 1.00 99.63  ? 1552 GLN A NE2 1 
ATOM   1245 N  N   . ALA A 1 176 ? -10.360 -9.338  -61.812 1.00 65.47  ? 1553 ALA A N   1 
ATOM   1246 C  CA  . ALA A 1 176 ? -9.733  -10.109 -60.745 1.00 63.81  ? 1553 ALA A CA  1 
ATOM   1247 C  C   . ALA A 1 176 ? -8.452  -10.766 -61.263 1.00 69.63  ? 1553 ALA A C   1 
ATOM   1248 O  O   . ALA A 1 176 ? -8.455  -11.342 -62.354 1.00 72.53  ? 1553 ALA A O   1 
ATOM   1249 C  CB  . ALA A 1 176 ? -10.694 -11.179 -60.249 1.00 63.63  ? 1553 ALA A CB  1 
ATOM   1250 N  N   . MET A 1 177 ? -7.360  -10.671 -60.494 1.00 63.17  ? 1554 MET A N   1 
ATOM   1251 C  CA  . MET A 1 177 ? -6.077  -11.221 -60.908 1.00 62.53  ? 1554 MET A CA  1 
ATOM   1252 C  C   . MET A 1 177 ? -5.962  -12.717 -60.582 1.00 64.44  ? 1554 MET A C   1 
ATOM   1253 O  O   . MET A 1 177 ? -5.235  -13.129 -59.671 1.00 63.18  ? 1554 MET A O   1 
ATOM   1254 C  CB  . MET A 1 177 ? -4.915  -10.379 -60.376 1.00 64.22  ? 1554 MET A CB  1 
ATOM   1255 C  CG  . MET A 1 177 ? -4.803  -9.080  -61.119 1.00 69.55  ? 1554 MET A CG  1 
ATOM   1256 S  SD  . MET A 1 177 ? -3.510  -7.985  -60.516 1.00 74.53  ? 1554 MET A SD  1 
ATOM   1257 C  CE  . MET A 1 177 ? -2.080  -8.682  -61.310 1.00 72.99  ? 1554 MET A CE  1 
ATOM   1258 N  N   . VAL A 1 178 ? -6.722  -13.519 -61.355 1.00 60.47  ? 1555 VAL A N   1 
ATOM   1259 C  CA  . VAL A 1 178 ? -6.770  -14.982 -61.327 1.00 60.14  ? 1555 VAL A CA  1 
ATOM   1260 C  C   . VAL A 1 178 ? -6.260  -15.468 -62.699 1.00 64.14  ? 1555 VAL A C   1 
ATOM   1261 O  O   . VAL A 1 178 ? -6.871  -15.199 -63.741 1.00 65.19  ? 1555 VAL A O   1 
ATOM   1262 C  CB  . VAL A 1 178 ? -8.160  -15.569 -60.939 1.00 63.58  ? 1555 VAL A CB  1 
ATOM   1263 C  CG1 . VAL A 1 178 ? -9.216  -15.312 -62.011 1.00 65.09  ? 1555 VAL A CG1 1 
ATOM   1264 C  CG2 . VAL A 1 178 ? -8.056  -17.061 -60.673 1.00 63.54  ? 1555 VAL A CG2 1 
ATOM   1265 N  N   . PHE A 1 179 ? -5.120  -16.142 -62.687 1.00 59.40  ? 1556 PHE A N   1 
ATOM   1266 C  CA  . PHE A 1 179 ? -4.471  -16.602 -63.900 1.00 61.17  ? 1556 PHE A CA  1 
ATOM   1267 C  C   . PHE A 1 179 ? -4.379  -18.126 -63.979 1.00 66.41  ? 1556 PHE A C   1 
ATOM   1268 O  O   . PHE A 1 179 ? -4.221  -18.769 -62.936 1.00 66.14  ? 1556 PHE A O   1 
ATOM   1269 C  CB  . PHE A 1 179 ? -3.059  -16.007 -63.969 1.00 63.48  ? 1556 PHE A CB  1 
ATOM   1270 C  CG  . PHE A 1 179 ? -2.993  -14.528 -63.671 1.00 64.19  ? 1556 PHE A CG  1 
ATOM   1271 C  CD1 . PHE A 1 179 ? -3.407  -13.592 -64.612 1.00 67.80  ? 1556 PHE A CD1 1 
ATOM   1272 C  CD2 . PHE A 1 179 ? -2.511  -14.071 -62.454 1.00 64.16  ? 1556 PHE A CD2 1 
ATOM   1273 C  CE1 . PHE A 1 179 ? -3.349  -12.229 -64.335 1.00 67.32  ? 1556 PHE A CE1 1 
ATOM   1274 C  CE2 . PHE A 1 179 ? -2.459  -12.706 -62.179 1.00 65.85  ? 1556 PHE A CE2 1 
ATOM   1275 C  CZ  . PHE A 1 179 ? -2.877  -11.797 -63.122 1.00 64.68  ? 1556 PHE A CZ  1 
ATOM   1276 N  N   . PRO A 1 180 ? -4.408  -18.737 -65.193 1.00 62.84  ? 1557 PRO A N   1 
ATOM   1277 C  CA  . PRO A 1 180 ? -4.246  -20.199 -65.272 1.00 62.45  ? 1557 PRO A CA  1 
ATOM   1278 C  C   . PRO A 1 180 ? -2.862  -20.643 -64.826 1.00 64.66  ? 1557 PRO A C   1 
ATOM   1279 O  O   . PRO A 1 180 ? -1.870  -19.958 -65.077 1.00 64.18  ? 1557 PRO A O   1 
ATOM   1280 C  CB  . PRO A 1 180 ? -4.477  -20.508 -66.748 1.00 67.05  ? 1557 PRO A CB  1 
ATOM   1281 C  CG  . PRO A 1 180 ? -4.216  -19.241 -67.455 1.00 72.57  ? 1557 PRO A CG  1 
ATOM   1282 C  CD  . PRO A 1 180 ? -4.586  -18.137 -66.532 1.00 65.83  ? 1557 PRO A CD  1 
ATOM   1283 N  N   . TYR A 1 181 ? -2.814  -21.755 -64.110 1.00 61.46  ? 1558 TYR A N   1 
ATOM   1284 C  CA  . TYR A 1 181 ? -1.581  -22.348 -63.607 1.00 62.17  ? 1558 TYR A CA  1 
ATOM   1285 C  C   . TYR A 1 181 ? -1.213  -23.590 -64.447 1.00 68.43  ? 1558 TYR A C   1 
ATOM   1286 O  O   . TYR A 1 181 ? -2.054  -24.461 -64.707 1.00 67.40  ? 1558 TYR A O   1 
ATOM   1287 C  CB  . TYR A 1 181 ? -1.711  -22.642 -62.109 1.00 61.75  ? 1558 TYR A CB  1 
ATOM   1288 C  CG  . TYR A 1 181 ? -0.584  -23.435 -61.498 1.00 64.39  ? 1558 TYR A CG  1 
ATOM   1289 C  CD1 . TYR A 1 181 ? 0.628   -22.831 -61.183 1.00 66.19  ? 1558 TYR A CD1 1 
ATOM   1290 C  CD2 . TYR A 1 181 ? -0.756  -24.768 -61.158 1.00 66.60  ? 1558 TYR A CD2 1 
ATOM   1291 C  CE1 . TYR A 1 181 ? 1.663   -23.551 -60.594 1.00 68.56  ? 1558 TYR A CE1 1 
ATOM   1292 C  CE2 . TYR A 1 181 ? 0.278   -25.506 -60.587 1.00 68.82  ? 1558 TYR A CE2 1 
ATOM   1293 C  CZ  . TYR A 1 181 ? 1.484   -24.891 -60.296 1.00 76.07  ? 1558 TYR A CZ  1 
ATOM   1294 O  OH  . TYR A 1 181 ? 2.491   -25.600 -59.691 1.00 76.17  ? 1558 TYR A OH  1 
ATOM   1295 N  N   . HIS A 1 182 ? 0.049   -23.615 -64.908 1.00 67.56  ? 1559 HIS A N   1 
ATOM   1296 C  CA  . HIS A 1 182 ? 0.617   -24.637 -65.783 1.00 112.45 ? 1559 HIS A CA  1 
ATOM   1297 C  C   . HIS A 1 182 ? 1.569   -25.584 -65.049 1.00 127.02 ? 1559 HIS A C   1 
ATOM   1298 O  O   . HIS A 1 182 ? 1.358   -26.795 -65.054 1.00 82.96  ? 1559 HIS A O   1 
ATOM   1299 C  CB  . HIS A 1 182 ? 1.342   -23.959 -66.959 1.00 115.37 ? 1559 HIS A CB  1 
ATOM   1300 C  CG  . HIS A 1 182 ? 0.522   -22.917 -67.661 1.00 118.50 ? 1559 HIS A CG  1 
ATOM   1301 N  ND1 . HIS A 1 182 ? -0.606  -23.256 -68.381 1.00 121.05 ? 1559 HIS A ND1 1 
ATOM   1302 C  CD2 . HIS A 1 182 ? 0.701   -21.576 -67.734 1.00 119.48 ? 1559 HIS A CD2 1 
ATOM   1303 C  CE1 . HIS A 1 182 ? -1.079  -22.118 -68.866 1.00 120.29 ? 1559 HIS A CE1 1 
ATOM   1304 N  NE2 . HIS A 1 182 ? -0.327  -21.080 -68.503 1.00 119.68 ? 1559 HIS A NE2 1 
ATOM   1305 N  N   . ILE A 1 201 ? -5.114  -26.880 -65.351 1.00 76.54  ? 1578 ILE A N   1 
ATOM   1306 C  CA  . ILE A 1 201 ? -4.413  -27.520 -64.233 1.00 76.31  ? 1578 ILE A CA  1 
ATOM   1307 C  C   . ILE A 1 201 ? -4.841  -26.858 -62.898 1.00 76.77  ? 1578 ILE A C   1 
ATOM   1308 O  O   . ILE A 1 201 ? -5.375  -27.555 -62.012 1.00 76.75  ? 1578 ILE A O   1 
ATOM   1309 C  CB  . ILE A 1 201 ? -2.853  -27.599 -64.480 1.00 81.41  ? 1578 ILE A CB  1 
ATOM   1310 C  CG1 . ILE A 1 201 ? -2.502  -28.822 -65.377 1.00 85.87  ? 1578 ILE A CG1 1 
ATOM   1311 C  CG2 . ILE A 1 201 ? -1.957  -27.545 -63.183 1.00 79.52  ? 1578 ILE A CG2 1 
ATOM   1312 C  CD1 . ILE A 1 201 ? -1.070  -28.829 -66.068 1.00 97.22  ? 1578 ILE A CD1 1 
ATOM   1313 N  N   . GLY A 1 202 ? -4.644  -25.531 -62.798 1.00 68.23  ? 1579 GLY A N   1 
ATOM   1314 C  CA  . GLY A 1 202 ? -5.012  -24.757 -61.618 1.00 62.91  ? 1579 GLY A CA  1 
ATOM   1315 C  C   . GLY A 1 202 ? -5.126  -23.271 -61.846 1.00 61.06  ? 1579 GLY A C   1 
ATOM   1316 O  O   . GLY A 1 202 ? -5.410  -22.816 -62.955 1.00 61.01  ? 1579 GLY A O   1 
ATOM   1317 N  N   . SER A 1 203 ? -4.912  -22.508 -60.775 1.00 54.24  ? 1580 SER A N   1 
ATOM   1318 C  CA  . SER A 1 203 ? -4.974  -21.046 -60.762 1.00 52.39  ? 1580 SER A CA  1 
ATOM   1319 C  C   . SER A 1 203 ? -3.889  -20.407 -59.917 1.00 52.53  ? 1580 SER A C   1 
ATOM   1320 O  O   . SER A 1 203 ? -3.457  -20.976 -58.927 1.00 49.50  ? 1580 SER A O   1 
ATOM   1321 C  CB  . SER A 1 203 ? -6.314  -20.585 -60.209 1.00 55.13  ? 1580 SER A CB  1 
ATOM   1322 O  OG  . SER A 1 203 ? -7.376  -20.844 -61.105 1.00 66.90  ? 1580 SER A OG  1 
ATOM   1323 N  N   . VAL A 1 204 ? -3.484  -19.206 -60.290 1.00 50.20  ? 1581 VAL A N   1 
ATOM   1324 C  CA  . VAL A 1 204 ? -2.563  -18.364 -59.526 1.00 49.38  ? 1581 VAL A CA  1 
ATOM   1325 C  C   . VAL A 1 204 ? -3.455  -17.158 -59.154 1.00 49.98  ? 1581 VAL A C   1 
ATOM   1326 O  O   . VAL A 1 204 ? -3.852  -16.375 -60.025 1.00 48.05  ? 1581 VAL A O   1 
ATOM   1327 C  CB  . VAL A 1 204 ? -1.253  -17.981 -60.273 1.00 54.82  ? 1581 VAL A CB  1 
ATOM   1328 C  CG1 . VAL A 1 204 ? -0.264  -17.312 -59.332 1.00 53.74  ? 1581 VAL A CG1 1 
ATOM   1329 C  CG2 . VAL A 1 204 ? -0.609  -19.196 -60.915 1.00 56.30  ? 1581 VAL A CG2 1 
ATOM   1330 N  N   . VAL A 1 205 ? -3.890  -17.132 -57.891 1.00 46.05  ? 1582 VAL A N   1 
ATOM   1331 C  CA  . VAL A 1 205 ? -4.830  -16.156 -57.350 1.00 46.23  ? 1582 VAL A CA  1 
ATOM   1332 C  C   . VAL A 1 205 ? -4.078  -15.079 -56.576 1.00 50.93  ? 1582 VAL A C   1 
ATOM   1333 O  O   . VAL A 1 205 ? -3.278  -15.411 -55.685 1.00 51.20  ? 1582 VAL A O   1 
ATOM   1334 C  CB  . VAL A 1 205 ? -5.919  -16.841 -56.466 1.00 49.76  ? 1582 VAL A CB  1 
ATOM   1335 C  CG1 . VAL A 1 205 ? -6.909  -15.818 -55.898 1.00 48.54  ? 1582 VAL A CG1 1 
ATOM   1336 C  CG2 . VAL A 1 205 ? -6.653  -17.951 -57.224 1.00 50.36  ? 1582 VAL A CG2 1 
ATOM   1337 N  N   . MET A 1 206 ? -4.348  -13.794 -56.903 1.00 45.51  ? 1583 MET A N   1 
ATOM   1338 C  CA  . MET A 1 206 ? -3.675  -12.678 -56.259 1.00 44.27  ? 1583 MET A CA  1 
ATOM   1339 C  C   . MET A 1 206 ? -4.662  -11.954 -55.377 1.00 45.02  ? 1583 MET A C   1 
ATOM   1340 O  O   . MET A 1 206 ? -5.669  -11.467 -55.862 1.00 45.83  ? 1583 MET A O   1 
ATOM   1341 C  CB  . MET A 1 206 ? -3.016  -11.770 -57.298 1.00 48.46  ? 1583 MET A CB  1 
ATOM   1342 C  CG  . MET A 1 206 ? -2.030  -12.499 -58.149 1.00 54.56  ? 1583 MET A CG  1 
ATOM   1343 S  SD  . MET A 1 206 ? -0.983  -11.444 -59.131 1.00 62.43  ? 1583 MET A SD  1 
ATOM   1344 C  CE  . MET A 1 206 ? 0.210   -12.648 -59.653 1.00 61.11  ? 1583 MET A CE  1 
ATOM   1345 N  N   . LEU A 1 207 ? -4.402  -11.925 -54.072 1.00 38.42  ? 1584 LEU A N   1 
ATOM   1346 C  CA  . LEU A 1 207 ? -5.299  -11.318 -53.106 1.00 36.08  ? 1584 LEU A CA  1 
ATOM   1347 C  C   . LEU A 1 207 ? -4.698  -10.152 -52.331 1.00 37.24  ? 1584 LEU A C   1 
ATOM   1348 O  O   . LEU A 1 207 ? -3.510  -10.157 -51.982 1.00 35.09  ? 1584 LEU A O   1 
ATOM   1349 C  CB  . LEU A 1 207 ? -5.811  -12.363 -52.091 1.00 35.23  ? 1584 LEU A CB  1 
ATOM   1350 C  CG  . LEU A 1 207 ? -6.637  -13.542 -52.597 1.00 41.97  ? 1584 LEU A CG  1 
ATOM   1351 C  CD1 . LEU A 1 207 ? -7.060  -14.473 -51.443 1.00 42.69  ? 1584 LEU A CD1 1 
ATOM   1352 C  CD2 . LEU A 1 207 ? -7.851  -13.105 -53.297 1.00 42.78  ? 1584 LEU A CD2 1 
ATOM   1353 N  N   . GLU A 1 208 ? -5.562  -9.192  -51.981 1.00 32.02  ? 1585 GLU A N   1 
ATOM   1354 C  CA  . GLU A 1 208 ? -5.179  -8.110  -51.117 1.00 31.21  ? 1585 GLU A CA  1 
ATOM   1355 C  C   . GLU A 1 208 ? -5.854  -8.310  -49.756 1.00 31.82  ? 1585 GLU A C   1 
ATOM   1356 O  O   . GLU A 1 208 ? -6.921  -8.896  -49.680 1.00 29.16  ? 1585 GLU A O   1 
ATOM   1357 C  CB  . GLU A 1 208 ? -5.529  -6.760  -51.741 1.00 33.70  ? 1585 GLU A CB  1 
ATOM   1358 C  CG  . GLU A 1 208 ? -4.646  -6.435  -52.930 1.00 50.64  ? 1585 GLU A CG  1 
ATOM   1359 C  CD  . GLU A 1 208 ? -5.026  -5.172  -53.669 1.00 95.10  ? 1585 GLU A CD  1 
ATOM   1360 O  OE1 . GLU A 1 208 ? -6.238  -4.932  -53.892 1.00 108.99 ? 1585 GLU A OE1 1 
ATOM   1361 O  OE2 . GLU A 1 208 ? -4.095  -4.425  -54.043 1.00 95.51  ? 1585 GLU A OE2 1 
ATOM   1362 N  N   . ILE A 1 209 ? -5.213  -7.848  -48.688 1.00 29.59  ? 1586 ILE A N   1 
ATOM   1363 C  CA  . ILE A 1 209 ? -5.727  -7.906  -47.326 1.00 29.00  ? 1586 ILE A CA  1 
ATOM   1364 C  C   . ILE A 1 209 ? -6.140  -6.480  -46.909 1.00 35.32  ? 1586 ILE A C   1 
ATOM   1365 O  O   . ILE A 1 209 ? -5.290  -5.608  -46.774 1.00 37.98  ? 1586 ILE A O   1 
ATOM   1366 C  CB  . ILE A 1 209 ? -4.634  -8.478  -46.390 1.00 32.08  ? 1586 ILE A CB  1 
ATOM   1367 C  CG1 . ILE A 1 209 ? -4.347  -9.934  -46.696 1.00 33.39  ? 1586 ILE A CG1 1 
ATOM   1368 C  CG2 . ILE A 1 209 ? -4.978  -8.302  -44.912 1.00 32.10  ? 1586 ILE A CG2 1 
ATOM   1369 C  CD1 . ILE A 1 209 ? -2.877  -10.365 -46.315 1.00 48.86  ? 1586 ILE A CD1 1 
ATOM   1370 N  N   . ASP A 1 210 ? -7.418  -6.257  -46.689 1.00 31.54  ? 1587 ASP A N   1 
ATOM   1371 C  CA  . ASP A 1 210 ? -7.914  -4.974  -46.244 1.00 33.03  ? 1587 ASP A CA  1 
ATOM   1372 C  C   . ASP A 1 210 ? -8.200  -5.058  -44.756 1.00 38.34  ? 1587 ASP A C   1 
ATOM   1373 O  O   . ASP A 1 210 ? -9.155  -5.698  -44.332 1.00 37.33  ? 1587 ASP A O   1 
ATOM   1374 C  CB  . ASP A 1 210 ? -9.165  -4.546  -47.039 1.00 36.80  ? 1587 ASP A CB  1 
ATOM   1375 C  CG  . ASP A 1 210 ? -9.572  -3.075  -46.845 1.00 49.02  ? 1587 ASP A CG  1 
ATOM   1376 O  OD1 . ASP A 1 210 ? -9.148  -2.465  -45.836 1.00 48.18  ? 1587 ASP A OD1 1 
ATOM   1377 O  OD2 . ASP A 1 210 ? -10.342 -2.545  -47.695 1.00 53.68  ? 1587 ASP A OD2 1 
ATOM   1378 N  N   . ASN A 1 211 ? -7.361  -4.411  -43.967 1.00 38.00  ? 1588 ASN A N   1 
ATOM   1379 C  CA  . ASN A 1 211 ? -7.442  -4.349  -42.502 1.00 38.23  ? 1588 ASN A CA  1 
ATOM   1380 C  C   . ASN A 1 211 ? -8.277  -3.145  -41.987 1.00 46.59  ? 1588 ASN A C   1 
ATOM   1381 O  O   . ASN A 1 211 ? -8.102  -2.738  -40.829 1.00 47.76  ? 1588 ASN A O   1 
ATOM   1382 C  CB  . ASN A 1 211 ? -6.014  -4.319  -41.889 1.00 32.20  ? 1588 ASN A CB  1 
ATOM   1383 C  CG  . ASN A 1 211 ? -5.253  -5.604  -42.003 1.00 41.89  ? 1588 ASN A CG  1 
ATOM   1384 O  OD1 . ASN A 1 211 ? -5.801  -6.687  -41.922 1.00 34.43  ? 1588 ASN A OD1 1 
ATOM   1385 N  ND2 . ASN A 1 211 ? -3.953  -5.530  -42.143 1.00 41.88  ? 1588 ASN A ND2 1 
ATOM   1386 N  N   . ARG A 1 212 ? -9.197  -2.593  -42.820 1.00 43.37  ? 1589 ARG A N   1 
ATOM   1387 C  CA  . ARG A 1 212 ? -10.022 -1.443  -42.398 1.00 43.29  ? 1589 ARG A CA  1 
ATOM   1388 C  C   . ARG A 1 212 ? -10.914 -1.718  -41.159 1.00 45.67  ? 1589 ARG A C   1 
ATOM   1389 O  O   . ARG A 1 212 ? -11.280 -0.777  -40.450 1.00 47.49  ? 1589 ARG A O   1 
ATOM   1390 C  CB  . ARG A 1 212 ? -10.861 -0.856  -43.547 1.00 41.49  ? 1589 ARG A CB  1 
ATOM   1391 C  CG  . ARG A 1 212 ? -12.029 -1.718  -43.966 1.00 35.48  ? 1589 ARG A CG  1 
ATOM   1392 C  CD  . ARG A 1 212 ? -12.893 -0.993  -44.949 1.00 33.35  ? 1589 ARG A CD  1 
ATOM   1393 N  NE  . ARG A 1 212 ? -12.336 -1.009  -46.304 1.00 35.43  ? 1589 ARG A NE  1 
ATOM   1394 C  CZ  . ARG A 1 212 ? -13.027 -0.713  -47.406 1.00 45.45  ? 1589 ARG A CZ  1 
ATOM   1395 N  NH1 . ARG A 1 212 ? -14.298 -0.335  -47.323 1.00 31.22  ? 1589 ARG A NH1 1 
ATOM   1396 N  NH2 . ARG A 1 212 ? -12.456 -0.801  -48.596 1.00 28.48  ? 1589 ARG A NH2 1 
ATOM   1397 N  N   . LEU A 1 213 ? -11.241 -2.977  -40.890 1.00 37.81  ? 1590 LEU A N   1 
ATOM   1398 C  CA  . LEU A 1 213 ? -12.049 -3.298  -39.731 1.00 36.14  ? 1590 LEU A CA  1 
ATOM   1399 C  C   . LEU A 1 213 ? -11.251 -4.040  -38.669 1.00 40.81  ? 1590 LEU A C   1 
ATOM   1400 O  O   . LEU A 1 213 ? -11.693 -4.128  -37.509 1.00 39.51  ? 1590 LEU A O   1 
ATOM   1401 C  CB  . LEU A 1 213 ? -13.269 -4.117  -40.148 1.00 35.19  ? 1590 LEU A CB  1 
ATOM   1402 C  CG  . LEU A 1 213 ? -14.314 -3.431  -41.015 1.00 37.13  ? 1590 LEU A CG  1 
ATOM   1403 C  CD1 . LEU A 1 213 ? -15.469 -4.312  -41.194 1.00 34.46  ? 1590 LEU A CD1 1 
ATOM   1404 C  CD2 . LEU A 1 213 ? -14.763 -2.144  -40.397 1.00 38.53  ? 1590 LEU A CD2 1 
ATOM   1405 N  N   . CYS A 1 214 ? -10.067 -4.573  -39.062 1.00 38.84  ? 1591 CYS A N   1 
ATOM   1406 C  CA  . CYS A 1 214 ? -9.184  -5.270  -38.134 1.00 39.01  ? 1591 CYS A CA  1 
ATOM   1407 C  C   . CYS A 1 214 ? -8.714  -4.274  -37.092 1.00 45.24  ? 1591 CYS A C   1 
ATOM   1408 O  O   . CYS A 1 214 ? -8.780  -4.560  -35.902 1.00 47.54  ? 1591 CYS A O   1 
ATOM   1409 C  CB  . CYS A 1 214 ? -8.002  -5.884  -38.864 1.00 39.02  ? 1591 CYS A CB  1 
ATOM   1410 S  SG  . CYS A 1 214 ? -7.054  -7.048  -37.860 1.00 42.88  ? 1591 CYS A SG  1 
ATOM   1411 N  N   . LEU A 1 215 ? -8.355  -3.063  -37.563 1.00 39.88  ? 1592 LEU A N   1 
ATOM   1412 C  CA  . LEU A 1 215 ? -7.825  -1.943  -36.806 1.00 39.98  ? 1592 LEU A CA  1 
ATOM   1413 C  C   . LEU A 1 215 ? -8.919  -1.103  -36.197 1.00 48.74  ? 1592 LEU A C   1 
ATOM   1414 O  O   . LEU A 1 215 ? -8.647  -0.099  -35.518 1.00 49.75  ? 1592 LEU A O   1 
ATOM   1415 C  CB  . LEU A 1 215 ? -6.877  -1.148  -37.708 1.00 39.29  ? 1592 LEU A CB  1 
ATOM   1416 C  CG  . LEU A 1 215 ? -5.776  -2.030  -38.257 1.00 41.83  ? 1592 LEU A CG  1 
ATOM   1417 C  CD1 . LEU A 1 215 ? -5.207  -1.501  -39.511 1.00 42.59  ? 1592 LEU A CD1 1 
ATOM   1418 C  CD2 . LEU A 1 215 ? -4.773  -2.350  -37.212 1.00 40.99  ? 1592 LEU A CD2 1 
ATOM   1419 N  N   . GLN A 1 216 ? -10.157 -1.581  -36.362 1.00 47.54  ? 1593 GLN A N   1 
ATOM   1420 C  CA  . GLN A 1 216 ? -11.328 -0.963  -35.772 1.00 49.79  ? 1593 GLN A CA  1 
ATOM   1421 C  C   . GLN A 1 216 ? -11.579 -1.630  -34.411 1.00 60.06  ? 1593 GLN A C   1 
ATOM   1422 O  O   . GLN A 1 216 ? -12.726 -1.807  -33.970 1.00 61.45  ? 1593 GLN A O   1 
ATOM   1423 C  CB  . GLN A 1 216 ? -12.525 -1.040  -36.721 1.00 50.69  ? 1593 GLN A CB  1 
ATOM   1424 C  CG  . GLN A 1 216 ? -13.410 0.193   -36.654 1.00 55.24  ? 1593 GLN A CG  1 
ATOM   1425 C  CD  . GLN A 1 216 ? -13.550 0.883   -37.989 1.00 67.30  ? 1593 GLN A CD  1 
ATOM   1426 O  OE1 . GLN A 1 216 ? -14.670 1.014   -38.516 1.00 61.97  ? 1593 GLN A OE1 1 
ATOM   1427 N  NE2 . GLN A 1 216 ? -12.423 1.360   -38.552 1.00 50.61  ? 1593 GLN A NE2 1 
ATOM   1428 N  N   . SER A 1 217 ? -10.445 -1.981  -33.744 1.00 59.27  ? 1594 SER A N   1 
ATOM   1429 C  CA  . SER A 1 217 ? -10.329 -2.575  -32.415 1.00 60.14  ? 1594 SER A CA  1 
ATOM   1430 C  C   . SER A 1 217 ? -11.130 -3.897  -32.307 1.00 64.30  ? 1594 SER A C   1 
ATOM   1431 O  O   . SER A 1 217 ? -11.555 -4.402  -33.356 1.00 62.58  ? 1594 SER A O   1 
ATOM   1432 C  CB  . SER A 1 217 ? -10.685 -1.540  -31.341 1.00 65.57  ? 1594 SER A CB  1 
ATOM   1433 O  OG  . SER A 1 217 ? -9.591  -0.682  -31.056 1.00 74.28  ? 1594 SER A OG  1 
ATOM   1434 N  N   . PRO A 1 218 ? -11.324 -4.519  -31.117 1.00 63.25  ? 1595 PRO A N   1 
ATOM   1435 C  CA  . PRO A 1 218 ? -10.862 -4.125  -29.776 1.00 64.41  ? 1595 PRO A CA  1 
ATOM   1436 C  C   . PRO A 1 218 ? -9.349  -4.341  -29.648 1.00 69.43  ? 1595 PRO A C   1 
ATOM   1437 O  O   . PRO A 1 218 ? -8.598  -3.367  -29.512 1.00 69.61  ? 1595 PRO A O   1 
ATOM   1438 C  CB  . PRO A 1 218 ? -11.745 -4.968  -28.859 1.00 67.07  ? 1595 PRO A CB  1 
ATOM   1439 C  CG  . PRO A 1 218 ? -11.972 -6.247  -29.637 1.00 71.27  ? 1595 PRO A CG  1 
ATOM   1440 C  CD  . PRO A 1 218 ? -12.063 -5.801  -31.077 1.00 65.89  ? 1595 PRO A CD  1 
ATOM   1441 N  N   . GLU A 1 219 ? -8.892  -5.603  -29.771 1.00 65.72  ? 1596 GLU A N   1 
ATOM   1442 C  CA  . GLU A 1 219 ? -7.472  -5.904  -29.807 1.00 65.33  ? 1596 GLU A CA  1 
ATOM   1443 C  C   . GLU A 1 219 ? -7.150  -5.821  -31.305 1.00 63.82  ? 1596 GLU A C   1 
ATOM   1444 O  O   . GLU A 1 219 ? -7.431  -6.740  -32.094 1.00 62.48  ? 1596 GLU A O   1 
ATOM   1445 C  CB  . GLU A 1 219 ? -7.146  -7.291  -29.215 1.00 67.80  ? 1596 GLU A CB  1 
ATOM   1446 C  CG  . GLU A 1 219 ? -7.106  -7.373  -27.693 1.00 83.89  ? 1596 GLU A CG  1 
ATOM   1447 C  CD  . GLU A 1 219 ? -7.221  -8.775  -27.101 1.00 115.06 ? 1596 GLU A CD  1 
ATOM   1448 O  OE1 . GLU A 1 219 ? -6.885  -9.765  -27.794 1.00 96.67  ? 1596 GLU A OE1 1 
ATOM   1449 O  OE2 . GLU A 1 219 ? -7.640  -8.879  -25.925 1.00 121.84 ? 1596 GLU A OE2 1 
ATOM   1450 N  N   . ASN A 1 220 ? -6.674  -4.645  -31.691 1.00 56.78  ? 1597 ASN A N   1 
ATOM   1451 C  CA  . ASN A 1 220 ? -6.316  -4.304  -33.051 1.00 54.82  ? 1597 ASN A CA  1 
ATOM   1452 C  C   . ASN A 1 220 ? -4.836  -4.597  -33.411 1.00 58.56  ? 1597 ASN A C   1 
ATOM   1453 O  O   . ASN A 1 220 ? -4.390  -4.142  -34.468 1.00 59.53  ? 1597 ASN A O   1 
ATOM   1454 C  CB  . ASN A 1 220 ? -6.688  -2.841  -33.317 1.00 52.31  ? 1597 ASN A CB  1 
ATOM   1455 C  CG  . ASN A 1 220 ? -6.124  -1.812  -32.357 1.00 69.06  ? 1597 ASN A CG  1 
ATOM   1456 O  OD1 . ASN A 1 220 ? -5.609  -0.781  -32.779 1.00 59.74  ? 1597 ASN A OD1 1 
ATOM   1457 N  ND2 . ASN A 1 220 ? -6.274  -2.002  -31.051 1.00 63.54  ? 1597 ASN A ND2 1 
ATOM   1458 N  N   . ASP A 1 221 ? -4.087  -5.373  -32.568 1.00 52.00  ? 1598 ASP A N   1 
ATOM   1459 C  CA  . ASP A 1 221 ? -2.660  -5.677  -32.789 1.00 49.75  ? 1598 ASP A CA  1 
ATOM   1460 C  C   . ASP A 1 221 ? -2.404  -7.046  -33.428 1.00 52.90  ? 1598 ASP A C   1 
ATOM   1461 O  O   . ASP A 1 221 ? -1.278  -7.347  -33.859 1.00 51.55  ? 1598 ASP A O   1 
ATOM   1462 C  CB  . ASP A 1 221 ? -1.836  -5.505  -31.503 1.00 50.74  ? 1598 ASP A CB  1 
ATOM   1463 C  CG  . ASP A 1 221 ? -2.573  -5.596  -30.188 1.00 44.61  ? 1598 ASP A CG  1 
ATOM   1464 O  OD1 . ASP A 1 221 ? -3.339  -6.570  -29.999 1.00 40.01  ? 1598 ASP A OD1 1 
ATOM   1465 O  OD2 . ASP A 1 221 ? -2.308  -4.756  -29.313 1.00 49.14  ? 1598 ASP A OD2 1 
ATOM   1466 N  N   . HIS A 1 222 ? -3.478  -7.855  -33.492 1.00 50.51  ? 1599 HIS A N   1 
ATOM   1467 C  CA  . HIS A 1 222 ? -3.610  -9.218  -34.032 1.00 51.03  ? 1599 HIS A CA  1 
ATOM   1468 C  C   . HIS A 1 222 ? -4.046  -9.199  -35.546 1.00 49.95  ? 1599 HIS A C   1 
ATOM   1469 O  O   . HIS A 1 222 ? -4.855  -10.020 -36.043 1.00 49.05  ? 1599 HIS A O   1 
ATOM   1470 C  CB  . HIS A 1 222 ? -4.612  -9.955  -33.127 1.00 53.67  ? 1599 HIS A CB  1 
ATOM   1471 C  CG  . HIS A 1 222 ? -4.024  -10.259 -31.786 1.00 59.46  ? 1599 HIS A CG  1 
ATOM   1472 N  ND1 . HIS A 1 222 ? -3.452  -11.496 -31.506 1.00 62.81  ? 1599 HIS A ND1 1 
ATOM   1473 C  CD2 . HIS A 1 222 ? -3.951  -9.482  -30.682 1.00 62.93  ? 1599 HIS A CD2 1 
ATOM   1474 C  CE1 . HIS A 1 222 ? -3.041  -11.426 -30.248 1.00 63.77  ? 1599 HIS A CE1 1 
ATOM   1475 N  NE2 . HIS A 1 222 ? -3.330  -10.237 -29.707 1.00 64.18  ? 1599 HIS A NE2 1 
ATOM   1476 N  N   . CYS A 1 223 ? -3.451  -8.215  -36.253 1.00 42.24  ? 1600 CYS A N   1 
ATOM   1477 C  CA  . CYS A 1 223 ? -3.665  -7.862  -37.650 1.00 39.66  ? 1600 CYS A CA  1 
ATOM   1478 C  C   . CYS A 1 223 ? -2.421  -8.128  -38.445 1.00 39.66  ? 1600 CYS A C   1 
ATOM   1479 O  O   . CYS A 1 223 ? -1.348  -7.715  -38.029 1.00 40.84  ? 1600 CYS A O   1 
ATOM   1480 C  CB  . CYS A 1 223 ? -4.082  -6.394  -37.766 1.00 40.01  ? 1600 CYS A CB  1 
ATOM   1481 S  SG  . CYS A 1 223 ? -5.624  -5.969  -36.902 1.00 43.66  ? 1600 CYS A SG  1 
ATOM   1482 N  N   . PHE A 1 224 ? -2.553  -8.782  -39.600 1.00 33.36  ? 1601 PHE A N   1 
ATOM   1483 C  CA  . PHE A 1 224 ? -1.400  -9.054  -40.453 1.00 33.05  ? 1601 PHE A CA  1 
ATOM   1484 C  C   . PHE A 1 224 ? -0.888  -7.784  -41.141 1.00 33.87  ? 1601 PHE A C   1 
ATOM   1485 O  O   . PHE A 1 224 ? -1.630  -7.151  -41.877 1.00 30.72  ? 1601 PHE A O   1 
ATOM   1486 C  CB  . PHE A 1 224 ? -1.674  -10.195 -41.441 1.00 35.23  ? 1601 PHE A CB  1 
ATOM   1487 C  CG  . PHE A 1 224 ? -1.954  -11.515 -40.754 1.00 37.63  ? 1601 PHE A CG  1 
ATOM   1488 C  CD1 . PHE A 1 224 ? -0.915  -12.270 -40.189 1.00 39.98  ? 1601 PHE A CD1 1 
ATOM   1489 C  CD2 . PHE A 1 224 ? -3.255  -12.002 -40.658 1.00 39.98  ? 1601 PHE A CD2 1 
ATOM   1490 C  CE1 . PHE A 1 224 ? -1.179  -13.482 -39.544 1.00 40.11  ? 1601 PHE A CE1 1 
ATOM   1491 C  CE2 . PHE A 1 224 ? -3.516  -13.221 -40.025 1.00 42.50  ? 1601 PHE A CE2 1 
ATOM   1492 C  CZ  . PHE A 1 224 ? -2.472  -13.951 -39.471 1.00 39.85  ? 1601 PHE A CZ  1 
ATOM   1493 N  N   . PRO A 1 225 ? 0.363   -7.364  -40.881 1.00 32.90  ? 1602 PRO A N   1 
ATOM   1494 C  CA  . PRO A 1 225 ? 0.859   -6.140  -41.530 1.00 35.21  ? 1602 PRO A CA  1 
ATOM   1495 C  C   . PRO A 1 225 ? 1.195   -6.276  -43.030 1.00 42.05  ? 1602 PRO A C   1 
ATOM   1496 O  O   . PRO A 1 225 ? 1.232   -5.271  -43.758 1.00 41.07  ? 1602 PRO A O   1 
ATOM   1497 C  CB  . PRO A 1 225 ? 2.081   -5.775  -40.679 1.00 37.60  ? 1602 PRO A CB  1 
ATOM   1498 C  CG  . PRO A 1 225 ? 2.553   -7.044  -40.128 1.00 40.71  ? 1602 PRO A CG  1 
ATOM   1499 C  CD  . PRO A 1 225 ? 1.397   -7.978  -40.022 1.00 34.67  ? 1602 PRO A CD  1 
ATOM   1500 N  N   . ASP A 1 226 ? 1.451   -7.523  -43.476 1.00 40.67  ? 1603 ASP A N   1 
ATOM   1501 C  CA  . ASP A 1 226 ? 1.817   -7.844  -44.843 1.00 41.92  ? 1603 ASP A CA  1 
ATOM   1502 C  C   . ASP A 1 226 ? 1.317   -9.209  -45.252 1.00 46.41  ? 1603 ASP A C   1 
ATOM   1503 O  O   . ASP A 1 226 ? 0.995   -10.035 -44.387 1.00 46.94  ? 1603 ASP A O   1 
ATOM   1504 C  CB  . ASP A 1 226 ? 3.342   -7.724  -44.999 1.00 46.10  ? 1603 ASP A CB  1 
ATOM   1505 C  CG  . ASP A 1 226 ? 4.129   -8.903  -45.519 1.00 67.67  ? 1603 ASP A CG  1 
ATOM   1506 O  OD1 . ASP A 1 226 ? 4.075   -9.160  -46.757 1.00 68.65  ? 1603 ASP A OD1 1 
ATOM   1507 O  OD2 . ASP A 1 226 ? 4.907   -9.482  -44.730 1.00 80.35  ? 1603 ASP A OD2 1 
ATOM   1508 N  N   . ALA A 1 227 ? 1.293   -9.458  -46.579 1.00 41.84  ? 1604 ALA A N   1 
ATOM   1509 C  CA  . ALA A 1 227 ? 0.908   -10.729 -47.199 1.00 40.18  ? 1604 ALA A CA  1 
ATOM   1510 C  C   . ALA A 1 227 ? 1.765   -11.951 -46.779 1.00 41.79  ? 1604 ALA A C   1 
ATOM   1511 O  O   . ALA A 1 227 ? 1.204   -13.044 -46.685 1.00 40.31  ? 1604 ALA A O   1 
ATOM   1512 C  CB  . ALA A 1 227 ? 0.918   -10.588 -48.701 1.00 41.49  ? 1604 ALA A CB  1 
ATOM   1513 N  N   . GLN A 1 228 ? 3.096   -11.788 -46.524 1.00 37.22  ? 1605 GLN A N   1 
ATOM   1514 C  CA  . GLN A 1 228 ? 3.923   -12.927 -46.100 1.00 37.22  ? 1605 GLN A CA  1 
ATOM   1515 C  C   . GLN A 1 228 ? 3.542   -13.439 -44.727 1.00 41.94  ? 1605 GLN A C   1 
ATOM   1516 O  O   . GLN A 1 228 ? 3.574   -14.642 -44.505 1.00 42.18  ? 1605 GLN A O   1 
ATOM   1517 C  CB  . GLN A 1 228 ? 5.434   -12.663 -46.178 1.00 39.30  ? 1605 GLN A CB  1 
ATOM   1518 C  CG  . GLN A 1 228 ? 6.305   -13.931 -46.013 1.00 52.46  ? 1605 GLN A CG  1 
ATOM   1519 C  CD  . GLN A 1 228 ? 5.994   -15.068 -46.998 1.00 73.57  ? 1605 GLN A CD  1 
ATOM   1520 O  OE1 . GLN A 1 228 ? 5.958   -14.895 -48.223 1.00 64.92  ? 1605 GLN A OE1 1 
ATOM   1521 N  NE2 . GLN A 1 228 ? 5.777   -16.269 -46.497 1.00 71.06  ? 1605 GLN A NE2 1 
ATOM   1522 N  N   . SER A 1 229 ? 3.159   -12.529 -43.817 1.00 38.96  ? 1606 SER A N   1 
ATOM   1523 C  CA  . SER A 1 229 ? 2.728   -12.838 -42.447 1.00 38.00  ? 1606 SER A CA  1 
ATOM   1524 C  C   . SER A 1 229 ? 1.517   -13.750 -42.481 1.00 35.56  ? 1606 SER A C   1 
ATOM   1525 O  O   . SER A 1 229 ? 1.472   -14.752 -41.748 1.00 33.20  ? 1606 SER A O   1 
ATOM   1526 C  CB  . SER A 1 229 ? 2.392   -11.547 -41.692 1.00 43.74  ? 1606 SER A CB  1 
ATOM   1527 O  OG  . SER A 1 229 ? 3.584   -10.861 -41.336 1.00 59.49  ? 1606 SER A OG  1 
ATOM   1528 N  N   . ALA A 1 230 ? 0.545   -13.393 -43.365 1.00 28.45  ? 1607 ALA A N   1 
ATOM   1529 C  CA  . ALA A 1 230 ? -0.684  -14.147 -43.588 1.00 25.86  ? 1607 ALA A CA  1 
ATOM   1530 C  C   . ALA A 1 230 ? -0.358  -15.512 -44.219 1.00 28.11  ? 1607 ALA A C   1 
ATOM   1531 O  O   . ALA A 1 230 ? -0.957  -16.506 -43.829 1.00 24.99  ? 1607 ALA A O   1 
ATOM   1532 C  CB  . ALA A 1 230 ? -1.627  -13.366 -44.480 1.00 25.45  ? 1607 ALA A CB  1 
ATOM   1533 N  N   . ALA A 1 231 ? 0.596   -15.558 -45.183 1.00 26.37  ? 1608 ALA A N   1 
ATOM   1534 C  CA  . ALA A 1 231 ? 1.013   -16.774 -45.865 1.00 27.05  ? 1608 ALA A CA  1 
ATOM   1535 C  C   . ALA A 1 231 ? 1.659   -17.724 -44.872 1.00 34.91  ? 1608 ALA A C   1 
ATOM   1536 O  O   . ALA A 1 231 ? 1.318   -18.901 -44.900 1.00 36.74  ? 1608 ALA A O   1 
ATOM   1537 C  CB  . ALA A 1 231 ? 1.968   -16.439 -46.993 1.00 28.53  ? 1608 ALA A CB  1 
ATOM   1538 N  N   . ASP A 1 232 ? 2.540   -17.225 -43.959 1.00 32.27  ? 1609 ASP A N   1 
ATOM   1539 C  CA  . ASP A 1 232 ? 3.176   -18.033 -42.898 1.00 33.08  ? 1609 ASP A CA  1 
ATOM   1540 C  C   . ASP A 1 232 ? 2.137   -18.613 -41.958 1.00 35.45  ? 1609 ASP A C   1 
ATOM   1541 O  O   . ASP A 1 232 ? 2.228   -19.782 -41.618 1.00 34.35  ? 1609 ASP A O   1 
ATOM   1542 C  CB  . ASP A 1 232 ? 4.160   -17.195 -42.062 1.00 36.40  ? 1609 ASP A CB  1 
ATOM   1543 C  CG  . ASP A 1 232 ? 5.362   -16.663 -42.808 1.00 52.79  ? 1609 ASP A CG  1 
ATOM   1544 O  OD1 . ASP A 1 232 ? 5.601   -17.118 -43.952 1.00 57.46  ? 1609 ASP A OD1 1 
ATOM   1545 O  OD2 . ASP A 1 232 ? 6.065   -15.782 -42.251 1.00 51.56  ? 1609 ASP A OD2 1 
ATOM   1546 N  N   . TYR A 1 233 ? 1.151   -17.792 -41.532 1.00 33.12  ? 1610 TYR A N   1 
ATOM   1547 C  CA  . TYR A 1 233 ? 0.075   -18.250 -40.668 1.00 33.11  ? 1610 TYR A CA  1 
ATOM   1548 C  C   . TYR A 1 233 ? -0.722  -19.392 -41.344 1.00 39.56  ? 1610 TYR A C   1 
ATOM   1549 O  O   . TYR A 1 233 ? -0.981  -20.397 -40.690 1.00 41.30  ? 1610 TYR A O   1 
ATOM   1550 C  CB  . TYR A 1 233 ? -0.826  -17.095 -40.255 1.00 32.70  ? 1610 TYR A CB  1 
ATOM   1551 C  CG  . TYR A 1 233 ? -2.011  -17.548 -39.455 1.00 35.76  ? 1610 TYR A CG  1 
ATOM   1552 C  CD1 . TYR A 1 233 ? -1.855  -18.039 -38.158 1.00 39.07  ? 1610 TYR A CD1 1 
ATOM   1553 C  CD2 . TYR A 1 233 ? -3.288  -17.551 -40.013 1.00 37.23  ? 1610 TYR A CD2 1 
ATOM   1554 C  CE1 . TYR A 1 233 ? -2.948  -18.520 -37.436 1.00 42.56  ? 1610 TYR A CE1 1 
ATOM   1555 C  CE2 . TYR A 1 233 ? -4.391  -18.009 -39.294 1.00 39.35  ? 1610 TYR A CE2 1 
ATOM   1556 C  CZ  . TYR A 1 233 ? -4.216  -18.502 -38.011 1.00 49.26  ? 1610 TYR A CZ  1 
ATOM   1557 O  OH  . TYR A 1 233 ? -5.332  -18.920 -37.338 1.00 48.72  ? 1610 TYR A OH  1 
ATOM   1558 N  N   . LEU A 1 234 ? -1.057  -19.265 -42.645 1.00 35.16  ? 1611 LEU A N   1 
ATOM   1559 C  CA  . LEU A 1 234 ? -1.767  -20.297 -43.390 1.00 35.13  ? 1611 LEU A CA  1 
ATOM   1560 C  C   . LEU A 1 234 ? -0.926  -21.552 -43.498 1.00 43.07  ? 1611 LEU A C   1 
ATOM   1561 O  O   . LEU A 1 234 ? -1.487  -22.652 -43.482 1.00 45.81  ? 1611 LEU A O   1 
ATOM   1562 C  CB  . LEU A 1 234 ? -2.162  -19.824 -44.790 1.00 35.08  ? 1611 LEU A CB  1 
ATOM   1563 C  CG  . LEU A 1 234 ? -3.277  -18.784 -44.895 1.00 39.91  ? 1611 LEU A CG  1 
ATOM   1564 C  CD1 . LEU A 1 234 ? -3.373  -18.221 -46.302 1.00 39.70  ? 1611 LEU A CD1 1 
ATOM   1565 C  CD2 . LEU A 1 234 ? -4.618  -19.363 -44.508 1.00 43.63  ? 1611 LEU A CD2 1 
ATOM   1566 N  N   . GLY A 1 235 ? 0.397   -21.390 -43.609 1.00 39.38  ? 1612 GLY A N   1 
ATOM   1567 C  CA  . GLY A 1 235 ? 1.325   -22.508 -43.711 1.00 40.87  ? 1612 GLY A CA  1 
ATOM   1568 C  C   . GLY A 1 235 ? 1.378   -23.283 -42.418 1.00 46.47  ? 1612 GLY A C   1 
ATOM   1569 O  O   . GLY A 1 235 ? 1.425   -24.509 -42.435 1.00 46.71  ? 1612 GLY A O   1 
ATOM   1570 N  N   . ALA A 1 236 ? 1.339   -22.554 -41.292 1.00 44.18  ? 1613 ALA A N   1 
ATOM   1571 C  CA  . ALA A 1 236 ? 1.345   -23.090 -39.938 1.00 44.97  ? 1613 ALA A CA  1 
ATOM   1572 C  C   . ALA A 1 236 ? 0.079   -23.902 -39.673 1.00 50.74  ? 1613 ALA A C   1 
ATOM   1573 O  O   . ALA A 1 236 ? 0.167   -24.898 -38.950 1.00 54.47  ? 1613 ALA A O   1 
ATOM   1574 C  CB  . ALA A 1 236 ? 1.446   -21.964 -38.942 1.00 44.81  ? 1613 ALA A CB  1 
ATOM   1575 N  N   . LEU A 1 237 ? -1.087  -23.492 -40.247 1.00 43.26  ? 1614 LEU A N   1 
ATOM   1576 C  CA  . LEU A 1 237 ? -2.362  -24.203 -40.100 1.00 42.21  ? 1614 LEU A CA  1 
ATOM   1577 C  C   . LEU A 1 237 ? -2.352  -25.497 -40.918 1.00 45.92  ? 1614 LEU A C   1 
ATOM   1578 O  O   . LEU A 1 237 ? -2.846  -26.534 -40.469 1.00 46.76  ? 1614 LEU A O   1 
ATOM   1579 C  CB  . LEU A 1 237 ? -3.536  -23.323 -40.546 1.00 41.08  ? 1614 LEU A CB  1 
ATOM   1580 C  CG  . LEU A 1 237 ? -3.964  -22.228 -39.597 1.00 45.42  ? 1614 LEU A CG  1 
ATOM   1581 C  CD1 . LEU A 1 237 ? -4.998  -21.337 -40.239 1.00 43.32  ? 1614 LEU A CD1 1 
ATOM   1582 C  CD2 . LEU A 1 237 ? -4.525  -22.822 -38.327 1.00 52.08  ? 1614 LEU A CD2 1 
ATOM   1583 N  N   . SER A 1 238 ? -1.783  -25.436 -42.124 1.00 40.72  ? 1615 SER A N   1 
ATOM   1584 C  CA  . SER A 1 238 ? -1.679  -26.599 -42.996 1.00 40.59  ? 1615 SER A CA  1 
ATOM   1585 C  C   . SER A 1 238 ? -0.705  -27.624 -42.391 1.00 46.64  ? 1615 SER A C   1 
ATOM   1586 O  O   . SER A 1 238 ? -0.929  -28.819 -42.539 1.00 48.95  ? 1615 SER A O   1 
ATOM   1587 C  CB  . SER A 1 238 ? -1.201  -26.165 -44.377 1.00 41.58  ? 1615 SER A CB  1 
ATOM   1588 O  OG  . SER A 1 238 ? -1.089  -27.260 -45.270 1.00 44.27  ? 1615 SER A OG  1 
ATOM   1589 N  N   . ALA A 1 239 ? 0.370   -27.148 -41.716 1.00 41.73  ? 1616 ALA A N   1 
ATOM   1590 C  CA  . ALA A 1 239 ? 1.406   -27.955 -41.079 1.00 41.87  ? 1616 ALA A CA  1 
ATOM   1591 C  C   . ALA A 1 239 ? 0.834   -28.734 -39.893 1.00 47.04  ? 1616 ALA A C   1 
ATOM   1592 O  O   . ALA A 1 239 ? 1.196   -29.901 -39.688 1.00 48.82  ? 1616 ALA A O   1 
ATOM   1593 C  CB  . ALA A 1 239 ? 2.550   -27.062 -40.617 1.00 41.93  ? 1616 ALA A CB  1 
ATOM   1594 N  N   . VAL A 1 240 ? -0.056  -28.094 -39.107 1.00 41.29  ? 1617 VAL A N   1 
ATOM   1595 C  CA  . VAL A 1 240 ? -0.659  -28.756 -37.952 1.00 41.03  ? 1617 VAL A CA  1 
ATOM   1596 C  C   . VAL A 1 240 ? -2.011  -29.411 -38.306 1.00 46.62  ? 1617 VAL A C   1 
ATOM   1597 O  O   . VAL A 1 240 ? -2.718  -29.856 -37.406 1.00 47.42  ? 1617 VAL A O   1 
ATOM   1598 C  CB  . VAL A 1 240 ? -0.739  -27.858 -36.694 1.00 41.93  ? 1617 VAL A CB  1 
ATOM   1599 C  CG1 . VAL A 1 240 ? 0.627   -27.356 -36.281 1.00 41.19  ? 1617 VAL A CG1 1 
ATOM   1600 C  CG2 . VAL A 1 240 ? -1.706  -26.708 -36.875 1.00 39.53  ? 1617 VAL A CG2 1 
ATOM   1601 N  N   . GLU A 1 241 ? -2.356  -29.479 -39.611 1.00 43.35  ? 1618 GLU A N   1 
ATOM   1602 C  CA  . GLU A 1 241 ? -3.590  -30.081 -40.130 1.00 43.69  ? 1618 GLU A CA  1 
ATOM   1603 C  C   . GLU A 1 241 ? -4.851  -29.424 -39.565 1.00 47.46  ? 1618 GLU A C   1 
ATOM   1604 O  O   . GLU A 1 241 ? -5.847  -30.112 -39.362 1.00 49.50  ? 1618 GLU A O   1 
ATOM   1605 C  CB  . GLU A 1 241 ? -3.608  -31.623 -39.911 1.00 47.57  ? 1618 GLU A CB  1 
ATOM   1606 C  CG  . GLU A 1 241 ? -2.808  -32.411 -40.937 1.00 63.95  ? 1618 GLU A CG  1 
ATOM   1607 C  CD  . GLU A 1 241 ? -2.276  -33.785 -40.551 1.00 92.11  ? 1618 GLU A CD  1 
ATOM   1608 O  OE1 . GLU A 1 241 ? -3.022  -34.575 -39.929 1.00 106.92 ? 1618 GLU A OE1 1 
ATOM   1609 O  OE2 . GLU A 1 241 ? -1.113  -34.085 -40.904 1.00 75.71  ? 1618 GLU A OE2 1 
ATOM   1610 N  N   . ARG A 1 242 ? -4.821  -28.107 -39.299 1.00 42.87  ? 1619 ARG A N   1 
ATOM   1611 C  CA  . ARG A 1 242 ? -5.977  -27.377 -38.752 1.00 42.04  ? 1619 ARG A CA  1 
ATOM   1612 C  C   . ARG A 1 242 ? -6.546  -26.363 -39.752 1.00 46.91  ? 1619 ARG A C   1 
ATOM   1613 O  O   . ARG A 1 242 ? -7.373  -25.542 -39.376 1.00 47.37  ? 1619 ARG A O   1 
ATOM   1614 C  CB  . ARG A 1 242 ? -5.646  -26.755 -37.362 1.00 41.54  ? 1619 ARG A CB  1 
ATOM   1615 C  CG  . ARG A 1 242 ? -6.659  -25.745 -36.765 1.00 54.28  ? 1619 ARG A CG  1 
ATOM   1616 C  CD  . ARG A 1 242 ? -7.421  -26.256 -35.539 1.00 70.73  ? 1619 ARG A CD  1 
ATOM   1617 N  NE  . ARG A 1 242 ? -6.778  -25.884 -34.273 1.00 77.85  ? 1619 ARG A NE  1 
ATOM   1618 C  CZ  . ARG A 1 242 ? -7.264  -24.997 -33.409 1.00 82.16  ? 1619 ARG A CZ  1 
ATOM   1619 N  NH1 . ARG A 1 242 ? -8.416  -24.384 -33.654 1.00 56.33  ? 1619 ARG A NH1 1 
ATOM   1620 N  NH2 . ARG A 1 242 ? -6.593  -24.707 -32.297 1.00 69.53  ? 1619 ARG A NH2 1 
ATOM   1621 N  N   . LEU A 1 243 ? -6.165  -26.463 -41.031 1.00 44.99  ? 1620 LEU A N   1 
ATOM   1622 C  CA  . LEU A 1 243 ? -6.683  -25.598 -42.082 1.00 45.03  ? 1620 LEU A CA  1 
ATOM   1623 C  C   . LEU A 1 243 ? -7.896  -26.291 -42.698 1.00 53.38  ? 1620 LEU A C   1 
ATOM   1624 O  O   . LEU A 1 243 ? -7.756  -27.390 -43.279 1.00 53.77  ? 1620 LEU A O   1 
ATOM   1625 C  CB  . LEU A 1 243 ? -5.599  -25.289 -43.126 1.00 45.41  ? 1620 LEU A CB  1 
ATOM   1626 C  CG  . LEU A 1 243 ? -6.022  -24.454 -44.330 1.00 50.23  ? 1620 LEU A CG  1 
ATOM   1627 C  CD1 . LEU A 1 243 ? -6.443  -23.071 -43.922 1.00 49.60  ? 1620 LEU A CD1 1 
ATOM   1628 C  CD2 . LEU A 1 243 ? -4.909  -24.343 -45.336 1.00 52.79  ? 1620 LEU A CD2 1 
ATOM   1629 N  N   . ASP A 1 244 ? -9.107  -25.642 -42.519 1.00 50.88  ? 1621 ASP A N   1 
ATOM   1630 C  CA  . ASP A 1 244 ? -10.427 -26.127 -42.981 1.00 51.04  ? 1621 ASP A CA  1 
ATOM   1631 C  C   . ASP A 1 244 ? -10.888 -25.279 -44.117 1.00 52.69  ? 1621 ASP A C   1 
ATOM   1632 O  O   . ASP A 1 244 ? -11.775 -24.438 -43.969 1.00 50.99  ? 1621 ASP A O   1 
ATOM   1633 C  CB  . ASP A 1 244 ? -11.498 -26.128 -41.867 1.00 53.03  ? 1621 ASP A CB  1 
ATOM   1634 C  CG  . ASP A 1 244 ? -11.069 -26.661 -40.518 1.00 69.97  ? 1621 ASP A CG  1 
ATOM   1635 O  OD1 . ASP A 1 244 ? -10.592 -27.840 -40.455 1.00 70.78  ? 1621 ASP A OD1 1 
ATOM   1636 O  OD2 . ASP A 1 244 ? -11.211 -25.916 -39.522 1.00 78.29  ? 1621 ASP A OD2 1 
ATOM   1637 N  N   . PHE A 1 245 ? -10.261 -25.493 -45.264 1.00 49.73  ? 1622 PHE A N   1 
ATOM   1638 C  CA  . PHE A 1 245 ? -10.521 -24.742 -46.473 1.00 48.74  ? 1622 PHE A CA  1 
ATOM   1639 C  C   . PHE A 1 245 ? -10.880 -25.711 -47.592 1.00 50.08  ? 1622 PHE A C   1 
ATOM   1640 O  O   . PHE A 1 245 ? -10.018 -26.480 -48.025 1.00 50.75  ? 1622 PHE A O   1 
ATOM   1641 C  CB  . PHE A 1 245 ? -9.287  -23.896 -46.801 1.00 50.52  ? 1622 PHE A CB  1 
ATOM   1642 C  CG  . PHE A 1 245 ? -9.530  -22.822 -47.804 1.00 51.71  ? 1622 PHE A CG  1 
ATOM   1643 C  CD1 . PHE A 1 245 ? -10.580 -21.941 -47.651 1.00 52.69  ? 1622 PHE A CD1 1 
ATOM   1644 C  CD2 . PHE A 1 245 ? -8.685  -22.668 -48.889 1.00 55.88  ? 1622 PHE A CD2 1 
ATOM   1645 C  CE1 . PHE A 1 245 ? -10.793 -20.943 -48.570 1.00 54.06  ? 1622 PHE A CE1 1 
ATOM   1646 C  CE2 . PHE A 1 245 ? -8.895  -21.654 -49.807 1.00 58.52  ? 1622 PHE A CE2 1 
ATOM   1647 C  CZ  . PHE A 1 245 ? -9.940  -20.790 -49.633 1.00 55.27  ? 1622 PHE A CZ  1 
ATOM   1648 N  N   . PRO A 1 246 ? -12.163 -25.710 -48.038 1.00 44.40  ? 1623 PRO A N   1 
ATOM   1649 C  CA  . PRO A 1 246 ? -12.608 -26.695 -49.039 1.00 44.94  ? 1623 PRO A CA  1 
ATOM   1650 C  C   . PRO A 1 246 ? -12.175 -26.421 -50.479 1.00 48.08  ? 1623 PRO A C   1 
ATOM   1651 O  O   . PRO A 1 246 ? -13.009 -26.476 -51.402 1.00 48.92  ? 1623 PRO A O   1 
ATOM   1652 C  CB  . PRO A 1 246 ? -14.132 -26.705 -48.880 1.00 46.37  ? 1623 PRO A CB  1 
ATOM   1653 C  CG  . PRO A 1 246 ? -14.446 -25.327 -48.465 1.00 49.36  ? 1623 PRO A CG  1 
ATOM   1654 C  CD  . PRO A 1 246 ? -13.291 -24.862 -47.598 1.00 44.48  ? 1623 PRO A CD  1 
ATOM   1655 N  N   . TYR A 1 247 ? -10.863 -26.157 -50.671 1.00 41.59  ? 1624 TYR A N   1 
ATOM   1656 C  CA  . TYR A 1 247 ? -10.275 -25.882 -51.971 1.00 41.20  ? 1624 TYR A CA  1 
ATOM   1657 C  C   . TYR A 1 247 ? -8.936  -26.560 -52.081 1.00 47.97  ? 1624 TYR A C   1 
ATOM   1658 O  O   . TYR A 1 247 ? -8.227  -26.612 -51.073 1.00 47.85  ? 1624 TYR A O   1 
ATOM   1659 C  CB  . TYR A 1 247 ? -10.140 -24.369 -52.186 1.00 40.53  ? 1624 TYR A CB  1 
ATOM   1660 C  CG  . TYR A 1 247 ? -11.470 -23.669 -52.314 1.00 41.21  ? 1624 TYR A CG  1 
ATOM   1661 C  CD1 . TYR A 1 247 ? -12.109 -23.565 -53.547 1.00 44.00  ? 1624 TYR A CD1 1 
ATOM   1662 C  CD2 . TYR A 1 247 ? -12.112 -23.142 -51.198 1.00 40.28  ? 1624 TYR A CD2 1 
ATOM   1663 C  CE1 . TYR A 1 247 ? -13.355 -22.957 -53.664 1.00 43.76  ? 1624 TYR A CE1 1 
ATOM   1664 C  CE2 . TYR A 1 247 ? -13.367 -22.553 -51.300 1.00 40.24  ? 1624 TYR A CE2 1 
ATOM   1665 C  CZ  . TYR A 1 247 ? -13.982 -22.457 -52.537 1.00 45.65  ? 1624 TYR A CZ  1 
ATOM   1666 O  OH  . TYR A 1 247 ? -15.198 -21.841 -52.652 1.00 42.48  ? 1624 TYR A OH  1 
ATOM   1667 N  N   . PRO A 1 248 ? -8.541  -27.056 -53.280 1.00 48.13  ? 1625 PRO A N   1 
ATOM   1668 C  CA  . PRO A 1 248 ? -7.207  -27.686 -53.405 1.00 50.14  ? 1625 PRO A CA  1 
ATOM   1669 C  C   . PRO A 1 248 ? -6.053  -26.664 -53.451 1.00 51.51  ? 1625 PRO A C   1 
ATOM   1670 O  O   . PRO A 1 248 ? -5.429  -26.462 -54.501 1.00 51.77  ? 1625 PRO A O   1 
ATOM   1671 C  CB  . PRO A 1 248 ? -7.330  -28.505 -54.690 1.00 54.61  ? 1625 PRO A CB  1 
ATOM   1672 C  CG  . PRO A 1 248 ? -8.324  -27.736 -55.523 1.00 58.52  ? 1625 PRO A CG  1 
ATOM   1673 C  CD  . PRO A 1 248 ? -9.263  -27.048 -54.573 1.00 51.22  ? 1625 PRO A CD  1 
ATOM   1674 N  N   . LEU A 1 249 ? -5.794  -26.002 -52.296 1.00 44.01  ? 1626 LEU A N   1 
ATOM   1675 C  CA  . LEU A 1 249 ? -4.763  -24.995 -52.113 1.00 41.42  ? 1626 LEU A CA  1 
ATOM   1676 C  C   . LEU A 1 249 ? -3.377  -25.670 -51.988 1.00 48.11  ? 1626 LEU A C   1 
ATOM   1677 O  O   . LEU A 1 249 ? -3.109  -26.365 -51.005 1.00 48.67  ? 1626 LEU A O   1 
ATOM   1678 C  CB  . LEU A 1 249 ? -5.113  -24.132 -50.892 1.00 38.80  ? 1626 LEU A CB  1 
ATOM   1679 C  CG  . LEU A 1 249 ? -4.115  -23.029 -50.469 1.00 41.19  ? 1626 LEU A CG  1 
ATOM   1680 C  CD1 . LEU A 1 249 ? -4.017  -21.941 -51.501 1.00 41.63  ? 1626 LEU A CD1 1 
ATOM   1681 C  CD2 . LEU A 1 249 ? -4.503  -22.416 -49.129 1.00 35.69  ? 1626 LEU A CD2 1 
ATOM   1682 N  N   . ARG A 1 250 ? -2.508  -25.459 -53.000 1.00 45.61  ? 1627 ARG A N   1 
ATOM   1683 C  CA  . ARG A 1 250 ? -1.162  -26.037 -53.110 1.00 46.65  ? 1627 ARG A CA  1 
ATOM   1684 C  C   . ARG A 1 250 ? -0.130  -25.249 -52.334 1.00 48.79  ? 1627 ARG A C   1 
ATOM   1685 O  O   . ARG A 1 250 ? 0.585   -25.834 -51.525 1.00 48.95  ? 1627 ARG A O   1 
ATOM   1686 C  CB  . ARG A 1 250 ? -0.750  -26.169 -54.599 1.00 49.55  ? 1627 ARG A CB  1 
ATOM   1687 C  CG  . ARG A 1 250 ? 0.586   -26.865 -54.896 1.00 62.48  ? 1627 ARG A CG  1 
ATOM   1688 C  CD  . ARG A 1 250 ? 0.412   -28.175 -55.642 1.00 88.60  ? 1627 ARG A CD  1 
ATOM   1689 N  NE  . ARG A 1 250 ? 1.013   -28.146 -56.978 1.00 113.25 ? 1627 ARG A NE  1 
ATOM   1690 C  CZ  . ARG A 1 250 ? 0.937   -29.145 -57.859 1.00 138.25 ? 1627 ARG A CZ  1 
ATOM   1691 N  NH1 . ARG A 1 250 ? 0.278   -30.257 -57.560 1.00 126.83 ? 1627 ARG A NH1 1 
ATOM   1692 N  NH2 . ARG A 1 250 ? 1.520   -29.038 -59.045 1.00 131.39 ? 1627 ARG A NH2 1 
ATOM   1693 N  N   . ASP A 1 251 ? -0.035  -23.931 -52.587 1.00 43.55  ? 1628 ASP A N   1 
ATOM   1694 C  CA  . ASP A 1 251 ? 0.953   -23.075 -51.948 1.00 42.01  ? 1628 ASP A CA  1 
ATOM   1695 C  C   . ASP A 1 251 ? 0.482   -21.651 -51.719 1.00 44.63  ? 1628 ASP A C   1 
ATOM   1696 O  O   . ASP A 1 251 ? -0.485  -21.210 -52.333 1.00 44.55  ? 1628 ASP A O   1 
ATOM   1697 C  CB  . ASP A 1 251 ? 2.262   -23.081 -52.753 1.00 45.27  ? 1628 ASP A CB  1 
ATOM   1698 C  CG  . ASP A 1 251 ? 2.114   -22.703 -54.205 1.00 59.51  ? 1628 ASP A CG  1 
ATOM   1699 O  OD1 . ASP A 1 251 ? 1.781   -21.528 -54.483 1.00 62.14  ? 1628 ASP A OD1 1 
ATOM   1700 O  OD2 . ASP A 1 251 ? 2.303   -23.583 -55.062 1.00 65.24  ? 1628 ASP A OD2 1 
ATOM   1701 N  N   . VAL A 1 252 ? 1.188   -20.929 -50.838 1.00 39.28  ? 1629 VAL A N   1 
ATOM   1702 C  CA  . VAL A 1 252 ? 0.949   -19.533 -50.505 1.00 36.77  ? 1629 VAL A CA  1 
ATOM   1703 C  C   . VAL A 1 252 ? 2.271   -18.795 -50.355 1.00 44.74  ? 1629 VAL A C   1 
ATOM   1704 O  O   . VAL A 1 252 ? 3.248   -19.378 -49.868 1.00 45.21  ? 1629 VAL A O   1 
ATOM   1705 C  CB  . VAL A 1 252 ? 0.048   -19.320 -49.269 1.00 37.02  ? 1629 VAL A CB  1 
ATOM   1706 C  CG1 . VAL A 1 252 ? -1.366  -19.782 -49.531 1.00 36.46  ? 1629 VAL A CG1 1 
ATOM   1707 C  CG2 . VAL A 1 252 ? 0.608   -19.983 -48.034 1.00 36.20  ? 1629 VAL A CG2 1 
ATOM   1708 N  N   . ARG A 1 253 ? 2.290   -17.499 -50.729 1.00 42.75  ? 1630 ARG A N   1 
ATOM   1709 C  CA  . ARG A 1 253 ? 3.454   -16.622 -50.582 1.00 43.63  ? 1630 ARG A CA  1 
ATOM   1710 C  C   . ARG A 1 253 ? 3.015   -15.173 -50.604 1.00 49.40  ? 1630 ARG A C   1 
ATOM   1711 O  O   . ARG A 1 253 ? 1.957   -14.861 -51.150 1.00 49.38  ? 1630 ARG A O   1 
ATOM   1712 C  CB  . ARG A 1 253 ? 4.533   -16.890 -51.668 1.00 44.20  ? 1630 ARG A CB  1 
ATOM   1713 C  CG  . ARG A 1 253 ? 4.111   -16.553 -53.103 1.00 51.60  ? 1630 ARG A CG  1 
ATOM   1714 C  CD  . ARG A 1 253 ? 5.181   -16.906 -54.119 1.00 58.85  ? 1630 ARG A CD  1 
ATOM   1715 N  NE  . ARG A 1 253 ? 4.879   -16.364 -55.446 1.00 64.20  ? 1630 ARG A NE  1 
ATOM   1716 C  CZ  . ARG A 1 253 ? 4.125   -16.978 -56.358 1.00 83.12  ? 1630 ARG A CZ  1 
ATOM   1717 N  NH1 . ARG A 1 253 ? 3.582   -18.163 -56.094 1.00 69.91  ? 1630 ARG A NH1 1 
ATOM   1718 N  NH2 . ARG A 1 253 ? 3.901   -16.408 -57.537 1.00 70.88  ? 1630 ARG A NH2 1 
ATOM   1719 N  N   . GLY A 1 254 ? 3.846   -14.309 -50.035 1.00 46.81  ? 1631 GLY A N   1 
ATOM   1720 C  CA  . GLY A 1 254 ? 3.667   -12.866 -50.079 1.00 46.32  ? 1631 GLY A CA  1 
ATOM   1721 C  C   . GLY A 1 254 ? 4.602   -12.313 -51.139 1.00 52.22  ? 1631 GLY A C   1 
ATOM   1722 O  O   . GLY A 1 254 ? 5.756   -12.756 -51.239 1.00 53.51  ? 1631 GLY A O   1 
ATOM   1723 N  N   . GLU A 1 255 ? 4.098   -11.387 -51.972 1.00 48.59  ? 1632 GLU A N   1 
ATOM   1724 C  CA  . GLU A 1 255 ? 4.853   -10.714 -53.040 1.00 49.64  ? 1632 GLU A CA  1 
ATOM   1725 C  C   . GLU A 1 255 ? 4.594   -9.194  -53.048 1.00 55.51  ? 1632 GLU A C   1 
ATOM   1726 O  O   . GLU A 1 255 ? 3.436   -8.782  -52.967 1.00 55.06  ? 1632 GLU A O   1 
ATOM   1727 C  CB  . GLU A 1 255 ? 4.510   -11.297 -54.424 1.00 51.81  ? 1632 GLU A CB  1 
ATOM   1728 C  CG  . GLU A 1 255 ? 5.146   -12.641 -54.703 1.00 65.15  ? 1632 GLU A CG  1 
ATOM   1729 C  CD  . GLU A 1 255 ? 6.665   -12.681 -54.623 1.00 84.25  ? 1632 GLU A CD  1 
ATOM   1730 O  OE1 . GLU A 1 255 ? 7.199   -13.390 -53.736 1.00 65.02  ? 1632 GLU A OE1 1 
ATOM   1731 O  OE2 . GLU A 1 255 ? 7.317   -11.978 -55.429 1.00 77.88  ? 1632 GLU A OE2 1 
ATOM   1732 N  N   . PRO A 1 256 ? 5.629   -8.343  -53.213 1.00 53.91  ? 1633 PRO A N   1 
ATOM   1733 C  CA  . PRO A 1 256 ? 5.388   -6.881  -53.280 1.00 58.92  ? 1633 PRO A CA  1 
ATOM   1734 C  C   . PRO A 1 256 ? 4.652   -6.413  -54.545 1.00 97.57  ? 1633 PRO A C   1 
ATOM   1735 O  O   . PRO A 1 256 ? 3.653   -5.681  -54.482 1.00 47.82  ? 1633 PRO A O   1 
ATOM   1736 C  CB  . PRO A 1 256 ? 6.797   -6.293  -53.263 1.00 61.29  ? 1633 PRO A CB  1 
ATOM   1737 C  CG  . PRO A 1 256 ? 7.691   -7.423  -52.805 1.00 64.42  ? 1633 PRO A CG  1 
ATOM   1738 C  CD  . PRO A 1 256 ? 7.065   -8.653  -53.320 1.00 58.34  ? 1633 PRO A CD  1 
ATOM   1739 N  N   . GLN B 2 1   ? -15.941 7.869   -23.376 1.00 69.61  ? 1    GLN H N   1 
ATOM   1740 C  CA  . GLN B 2 1   ? -14.498 7.778   -23.628 1.00 65.92  ? 1    GLN H CA  1 
ATOM   1741 C  C   . GLN B 2 1   ? -13.780 6.817   -22.682 1.00 66.77  ? 1    GLN H C   1 
ATOM   1742 O  O   . GLN B 2 1   ? -14.031 6.861   -21.481 1.00 64.22  ? 1    GLN H O   1 
ATOM   1743 C  CB  . GLN B 2 1   ? -13.848 9.173   -23.619 1.00 66.37  ? 1    GLN H CB  1 
ATOM   1744 C  CG  . GLN B 2 1   ? -14.422 10.108  -24.709 1.00 81.76  ? 1    GLN H CG  1 
ATOM   1745 C  CD  . GLN B 2 1   ? -13.385 10.886  -25.507 1.00 86.96  ? 1    GLN H CD  1 
ATOM   1746 O  OE1 . GLN B 2 1   ? -12.178 10.558  -25.517 1.00 74.90  ? 1    GLN H OE1 1 
ATOM   1747 N  NE2 . GLN B 2 1   ? -13.853 11.919  -26.228 1.00 68.81  ? 1    GLN H NE2 1 
ATOM   1748 N  N   . VAL B 2 2   ? -12.896 5.948   -23.232 1.00 64.48  ? 2    VAL H N   1 
ATOM   1749 C  CA  . VAL B 2 2   ? -12.132 4.958   -22.443 1.00 63.45  ? 2    VAL H CA  1 
ATOM   1750 C  C   . VAL B 2 2   ? -11.003 5.613   -21.624 1.00 66.08  ? 2    VAL H C   1 
ATOM   1751 O  O   . VAL B 2 2   ? -10.235 6.415   -22.161 1.00 64.65  ? 2    VAL H O   1 
ATOM   1752 C  CB  . VAL B 2 2   ? -11.626 3.731   -23.247 1.00 66.86  ? 2    VAL H CB  1 
ATOM   1753 C  CG1 . VAL B 2 2   ? -12.791 3.015   -23.934 1.00 69.31  ? 2    VAL H CG1 1 
ATOM   1754 C  CG2 . VAL B 2 2   ? -10.547 4.111   -24.254 1.00 65.35  ? 2    VAL H CG2 1 
ATOM   1755 N  N   . GLN B 2 3   ? -10.917 5.265   -20.325 1.00 62.28  ? 3    GLN H N   1 
ATOM   1756 C  CA  . GLN B 2 3   ? -9.930  5.820   -19.395 1.00 59.80  ? 3    GLN H CA  1 
ATOM   1757 C  C   . GLN B 2 3   ? -9.406  4.748   -18.459 1.00 61.23  ? 3    GLN H C   1 
ATOM   1758 O  O   . GLN B 2 3   ? -10.170 3.884   -18.014 1.00 63.71  ? 3    GLN H O   1 
ATOM   1759 C  CB  . GLN B 2 3   ? -10.568 6.969   -18.577 1.00 63.11  ? 3    GLN H CB  1 
ATOM   1760 C  CG  . GLN B 2 3   ? -9.569  7.898   -17.860 1.00 89.17  ? 3    GLN H CG  1 
ATOM   1761 C  CD  . GLN B 2 3   ? -9.272  9.220   -18.567 1.00 106.32 ? 3    GLN H CD  1 
ATOM   1762 O  OE1 . GLN B 2 3   ? -10.175 9.970   -18.970 1.00 96.81  ? 3    GLN H OE1 1 
ATOM   1763 N  NE2 . GLN B 2 3   ? -7.984  9.566   -18.654 1.00 98.05  ? 3    GLN H NE2 1 
ATOM   1764 N  N   . LEU B 2 4   ? -8.106  4.804   -18.147 1.00 53.43  ? 4    LEU H N   1 
ATOM   1765 C  CA  . LEU B 2 4   ? -7.474  3.871   -17.196 1.00 51.45  ? 4    LEU H CA  1 
ATOM   1766 C  C   . LEU B 2 4   ? -6.958  4.690   -15.999 1.00 52.35  ? 4    LEU H C   1 
ATOM   1767 O  O   . LEU B 2 4   ? -6.114  5.576   -16.178 1.00 51.70  ? 4    LEU H O   1 
ATOM   1768 C  CB  . LEU B 2 4   ? -6.319  3.062   -17.832 1.00 49.62  ? 4    LEU H CB  1 
ATOM   1769 C  CG  . LEU B 2 4   ? -6.589  2.174   -19.070 1.00 53.87  ? 4    LEU H CG  1 
ATOM   1770 C  CD1 . LEU B 2 4   ? -5.299  1.576   -19.590 1.00 51.18  ? 4    LEU H CD1 1 
ATOM   1771 C  CD2 . LEU B 2 4   ? -7.534  1.060   -18.751 1.00 59.19  ? 4    LEU H CD2 1 
ATOM   1772 N  N   . VAL B 2 5   ? -7.515  4.431   -14.801 1.00 46.68  ? 5    VAL H N   1 
ATOM   1773 C  CA  . VAL B 2 5   ? -7.216  5.155   -13.568 1.00 45.29  ? 5    VAL H CA  1 
ATOM   1774 C  C   . VAL B 2 5   ? -6.514  4.242   -12.601 1.00 48.69  ? 5    VAL H C   1 
ATOM   1775 O  O   . VAL B 2 5   ? -7.045  3.201   -12.211 1.00 48.16  ? 5    VAL H O   1 
ATOM   1776 C  CB  . VAL B 2 5   ? -8.450  5.897   -12.958 1.00 50.96  ? 5    VAL H CB  1 
ATOM   1777 C  CG1 . VAL B 2 5   ? -9.725  5.048   -12.971 1.00 52.73  ? 5    VAL H CG1 1 
ATOM   1778 C  CG2 . VAL B 2 5   ? -8.164  6.430   -11.558 1.00 51.43  ? 5    VAL H CG2 1 
ATOM   1779 N  N   . GLN B 2 6   ? -5.297  4.636   -12.221 1.00 45.95  ? 6    GLN H N   1 
ATOM   1780 C  CA  . GLN B 2 6   ? -4.445  3.850   -11.324 1.00 45.95  ? 6    GLN H CA  1 
ATOM   1781 C  C   . GLN B 2 6   ? -4.537  4.269   -9.856  1.00 53.22  ? 6    GLN H C   1 
ATOM   1782 O  O   . GLN B 2 6   ? -4.995  5.373   -9.537  1.00 53.75  ? 6    GLN H O   1 
ATOM   1783 C  CB  . GLN B 2 6   ? -2.988  3.870   -11.812 1.00 44.30  ? 6    GLN H CB  1 
ATOM   1784 C  CG  . GLN B 2 6   ? -2.840  3.367   -13.231 1.00 33.03  ? 6    GLN H CG  1 
ATOM   1785 C  CD  . GLN B 2 6   ? -1.424  3.142   -13.600 1.00 29.76  ? 6    GLN H CD  1 
ATOM   1786 O  OE1 . GLN B 2 6   ? -0.754  2.327   -12.996 1.00 19.90  ? 6    GLN H OE1 1 
ATOM   1787 N  NE2 . GLN B 2 6   ? -1.047  3.600   -14.761 1.00 22.68  ? 6    GLN H NE2 1 
ATOM   1788 N  N   . SER B 2 7   ? -4.097  3.377   -8.966  1.00 51.37  ? 7    SER H N   1 
ATOM   1789 C  CA  . SER B 2 7   ? -4.063  3.650   -7.539  1.00 53.58  ? 7    SER H CA  1 
ATOM   1790 C  C   . SER B 2 7   ? -2.942  4.687   -7.224  1.00 56.94  ? 7    SER H C   1 
ATOM   1791 O  O   . SER B 2 7   ? -2.114  5.004   -8.097  1.00 54.61  ? 7    SER H O   1 
ATOM   1792 C  CB  . SER B 2 7   ? -3.902  2.348   -6.755  1.00 60.18  ? 7    SER H CB  1 
ATOM   1793 O  OG  . SER B 2 7   ? -2.840  1.534   -7.230  1.00 70.64  ? 7    SER H OG  1 
ATOM   1794 N  N   . GLY B 2 8   ? -2.981  5.251   -6.014  1.00 54.68  ? 8    GLY H N   1 
ATOM   1795 C  CA  . GLY B 2 8   ? -2.037  6.276   -5.576  1.00 53.94  ? 8    GLY H CA  1 
ATOM   1796 C  C   . GLY B 2 8   ? -0.631  5.788   -5.294  1.00 57.44  ? 8    GLY H C   1 
ATOM   1797 O  O   . GLY B 2 8   ? -0.415  4.588   -5.072  1.00 57.53  ? 8    GLY H O   1 
ATOM   1798 N  N   . ALA B 2 9   ? 0.330   6.737   -5.280  1.00 53.23  ? 9    ALA H N   1 
ATOM   1799 C  CA  . ALA B 2 9   ? 1.756   6.489   -5.039  1.00 52.95  ? 9    ALA H CA  1 
ATOM   1800 C  C   . ALA B 2 9   ? 2.040   5.702   -3.757  1.00 59.91  ? 9    ALA H C   1 
ATOM   1801 O  O   . ALA B 2 9   ? 1.313   5.822   -2.768  1.00 61.47  ? 9    ALA H O   1 
ATOM   1802 C  CB  . ALA B 2 9   ? 2.543   7.784   -5.071  1.00 53.17  ? 9    ALA H CB  1 
ATOM   1803 N  N   . GLU B 2 10  ? 3.068   4.840   -3.822  1.00 56.93  ? 10   GLU H N   1 
ATOM   1804 C  CA  . GLU B 2 10  ? 3.469   3.896   -2.781  1.00 58.40  ? 10   GLU H CA  1 
ATOM   1805 C  C   . GLU B 2 10  ? 4.894   4.138   -2.284  1.00 60.84  ? 10   GLU H C   1 
ATOM   1806 O  O   . GLU B 2 10  ? 5.764   4.569   -3.046  1.00 59.89  ? 10   GLU H O   1 
ATOM   1807 C  CB  . GLU B 2 10  ? 3.333   2.447   -3.304  1.00 59.60  ? 10   GLU H CB  1 
ATOM   1808 C  CG  . GLU B 2 10  ? 1.924   2.080   -3.753  1.00 74.81  ? 10   GLU H CG  1 
ATOM   1809 C  CD  . GLU B 2 10  ? 0.956   1.528   -2.715  1.00 110.90 ? 10   GLU H CD  1 
ATOM   1810 O  OE1 . GLU B 2 10  ? 1.308   1.494   -1.511  1.00 102.72 ? 10   GLU H OE1 1 
ATOM   1811 O  OE2 . GLU B 2 10  ? -0.160  1.116   -3.116  1.00 113.42 ? 10   GLU H OE2 1 
ATOM   1812 N  N   . VAL B 2 11  ? 5.114   3.879   -0.987  1.00 56.29  ? 11   VAL H N   1 
ATOM   1813 C  CA  . VAL B 2 11  ? 6.403   3.976   -0.306  1.00 55.27  ? 11   VAL H CA  1 
ATOM   1814 C  C   . VAL B 2 11  ? 6.554   2.632   0.375   1.00 59.02  ? 11   VAL H C   1 
ATOM   1815 O  O   . VAL B 2 11  ? 5.686   2.232   1.167   1.00 59.60  ? 11   VAL H O   1 
ATOM   1816 C  CB  . VAL B 2 11  ? 6.528   5.156   0.710   1.00 60.13  ? 11   VAL H CB  1 
ATOM   1817 C  CG1 . VAL B 2 11  ? 7.985   5.455   1.013   1.00 60.28  ? 11   VAL H CG1 1 
ATOM   1818 C  CG2 . VAL B 2 11  ? 5.833   6.423   0.221   1.00 58.37  ? 11   VAL H CG2 1 
ATOM   1819 N  N   . LYS B 2 12  ? 7.614   1.904   0.010   1.00 55.32  ? 12   LYS H N   1 
ATOM   1820 C  CA  . LYS B 2 12  ? 7.882   0.560   0.513   1.00 57.47  ? 12   LYS H CA  1 
ATOM   1821 C  C   . LYS B 2 12  ? 9.300   0.383   0.960   1.00 64.25  ? 12   LYS H C   1 
ATOM   1822 O  O   . LYS B 2 12  ? 10.193  1.034   0.426   1.00 62.76  ? 12   LYS H O   1 
ATOM   1823 C  CB  . LYS B 2 12  ? 7.581   -0.503  -0.549  1.00 57.64  ? 12   LYS H CB  1 
ATOM   1824 C  CG  . LYS B 2 12  ? 6.138   -0.572  -0.987  1.00 59.69  ? 12   LYS H CG  1 
ATOM   1825 C  CD  . LYS B 2 12  ? 5.242   -1.321  -0.036  1.00 67.40  ? 12   LYS H CD  1 
ATOM   1826 C  CE  . LYS B 2 12  ? 3.820   -0.888  -0.269  1.00 75.25  ? 12   LYS H CE  1 
ATOM   1827 N  NZ  . LYS B 2 12  ? 2.850   -1.756  0.443   1.00 90.79  ? 12   LYS H NZ  1 
ATOM   1828 N  N   . LYS B 2 13  ? 9.512   -0.527  1.927   1.00 64.53  ? 13   LYS H N   1 
ATOM   1829 C  CA  . LYS B 2 13  ? 10.834  -0.833  2.449   1.00 66.55  ? 13   LYS H CA  1 
ATOM   1830 C  C   . LYS B 2 13  ? 11.363  -2.034  1.672   1.00 71.10  ? 13   LYS H C   1 
ATOM   1831 O  O   . LYS B 2 13  ? 10.545  -2.838  1.217   1.00 70.76  ? 13   LYS H O   1 
ATOM   1832 C  CB  . LYS B 2 13  ? 10.747  -1.138  3.956   1.00 73.15  ? 13   LYS H CB  1 
ATOM   1833 C  CG  . LYS B 2 13  ? 11.540  -0.154  4.822   1.00 90.98  ? 13   LYS H CG  1 
ATOM   1834 C  CD  . LYS B 2 13  ? 10.756  1.116   5.210   1.00 96.06  ? 13   LYS H CD  1 
ATOM   1835 C  CE  . LYS B 2 13  ? 11.556  2.212   5.899   1.00 91.54  ? 13   LYS H CE  1 
ATOM   1836 N  NZ  . LYS B 2 13  ? 12.338  1.696   7.055   1.00 95.79  ? 13   LYS H NZ  1 
ATOM   1837 N  N   . PRO B 2 14  ? 12.699  -2.205  1.508   1.00 68.02  ? 14   PRO H N   1 
ATOM   1838 C  CA  . PRO B 2 14  ? 13.211  -3.401  0.808   1.00 67.86  ? 14   PRO H CA  1 
ATOM   1839 C  C   . PRO B 2 14  ? 12.697  -4.725  1.396   1.00 73.90  ? 14   PRO H C   1 
ATOM   1840 O  O   . PRO B 2 14  ? 12.599  -4.857  2.617   1.00 76.34  ? 14   PRO H O   1 
ATOM   1841 C  CB  . PRO B 2 14  ? 14.734  -3.267  0.945   1.00 71.13  ? 14   PRO H CB  1 
ATOM   1842 C  CG  . PRO B 2 14  ? 14.972  -1.826  1.166   1.00 74.59  ? 14   PRO H CG  1 
ATOM   1843 C  CD  . PRO B 2 14  ? 13.807  -1.358  1.976   1.00 70.49  ? 14   PRO H CD  1 
ATOM   1844 N  N   . GLY B 2 15  ? 12.339  -5.662  0.519   1.00 69.62  ? 15   GLY H N   1 
ATOM   1845 C  CA  . GLY B 2 15  ? 11.822  -6.979  0.880   1.00 72.50  ? 15   GLY H CA  1 
ATOM   1846 C  C   . GLY B 2 15  ? 10.310  -7.053  0.920   1.00 76.11  ? 15   GLY H C   1 
ATOM   1847 O  O   . GLY B 2 15  ? 9.735   -8.135  0.827   1.00 75.77  ? 15   GLY H O   1 
ATOM   1848 N  N   . SER B 2 16  ? 9.653   -5.902  1.041   1.00 73.04  ? 16   SER H N   1 
ATOM   1849 C  CA  . SER B 2 16  ? 8.196   -5.823  1.072   1.00 73.25  ? 16   SER H CA  1 
ATOM   1850 C  C   . SER B 2 16  ? 7.610   -6.132  -0.324  1.00 75.52  ? 16   SER H C   1 
ATOM   1851 O  O   . SER B 2 16  ? 8.353   -6.483  -1.251  1.00 74.49  ? 16   SER H O   1 
ATOM   1852 C  CB  . SER B 2 16  ? 7.763   -4.439  1.546   1.00 77.02  ? 16   SER H CB  1 
ATOM   1853 O  OG  . SER B 2 16  ? 6.499   -4.485  2.178   1.00 92.56  ? 16   SER H OG  1 
ATOM   1854 N  N   . SER B 2 17  ? 6.277   -6.026  -0.455  1.00 70.99  ? 17   SER H N   1 
ATOM   1855 C  CA  . SER B 2 17  ? 5.531   -6.251  -1.688  1.00 67.71  ? 17   SER H CA  1 
ATOM   1856 C  C   . SER B 2 17  ? 4.641   -5.045  -1.960  1.00 68.85  ? 17   SER H C   1 
ATOM   1857 O  O   . SER B 2 17  ? 4.245   -4.348  -1.023  1.00 71.06  ? 17   SER H O   1 
ATOM   1858 C  CB  . SER B 2 17  ? 4.660   -7.494  -1.549  1.00 73.36  ? 17   SER H CB  1 
ATOM   1859 O  OG  . SER B 2 17  ? 4.533   -8.178  -2.783  1.00 80.77  ? 17   SER H OG  1 
ATOM   1860 N  N   . VAL B 2 18  ? 4.340   -4.782  -3.242  1.00 60.06  ? 18   VAL H N   1 
ATOM   1861 C  CA  . VAL B 2 18  ? 3.438   -3.700  -3.667  1.00 56.84  ? 18   VAL H CA  1 
ATOM   1862 C  C   . VAL B 2 18  ? 2.375   -4.288  -4.548  1.00 59.16  ? 18   VAL H C   1 
ATOM   1863 O  O   . VAL B 2 18  ? 2.687   -5.182  -5.337  1.00 58.95  ? 18   VAL H O   1 
ATOM   1864 C  CB  . VAL B 2 18  ? 4.058   -2.507  -4.442  1.00 57.34  ? 18   VAL H CB  1 
ATOM   1865 C  CG1 . VAL B 2 18  ? 4.533   -1.391  -3.576  1.00 57.64  ? 18   VAL H CG1 1 
ATOM   1866 C  CG2 . VAL B 2 18  ? 5.030   -2.901  -5.546  1.00 55.48  ? 18   VAL H CG2 1 
ATOM   1867 N  N   . LYS B 2 19  ? 1.137   -3.754  -4.477  1.00 53.52  ? 19   LYS H N   1 
ATOM   1868 C  CA  . LYS B 2 19  ? 0.066   -4.172  -5.377  1.00 51.82  ? 19   LYS H CA  1 
ATOM   1869 C  C   . LYS B 2 19  ? -0.600  -2.938  -5.877  1.00 53.42  ? 19   LYS H C   1 
ATOM   1870 O  O   . LYS B 2 19  ? -1.226  -2.195  -5.107  1.00 54.05  ? 19   LYS H O   1 
ATOM   1871 C  CB  . LYS B 2 19  ? -0.936  -5.158  -4.767  1.00 57.09  ? 19   LYS H CB  1 
ATOM   1872 C  CG  . LYS B 2 19  ? -1.941  -5.694  -5.780  1.00 54.95  ? 19   LYS H CG  1 
ATOM   1873 C  CD  . LYS B 2 19  ? -2.917  -6.653  -5.135  1.00 60.77  ? 19   LYS H CD  1 
ATOM   1874 C  CE  . LYS B 2 19  ? -3.227  -7.887  -5.958  1.00 73.15  ? 19   LYS H CE  1 
ATOM   1875 N  NZ  . LYS B 2 19  ? -2.238  -8.197  -7.041  1.00 78.43  ? 19   LYS H NZ  1 
ATOM   1876 N  N   . VAL B 2 20  ? -0.417  -2.700  -7.182  1.00 47.27  ? 20   VAL H N   1 
ATOM   1877 C  CA  . VAL B 2 20  ? -0.930  -1.539  -7.892  1.00 44.32  ? 20   VAL H CA  1 
ATOM   1878 C  C   . VAL B 2 20  ? -2.139  -1.960  -8.674  1.00 50.84  ? 20   VAL H C   1 
ATOM   1879 O  O   . VAL B 2 20  ? -2.159  -3.062  -9.241  1.00 50.79  ? 20   VAL H O   1 
ATOM   1880 C  CB  . VAL B 2 20  ? 0.147   -0.915  -8.792  1.00 44.01  ? 20   VAL H CB  1 
ATOM   1881 C  CG1 . VAL B 2 20  ? -0.390  0.316   -9.487  1.00 42.92  ? 20   VAL H CG1 1 
ATOM   1882 C  CG2 . VAL B 2 20  ? 1.378   -0.564  -7.980  1.00 43.33  ? 20   VAL H CG2 1 
ATOM   1883 N  N   . SER B 2 21  ? -3.167  -1.107  -8.665  1.00 49.88  ? 21   SER H N   1 
ATOM   1884 C  CA  . SER B 2 21  ? -4.404  -1.391  -9.370  1.00 51.83  ? 21   SER H CA  1 
ATOM   1885 C  C   . SER B 2 21  ? -4.625  -0.439  -10.529 1.00 56.95  ? 21   SER H C   1 
ATOM   1886 O  O   . SER B 2 21  ? -4.122  0.688   -10.524 1.00 54.66  ? 21   SER H O   1 
ATOM   1887 C  CB  . SER B 2 21  ? -5.591  -1.358  -8.411  1.00 58.04  ? 21   SER H CB  1 
ATOM   1888 O  OG  . SER B 2 21  ? -5.886  -0.038  -7.992  1.00 68.62  ? 21   SER H OG  1 
ATOM   1889 N  N   . CYS B 2 22  ? -5.393  -0.893  -11.516 1.00 56.58  ? 22   CYS H N   1 
ATOM   1890 C  CA  . CYS B 2 22  ? -5.734  -0.088  -12.663 1.00 56.78  ? 22   CYS H CA  1 
ATOM   1891 C  C   . CYS B 2 22  ? -7.185  -0.353  -13.074 1.00 63.82  ? 22   CYS H C   1 
ATOM   1892 O  O   . CYS B 2 22  ? -7.517  -1.463  -13.471 1.00 63.44  ? 22   CYS H O   1 
ATOM   1893 C  CB  . CYS B 2 22  ? -4.756  -0.360  -13.793 1.00 55.59  ? 22   CYS H CB  1 
ATOM   1894 S  SG  . CYS B 2 22  ? -5.140  0.502   -15.327 1.00 59.26  ? 22   CYS H SG  1 
ATOM   1895 N  N   . LYS B 2 23  ? -8.052  0.660   -12.922 1.00 63.19  ? 23   LYS H N   1 
ATOM   1896 C  CA  . LYS B 2 23  ? -9.467  0.553   -13.241 1.00 65.69  ? 23   LYS H CA  1 
ATOM   1897 C  C   . LYS B 2 23  ? -9.762  1.096   -14.638 1.00 71.50  ? 23   LYS H C   1 
ATOM   1898 O  O   . LYS B 2 23  ? -9.412  2.231   -14.950 1.00 70.16  ? 23   LYS H O   1 
ATOM   1899 C  CB  . LYS B 2 23  ? -10.334 1.255   -12.167 1.00 69.61  ? 23   LYS H CB  1 
ATOM   1900 C  CG  . LYS B 2 23  ? -11.825 0.946   -12.296 1.00 79.21  ? 23   LYS H CG  1 
ATOM   1901 C  CD  . LYS B 2 23  ? -12.700 1.663   -11.281 1.00 86.16  ? 23   LYS H CD  1 
ATOM   1902 C  CE  . LYS B 2 23  ? -13.204 0.748   -10.186 1.00 95.57  ? 23   LYS H CE  1 
ATOM   1903 N  NZ  . LYS B 2 23  ? -14.199 -0.251  -10.671 1.00 108.31 ? 23   LYS H NZ  1 
ATOM   1904 N  N   . ALA B 2 24  ? -10.412 0.278   -15.470 1.00 70.93  ? 24   ALA H N   1 
ATOM   1905 C  CA  . ALA B 2 24  ? -10.832 0.667   -16.806 1.00 71.86  ? 24   ALA H CA  1 
ATOM   1906 C  C   . ALA B 2 24  ? -12.284 1.140   -16.733 1.00 82.66  ? 24   ALA H C   1 
ATOM   1907 O  O   . ALA B 2 24  ? -13.114 0.515   -16.053 1.00 84.63  ? 24   ALA H O   1 
ATOM   1908 C  CB  . ALA B 2 24  ? -10.717 -0.513  -17.755 1.00 72.16  ? 24   ALA H CB  1 
ATOM   1909 N  N   . SER B 2 25  ? -12.572 2.266   -17.410 1.00 82.33  ? 25   SER H N   1 
ATOM   1910 C  CA  . SER B 2 25  ? -13.905 2.856   -17.497 1.00 86.50  ? 25   SER H CA  1 
ATOM   1911 C  C   . SER B 2 25  ? -14.173 3.288   -18.934 1.00 93.26  ? 25   SER H C   1 
ATOM   1912 O  O   . SER B 2 25  ? -13.235 3.632   -19.662 1.00 90.62  ? 25   SER H O   1 
ATOM   1913 C  CB  . SER B 2 25  ? -14.057 4.024   -16.525 1.00 91.10  ? 25   SER H CB  1 
ATOM   1914 O  OG  . SER B 2 25  ? -13.237 5.133   -16.859 1.00 96.39  ? 25   SER H OG  1 
ATOM   1915 N  N   . GLY B 2 26  ? -15.447 3.251   -19.323 1.00 94.82  ? 26   GLY H N   1 
ATOM   1916 C  CA  . GLY B 2 26  ? -15.888 3.591   -20.671 1.00 97.17  ? 26   GLY H CA  1 
ATOM   1917 C  C   . GLY B 2 26  ? -16.071 2.312   -21.465 1.00 104.36 ? 26   GLY H C   1 
ATOM   1918 O  O   . GLY B 2 26  ? -17.200 1.918   -21.785 1.00 107.60 ? 26   GLY H O   1 
ATOM   1919 N  N   . GLY B 2 27  ? -14.960 1.623   -21.702 1.00 99.34  ? 27   GLY H N   1 
ATOM   1920 C  CA  . GLY B 2 27  ? -14.937 0.352   -22.414 1.00 99.97  ? 27   GLY H CA  1 
ATOM   1921 C  C   . GLY B 2 27  ? -15.145 -0.819  -21.482 1.00 104.80 ? 27   GLY H C   1 
ATOM   1922 O  O   . GLY B 2 27  ? -14.753 -0.766  -20.309 1.00 103.71 ? 27   GLY H O   1 
ATOM   1923 N  N   . THR B 2 28  ? -15.736 -1.891  -22.006 1.00 102.63 ? 28   THR H N   1 
ATOM   1924 C  CA  . THR B 2 28  ? -15.968 -3.093  -21.220 1.00 102.96 ? 28   THR H CA  1 
ATOM   1925 C  C   . THR B 2 28  ? -14.857 -4.031  -21.592 1.00 103.15 ? 28   THR H C   1 
ATOM   1926 O  O   . THR B 2 28  ? -14.852 -4.643  -22.668 1.00 103.00 ? 28   THR H O   1 
ATOM   1927 C  CB  . THR B 2 28  ? -17.392 -3.562  -21.330 1.00 118.46 ? 28   THR H CB  1 
ATOM   1928 O  OG1 . THR B 2 28  ? -17.650 -3.896  -22.692 1.00 121.77 ? 28   THR H OG1 1 
ATOM   1929 C  CG2 . THR B 2 28  ? -18.384 -2.499  -20.834 1.00 119.95 ? 28   THR H CG2 1 
ATOM   1930 N  N   . PHE B 2 29  ? -13.828 -3.975  -20.725 1.00 96.23  ? 29   PHE H N   1 
ATOM   1931 C  CA  . PHE B 2 29  ? -12.502 -4.595  -20.749 1.00 92.48  ? 29   PHE H CA  1 
ATOM   1932 C  C   . PHE B 2 29  ? -12.512 -6.125  -21.004 1.00 94.10  ? 29   PHE H C   1 
ATOM   1933 O  O   . PHE B 2 29  ? -11.484 -6.799  -20.895 1.00 91.46  ? 29   PHE H O   1 
ATOM   1934 C  CB  . PHE B 2 29  ? -11.729 -4.211  -19.475 1.00 92.42  ? 29   PHE H CB  1 
ATOM   1935 C  CG  . PHE B 2 29  ? -11.711 -5.126  -18.260 1.00 94.41  ? 29   PHE H CG  1 
ATOM   1936 C  CD1 . PHE B 2 29  ? -12.794 -5.957  -17.967 1.00 99.73  ? 29   PHE H CD1 1 
ATOM   1937 C  CD2 . PHE B 2 29  ? -10.641 -5.105  -17.374 1.00 94.15  ? 29   PHE H CD2 1 
ATOM   1938 C  CE1 . PHE B 2 29  ? -12.762 -6.805  -16.863 1.00 101.29 ? 29   PHE H CE1 1 
ATOM   1939 C  CE2 . PHE B 2 29  ? -10.628 -5.926  -16.248 1.00 97.68  ? 29   PHE H CE2 1 
ATOM   1940 C  CZ  . PHE B 2 29  ? -11.686 -6.773  -16.002 1.00 98.61  ? 29   PHE H CZ  1 
ATOM   1941 N  N   . SER B 2 30  ? -13.663 -6.641  -21.414 1.00 91.64  ? 30   SER H N   1 
ATOM   1942 C  CA  . SER B 2 30  ? -13.885 -8.014  -21.835 1.00 92.31  ? 30   SER H CA  1 
ATOM   1943 C  C   . SER B 2 30  ? -13.133 -8.319  -23.148 1.00 91.25  ? 30   SER H C   1 
ATOM   1944 O  O   . SER B 2 30  ? -12.609 -9.405  -23.297 1.00 90.10  ? 30   SER H O   1 
ATOM   1945 C  CB  . SER B 2 30  ? -15.379 -8.243  -22.065 1.00 100.74 ? 30   SER H CB  1 
ATOM   1946 O  OG  . SER B 2 30  ? -15.879 -7.321  -23.023 1.00 111.91 ? 30   SER H OG  1 
ATOM   1947 N  N   . SER B 2 31  ? -13.084 -7.380  -24.093 1.00 84.85  ? 31   SER H N   1 
ATOM   1948 C  CA  . SER B 2 31  ? -12.469 -7.608  -25.400 1.00 82.76  ? 31   SER H CA  1 
ATOM   1949 C  C   . SER B 2 31  ? -11.017 -7.099  -25.548 1.00 81.56  ? 31   SER H C   1 
ATOM   1950 O  O   . SER B 2 31  ? -10.509 -7.093  -26.671 1.00 80.44  ? 31   SER H O   1 
ATOM   1951 C  CB  . SER B 2 31  ? -13.367 -7.002  -26.472 1.00 87.46  ? 31   SER H CB  1 
ATOM   1952 O  OG  . SER B 2 31  ? -13.672 -5.653  -26.153 1.00 93.29  ? 31   SER H OG  1 
ATOM   1953 N  N   . TYR B 2 32  ? -10.333 -6.747  -24.415 1.00 75.31  ? 32   TYR H N   1 
ATOM   1954 C  CA  . TYR B 2 32  ? -8.986  -6.145  -24.353 1.00 71.79  ? 32   TYR H CA  1 
ATOM   1955 C  C   . TYR B 2 32  ? -7.931  -6.831  -23.411 1.00 67.94  ? 32   TYR H C   1 
ATOM   1956 O  O   . TYR B 2 32  ? -8.239  -7.739  -22.626 1.00 67.92  ? 32   TYR H O   1 
ATOM   1957 C  CB  . TYR B 2 32  ? -9.131  -4.659  -23.944 1.00 73.92  ? 32   TYR H CB  1 
ATOM   1958 C  CG  . TYR B 2 32  ? -9.792  -3.774  -24.983 1.00 79.33  ? 32   TYR H CG  1 
ATOM   1959 C  CD1 . TYR B 2 32  ? -9.039  -3.139  -25.972 1.00 80.66  ? 32   TYR H CD1 1 
ATOM   1960 C  CD2 . TYR B 2 32  ? -11.169 -3.544  -24.961 1.00 83.25  ? 32   TYR H CD2 1 
ATOM   1961 C  CE1 . TYR B 2 32  ? -9.633  -2.269  -26.890 1.00 83.26  ? 32   TYR H CE1 1 
ATOM   1962 C  CE2 . TYR B 2 32  ? -11.781 -2.711  -25.904 1.00 85.76  ? 32   TYR H CE2 1 
ATOM   1963 C  CZ  . TYR B 2 32  ? -11.010 -2.082  -26.872 1.00 90.29  ? 32   TYR H CZ  1 
ATOM   1964 O  OH  . TYR B 2 32  ? -11.615 -1.284  -27.820 1.00 87.89  ? 32   TYR H OH  1 
ATOM   1965 N  N   . THR B 2 33  ? -6.680  -6.361  -23.523 1.00 57.54  ? 33   THR H N   1 
ATOM   1966 C  CA  . THR B 2 33  ? -5.538  -6.765  -22.708 1.00 53.36  ? 33   THR H CA  1 
ATOM   1967 C  C   . THR B 2 33  ? -5.045  -5.542  -21.937 1.00 52.90  ? 33   THR H C   1 
ATOM   1968 O  O   . THR B 2 33  ? -5.117  -4.406  -22.416 1.00 52.37  ? 33   THR H O   1 
ATOM   1969 C  CB  . THR B 2 33  ? -4.444  -7.506  -23.531 1.00 51.98  ? 33   THR H CB  1 
ATOM   1970 O  OG1 . THR B 2 33  ? -3.113  -7.110  -23.171 1.00 43.24  ? 33   THR H OG1 1 
ATOM   1971 C  CG2 . THR B 2 33  ? -4.635  -7.376  -25.020 1.00 52.77  ? 33   THR H CG2 1 
ATOM   1972 N  N   . ILE B 2 34  ? -4.602  -5.781  -20.724 1.00 47.02  ? 34   ILE H N   1 
ATOM   1973 C  CA  . ILE B 2 34  ? -4.047  -4.760  -19.849 1.00 44.61  ? 34   ILE H CA  1 
ATOM   1974 C  C   . ILE B 2 34  ? -2.566  -5.118  -19.654 1.00 46.47  ? 34   ILE H C   1 
ATOM   1975 O  O   . ILE B 2 34  ? -2.258  -6.248  -19.295 1.00 46.20  ? 34   ILE H O   1 
ATOM   1976 C  CB  . ILE B 2 34  ? -4.864  -4.643  -18.529 1.00 48.25  ? 34   ILE H CB  1 
ATOM   1977 C  CG1 . ILE B 2 34  ? -6.096  -3.729  -18.744 1.00 49.21  ? 34   ILE H CG1 1 
ATOM   1978 C  CG2 . ILE B 2 34  ? -4.012  -4.020  -17.434 1.00 47.32  ? 34   ILE H CG2 1 
ATOM   1979 C  CD1 . ILE B 2 34  ? -7.401  -4.398  -19.422 1.00 61.23  ? 34   ILE H CD1 1 
ATOM   1980 N  N   . SER B 2 35  ? -1.663  -4.163  -19.912 1.00 41.06  ? 35   SER H N   1 
ATOM   1981 C  CA  . SER B 2 35  ? -0.209  -4.313  -19.823 1.00 39.32  ? 35   SER H CA  1 
ATOM   1982 C  C   . SER B 2 35  ? 0.412   -3.450  -18.710 1.00 44.16  ? 35   SER H C   1 
ATOM   1983 O  O   . SER B 2 35  ? -0.143  -2.412  -18.348 1.00 44.75  ? 35   SER H O   1 
ATOM   1984 C  CB  . SER B 2 35  ? 0.419   -3.989  -21.175 1.00 38.06  ? 35   SER H CB  1 
ATOM   1985 O  OG  . SER B 2 35  ? -0.076  -4.883  -22.169 1.00 35.40  ? 35   SER H OG  1 
ATOM   1986 N  N   . TRP B 2 36  ? 1.536   -3.885  -18.163 1.00 40.99  ? 36   TRP H N   1 
ATOM   1987 C  CA  . TRP B 2 36  ? 2.220   -3.155  -17.113 1.00 41.31  ? 36   TRP H CA  1 
ATOM   1988 C  C   . TRP B 2 36  ? 3.618   -2.804  -17.648 1.00 45.01  ? 36   TRP H C   1 
ATOM   1989 O  O   . TRP B 2 36  ? 4.343   -3.671  -18.154 1.00 45.94  ? 36   TRP H O   1 
ATOM   1990 C  CB  . TRP B 2 36  ? 2.221   -3.961  -15.779 1.00 42.10  ? 36   TRP H CB  1 
ATOM   1991 C  CG  . TRP B 2 36  ? 0.869   -4.011  -15.082 1.00 44.03  ? 36   TRP H CG  1 
ATOM   1992 C  CD1 . TRP B 2 36  ? -0.076  -4.993  -15.183 1.00 48.08  ? 36   TRP H CD1 1 
ATOM   1993 C  CD2 . TRP B 2 36  ? 0.279   -2.970  -14.284 1.00 43.84  ? 36   TRP H CD2 1 
ATOM   1994 N  NE1 . TRP B 2 36  ? -1.202  -4.648  -14.457 1.00 48.44  ? 36   TRP H NE1 1 
ATOM   1995 C  CE2 . TRP B 2 36  ? -1.014  -3.411  -13.897 1.00 49.33  ? 36   TRP H CE2 1 
ATOM   1996 C  CE3 . TRP B 2 36  ? 0.728   -1.714  -13.831 1.00 44.09  ? 36   TRP H CE3 1 
ATOM   1997 C  CZ2 . TRP B 2 36  ? -1.861  -2.640  -13.070 1.00 49.66  ? 36   TRP H CZ2 1 
ATOM   1998 C  CZ3 . TRP B 2 36  ? -0.118  -0.944  -13.028 1.00 46.22  ? 36   TRP H CZ3 1 
ATOM   1999 C  CH2 . TRP B 2 36  ? -1.393  -1.404  -12.656 1.00 48.56  ? 36   TRP H CH2 1 
ATOM   2000 N  N   . VAL B 2 37  ? 3.957   -1.507  -17.606 1.00 40.05  ? 37   VAL H N   1 
ATOM   2001 C  CA  . VAL B 2 37  ? 5.241   -0.948  -18.090 1.00 38.73  ? 37   VAL H CA  1 
ATOM   2002 C  C   . VAL B 2 37  ? 5.819   -0.047  -16.967 1.00 41.81  ? 37   VAL H C   1 
ATOM   2003 O  O   . VAL B 2 37  ? 5.086   0.743   -16.395 1.00 40.65  ? 37   VAL H O   1 
ATOM   2004 C  CB  . VAL B 2 37  ? 5.057   -0.159  -19.441 1.00 41.62  ? 37   VAL H CB  1 
ATOM   2005 C  CG1 . VAL B 2 37  ? 6.353   0.538   -19.888 1.00 41.07  ? 37   VAL H CG1 1 
ATOM   2006 C  CG2 . VAL B 2 37  ? 4.507   -1.046  -20.563 1.00 41.39  ? 37   VAL H CG2 1 
ATOM   2007 N  N   . ARG B 2 38  ? 7.102   -0.163  -16.636 1.00 38.85  ? 38   ARG H N   1 
ATOM   2008 C  CA  . ARG B 2 38  ? 7.647   0.712   -15.596 1.00 38.52  ? 38   ARG H CA  1 
ATOM   2009 C  C   . ARG B 2 38  ? 8.697   1.647   -16.121 1.00 44.88  ? 38   ARG H C   1 
ATOM   2010 O  O   . ARG B 2 38  ? 9.305   1.381   -17.156 1.00 45.90  ? 38   ARG H O   1 
ATOM   2011 C  CB  . ARG B 2 38  ? 8.149   -0.055  -14.371 1.00 37.50  ? 38   ARG H CB  1 
ATOM   2012 C  CG  . ARG B 2 38  ? 9.419   -0.867  -14.583 1.00 43.51  ? 38   ARG H CG  1 
ATOM   2013 C  CD  . ARG B 2 38  ? 9.924   -1.334  -13.245 1.00 54.21  ? 38   ARG H CD  1 
ATOM   2014 N  NE  . ARG B 2 38  ? 11.203  -2.032  -13.350 1.00 65.11  ? 38   ARG H NE  1 
ATOM   2015 C  CZ  . ARG B 2 38  ? 11.729  -2.767  -12.376 1.00 77.25  ? 38   ARG H CZ  1 
ATOM   2016 N  NH1 . ARG B 2 38  ? 11.091  -2.904  -11.222 1.00 67.26  ? 38   ARG H NH1 1 
ATOM   2017 N  NH2 . ARG B 2 38  ? 12.897  -3.377  -12.551 1.00 56.82  ? 38   ARG H NH2 1 
ATOM   2018 N  N   . GLN B 2 39  ? 8.935   2.734   -15.389 1.00 42.24  ? 39   GLN H N   1 
ATOM   2019 C  CA  . GLN B 2 39  ? 9.922   3.736   -15.742 1.00 42.02  ? 39   GLN H CA  1 
ATOM   2020 C  C   . GLN B 2 39  ? 10.624  4.243   -14.499 1.00 50.74  ? 39   GLN H C   1 
ATOM   2021 O  O   . GLN B 2 39  ? 10.037  4.989   -13.714 1.00 49.98  ? 39   GLN H O   1 
ATOM   2022 C  CB  . GLN B 2 39  ? 9.244   4.871   -16.496 1.00 41.94  ? 39   GLN H CB  1 
ATOM   2023 C  CG  . GLN B 2 39  ? 10.175  5.969   -16.946 1.00 51.77  ? 39   GLN H CG  1 
ATOM   2024 C  CD  . GLN B 2 39  ? 9.478   6.820   -17.961 1.00 58.02  ? 39   GLN H CD  1 
ATOM   2025 O  OE1 . GLN B 2 39  ? 8.396   7.354   -17.726 1.00 63.20  ? 39   GLN H OE1 1 
ATOM   2026 N  NE2 . GLN B 2 39  ? 10.065  6.948   -19.122 1.00 27.38  ? 39   GLN H NE2 1 
ATOM   2027 N  N   . ALA B 2 40  ? 11.891  3.840   -14.326 1.00 51.89  ? 40   ALA H N   1 
ATOM   2028 C  CA  . ALA B 2 40  ? 12.737  4.287   -13.224 1.00 54.64  ? 40   ALA H CA  1 
ATOM   2029 C  C   . ALA B 2 40  ? 13.064  5.787   -13.436 1.00 65.72  ? 40   ALA H C   1 
ATOM   2030 O  O   . ALA B 2 40  ? 13.080  6.213   -14.585 1.00 64.36  ? 40   ALA H O   1 
ATOM   2031 C  CB  . ALA B 2 40  ? 14.006  3.462   -13.187 1.00 56.43  ? 40   ALA H CB  1 
ATOM   2032 N  N   . PRO B 2 41  ? 13.271  6.596   -12.363 1.00 69.10  ? 41   PRO H N   1 
ATOM   2033 C  CA  . PRO B 2 41  ? 13.501  8.047   -12.497 1.00 70.51  ? 41   PRO H CA  1 
ATOM   2034 C  C   . PRO B 2 41  ? 13.957  8.634   -13.850 1.00 78.97  ? 41   PRO H C   1 
ATOM   2035 O  O   . PRO B 2 41  ? 13.098  9.047   -14.640 1.00 78.86  ? 41   PRO H O   1 
ATOM   2036 C  CB  . PRO B 2 41  ? 14.518  8.313   -11.393 1.00 73.70  ? 41   PRO H CB  1 
ATOM   2037 C  CG  . PRO B 2 41  ? 14.074  7.354   -10.297 1.00 78.74  ? 41   PRO H CG  1 
ATOM   2038 C  CD  . PRO B 2 41  ? 13.255  6.242   -10.933 1.00 73.36  ? 41   PRO H CD  1 
ATOM   2039 N  N   . GLY B 2 42  ? 15.254  8.770   -14.088 1.00 78.24  ? 42   GLY H N   1 
ATOM   2040 C  CA  . GLY B 2 42  ? 15.709  9.392   -15.327 1.00 78.80  ? 42   GLY H CA  1 
ATOM   2041 C  C   . GLY B 2 42  ? 15.767  8.451   -16.507 1.00 83.67  ? 42   GLY H C   1 
ATOM   2042 O  O   . GLY B 2 42  ? 16.194  8.849   -17.594 1.00 84.42  ? 42   GLY H O   1 
ATOM   2043 N  N   . GLN B 2 43  ? 15.300  7.219   -16.309 1.00 79.07  ? 43   GLN H N   1 
ATOM   2044 C  CA  . GLN B 2 43  ? 15.367  6.137   -17.272 1.00 78.13  ? 43   GLN H CA  1 
ATOM   2045 C  C   . GLN B 2 43  ? 14.237  6.064   -18.320 1.00 76.77  ? 43   GLN H C   1 
ATOM   2046 O  O   . GLN B 2 43  ? 13.317  6.882   -18.344 1.00 74.32  ? 43   GLN H O   1 
ATOM   2047 C  CB  . GLN B 2 43  ? 15.443  4.809   -16.500 1.00 80.34  ? 43   GLN H CB  1 
ATOM   2048 C  CG  . GLN B 2 43  ? 16.705  4.606   -15.669 1.00 99.40  ? 43   GLN H CG  1 
ATOM   2049 C  CD  . GLN B 2 43  ? 17.214  3.172   -15.751 1.00 115.24 ? 43   GLN H CD  1 
ATOM   2050 O  OE1 . GLN B 2 43  ? 16.917  2.401   -16.688 1.00 108.44 ? 43   GLN H OE1 1 
ATOM   2051 N  NE2 . GLN B 2 43  ? 18.011  2.780   -14.766 1.00 104.98 ? 43   GLN H NE2 1 
ATOM   2052 N  N   . GLY B 2 44  ? 14.357  5.045   -19.160 1.00 71.62  ? 44   GLY H N   1 
ATOM   2053 C  CA  . GLY B 2 44  ? 13.403  4.731   -20.194 1.00 70.16  ? 44   GLY H CA  1 
ATOM   2054 C  C   . GLY B 2 44  ? 12.318  3.786   -19.717 1.00 71.42  ? 44   GLY H C   1 
ATOM   2055 O  O   . GLY B 2 44  ? 12.071  3.646   -18.513 1.00 70.87  ? 44   GLY H O   1 
ATOM   2056 N  N   . LEU B 2 45  ? 11.664  3.135   -20.677 1.00 64.77  ? 45   LEU H N   1 
ATOM   2057 C  CA  . LEU B 2 45  ? 10.519  2.269   -20.457 1.00 62.36  ? 45   LEU H CA  1 
ATOM   2058 C  C   . LEU B 2 45  ? 10.870  0.778   -20.489 1.00 63.48  ? 45   LEU H C   1 
ATOM   2059 O  O   . LEU B 2 45  ? 11.731  0.353   -21.257 1.00 63.95  ? 45   LEU H O   1 
ATOM   2060 C  CB  . LEU B 2 45  ? 9.408   2.643   -21.470 1.00 61.79  ? 45   LEU H CB  1 
ATOM   2061 C  CG  . LEU B 2 45  ? 8.968   4.127   -21.495 1.00 66.16  ? 45   LEU H CG  1 
ATOM   2062 C  CD1 . LEU B 2 45  ? 8.225   4.460   -22.759 1.00 66.34  ? 45   LEU H CD1 1 
ATOM   2063 C  CD2 . LEU B 2 45  ? 8.086   4.454   -20.320 1.00 68.96  ? 45   LEU H CD2 1 
ATOM   2064 N  N   . GLU B 2 46  ? 10.205  -0.008  -19.632 1.00 56.98  ? 46   GLU H N   1 
ATOM   2065 C  CA  . GLU B 2 46  ? 10.431  -1.439  -19.496 1.00 55.99  ? 46   GLU H CA  1 
ATOM   2066 C  C   . GLU B 2 46  ? 9.103   -2.192  -19.365 1.00 57.06  ? 46   GLU H C   1 
ATOM   2067 O  O   . GLU B 2 46  ? 8.365   -1.981  -18.406 1.00 58.71  ? 46   GLU H O   1 
ATOM   2068 C  CB  . GLU B 2 46  ? 11.321  -1.669  -18.275 1.00 57.84  ? 46   GLU H CB  1 
ATOM   2069 C  CG  . GLU B 2 46  ? 11.568  -3.125  -17.932 1.00 66.96  ? 46   GLU H CG  1 
ATOM   2070 C  CD  . GLU B 2 46  ? 12.598  -3.303  -16.835 1.00 78.10  ? 46   GLU H CD  1 
ATOM   2071 O  OE1 . GLU B 2 46  ? 12.429  -2.675  -15.766 1.00 82.18  ? 46   GLU H OE1 1 
ATOM   2072 O  OE2 . GLU B 2 46  ? 13.573  -4.061  -17.041 1.00 51.69  ? 46   GLU H OE2 1 
ATOM   2073 N  N   . TRP B 2 47  ? 8.812   -3.075  -20.314 1.00 48.77  ? 47   TRP H N   1 
ATOM   2074 C  CA  . TRP B 2 47  ? 7.575   -3.856  -20.303 1.00 46.66  ? 47   TRP H CA  1 
ATOM   2075 C  C   . TRP B 2 47  ? 7.708   -4.985  -19.297 1.00 49.38  ? 47   TRP H C   1 
ATOM   2076 O  O   . TRP B 2 47  ? 8.731   -5.664  -19.295 1.00 52.26  ? 47   TRP H O   1 
ATOM   2077 C  CB  . TRP B 2 47  ? 7.310   -4.389  -21.709 1.00 45.13  ? 47   TRP H CB  1 
ATOM   2078 C  CG  . TRP B 2 47  ? 6.121   -5.277  -21.849 1.00 46.63  ? 47   TRP H CG  1 
ATOM   2079 C  CD1 . TRP B 2 47  ? 4.823   -4.895  -22.027 1.00 49.76  ? 47   TRP H CD1 1 
ATOM   2080 C  CD2 . TRP B 2 47  ? 6.141   -6.693  -21.962 1.00 47.66  ? 47   TRP H CD2 1 
ATOM   2081 N  NE1 . TRP B 2 47  ? 4.027   -6.001  -22.219 1.00 50.76  ? 47   TRP H NE1 1 
ATOM   2082 C  CE2 . TRP B 2 47  ? 4.814   -7.119  -22.192 1.00 52.60  ? 47   TRP H CE2 1 
ATOM   2083 C  CE3 . TRP B 2 47  ? 7.149   -7.655  -21.868 1.00 50.06  ? 47   TRP H CE3 1 
ATOM   2084 C  CZ2 . TRP B 2 47  ? 4.478   -8.461  -22.338 1.00 53.33  ? 47   TRP H CZ2 1 
ATOM   2085 C  CZ3 . TRP B 2 47  ? 6.814   -8.985  -22.021 1.00 53.47  ? 47   TRP H CZ3 1 
ATOM   2086 C  CH2 . TRP B 2 47  ? 5.486   -9.380  -22.213 1.00 54.48  ? 47   TRP H CH2 1 
ATOM   2087 N  N   . MET B 2 48  ? 6.710   -5.168  -18.422 1.00 42.21  ? 48   MET H N   1 
ATOM   2088 C  CA  . MET B 2 48  ? 6.741   -6.212  -17.391 1.00 42.23  ? 48   MET H CA  1 
ATOM   2089 C  C   . MET B 2 48  ? 5.921   -7.447  -17.775 1.00 47.08  ? 48   MET H C   1 
ATOM   2090 O  O   . MET B 2 48  ? 6.300   -8.582  -17.453 1.00 46.88  ? 48   MET H O   1 
ATOM   2091 C  CB  . MET B 2 48  ? 6.291   -5.652  -16.046 1.00 43.99  ? 48   MET H CB  1 
ATOM   2092 C  CG  . MET B 2 48  ? 7.156   -4.484  -15.583 1.00 46.09  ? 48   MET H CG  1 
ATOM   2093 S  SD  . MET B 2 48  ? 6.565   -3.770  -14.055 1.00 49.84  ? 48   MET H SD  1 
ATOM   2094 C  CE  . MET B 2 48  ? 5.379   -2.729  -14.635 1.00 45.24  ? 48   MET H CE  1 
ATOM   2095 N  N   . GLY B 2 49  ? 4.826   -7.216  -18.490 1.00 43.59  ? 49   GLY H N   1 
ATOM   2096 C  CA  . GLY B 2 49  ? 3.935   -8.278  -18.940 1.00 44.68  ? 49   GLY H CA  1 
ATOM   2097 C  C   . GLY B 2 49  ? 2.540   -7.764  -19.238 1.00 47.65  ? 49   GLY H C   1 
ATOM   2098 O  O   . GLY B 2 49  ? 2.355   -6.548  -19.326 1.00 46.15  ? 49   GLY H O   1 
ATOM   2099 N  N   . TRP B 2 50  ? 1.522   -8.683  -19.320 1.00 44.15  ? 50   TRP H N   1 
ATOM   2100 C  CA  . TRP B 2 50  ? 0.119   -8.360  -19.631 1.00 43.45  ? 50   TRP H CA  1 
ATOM   2101 C  C   . TRP B 2 50  ? -0.873  -9.349  -19.092 1.00 51.64  ? 50   TRP H C   1 
ATOM   2102 O  O   . TRP B 2 50  ? -0.477  -10.437 -18.716 1.00 53.80  ? 50   TRP H O   1 
ATOM   2103 C  CB  . TRP B 2 50  ? -0.117  -8.243  -21.160 1.00 41.39  ? 50   TRP H CB  1 
ATOM   2104 C  CG  . TRP B 2 50  ? 0.263   -9.425  -22.045 1.00 42.93  ? 50   TRP H CG  1 
ATOM   2105 C  CD1 . TRP B 2 50  ? 1.232   -9.424  -23.003 1.00 45.24  ? 50   TRP H CD1 1 
ATOM   2106 C  CD2 . TRP B 2 50  ? -0.454  -10.668 -22.215 1.00 44.46  ? 50   TRP H CD2 1 
ATOM   2107 N  NE1 . TRP B 2 50  ? 1.216   -10.606 -23.705 1.00 45.62  ? 50   TRP H NE1 1 
ATOM   2108 C  CE2 . TRP B 2 50  ? 0.178   -11.377 -23.260 1.00 48.56  ? 50   TRP H CE2 1 
ATOM   2109 C  CE3 . TRP B 2 50  ? -1.594  -11.238 -21.617 1.00 46.87  ? 50   TRP H CE3 1 
ATOM   2110 C  CZ2 . TRP B 2 50  ? -0.251  -12.646 -23.674 1.00 49.56  ? 50   TRP H CZ2 1 
ATOM   2111 C  CZ3 . TRP B 2 50  ? -1.995  -12.504 -22.009 1.00 49.58  ? 50   TRP H CZ3 1 
ATOM   2112 C  CH2 . TRP B 2 50  ? -1.323  -13.195 -23.020 1.00 50.50  ? 50   TRP H CH2 1 
ATOM   2113 N  N   . ILE B 2 51  ? -2.180  -9.018  -19.165 1.00 50.05  ? 51   ILE H N   1 
ATOM   2114 C  CA  . ILE B 2 51  ? -3.311  -9.892  -18.810 1.00 52.57  ? 51   ILE H CA  1 
ATOM   2115 C  C   . ILE B 2 51  ? -4.505  -9.658  -19.755 1.00 59.92  ? 51   ILE H C   1 
ATOM   2116 O  O   . ILE B 2 51  ? -4.788  -8.498  -20.084 1.00 60.31  ? 51   ILE H O   1 
ATOM   2117 C  CB  . ILE B 2 51  ? -3.762  -9.780  -17.320 1.00 56.27  ? 51   ILE H CB  1 
ATOM   2118 C  CG1 . ILE B 2 51  ? -4.778  -10.892 -16.967 1.00 60.20  ? 51   ILE H CG1 1 
ATOM   2119 C  CG2 . ILE B 2 51  ? -4.332  -8.391  -16.970 1.00 54.94  ? 51   ILE H CG2 1 
ATOM   2120 C  CD1 . ILE B 2 51  ? -5.183  -11.044 -15.500 1.00 73.29  ? 51   ILE H CD1 1 
ATOM   2121 N  N   . LYS B 2 52  ? -5.241  -10.746 -20.125 1.00 57.67  ? 52   LYS H N   1 
ATOM   2122 C  CA  . LYS B 2 52  ? -6.494  -10.664 -20.873 1.00 58.20  ? 52   LYS H CA  1 
ATOM   2123 C  C   . LYS B 2 52  ? -7.565  -11.048 -19.842 1.00 64.41  ? 52   LYS H C   1 
ATOM   2124 O  O   . LYS B 2 52  ? -7.729  -12.227 -19.547 1.00 64.70  ? 52   LYS H O   1 
ATOM   2125 C  CB  . LYS B 2 52  ? -6.501  -11.574 -22.113 1.00 60.83  ? 52   LYS H CB  1 
ATOM   2126 C  CG  . LYS B 2 52  ? -5.301  -11.352 -23.044 1.00 63.48  ? 52   LYS H CG  1 
ATOM   2127 C  CD  . LYS B 2 52  ? -5.650  -11.535 -24.525 1.00 60.99  ? 52   LYS H CD  1 
ATOM   2128 C  CE  . LYS B 2 52  ? -4.697  -10.885 -25.512 1.00 48.70  ? 52   LYS H CE  1 
ATOM   2129 N  NZ  . LYS B 2 52  ? -3.284  -11.324 -25.379 1.00 43.63  ? 52   LYS H NZ  1 
ATOM   2130 N  N   . PRO B 2 53  ? -8.215  -10.056 -19.186 1.00 63.32  ? 53   PRO H N   1 
ATOM   2131 C  CA  . PRO B 2 53  ? -9.167  -10.381 -18.110 1.00 66.39  ? 53   PRO H CA  1 
ATOM   2132 C  C   . PRO B 2 53  ? -10.294 -11.330 -18.453 1.00 77.57  ? 53   PRO H C   1 
ATOM   2133 O  O   . PRO B 2 53  ? -10.751 -12.011 -17.537 1.00 80.29  ? 53   PRO H O   1 
ATOM   2134 C  CB  . PRO B 2 53  ? -9.713  -9.029  -17.697 1.00 67.52  ? 53   PRO H CB  1 
ATOM   2135 C  CG  . PRO B 2 53  ? -8.609  -8.074  -18.032 1.00 68.94  ? 53   PRO H CG  1 
ATOM   2136 C  CD  . PRO B 2 53  ? -8.075  -8.593  -19.335 1.00 63.41  ? 53   PRO H CD  1 
ATOM   2137 N  N   . ARG B 2 54  ? -10.719 -11.417 -19.740 1.00 77.30  ? 54   ARG H N   1 
ATOM   2138 C  CA  . ARG B 2 54  ? -11.795 -12.333 -20.167 1.00 81.41  ? 54   ARG H CA  1 
ATOM   2139 C  C   . ARG B 2 54  ? -11.449 -13.780 -19.883 1.00 89.79  ? 54   ARG H C   1 
ATOM   2140 O  O   . ARG B 2 54  ? -12.337 -14.541 -19.470 1.00 92.79  ? 54   ARG H O   1 
ATOM   2141 C  CB  . ARG B 2 54  ? -12.176 -12.167 -21.639 1.00 80.53  ? 54   ARG H CB  1 
ATOM   2142 C  CG  . ARG B 2 54  ? -13.579 -12.696 -21.972 1.00 90.63  ? 54   ARG H CG  1 
ATOM   2143 C  CD  . ARG B 2 54  ? -14.323 -11.779 -22.953 1.00 95.92  ? 54   ARG H CD  1 
ATOM   2144 N  NE  . ARG B 2 54  ? -14.384 -12.252 -24.349 1.00 96.75  ? 54   ARG H NE  1 
ATOM   2145 C  CZ  . ARG B 2 54  ? -13.432 -12.089 -25.274 1.00 92.45  ? 54   ARG H CZ  1 
ATOM   2146 N  NH1 . ARG B 2 54  ? -12.273 -11.533 -24.956 1.00 78.50  ? 54   ARG H NH1 1 
ATOM   2147 N  NH2 . ARG B 2 54  ? -13.611 -12.543 -26.506 1.00 59.28  ? 54   ARG H NH2 1 
ATOM   2148 N  N   . TRP B 2 55  ? -10.177 -14.177 -20.084 1.00 85.38  ? 55   TRP H N   1 
ATOM   2149 C  CA  . TRP B 2 55  ? -9.904  -15.549 -19.734 1.00 87.33  ? 55   TRP H CA  1 
ATOM   2150 C  C   . TRP B 2 55  ? -8.777  -15.706 -18.750 1.00 88.85  ? 55   TRP H C   1 
ATOM   2151 O  O   . TRP B 2 55  ? -8.400  -16.827 -18.436 1.00 90.44  ? 55   TRP H O   1 
ATOM   2152 C  CB  . TRP B 2 55  ? -9.800  -16.449 -20.938 1.00 87.72  ? 55   TRP H CB  1 
ATOM   2153 C  CG  . TRP B 2 55  ? -11.208 -16.881 -21.243 1.00 92.44  ? 55   TRP H CG  1 
ATOM   2154 C  CD1 . TRP B 2 55  ? -12.026 -17.594 -20.410 1.00 98.34  ? 55   TRP H CD1 1 
ATOM   2155 C  CD2 . TRP B 2 55  ? -12.059 -16.328 -22.254 1.00 93.11  ? 55   TRP H CD2 1 
ATOM   2156 N  NE1 . TRP B 2 55  ? -13.310 -17.604 -20.899 1.00 100.21 ? 55   TRP H NE1 1 
ATOM   2157 C  CE2 . TRP B 2 55  ? -13.355 -16.855 -22.045 1.00 100.29 ? 55   TRP H CE2 1 
ATOM   2158 C  CE3 . TRP B 2 55  ? -11.836 -15.503 -23.371 1.00 92.95  ? 55   TRP H CE3 1 
ATOM   2159 C  CZ2 . TRP B 2 55  ? -14.421 -16.597 -22.917 1.00 101.37 ? 55   TRP H CZ2 1 
ATOM   2160 C  CZ3 . TRP B 2 55  ? -12.892 -15.256 -24.238 1.00 96.28  ? 55   TRP H CZ3 1 
ATOM   2161 C  CH2 . TRP B 2 55  ? -14.175 -15.771 -23.989 1.00 100.13 ? 55   TRP H CH2 1 
ATOM   2162 N  N   . GLY B 2 56  ? -8.393  -14.608 -18.122 1.00 82.52  ? 56   GLY H N   1 
ATOM   2163 C  CA  . GLY B 2 56  ? -7.426  -14.602 -17.037 1.00 80.98  ? 56   GLY H CA  1 
ATOM   2164 C  C   . GLY B 2 56  ? -6.008  -15.008 -17.364 1.00 81.85  ? 56   GLY H C   1 
ATOM   2165 O  O   . GLY B 2 56  ? -5.215  -15.170 -16.436 1.00 82.13  ? 56   GLY H O   1 
ATOM   2166 N  N   . ALA B 2 57  ? -5.664  -15.150 -18.666 1.00 75.99  ? 57   ALA H N   1 
ATOM   2167 C  CA  . ALA B 2 57  ? -4.313  -15.523 -19.098 1.00 74.35  ? 57   ALA H CA  1 
ATOM   2168 C  C   . ALA B 2 57  ? -3.341  -14.336 -18.988 1.00 74.22  ? 57   ALA H C   1 
ATOM   2169 O  O   . ALA B 2 57  ? -3.666  -13.236 -19.428 1.00 71.52  ? 57   ALA H O   1 
ATOM   2170 C  CB  . ALA B 2 57  ? -4.331  -16.088 -20.520 1.00 75.45  ? 57   ALA H CB  1 
ATOM   2171 N  N   . ALA B 2 58  ? -2.170  -14.560 -18.355 1.00 70.43  ? 58   ALA H N   1 
ATOM   2172 C  CA  . ALA B 2 58  ? -1.112  -13.567 -18.154 1.00 67.21  ? 58   ALA H CA  1 
ATOM   2173 C  C   . ALA B 2 58  ? 0.186   -14.042 -18.768 1.00 69.56  ? 58   ALA H C   1 
ATOM   2174 O  O   . ALA B 2 58  ? 0.454   -15.241 -18.794 1.00 71.71  ? 58   ALA H O   1 
ATOM   2175 C  CB  . ALA B 2 58  ? -0.888  -13.322 -16.671 1.00 68.25  ? 58   ALA H CB  1 
ATOM   2176 N  N   . HIS B 2 59  ? 1.022   -13.098 -19.174 1.00 63.06  ? 59   HIS H N   1 
ATOM   2177 C  CA  . HIS B 2 59  ? 2.346   -13.323 -19.737 1.00 62.76  ? 59   HIS H CA  1 
ATOM   2178 C  C   . HIS B 2 59  ? 3.261   -12.296 -19.107 1.00 65.90  ? 59   HIS H C   1 
ATOM   2179 O  O   . HIS B 2 59  ? 2.827   -11.166 -18.891 1.00 64.33  ? 59   HIS H O   1 
ATOM   2180 C  CB  . HIS B 2 59  ? 2.305   -13.123 -21.253 1.00 62.86  ? 59   HIS H CB  1 
ATOM   2181 C  CG  . HIS B 2 59  ? 3.589   -13.416 -21.965 1.00 66.11  ? 59   HIS H CG  1 
ATOM   2182 N  ND1 . HIS B 2 59  ? 4.235   -14.636 -21.826 1.00 69.79  ? 59   HIS H ND1 1 
ATOM   2183 C  CD2 . HIS B 2 59  ? 4.308   -12.633 -22.801 1.00 66.33  ? 59   HIS H CD2 1 
ATOM   2184 C  CE1 . HIS B 2 59  ? 5.325   -14.547 -22.569 1.00 69.07  ? 59   HIS H CE1 1 
ATOM   2185 N  NE2 . HIS B 2 59  ? 5.412   -13.362 -23.175 1.00 67.34  ? 59   HIS H NE2 1 
ATOM   2186 N  N   . TYR B 2 60  ? 4.509   -12.679 -18.794 1.00 63.93  ? 60   TYR H N   1 
ATOM   2187 C  CA  . TYR B 2 60  ? 5.478   -11.797 -18.138 1.00 63.47  ? 60   TYR H CA  1 
ATOM   2188 C  C   . TYR B 2 60  ? 6.832   -11.774 -18.858 1.00 69.80  ? 60   TYR H C   1 
ATOM   2189 O  O   . TYR B 2 60  ? 7.179   -12.737 -19.547 1.00 72.09  ? 60   TYR H O   1 
ATOM   2190 C  CB  . TYR B 2 60  ? 5.733   -12.269 -16.686 1.00 65.58  ? 60   TYR H CB  1 
ATOM   2191 C  CG  . TYR B 2 60  ? 4.507   -12.531 -15.833 1.00 67.89  ? 60   TYR H CG  1 
ATOM   2192 C  CD1 . TYR B 2 60  ? 3.727   -11.483 -15.349 1.00 69.19  ? 60   TYR H CD1 1 
ATOM   2193 C  CD2 . TYR B 2 60  ? 4.169   -13.820 -15.445 1.00 71.29  ? 60   TYR H CD2 1 
ATOM   2194 C  CE1 . TYR B 2 60  ? 2.616   -11.722 -14.524 1.00 72.60  ? 60   TYR H CE1 1 
ATOM   2195 C  CE2 . TYR B 2 60  ? 3.058   -14.073 -14.627 1.00 73.50  ? 60   TYR H CE2 1 
ATOM   2196 C  CZ  . TYR B 2 60  ? 2.270   -13.023 -14.181 1.00 78.93  ? 60   TYR H CZ  1 
ATOM   2197 O  OH  . TYR B 2 60  ? 1.163   -13.262 -13.392 1.00 78.77  ? 60   TYR H OH  1 
ATOM   2198 N  N   . ALA B 2 61  ? 7.625   -10.704 -18.644 1.00 64.60  ? 61   ALA H N   1 
ATOM   2199 C  CA  . ALA B 2 61  ? 9.014   -10.612 -19.122 1.00 64.84  ? 61   ALA H CA  1 
ATOM   2200 C  C   . ALA B 2 61  ? 9.794   -11.544 -18.193 1.00 69.57  ? 61   ALA H C   1 
ATOM   2201 O  O   . ALA B 2 61  ? 9.547   -11.526 -16.981 1.00 70.02  ? 61   ALA H O   1 
ATOM   2202 C  CB  . ALA B 2 61  ? 9.532   -9.188  -18.952 1.00 64.12  ? 61   ALA H CB  1 
ATOM   2203 N  N   . GLN B 2 62  ? 10.704  -12.362 -18.739 1.00 65.95  ? 62   GLN H N   1 
ATOM   2204 C  CA  . GLN B 2 62  ? 11.505  -13.343 -17.963 1.00 67.43  ? 62   GLN H CA  1 
ATOM   2205 C  C   . GLN B 2 62  ? 12.135  -12.766 -16.695 1.00 71.31  ? 62   GLN H C   1 
ATOM   2206 O  O   . GLN B 2 62  ? 12.135  -13.420 -15.655 1.00 71.70  ? 62   GLN H O   1 
ATOM   2207 C  CB  . GLN B 2 62  ? 12.662  -13.956 -18.803 1.00 69.55  ? 62   GLN H CB  1 
ATOM   2208 C  CG  . GLN B 2 62  ? 12.360  -14.388 -20.223 1.00 65.75  ? 62   GLN H CG  1 
ATOM   2209 C  CD  . GLN B 2 62  ? 11.671  -15.716 -20.256 1.00 69.47  ? 62   GLN H CD  1 
ATOM   2210 O  OE1 . GLN B 2 62  ? 10.505  -15.859 -19.860 1.00 59.20  ? 62   GLN H OE1 1 
ATOM   2211 N  NE2 . GLN B 2 62  ? 12.374  -16.711 -20.763 1.00 66.36  ? 62   GLN H NE2 1 
ATOM   2212 N  N   . LYS B 2 63  ? 12.680  -11.538 -16.778 1.00 67.31  ? 63   LYS H N   1 
ATOM   2213 C  CA  . LYS B 2 63  ? 13.355  -10.916 -15.631 1.00 67.98  ? 63   LYS H CA  1 
ATOM   2214 C  C   . LYS B 2 63  ? 12.423  -10.636 -14.413 1.00 74.49  ? 63   LYS H C   1 
ATOM   2215 O  O   . LYS B 2 63  ? 12.902  -10.410 -13.293 1.00 76.07  ? 63   LYS H O   1 
ATOM   2216 C  CB  . LYS B 2 63  ? 14.132  -9.668  -16.056 1.00 67.04  ? 63   LYS H CB  1 
ATOM   2217 C  CG  . LYS B 2 63  ? 13.297  -8.459  -16.409 1.00 52.06  ? 63   LYS H CG  1 
ATOM   2218 C  CD  . LYS B 2 63  ? 14.156  -7.200  -16.430 1.00 49.83  ? 63   LYS H CD  1 
ATOM   2219 C  CE  . LYS B 2 63  ? 14.473  -6.648  -15.047 1.00 62.07  ? 63   LYS H CE  1 
ATOM   2220 N  NZ  . LYS B 2 63  ? 15.145  -5.314  -15.098 1.00 71.87  ? 63   LYS H NZ  1 
ATOM   2221 N  N   . PHE B 2 64  ? 11.105  -10.679 -14.638 1.00 70.15  ? 64   PHE H N   1 
ATOM   2222 C  CA  . PHE B 2 64  ? 10.104  -10.477 -13.601 1.00 69.62  ? 64   PHE H CA  1 
ATOM   2223 C  C   . PHE B 2 64  ? 9.401   -11.800 -13.196 1.00 75.39  ? 64   PHE H C   1 
ATOM   2224 O  O   . PHE B 2 64  ? 8.441   -11.784 -12.421 1.00 74.80  ? 64   PHE H O   1 
ATOM   2225 C  CB  . PHE B 2 64  ? 9.102   -9.413  -14.042 1.00 68.39  ? 64   PHE H CB  1 
ATOM   2226 C  CG  . PHE B 2 64  ? 9.691   -8.060  -14.333 1.00 67.50  ? 64   PHE H CG  1 
ATOM   2227 C  CD1 . PHE B 2 64  ? 10.113  -7.231  -13.302 1.00 70.30  ? 64   PHE H CD1 1 
ATOM   2228 C  CD2 . PHE B 2 64  ? 9.795   -7.598  -15.636 1.00 68.00  ? 64   PHE H CD2 1 
ATOM   2229 C  CE1 . PHE B 2 64  ? 10.651  -5.966  -13.574 1.00 69.64  ? 64   PHE H CE1 1 
ATOM   2230 C  CE2 . PHE B 2 64  ? 10.325  -6.336  -15.907 1.00 69.66  ? 64   PHE H CE2 1 
ATOM   2231 C  CZ  . PHE B 2 64  ? 10.757  -5.529  -14.872 1.00 67.64  ? 64   PHE H CZ  1 
ATOM   2232 N  N   . GLN B 2 65  ? 9.923   -12.942 -13.666 1.00 74.09  ? 65   GLN H N   1 
ATOM   2233 C  CA  . GLN B 2 65  ? 9.366   -14.261 -13.356 1.00 76.47  ? 65   GLN H CA  1 
ATOM   2234 C  C   . GLN B 2 65  ? 9.515   -14.619 -11.879 1.00 81.71  ? 65   GLN H C   1 
ATOM   2235 O  O   . GLN B 2 65  ? 10.626  -14.579 -11.330 1.00 82.30  ? 65   GLN H O   1 
ATOM   2236 C  CB  . GLN B 2 65  ? 9.986   -15.354 -14.254 1.00 79.60  ? 65   GLN H CB  1 
ATOM   2237 C  CG  . GLN B 2 65  ? 9.023   -16.474 -14.650 1.00 94.75  ? 65   GLN H CG  1 
ATOM   2238 C  CD  . GLN B 2 65  ? 7.942   -16.048 -15.619 1.00 112.77 ? 65   GLN H CD  1 
ATOM   2239 O  OE1 . GLN B 2 65  ? 8.044   -15.025 -16.311 1.00 108.55 ? 65   GLN H OE1 1 
ATOM   2240 N  NE2 . GLN B 2 65  ? 6.867   -16.826 -15.688 1.00 101.49 ? 65   GLN H NE2 1 
ATOM   2241 N  N   . GLY B 2 66  ? 8.381   -14.917 -11.250 1.00 78.39  ? 66   GLY H N   1 
ATOM   2242 C  CA  . GLY B 2 66  ? 8.328   -15.280 -9.836  1.00 80.70  ? 66   GLY H CA  1 
ATOM   2243 C  C   . GLY B 2 66  ? 8.104   -14.122 -8.880  1.00 82.21  ? 66   GLY H C   1 
ATOM   2244 O  O   . GLY B 2 66  ? 7.622   -14.337 -7.763  1.00 83.58  ? 66   GLY H O   1 
ATOM   2245 N  N   . ARG B 2 67  ? 8.465   -12.883 -9.302  1.00 74.75  ? 67   ARG H N   1 
ATOM   2246 C  CA  . ARG B 2 67  ? 8.302   -11.666 -8.492  1.00 72.43  ? 67   ARG H CA  1 
ATOM   2247 C  C   . ARG B 2 67  ? 7.053   -10.893 -8.861  1.00 74.09  ? 67   ARG H C   1 
ATOM   2248 O  O   . ARG B 2 67  ? 6.486   -10.206 -8.010  1.00 74.08  ? 67   ARG H O   1 
ATOM   2249 C  CB  . ARG B 2 67  ? 9.527   -10.750 -8.589  1.00 67.71  ? 67   ARG H CB  1 
ATOM   2250 C  CG  . ARG B 2 67  ? 10.701  -11.229 -7.757  1.00 69.28  ? 67   ARG H CG  1 
ATOM   2251 C  CD  . ARG B 2 67  ? 11.939  -10.399 -7.979  1.00 63.07  ? 67   ARG H CD  1 
ATOM   2252 N  NE  . ARG B 2 67  ? 11.762  -9.005  -7.606  1.00 60.73  ? 67   ARG H NE  1 
ATOM   2253 C  CZ  . ARG B 2 67  ? 11.963  -7.988  -8.435  1.00 76.58  ? 67   ARG H CZ  1 
ATOM   2254 N  NH1 . ARG B 2 67  ? 12.343  -8.209  -9.689  1.00 64.51  ? 67   ARG H NH1 1 
ATOM   2255 N  NH2 . ARG B 2 67  ? 11.782  -6.748  -8.024  1.00 65.01  ? 67   ARG H NH2 1 
ATOM   2256 N  N   . VAL B 2 68  ? 6.619   -10.999 -10.122 1.00 68.75  ? 68   VAL H N   1 
ATOM   2257 C  CA  . VAL B 2 68  ? 5.428   -10.287 -10.557 1.00 66.79  ? 68   VAL H CA  1 
ATOM   2258 C  C   . VAL B 2 68  ? 4.204   -11.208 -10.601 1.00 70.61  ? 68   VAL H C   1 
ATOM   2259 O  O   . VAL B 2 68  ? 4.301   -12.356 -11.020 1.00 70.80  ? 68   VAL H O   1 
ATOM   2260 C  CB  . VAL B 2 68  ? 5.578   -9.457  -11.877 1.00 68.31  ? 68   VAL H CB  1 
ATOM   2261 C  CG1 . VAL B 2 68  ? 6.651   -8.388  -11.802 1.00 66.96  ? 68   VAL H CG1 1 
ATOM   2262 C  CG2 . VAL B 2 68  ? 5.722   -10.325 -13.115 1.00 68.17  ? 68   VAL H CG2 1 
ATOM   2263 N  N   . THR B 2 69  ? 3.054   -10.691 -10.188 1.00 67.04  ? 69   THR H N   1 
ATOM   2264 C  CA  . THR B 2 69  ? 1.786   -11.403 -10.283 1.00 67.80  ? 69   THR H CA  1 
ATOM   2265 C  C   . THR B 2 69  ? 0.767   -10.451 -10.856 1.00 67.47  ? 69   THR H C   1 
ATOM   2266 O  O   . THR B 2 69  ? 0.474   -9.414  -10.253 1.00 66.10  ? 69   THR H O   1 
ATOM   2267 C  CB  . THR B 2 69  ? 1.355   -12.036 -8.962  1.00 82.37  ? 69   THR H CB  1 
ATOM   2268 O  OG1 . THR B 2 69  ? 2.456   -12.751 -8.406  1.00 84.02  ? 69   THR H OG1 1 
ATOM   2269 C  CG2 . THR B 2 69  ? 0.157   -12.972 -9.135  1.00 83.69  ? 69   THR H CG2 1 
ATOM   2270 N  N   . ILE B 2 70  ? 0.257   -10.789 -12.037 1.00 62.67  ? 70   ILE H N   1 
ATOM   2271 C  CA  . ILE B 2 70  ? -0.733  -9.962  -12.698 1.00 61.44  ? 70   ILE H CA  1 
ATOM   2272 C  C   . ILE B 2 70  ? -2.074  -10.680 -12.645 1.00 69.79  ? 70   ILE H C   1 
ATOM   2273 O  O   . ILE B 2 70  ? -2.165  -11.849 -13.036 1.00 71.15  ? 70   ILE H O   1 
ATOM   2274 C  CB  . ILE B 2 70  ? -0.293  -9.478  -14.112 1.00 61.73  ? 70   ILE H CB  1 
ATOM   2275 C  CG1 . ILE B 2 70  ? 0.974   -8.579  -14.031 1.00 59.83  ? 70   ILE H CG1 1 
ATOM   2276 C  CG2 . ILE B 2 70  ? -1.417  -8.711  -14.787 1.00 61.31  ? 70   ILE H CG2 1 
ATOM   2277 C  CD1 . ILE B 2 70  ? 1.704   -8.265  -15.360 1.00 59.00  ? 70   ILE H CD1 1 
ATOM   2278 N  N   . THR B 2 71  ? -3.100  -9.991  -12.091 1.00 67.38  ? 71   THR H N   1 
ATOM   2279 C  CA  . THR B 2 71  ? -4.466  -10.507 -11.926 1.00 69.08  ? 71   THR H CA  1 
ATOM   2280 C  C   . THR B 2 71  ? -5.455  -9.463  -12.394 1.00 74.22  ? 71   THR H C   1 
ATOM   2281 O  O   . THR B 2 71  ? -5.053  -8.341  -12.684 1.00 72.88  ? 71   THR H O   1 
ATOM   2282 C  CB  . THR B 2 71  ? -4.744  -10.880 -10.463 1.00 71.87  ? 71   THR H CB  1 
ATOM   2283 O  OG1 . THR B 2 71  ? -4.465  -9.762  -9.622  1.00 68.91  ? 71   THR H OG1 1 
ATOM   2284 C  CG2 . THR B 2 71  ? -3.957  -12.084 -10.009 1.00 70.89  ? 71   THR H CG2 1 
ATOM   2285 N  N   . ALA B 2 72  ? -6.744  -9.827  -12.485 1.00 73.03  ? 72   ALA H N   1 
ATOM   2286 C  CA  . ALA B 2 72  ? -7.822  -8.917  -12.878 1.00 72.81  ? 72   ALA H CA  1 
ATOM   2287 C  C   . ALA B 2 72  ? -9.130  -9.363  -12.272 1.00 82.26  ? 72   ALA H C   1 
ATOM   2288 O  O   . ALA B 2 72  ? -9.308  -10.552 -11.999 1.00 84.85  ? 72   ALA H O   1 
ATOM   2289 C  CB  . ALA B 2 72  ? -7.944  -8.838  -14.388 1.00 71.94  ? 72   ALA H CB  1 
ATOM   2290 N  N   . ASP B 2 73  ? -10.023 -8.401  -12.014 1.00 80.23  ? 73   ASP H N   1 
ATOM   2291 C  CA  . ASP B 2 73  ? -11.351 -8.641  -11.470 1.00 83.54  ? 73   ASP H CA  1 
ATOM   2292 C  C   . ASP B 2 73  ? -12.313 -8.092  -12.492 1.00 85.79  ? 73   ASP H C   1 
ATOM   2293 O  O   . ASP B 2 73  ? -12.433 -6.876  -12.654 1.00 84.27  ? 73   ASP H O   1 
ATOM   2294 C  CB  . ASP B 2 73  ? -11.543 -7.986  -10.090 1.00 87.21  ? 73   ASP H CB  1 
ATOM   2295 C  CG  . ASP B 2 73  ? -12.854 -8.350  -9.419  1.00 106.57 ? 73   ASP H CG  1 
ATOM   2296 O  OD1 . ASP B 2 73  ? -12.977 -9.499  -8.933  1.00 109.92 ? 73   ASP H OD1 1 
ATOM   2297 O  OD2 . ASP B 2 73  ? -13.744 -7.483  -9.362  1.00 115.80 ? 73   ASP H OD2 1 
ATOM   2298 N  N   . GLU B 2 74  ? -12.924 -9.013  -13.246 1.00 82.32  ? 74   GLU H N   1 
ATOM   2299 C  CA  . GLU B 2 74  ? -13.880 -8.758  -14.323 1.00 82.27  ? 74   GLU H CA  1 
ATOM   2300 C  C   . GLU B 2 74  ? -15.031 -7.840  -13.914 1.00 87.96  ? 74   GLU H C   1 
ATOM   2301 O  O   . GLU B 2 74  ? -15.355 -6.900  -14.650 1.00 87.37  ? 74   GLU H O   1 
ATOM   2302 C  CB  . GLU B 2 74  ? -14.414 -10.075 -14.918 1.00 85.56  ? 74   GLU H CB  1 
ATOM   2303 C  CG  . GLU B 2 74  ? -13.683 -10.574 -16.161 1.00 90.56  ? 74   GLU H CG  1 
ATOM   2304 C  CD  . GLU B 2 74  ? -14.368 -11.735 -16.858 1.00 99.89  ? 74   GLU H CD  1 
ATOM   2305 O  OE1 . GLU B 2 74  ? -15.560 -11.593 -17.217 1.00 104.24 ? 74   GLU H OE1 1 
ATOM   2306 O  OE2 . GLU B 2 74  ? -13.711 -12.784 -17.055 1.00 76.10  ? 74   GLU H OE2 1 
ATOM   2307 N  N   . SER B 2 75  ? -15.625 -8.101  -12.732 1.00 86.16  ? 75   SER H N   1 
ATOM   2308 C  CA  . SER B 2 75  ? -16.759 -7.344  -12.196 1.00 88.14  ? 75   SER H CA  1 
ATOM   2309 C  C   . SER B 2 75  ? -16.479 -5.865  -11.983 1.00 89.59  ? 75   SER H C   1 
ATOM   2310 O  O   . SER B 2 75  ? -17.380 -5.051  -12.171 1.00 91.39  ? 75   SER H O   1 
ATOM   2311 C  CB  . SER B 2 75  ? -17.272 -7.972  -10.906 1.00 95.06  ? 75   SER H CB  1 
ATOM   2312 O  OG  . SER B 2 75  ? -16.246 -8.113  -9.940  1.00 101.14 ? 75   SER H OG  1 
ATOM   2313 N  N   . THR B 2 76  ? -15.243 -5.515  -11.602 1.00 81.80  ? 76   THR H N   1 
ATOM   2314 C  CA  . THR B 2 76  ? -14.846 -4.126  -11.349 1.00 79.27  ? 76   THR H CA  1 
ATOM   2315 C  C   . THR B 2 76  ? -14.051 -3.498  -12.514 1.00 78.57  ? 76   THR H C   1 
ATOM   2316 O  O   . THR B 2 76  ? -13.702 -2.311  -12.450 1.00 77.40  ? 76   THR H O   1 
ATOM   2317 C  CB  . THR B 2 76  ? -14.084 -4.026  -10.014 1.00 86.50  ? 76   THR H CB  1 
ATOM   2318 O  OG1 . THR B 2 76  ? -12.996 -4.946  -10.027 1.00 84.13  ? 76   THR H OG1 1 
ATOM   2319 C  CG2 . THR B 2 76  ? -14.966 -4.280  -8.809  1.00 89.30  ? 76   THR H CG2 1 
ATOM   2320 N  N   . SER B 2 77  ? -13.780 -4.284  -13.582 1.00 71.90  ? 77   SER H N   1 
ATOM   2321 C  CA  . SER B 2 77  ? -12.980 -3.861  -14.742 1.00 67.54  ? 77   SER H CA  1 
ATOM   2322 C  C   . SER B 2 77  ? -11.594 -3.377  -14.258 1.00 64.33  ? 77   SER H C   1 
ATOM   2323 O  O   . SER B 2 77  ? -11.114 -2.347  -14.705 1.00 61.67  ? 77   SER H O   1 
ATOM   2324 C  CB  . SER B 2 77  ? -13.714 -2.818  -15.599 1.00 71.69  ? 77   SER H CB  1 
ATOM   2325 O  OG  . SER B 2 77  ? -14.942 -3.301  -16.128 1.00 80.53  ? 77   SER H OG  1 
ATOM   2326 N  N   . THR B 2 78  ? -10.975 -4.124  -13.324 1.00 59.15  ? 78   THR H N   1 
ATOM   2327 C  CA  . THR B 2 78  ? -9.714  -3.744  -12.688 1.00 56.58  ? 78   THR H CA  1 
ATOM   2328 C  C   . THR B 2 78  ? -8.624  -4.804  -12.867 1.00 57.97  ? 78   THR H C   1 
ATOM   2329 O  O   . THR B 2 78  ? -8.898  -5.985  -12.722 1.00 59.79  ? 78   THR H O   1 
ATOM   2330 C  CB  . THR B 2 78  ? -9.986  -3.378  -11.202 1.00 67.42  ? 78   THR H CB  1 
ATOM   2331 O  OG1 . THR B 2 78  ? -11.021 -2.394  -11.132 1.00 66.86  ? 78   THR H OG1 1 
ATOM   2332 C  CG2 . THR B 2 78  ? -8.770  -2.812  -10.489 1.00 64.96  ? 78   THR H CG2 1 
ATOM   2333 N  N   . ALA B 2 79  ? -7.396  -4.358  -13.199 1.00 50.23  ? 79   ALA H N   1 
ATOM   2334 C  CA  . ALA B 2 79  ? -6.182  -5.162  -13.377 1.00 48.31  ? 79   ALA H CA  1 
ATOM   2335 C  C   . ALA B 2 79  ? -5.240  -4.821  -12.239 1.00 53.63  ? 79   ALA H C   1 
ATOM   2336 O  O   . ALA B 2 79  ? -5.244  -3.689  -11.762 1.00 52.56  ? 79   ALA H O   1 
ATOM   2337 C  CB  . ALA B 2 79  ? -5.516  -4.842  -14.701 1.00 46.44  ? 79   ALA H CB  1 
ATOM   2338 N  N   . TYR B 2 80  ? -4.431  -5.789  -11.805 1.00 52.00  ? 80   TYR H N   1 
ATOM   2339 C  CA  . TYR B 2 80  ? -3.519  -5.608  -10.689 1.00 51.67  ? 80   TYR H CA  1 
ATOM   2340 C  C   . TYR B 2 80  ? -2.164  -6.105  -11.034 1.00 53.73  ? 80   TYR H C   1 
ATOM   2341 O  O   . TYR B 2 80  ? -2.034  -7.120  -11.733 1.00 52.29  ? 80   TYR H O   1 
ATOM   2342 C  CB  . TYR B 2 80  ? -4.002  -6.385  -9.451  1.00 55.54  ? 80   TYR H CB  1 
ATOM   2343 C  CG  . TYR B 2 80  ? -5.366  -5.973  -8.960  1.00 58.60  ? 80   TYR H CG  1 
ATOM   2344 C  CD1 . TYR B 2 80  ? -5.512  -4.963  -8.013  1.00 60.99  ? 80   TYR H CD1 1 
ATOM   2345 C  CD2 . TYR B 2 80  ? -6.509  -6.621  -9.404  1.00 60.67  ? 80   TYR H CD2 1 
ATOM   2346 C  CE1 . TYR B 2 80  ? -6.766  -4.579  -7.555  1.00 63.25  ? 80   TYR H CE1 1 
ATOM   2347 C  CE2 . TYR B 2 80  ? -7.766  -6.247  -8.952  1.00 63.59  ? 80   TYR H CE2 1 
ATOM   2348 C  CZ  . TYR B 2 80  ? -7.887  -5.236  -8.013  1.00 72.24  ? 80   TYR H CZ  1 
ATOM   2349 O  OH  . TYR B 2 80  ? -9.120  -4.855  -7.554  1.00 77.57  ? 80   TYR H OH  1 
ATOM   2350 N  N   . MET B 2 81  ? -1.152  -5.424  -10.485 1.00 49.44  ? 81   MET H N   1 
ATOM   2351 C  CA  . MET B 2 81  ? 0.230   -5.821  -10.622 1.00 48.93  ? 81   MET H CA  1 
ATOM   2352 C  C   . MET B 2 81  ? 0.768   -5.879  -9.219  1.00 54.49  ? 81   MET H C   1 
ATOM   2353 O  O   . MET B 2 81  ? 0.728   -4.883  -8.495  1.00 52.22  ? 81   MET H O   1 
ATOM   2354 C  CB  . MET B 2 81  ? 1.006   -4.824  -11.475 1.00 49.15  ? 81   MET H CB  1 
ATOM   2355 C  CG  . MET B 2 81  ? 2.345   -5.325  -11.956 1.00 53.37  ? 81   MET H CG  1 
ATOM   2356 S  SD  . MET B 2 81  ? 3.656   -5.172  -10.705 1.00 59.94  ? 81   MET H SD  1 
ATOM   2357 C  CE  . MET B 2 81  ? 3.529   -3.455  -10.282 1.00 55.09  ? 81   MET H CE  1 
ATOM   2358 N  N   . GLU B 2 82  ? 1.238   -7.070  -8.822  1.00 54.39  ? 82   GLU H N   1 
ATOM   2359 C  CA  . GLU B 2 82  ? 1.839   -7.286  -7.520  1.00 55.97  ? 82   GLU H CA  1 
ATOM   2360 C  C   . GLU B 2 82  ? 3.293   -7.621  -7.761  1.00 59.66  ? 82   GLU H C   1 
ATOM   2361 O  O   . GLU B 2 82  ? 3.595   -8.497  -8.564  1.00 59.53  ? 82   GLU H O   1 
ATOM   2362 C  CB  . GLU B 2 82  ? 1.121   -8.395  -6.749  1.00 60.31  ? 82   GLU H CB  1 
ATOM   2363 C  CG  . GLU B 2 82  ? 1.642   -8.615  -5.342  1.00 73.98  ? 82   GLU H CG  1 
ATOM   2364 C  CD  . GLU B 2 82  ? 0.899   -9.748  -4.666  1.00 101.52 ? 82   GLU H CD  1 
ATOM   2365 O  OE1 . GLU B 2 82  ? 1.395   -10.896 -4.727  1.00 108.52 ? 82   GLU H OE1 1 
ATOM   2366 O  OE2 . GLU B 2 82  ? -0.230  -9.511  -4.180  1.00 90.81  ? 82   GLU H OE2 1 
ATOM   2367 N  N   . LEU B 2 83  ? 4.192   -6.886  -7.120  1.00 56.05  ? 83   LEU H N   1 
ATOM   2368 C  CA  . LEU B 2 83  ? 5.628   -7.109  -7.241  1.00 55.90  ? 83   LEU H CA  1 
ATOM   2369 C  C   . LEU B 2 83  ? 6.160   -7.380  -5.845  1.00 63.87  ? 83   LEU H C   1 
ATOM   2370 O  O   . LEU B 2 83  ? 5.948   -6.573  -4.940  1.00 64.55  ? 83   LEU H O   1 
ATOM   2371 C  CB  . LEU B 2 83  ? 6.320   -5.913  -7.920  1.00 53.02  ? 83   LEU H CB  1 
ATOM   2372 C  CG  . LEU B 2 83  ? 7.802   -6.059  -8.257  1.00 57.26  ? 83   LEU H CG  1 
ATOM   2373 C  CD1 . LEU B 2 83  ? 8.048   -7.167  -9.248  1.00 57.64  ? 83   LEU H CD1 1 
ATOM   2374 C  CD2 . LEU B 2 83  ? 8.358   -4.767  -8.784  1.00 56.39  ? 83   LEU H CD2 1 
ATOM   2375 N  N   . SER B 2 84  ? 6.785   -8.545  -5.658  1.00 62.74  ? 84   SER H N   1 
ATOM   2376 C  CA  . SER B 2 84  ? 7.279   -9.004  -4.361  1.00 66.07  ? 84   SER H CA  1 
ATOM   2377 C  C   . SER B 2 84  ? 8.798   -8.884  -4.231  1.00 72.60  ? 84   SER H C   1 
ATOM   2378 O  O   . SER B 2 84  ? 9.473   -8.586  -5.231  1.00 71.04  ? 84   SER H O   1 
ATOM   2379 C  CB  . SER B 2 84  ? 6.811   -10.433 -4.108  1.00 70.57  ? 84   SER H CB  1 
ATOM   2380 O  OG  . SER B 2 84  ? 5.414   -10.549 -4.331  1.00 75.37  ? 84   SER H OG  1 
ATOM   2381 N  N   . SER B 2 85  ? 9.335   -9.091  -2.990  1.00 71.54  ? 85   SER H N   1 
ATOM   2382 C  CA  . SER B 2 85  ? 10.772  -9.006  -2.675  1.00 72.21  ? 85   SER H CA  1 
ATOM   2383 C  C   . SER B 2 85  ? 11.368  -7.699  -3.274  1.00 72.28  ? 85   SER H C   1 
ATOM   2384 O  O   . SER B 2 85  ? 12.327  -7.731  -4.049  1.00 71.60  ? 85   SER H O   1 
ATOM   2385 C  CB  . SER B 2 85  ? 11.496  -10.270 -3.162  1.00 75.93  ? 85   SER H CB  1 
ATOM   2386 O  OG  . SER B 2 85  ? 12.907  -10.239 -3.027  1.00 82.15  ? 85   SER H OG  1 
ATOM   2387 N  N   . LEU B 2 86  ? 10.738  -6.564  -2.940  1.00 66.03  ? 86   LEU H N   1 
ATOM   2388 C  CA  . LEU B 2 86  ? 11.100  -5.246  -3.451  1.00 63.32  ? 86   LEU H CA  1 
ATOM   2389 C  C   . LEU B 2 86  ? 12.524  -4.821  -3.120  1.00 70.47  ? 86   LEU H C   1 
ATOM   2390 O  O   . LEU B 2 86  ? 12.971  -5.015  -1.993  1.00 72.21  ? 86   LEU H O   1 
ATOM   2391 C  CB  . LEU B 2 86  ? 10.094  -4.169  -3.005  1.00 61.76  ? 86   LEU H CB  1 
ATOM   2392 C  CG  . LEU B 2 86  ? 8.705   -4.225  -3.632  1.00 63.92  ? 86   LEU H CG  1 
ATOM   2393 C  CD1 . LEU B 2 86  ? 7.787   -3.278  -2.958  1.00 63.56  ? 86   LEU H CD1 1 
ATOM   2394 C  CD2 . LEU B 2 86  ? 8.748   -3.916  -5.114  1.00 62.90  ? 86   LEU H CD2 1 
ATOM   2395 N  N   . ARG B 2 87  ? 13.237  -4.266  -4.133  1.00 66.81  ? 87   ARG H N   1 
ATOM   2396 C  CA  . ARG B 2 87  ? 14.621  -3.768  -4.059  1.00 68.03  ? 87   ARG H CA  1 
ATOM   2397 C  C   . ARG B 2 87  ? 14.619  -2.262  -4.370  1.00 71.22  ? 87   ARG H C   1 
ATOM   2398 O  O   . ARG B 2 87  ? 13.659  -1.785  -4.976  1.00 68.62  ? 87   ARG H O   1 
ATOM   2399 C  CB  . ARG B 2 87  ? 15.506  -4.487  -5.096  1.00 68.32  ? 87   ARG H CB  1 
ATOM   2400 C  CG  . ARG B 2 87  ? 15.521  -6.008  -5.002  1.00 88.07  ? 87   ARG H CG  1 
ATOM   2401 C  CD  . ARG B 2 87  ? 14.761  -6.648  -6.148  1.00 103.07 ? 87   ARG H CD  1 
ATOM   2402 N  NE  . ARG B 2 87  ? 14.598  -8.083  -5.921  1.00 125.68 ? 87   ARG H NE  1 
ATOM   2403 C  CZ  . ARG B 2 87  ? 15.269  -9.023  -6.574  1.00 148.98 ? 87   ARG H CZ  1 
ATOM   2404 N  NH1 . ARG B 2 87  ? 16.119  -8.691  -7.540  1.00 134.19 ? 87   ARG H NH1 1 
ATOM   2405 N  NH2 . ARG B 2 87  ? 15.073  -10.306 -6.289  1.00 143.74 ? 87   ARG H NH2 1 
ATOM   2406 N  N   . SER B 2 88  ? 15.705  -1.516  -4.022  1.00 69.14  ? 88   SER H N   1 
ATOM   2407 C  CA  . SER B 2 88  ? 15.786  -0.068  -4.329  1.00 66.32  ? 88   SER H CA  1 
ATOM   2408 C  C   . SER B 2 88  ? 15.669  0.215   -5.849  1.00 64.36  ? 88   SER H C   1 
ATOM   2409 O  O   . SER B 2 88  ? 15.086  1.221   -6.239  1.00 60.63  ? 88   SER H O   1 
ATOM   2410 C  CB  . SER B 2 88  ? 17.045  0.558   -3.736  1.00 71.91  ? 88   SER H CB  1 
ATOM   2411 O  OG  . SER B 2 88  ? 18.212  -0.093  -4.212  1.00 84.80  ? 88   SER H OG  1 
ATOM   2412 N  N   . GLU B 2 89  ? 16.136  -0.735  -6.693  1.00 59.62  ? 89   GLU H N   1 
ATOM   2413 C  CA  . GLU B 2 89  ? 16.064  -0.655  -8.152  1.00 56.35  ? 89   GLU H CA  1 
ATOM   2414 C  C   . GLU B 2 89  ? 14.637  -0.743  -8.651  1.00 57.16  ? 89   GLU H C   1 
ATOM   2415 O  O   . GLU B 2 89  ? 14.414  -0.499  -9.832  1.00 55.15  ? 89   GLU H O   1 
ATOM   2416 C  CB  . GLU B 2 89  ? 16.909  -1.744  -8.847  1.00 58.90  ? 89   GLU H CB  1 
ATOM   2417 C  CG  . GLU B 2 89  ? 18.283  -1.987  -8.265  1.00 75.90  ? 89   GLU H CG  1 
ATOM   2418 C  CD  . GLU B 2 89  ? 18.276  -3.064  -7.201  1.00 111.07 ? 89   GLU H CD  1 
ATOM   2419 O  OE1 . GLU B 2 89  ? 18.192  -4.259  -7.573  1.00 103.53 ? 89   GLU H OE1 1 
ATOM   2420 O  OE2 . GLU B 2 89  ? 18.206  -2.709  -6.001  1.00 115.57 ? 89   GLU H OE2 1 
ATOM   2421 N  N   . ASP B 2 90  ? 13.677  -1.118  -7.787  1.00 54.69  ? 90   ASP H N   1 
ATOM   2422 C  CA  . ASP B 2 90  ? 12.272  -1.204  -8.184  1.00 54.15  ? 90   ASP H CA  1 
ATOM   2423 C  C   . ASP B 2 90  ? 11.567  0.161   -8.076  1.00 59.55  ? 90   ASP H C   1 
ATOM   2424 O  O   . ASP B 2 90  ? 10.417  0.278   -8.504  1.00 56.65  ? 90   ASP H O   1 
ATOM   2425 C  CB  . ASP B 2 90  ? 11.501  -2.287  -7.409  1.00 57.61  ? 90   ASP H CB  1 
ATOM   2426 C  CG  . ASP B 2 90  ? 11.950  -3.710  -7.668  1.00 68.25  ? 90   ASP H CG  1 
ATOM   2427 O  OD1 . ASP B 2 90  ? 12.137  -4.073  -8.851  1.00 68.63  ? 90   ASP H OD1 1 
ATOM   2428 O  OD2 . ASP B 2 90  ? 12.066  -4.477  -6.696  1.00 72.69  ? 90   ASP H OD2 1 
ATOM   2429 N  N   . THR B 2 91  ? 12.252  1.193   -7.506  1.00 58.94  ? 91   THR H N   1 
ATOM   2430 C  CA  . THR B 2 91  ? 11.699  2.553   -7.393  1.00 57.92  ? 91   THR H CA  1 
ATOM   2431 C  C   . THR B 2 91  ? 11.434  3.036   -8.816  1.00 58.59  ? 91   THR H C   1 
ATOM   2432 O  O   . THR B 2 91  ? 12.367  3.122   -9.618  1.00 58.22  ? 91   THR H O   1 
ATOM   2433 C  CB  . THR B 2 91  ? 12.666  3.524   -6.685  1.00 72.28  ? 91   THR H CB  1 
ATOM   2434 O  OG1 . THR B 2 91  ? 13.867  3.667   -7.447  1.00 78.26  ? 91   THR H OG1 1 
ATOM   2435 C  CG2 . THR B 2 91  ? 12.974  3.143   -5.262  1.00 72.13  ? 91   THR H CG2 1 
ATOM   2436 N  N   . ALA B 2 92  ? 10.160  3.264   -9.154  1.00 52.27  ? 92   ALA H N   1 
ATOM   2437 C  CA  . ALA B 2 92  ? 9.759   3.661   -10.499 1.00 48.28  ? 92   ALA H CA  1 
ATOM   2438 C  C   . ALA B 2 92  ? 8.315   4.105   -10.505 1.00 48.56  ? 92   ALA H C   1 
ATOM   2439 O  O   . ALA B 2 92  ? 7.593   3.915   -9.527  1.00 48.23  ? 92   ALA H O   1 
ATOM   2440 C  CB  . ALA B 2 92  ? 9.903   2.461   -11.435 1.00 48.29  ? 92   ALA H CB  1 
ATOM   2441 N  N   . VAL B 2 93  ? 7.893   4.665   -11.647 1.00 42.61  ? 93   VAL H N   1 
ATOM   2442 C  CA  . VAL B 2 93  ? 6.511   4.968   -11.960 1.00 41.19  ? 93   VAL H CA  1 
ATOM   2443 C  C   . VAL B 2 93  ? 6.055   3.737   -12.755 1.00 43.57  ? 93   VAL H C   1 
ATOM   2444 O  O   . VAL B 2 93  ? 6.712   3.353   -13.720 1.00 43.51  ? 93   VAL H O   1 
ATOM   2445 C  CB  . VAL B 2 93  ? 6.341   6.269   -12.754 1.00 44.15  ? 93   VAL H CB  1 
ATOM   2446 C  CG1 . VAL B 2 93  ? 4.892   6.439   -13.211 1.00 44.15  ? 93   VAL H CG1 1 
ATOM   2447 C  CG2 . VAL B 2 93  ? 6.783   7.460   -11.923 1.00 44.47  ? 93   VAL H CG2 1 
ATOM   2448 N  N   . TYR B 2 94  ? 4.977   3.096   -12.316 1.00 39.23  ? 94   TYR H N   1 
ATOM   2449 C  CA  . TYR B 2 94  ? 4.426   1.900   -12.934 1.00 38.88  ? 94   TYR H CA  1 
ATOM   2450 C  C   . TYR B 2 94  ? 3.198   2.276   -13.694 1.00 44.71  ? 94   TYR H C   1 
ATOM   2451 O  O   . TYR B 2 94  ? 2.249   2.811   -13.123 1.00 44.29  ? 94   TYR H O   1 
ATOM   2452 C  CB  . TYR B 2 94  ? 4.098   0.852   -11.859 1.00 40.84  ? 94   TYR H CB  1 
ATOM   2453 C  CG  . TYR B 2 94  ? 5.340   0.227   -11.265 1.00 41.41  ? 94   TYR H CG  1 
ATOM   2454 C  CD1 . TYR B 2 94  ? 6.103   0.906   -10.322 1.00 43.53  ? 94   TYR H CD1 1 
ATOM   2455 C  CD2 . TYR B 2 94  ? 5.785   -1.020  -11.690 1.00 41.38  ? 94   TYR H CD2 1 
ATOM   2456 C  CE1 . TYR B 2 94  ? 7.289   0.372   -9.843  1.00 45.08  ? 94   TYR H CE1 1 
ATOM   2457 C  CE2 . TYR B 2 94  ? 6.959   -1.573  -11.203 1.00 42.17  ? 94   TYR H CE2 1 
ATOM   2458 C  CZ  . TYR B 2 94  ? 7.710   -0.873  -10.282 1.00 48.01  ? 94   TYR H CZ  1 
ATOM   2459 O  OH  . TYR B 2 94  ? 8.887   -1.411  -9.833  1.00 45.53  ? 94   TYR H OH  1 
ATOM   2460 N  N   . TYR B 2 95  ? 3.227   2.037   -14.997 1.00 43.16  ? 95   TYR H N   1 
ATOM   2461 C  CA  . TYR B 2 95  ? 2.118   2.346   -15.885 1.00 43.82  ? 95   TYR H CA  1 
ATOM   2462 C  C   . TYR B 2 95  ? 1.320   1.137   -16.259 1.00 50.97  ? 95   TYR H C   1 
ATOM   2463 O  O   . TYR B 2 95  ? 1.863   0.060   -16.561 1.00 51.04  ? 95   TYR H O   1 
ATOM   2464 C  CB  . TYR B 2 95  ? 2.603   2.990   -17.182 1.00 43.65  ? 95   TYR H CB  1 
ATOM   2465 C  CG  . TYR B 2 95  ? 3.218   4.347   -16.994 1.00 44.94  ? 95   TYR H CG  1 
ATOM   2466 C  CD1 . TYR B 2 95  ? 2.424   5.466   -16.773 1.00 48.23  ? 95   TYR H CD1 1 
ATOM   2467 C  CD2 . TYR B 2 95  ? 4.591   4.530   -17.100 1.00 44.38  ? 95   TYR H CD2 1 
ATOM   2468 C  CE1 . TYR B 2 95  ? 2.986   6.725   -16.618 1.00 50.22  ? 95   TYR H CE1 1 
ATOM   2469 C  CE2 . TYR B 2 95  ? 5.163   5.785   -16.957 1.00 44.78  ? 95   TYR H CE2 1 
ATOM   2470 C  CZ  . TYR B 2 95  ? 4.354   6.881   -16.735 1.00 57.51  ? 95   TYR H CZ  1 
ATOM   2471 O  OH  . TYR B 2 95  ? 4.905   8.119   -16.595 1.00 65.99  ? 95   TYR H OH  1 
ATOM   2472 N  N   . CYS B 2 96  ? 0.020   1.362   -16.322 1.00 48.38  ? 96   CYS H N   1 
ATOM   2473 C  CA  . CYS B 2 96  ? -0.987  0.446   -16.781 1.00 49.07  ? 96   CYS H CA  1 
ATOM   2474 C  C   . CYS B 2 96  ? -1.299  0.939   -18.189 1.00 51.36  ? 96   CYS H C   1 
ATOM   2475 O  O   . CYS B 2 96  ? -1.447  2.147   -18.397 1.00 50.58  ? 96   CYS H O   1 
ATOM   2476 C  CB  . CYS B 2 96  ? -2.194  0.558   -15.872 1.00 51.51  ? 96   CYS H CB  1 
ATOM   2477 S  SG  . CYS B 2 96  ? -3.665  -0.255  -16.497 1.00 57.50  ? 96   CYS H SG  1 
ATOM   2478 N  N   . ALA B 2 97  ? -1.334  0.034   -19.163 1.00 46.75  ? 97   ALA H N   1 
ATOM   2479 C  CA  . ALA B 2 97  ? -1.592  0.408   -20.554 1.00 46.19  ? 97   ALA H CA  1 
ATOM   2480 C  C   . ALA B 2 97  ? -2.516  -0.616  -21.172 1.00 50.48  ? 97   ALA H C   1 
ATOM   2481 O  O   . ALA B 2 97  ? -2.563  -1.755  -20.718 1.00 51.66  ? 97   ALA H O   1 
ATOM   2482 C  CB  . ALA B 2 97  ? -0.273  0.482   -21.339 1.00 45.92  ? 97   ALA H CB  1 
ATOM   2483 N  N   . ARG B 2 98  ? -3.259  -0.228  -22.198 1.00 46.01  ? 98   ARG H N   1 
ATOM   2484 C  CA  . ARG B 2 98  ? -4.146  -1.171  -22.870 1.00 45.86  ? 98   ARG H CA  1 
ATOM   2485 C  C   . ARG B 2 98  ? -3.647  -1.451  -24.303 1.00 45.89  ? 98   ARG H C   1 
ATOM   2486 O  O   . ARG B 2 98  ? -3.239  -0.551  -25.050 1.00 44.81  ? 98   ARG H O   1 
ATOM   2487 C  CB  . ARG B 2 98  ? -5.599  -0.699  -22.765 1.00 46.74  ? 98   ARG H CB  1 
ATOM   2488 C  CG  . ARG B 2 98  ? -6.644  -1.476  -23.543 1.00 55.43  ? 98   ARG H CG  1 
ATOM   2489 C  CD  . ARG B 2 98  ? -7.799  -0.545  -23.895 1.00 73.72  ? 98   ARG H CD  1 
ATOM   2490 N  NE  . ARG B 2 98  ? -9.072  -1.057  -23.384 1.00 96.00  ? 98   ARG H NE  1 
ATOM   2491 C  CZ  . ARG B 2 98  ? -10.068 -0.304  -22.928 1.00 109.04 ? 98   ARG H CZ  1 
ATOM   2492 N  NH1 . ARG B 2 98  ? -9.945  1.019   -22.887 1.00 90.96  ? 98   ARG H NH1 1 
ATOM   2493 N  NH2 . ARG B 2 98  ? -11.181 -0.871  -22.472 1.00 91.92  ? 98   ARG H NH2 1 
ATOM   2494 N  N   . GLY B 2 99  ? -3.681  -2.719  -24.623 1.00 40.16  ? 99   GLY H N   1 
ATOM   2495 C  CA  . GLY B 2 99  ? -3.174  -3.269  -25.858 1.00 39.34  ? 99   GLY H CA  1 
ATOM   2496 C  C   . GLY B 2 99  ? -2.031  -4.153  -25.443 1.00 40.63  ? 99   GLY H C   1 
ATOM   2497 O  O   . GLY B 2 99  ? -1.429  -3.936  -24.383 1.00 38.83  ? 99   GLY H O   1 
ATOM   2498 N  N   . SER B 2 100 ? -1.777  -5.191  -26.233 1.00 36.97  ? 100  SER H N   1 
ATOM   2499 C  CA  . SER B 2 100 ? -0.739  -6.176  -25.951 1.00 35.77  ? 100  SER H CA  1 
ATOM   2500 C  C   . SER B 2 100 ? 0.566   -5.822  -26.639 1.00 36.07  ? 100  SER H C   1 
ATOM   2501 O  O   . SER B 2 100 ? 1.587   -5.649  -25.954 1.00 32.16  ? 100  SER H O   1 
ATOM   2502 C  CB  . SER B 2 100 ? -1.220  -7.565  -26.352 1.00 42.11  ? 100  SER H CB  1 
ATOM   2503 O  OG  . SER B 2 100 ? -2.186  -7.501  -27.391 1.00 55.20  ? 100  SER H OG  1 
ATOM   2504 N  N   . PHE B 2 101 ? 0.509   -5.665  -27.988 1.00 34.47  ? 101  PHE H N   1 
ATOM   2505 C  CA  . PHE B 2 101 ? 1.656   -5.310  -28.838 1.00 34.63  ? 101  PHE H CA  1 
ATOM   2506 C  C   . PHE B 2 101 ? 1.913   -3.778  -28.937 1.00 37.34  ? 101  PHE H C   1 
ATOM   2507 O  O   . PHE B 2 101 ? 3.064   -3.369  -29.000 1.00 35.28  ? 101  PHE H O   1 
ATOM   2508 C  CB  . PHE B 2 101 ? 1.562   -5.968  -30.227 1.00 38.12  ? 101  PHE H CB  1 
ATOM   2509 C  CG  . PHE B 2 101 ? 1.429   -7.478  -30.201 1.00 40.73  ? 101  PHE H CG  1 
ATOM   2510 C  CD1 . PHE B 2 101 ? 2.296   -8.260  -29.439 1.00 43.08  ? 101  PHE H CD1 1 
ATOM   2511 C  CD2 . PHE B 2 101 ? 0.455   -8.117  -30.951 1.00 44.68  ? 101  PHE H CD2 1 
ATOM   2512 C  CE1 . PHE B 2 101 ? 2.186   -9.650  -29.430 1.00 45.05  ? 101  PHE H CE1 1 
ATOM   2513 C  CE2 . PHE B 2 101 ? 0.347   -9.512  -30.945 1.00 48.63  ? 101  PHE H CE2 1 
ATOM   2514 C  CZ  . PHE B 2 101 ? 1.217   -10.266 -30.189 1.00 46.10  ? 101  PHE H CZ  1 
ATOM   2515 N  N   . TRP B 2 102 ? 0.869   -2.941  -28.929 1.00 35.27  ? 102  TRP H N   1 
ATOM   2516 C  CA  . TRP B 2 102 ? 1.020   -1.482  -28.943 1.00 35.26  ? 102  TRP H CA  1 
ATOM   2517 C  C   . TRP B 2 102 ? -0.076  -0.835  -28.138 1.00 40.79  ? 102  TRP H C   1 
ATOM   2518 O  O   . TRP B 2 102 ? -1.232  -1.261  -28.193 1.00 43.23  ? 102  TRP H O   1 
ATOM   2519 C  CB  . TRP B 2 102 ? 1.143   -0.876  -30.353 1.00 35.11  ? 102  TRP H CB  1 
ATOM   2520 C  CG  . TRP B 2 102 ? -0.109  -0.861  -31.161 1.00 37.14  ? 102  TRP H CG  1 
ATOM   2521 C  CD1 . TRP B 2 102 ? -1.208  -0.090  -30.953 1.00 40.54  ? 102  TRP H CD1 1 
ATOM   2522 C  CD2 . TRP B 2 102 ? -0.339  -1.566  -32.375 1.00 38.47  ? 102  TRP H CD2 1 
ATOM   2523 N  NE1 . TRP B 2 102 ? -2.144  -0.338  -31.917 1.00 42.02  ? 102  TRP H NE1 1 
ATOM   2524 C  CE2 . TRP B 2 102 ? -1.627  -1.218  -32.824 1.00 43.79  ? 102  TRP H CE2 1 
ATOM   2525 C  CE3 . TRP B 2 102 ? 0.412   -2.478  -33.125 1.00 40.26  ? 102  TRP H CE3 1 
ATOM   2526 C  CZ2 . TRP B 2 102 ? -2.190  -1.757  -33.980 1.00 45.17  ? 102  TRP H CZ2 1 
ATOM   2527 C  CZ3 . TRP B 2 102 ? -0.142  -3.000  -34.282 1.00 43.80  ? 102  TRP H CZ3 1 
ATOM   2528 C  CH2 . TRP B 2 102 ? -1.431  -2.646  -34.694 1.00 45.90  ? 102  TRP H CH2 1 
ATOM   2529 N  N   . PHE B 2 103 ? 0.265   0.225   -27.442 1.00 35.83  ? 103  PHE H N   1 
ATOM   2530 C  CA  . PHE B 2 103 ? -0.637  0.807   -26.488 1.00 35.78  ? 103  PHE H CA  1 
ATOM   2531 C  C   . PHE B 2 103 ? -1.052  2.215   -26.796 1.00 37.64  ? 103  PHE H C   1 
ATOM   2532 O  O   . PHE B 2 103 ? -0.256  3.147   -26.694 1.00 35.00  ? 103  PHE H O   1 
ATOM   2533 C  CB  . PHE B 2 103 ? -0.004  0.701   -25.083 1.00 37.02  ? 103  PHE H CB  1 
ATOM   2534 C  CG  . PHE B 2 103 ? 1.021   -0.405  -24.957 1.00 39.24  ? 103  PHE H CG  1 
ATOM   2535 C  CD1 . PHE B 2 103 ? 2.316   -0.242  -25.448 1.00 42.87  ? 103  PHE H CD1 1 
ATOM   2536 C  CD2 . PHE B 2 103 ? 0.687   -1.624  -24.389 1.00 42.85  ? 103  PHE H CD2 1 
ATOM   2537 C  CE1 . PHE B 2 103 ? 3.258   -1.288  -25.376 1.00 43.50  ? 103  PHE H CE1 1 
ATOM   2538 C  CE2 . PHE B 2 103 ? 1.642   -2.661  -24.292 1.00 45.79  ? 103  PHE H CE2 1 
ATOM   2539 C  CZ  . PHE B 2 103 ? 2.921   -2.480  -24.779 1.00 42.73  ? 103  PHE H CZ  1 
ATOM   2540 N  N   . GLY B 2 104 ? -2.325  2.359   -27.116 1.00 36.18  ? 104  GLY H N   1 
ATOM   2541 C  CA  . GLY B 2 104 ? -2.915  3.664   -27.370 1.00 37.69  ? 104  GLY H CA  1 
ATOM   2542 C  C   . GLY B 2 104 ? -3.385  4.326   -26.092 1.00 42.78  ? 104  GLY H C   1 
ATOM   2543 O  O   . GLY B 2 104 ? -3.249  5.547   -25.918 1.00 42.82  ? 104  GLY H O   1 
ATOM   2544 N  N   . TYR B 2 105 ? -3.907  3.498   -25.172 1.00 40.26  ? 105  TYR H N   1 
ATOM   2545 C  CA  . TYR B 2 105 ? -4.477  3.968   -23.910 1.00 40.21  ? 105  TYR H CA  1 
ATOM   2546 C  C   . TYR B 2 105 ? -3.585  3.657   -22.732 1.00 44.49  ? 105  TYR H C   1 
ATOM   2547 O  O   . TYR B 2 105 ? -3.076  2.549   -22.619 1.00 41.88  ? 105  TYR H O   1 
ATOM   2548 C  CB  . TYR B 2 105 ? -5.922  3.446   -23.736 1.00 42.65  ? 105  TYR H CB  1 
ATOM   2549 C  CG  . TYR B 2 105 ? -6.731  3.631   -25.011 1.00 45.83  ? 105  TYR H CG  1 
ATOM   2550 C  CD1 . TYR B 2 105 ? -7.186  4.890   -25.396 1.00 48.98  ? 105  TYR H CD1 1 
ATOM   2551 C  CD2 . TYR B 2 105 ? -6.931  2.574   -25.891 1.00 47.52  ? 105  TYR H CD2 1 
ATOM   2552 C  CE1 . TYR B 2 105 ? -7.859  5.082   -26.602 1.00 51.84  ? 105  TYR H CE1 1 
ATOM   2553 C  CE2 . TYR B 2 105 ? -7.596  2.754   -27.104 1.00 50.75  ? 105  TYR H CE2 1 
ATOM   2554 C  CZ  . TYR B 2 105 ? -8.059  4.011   -27.457 1.00 61.17  ? 105  TYR H CZ  1 
ATOM   2555 O  OH  . TYR B 2 105 ? -8.718  4.188   -28.656 1.00 65.86  ? 105  TYR H OH  1 
ATOM   2556 N  N   . TRP B 2 106 ? -3.300  4.678   -21.913 1.00 45.22  ? 106  TRP H N   1 
ATOM   2557 C  CA  . TRP B 2 106 ? -2.443  4.550   -20.732 1.00 46.28  ? 106  TRP H CA  1 
ATOM   2558 C  C   . TRP B 2 106 ? -3.112  5.025   -19.426 1.00 53.61  ? 106  TRP H C   1 
ATOM   2559 O  O   . TRP B 2 106 ? -3.964  5.920   -19.433 1.00 54.70  ? 106  TRP H O   1 
ATOM   2560 C  CB  . TRP B 2 106 ? -1.134  5.359   -20.902 1.00 44.32  ? 106  TRP H CB  1 
ATOM   2561 C  CG  . TRP B 2 106 ? -0.183  4.824   -21.928 1.00 44.76  ? 106  TRP H CG  1 
ATOM   2562 C  CD1 . TRP B 2 106 ? -0.286  4.954   -23.279 1.00 48.35  ? 106  TRP H CD1 1 
ATOM   2563 C  CD2 . TRP B 2 106 ? 1.071   4.170   -21.682 1.00 43.43  ? 106  TRP H CD2 1 
ATOM   2564 N  NE1 . TRP B 2 106 ? 0.799   4.375   -23.897 1.00 46.78  ? 106  TRP H NE1 1 
ATOM   2565 C  CE2 . TRP B 2 106 ? 1.656   3.898   -22.939 1.00 46.99  ? 106  TRP H CE2 1 
ATOM   2566 C  CE3 . TRP B 2 106 ? 1.742   3.753   -20.518 1.00 43.95  ? 106  TRP H CE3 1 
ATOM   2567 C  CZ2 . TRP B 2 106 ? 2.885   3.240   -23.067 1.00 45.52  ? 106  TRP H CZ2 1 
ATOM   2568 C  CZ3 . TRP B 2 106 ? 2.967   3.117   -20.646 1.00 44.66  ? 106  TRP H CZ3 1 
ATOM   2569 C  CH2 . TRP B 2 106 ? 3.534   2.883   -21.906 1.00 45.26  ? 106  TRP H CH2 1 
ATOM   2570 N  N   . GLY B 2 107 ? -2.622  4.495   -18.305 1.00 49.71  ? 107  GLY H N   1 
ATOM   2571 C  CA  . GLY B 2 107 ? -2.986  4.945   -16.974 1.00 49.72  ? 107  GLY H CA  1 
ATOM   2572 C  C   . GLY B 2 107 ? -2.115  6.153   -16.658 1.00 51.73  ? 107  GLY H C   1 
ATOM   2573 O  O   . GLY B 2 107 ? -1.269  6.550   -17.474 1.00 48.70  ? 107  GLY H O   1 
ATOM   2574 N  N   . GLN B 2 108 ? -2.302  6.755   -15.490 1.00 49.71  ? 108  GLN H N   1 
ATOM   2575 C  CA  . GLN B 2 108 ? -1.493  7.919   -15.164 1.00 49.47  ? 108  GLN H CA  1 
ATOM   2576 C  C   . GLN B 2 108 ? -0.113  7.556   -14.601 1.00 56.47  ? 108  GLN H C   1 
ATOM   2577 O  O   . GLN B 2 108 ? 0.796   8.385   -14.601 1.00 57.23  ? 108  GLN H O   1 
ATOM   2578 C  CB  . GLN B 2 108 ? -2.251  8.872   -14.245 1.00 51.32  ? 108  GLN H CB  1 
ATOM   2579 C  CG  . GLN B 2 108 ? -2.180  8.518   -12.768 1.00 43.56  ? 108  GLN H CG  1 
ATOM   2580 C  CD  . GLN B 2 108 ? -3.227  7.540   -12.312 1.00 50.32  ? 108  GLN H CD  1 
ATOM   2581 O  OE1 . GLN B 2 108 ? -3.985  6.930   -13.098 1.00 36.14  ? 108  GLN H OE1 1 
ATOM   2582 N  NE2 . GLN B 2 108 ? -3.282  7.390   -11.001 1.00 45.47  ? 108  GLN H NE2 1 
ATOM   2583 N  N   . GLY B 2 109 ? 0.030   6.327   -14.135 1.00 54.07  ? 109  GLY H N   1 
ATOM   2584 C  CA  . GLY B 2 109 ? 1.277   5.851   -13.555 1.00 53.58  ? 109  GLY H CA  1 
ATOM   2585 C  C   . GLY B 2 109 ? 1.275   5.943   -12.048 1.00 59.04  ? 109  GLY H C   1 
ATOM   2586 O  O   . GLY B 2 109 ? 0.829   6.948   -11.478 1.00 59.74  ? 109  GLY H O   1 
ATOM   2587 N  N   . THR B 2 110 ? 1.742   4.882   -11.399 1.00 55.49  ? 110  THR H N   1 
ATOM   2588 C  CA  . THR B 2 110 ? 1.788   4.826   -9.942  1.00 56.15  ? 110  THR H CA  1 
ATOM   2589 C  C   . THR B 2 110 ? 3.235   4.883   -9.506  1.00 58.48  ? 110  THR H C   1 
ATOM   2590 O  O   . THR B 2 110 ? 4.006   4.010   -9.895  1.00 58.41  ? 110  THR H O   1 
ATOM   2591 C  CB  . THR B 2 110 ? 1.010   3.591   -9.416  1.00 59.67  ? 110  THR H CB  1 
ATOM   2592 O  OG1 . THR B 2 110 ? -0.373  3.694   -9.793  1.00 55.17  ? 110  THR H OG1 1 
ATOM   2593 C  CG2 . THR B 2 110 ? 1.134   3.400   -7.885  1.00 57.68  ? 110  THR H CG2 1 
ATOM   2594 N  N   . LEU B 2 111 ? 3.603   5.879   -8.680  1.00 53.41  ? 111  LEU H N   1 
ATOM   2595 C  CA  . LEU B 2 111 ? 4.967   5.967   -8.209  1.00 52.64  ? 111  LEU H CA  1 
ATOM   2596 C  C   . LEU B 2 111 ? 5.232   5.025   -7.023  1.00 56.60  ? 111  LEU H C   1 
ATOM   2597 O  O   . LEU B 2 111 ? 4.696   5.247   -5.941  1.00 57.31  ? 111  LEU H O   1 
ATOM   2598 C  CB  . LEU B 2 111 ? 5.317   7.417   -7.853  1.00 52.75  ? 111  LEU H CB  1 
ATOM   2599 C  CG  . LEU B 2 111 ? 6.734   7.599   -7.333  1.00 58.27  ? 111  LEU H CG  1 
ATOM   2600 C  CD1 . LEU B 2 111 ? 7.453   8.675   -8.093  1.00 57.69  ? 111  LEU H CD1 1 
ATOM   2601 C  CD2 . LEU B 2 111 ? 6.742   7.863   -5.836  1.00 62.80  ? 111  LEU H CD2 1 
ATOM   2602 N  N   . VAL B 2 112 ? 6.092   4.007   -7.204  1.00 52.21  ? 112  VAL H N   1 
ATOM   2603 C  CA  . VAL B 2 112 ? 6.510   3.173   -6.069  1.00 53.39  ? 112  VAL H CA  1 
ATOM   2604 C  C   . VAL B 2 112 ? 7.964   3.539   -5.714  1.00 60.89  ? 112  VAL H C   1 
ATOM   2605 O  O   . VAL B 2 112 ? 8.774   3.797   -6.611  1.00 60.37  ? 112  VAL H O   1 
ATOM   2606 C  CB  . VAL B 2 112 ? 6.250   1.658   -6.142  1.00 56.28  ? 112  VAL H CB  1 
ATOM   2607 C  CG1 . VAL B 2 112 ? 5.000   1.345   -6.930  1.00 54.84  ? 112  VAL H CG1 1 
ATOM   2608 C  CG2 . VAL B 2 112 ? 7.440   0.913   -6.700  1.00 55.83  ? 112  VAL H CG2 1 
ATOM   2609 N  N   . THR B 2 113 ? 8.270   3.626   -4.410  1.00 59.47  ? 113  THR H N   1 
ATOM   2610 C  CA  . THR B 2 113 ? 9.581   4.012   -3.913  1.00 59.35  ? 113  THR H CA  1 
ATOM   2611 C  C   . THR B 2 113 ? 10.004  2.980   -2.912  1.00 65.74  ? 113  THR H C   1 
ATOM   2612 O  O   . THR B 2 113 ? 9.349   2.827   -1.882  1.00 68.01  ? 113  THR H O   1 
ATOM   2613 C  CB  . THR B 2 113 ? 9.489   5.406   -3.280  1.00 62.38  ? 113  THR H CB  1 
ATOM   2614 O  OG1 . THR B 2 113 ? 9.073   6.334   -4.281  1.00 60.45  ? 113  THR H OG1 1 
ATOM   2615 C  CG2 . THR B 2 113 ? 10.797  5.869   -2.635  1.00 59.70  ? 113  THR H CG2 1 
ATOM   2616 N  N   . VAL B 2 114 ? 11.077  2.260   -3.213  1.00 61.07  ? 114  VAL H N   1 
ATOM   2617 C  CA  . VAL B 2 114 ? 11.633  1.299   -2.273  1.00 63.23  ? 114  VAL H CA  1 
ATOM   2618 C  C   . VAL B 2 114 ? 12.809  1.985   -1.549  1.00 69.54  ? 114  VAL H C   1 
ATOM   2619 O  O   . VAL B 2 114 ? 13.796  2.372   -2.188  1.00 68.29  ? 114  VAL H O   1 
ATOM   2620 C  CB  . VAL B 2 114 ? 12.051  -0.040  -2.922  1.00 66.24  ? 114  VAL H CB  1 
ATOM   2621 C  CG1 . VAL B 2 114 ? 11.999  -1.184  -1.915  1.00 68.58  ? 114  VAL H CG1 1 
ATOM   2622 C  CG2 . VAL B 2 114 ? 11.189  -0.347  -4.133  1.00 63.52  ? 114  VAL H CG2 1 
ATOM   2623 N  N   . SER B 2 115 ? 12.696  2.156   -0.223  1.00 68.55  ? 115  SER H N   1 
ATOM   2624 C  CA  . SER B 2 115 ? 13.751  2.729   0.599   1.00 70.89  ? 115  SER H CA  1 
ATOM   2625 C  C   . SER B 2 115 ? 13.575  2.256   2.011   1.00 79.65  ? 115  SER H C   1 
ATOM   2626 O  O   . SER B 2 115 ? 12.462  2.292   2.544   1.00 78.88  ? 115  SER H O   1 
ATOM   2627 C  CB  . SER B 2 115 ? 13.792  4.258   0.535   1.00 72.85  ? 115  SER H CB  1 
ATOM   2628 O  OG  . SER B 2 115 ? 15.045  4.775   0.967   1.00 80.19  ? 115  SER H OG  1 
ATOM   2629 N  N   . SER B 2 116 ? 14.695  1.808   2.615   1.00 80.69  ? 116  SER H N   1 
ATOM   2630 C  CA  . SER B 2 116 ? 14.817  1.296   3.980   1.00 85.29  ? 116  SER H CA  1 
ATOM   2631 C  C   . SER B 2 116 ? 14.873  2.407   5.016   1.00 93.63  ? 116  SER H C   1 
ATOM   2632 O  O   . SER B 2 116 ? 15.018  2.123   6.208   1.00 97.97  ? 116  SER H O   1 
ATOM   2633 C  CB  . SER B 2 116 ? 16.050  0.410   4.093   1.00 90.62  ? 116  SER H CB  1 
ATOM   2634 O  OG  . SER B 2 116 ? 17.197  1.089   3.615   1.00 98.70  ? 116  SER H OG  1 
ATOM   2635 N  N   . ALA B 2 117 ? 14.708  3.667   4.560   1.00 88.60  ? 117  ALA H N   1 
ATOM   2636 C  CA  . ALA B 2 117 ? 14.743  4.860   5.393   1.00 90.09  ? 117  ALA H CA  1 
ATOM   2637 C  C   . ALA B 2 117 ? 13.348  5.350   5.763   1.00 94.38  ? 117  ALA H C   1 
ATOM   2638 O  O   . ALA B 2 117 ? 12.441  5.403   4.923   1.00 90.25  ? 117  ALA H O   1 
ATOM   2639 C  CB  . ALA B 2 117 ? 15.546  5.962   4.711   1.00 88.84  ? 117  ALA H CB  1 
ATOM   2640 N  N   . SER B 2 118 ? 13.189  5.680   7.058   1.00 95.83  ? 118  SER H N   1 
ATOM   2641 C  CA  . SER B 2 118 ? 11.951  6.188   7.660   1.00 96.63  ? 118  SER H CA  1 
ATOM   2642 C  C   . SER B 2 118 ? 11.574  7.593   7.189   1.00 98.15  ? 118  SER H C   1 
ATOM   2643 O  O   . SER B 2 118 ? 12.421  8.315   6.664   1.00 95.02  ? 118  SER H O   1 
ATOM   2644 C  CB  . SER B 2 118 ? 12.026  6.126   9.181   1.00 104.86 ? 118  SER H CB  1 
ATOM   2645 O  OG  . SER B 2 118 ? 11.486  4.909   9.673   1.00 114.57 ? 118  SER H OG  1 
ATOM   2646 N  N   . THR B 2 119 ? 10.306  7.980   7.404   1.00 96.26  ? 119  THR H N   1 
ATOM   2647 C  CA  . THR B 2 119 ? 9.715   9.247   6.982   1.00 94.98  ? 119  THR H CA  1 
ATOM   2648 C  C   . THR B 2 119 ? 10.221  10.432  7.848   1.00 101.47 ? 119  THR H C   1 
ATOM   2649 O  O   . THR B 2 119 ? 9.447   11.167  8.469   1.00 101.70 ? 119  THR H O   1 
ATOM   2650 C  CB  . THR B 2 119 ? 8.179   9.124   6.870   1.00 107.42 ? 119  THR H CB  1 
ATOM   2651 O  OG1 . THR B 2 119 ? 7.608   10.418  6.614   1.00 107.52 ? 119  THR H OG1 1 
ATOM   2652 C  CG2 . THR B 2 119 ? 7.528   8.449   8.100   1.00 110.15 ? 119  THR H CG2 1 
ATOM   2653 N  N   . LYS B 2 120 ? 11.539  10.643  7.804   1.00 99.77  ? 120  LYS H N   1 
ATOM   2654 C  CA  . LYS B 2 120 ? 12.264  11.708  8.498   1.00 102.22 ? 120  LYS H CA  1 
ATOM   2655 C  C   . LYS B 2 120 ? 11.955  13.057  7.852   1.00 104.89 ? 120  LYS H C   1 
ATOM   2656 O  O   . LYS B 2 120 ? 11.545  13.119  6.682   1.00 101.31 ? 120  LYS H O   1 
ATOM   2657 C  CB  . LYS B 2 120 ? 13.783  11.432  8.490   1.00 105.86 ? 120  LYS H CB  1 
ATOM   2658 C  CG  . LYS B 2 120 ? 14.191  10.161  9.261   1.00 123.90 ? 120  LYS H CG  1 
ATOM   2659 C  CD  . LYS B 2 120 ? 15.543  9.577   8.801   1.00 130.27 ? 120  LYS H CD  1 
ATOM   2660 C  CE  . LYS B 2 120 ? 16.018  8.407   9.644   1.00 133.86 ? 120  LYS H CE  1 
ATOM   2661 N  NZ  . LYS B 2 120 ? 15.338  7.132   9.289   1.00 135.94 ? 120  LYS H NZ  1 
ATOM   2662 N  N   . GLY B 2 121 ? 12.153  14.121  8.628   1.00 103.94 ? 121  GLY H N   1 
ATOM   2663 C  CA  . GLY B 2 121 ? 11.873  15.489  8.214   1.00 102.34 ? 121  GLY H CA  1 
ATOM   2664 C  C   . GLY B 2 121 ? 13.068  16.278  7.716   1.00 103.80 ? 121  GLY H C   1 
ATOM   2665 O  O   . GLY B 2 121 ? 14.205  16.021  8.129   1.00 105.82 ? 121  GLY H O   1 
ATOM   2666 N  N   . PRO B 2 122 ? 12.817  17.284  6.848   1.00 95.45  ? 122  PRO H N   1 
ATOM   2667 C  CA  . PRO B 2 122 ? 13.916  18.099  6.326   1.00 94.11  ? 122  PRO H CA  1 
ATOM   2668 C  C   . PRO B 2 122 ? 14.490  19.072  7.343   1.00 100.27 ? 122  PRO H C   1 
ATOM   2669 O  O   . PRO B 2 122 ? 13.924  19.305  8.411   1.00 102.45 ? 122  PRO H O   1 
ATOM   2670 C  CB  . PRO B 2 122 ? 13.252  18.872  5.185   1.00 92.76  ? 122  PRO H CB  1 
ATOM   2671 C  CG  . PRO B 2 122 ? 11.848  18.994  5.600   1.00 97.52  ? 122  PRO H CG  1 
ATOM   2672 C  CD  . PRO B 2 122 ? 11.522  17.710  6.285   1.00 94.35  ? 122  PRO H CD  1 
ATOM   2673 N  N   . SER B 2 123 ? 15.598  19.698  6.955   1.00 95.84  ? 123  SER H N   1 
ATOM   2674 C  CA  . SER B 2 123 ? 16.278  20.736  7.714   1.00 98.07  ? 123  SER H CA  1 
ATOM   2675 C  C   . SER B 2 123 ? 16.761  21.797  6.736   1.00 99.58  ? 123  SER H C   1 
ATOM   2676 O  O   . SER B 2 123 ? 17.442  21.480  5.762   1.00 96.64  ? 123  SER H O   1 
ATOM   2677 C  CB  . SER B 2 123 ? 17.425  20.157  8.529   1.00 104.21 ? 123  SER H CB  1 
ATOM   2678 O  OG  . SER B 2 123 ? 16.980  19.787  9.824   1.00 114.54 ? 123  SER H OG  1 
ATOM   2679 N  N   . VAL B 2 124 ? 16.359  23.043  6.964   1.00 97.82  ? 124  VAL H N   1 
ATOM   2680 C  CA  . VAL B 2 124 ? 16.671  24.137  6.057   1.00 97.05  ? 124  VAL H CA  1 
ATOM   2681 C  C   . VAL B 2 124 ? 17.878  24.908  6.476   1.00 106.07 ? 124  VAL H C   1 
ATOM   2682 O  O   . VAL B 2 124 ? 17.908  25.434  7.589   1.00 109.57 ? 124  VAL H O   1 
ATOM   2683 C  CB  . VAL B 2 124 ? 15.451  25.059  5.851   1.00 100.14 ? 124  VAL H CB  1 
ATOM   2684 C  CG1 . VAL B 2 124 ? 15.731  26.141  4.811   1.00 98.48  ? 124  VAL H CG1 1 
ATOM   2685 C  CG2 . VAL B 2 124 ? 14.226  24.246  5.469   1.00 97.72  ? 124  VAL H CG2 1 
ATOM   2686 N  N   . PHE B 2 125 ? 18.859  25.031  5.565   1.00 102.63 ? 125  PHE H N   1 
ATOM   2687 C  CA  . PHE B 2 125 ? 20.067  25.823  5.795   1.00 105.18 ? 125  PHE H CA  1 
ATOM   2688 C  C   . PHE B 2 125 ? 20.148  26.934  4.778   1.00 109.07 ? 125  PHE H C   1 
ATOM   2689 O  O   . PHE B 2 125 ? 19.889  26.690  3.597   1.00 106.36 ? 125  PHE H O   1 
ATOM   2690 C  CB  . PHE B 2 125 ? 21.329  24.955  5.889   1.00 107.55 ? 125  PHE H CB  1 
ATOM   2691 C  CG  . PHE B 2 125 ? 21.177  23.984  7.035   1.00 110.09 ? 125  PHE H CG  1 
ATOM   2692 C  CD1 . PHE B 2 125 ? 20.991  24.442  8.338   1.00 116.08 ? 125  PHE H CD1 1 
ATOM   2693 C  CD2 . PHE B 2 125 ? 21.119  22.618  6.805   1.00 109.97 ? 125  PHE H CD2 1 
ATOM   2694 C  CE1 . PHE B 2 125 ? 20.785  23.550  9.390   1.00 118.56 ? 125  PHE H CE1 1 
ATOM   2695 C  CE2 . PHE B 2 125 ? 20.942  21.724  7.863   1.00 114.55 ? 125  PHE H CE2 1 
ATOM   2696 C  CZ  . PHE B 2 125 ? 20.782  22.196  9.148   1.00 116.06 ? 125  PHE H CZ  1 
ATOM   2697 N  N   . PRO B 2 126 ? 20.365  28.185  5.237   1.00 107.83 ? 126  PRO H N   1 
ATOM   2698 C  CA  . PRO B 2 126 ? 20.350  29.311  4.305   1.00 107.03 ? 126  PRO H CA  1 
ATOM   2699 C  C   . PRO B 2 126 ? 21.688  29.522  3.602   1.00 111.12 ? 126  PRO H C   1 
ATOM   2700 O  O   . PRO B 2 126 ? 22.744  29.217  4.153   1.00 112.69 ? 126  PRO H O   1 
ATOM   2701 C  CB  . PRO B 2 126 ? 19.929  30.504  5.185   1.00 111.73 ? 126  PRO H CB  1 
ATOM   2702 C  CG  . PRO B 2 126 ? 19.985  30.018  6.609   1.00 118.71 ? 126  PRO H CG  1 
ATOM   2703 C  CD  . PRO B 2 126 ? 20.586  28.647  6.621   1.00 113.24 ? 126  PRO H CD  1 
ATOM   2704 N  N   . LEU B 2 127 ? 21.630  30.024  2.364   1.00 105.84 ? 127  LEU H N   1 
ATOM   2705 C  CA  . LEU B 2 127 ? 22.804  30.336  1.544   1.00 106.08 ? 127  LEU H CA  1 
ATOM   2706 C  C   . LEU B 2 127 ? 22.783  31.854  1.295   1.00 111.58 ? 127  LEU H C   1 
ATOM   2707 O  O   . LEU B 2 127 ? 21.827  32.354  0.707   1.00 110.15 ? 127  LEU H O   1 
ATOM   2708 C  CB  . LEU B 2 127 ? 22.765  29.549  0.217   1.00 102.61 ? 127  LEU H CB  1 
ATOM   2709 C  CG  . LEU B 2 127 ? 22.548  28.028  0.257   1.00 104.53 ? 127  LEU H CG  1 
ATOM   2710 C  CD1 . LEU B 2 127 ? 22.287  27.494  -1.126  1.00 101.21 ? 127  LEU H CD1 1 
ATOM   2711 C  CD2 . LEU B 2 127 ? 23.741  27.295  0.863   1.00 108.35 ? 127  LEU H CD2 1 
ATOM   2712 N  N   . ALA B 2 128 ? 23.801  32.582  1.780   1.00 111.21 ? 128  ALA H N   1 
ATOM   2713 C  CA  . ALA B 2 128 ? 23.864  34.042  1.738   1.00 113.76 ? 128  ALA H CA  1 
ATOM   2714 C  C   . ALA B 2 128 ? 24.651  34.640  0.552   1.00 118.17 ? 128  ALA H C   1 
ATOM   2715 O  O   . ALA B 2 128 ? 25.603  34.004  0.091   1.00 118.39 ? 128  ALA H O   1 
ATOM   2716 C  CB  . ALA B 2 128 ? 24.420  34.550  3.057   1.00 118.67 ? 128  ALA H CB  1 
ATOM   2717 N  N   . PRO B 2 129 ? 24.294  35.857  0.051   1.00 114.40 ? 129  PRO H N   1 
ATOM   2718 C  CA  . PRO B 2 129 ? 25.047  36.427  -1.081  1.00 116.98 ? 129  PRO H CA  1 
ATOM   2719 C  C   . PRO B 2 129 ? 26.402  36.991  -0.661  1.00 140.97 ? 129  PRO H C   1 
ATOM   2720 O  O   . PRO B 2 129 ? 26.546  37.473  0.457   1.00 99.88  ? 129  PRO H O   1 
ATOM   2721 C  CB  . PRO B 2 129 ? 24.123  37.526  -1.602  1.00 118.38 ? 129  PRO H CB  1 
ATOM   2722 C  CG  . PRO B 2 129 ? 23.358  37.968  -0.413  1.00 123.11 ? 129  PRO H CG  1 
ATOM   2723 C  CD  . PRO B 2 129 ? 23.193  36.754  0.467   1.00 116.71 ? 129  PRO H CD  1 
ATOM   2724 N  N   . ALA B 2 140 ? 23.950  36.295  -5.384  1.00 90.90  ? 140  ALA H N   1 
ATOM   2725 C  CA  . ALA B 2 140 ? 22.809  35.375  -5.484  1.00 87.15  ? 140  ALA H CA  1 
ATOM   2726 C  C   . ALA B 2 140 ? 22.548  34.694  -4.154  1.00 90.46  ? 140  ALA H C   1 
ATOM   2727 O  O   . ALA B 2 140 ? 23.497  34.329  -3.467  1.00 90.93  ? 140  ALA H O   1 
ATOM   2728 C  CB  . ALA B 2 140 ? 23.062  34.337  -6.563  1.00 85.35  ? 140  ALA H CB  1 
ATOM   2729 N  N   . LEU B 2 141 ? 21.276  34.574  -3.763  1.00 86.38  ? 141  LEU H N   1 
ATOM   2730 C  CA  . LEU B 2 141 ? 20.951  33.946  -2.490  1.00 86.73  ? 141  LEU H CA  1 
ATOM   2731 C  C   . LEU B 2 141 ? 20.204  32.639  -2.674  1.00 88.46  ? 141  LEU H C   1 
ATOM   2732 O  O   . LEU B 2 141 ? 19.311  32.540  -3.520  1.00 86.50  ? 141  LEU H O   1 
ATOM   2733 C  CB  . LEU B 2 141 ? 20.219  34.906  -1.519  1.00 88.93  ? 141  LEU H CB  1 
ATOM   2734 C  CG  . LEU B 2 141 ? 18.768  35.272  -1.820  1.00 92.46  ? 141  LEU H CG  1 
ATOM   2735 C  CD1 . LEU B 2 141 ? 17.912  35.104  -0.606  1.00 92.99  ? 141  LEU H CD1 1 
ATOM   2736 C  CD2 . LEU B 2 141 ? 18.653  36.673  -2.328  1.00 96.89  ? 141  LEU H CD2 1 
ATOM   2737 N  N   . GLY B 2 142 ? 20.582  31.653  -1.883  1.00 84.44  ? 142  GLY H N   1 
ATOM   2738 C  CA  . GLY B 2 142 ? 19.937  30.360  -1.933  1.00 81.20  ? 142  GLY H CA  1 
ATOM   2739 C  C   . GLY B 2 142 ? 19.287  29.949  -0.637  1.00 86.06  ? 142  GLY H C   1 
ATOM   2740 O  O   . GLY B 2 142 ? 19.260  30.696  0.340   1.00 86.97  ? 142  GLY H O   1 
ATOM   2741 N  N   . CYS B 2 143 ? 18.735  28.743  -0.659  1.00 82.67  ? 143  CYS H N   1 
ATOM   2742 C  CA  . CYS B 2 143 ? 18.101  28.024  0.446   1.00 83.02  ? 143  CYS H CA  1 
ATOM   2743 C  C   . CYS B 2 143 ? 18.329  26.562  0.201   1.00 80.76  ? 143  CYS H C   1 
ATOM   2744 O  O   . CYS B 2 143 ? 18.148  26.095  -0.925  1.00 76.71  ? 143  CYS H O   1 
ATOM   2745 C  CB  . CYS B 2 143 ? 16.612  28.335  0.551   1.00 83.69  ? 143  CYS H CB  1 
ATOM   2746 S  SG  . CYS B 2 143 ? 16.068  28.714  2.233   1.00 91.45  ? 143  CYS H SG  1 
ATOM   2747 N  N   . LEU B 2 144 ? 18.711  25.835  1.246   1.00 77.48  ? 144  LEU H N   1 
ATOM   2748 C  CA  . LEU B 2 144 ? 18.970  24.401  1.156   1.00 75.71  ? 144  LEU H CA  1 
ATOM   2749 C  C   . LEU B 2 144 ? 18.002  23.588  2.029   1.00 79.86  ? 144  LEU H C   1 
ATOM   2750 O  O   . LEU B 2 144 ? 17.758  23.962  3.171   1.00 81.89  ? 144  LEU H O   1 
ATOM   2751 C  CB  . LEU B 2 144 ? 20.427  24.102  1.530   1.00 77.38  ? 144  LEU H CB  1 
ATOM   2752 C  CG  . LEU B 2 144 ? 20.894  22.666  1.331   1.00 80.20  ? 144  LEU H CG  1 
ATOM   2753 C  CD1 . LEU B 2 144 ? 21.855  22.566  0.191   1.00 79.21  ? 144  LEU H CD1 1 
ATOM   2754 C  CD2 . LEU B 2 144 ? 21.510  22.117  2.588   1.00 85.06  ? 144  LEU H CD2 1 
ATOM   2755 N  N   . VAL B 2 145 ? 17.460  22.487  1.468   1.00 73.76  ? 145  VAL H N   1 
ATOM   2756 C  CA  . VAL B 2 145 ? 16.546  21.548  2.122   1.00 73.70  ? 145  VAL H CA  1 
ATOM   2757 C  C   . VAL B 2 145 ? 17.309  20.227  2.170   1.00 78.84  ? 145  VAL H C   1 
ATOM   2758 O  O   . VAL B 2 145 ? 17.567  19.628  1.123   1.00 76.06  ? 145  VAL H O   1 
ATOM   2759 C  CB  . VAL B 2 145 ? 15.203  21.430  1.352   1.00 75.10  ? 145  VAL H CB  1 
ATOM   2760 C  CG1 . VAL B 2 145 ? 14.244  20.465  2.046   1.00 74.87  ? 145  VAL H CG1 1 
ATOM   2761 C  CG2 . VAL B 2 145 ? 14.549  22.797  1.159   1.00 75.22  ? 145  VAL H CG2 1 
ATOM   2762 N  N   . LYS B 2 146 ? 17.763  19.845  3.374   1.00 79.47  ? 146  LYS H N   1 
ATOM   2763 C  CA  . LYS B 2 146 ? 18.616  18.688  3.560   1.00 80.63  ? 146  LYS H CA  1 
ATOM   2764 C  C   . LYS B 2 146 ? 18.044  17.605  4.445   1.00 87.31  ? 146  LYS H C   1 
ATOM   2765 O  O   . LYS B 2 146 ? 17.386  17.880  5.446   1.00 88.38  ? 146  LYS H O   1 
ATOM   2766 C  CB  . LYS B 2 146 ? 19.989  19.130  4.080   1.00 86.25  ? 146  LYS H CB  1 
ATOM   2767 C  CG  . LYS B 2 146 ? 21.149  18.405  3.402   1.00 101.49 ? 146  LYS H CG  1 
ATOM   2768 C  CD  . LYS B 2 146 ? 22.477  18.550  4.142   1.00 112.48 ? 146  LYS H CD  1 
ATOM   2769 C  CE  . LYS B 2 146 ? 23.489  17.485  3.762   1.00 119.85 ? 146  LYS H CE  1 
ATOM   2770 N  NZ  . LYS B 2 146 ? 23.229  16.182  4.436   1.00 126.31 ? 146  LYS H NZ  1 
ATOM   2771 N  N   . ASP B 2 147 ? 18.326  16.356  4.043   1.00 85.32  ? 147  ASP H N   1 
ATOM   2772 C  CA  . ASP B 2 147 ? 17.993  15.070  4.664   1.00 87.24  ? 147  ASP H CA  1 
ATOM   2773 C  C   . ASP B 2 147 ? 16.503  14.857  5.017   1.00 94.65  ? 147  ASP H C   1 
ATOM   2774 O  O   . ASP B 2 147 ? 16.161  14.745  6.200   1.00 98.42  ? 147  ASP H O   1 
ATOM   2775 C  CB  . ASP B 2 147 ? 18.877  14.795  5.896   1.00 92.59  ? 147  ASP H CB  1 
ATOM   2776 C  CG  . ASP B 2 147 ? 20.323  15.201  5.719   1.00 100.43 ? 147  ASP H CG  1 
ATOM   2777 O  OD1 . ASP B 2 147 ? 20.640  16.373  5.978   1.00 101.95 ? 147  ASP H OD1 1 
ATOM   2778 O  OD2 . ASP B 2 147 ? 21.136  14.345  5.320   1.00 105.56 ? 147  ASP H OD2 1 
ATOM   2779 N  N   . TYR B 2 148 ? 15.635  14.719  3.992   1.00 88.89  ? 148  TYR H N   1 
ATOM   2780 C  CA  . TYR B 2 148 ? 14.215  14.413  4.194   1.00 88.48  ? 148  TYR H CA  1 
ATOM   2781 C  C   . TYR B 2 148 ? 13.794  13.182  3.405   1.00 92.49  ? 148  TYR H C   1 
ATOM   2782 O  O   . TYR B 2 148 ? 14.396  12.846  2.375   1.00 90.46  ? 148  TYR H O   1 
ATOM   2783 C  CB  . TYR B 2 148 ? 13.301  15.593  3.834   1.00 87.80  ? 148  TYR H CB  1 
ATOM   2784 C  CG  . TYR B 2 148 ? 13.233  15.891  2.356   1.00 85.94  ? 148  TYR H CG  1 
ATOM   2785 C  CD1 . TYR B 2 148 ? 14.170  16.717  1.748   1.00 87.52  ? 148  TYR H CD1 1 
ATOM   2786 C  CD2 . TYR B 2 148 ? 12.218  15.364  1.566   1.00 84.38  ? 148  TYR H CD2 1 
ATOM   2787 C  CE1 . TYR B 2 148 ? 14.118  16.986  0.381   1.00 85.77  ? 148  TYR H CE1 1 
ATOM   2788 C  CE2 . TYR B 2 148 ? 12.161  15.615  0.197   1.00 82.70  ? 148  TYR H CE2 1 
ATOM   2789 C  CZ  . TYR B 2 148 ? 13.109  16.434  -0.391  1.00 88.95  ? 148  TYR H CZ  1 
ATOM   2790 O  OH  . TYR B 2 148 ? 13.034  16.715  -1.734  1.00 86.04  ? 148  TYR H OH  1 
ATOM   2791 N  N   . PHE B 2 149 ? 12.712  12.545  3.853   1.00 90.24  ? 149  PHE H N   1 
ATOM   2792 C  CA  . PHE B 2 149 ? 12.124  11.405  3.167   1.00 88.67  ? 149  PHE H CA  1 
ATOM   2793 C  C   . PHE B 2 149 ? 10.653  11.284  3.542   1.00 94.01  ? 149  PHE H C   1 
ATOM   2794 O  O   . PHE B 2 149 ? 10.307  11.464  4.710   1.00 95.92  ? 149  PHE H O   1 
ATOM   2795 C  CB  . PHE B 2 149 ? 12.897  10.084  3.426   1.00 91.87  ? 149  PHE H CB  1 
ATOM   2796 C  CG  . PHE B 2 149 ? 12.445  8.908   2.579   1.00 91.45  ? 149  PHE H CG  1 
ATOM   2797 C  CD1 . PHE B 2 149 ? 12.885  8.761   1.269   1.00 91.80  ? 149  PHE H CD1 1 
ATOM   2798 C  CD2 . PHE B 2 149 ? 11.547  7.972   3.081   1.00 94.47  ? 149  PHE H CD2 1 
ATOM   2799 C  CE1 . PHE B 2 149 ? 12.432  7.700   0.476   1.00 90.91  ? 149  PHE H CE1 1 
ATOM   2800 C  CE2 . PHE B 2 149 ? 11.107  6.904   2.292   1.00 95.36  ? 149  PHE H CE2 1 
ATOM   2801 C  CZ  . PHE B 2 149 ? 11.537  6.788   0.991   1.00 90.72  ? 149  PHE H CZ  1 
ATOM   2802 N  N   . PRO B 2 150 ? 9.759   10.963  2.585   1.00 89.53  ? 150  PRO H N   1 
ATOM   2803 C  CA  . PRO B 2 150 ? 9.975   10.771  1.146   1.00 86.62  ? 150  PRO H CA  1 
ATOM   2804 C  C   . PRO B 2 150 ? 9.751   12.097  0.427   1.00 90.19  ? 150  PRO H C   1 
ATOM   2805 O  O   . PRO B 2 150 ? 9.963   13.153  1.036   1.00 91.49  ? 150  PRO H O   1 
ATOM   2806 C  CB  . PRO B 2 150 ? 8.944   9.690   0.794   1.00 87.52  ? 150  PRO H CB  1 
ATOM   2807 C  CG  . PRO B 2 150 ? 7.895   9.722   1.931   1.00 94.46  ? 150  PRO H CG  1 
ATOM   2808 C  CD  . PRO B 2 150 ? 8.336   10.795  2.902   1.00 91.92  ? 150  PRO H CD  1 
ATOM   2809 N  N   . GLU B 2 151 ? 9.314   12.049  -0.848  1.00 84.69  ? 151  GLU H N   1 
ATOM   2810 C  CA  . GLU B 2 151 ? 9.015   13.223  -1.670  1.00 83.23  ? 151  GLU H CA  1 
ATOM   2811 C  C   . GLU B 2 151 ? 7.495   13.527  -1.638  1.00 88.68  ? 151  GLU H C   1 
ATOM   2812 O  O   . GLU B 2 151 ? 6.711   12.609  -1.365  1.00 87.81  ? 151  GLU H O   1 
ATOM   2813 C  CB  . GLU B 2 151 ? 9.490   12.995  -3.109  1.00 82.08  ? 151  GLU H CB  1 
ATOM   2814 C  CG  . GLU B 2 151 ? 10.979  13.195  -3.329  1.00 90.79  ? 151  GLU H CG  1 
ATOM   2815 C  CD  . GLU B 2 151 ? 11.318  14.279  -4.331  1.00 112.53 ? 151  GLU H CD  1 
ATOM   2816 O  OE1 . GLU B 2 151 ? 10.977  15.459  -4.079  1.00 104.82 ? 151  GLU H OE1 1 
ATOM   2817 O  OE2 . GLU B 2 151 ? 11.940  13.948  -5.367  1.00 108.12 ? 151  GLU H OE2 1 
ATOM   2818 N  N   . PRO B 2 152 ? 7.036   14.793  -1.814  1.00 88.08  ? 152  PRO H N   1 
ATOM   2819 C  CA  . PRO B 2 152 ? 7.754   16.004  -2.239  1.00 88.62  ? 152  PRO H CA  1 
ATOM   2820 C  C   . PRO B 2 152 ? 7.938   17.132  -1.204  1.00 95.79  ? 152  PRO H C   1 
ATOM   2821 O  O   . PRO B 2 152 ? 7.484   17.033  -0.058  1.00 97.56  ? 152  PRO H O   1 
ATOM   2822 C  CB  . PRO B 2 152 ? 6.856   16.478  -3.388  1.00 88.96  ? 152  PRO H CB  1 
ATOM   2823 C  CG  . PRO B 2 152 ? 5.425   16.131  -2.907  1.00 93.74  ? 152  PRO H CG  1 
ATOM   2824 C  CD  . PRO B 2 152 ? 5.581   15.054  -1.836  1.00 90.23  ? 152  PRO H CD  1 
ATOM   2825 N  N   . VAL B 2 153 ? 8.612   18.225  -1.642  1.00 92.19  ? 153  VAL H N   1 
ATOM   2826 C  CA  . VAL B 2 153 ? 8.820   19.455  -0.869  1.00 93.72  ? 153  VAL H CA  1 
ATOM   2827 C  C   . VAL B 2 153 ? 8.424   20.697  -1.663  1.00 95.70  ? 153  VAL H C   1 
ATOM   2828 O  O   . VAL B 2 153 ? 8.909   20.919  -2.780  1.00 93.92  ? 153  VAL H O   1 
ATOM   2829 C  CB  . VAL B 2 153 ? 10.222  19.612  -0.241  1.00 99.34  ? 153  VAL H CB  1 
ATOM   2830 C  CG1 . VAL B 2 153 ? 10.381  18.715  0.976   1.00 101.05 ? 153  VAL H CG1 1 
ATOM   2831 C  CG2 . VAL B 2 153 ? 11.331  19.367  -1.258  1.00 97.62  ? 153  VAL H CG2 1 
ATOM   2832 N  N   . THR B 2 154 ? 7.526   21.496  -1.080  1.00 92.42  ? 154  THR H N   1 
ATOM   2833 C  CA  . THR B 2 154 ? 7.090   22.761  -1.654  1.00 91.73  ? 154  THR H CA  1 
ATOM   2834 C  C   . THR B 2 154 ? 8.219   23.727  -1.351  1.00 94.86  ? 154  THR H C   1 
ATOM   2835 O  O   . THR B 2 154 ? 8.937   23.524  -0.375  1.00 95.50  ? 154  THR H O   1 
ATOM   2836 C  CB  . THR B 2 154 ? 5.806   23.240  -0.971  1.00 98.72  ? 154  THR H CB  1 
ATOM   2837 O  OG1 . THR B 2 154 ? 5.022   22.118  -0.556  1.00 95.49  ? 154  THR H OG1 1 
ATOM   2838 C  CG2 . THR B 2 154 ? 4.985   24.159  -1.857  1.00 97.87  ? 154  THR H CG2 1 
ATOM   2839 N  N   . VAL B 2 155 ? 8.412   24.744  -2.193  1.00 89.84  ? 155  VAL H N   1 
ATOM   2840 C  CA  . VAL B 2 155 ? 9.445   25.747  -1.965  1.00 90.66  ? 155  VAL H CA  1 
ATOM   2841 C  C   . VAL B 2 155 ? 9.121   27.002  -2.802  1.00 94.94  ? 155  VAL H C   1 
ATOM   2842 O  O   . VAL B 2 155 ? 9.285   27.016  -4.023  1.00 93.86  ? 155  VAL H O   1 
ATOM   2843 C  CB  . VAL B 2 155 ? 10.917  25.233  -2.089  1.00 93.46  ? 155  VAL H CB  1 
ATOM   2844 C  CG1 . VAL B 2 155 ? 11.152  24.466  -3.377  1.00 90.84  ? 155  VAL H CG1 1 
ATOM   2845 C  CG2 . VAL B 2 155 ? 11.932  26.354  -1.919  1.00 95.08  ? 155  VAL H CG2 1 
ATOM   2846 N  N   . SER B 2 156 ? 8.585   28.024  -2.125  1.00 92.45  ? 156  SER H N   1 
ATOM   2847 C  CA  . SER B 2 156 ? 8.218   29.299  -2.718  1.00 92.73  ? 156  SER H CA  1 
ATOM   2848 C  C   . SER B 2 156 ? 8.840   30.358  -1.852  1.00 99.53  ? 156  SER H C   1 
ATOM   2849 O  O   . SER B 2 156 ? 8.967   30.148  -0.644  1.00 100.19 ? 156  SER H O   1 
ATOM   2850 C  CB  . SER B 2 156 ? 6.702   29.450  -2.766  1.00 95.06  ? 156  SER H CB  1 
ATOM   2851 O  OG  . SER B 2 156 ? 6.335   30.033  -4.002  1.00 99.07  ? 156  SER H OG  1 
ATOM   2852 N  N   . TRP B 2 157 ? 9.284   31.464  -2.470  1.00 97.99  ? 157  TRP H N   1 
ATOM   2853 C  CA  . TRP B 2 157 ? 9.929   32.593  -1.786  1.00 100.90 ? 157  TRP H CA  1 
ATOM   2854 C  C   . TRP B 2 157 ? 8.924   33.711  -1.497  1.00 106.41 ? 157  TRP H C   1 
ATOM   2855 O  O   . TRP B 2 157 ? 8.068   33.989  -2.343  1.00 105.37 ? 157  TRP H O   1 
ATOM   2856 C  CB  . TRP B 2 157 ? 11.103  33.144  -2.609  1.00 99.96  ? 157  TRP H CB  1 
ATOM   2857 C  CG  . TRP B 2 157 ? 12.161  32.134  -2.958  1.00 98.89  ? 157  TRP H CG  1 
ATOM   2858 C  CD1 . TRP B 2 157 ? 12.082  31.163  -3.912  1.00 98.93  ? 157  TRP H CD1 1 
ATOM   2859 C  CD2 . TRP B 2 157 ? 13.490  32.056  -2.416  1.00 99.67  ? 157  TRP H CD2 1 
ATOM   2860 N  NE1 . TRP B 2 157 ? 13.264  30.463  -3.975  1.00 97.57  ? 157  TRP H NE1 1 
ATOM   2861 C  CE2 . TRP B 2 157 ? 14.147  30.991  -3.069  1.00 101.36 ? 157  TRP H CE2 1 
ATOM   2862 C  CE3 . TRP B 2 157 ? 14.187  32.778  -1.431  1.00 103.74 ? 157  TRP H CE3 1 
ATOM   2863 C  CZ2 . TRP B 2 157 ? 15.465  30.620  -2.762  1.00 101.23 ? 157  TRP H CZ2 1 
ATOM   2864 C  CZ3 . TRP B 2 157 ? 15.494  32.416  -1.136  1.00 105.72 ? 157  TRP H CZ3 1 
ATOM   2865 C  CH2 . TRP B 2 157 ? 16.119  31.348  -1.794  1.00 104.11 ? 157  TRP H CH2 1 
ATOM   2866 N  N   . ASN B 2 158 ? 9.041   34.357  -0.300  1.00 105.54 ? 158  ASN H N   1 
ATOM   2867 C  CA  . ASN B 2 158 ? 8.160   35.428  0.238   1.00 108.10 ? 158  ASN H CA  1 
ATOM   2868 C  C   . ASN B 2 158 ? 6.662   35.010  0.180   1.00 110.42 ? 158  ASN H C   1 
ATOM   2869 O  O   . ASN B 2 158 ? 5.779   35.801  -0.174  1.00 110.67 ? 158  ASN H O   1 
ATOM   2870 C  CB  . ASN B 2 158 ? 8.435   36.810  -0.414  1.00 109.30 ? 158  ASN H CB  1 
ATOM   2871 C  CG  . ASN B 2 158 ? 9.837   37.356  -0.205  1.00 124.84 ? 158  ASN H CG  1 
ATOM   2872 O  OD1 . ASN B 2 158 ? 10.532  37.040  0.773   1.00 115.28 ? 158  ASN H OD1 1 
ATOM   2873 N  ND2 . ASN B 2 158 ? 10.273  38.224  -1.113  1.00 115.61 ? 158  ASN H ND2 1 
ATOM   2874 N  N   . SER B 2 159 ? 6.429   33.717  0.542   1.00 105.22 ? 159  SER H N   1 
ATOM   2875 C  CA  . SER B 2 159 ? 5.212   32.887  0.528   1.00 103.91 ? 159  SER H CA  1 
ATOM   2876 C  C   . SER B 2 159 ? 4.601   32.731  -0.888  1.00 106.28 ? 159  SER H C   1 
ATOM   2877 O  O   . SER B 2 159 ? 3.484   32.229  -1.037  1.00 105.28 ? 159  SER H O   1 
ATOM   2878 C  CB  . SER B 2 159 ? 4.188   33.329  1.568   1.00 109.61 ? 159  SER H CB  1 
ATOM   2879 O  OG  . SER B 2 159 ? 4.485   32.691  2.801   1.00 116.11 ? 159  SER H OG  1 
ATOM   2880 N  N   . GLY B 2 160 ? 5.401   33.064  -1.903  1.00 102.41 ? 160  GLY H N   1 
ATOM   2881 C  CA  . GLY B 2 160 ? 5.030   32.951  -3.305  1.00 100.93 ? 160  GLY H CA  1 
ATOM   2882 C  C   . GLY B 2 160 ? 5.399   34.144  -4.153  1.00 107.44 ? 160  GLY H C   1 
ATOM   2883 O  O   . GLY B 2 160 ? 5.612   33.998  -5.358  1.00 105.63 ? 160  GLY H O   1 
ATOM   2884 N  N   . ALA B 2 161 ? 5.460   35.330  -3.539  1.00 108.39 ? 161  ALA H N   1 
ATOM   2885 C  CA  . ALA B 2 161 ? 5.748   36.601  -4.202  1.00 110.92 ? 161  ALA H CA  1 
ATOM   2886 C  C   . ALA B 2 161 ? 6.938   36.555  -5.161  1.00 113.77 ? 161  ALA H C   1 
ATOM   2887 O  O   . ALA B 2 161 ? 6.796   36.946  -6.326  1.00 114.51 ? 161  ALA H O   1 
ATOM   2888 C  CB  . ALA B 2 161 ? 5.939   37.704  -3.163  1.00 115.11 ? 161  ALA H CB  1 
ATOM   2889 N  N   . LEU B 2 162 ? 8.088   36.059  -4.689  1.00 107.59 ? 162  LEU H N   1 
ATOM   2890 C  CA  . LEU B 2 162 ? 9.283   36.080  -5.513  1.00 105.40 ? 162  LEU H CA  1 
ATOM   2891 C  C   . LEU B 2 162 ? 9.427   34.863  -6.402  1.00 103.03 ? 162  LEU H C   1 
ATOM   2892 O  O   . LEU B 2 162 ? 10.081  33.883  -6.033  1.00 99.98  ? 162  LEU H O   1 
ATOM   2893 C  CB  . LEU B 2 162 ? 10.554  36.339  -4.681  1.00 106.35 ? 162  LEU H CB  1 
ATOM   2894 C  CG  . LEU B 2 162 ? 11.762  36.928  -5.436  1.00 111.20 ? 162  LEU H CG  1 
ATOM   2895 C  CD1 . LEU B 2 162 ? 11.435  38.288  -6.065  1.00 114.30 ? 162  LEU H CD1 1 
ATOM   2896 C  CD2 . LEU B 2 162 ? 12.945  37.075  -4.514  1.00 113.45 ? 162  LEU H CD2 1 
ATOM   2897 N  N   . THR B 2 163 ? 8.839   34.960  -7.604  1.00 97.84  ? 163  THR H N   1 
ATOM   2898 C  CA  . THR B 2 163 ? 8.899   33.955  -8.673  1.00 94.04  ? 163  THR H CA  1 
ATOM   2899 C  C   . THR B 2 163 ? 10.086  34.232  -9.629  1.00 95.46  ? 163  THR H C   1 
ATOM   2900 O  O   . THR B 2 163 ? 10.681  33.300  -10.182 1.00 92.93  ? 163  THR H O   1 
ATOM   2901 C  CB  . THR B 2 163 ? 7.580   33.926  -9.462  1.00 100.12 ? 163  THR H CB  1 
ATOM   2902 O  OG1 . THR B 2 163 ? 7.002   35.232  -9.482  1.00 103.07 ? 163  THR H OG1 1 
ATOM   2903 C  CG2 . THR B 2 163 ? 6.591   32.943  -8.889  1.00 96.98  ? 163  THR H CG2 1 
ATOM   2904 N  N   . SER B 2 164 ? 10.430  35.526  -9.772  1.00 92.00  ? 164  SER H N   1 
ATOM   2905 C  CA  . SER B 2 164 ? 11.447  36.111  -10.655 1.00 91.28  ? 164  SER H CA  1 
ATOM   2906 C  C   . SER B 2 164 ? 12.905  35.618  -10.456 1.00 89.80  ? 164  SER H C   1 
ATOM   2907 O  O   . SER B 2 164 ? 13.589  36.009  -9.502  1.00 89.41  ? 164  SER H O   1 
ATOM   2908 C  CB  . SER B 2 164 ? 11.394  37.634  -10.563 1.00 98.49  ? 164  SER H CB  1 
ATOM   2909 O  OG  . SER B 2 164 ? 10.322  38.082  -9.746  1.00 108.14 ? 164  SER H OG  1 
ATOM   2910 N  N   . GLY B 2 165 ? 13.364  34.807  -11.411 1.00 83.00  ? 165  GLY H N   1 
ATOM   2911 C  CA  . GLY B 2 165 ? 14.709  34.225  -11.461 1.00 81.40  ? 165  GLY H CA  1 
ATOM   2912 C  C   . GLY B 2 165 ? 15.034  33.079  -10.511 1.00 80.98  ? 165  GLY H C   1 
ATOM   2913 O  O   . GLY B 2 165 ? 16.215  32.863  -10.212 1.00 78.91  ? 165  GLY H O   1 
ATOM   2914 N  N   . VAL B 2 166 ? 13.984  32.319  -10.067 1.00 75.77  ? 166  VAL H N   1 
ATOM   2915 C  CA  . VAL B 2 166 ? 14.021  31.206  -9.107  1.00 73.71  ? 166  VAL H CA  1 
ATOM   2916 C  C   . VAL B 2 166 ? 14.193  29.852  -9.783  1.00 76.24  ? 166  VAL H C   1 
ATOM   2917 O  O   . VAL B 2 166 ? 13.404  29.470  -10.661 1.00 75.33  ? 166  VAL H O   1 
ATOM   2918 C  CB  . VAL B 2 166 ? 12.804  31.229  -8.152  1.00 77.31  ? 166  VAL H CB  1 
ATOM   2919 C  CG1 . VAL B 2 166 ? 12.697  29.949  -7.329  1.00 75.31  ? 166  VAL H CG1 1 
ATOM   2920 C  CG2 . VAL B 2 166 ? 12.857  32.438  -7.239  1.00 79.94  ? 166  VAL H CG2 1 
ATOM   2921 N  N   . HIS B 2 167 ? 15.242  29.139  -9.350  1.00 71.92  ? 167  HIS H N   1 
ATOM   2922 C  CA  . HIS B 2 167 ? 15.594  27.837  -9.866  1.00 69.26  ? 167  HIS H CA  1 
ATOM   2923 C  C   . HIS B 2 167 ? 15.483  26.752  -8.802  1.00 71.30  ? 167  HIS H C   1 
ATOM   2924 O  O   . HIS B 2 167 ? 16.355  26.613  -7.954  1.00 72.59  ? 167  HIS H O   1 
ATOM   2925 C  CB  . HIS B 2 167 ? 16.981  27.891  -10.515 1.00 71.13  ? 167  HIS H CB  1 
ATOM   2926 C  CG  . HIS B 2 167 ? 17.001  28.760  -11.731 1.00 76.06  ? 167  HIS H CG  1 
ATOM   2927 N  ND1 . HIS B 2 167 ? 17.170  30.124  -11.634 1.00 80.88  ? 167  HIS H ND1 1 
ATOM   2928 C  CD2 . HIS B 2 167 ? 16.815  28.434  -13.032 1.00 77.12  ? 167  HIS H CD2 1 
ATOM   2929 C  CE1 . HIS B 2 167 ? 17.092  30.584  -12.873 1.00 80.97  ? 167  HIS H CE1 1 
ATOM   2930 N  NE2 . HIS B 2 167 ? 16.900  29.600  -13.751 1.00 79.04  ? 167  HIS H NE2 1 
ATOM   2931 N  N   . THR B 2 168 ? 14.400  25.990  -8.830  1.00 65.47  ? 168  THR H N   1 
ATOM   2932 C  CA  . THR B 2 168 ? 14.255  24.921  -7.861  1.00 64.93  ? 168  THR H CA  1 
ATOM   2933 C  C   . THR B 2 168 ? 14.756  23.605  -8.478  1.00 67.84  ? 168  THR H C   1 
ATOM   2934 O  O   . THR B 2 168 ? 14.201  23.057  -9.446  1.00 66.53  ? 168  THR H O   1 
ATOM   2935 C  CB  . THR B 2 168 ? 12.864  24.895  -7.254  1.00 75.33  ? 168  THR H CB  1 
ATOM   2936 O  OG1 . THR B 2 168 ? 12.816  25.938  -6.284  1.00 75.72  ? 168  THR H OG1 1 
ATOM   2937 C  CG2 . THR B 2 168 ? 12.533  23.560  -6.582  1.00 72.83  ? 168  THR H CG2 1 
ATOM   2938 N  N   . PHE B 2 169 ? 15.842  23.130  -7.887  1.00 63.44  ? 169  PHE H N   1 
ATOM   2939 C  CA  . PHE B 2 169 ? 16.538  21.935  -8.282  1.00 61.40  ? 169  PHE H CA  1 
ATOM   2940 C  C   . PHE B 2 169 ? 15.827  20.663  -7.879  1.00 64.12  ? 169  PHE H C   1 
ATOM   2941 O  O   . PHE B 2 169 ? 15.399  20.553  -6.730  1.00 64.05  ? 169  PHE H O   1 
ATOM   2942 C  CB  . PHE B 2 169 ? 17.960  21.949  -7.688  1.00 64.68  ? 169  PHE H CB  1 
ATOM   2943 C  CG  . PHE B 2 169 ? 18.820  22.910  -8.439  1.00 66.79  ? 169  PHE H CG  1 
ATOM   2944 C  CD1 . PHE B 2 169 ? 19.441  22.526  -9.618  1.00 68.44  ? 169  PHE H CD1 1 
ATOM   2945 C  CD2 . PHE B 2 169 ? 18.919  24.236  -8.036  1.00 70.56  ? 169  PHE H CD2 1 
ATOM   2946 C  CE1 . PHE B 2 169 ? 20.160  23.443  -10.372 1.00 70.79  ? 169  PHE H CE1 1 
ATOM   2947 C  CE2 . PHE B 2 169 ? 19.665  25.150  -8.778  1.00 74.89  ? 169  PHE H CE2 1 
ATOM   2948 C  CZ  . PHE B 2 169 ? 20.295  24.743  -9.936  1.00 72.44  ? 169  PHE H CZ  1 
ATOM   2949 N  N   . PRO B 2 170 ? 15.781  19.648  -8.770  1.00 59.55  ? 170  PRO H N   1 
ATOM   2950 C  CA  . PRO B 2 170 ? 15.194  18.348  -8.380  1.00 58.44  ? 170  PRO H CA  1 
ATOM   2951 C  C   . PRO B 2 170 ? 15.977  17.665  -7.248  1.00 64.97  ? 170  PRO H C   1 
ATOM   2952 O  O   . PRO B 2 170 ? 17.200  17.796  -7.179  1.00 65.70  ? 170  PRO H O   1 
ATOM   2953 C  CB  . PRO B 2 170 ? 15.234  17.544  -9.674  1.00 58.46  ? 170  PRO H CB  1 
ATOM   2954 C  CG  . PRO B 2 170 ? 16.249  18.212  -10.531 1.00 63.18  ? 170  PRO H CG  1 
ATOM   2955 C  CD  . PRO B 2 170 ? 16.257  19.642  -10.170 1.00 60.06  ? 170  PRO H CD  1 
ATOM   2956 N  N   . ALA B 2 171 ? 15.266  16.969  -6.350  1.00 62.64  ? 171  ALA H N   1 
ATOM   2957 C  CA  . ALA B 2 171 ? 15.804  16.321  -5.164  1.00 64.03  ? 171  ALA H CA  1 
ATOM   2958 C  C   . ALA B 2 171 ? 16.625  15.063  -5.441  1.00 68.05  ? 171  ALA H C   1 
ATOM   2959 O  O   . ALA B 2 171 ? 16.063  14.004  -5.706  1.00 65.82  ? 171  ALA H O   1 
ATOM   2960 C  CB  . ALA B 2 171 ? 14.671  16.023  -4.197  1.00 64.82  ? 171  ALA H CB  1 
ATOM   2961 N  N   . VAL B 2 172 ? 17.955  15.176  -5.348  1.00 67.45  ? 172  VAL H N   1 
ATOM   2962 C  CA  . VAL B 2 172 ? 18.860  14.036  -5.546  1.00 68.34  ? 172  VAL H CA  1 
ATOM   2963 C  C   . VAL B 2 172 ? 19.000  13.213  -4.302  1.00 73.83  ? 172  VAL H C   1 
ATOM   2964 O  O   . VAL B 2 172 ? 19.099  13.759  -3.202  1.00 74.72  ? 172  VAL H O   1 
ATOM   2965 C  CB  . VAL B 2 172 ? 20.241  14.406  -6.126  1.00 74.18  ? 172  VAL H CB  1 
ATOM   2966 C  CG1 . VAL B 2 172 ? 20.183  14.504  -7.648  1.00 72.39  ? 172  VAL H CG1 1 
ATOM   2967 C  CG2 . VAL B 2 172 ? 20.802  15.693  -5.504  1.00 76.19  ? 172  VAL H CG2 1 
ATOM   2968 N  N   . LEU B 2 173 ? 19.014  11.895  -4.476  1.00 71.03  ? 173  LEU H N   1 
ATOM   2969 C  CA  . LEU B 2 173 ? 19.175  10.957  -3.374  1.00 73.24  ? 173  LEU H CA  1 
ATOM   2970 C  C   . LEU B 2 173 ? 20.612  11.032  -2.861  1.00 80.95  ? 173  LEU H C   1 
ATOM   2971 O  O   . LEU B 2 173 ? 21.544  11.138  -3.660  1.00 80.06  ? 173  LEU H O   1 
ATOM   2972 C  CB  . LEU B 2 173 ? 18.853  9.535   -3.855  1.00 72.17  ? 173  LEU H CB  1 
ATOM   2973 C  CG  . LEU B 2 173 ? 17.691  8.825   -3.174  1.00 76.62  ? 173  LEU H CG  1 
ATOM   2974 C  CD1 . LEU B 2 173 ? 17.047  7.833   -4.111  1.00 74.97  ? 173  LEU H CD1 1 
ATOM   2975 C  CD2 . LEU B 2 173 ? 18.138  8.113   -1.911  1.00 82.19  ? 173  LEU H CD2 1 
ATOM   2976 N  N   . GLN B 2 174 ? 20.773  11.032  -1.531  1.00 81.45  ? 174  GLN H N   1 
ATOM   2977 C  CA  . GLN B 2 174 ? 22.071  11.048  -0.850  1.00 85.00  ? 174  GLN H CA  1 
ATOM   2978 C  C   . GLN B 2 174 ? 22.531  9.609   -0.567  1.00 90.55  ? 174  GLN H C   1 
ATOM   2979 O  O   . GLN B 2 174 ? 21.742  8.672   -0.715  1.00 88.07  ? 174  GLN H O   1 
ATOM   2980 C  CB  . GLN B 2 174 ? 21.968  11.807  0.486   1.00 88.88  ? 174  GLN H CB  1 
ATOM   2981 C  CG  . GLN B 2 174 ? 21.905  13.318  0.346   1.00 104.66 ? 174  GLN H CG  1 
ATOM   2982 C  CD  . GLN B 2 174 ? 21.723  13.968  1.690   1.00 122.67 ? 174  GLN H CD  1 
ATOM   2983 O  OE1 . GLN B 2 174 ? 22.689  14.402  2.334   1.00 118.92 ? 174  GLN H OE1 1 
ATOM   2984 N  NE2 . GLN B 2 174 ? 20.479  14.032  2.149   1.00 112.53 ? 174  GLN H NE2 1 
ATOM   2985 N  N   . SER B 2 175 ? 23.798  9.445   -0.107  1.00 91.18  ? 175  SER H N   1 
ATOM   2986 C  CA  . SER B 2 175 ? 24.404  8.160   0.288   1.00 93.95  ? 175  SER H CA  1 
ATOM   2987 C  C   . SER B 2 175 ? 23.775  7.607   1.588   1.00 99.68  ? 175  SER H C   1 
ATOM   2988 O  O   . SER B 2 175 ? 23.871  6.408   1.863   1.00 100.39 ? 175  SER H O   1 
ATOM   2989 C  CB  . SER B 2 175 ? 25.911  8.315   0.461   1.00 101.71 ? 175  SER H CB  1 
ATOM   2990 O  OG  . SER B 2 175 ? 26.520  7.165   1.034   1.00 113.78 ? 175  SER H OG  1 
ATOM   2991 N  N   . SER B 2 176 ? 23.120  8.493   2.363   1.00 96.36  ? 176  SER H N   1 
ATOM   2992 C  CA  . SER B 2 176 ? 22.401  8.168   3.592   1.00 97.78  ? 176  SER H CA  1 
ATOM   2993 C  C   . SER B 2 176 ? 21.038  7.498   3.286   1.00 98.36  ? 176  SER H C   1 
ATOM   2994 O  O   . SER B 2 176 ? 20.509  6.773   4.131   1.00 99.27  ? 176  SER H O   1 
ATOM   2995 C  CB  . SER B 2 176 ? 22.189  9.435   4.419   1.00 102.30 ? 176  SER H CB  1 
ATOM   2996 O  OG  . SER B 2 176 ? 21.425  10.400  3.709   1.00 105.51 ? 176  SER H OG  1 
ATOM   2997 N  N   . GLY B 2 177 ? 20.505  7.754   2.089   1.00 91.06  ? 177  GLY H N   1 
ATOM   2998 C  CA  . GLY B 2 177 ? 19.204  7.270   1.637   1.00 88.18  ? 177  GLY H CA  1 
ATOM   2999 C  C   . GLY B 2 177 ? 18.106  8.314   1.777   1.00 90.53  ? 177  GLY H C   1 
ATOM   3000 O  O   . GLY B 2 177 ? 16.924  7.983   1.627   1.00 88.15  ? 177  GLY H O   1 
ATOM   3001 N  N   . LEU B 2 178 ? 18.499  9.603   2.046   1.00 87.73  ? 178  LEU H N   1 
ATOM   3002 C  CA  . LEU B 2 178 ? 17.636  10.789  2.241   1.00 86.14  ? 178  LEU H CA  1 
ATOM   3003 C  C   . LEU B 2 178 ? 17.747  11.800  1.070   1.00 86.33  ? 178  LEU H C   1 
ATOM   3004 O  O   . LEU B 2 178 ? 18.854  12.098  0.607   1.00 85.59  ? 178  LEU H O   1 
ATOM   3005 C  CB  . LEU B 2 178 ? 17.982  11.503  3.578   1.00 89.37  ? 178  LEU H CB  1 
ATOM   3006 C  CG  . LEU B 2 178 ? 17.570  10.814  4.879   1.00 96.31  ? 178  LEU H CG  1 
ATOM   3007 C  CD1 . LEU B 2 178 ? 18.626  10.997  5.938   1.00 100.33 ? 178  LEU H CD1 1 
ATOM   3008 C  CD2 . LEU B 2 178 ? 16.222  11.317  5.378   1.00 97.05  ? 178  LEU H CD2 1 
ATOM   3009 N  N   . TYR B 2 179 ? 16.599  12.363  0.632   1.00 80.02  ? 179  TYR H N   1 
ATOM   3010 C  CA  . TYR B 2 179 ? 16.549  13.341  -0.460  1.00 77.38  ? 179  TYR H CA  1 
ATOM   3011 C  C   . TYR B 2 179 ? 17.036  14.748  -0.052  1.00 84.25  ? 179  TYR H C   1 
ATOM   3012 O  O   . TYR B 2 179 ? 16.862  15.146  1.105   1.00 86.39  ? 179  TYR H O   1 
ATOM   3013 C  CB  . TYR B 2 179 ? 15.129  13.410  -1.041  1.00 75.37  ? 179  TYR H CB  1 
ATOM   3014 C  CG  . TYR B 2 179 ? 14.736  12.176  -1.825  1.00 74.72  ? 179  TYR H CG  1 
ATOM   3015 C  CD1 . TYR B 2 179 ? 15.096  12.029  -3.162  1.00 74.68  ? 179  TYR H CD1 1 
ATOM   3016 C  CD2 . TYR B 2 179 ? 13.990  11.160  -1.235  1.00 75.76  ? 179  TYR H CD2 1 
ATOM   3017 C  CE1 . TYR B 2 179 ? 14.731  10.897  -3.892  1.00 73.53  ? 179  TYR H CE1 1 
ATOM   3018 C  CE2 . TYR B 2 179 ? 13.635  10.014  -1.950  1.00 75.08  ? 179  TYR H CE2 1 
ATOM   3019 C  CZ  . TYR B 2 179 ? 14.010  9.885   -3.278  1.00 79.49  ? 179  TYR H CZ  1 
ATOM   3020 O  OH  . TYR B 2 179 ? 13.670  8.754   -3.982  1.00 77.78  ? 179  TYR H OH  1 
ATOM   3021 N  N   . SER B 2 180 ? 17.643  15.497  -1.008  1.00 80.14  ? 180  SER H N   1 
ATOM   3022 C  CA  . SER B 2 180 ? 18.098  16.882  -0.810  1.00 81.31  ? 180  SER H CA  1 
ATOM   3023 C  C   . SER B 2 180 ? 17.798  17.803  -2.010  1.00 83.99  ? 180  SER H C   1 
ATOM   3024 O  O   . SER B 2 180 ? 18.414  17.693  -3.078  1.00 82.80  ? 180  SER H O   1 
ATOM   3025 C  CB  . SER B 2 180 ? 19.567  16.956  -0.410  1.00 86.38  ? 180  SER H CB  1 
ATOM   3026 O  OG  . SER B 2 180 ? 19.674  16.858  0.997   1.00 94.70  ? 180  SER H OG  1 
ATOM   3027 N  N   . LEU B 2 181 ? 16.841  18.718  -1.812  1.00 80.06  ? 181  LEU H N   1 
ATOM   3028 C  CA  . LEU B 2 181 ? 16.434  19.708  -2.802  1.00 78.40  ? 181  LEU H CA  1 
ATOM   3029 C  C   . LEU B 2 181 ? 17.081  21.057  -2.433  1.00 85.00  ? 181  LEU H C   1 
ATOM   3030 O  O   . LEU B 2 181 ? 17.376  21.323  -1.264  1.00 87.08  ? 181  LEU H O   1 
ATOM   3031 C  CB  . LEU B 2 181 ? 14.890  19.818  -2.814  1.00 77.02  ? 181  LEU H CB  1 
ATOM   3032 C  CG  . LEU B 2 181 ? 14.223  20.614  -3.946  1.00 79.83  ? 181  LEU H CG  1 
ATOM   3033 C  CD1 . LEU B 2 181 ? 12.947  19.933  -4.446  1.00 78.15  ? 181  LEU H CD1 1 
ATOM   3034 C  CD2 . LEU B 2 181 ? 13.947  22.035  -3.531  1.00 82.62  ? 181  LEU H CD2 1 
ATOM   3035 N  N   . SER B 2 182 ? 17.321  21.885  -3.439  1.00 80.74  ? 182  SER H N   1 
ATOM   3036 C  CA  . SER B 2 182 ? 17.836  23.228  -3.243  1.00 82.15  ? 182  SER H CA  1 
ATOM   3037 C  C   . SER B 2 182 ? 17.074  24.196  -4.126  1.00 84.53  ? 182  SER H C   1 
ATOM   3038 O  O   . SER B 2 182 ? 16.437  23.798  -5.108  1.00 82.01  ? 182  SER H O   1 
ATOM   3039 C  CB  . SER B 2 182 ? 19.330  23.291  -3.515  1.00 86.43  ? 182  SER H CB  1 
ATOM   3040 O  OG  . SER B 2 182 ? 19.983  22.394  -2.633  1.00 95.53  ? 182  SER H OG  1 
ATOM   3041 N  N   . SER B 2 183 ? 17.122  25.474  -3.758  1.00 82.24  ? 183  SER H N   1 
ATOM   3042 C  CA  . SER B 2 183 ? 16.459  26.535  -4.501  1.00 81.63  ? 183  SER H CA  1 
ATOM   3043 C  C   . SER B 2 183 ? 17.244  27.820  -4.367  1.00 85.53  ? 183  SER H C   1 
ATOM   3044 O  O   . SER B 2 183 ? 17.749  28.122  -3.286  1.00 86.69  ? 183  SER H O   1 
ATOM   3045 C  CB  . SER B 2 183 ? 15.026  26.722  -4.022  1.00 85.73  ? 183  SER H CB  1 
ATOM   3046 O  OG  . SER B 2 183 ? 14.328  27.619  -4.870  1.00 93.97  ? 183  SER H OG  1 
ATOM   3047 N  N   . VAL B 2 184 ? 17.370  28.555  -5.489  1.00 80.83  ? 184  VAL H N   1 
ATOM   3048 C  CA  . VAL B 2 184 ? 18.142  29.787  -5.596  1.00 82.78  ? 184  VAL H CA  1 
ATOM   3049 C  C   . VAL B 2 184 ? 17.419  30.827  -6.402  1.00 85.19  ? 184  VAL H C   1 
ATOM   3050 O  O   . VAL B 2 184 ? 16.711  30.475  -7.345  1.00 83.43  ? 184  VAL H O   1 
ATOM   3051 C  CB  . VAL B 2 184 ? 19.530  29.566  -6.237  1.00 87.81  ? 184  VAL H CB  1 
ATOM   3052 C  CG1 . VAL B 2 184 ? 20.619  30.260  -5.437  1.00 91.20  ? 184  VAL H CG1 1 
ATOM   3053 C  CG2 . VAL B 2 184 ? 19.860  28.087  -6.457  1.00 85.48  ? 184  VAL H CG2 1 
ATOM   3054 N  N   . VAL B 2 185 ? 17.646  32.105  -6.057  1.00 82.49  ? 185  VAL H N   1 
ATOM   3055 C  CA  . VAL B 2 185 ? 17.094  33.273  -6.731  1.00 82.94  ? 185  VAL H CA  1 
ATOM   3056 C  C   . VAL B 2 185 ? 18.244  34.198  -7.082  1.00 88.72  ? 185  VAL H C   1 
ATOM   3057 O  O   . VAL B 2 185 ? 19.265  34.215  -6.382  1.00 90.27  ? 185  VAL H O   1 
ATOM   3058 C  CB  . VAL B 2 185 ? 15.986  33.983  -5.896  1.00 87.58  ? 185  VAL H CB  1 
ATOM   3059 C  CG1 . VAL B 2 185 ? 16.516  34.538  -4.578  1.00 89.83  ? 185  VAL H CG1 1 
ATOM   3060 C  CG2 . VAL B 2 185 ? 15.266  35.066  -6.697  1.00 88.45  ? 185  VAL H CG2 1 
ATOM   3061 N  N   . THR B 2 186 ? 18.065  34.979  -8.157  1.00 84.72  ? 186  THR H N   1 
ATOM   3062 C  CA  . THR B 2 186 ? 19.023  35.975  -8.622  1.00 86.66  ? 186  THR H CA  1 
ATOM   3063 C  C   . THR B 2 186 ? 18.364  37.344  -8.421  1.00 92.05  ? 186  THR H C   1 
ATOM   3064 O  O   . THR B 2 186 ? 17.302  37.592  -8.982  1.00 90.88  ? 186  THR H O   1 
ATOM   3065 C  CB  . THR B 2 186 ? 19.485  35.697  -10.076 1.00 93.20  ? 186  THR H CB  1 
ATOM   3066 O  OG1 . THR B 2 186 ? 18.738  36.488  -11.008 1.00 96.43  ? 186  THR H OG1 1 
ATOM   3067 C  CG2 . THR B 2 186 ? 19.388  34.207  -10.486 1.00 88.25  ? 186  THR H CG2 1 
ATOM   3068 N  N   . VAL B 2 187 ? 18.957  38.193  -7.573  1.00 91.24  ? 187  VAL H N   1 
ATOM   3069 C  CA  . VAL B 2 187 ? 18.429  39.514  -7.222  1.00 94.16  ? 187  VAL H CA  1 
ATOM   3070 C  C   . VAL B 2 187 ? 19.515  40.602  -7.380  1.00 103.07 ? 187  VAL H C   1 
ATOM   3071 O  O   . VAL B 2 187 ? 20.681  40.237  -7.567  1.00 102.82 ? 187  VAL H O   1 
ATOM   3072 C  CB  . VAL B 2 187 ? 17.855  39.528  -5.769  1.00 98.16  ? 187  VAL H CB  1 
ATOM   3073 C  CG1 . VAL B 2 187 ? 16.622  38.653  -5.621  1.00 94.92  ? 187  VAL H CG1 1 
ATOM   3074 C  CG2 . VAL B 2 187 ? 18.919  39.205  -4.721  1.00 98.74  ? 187  VAL H CG2 1 
ATOM   3075 N  N   . PRO B 2 188 ? 19.207  41.927  -7.180  1.00 103.75 ? 188  PRO H N   1 
ATOM   3076 C  CA  . PRO B 2 188 ? 20.267  42.940  -7.284  1.00 107.64 ? 188  PRO H CA  1 
ATOM   3077 C  C   . PRO B 2 188 ? 21.051  43.173  -5.990  1.00 114.53 ? 188  PRO H C   1 
ATOM   3078 O  O   . PRO B 2 188 ? 20.501  43.044  -4.891  1.00 114.00 ? 188  PRO H O   1 
ATOM   3079 C  CB  . PRO B 2 188 ? 19.512  44.195  -7.723  1.00 112.03 ? 188  PRO H CB  1 
ATOM   3080 C  CG  . PRO B 2 188 ? 18.129  44.019  -7.213  1.00 114.55 ? 188  PRO H CG  1 
ATOM   3081 C  CD  . PRO B 2 188 ? 17.892  42.569  -6.936  1.00 105.87 ? 188  PRO H CD  1 
ATOM   3082 N  N   . SER B 2 189 ? 22.334  43.547  -6.139  1.00 113.76 ? 189  SER H N   1 
ATOM   3083 C  CA  . SER B 2 189 ? 23.261  43.820  -5.042  1.00 116.43 ? 189  SER H CA  1 
ATOM   3084 C  C   . SER B 2 189 ? 22.846  44.995  -4.113  1.00 124.43 ? 189  SER H C   1 
ATOM   3085 O  O   . SER B 2 189 ? 23.164  44.972  -2.920  1.00 125.48 ? 189  SER H O   1 
ATOM   3086 C  CB  . SER B 2 189 ? 24.669  44.028  -5.587  1.00 122.31 ? 189  SER H CB  1 
ATOM   3087 O  OG  . SER B 2 189 ? 24.727  45.095  -6.520  1.00 133.82 ? 189  SER H OG  1 
ATOM   3088 N  N   . SER B 2 190 ? 22.143  46.002  -4.647  1.00 122.66 ? 190  SER H N   1 
ATOM   3089 C  CA  . SER B 2 190 ? 21.681  47.162  -3.874  1.00 125.89 ? 190  SER H CA  1 
ATOM   3090 C  C   . SER B 2 190 ? 20.546  46.807  -2.899  1.00 128.66 ? 190  SER H C   1 
ATOM   3091 O  O   . SER B 2 190 ? 20.591  47.194  -1.731  1.00 129.94 ? 190  SER H O   1 
ATOM   3092 C  CB  . SER B 2 190 ? 21.252  48.284  -4.815  1.00 131.34 ? 190  SER H CB  1 
ATOM   3093 O  OG  . SER B 2 190 ? 20.728  47.749  -6.023  1.00 134.89 ? 190  SER H OG  1 
ATOM   3094 N  N   . SER B 2 191 ? 19.563  46.030  -3.378  1.00 122.70 ? 191  SER H N   1 
ATOM   3095 C  CA  . SER B 2 191 ? 18.365  45.586  -2.650  1.00 121.12 ? 191  SER H CA  1 
ATOM   3096 C  C   . SER B 2 191 ? 18.588  44.790  -1.372  1.00 124.65 ? 191  SER H C   1 
ATOM   3097 O  O   . SER B 2 191 ? 17.783  44.937  -0.462  1.00 124.77 ? 191  SER H O   1 
ATOM   3098 C  CB  . SER B 2 191 ? 17.473  44.765  -3.578  1.00 119.75 ? 191  SER H CB  1 
ATOM   3099 O  OG  . SER B 2 191 ? 18.036  43.485  -3.826  1.00 117.12 ? 191  SER H OG  1 
ATOM   3100 N  N   . LEU B 2 192 ? 19.586  43.867  -1.359  1.00 119.53 ? 192  LEU H N   1 
ATOM   3101 C  CA  . LEU B 2 192 ? 19.932  42.930  -0.276  1.00 118.11 ? 192  LEU H CA  1 
ATOM   3102 C  C   . LEU B 2 192 ? 19.731  43.482  1.141   1.00 124.62 ? 192  LEU H C   1 
ATOM   3103 O  O   . LEU B 2 192 ? 19.055  42.842  1.952   1.00 123.08 ? 192  LEU H O   1 
ATOM   3104 C  CB  . LEU B 2 192 ? 21.372  42.393  -0.434  1.00 117.97 ? 192  LEU H CB  1 
ATOM   3105 C  CG  . LEU B 2 192 ? 21.829  41.928  -1.821  1.00 120.28 ? 192  LEU H CG  1 
ATOM   3106 C  CD1 . LEU B 2 192 ? 23.335  41.775  -1.861  1.00 121.82 ? 192  LEU H CD1 1 
ATOM   3107 C  CD2 . LEU B 2 192 ? 21.178  40.614  -2.208  1.00 118.30 ? 192  LEU H CD2 1 
ATOM   3108 N  N   . GLY B 2 193 ? 20.314  44.658  1.401   1.00 124.36 ? 193  GLY H N   1 
ATOM   3109 C  CA  . GLY B 2 193 ? 20.296  45.337  2.692   1.00 127.15 ? 193  GLY H CA  1 
ATOM   3110 C  C   . GLY B 2 193 ? 18.928  45.770  3.173   1.00 130.37 ? 193  GLY H C   1 
ATOM   3111 O  O   . GLY B 2 193 ? 18.686  45.840  4.384   1.00 131.05 ? 193  GLY H O   1 
ATOM   3112 N  N   . THR B 2 194 ? 18.028  46.069  2.225   1.00 125.54 ? 194  THR H N   1 
ATOM   3113 C  CA  . THR B 2 194 ? 16.670  46.521  2.537   1.00 125.96 ? 194  THR H CA  1 
ATOM   3114 C  C   . THR B 2 194 ? 15.685  45.356  2.479   1.00 124.60 ? 194  THR H C   1 
ATOM   3115 O  O   . THR B 2 194 ? 14.867  45.163  3.389   1.00 123.64 ? 194  THR H O   1 
ATOM   3116 C  CB  . THR B 2 194 ? 16.238  47.616  1.542   1.00 135.85 ? 194  THR H CB  1 
ATOM   3117 O  OG1 . THR B 2 194 ? 16.300  47.113  0.204   1.00 134.06 ? 194  THR H OG1 1 
ATOM   3118 C  CG2 . THR B 2 194 ? 17.044  48.904  1.684   1.00 137.12 ? 194  THR H CG2 1 
ATOM   3119 N  N   . GLN B 2 195 ? 15.754  44.611  1.360   1.00 118.01 ? 195  GLN H N   1 
ATOM   3120 C  CA  . GLN B 2 195 ? 14.891  43.485  1.020   1.00 114.29 ? 195  GLN H CA  1 
ATOM   3121 C  C   . GLN B 2 195 ? 15.134  42.246  1.895   1.00 117.79 ? 195  GLN H C   1 
ATOM   3122 O  O   . GLN B 2 195 ? 16.150  41.545  1.767   1.00 115.57 ? 195  GLN H O   1 
ATOM   3123 C  CB  . GLN B 2 195 ? 14.971  43.148  -0.478  1.00 112.38 ? 195  GLN H CB  1 
ATOM   3124 C  CG  . GLN B 2 195 ? 14.262  44.127  -1.429  1.00 116.88 ? 195  GLN H CG  1 
ATOM   3125 C  CD  . GLN B 2 195 ? 12.821  43.765  -1.731  1.00 123.22 ? 195  GLN H CD  1 
ATOM   3126 O  OE1 . GLN B 2 195 ? 11.990  44.639  -1.998  1.00 119.29 ? 195  GLN H OE1 1 
ATOM   3127 N  NE2 . GLN B 2 195 ? 12.489  42.476  -1.739  1.00 106.20 ? 195  GLN H NE2 1 
ATOM   3128 N  N   . THR B 2 196 ? 14.139  41.955  2.755   1.00 115.87 ? 196  THR H N   1 
ATOM   3129 C  CA  . THR B 2 196 ? 14.115  40.836  3.698   1.00 114.95 ? 196  THR H CA  1 
ATOM   3130 C  C   . THR B 2 196 ? 13.526  39.613  3.002   1.00 115.52 ? 196  THR H C   1 
ATOM   3131 O  O   . THR B 2 196 ? 12.369  39.229  3.225   1.00 113.97 ? 196  THR H O   1 
ATOM   3132 C  CB  . THR B 2 196 ? 13.443  41.237  5.034   1.00 127.57 ? 196  THR H CB  1 
ATOM   3133 O  OG1 . THR B 2 196 ? 14.007  42.471  5.503   1.00 133.20 ? 196  THR H OG1 1 
ATOM   3134 C  CG2 . THR B 2 196 ? 13.567  40.147  6.116   1.00 124.68 ? 196  THR H CG2 1 
ATOM   3135 N  N   . TYR B 2 197 ? 14.349  39.045  2.106   1.00 110.93 ? 197  TYR H N   1 
ATOM   3136 C  CA  . TYR B 2 197 ? 14.079  37.872  1.279   1.00 107.17 ? 197  TYR H CA  1 
ATOM   3137 C  C   . TYR B 2 197 ? 13.935  36.648  2.168   1.00 108.89 ? 197  TYR H C   1 
ATOM   3138 O  O   . TYR B 2 197 ? 14.785  36.404  3.028   1.00 109.86 ? 197  TYR H O   1 
ATOM   3139 C  CB  . TYR B 2 197 ? 15.230  37.642  0.272   1.00 107.69 ? 197  TYR H CB  1 
ATOM   3140 C  CG  . TYR B 2 197 ? 15.435  38.736  -0.758  1.00 111.88 ? 197  TYR H CG  1 
ATOM   3141 C  CD1 . TYR B 2 197 ? 14.480  38.985  -1.742  1.00 113.05 ? 197  TYR H CD1 1 
ATOM   3142 C  CD2 . TYR B 2 197 ? 16.618  39.472  -0.797  1.00 115.36 ? 197  TYR H CD2 1 
ATOM   3143 C  CE1 . TYR B 2 197 ? 14.666  39.986  -2.697  1.00 115.62 ? 197  TYR H CE1 1 
ATOM   3144 C  CE2 . TYR B 2 197 ? 16.823  40.464  -1.757  1.00 117.95 ? 197  TYR H CE2 1 
ATOM   3145 C  CZ  . TYR B 2 197 ? 15.843  40.717  -2.707  1.00 124.70 ? 197  TYR H CZ  1 
ATOM   3146 O  OH  . TYR B 2 197 ? 16.013  41.713  -3.640  1.00 126.94 ? 197  TYR H OH  1 
ATOM   3147 N  N   . ILE B 2 198 ? 12.852  35.882  1.964   1.00 102.24 ? 198  ILE H N   1 
ATOM   3148 C  CA  . ILE B 2 198 ? 12.542  34.671  2.724   1.00 100.08 ? 198  ILE H CA  1 
ATOM   3149 C  C   . ILE B 2 198 ? 12.318  33.496  1.782   1.00 98.93  ? 198  ILE H C   1 
ATOM   3150 O  O   . ILE B 2 198 ? 11.809  33.684  0.679   1.00 96.95  ? 198  ILE H O   1 
ATOM   3151 C  CB  . ILE B 2 198 ? 11.326  34.955  3.672   1.00 105.01 ? 198  ILE H CB  1 
ATOM   3152 C  CG1 . ILE B 2 198 ? 11.805  35.498  5.043   1.00 108.92 ? 198  ILE H CG1 1 
ATOM   3153 C  CG2 . ILE B 2 198 ? 10.354  33.768  3.843   1.00 103.67 ? 198  ILE H CG2 1 
ATOM   3154 C  CD1 . ILE B 2 198 ? 10.817  36.404  5.824   1.00 115.99 ? 198  ILE H CD1 1 
ATOM   3155 N  N   . CYS B 2 199 ? 12.699  32.288  2.224   1.00 93.47  ? 199  CYS H N   1 
ATOM   3156 C  CA  . CYS B 2 199 ? 12.449  31.027  1.524   1.00 89.58  ? 199  CYS H CA  1 
ATOM   3157 C  C   . CYS B 2 199 ? 11.501  30.188  2.402   1.00 95.03  ? 199  CYS H C   1 
ATOM   3158 O  O   . CYS B 2 199 ? 11.704  30.120  3.616   1.00 97.44  ? 199  CYS H O   1 
ATOM   3159 C  CB  . CYS B 2 199 ? 13.751  30.297  1.201   1.00 87.84  ? 199  CYS H CB  1 
ATOM   3160 S  SG  . CYS B 2 199 ? 14.038  28.770  2.139   1.00 90.46  ? 199  CYS H SG  1 
ATOM   3161 N  N   . ASN B 2 200 ? 10.431  29.632  1.816   1.00 89.76  ? 200  ASN H N   1 
ATOM   3162 C  CA  . ASN B 2 200 ? 9.438   28.875  2.575   1.00 90.13  ? 200  ASN H CA  1 
ATOM   3163 C  C   . ASN B 2 200 ? 9.338   27.508  1.978   1.00 94.02  ? 200  ASN H C   1 
ATOM   3164 O  O   . ASN B 2 200 ? 9.170   27.389  0.762   1.00 92.42  ? 200  ASN H O   1 
ATOM   3165 C  CB  . ASN B 2 200 ? 8.060   29.569  2.551   1.00 90.58  ? 200  ASN H CB  1 
ATOM   3166 C  CG  . ASN B 2 200 ? 8.072   31.068  2.749   1.00 116.26 ? 200  ASN H CG  1 
ATOM   3167 O  OD1 . ASN B 2 200 ? 8.430   31.834  1.845   1.00 107.42 ? 200  ASN H OD1 1 
ATOM   3168 N  ND2 . ASN B 2 200 ? 7.642   31.537  3.913   1.00 111.99 ? 200  ASN H ND2 1 
ATOM   3169 N  N   . VAL B 2 201 ? 9.431   26.471  2.822   1.00 91.94  ? 201  VAL H N   1 
ATOM   3170 C  CA  . VAL B 2 201 ? 9.373   25.073  2.374   1.00 89.64  ? 201  VAL H CA  1 
ATOM   3171 C  C   . VAL B 2 201 ? 8.368   24.255  3.174   1.00 94.16  ? 201  VAL H C   1 
ATOM   3172 O  O   . VAL B 2 201 ? 8.454   24.199  4.404   1.00 96.72  ? 201  VAL H O   1 
ATOM   3173 C  CB  . VAL B 2 201 ? 10.786  24.414  2.331   1.00 93.11  ? 201  VAL H CB  1 
ATOM   3174 C  CG1 . VAL B 2 201 ? 11.626  24.818  3.533   1.00 95.89  ? 201  VAL H CG1 1 
ATOM   3175 C  CG2 . VAL B 2 201 ? 10.733  22.890  2.173   1.00 91.23  ? 201  VAL H CG2 1 
ATOM   3176 N  N   . ASN B 2 202 ? 7.422   23.627  2.471   1.00 87.88  ? 202  ASN H N   1 
ATOM   3177 C  CA  . ASN B 2 202 ? 6.474   22.750  3.118   1.00 88.10  ? 202  ASN H CA  1 
ATOM   3178 C  C   . ASN B 2 202 ? 6.810   21.289  2.763   1.00 89.78  ? 202  ASN H C   1 
ATOM   3179 O  O   . ASN B 2 202 ? 6.970   20.944  1.594   1.00 86.68  ? 202  ASN H O   1 
ATOM   3180 C  CB  . ASN B 2 202 ? 5.022   23.115  2.755   1.00 88.84  ? 202  ASN H CB  1 
ATOM   3181 C  CG  . ASN B 2 202 ? 3.992   22.043  3.075   1.00 109.66 ? 202  ASN H CG  1 
ATOM   3182 O  OD1 . ASN B 2 202 ? 3.835   21.601  4.220   1.00 105.16 ? 202  ASN H OD1 1 
ATOM   3183 N  ND2 . ASN B 2 202 ? 3.265   21.605  2.059   1.00 97.03  ? 202  ASN H ND2 1 
ATOM   3184 N  N   . HIS B 2 203 ? 6.931   20.438  3.781   1.00 87.38  ? 203  HIS H N   1 
ATOM   3185 C  CA  . HIS B 2 203 ? 7.091   19.001  3.601   1.00 85.78  ? 203  HIS H CA  1 
ATOM   3186 C  C   . HIS B 2 203 ? 5.837   18.432  4.230   1.00 90.94  ? 203  HIS H C   1 
ATOM   3187 O  O   . HIS B 2 203 ? 5.613   18.604  5.431   1.00 93.22  ? 203  HIS H O   1 
ATOM   3188 C  CB  . HIS B 2 203 ? 8.355   18.433  4.265   1.00 87.78  ? 203  HIS H CB  1 
ATOM   3189 C  CG  . HIS B 2 203 ? 8.549   16.948  4.059   1.00 90.16  ? 203  HIS H CG  1 
ATOM   3190 N  ND1 . HIS B 2 203 ? 8.733   16.091  5.130   1.00 94.05  ? 203  HIS H ND1 1 
ATOM   3191 C  CD2 . HIS B 2 203 ? 8.610   16.224  2.913   1.00 89.15  ? 203  HIS H CD2 1 
ATOM   3192 C  CE1 . HIS B 2 203 ? 8.898   14.884  4.607   1.00 91.95  ? 203  HIS H CE1 1 
ATOM   3193 N  NE2 . HIS B 2 203 ? 8.821   14.911  3.278   1.00 89.22  ? 203  HIS H NE2 1 
ATOM   3194 N  N   . LYS B 2 204 ? 4.972   17.847  3.402   1.00 85.56  ? 204  LYS H N   1 
ATOM   3195 C  CA  . LYS B 2 204 ? 3.691   17.342  3.868   1.00 86.17  ? 204  LYS H CA  1 
ATOM   3196 C  C   . LYS B 2 204 ? 3.730   15.914  4.443   1.00 90.69  ? 204  LYS H C   1 
ATOM   3197 O  O   . LYS B 2 204 ? 3.059   15.751  5.459   1.00 92.73  ? 204  LYS H O   1 
ATOM   3198 C  CB  . LYS B 2 204 ? 2.622   17.491  2.800   1.00 86.08  ? 204  LYS H CB  1 
ATOM   3199 C  CG  . LYS B 2 204 ? 1.779   18.753  2.986   1.00 85.60  ? 204  LYS H CG  1 
ATOM   3200 C  CD  . LYS B 2 204 ? 0.323   18.449  3.316   1.00 89.33  ? 204  LYS H CD  1 
ATOM   3201 C  CE  . LYS B 2 204 ? 0.077   18.171  4.779   1.00 96.96  ? 204  LYS H CE  1 
ATOM   3202 N  NZ  . LYS B 2 204 ? -1.368  18.009  5.066   1.00 107.09 ? 204  LYS H NZ  1 
ATOM   3203 N  N   . PRO B 2 205 ? 4.509   14.900  3.946   1.00 85.84  ? 205  PRO H N   1 
ATOM   3204 C  CA  . PRO B 2 205 ? 4.525   13.586  4.641   1.00 87.53  ? 205  PRO H CA  1 
ATOM   3205 C  C   . PRO B 2 205 ? 4.962   13.632  6.130   1.00 96.54  ? 205  PRO H C   1 
ATOM   3206 O  O   . PRO B 2 205 ? 4.448   12.844  6.925   1.00 98.25  ? 205  PRO H O   1 
ATOM   3207 C  CB  . PRO B 2 205 ? 5.455   12.726  3.780   1.00 86.50  ? 205  PRO H CB  1 
ATOM   3208 C  CG  . PRO B 2 205 ? 5.549   13.421  2.475   1.00 87.55  ? 205  PRO H CG  1 
ATOM   3209 C  CD  . PRO B 2 205 ? 5.383   14.879  2.755   1.00 84.08  ? 205  PRO H CD  1 
ATOM   3210 N  N   . SER B 2 206 ? 5.865   14.579  6.518   1.00 94.31  ? 206  SER H N   1 
ATOM   3211 C  CA  . SER B 2 206 ? 6.301   14.770  7.918   1.00 97.25  ? 206  SER H CA  1 
ATOM   3212 C  C   . SER B 2 206 ? 5.766   16.078  8.569   1.00 102.64 ? 206  SER H C   1 
ATOM   3213 O  O   . SER B 2 206 ? 6.163   16.388  9.696   1.00 105.63 ? 206  SER H O   1 
ATOM   3214 C  CB  . SER B 2 206 ? 7.823   14.658  8.053   1.00 100.04 ? 206  SER H CB  1 
ATOM   3215 O  OG  . SER B 2 206 ? 8.512   15.885  7.862   1.00 103.70 ? 206  SER H OG  1 
ATOM   3216 N  N   . ASN B 2 207 ? 4.852   16.814  7.877   1.00 97.12  ? 207  ASN H N   1 
ATOM   3217 C  CA  . ASN B 2 207 ? 4.207   18.075  8.280   1.00 98.61  ? 207  ASN H CA  1 
ATOM   3218 C  C   . ASN B 2 207 ? 5.195   19.108  8.905   1.00 103.63 ? 207  ASN H C   1 
ATOM   3219 O  O   . ASN B 2 207 ? 5.032   19.570  10.046  1.00 106.76 ? 207  ASN H O   1 
ATOM   3220 C  CB  . ASN B 2 207 ? 2.970   17.835  9.143   1.00 102.48 ? 207  ASN H CB  1 
ATOM   3221 C  CG  . ASN B 2 207 ? 1.746   17.599  8.291   1.00 127.53 ? 207  ASN H CG  1 
ATOM   3222 O  OD1 . ASN B 2 207 ? 1.492   16.495  7.809   1.00 121.67 ? 207  ASN H OD1 1 
ATOM   3223 N  ND2 . ASN B 2 207 ? 0.979   18.655  8.056   1.00 121.78 ? 207  ASN H ND2 1 
ATOM   3224 N  N   . THR B 2 208 ? 6.219   19.460  8.102   1.00 96.67  ? 208  THR H N   1 
ATOM   3225 C  CA  . THR B 2 208 ? 7.241   20.469  8.401   1.00 96.72  ? 208  THR H CA  1 
ATOM   3226 C  C   . THR B 2 208 ? 6.870   21.679  7.547   1.00 95.79  ? 208  THR H C   1 
ATOM   3227 O  O   . THR B 2 208 ? 6.731   21.556  6.329   1.00 92.45  ? 208  THR H O   1 
ATOM   3228 C  CB  . THR B 2 208 ? 8.685   19.965  8.102   1.00 105.29 ? 208  THR H CB  1 
ATOM   3229 O  OG1 . THR B 2 208 ? 8.665   18.600  7.671   1.00 104.34 ? 208  THR H OG1 1 
ATOM   3230 C  CG2 . THR B 2 208 ? 9.613   20.105  9.300   1.00 106.76 ? 208  THR H CG2 1 
ATOM   3231 N  N   . LYS B 2 209 ? 6.639   22.828  8.174   1.00 92.07  ? 209  LYS H N   1 
ATOM   3232 C  CA  . LYS B 2 209 ? 6.259   24.013  7.409   1.00 90.08  ? 209  LYS H CA  1 
ATOM   3233 C  C   . LYS B 2 209 ? 7.270   25.131  7.614   1.00 94.77  ? 209  LYS H C   1 
ATOM   3234 O  O   . LYS B 2 209 ? 6.918   26.313  7.712   1.00 96.32  ? 209  LYS H O   1 
ATOM   3235 C  CB  . LYS B 2 209 ? 4.811   24.436  7.723   1.00 93.26  ? 209  LYS H CB  1 
ATOM   3236 C  CG  . LYS B 2 209 ? 3.734   23.660  6.933   1.00 94.90  ? 209  LYS H CG  1 
ATOM   3237 C  CD  . LYS B 2 209 ? 3.429   22.213  7.428   1.00 96.33  ? 209  LYS H CD  1 
ATOM   3238 C  CE  . LYS B 2 209 ? 2.607   22.090  8.694   1.00 100.47 ? 209  LYS H CE  1 
ATOM   3239 N  NZ  . LYS B 2 209 ? 1.146   22.167  8.431   1.00 104.55 ? 209  LYS H NZ  1 
ATOM   3240 N  N   . VAL B 2 210 ? 8.552   24.745  7.619   1.00 89.86  ? 210  VAL H N   1 
ATOM   3241 C  CA  . VAL B 2 210 ? 9.681   25.649  7.852   1.00 90.74  ? 210  VAL H CA  1 
ATOM   3242 C  C   . VAL B 2 210 ? 9.746   26.829  6.855   1.00 92.66  ? 210  VAL H C   1 
ATOM   3243 O  O   . VAL B 2 210 ? 9.751   26.641  5.636   1.00 88.40  ? 210  VAL H O   1 
ATOM   3244 C  CB  . VAL B 2 210 ? 11.052  24.906  7.939   1.00 93.88  ? 210  VAL H CB  1 
ATOM   3245 C  CG1 . VAL B 2 210 ? 12.201  25.877  8.202   1.00 95.46  ? 210  VAL H CG1 1 
ATOM   3246 C  CG2 . VAL B 2 210 ? 11.026  23.821  9.012   1.00 95.36  ? 210  VAL H CG2 1 
ATOM   3247 N  N   . ASP B 2 211 ? 9.815   28.048  7.411   1.00 92.08  ? 211  ASP H N   1 
ATOM   3248 C  CA  . ASP B 2 211 ? 10.006  29.303  6.679   1.00 91.80  ? 211  ASP H CA  1 
ATOM   3249 C  C   . ASP B 2 211 ? 11.316  29.901  7.196   1.00 97.34  ? 211  ASP H C   1 
ATOM   3250 O  O   . ASP B 2 211 ? 11.473  30.052  8.410   1.00 99.96  ? 211  ASP H O   1 
ATOM   3251 C  CB  . ASP B 2 211 ? 8.819   30.273  6.887   1.00 95.36  ? 211  ASP H CB  1 
ATOM   3252 C  CG  . ASP B 2 211 ? 7.427   29.671  6.690   1.00 101.16 ? 211  ASP H CG  1 
ATOM   3253 O  OD1 . ASP B 2 211 ? 7.294   28.710  5.893   1.00 96.93  ? 211  ASP H OD1 1 
ATOM   3254 O  OD2 . ASP B 2 211 ? 6.469   30.177  7.317   1.00 109.61 ? 211  ASP H OD2 1 
ATOM   3255 N  N   . LYS B 2 212 ? 12.268  30.187  6.294   1.00 92.70  ? 212  LYS H N   1 
ATOM   3256 C  CA  . LYS B 2 212 ? 13.578  30.715  6.660   1.00 95.09  ? 212  LYS H CA  1 
ATOM   3257 C  C   . LYS B 2 212 ? 13.952  32.039  5.990   1.00 102.12 ? 212  LYS H C   1 
ATOM   3258 O  O   . LYS B 2 212 ? 13.476  32.337  4.895   1.00 99.49  ? 212  LYS H O   1 
ATOM   3259 C  CB  . LYS B 2 212 ? 14.670  29.667  6.415   1.00 95.41  ? 212  LYS H CB  1 
ATOM   3260 C  CG  . LYS B 2 212 ? 15.199  29.077  7.700   1.00 100.88 ? 212  LYS H CG  1 
ATOM   3261 C  CD  . LYS B 2 212 ? 16.581  29.626  8.015   1.00 106.87 ? 212  LYS H CD  1 
ATOM   3262 C  CE  . LYS B 2 212 ? 17.217  28.923  9.179   1.00 117.09 ? 212  LYS H CE  1 
ATOM   3263 N  NZ  . LYS B 2 212 ? 18.462  29.604  9.589   1.00 126.65 ? 212  LYS H NZ  1 
ATOM   3264 N  N   . ARG B 2 213 ? 14.844  32.814  6.656   1.00 103.94 ? 213  ARG H N   1 
ATOM   3265 C  CA  . ARG B 2 213 ? 15.354  34.125  6.212   1.00 106.24 ? 213  ARG H CA  1 
ATOM   3266 C  C   . ARG B 2 213 ? 16.887  34.106  5.977   1.00 112.15 ? 213  ARG H C   1 
ATOM   3267 O  O   . ARG B 2 213 ? 17.628  33.526  6.780   1.00 113.62 ? 213  ARG H O   1 
ATOM   3268 C  CB  . ARG B 2 213 ? 14.948  35.221  7.215   1.00 110.69 ? 213  ARG H CB  1 
ATOM   3269 C  CG  . ARG B 2 213 ? 14.993  36.647  6.654   1.00 122.41 ? 213  ARG H CG  1 
ATOM   3270 N  N   . VAL B 2 214 ? 17.336  34.740  4.869   1.00 107.99 ? 214  VAL H N   1 
ATOM   3271 C  CA  . VAL B 2 214 ? 18.728  34.806  4.413   1.00 108.13 ? 214  VAL H CA  1 
ATOM   3272 C  C   . VAL B 2 214 ? 19.324  36.181  4.686   1.00 115.23 ? 214  VAL H C   1 
ATOM   3273 O  O   . VAL B 2 214 ? 18.753  37.187  4.274   1.00 114.99 ? 214  VAL H O   1 
ATOM   3274 C  CB  . VAL B 2 214 ? 18.822  34.429  2.903   1.00 108.59 ? 214  VAL H CB  1 
ATOM   3275 C  CG1 . VAL B 2 214 ? 20.209  34.711  2.328   1.00 109.56 ? 214  VAL H CG1 1 
ATOM   3276 C  CG2 . VAL B 2 214 ? 18.421  32.976  2.658   1.00 104.85 ? 214  VAL H CG2 1 
ATOM   3277 N  N   . GLU B 2 215 ? 20.489  36.214  5.334   1.00 115.44 ? 215  GLU H N   1 
ATOM   3278 C  CA  . GLU B 2 215 ? 21.194  37.455  5.644   1.00 120.04 ? 215  GLU H CA  1 
ATOM   3279 C  C   . GLU B 2 215 ? 22.697  37.313  5.330   1.00 126.28 ? 215  GLU H C   1 
ATOM   3280 O  O   . GLU B 2 215 ? 23.323  36.353  5.789   1.00 126.34 ? 215  GLU H O   1 
ATOM   3281 C  CB  . GLU B 2 215 ? 20.964  37.858  7.123   1.00 125.11 ? 215  GLU H CB  1 
ATOM   3282 C  CG  . GLU B 2 215 ? 21.184  39.333  7.446   1.00 141.22 ? 215  GLU H CG  1 
ATOM   3283 C  CD  . GLU B 2 215 ? 20.179  40.343  6.916   1.00 164.45 ? 215  GLU H CD  1 
ATOM   3284 O  OE1 . GLU B 2 215 ? 19.046  39.947  6.553   1.00 155.25 ? 215  GLU H OE1 1 
ATOM   3285 O  OE2 . GLU B 2 215 ? 20.525  41.547  6.893   1.00 162.34 ? 215  GLU H OE2 1 
ATOM   3286 N  N   . PRO B 2 216 ? 23.307  38.243  4.558   1.00 124.20 ? 216  PRO H N   1 
ATOM   3287 C  CA  . PRO B 2 216 ? 24.756  38.141  4.308   1.00 128.81 ? 216  PRO H CA  1 
ATOM   3288 C  C   . PRO B 2 216 ? 25.542  38.724  5.486   1.00 158.35 ? 216  PRO H C   1 
ATOM   3289 O  O   . PRO B 2 216 ? 26.771  38.771  5.477   1.00 116.55 ? 216  PRO H O   1 
ATOM   3290 C  CB  . PRO B 2 216 ? 24.955  38.946  3.020   1.00 129.84 ? 216  PRO H CB  1 
ATOM   3291 C  CG  . PRO B 2 216 ? 23.805  39.902  2.978   1.00 133.47 ? 216  PRO H CG  1 
ATOM   3292 C  CD  . PRO B 2 216 ? 22.739  39.462  3.945   1.00 127.49 ? 216  PRO H CD  1 
ATOM   3293 N  N   . ILE C 3 2   ? 15.809  -8.114  -28.095 1.00 47.70  ? 2    ILE L N   1 
ATOM   3294 C  CA  . ILE C 3 2   ? 16.018  -7.169  -29.201 1.00 45.56  ? 2    ILE L CA  1 
ATOM   3295 C  C   . ILE C 3 2   ? 16.366  -5.810  -28.613 1.00 52.60  ? 2    ILE L C   1 
ATOM   3296 O  O   . ILE C 3 2   ? 15.598  -5.287  -27.815 1.00 52.64  ? 2    ILE L O   1 
ATOM   3297 C  CB  . ILE C 3 2   ? 14.837  -7.127  -30.231 1.00 44.83  ? 2    ILE L CB  1 
ATOM   3298 C  CG1 . ILE C 3 2   ? 14.552  -8.560  -30.793 1.00 44.18  ? 2    ILE L CG1 1 
ATOM   3299 C  CG2 . ILE C 3 2   ? 15.094  -6.080  -31.347 1.00 41.24  ? 2    ILE L CG2 1 
ATOM   3300 C  CD1 . ILE C 3 2   ? 13.500  -8.739  -31.829 1.00 42.46  ? 2    ILE L CD1 1 
ATOM   3301 N  N   . GLN C 3 3   ? 17.558  -5.283  -28.949 1.00 51.09  ? 3    GLN L N   1 
ATOM   3302 C  CA  . GLN C 3 3   ? 18.066  -4.001  -28.437 1.00 51.55  ? 3    GLN L CA  1 
ATOM   3303 C  C   . GLN C 3 3   ? 17.649  -2.890  -29.383 1.00 54.12  ? 3    GLN L C   1 
ATOM   3304 O  O   . GLN C 3 3   ? 17.854  -2.988  -30.593 1.00 53.68  ? 3    GLN L O   1 
ATOM   3305 C  CB  . GLN C 3 3   ? 19.618  -3.985  -28.203 1.00 54.33  ? 3    GLN L CB  1 
ATOM   3306 C  CG  . GLN C 3 3   ? 20.361  -5.333  -28.051 1.00 67.49  ? 3    GLN L CG  1 
ATOM   3307 C  CD  . GLN C 3 3   ? 19.687  -6.346  -27.134 1.00 85.07  ? 3    GLN L CD  1 
ATOM   3308 O  OE1 . GLN C 3 3   ? 19.405  -6.068  -25.961 1.00 77.84  ? 3    GLN L OE1 1 
ATOM   3309 N  NE2 . GLN C 3 3   ? 19.356  -7.527  -27.675 1.00 76.62  ? 3    GLN L NE2 1 
ATOM   3310 N  N   . MET C 3 4   ? 17.025  -1.861  -28.851 1.00 50.16  ? 4    MET L N   1 
ATOM   3311 C  CA  . MET C 3 4   ? 16.590  -0.737  -29.676 1.00 49.37  ? 4    MET L CA  1 
ATOM   3312 C  C   . MET C 3 4   ? 17.532  0.430   -29.404 1.00 55.23  ? 4    MET L C   1 
ATOM   3313 O  O   . MET C 3 4   ? 17.719  0.799   -28.244 1.00 56.23  ? 4    MET L O   1 
ATOM   3314 C  CB  . MET C 3 4   ? 15.122  -0.343  -29.367 1.00 50.78  ? 4    MET L CB  1 
ATOM   3315 C  CG  . MET C 3 4   ? 14.075  -1.449  -29.565 1.00 53.57  ? 4    MET L CG  1 
ATOM   3316 S  SD  . MET C 3 4   ? 14.122  -2.277  -31.157 1.00 56.52  ? 4    MET L SD  1 
ATOM   3317 C  CE  . MET C 3 4   ? 13.706  -1.065  -32.206 1.00 50.70  ? 4    MET L CE  1 
ATOM   3318 N  N   . THR C 3 5   ? 18.151  0.994   -30.444 1.00 51.40  ? 5    THR L N   1 
ATOM   3319 C  CA  . THR C 3 5   ? 19.086  2.113   -30.268 1.00 50.98  ? 5    THR L CA  1 
ATOM   3320 C  C   . THR C 3 5   ? 18.551  3.331   -30.988 1.00 50.78  ? 5    THR L C   1 
ATOM   3321 O  O   . THR C 3 5   ? 18.355  3.294   -32.197 1.00 49.78  ? 5    THR L O   1 
ATOM   3322 C  CB  . THR C 3 5   ? 20.541  1.701   -30.647 1.00 54.95  ? 5    THR L CB  1 
ATOM   3323 O  OG1 . THR C 3 5   ? 20.990  0.761   -29.681 1.00 52.30  ? 5    THR L OG1 1 
ATOM   3324 C  CG2 . THR C 3 5   ? 21.521  2.870   -30.682 1.00 50.76  ? 5    THR L CG2 1 
ATOM   3325 N  N   . GLN C 3 6   ? 18.321  4.407   -30.240 1.00 44.99  ? 6    GLN L N   1 
ATOM   3326 C  CA  . GLN C 3 6   ? 17.853  5.648   -30.826 1.00 43.31  ? 6    GLN L CA  1 
ATOM   3327 C  C   . GLN C 3 6   ? 18.986  6.629   -31.045 1.00 49.95  ? 6    GLN L C   1 
ATOM   3328 O  O   . GLN C 3 6   ? 19.943  6.669   -30.264 1.00 51.01  ? 6    GLN L O   1 
ATOM   3329 C  CB  . GLN C 3 6   ? 16.784  6.285   -29.970 1.00 43.14  ? 6    GLN L CB  1 
ATOM   3330 C  CG  . GLN C 3 6   ? 15.414  5.813   -30.305 1.00 31.71  ? 6    GLN L CG  1 
ATOM   3331 C  CD  . GLN C 3 6   ? 14.444  6.343   -29.318 1.00 53.17  ? 6    GLN L CD  1 
ATOM   3332 O  OE1 . GLN C 3 6   ? 13.957  5.622   -28.462 1.00 49.11  ? 6    GLN L OE1 1 
ATOM   3333 N  NE2 . GLN C 3 6   ? 14.106  7.607   -29.446 1.00 59.39  ? 6    GLN L NE2 1 
ATOM   3334 N  N   . SER C 3 7   ? 18.842  7.463   -32.082 1.00 45.99  ? 7    SER L N   1 
ATOM   3335 C  CA  . SER C 3 7   ? 19.821  8.474   -32.435 1.00 46.21  ? 7    SER L CA  1 
ATOM   3336 C  C   . SER C 3 7   ? 19.113  9.750   -32.960 1.00 51.35  ? 7    SER L C   1 
ATOM   3337 O  O   . SER C 3 7   ? 18.252  9.680   -33.845 1.00 50.74  ? 7    SER L O   1 
ATOM   3338 C  CB  . SER C 3 7   ? 20.806  7.925   -33.460 1.00 48.33  ? 7    SER L CB  1 
ATOM   3339 O  OG  . SER C 3 7   ? 20.593  6.539   -33.698 1.00 53.31  ? 7    SER L OG  1 
ATOM   3340 N  N   . PRO C 3 8   ? 19.470  10.940  -32.444 1.00 48.73  ? 8    PRO L N   1 
ATOM   3341 C  CA  . PRO C 3 8   ? 20.414  11.195  -31.334 1.00 49.27  ? 8    PRO L CA  1 
ATOM   3342 C  C   . PRO C 3 8   ? 19.717  10.921  -29.992 1.00 52.81  ? 8    PRO L C   1 
ATOM   3343 O  O   . PRO C 3 8   ? 18.528  10.617  -29.976 1.00 52.31  ? 8    PRO L O   1 
ATOM   3344 C  CB  . PRO C 3 8   ? 20.795  12.665  -31.541 1.00 51.02  ? 8    PRO L CB  1 
ATOM   3345 C  CG  . PRO C 3 8   ? 19.587  13.286  -32.196 1.00 55.25  ? 8    PRO L CG  1 
ATOM   3346 C  CD  . PRO C 3 8   ? 18.811  12.178  -32.904 1.00 49.84  ? 8    PRO L CD  1 
ATOM   3347 N  N   . SER C 3 9   ? 20.435  10.978  -28.884 1.00 49.01  ? 9    SER L N   1 
ATOM   3348 C  CA  . SER C 3 9   ? 19.812  10.802  -27.567 1.00 48.55  ? 9    SER L CA  1 
ATOM   3349 C  C   . SER C 3 9   ? 19.155  12.137  -27.144 1.00 51.60  ? 9    SER L C   1 
ATOM   3350 O  O   . SER C 3 9   ? 18.163  12.141  -26.410 1.00 49.30  ? 9    SER L O   1 
ATOM   3351 C  CB  . SER C 3 9   ? 20.859  10.377  -26.535 1.00 53.26  ? 9    SER L CB  1 
ATOM   3352 O  OG  . SER C 3 9   ? 22.078  11.106  -26.619 1.00 60.87  ? 9    SER L OG  1 
ATOM   3353 N  N   . SER C 3 10  ? 19.757  13.269  -27.604 1.00 48.71  ? 10   SER L N   1 
ATOM   3354 C  CA  . SER C 3 10  ? 19.357  14.647  -27.352 1.00 47.84  ? 10   SER L CA  1 
ATOM   3355 C  C   . SER C 3 10  ? 19.436  15.408  -28.655 1.00 48.58  ? 10   SER L C   1 
ATOM   3356 O  O   . SER C 3 10  ? 20.399  15.274  -29.410 1.00 46.17  ? 10   SER L O   1 
ATOM   3357 C  CB  . SER C 3 10  ? 20.278  15.292  -26.325 1.00 55.33  ? 10   SER L CB  1 
ATOM   3358 O  OG  . SER C 3 10  ? 20.244  14.643  -25.063 1.00 69.03  ? 10   SER L OG  1 
ATOM   3359 N  N   . LEU C 3 11  ? 18.414  16.206  -28.912 1.00 46.21  ? 11   LEU L N   1 
ATOM   3360 C  CA  . LEU C 3 11  ? 18.284  16.989  -30.126 1.00 46.65  ? 11   LEU L CA  1 
ATOM   3361 C  C   . LEU C 3 11  ? 17.797  18.383  -29.772 1.00 53.63  ? 11   LEU L C   1 
ATOM   3362 O  O   . LEU C 3 11  ? 16.868  18.505  -28.976 1.00 54.53  ? 11   LEU L O   1 
ATOM   3363 C  CB  . LEU C 3 11  ? 17.276  16.266  -31.037 1.00 44.99  ? 11   LEU L CB  1 
ATOM   3364 C  CG  . LEU C 3 11  ? 17.017  16.748  -32.485 1.00 49.60  ? 11   LEU L CG  1 
ATOM   3365 C  CD1 . LEU C 3 11  ? 18.266  17.330  -33.152 1.00 50.99  ? 11   LEU L CD1 1 
ATOM   3366 C  CD2 . LEU C 3 11  ? 16.650  15.578  -33.352 1.00 52.67  ? 11   LEU L CD2 1 
ATOM   3367 N  N   . SER C 3 12  ? 18.442  19.422  -30.333 1.00 50.07  ? 12   SER L N   1 
ATOM   3368 C  CA  . SER C 3 12  ? 18.054  20.802  -30.148 1.00 50.55  ? 12   SER L CA  1 
ATOM   3369 C  C   . SER C 3 12  ? 17.394  21.272  -31.457 1.00 53.46  ? 12   SER L C   1 
ATOM   3370 O  O   . SER C 3 12  ? 17.944  21.063  -32.542 1.00 54.67  ? 12   SER L O   1 
ATOM   3371 C  CB  . SER C 3 12  ? 19.274  21.653  -29.814 1.00 57.40  ? 12   SER L CB  1 
ATOM   3372 O  OG  . SER C 3 12  ? 19.965  22.080  -30.977 1.00 70.42  ? 12   SER L OG  1 
ATOM   3373 N  N   . ALA C 3 13  ? 16.203  21.857  -31.356 1.00 47.00  ? 13   ALA L N   1 
ATOM   3374 C  CA  . ALA C 3 13  ? 15.470  22.361  -32.510 1.00 45.27  ? 13   ALA L CA  1 
ATOM   3375 C  C   . ALA C 3 13  ? 14.612  23.609  -32.153 1.00 48.77  ? 13   ALA L C   1 
ATOM   3376 O  O   . ALA C 3 13  ? 14.458  23.959  -30.975 1.00 50.39  ? 13   ALA L O   1 
ATOM   3377 C  CB  . ALA C 3 13  ? 14.609  21.264  -33.077 1.00 44.37  ? 13   ALA L CB  1 
ATOM   3378 N  N   . SER C 3 14  ? 14.093  24.289  -33.185 1.00 41.21  ? 14   SER L N   1 
ATOM   3379 C  CA  . SER C 3 14  ? 13.240  25.455  -33.036 1.00 39.29  ? 14   SER L CA  1 
ATOM   3380 C  C   . SER C 3 14  ? 11.895  25.164  -33.665 1.00 38.09  ? 14   SER L C   1 
ATOM   3381 O  O   . SER C 3 14  ? 11.770  24.250  -34.499 1.00 36.67  ? 14   SER L O   1 
ATOM   3382 C  CB  . SER C 3 14  ? 13.853  26.634  -33.768 1.00 45.29  ? 14   SER L CB  1 
ATOM   3383 O  OG  . SER C 3 14  ? 15.122  26.945  -33.226 1.00 62.71  ? 14   SER L OG  1 
ATOM   3384 N  N   . VAL C 3 15  ? 10.885  25.964  -33.293 1.00 32.19  ? 15   VAL L N   1 
ATOM   3385 C  CA  . VAL C 3 15  ? 9.530   25.879  -33.858 1.00 30.49  ? 15   VAL L CA  1 
ATOM   3386 C  C   . VAL C 3 15  ? 9.649   26.018  -35.398 1.00 34.96  ? 15   VAL L C   1 
ATOM   3387 O  O   . VAL C 3 15  ? 10.418  26.862  -35.873 1.00 35.93  ? 15   VAL L O   1 
ATOM   3388 C  CB  . VAL C 3 15  ? 8.588   26.958  -33.223 1.00 31.44  ? 15   VAL L CB  1 
ATOM   3389 C  CG1 . VAL C 3 15  ? 7.230   26.973  -33.884 1.00 31.35  ? 15   VAL L CG1 1 
ATOM   3390 C  CG2 . VAL C 3 15  ? 8.422   26.754  -31.725 1.00 30.24  ? 15   VAL L CG2 1 
ATOM   3391 N  N   . GLY C 3 16  ? 8.971   25.146  -36.139 1.00 32.74  ? 16   GLY L N   1 
ATOM   3392 C  CA  . GLY C 3 16  ? 8.965   25.174  -37.598 1.00 33.79  ? 16   GLY L CA  1 
ATOM   3393 C  C   . GLY C 3 16  ? 9.977   24.272  -38.269 1.00 36.95  ? 16   GLY L C   1 
ATOM   3394 O  O   . GLY C 3 16  ? 9.852   23.972  -39.465 1.00 37.68  ? 16   GLY L O   1 
ATOM   3395 N  N   . ASP C 3 17  ? 10.975  23.818  -37.504 1.00 32.57  ? 17   ASP L N   1 
ATOM   3396 C  CA  . ASP C 3 17  ? 12.011  22.948  -38.029 1.00 32.09  ? 17   ASP L CA  1 
ATOM   3397 C  C   . ASP C 3 17  ? 11.461  21.553  -38.411 1.00 33.87  ? 17   ASP L C   1 
ATOM   3398 O  O   . ASP C 3 17  ? 10.539  21.054  -37.767 1.00 31.91  ? 17   ASP L O   1 
ATOM   3399 C  CB  . ASP C 3 17  ? 13.130  22.759  -36.966 1.00 33.28  ? 17   ASP L CB  1 
ATOM   3400 C  CG  . ASP C 3 17  ? 14.136  23.874  -36.761 1.00 46.54  ? 17   ASP L CG  1 
ATOM   3401 O  OD1 . ASP C 3 17  ? 13.983  24.938  -37.390 1.00 52.46  ? 17   ASP L OD1 1 
ATOM   3402 O  OD2 . ASP C 3 17  ? 15.069  23.687  -35.956 1.00 48.40  ? 17   ASP L OD2 1 
ATOM   3403 N  N   . ARG C 3 18  ? 12.093  20.902  -39.415 1.00 32.17  ? 18   ARG L N   1 
ATOM   3404 C  CA  . ARG C 3 18  ? 11.880  19.491  -39.752 1.00 30.71  ? 18   ARG L CA  1 
ATOM   3405 C  C   . ARG C 3 18  ? 12.839  18.734  -38.846 1.00 32.19  ? 18   ARG L C   1 
ATOM   3406 O  O   . ARG C 3 18  ? 14.025  19.061  -38.789 1.00 32.10  ? 18   ARG L O   1 
ATOM   3407 C  CB  . ARG C 3 18  ? 12.188  19.161  -41.222 1.00 31.47  ? 18   ARG L CB  1 
ATOM   3408 C  CG  . ARG C 3 18  ? 12.080  17.650  -41.524 1.00 40.27  ? 18   ARG L CG  1 
ATOM   3409 C  CD  . ARG C 3 18  ? 12.550  17.211  -42.906 1.00 62.68  ? 18   ARG L CD  1 
ATOM   3410 N  NE  . ARG C 3 18  ? 11.696  17.728  -43.985 1.00 93.16  ? 18   ARG L NE  1 
ATOM   3411 C  CZ  . ARG C 3 18  ? 10.573  17.152  -44.414 1.00 117.77 ? 18   ARG L CZ  1 
ATOM   3412 N  NH1 . ARG C 3 18  ? 10.154  16.011  -43.876 1.00 108.96 ? 18   ARG L NH1 1 
ATOM   3413 N  NH2 . ARG C 3 18  ? 9.861   17.713  -45.384 1.00 106.42 ? 18   ARG L NH2 1 
ATOM   3414 N  N   . VAL C 3 19  ? 12.316  17.782  -38.095 1.00 30.04  ? 19   VAL L N   1 
ATOM   3415 C  CA  . VAL C 3 19  ? 13.085  16.982  -37.147 1.00 30.55  ? 19   VAL L CA  1 
ATOM   3416 C  C   . VAL C 3 19  ? 13.014  15.516  -37.512 1.00 34.24  ? 19   VAL L C   1 
ATOM   3417 O  O   . VAL C 3 19  ? 11.919  15.041  -37.763 1.00 34.82  ? 19   VAL L O   1 
ATOM   3418 C  CB  . VAL C 3 19  ? 12.585  17.264  -35.702 1.00 33.09  ? 19   VAL L CB  1 
ATOM   3419 C  CG1 . VAL C 3 19  ? 12.985  16.152  -34.706 1.00 32.59  ? 19   VAL L CG1 1 
ATOM   3420 C  CG2 . VAL C 3 19  ? 13.044  18.650  -35.234 1.00 33.17  ? 19   VAL L CG2 1 
ATOM   3421 N  N   . THR C 3 20  ? 14.159  14.801  -37.510 1.00 31.64  ? 20   THR L N   1 
ATOM   3422 C  CA  . THR C 3 20  ? 14.249  13.363  -37.786 1.00 32.22  ? 20   THR L CA  1 
ATOM   3423 C  C   . THR C 3 20  ? 14.908  12.597  -36.615 1.00 40.27  ? 20   THR L C   1 
ATOM   3424 O  O   . THR C 3 20  ? 16.001  12.946  -36.171 1.00 43.06  ? 20   THR L O   1 
ATOM   3425 C  CB  . THR C 3 20  ? 14.921  13.122  -39.163 1.00 37.78  ? 20   THR L CB  1 
ATOM   3426 O  OG1 . THR C 3 20  ? 13.889  12.926  -40.132 1.00 37.80  ? 20   THR L OG1 1 
ATOM   3427 C  CG2 . THR C 3 20  ? 15.853  11.933  -39.192 1.00 32.17  ? 20   THR L CG2 1 
ATOM   3428 N  N   . ILE C 3 21  ? 14.246  11.552  -36.134 1.00 36.99  ? 21   ILE L N   1 
ATOM   3429 C  CA  . ILE C 3 21  ? 14.771  10.688  -35.072 1.00 38.74  ? 21   ILE L CA  1 
ATOM   3430 C  C   . ILE C 3 21  ? 14.892  9.282   -35.641 1.00 43.46  ? 21   ILE L C   1 
ATOM   3431 O  O   . ILE C 3 21  ? 13.934  8.771   -36.207 1.00 44.35  ? 21   ILE L O   1 
ATOM   3432 C  CB  . ILE C 3 21  ? 13.878  10.707  -33.799 1.00 42.49  ? 21   ILE L CB  1 
ATOM   3433 C  CG1 . ILE C 3 21  ? 13.822  12.104  -33.203 1.00 44.09  ? 21   ILE L CG1 1 
ATOM   3434 C  CG2 . ILE C 3 21  ? 14.375  9.676   -32.751 1.00 43.96  ? 21   ILE L CG2 1 
ATOM   3435 C  CD1 . ILE C 3 21  ? 12.648  12.311  -32.210 1.00 54.86  ? 21   ILE L CD1 1 
ATOM   3436 N  N   . THR C 3 22  ? 16.040  8.648   -35.480 1.00 39.68  ? 22   THR L N   1 
ATOM   3437 C  CA  . THR C 3 22  ? 16.220  7.310   -36.012 1.00 39.54  ? 22   THR L CA  1 
ATOM   3438 C  C   . THR C 3 22  ? 16.237  6.258   -34.888 1.00 45.03  ? 22   THR L C   1 
ATOM   3439 O  O   . THR C 3 22  ? 16.558  6.548   -33.738 1.00 45.63  ? 22   THR L O   1 
ATOM   3440 C  CB  . THR C 3 22  ? 17.431  7.241   -36.960 1.00 47.59  ? 22   THR L CB  1 
ATOM   3441 O  OG1 . THR C 3 22  ? 18.613  7.461   -36.203 1.00 53.89  ? 22   THR L OG1 1 
ATOM   3442 C  CG2 . THR C 3 22  ? 17.362  8.259   -38.097 1.00 42.40  ? 22   THR L CG2 1 
ATOM   3443 N  N   . CYS C 3 23  ? 15.861  5.047   -35.249 1.00 41.59  ? 23   CYS L N   1 
ATOM   3444 C  CA  . CYS C 3 23  ? 15.771  3.913   -34.362 1.00 42.55  ? 23   CYS L CA  1 
ATOM   3445 C  C   . CYS C 3 23  ? 16.375  2.720   -35.072 1.00 43.34  ? 23   CYS L C   1 
ATOM   3446 O  O   . CYS C 3 23  ? 15.961  2.388   -36.197 1.00 40.08  ? 23   CYS L O   1 
ATOM   3447 C  CB  . CYS C 3 23  ? 14.310  3.662   -33.986 1.00 43.56  ? 23   CYS L CB  1 
ATOM   3448 S  SG  . CYS C 3 23  ? 14.060  2.292   -32.826 1.00 48.82  ? 23   CYS L SG  1 
ATOM   3449 N  N   . ARG C 3 24  ? 17.351  2.070   -34.405 1.00 40.87  ? 24   ARG L N   1 
ATOM   3450 C  CA  . ARG C 3 24  ? 18.045  0.890   -34.914 1.00 41.00  ? 24   ARG L CA  1 
ATOM   3451 C  C   . ARG C 3 24  ? 17.712  -0.339  -34.055 1.00 45.76  ? 24   ARG L C   1 
ATOM   3452 O  O   . ARG C 3 24  ? 17.916  -0.316  -32.841 1.00 48.05  ? 24   ARG L O   1 
ATOM   3453 C  CB  . ARG C 3 24  ? 19.566  1.115   -34.980 1.00 40.81  ? 24   ARG L CB  1 
ATOM   3454 N  N   . ALA C 3 25  ? 17.173  -1.397  -34.683 1.00 38.76  ? 25   ALA L N   1 
ATOM   3455 C  CA  . ALA C 3 25  ? 16.873  -2.632  -33.997 1.00 38.23  ? 25   ALA L CA  1 
ATOM   3456 C  C   . ALA C 3 25  ? 18.062  -3.575  -34.206 1.00 45.18  ? 25   ALA L C   1 
ATOM   3457 O  O   . ALA C 3 25  ? 18.617  -3.606  -35.311 1.00 47.55  ? 25   ALA L O   1 
ATOM   3458 C  CB  . ALA C 3 25  ? 15.617  -3.240  -34.567 1.00 37.45  ? 25   ALA L CB  1 
ATOM   3459 N  N   . SER C 3 26  ? 18.463  -4.343  -33.153 1.00 39.45  ? 26   SER L N   1 
ATOM   3460 C  CA  . SER C 3 26  ? 19.592  -5.277  -33.188 1.00 37.94  ? 26   SER L CA  1 
ATOM   3461 C  C   . SER C 3 26  ? 19.427  -6.403  -34.217 1.00 41.35  ? 26   SER L C   1 
ATOM   3462 O  O   . SER C 3 26  ? 20.427  -6.976  -34.646 1.00 43.05  ? 26   SER L O   1 
ATOM   3463 C  CB  . SER C 3 26  ? 19.870  -5.820  -31.793 1.00 40.53  ? 26   SER L CB  1 
ATOM   3464 O  OG  . SER C 3 26  ? 18.705  -6.388  -31.221 1.00 44.98  ? 26   SER L OG  1 
ATOM   3465 N  N   . GLN C 3 27  ? 18.172  -6.706  -34.628 1.00 35.93  ? 27   GLN L N   1 
ATOM   3466 C  CA  . GLN C 3 27  ? 17.809  -7.718  -35.626 1.00 34.70  ? 27   GLN L CA  1 
ATOM   3467 C  C   . GLN C 3 27  ? 16.626  -7.161  -36.385 1.00 39.20  ? 27   GLN L C   1 
ATOM   3468 O  O   . GLN C 3 27  ? 15.976  -6.237  -35.887 1.00 37.66  ? 27   GLN L O   1 
ATOM   3469 C  CB  . GLN C 3 27  ? 17.378  -9.026  -34.935 1.00 36.92  ? 27   GLN L CB  1 
ATOM   3470 C  CG  . GLN C 3 27  ? 18.408  -9.633  -33.955 1.00 69.72  ? 27   GLN L CG  1 
ATOM   3471 C  CD  . GLN C 3 27  ? 17.819  -10.062 -32.625 1.00 70.57  ? 27   GLN L CD  1 
ATOM   3472 O  OE1 . GLN C 3 27  ? 16.809  -10.799 -32.601 1.00 54.23  ? 27   GLN L OE1 1 
ATOM   3473 N  NE2 . GLN C 3 27  ? 18.492  -9.650  -31.500 1.00 48.78  ? 27   GLN L NE2 1 
ATOM   3474 N  N   . GLY C 3 28  ? 16.327  -7.732  -37.555 1.00 37.31  ? 28   GLY L N   1 
ATOM   3475 C  CA  . GLY C 3 28  ? 15.179  -7.315  -38.359 1.00 36.71  ? 28   GLY L CA  1 
ATOM   3476 C  C   . GLY C 3 28  ? 13.852  -7.542  -37.645 1.00 40.88  ? 28   GLY L C   1 
ATOM   3477 O  O   . GLY C 3 28  ? 13.629  -8.622  -37.068 1.00 40.98  ? 28   GLY L O   1 
ATOM   3478 N  N   . ILE C 3 29  ? 12.986  -6.500  -37.643 1.00 35.52  ? 29   ILE L N   1 
ATOM   3479 C  CA  . ILE C 3 29  ? 11.673  -6.533  -37.001 1.00 34.70  ? 29   ILE L CA  1 
ATOM   3480 C  C   . ILE C 3 29  ? 10.559  -6.239  -37.997 1.00 36.34  ? 29   ILE L C   1 
ATOM   3481 O  O   . ILE C 3 29  ? 9.438   -5.949  -37.589 1.00 34.52  ? 29   ILE L O   1 
ATOM   3482 C  CB  . ILE C 3 29  ? 11.606  -5.634  -35.740 1.00 38.52  ? 29   ILE L CB  1 
ATOM   3483 C  CG1 . ILE C 3 29  ? 11.898  -4.159  -36.083 1.00 38.29  ? 29   ILE L CG1 1 
ATOM   3484 C  CG2 . ILE C 3 29  ? 12.515  -6.198  -34.618 1.00 41.35  ? 29   ILE L CG2 1 
ATOM   3485 C  CD1 . ILE C 3 29  ? 11.642  -3.137  -34.992 1.00 45.17  ? 29   ILE L CD1 1 
ATOM   3486 N  N   . ASN C 3 30  ? 10.865  -6.370  -39.304 1.00 33.54  ? 30   ASN L N   1 
ATOM   3487 C  CA  . ASN C 3 30  ? 9.964   -6.104  -40.444 1.00 32.29  ? 30   ASN L CA  1 
ATOM   3488 C  C   . ASN C 3 30  ? 9.402   -4.712  -40.267 1.00 35.94  ? 30   ASN L C   1 
ATOM   3489 O  O   . ASN C 3 30  ? 10.176  -3.761  -40.189 1.00 34.94  ? 30   ASN L O   1 
ATOM   3490 C  CB  . ASN C 3 30  ? 8.873   -7.196  -40.663 1.00 29.93  ? 30   ASN L CB  1 
ATOM   3491 C  CG  . ASN C 3 30  ? 9.381   -8.542  -41.163 1.00 36.99  ? 30   ASN L CG  1 
ATOM   3492 N  N   . ASN C 3 31  ? 8.094   -4.584  -40.107 1.00 34.38  ? 31   ASN L N   1 
ATOM   3493 C  CA  . ASN C 3 31  ? 7.503   -3.271  -39.905 1.00 34.44  ? 31   ASN L CA  1 
ATOM   3494 C  C   . ASN C 3 31  ? 6.816   -3.183  -38.517 1.00 41.17  ? 31   ASN L C   1 
ATOM   3495 O  O   . ASN C 3 31  ? 6.112   -2.223  -38.273 1.00 43.41  ? 31   ASN L O   1 
ATOM   3496 C  CB  . ASN C 3 31  ? 6.530   -2.936  -41.048 1.00 31.33  ? 31   ASN L CB  1 
ATOM   3497 C  CG  . ASN C 3 31  ? 7.179   -2.580  -42.364 1.00 34.46  ? 31   ASN L CG  1 
ATOM   3498 O  OD1 . ASN C 3 31  ? 7.550   -1.427  -42.618 1.00 31.66  ? 31   ASN L OD1 1 
ATOM   3499 N  ND2 . ASN C 3 31  ? 7.220   -3.532  -43.285 1.00 24.21  ? 31   ASN L ND2 1 
ATOM   3500 N  N   . TYR C 3 32  ? 7.083   -4.130  -37.591 1.00 36.81  ? 32   TYR L N   1 
ATOM   3501 C  CA  . TYR C 3 32  ? 6.536   -4.171  -36.216 1.00 36.75  ? 32   TYR L CA  1 
ATOM   3502 C  C   . TYR C 3 32  ? 7.207   -3.127  -35.257 1.00 37.95  ? 32   TYR L C   1 
ATOM   3503 O  O   . TYR C 3 32  ? 7.818   -3.487  -34.238 1.00 37.98  ? 32   TYR L O   1 
ATOM   3504 C  CB  . TYR C 3 32  ? 6.683   -5.581  -35.607 1.00 39.25  ? 32   TYR L CB  1 
ATOM   3505 C  CG  . TYR C 3 32  ? 6.127   -6.709  -36.435 1.00 41.43  ? 32   TYR L CG  1 
ATOM   3506 C  CD1 . TYR C 3 32  ? 6.866   -7.267  -37.472 1.00 44.24  ? 32   TYR L CD1 1 
ATOM   3507 C  CD2 . TYR C 3 32  ? 4.930   -7.323  -36.089 1.00 41.39  ? 32   TYR L CD2 1 
ATOM   3508 C  CE1 . TYR C 3 32  ? 6.375   -8.342  -38.212 1.00 46.87  ? 32   TYR L CE1 1 
ATOM   3509 C  CE2 . TYR C 3 32  ? 4.423   -8.384  -36.828 1.00 41.66  ? 32   TYR L CE2 1 
ATOM   3510 C  CZ  . TYR C 3 32  ? 5.155   -8.905  -37.878 1.00 51.36  ? 32   TYR L CZ  1 
ATOM   3511 O  OH  . TYR C 3 32  ? 4.652   -9.959  -38.605 1.00 52.09  ? 32   TYR L OH  1 
ATOM   3512 N  N   . LEU C 3 33  ? 7.069   -1.846  -35.569 1.00 32.01  ? 33   LEU L N   1 
ATOM   3513 C  CA  . LEU C 3 33  ? 7.680   -0.819  -34.737 1.00 32.26  ? 33   LEU L CA  1 
ATOM   3514 C  C   . LEU C 3 33  ? 6.705   0.317   -34.434 1.00 36.30  ? 33   LEU L C   1 
ATOM   3515 O  O   . LEU C 3 33  ? 6.061   0.836   -35.338 1.00 35.69  ? 33   LEU L O   1 
ATOM   3516 C  CB  . LEU C 3 33  ? 8.989   -0.262  -35.404 1.00 31.95  ? 33   LEU L CB  1 
ATOM   3517 C  CG  . LEU C 3 33  ? 9.850   0.794   -34.645 1.00 36.22  ? 33   LEU L CG  1 
ATOM   3518 C  CD1 . LEU C 3 33  ? 9.251   2.170   -34.589 1.00 37.26  ? 33   LEU L CD1 1 
ATOM   3519 C  CD2 . LEU C 3 33  ? 10.614  0.271   -33.482 1.00 35.93  ? 33   LEU L CD2 1 
ATOM   3520 N  N   . ASN C 3 34  ? 6.678   0.759   -33.179 1.00 32.79  ? 34   ASN L N   1 
ATOM   3521 C  CA  . ASN C 3 34  ? 5.871   1.879   -32.723 1.00 32.08  ? 34   ASN L CA  1 
ATOM   3522 C  C   . ASN C 3 34  ? 6.727   3.022   -32.225 1.00 36.01  ? 34   ASN L C   1 
ATOM   3523 O  O   . ASN C 3 34  ? 7.839   2.805   -31.751 1.00 35.11  ? 34   ASN L O   1 
ATOM   3524 C  CB  . ASN C 3 34  ? 4.951   1.464   -31.600 1.00 33.06  ? 34   ASN L CB  1 
ATOM   3525 C  CG  . ASN C 3 34  ? 4.253   0.188   -31.866 1.00 54.94  ? 34   ASN L CG  1 
ATOM   3526 O  OD1 . ASN C 3 34  ? 3.359   0.109   -32.721 1.00 48.57  ? 34   ASN L OD1 1 
ATOM   3527 N  ND2 . ASN C 3 34  ? 4.664   -0.829  -31.128 1.00 43.56  ? 34   ASN L ND2 1 
ATOM   3528 N  N   . TRP C 3 35  ? 6.173   4.245   -32.293 1.00 33.07  ? 35   TRP L N   1 
ATOM   3529 C  CA  . TRP C 3 35  ? 6.784   5.486   -31.807 1.00 33.60  ? 35   TRP L CA  1 
ATOM   3530 C  C   . TRP C 3 35  ? 5.867   6.116   -30.763 1.00 42.43  ? 35   TRP L C   1 
ATOM   3531 O  O   . TRP C 3 35  ? 4.657   6.183   -30.976 1.00 44.49  ? 35   TRP L O   1 
ATOM   3532 C  CB  . TRP C 3 35  ? 7.024   6.474   -32.951 1.00 30.81  ? 35   TRP L CB  1 
ATOM   3533 C  CG  . TRP C 3 35  ? 8.144   6.097   -33.868 1.00 30.80  ? 35   TRP L CG  1 
ATOM   3534 C  CD1 . TRP C 3 35  ? 8.039   5.526   -35.097 1.00 32.62  ? 35   TRP L CD1 1 
ATOM   3535 C  CD2 . TRP C 3 35  ? 9.532   6.324   -33.650 1.00 31.26  ? 35   TRP L CD2 1 
ATOM   3536 N  NE1 . TRP C 3 35  ? 9.277   5.382   -35.658 1.00 31.44  ? 35   TRP L NE1 1 
ATOM   3537 C  CE2 . TRP C 3 35  ? 10.215  5.864   -34.792 1.00 34.32  ? 35   TRP L CE2 1 
ATOM   3538 C  CE3 . TRP C 3 35  ? 10.270  6.915   -32.613 1.00 34.19  ? 35   TRP L CE3 1 
ATOM   3539 C  CZ2 . TRP C 3 35  ? 11.605  5.988   -34.934 1.00 35.36  ? 35   TRP L CZ2 1 
ATOM   3540 C  CZ3 . TRP C 3 35  ? 11.649  7.046   -32.754 1.00 36.92  ? 35   TRP L CZ3 1 
ATOM   3541 C  CH2 . TRP C 3 35  ? 12.303  6.592   -33.903 1.00 37.32  ? 35   TRP L CH2 1 
ATOM   3542 N  N   . TYR C 3 36  ? 6.438   6.552   -29.630 1.00 39.81  ? 36   TYR L N   1 
ATOM   3543 C  CA  . TYR C 3 36  ? 5.729   7.192   -28.517 1.00 39.56  ? 36   TYR L CA  1 
ATOM   3544 C  C   . TYR C 3 36  ? 6.326   8.554   -28.206 1.00 42.09  ? 36   TYR L C   1 
ATOM   3545 O  O   . TYR C 3 36  ? 7.523   8.758   -28.368 1.00 43.12  ? 36   TYR L O   1 
ATOM   3546 C  CB  . TYR C 3 36  ? 5.809   6.333   -27.234 1.00 40.78  ? 36   TYR L CB  1 
ATOM   3547 C  CG  . TYR C 3 36  ? 5.203   4.960   -27.393 1.00 41.28  ? 36   TYR L CG  1 
ATOM   3548 C  CD1 . TYR C 3 36  ? 3.858   4.743   -27.152 1.00 43.05  ? 36   TYR L CD1 1 
ATOM   3549 C  CD2 . TYR C 3 36  ? 5.973   3.880   -27.821 1.00 41.72  ? 36   TYR L CD2 1 
ATOM   3550 C  CE1 . TYR C 3 36  ? 3.291   3.481   -27.315 1.00 44.67  ? 36   TYR L CE1 1 
ATOM   3551 C  CE2 . TYR C 3 36  ? 5.411   2.624   -28.023 1.00 42.23  ? 36   TYR L CE2 1 
ATOM   3552 C  CZ  . TYR C 3 36  ? 4.067   2.427   -27.764 1.00 49.18  ? 36   TYR L CZ  1 
ATOM   3553 O  OH  . TYR C 3 36  ? 3.494   1.190   -27.932 1.00 48.11  ? 36   TYR L OH  1 
ATOM   3554 N  N   . GLN C 3 37  ? 5.500   9.461   -27.709 1.00 35.16  ? 37   GLN L N   1 
ATOM   3555 C  CA  . GLN C 3 37  ? 5.915   10.759  -27.214 1.00 33.63  ? 37   GLN L CA  1 
ATOM   3556 C  C   . GLN C 3 37  ? 5.655   10.762  -25.705 1.00 37.23  ? 37   GLN L C   1 
ATOM   3557 O  O   . GLN C 3 37  ? 4.625   10.274  -25.247 1.00 36.76  ? 37   GLN L O   1 
ATOM   3558 C  CB  . GLN C 3 37  ? 5.103   11.873  -27.890 1.00 34.42  ? 37   GLN L CB  1 
ATOM   3559 C  CG  . GLN C 3 37  ? 5.446   13.279  -27.392 1.00 44.50  ? 37   GLN L CG  1 
ATOM   3560 C  CD  . GLN C 3 37  ? 4.431   14.289  -27.802 1.00 52.17  ? 37   GLN L CD  1 
ATOM   3561 O  OE1 . GLN C 3 37  ? 3.299   14.285  -27.309 1.00 40.49  ? 37   GLN L OE1 1 
ATOM   3562 N  NE2 . GLN C 3 37  ? 4.825   15.185  -28.690 1.00 49.79  ? 37   GLN L NE2 1 
ATOM   3563 N  N   . GLN C 3 38  ? 6.550   11.347  -24.941 1.00 35.29  ? 38   GLN L N   1 
ATOM   3564 C  CA  . GLN C 3 38  ? 6.362   11.472  -23.508 1.00 36.59  ? 38   GLN L CA  1 
ATOM   3565 C  C   . GLN C 3 38  ? 6.900   12.803  -22.984 1.00 42.10  ? 38   GLN L C   1 
ATOM   3566 O  O   . GLN C 3 38  ? 8.050   13.179  -23.238 1.00 41.85  ? 38   GLN L O   1 
ATOM   3567 C  CB  . GLN C 3 38  ? 6.971   10.281  -22.742 1.00 38.53  ? 38   GLN L CB  1 
ATOM   3568 C  CG  . GLN C 3 38  ? 6.659   10.336  -21.246 1.00 47.92  ? 38   GLN L CG  1 
ATOM   3569 C  CD  . GLN C 3 38  ? 7.285   9.249   -20.424 1.00 48.15  ? 38   GLN L CD  1 
ATOM   3570 O  OE1 . GLN C 3 38  ? 8.416   8.796   -20.672 1.00 35.83  ? 38   GLN L OE1 1 
ATOM   3571 N  NE2 . GLN C 3 38  ? 6.573   8.853   -19.392 1.00 37.79  ? 38   GLN L NE2 1 
ATOM   3572 N  N   . LYS C 3 39  ? 6.071   13.480  -22.203 1.00 39.72  ? 39   LYS L N   1 
ATOM   3573 C  CA  . LYS C 3 39  ? 6.413   14.725  -21.532 1.00 40.47  ? 39   LYS L CA  1 
ATOM   3574 C  C   . LYS C 3 39  ? 6.665   14.444  -20.046 1.00 48.45  ? 39   LYS L C   1 
ATOM   3575 O  O   . LYS C 3 39  ? 6.121   13.472  -19.505 1.00 47.53  ? 39   LYS L O   1 
ATOM   3576 C  CB  . LYS C 3 39  ? 5.308   15.767  -21.740 1.00 41.14  ? 39   LYS L CB  1 
ATOM   3577 C  CG  . LYS C 3 39  ? 5.198   16.143  -23.201 1.00 30.70  ? 39   LYS L CG  1 
ATOM   3578 C  CD  . LYS C 3 39  ? 4.318   17.325  -23.420 1.00 30.24  ? 39   LYS L CD  1 
ATOM   3579 C  CE  . LYS C 3 39  ? 4.011   17.372  -24.883 1.00 34.10  ? 39   LYS L CE  1 
ATOM   3580 N  NZ  . LYS C 3 39  ? 2.912   18.331  -25.211 1.00 48.24  ? 39   LYS L NZ  1 
ATOM   3581 N  N   . PRO C 3 40  ? 7.501   15.250  -19.369 1.00 49.06  ? 40   PRO L N   1 
ATOM   3582 C  CA  . PRO C 3 40  ? 7.766   14.992  -17.942 1.00 50.93  ? 40   PRO L CA  1 
ATOM   3583 C  C   . PRO C 3 40  ? 6.502   14.930  -17.070 1.00 53.51  ? 40   PRO L C   1 
ATOM   3584 O  O   . PRO C 3 40  ? 5.580   15.754  -17.231 1.00 51.35  ? 40   PRO L O   1 
ATOM   3585 C  CB  . PRO C 3 40  ? 8.704   16.140  -17.528 1.00 53.81  ? 40   PRO L CB  1 
ATOM   3586 C  CG  . PRO C 3 40  ? 8.544   17.182  -18.573 1.00 57.87  ? 40   PRO L CG  1 
ATOM   3587 C  CD  . PRO C 3 40  ? 8.235   16.435  -19.846 1.00 51.80  ? 40   PRO L CD  1 
ATOM   3588 N  N   . GLY C 3 41  ? 6.460   13.905  -16.208 1.00 49.59  ? 41   GLY L N   1 
ATOM   3589 C  CA  . GLY C 3 41  ? 5.351   13.678  -15.295 1.00 49.46  ? 41   GLY L CA  1 
ATOM   3590 C  C   . GLY C 3 41  ? 4.082   13.205  -15.973 1.00 52.14  ? 41   GLY L C   1 
ATOM   3591 O  O   . GLY C 3 41  ? 3.027   13.150  -15.334 1.00 53.08  ? 41   GLY L O   1 
ATOM   3592 N  N   . LYS C 3 42  ? 4.171   12.841  -17.268 1.00 45.84  ? 42   LYS L N   1 
ATOM   3593 C  CA  . LYS C 3 42  ? 3.042   12.335  -18.040 1.00 43.85  ? 42   LYS L CA  1 
ATOM   3594 C  C   . LYS C 3 42  ? 3.325   10.964  -18.622 1.00 46.72  ? 42   LYS L C   1 
ATOM   3595 O  O   . LYS C 3 42  ? 4.483   10.588  -18.788 1.00 48.37  ? 42   LYS L O   1 
ATOM   3596 C  CB  . LYS C 3 42  ? 2.649   13.322  -19.141 1.00 44.97  ? 42   LYS L CB  1 
ATOM   3597 C  CG  . LYS C 3 42  ? 1.642   14.375  -18.681 1.00 63.06  ? 42   LYS L CG  1 
ATOM   3598 C  CD  . LYS C 3 42  ? 2.296   15.706  -18.337 1.00 80.59  ? 42   LYS L CD  1 
ATOM   3599 C  CE  . LYS C 3 42  ? 1.277   16.794  -18.079 1.00 88.40  ? 42   LYS L CE  1 
ATOM   3600 N  NZ  . LYS C 3 42  ? 0.962   17.545  -19.323 1.00 88.67  ? 42   LYS L NZ  1 
ATOM   3601 N  N   . ALA C 3 43  ? 2.273   10.212  -18.918 1.00 40.08  ? 43   ALA L N   1 
ATOM   3602 C  CA  . ALA C 3 43  ? 2.394   8.888   -19.509 1.00 38.06  ? 43   ALA L CA  1 
ATOM   3603 C  C   . ALA C 3 43  ? 2.793   8.992   -20.982 1.00 36.32  ? 43   ALA L C   1 
ATOM   3604 O  O   . ALA C 3 43  ? 2.432   9.995   -21.616 1.00 36.93  ? 43   ALA L O   1 
ATOM   3605 C  CB  . ALA C 3 43  ? 1.052   8.165   -19.413 1.00 38.99  ? 43   ALA L CB  1 
ATOM   3606 N  N   . PRO C 3 44  ? 3.460   7.965   -21.582 1.00 25.97  ? 44   PRO L N   1 
ATOM   3607 C  CA  . PRO C 3 44  ? 3.701   8.011   -23.039 1.00 23.08  ? 44   PRO L CA  1 
ATOM   3608 C  C   . PRO C 3 44  ? 2.376   8.059   -23.839 1.00 26.01  ? 44   PRO L C   1 
ATOM   3609 O  O   . PRO C 3 44  ? 1.288   7.708   -23.341 1.00 25.09  ? 44   PRO L O   1 
ATOM   3610 C  CB  . PRO C 3 44  ? 4.472   6.726   -23.319 1.00 23.53  ? 44   PRO L CB  1 
ATOM   3611 C  CG  . PRO C 3 44  ? 5.006   6.303   -21.975 1.00 28.80  ? 44   PRO L CG  1 
ATOM   3612 C  CD  . PRO C 3 44  ? 3.968   6.710   -20.997 1.00 25.88  ? 44   PRO L CD  1 
ATOM   3613 N  N   . LYS C 3 45  ? 2.484   8.532   -25.084 1.00 21.68  ? 45   LYS L N   1 
ATOM   3614 C  CA  . LYS C 3 45  ? 1.405   8.682   -26.032 1.00 20.21  ? 45   LYS L CA  1 
ATOM   3615 C  C   . LYS C 3 45  ? 1.797   8.015   -27.344 1.00 22.97  ? 45   LYS L C   1 
ATOM   3616 O  O   . LYS C 3 45  ? 2.820   8.385   -27.926 1.00 19.78  ? 45   LYS L O   1 
ATOM   3617 C  CB  . LYS C 3 45  ? 1.193   10.167  -26.262 1.00 22.56  ? 45   LYS L CB  1 
ATOM   3618 C  CG  . LYS C 3 45  ? 0.032   10.506  -27.216 1.00 45.85  ? 45   LYS L CG  1 
ATOM   3619 C  CD  . LYS C 3 45  ? -0.122  11.992  -27.479 1.00 42.77  ? 45   LYS L CD  1 
ATOM   3620 C  CE  . LYS C 3 45  ? -1.224  12.220  -28.465 1.00 68.47  ? 45   LYS L CE  1 
ATOM   3621 N  NZ  . LYS C 3 45  ? -2.578  12.103  -27.850 1.00 87.70  ? 45   LYS L NZ  1 
ATOM   3622 N  N   . LEU C 3 46  ? 0.960   7.062   -27.843 1.00 24.42  ? 46   LEU L N   1 
ATOM   3623 C  CA  . LEU C 3 46  ? 1.255   6.373   -29.117 1.00 25.16  ? 46   LEU L CA  1 
ATOM   3624 C  C   . LEU C 3 46  ? 1.088   7.323   -30.286 1.00 31.69  ? 46   LEU L C   1 
ATOM   3625 O  O   . LEU C 3 46  ? 0.024   7.941   -30.400 1.00 34.30  ? 46   LEU L O   1 
ATOM   3626 C  CB  . LEU C 3 46  ? 0.398   5.101   -29.332 1.00 24.97  ? 46   LEU L CB  1 
ATOM   3627 C  CG  . LEU C 3 46  ? 0.607   4.350   -30.683 1.00 29.39  ? 46   LEU L CG  1 
ATOM   3628 C  CD1 . LEU C 3 46  ? 1.931   3.642   -30.725 1.00 30.34  ? 46   LEU L CD1 1 
ATOM   3629 C  CD2 . LEU C 3 46  ? -0.497  3.340   -30.963 1.00 29.30  ? 46   LEU L CD2 1 
ATOM   3630 N  N   . LEU C 3 47  ? 2.114   7.440   -31.142 1.00 26.55  ? 47   LEU L N   1 
ATOM   3631 C  CA  . LEU C 3 47  ? 2.061   8.318   -32.309 1.00 26.76  ? 47   LEU L CA  1 
ATOM   3632 C  C   . LEU C 3 47  ? 1.896   7.493   -33.568 1.00 32.40  ? 47   LEU L C   1 
ATOM   3633 O  O   . LEU C 3 47  ? 1.044   7.774   -34.405 1.00 31.41  ? 47   LEU L O   1 
ATOM   3634 C  CB  . LEU C 3 47  ? 3.352   9.167   -32.443 1.00 27.25  ? 47   LEU L CB  1 
ATOM   3635 C  CG  . LEU C 3 47  ? 3.798   10.027  -31.251 1.00 35.26  ? 47   LEU L CG  1 
ATOM   3636 C  CD1 . LEU C 3 47  ? 5.238   10.451  -31.382 1.00 36.19  ? 47   LEU L CD1 1 
ATOM   3637 C  CD2 . LEU C 3 47  ? 2.896   11.257  -31.051 1.00 40.44  ? 47   LEU L CD2 1 
ATOM   3638 N  N   . ILE C 3 48  ? 2.759   6.502   -33.728 1.00 30.81  ? 48   ILE L N   1 
ATOM   3639 C  CA  . ILE C 3 48  ? 2.862   5.690   -34.932 1.00 30.13  ? 48   ILE L CA  1 
ATOM   3640 C  C   . ILE C 3 48  ? 2.914   4.251   -34.530 1.00 33.64  ? 48   ILE L C   1 
ATOM   3641 O  O   . ILE C 3 48  ? 3.649   3.931   -33.612 1.00 32.02  ? 48   ILE L O   1 
ATOM   3642 C  CB  . ILE C 3 48  ? 4.149   6.095   -35.747 1.00 33.48  ? 48   ILE L CB  1 
ATOM   3643 C  CG1 . ILE C 3 48  ? 4.004   7.466   -36.447 1.00 34.03  ? 48   ILE L CG1 1 
ATOM   3644 C  CG2 . ILE C 3 48  ? 4.568   4.996   -36.740 1.00 34.48  ? 48   ILE L CG2 1 
ATOM   3645 C  CD1 . ILE C 3 48  ? 3.697   7.456   -37.884 1.00 44.35  ? 48   ILE L CD1 1 
ATOM   3646 N  N   . TYR C 3 49  ? 2.169   3.380   -35.231 1.00 33.11  ? 49   TYR L N   1 
ATOM   3647 C  CA  . TYR C 3 49  ? 2.175   1.932   -35.021 1.00 33.85  ? 49   TYR L CA  1 
ATOM   3648 C  C   . TYR C 3 49  ? 2.526   1.232   -36.346 1.00 38.58  ? 49   TYR L C   1 
ATOM   3649 O  O   . TYR C 3 49  ? 2.231   1.761   -37.429 1.00 37.36  ? 49   TYR L O   1 
ATOM   3650 C  CB  . TYR C 3 49  ? 0.844   1.423   -34.411 1.00 35.09  ? 49   TYR L CB  1 
ATOM   3651 C  CG  . TYR C 3 49  ? -0.357  1.541   -35.328 1.00 35.32  ? 49   TYR L CG  1 
ATOM   3652 C  CD1 . TYR C 3 49  ? -0.664  0.535   -36.238 1.00 36.48  ? 49   TYR L CD1 1 
ATOM   3653 C  CD2 . TYR C 3 49  ? -1.184  2.655   -35.288 1.00 35.72  ? 49   TYR L CD2 1 
ATOM   3654 C  CE1 . TYR C 3 49  ? -1.756  0.640   -37.096 1.00 36.43  ? 49   TYR L CE1 1 
ATOM   3655 C  CE2 . TYR C 3 49  ? -2.287  2.767   -36.136 1.00 36.49  ? 49   TYR L CE2 1 
ATOM   3656 C  CZ  . TYR C 3 49  ? -2.590  1.742   -37.019 1.00 42.93  ? 49   TYR L CZ  1 
ATOM   3657 O  OH  . TYR C 3 49  ? -3.635  1.880   -37.910 1.00 44.46  ? 49   TYR L OH  1 
ATOM   3658 N  N   . ASP C 3 50  ? 3.179   0.064   -36.270 1.00 35.75  ? 50   ASP L N   1 
ATOM   3659 C  CA  . ASP C 3 50  ? 3.555   -0.684  -37.482 1.00 35.27  ? 50   ASP L CA  1 
ATOM   3660 C  C   . ASP C 3 50  ? 4.403   0.169   -38.478 1.00 39.46  ? 50   ASP L C   1 
ATOM   3661 O  O   . ASP C 3 50  ? 4.109   0.200   -39.666 1.00 37.59  ? 50   ASP L O   1 
ATOM   3662 C  CB  . ASP C 3 50  ? 2.285   -1.298  -38.172 1.00 36.54  ? 50   ASP L CB  1 
ATOM   3663 C  CG  . ASP C 3 50  ? 2.455   -2.128  -39.458 1.00 37.66  ? 50   ASP L CG  1 
ATOM   3664 O  OD1 . ASP C 3 50  ? 3.312   -3.046  -39.466 1.00 36.32  ? 50   ASP L OD1 1 
ATOM   3665 O  OD2 . ASP C 3 50  ? 1.669   -1.903  -40.431 1.00 33.79  ? 50   ASP L OD2 1 
ATOM   3666 N  N   . ALA C 3 51  ? 5.433   0.867   -37.978 1.00 37.99  ? 51   ALA L N   1 
ATOM   3667 C  CA  . ALA C 3 51  ? 6.424   1.677   -38.708 1.00 38.56  ? 51   ALA L CA  1 
ATOM   3668 C  C   . ALA C 3 51  ? 5.930   2.968   -39.311 1.00 45.03  ? 51   ALA L C   1 
ATOM   3669 O  O   . ALA C 3 51  ? 6.653   3.955   -39.219 1.00 47.11  ? 51   ALA L O   1 
ATOM   3670 C  CB  . ALA C 3 51  ? 7.131   0.860   -39.799 1.00 38.52  ? 51   ALA L CB  1 
ATOM   3671 N  N   . SER C 3 52  ? 4.773   2.969   -39.984 1.00 40.47  ? 52   SER L N   1 
ATOM   3672 C  CA  . SER C 3 52  ? 4.305   4.131   -40.739 1.00 39.55  ? 52   SER L CA  1 
ATOM   3673 C  C   . SER C 3 52  ? 2.835   4.521   -40.539 1.00 46.98  ? 52   SER L C   1 
ATOM   3674 O  O   . SER C 3 52  ? 2.384   5.500   -41.159 1.00 48.13  ? 52   SER L O   1 
ATOM   3675 C  CB  . SER C 3 52  ? 4.579   3.903   -42.224 1.00 38.90  ? 52   SER L CB  1 
ATOM   3676 O  OG  . SER C 3 52  ? 3.867   2.788   -42.739 1.00 40.13  ? 52   SER L OG  1 
ATOM   3677 N  N   . LYS C 3 53  ? 2.084   3.781   -39.698 1.00 43.03  ? 53   LYS L N   1 
ATOM   3678 C  CA  . LYS C 3 53  ? 0.676   4.092   -39.515 1.00 42.52  ? 53   LYS L CA  1 
ATOM   3679 C  C   . LYS C 3 53  ? 0.462   5.098   -38.414 1.00 48.23  ? 53   LYS L C   1 
ATOM   3680 O  O   . LYS C 3 53  ? 0.839   4.876   -37.269 1.00 48.81  ? 53   LYS L O   1 
ATOM   3681 C  CB  . LYS C 3 53  ? -0.165  2.831   -39.316 1.00 43.91  ? 53   LYS L CB  1 
ATOM   3682 C  CG  . LYS C 3 53  ? 0.225   1.573   -40.159 1.00 33.08  ? 53   LYS L CG  1 
ATOM   3683 C  CD  . LYS C 3 53  ? 0.334   1.768   -41.687 1.00 24.90  ? 53   LYS L CD  1 
ATOM   3684 C  CE  . LYS C 3 53  ? 0.474   0.463   -42.429 1.00 26.50  ? 53   LYS L CE  1 
ATOM   3685 N  NZ  . LYS C 3 53  ? -0.205  0.456   -43.765 1.00 27.26  ? 53   LYS L NZ  1 
ATOM   3686 N  N   . LEU C 3 54  ? -0.149  6.208   -38.764 1.00 45.71  ? 54   LEU L N   1 
ATOM   3687 C  CA  . LEU C 3 54  ? -0.415  7.289   -37.831 1.00 45.90  ? 54   LEU L CA  1 
ATOM   3688 C  C   . LEU C 3 54  ? -1.624  6.913   -36.944 1.00 50.18  ? 54   LEU L C   1 
ATOM   3689 O  O   . LEU C 3 54  ? -2.675  6.512   -37.457 1.00 49.43  ? 54   LEU L O   1 
ATOM   3690 C  CB  . LEU C 3 54  ? -0.659  8.578   -38.645 1.00 46.11  ? 54   LEU L CB  1 
ATOM   3691 C  CG  . LEU C 3 54  ? -0.879  9.874   -37.894 1.00 52.06  ? 54   LEU L CG  1 
ATOM   3692 C  CD1 . LEU C 3 54  ? 0.397   10.340  -37.197 1.00 52.03  ? 54   LEU L CD1 1 
ATOM   3693 C  CD2 . LEU C 3 54  ? -1.425  10.973  -38.842 1.00 57.06  ? 54   LEU L CD2 1 
ATOM   3694 N  N   . GLN C 3 55  ? -1.458  7.000   -35.610 1.00 46.25  ? 55   GLN L N   1 
ATOM   3695 C  CA  . GLN C 3 55  ? -2.547  6.691   -34.683 1.00 45.65  ? 55   GLN L CA  1 
ATOM   3696 C  C   . GLN C 3 55  ? -3.589  7.779   -34.786 1.00 51.33  ? 55   GLN L C   1 
ATOM   3697 O  O   . GLN C 3 55  ? -3.228  8.938   -34.998 1.00 51.30  ? 55   GLN L O   1 
ATOM   3698 C  CB  . GLN C 3 55  ? -2.023  6.543   -33.244 1.00 46.77  ? 55   GLN L CB  1 
ATOM   3699 C  CG  . GLN C 3 55  ? -3.082  6.328   -32.134 1.00 55.87  ? 55   GLN L CG  1 
ATOM   3700 C  CD  . GLN C 3 55  ? -3.780  4.980   -31.997 1.00 83.95  ? 55   GLN L CD  1 
ATOM   3701 O  OE1 . GLN C 3 55  ? -4.360  4.697   -30.945 1.00 78.75  ? 55   GLN L OE1 1 
ATOM   3702 N  NE2 . GLN C 3 55  ? -3.798  4.129   -33.026 1.00 83.39  ? 55   GLN L NE2 1 
ATOM   3703 N  N   . SER C 3 56  ? -4.884  7.412   -34.693 1.00 49.61  ? 56   SER L N   1 
ATOM   3704 C  CA  . SER C 3 56  ? -5.975  8.400   -34.786 1.00 50.47  ? 56   SER L CA  1 
ATOM   3705 C  C   . SER C 3 56  ? -5.863  9.422   -33.664 1.00 51.91  ? 56   SER L C   1 
ATOM   3706 O  O   . SER C 3 56  ? -5.554  9.047   -32.536 1.00 50.94  ? 56   SER L O   1 
ATOM   3707 C  CB  . SER C 3 56  ? -7.348  7.727   -34.801 1.00 56.02  ? 56   SER L CB  1 
ATOM   3708 O  OG  . SER C 3 56  ? -7.659  7.074   -33.581 1.00 67.79  ? 56   SER L OG  1 
ATOM   3709 N  N   . GLY C 3 57  ? -6.023  10.694  -34.006 1.00 47.25  ? 57   GLY L N   1 
ATOM   3710 C  CA  . GLY C 3 57  ? -5.901  11.777  -33.038 1.00 46.87  ? 57   GLY L CA  1 
ATOM   3711 C  C   . GLY C 3 57  ? -4.494  12.330  -32.948 1.00 47.97  ? 57   GLY L C   1 
ATOM   3712 O  O   . GLY C 3 57  ? -4.227  13.249  -32.167 1.00 50.66  ? 57   GLY L O   1 
ATOM   3713 N  N   . VAL C 3 58  ? -3.570  11.772  -33.732 1.00 38.61  ? 58   VAL L N   1 
ATOM   3714 C  CA  . VAL C 3 58  ? -2.186  12.261  -33.762 1.00 35.04  ? 58   VAL L CA  1 
ATOM   3715 C  C   . VAL C 3 58  ? -2.055  13.193  -34.980 1.00 33.82  ? 58   VAL L C   1 
ATOM   3716 O  O   . VAL C 3 58  ? -2.475  12.803  -36.077 1.00 33.04  ? 58   VAL L O   1 
ATOM   3717 C  CB  . VAL C 3 58  ? -1.124  11.119  -33.764 1.00 37.05  ? 58   VAL L CB  1 
ATOM   3718 C  CG1 . VAL C 3 58  ? 0.294   11.672  -33.848 1.00 36.15  ? 58   VAL L CG1 1 
ATOM   3719 C  CG2 . VAL C 3 58  ? -1.275  10.223  -32.536 1.00 36.84  ? 58   VAL L CG2 1 
ATOM   3720 N  N   . PRO C 3 59  ? -1.506  14.424  -34.812 1.00 27.41  ? 59   PRO L N   1 
ATOM   3721 C  CA  . PRO C 3 59  ? -1.360  15.341  -35.961 1.00 26.99  ? 59   PRO L CA  1 
ATOM   3722 C  C   . PRO C 3 59  ? -0.556  14.760  -37.133 1.00 30.62  ? 59   PRO L C   1 
ATOM   3723 O  O   . PRO C 3 59  ? 0.442   14.083  -36.918 1.00 32.21  ? 59   PRO L O   1 
ATOM   3724 C  CB  . PRO C 3 59  ? -0.671  16.576  -35.353 1.00 28.63  ? 59   PRO L CB  1 
ATOM   3725 C  CG  . PRO C 3 59  ? -0.884  16.486  -33.907 1.00 33.51  ? 59   PRO L CG  1 
ATOM   3726 C  CD  . PRO C 3 59  ? -0.998  15.035  -33.567 1.00 28.93  ? 59   PRO L CD  1 
ATOM   3727 N  N   . SER C 3 60  ? -0.974  15.040  -38.366 1.00 27.44  ? 60   SER L N   1 
ATOM   3728 C  CA  . SER C 3 60  ? -0.348  14.554  -39.602 1.00 27.42  ? 60   SER L CA  1 
ATOM   3729 C  C   . SER C 3 60  ? 1.115   14.959  -39.822 1.00 33.15  ? 60   SER L C   1 
ATOM   3730 O  O   . SER C 3 60  ? 1.774   14.393  -40.695 1.00 32.84  ? 60   SER L O   1 
ATOM   3731 C  CB  . SER C 3 60  ? -1.181  14.977  -40.802 1.00 32.29  ? 60   SER L CB  1 
ATOM   3732 O  OG  . SER C 3 60  ? -1.352  16.387  -40.848 1.00 43.83  ? 60   SER L OG  1 
ATOM   3733 N  N   . ARG C 3 61  ? 1.632   15.906  -39.023 1.00 32.27  ? 61   ARG L N   1 
ATOM   3734 C  CA  . ARG C 3 61  ? 3.020   16.376  -39.087 1.00 32.91  ? 61   ARG L CA  1 
ATOM   3735 C  C   . ARG C 3 61  ? 3.996   15.292  -38.631 1.00 38.40  ? 61   ARG L C   1 
ATOM   3736 O  O   . ARG C 3 61  ? 5.201   15.375  -38.898 1.00 39.53  ? 61   ARG L O   1 
ATOM   3737 C  CB  . ARG C 3 61  ? 3.209   17.691  -38.307 1.00 30.59  ? 61   ARG L CB  1 
ATOM   3738 C  CG  . ARG C 3 61  ? 3.070   17.536  -36.807 1.00 24.99  ? 61   ARG L CG  1 
ATOM   3739 C  CD  . ARG C 3 61  ? 3.528   18.776  -36.089 1.00 26.39  ? 61   ARG L CD  1 
ATOM   3740 N  NE  . ARG C 3 61  ? 2.394   19.328  -35.357 1.00 35.59  ? 61   ARG L NE  1 
ATOM   3741 C  CZ  . ARG C 3 61  ? 2.092   19.008  -34.110 1.00 40.53  ? 61   ARG L CZ  1 
ATOM   3742 N  NH1 . ARG C 3 61  ? 1.021   19.527  -33.528 1.00 31.74  ? 61   ARG L NH1 1 
ATOM   3743 N  NH2 . ARG C 3 61  ? 2.807   18.113  -33.460 1.00 23.64  ? 61   ARG L NH2 1 
ATOM   3744 N  N   . PHE C 3 62  ? 3.466   14.280  -37.949 1.00 34.40  ? 62   PHE L N   1 
ATOM   3745 C  CA  . PHE C 3 62  ? 4.226   13.132  -37.503 1.00 34.01  ? 62   PHE L CA  1 
ATOM   3746 C  C   . PHE C 3 62  ? 4.088   12.042  -38.550 1.00 41.95  ? 62   PHE L C   1 
ATOM   3747 O  O   . PHE C 3 62  ? 2.965   11.676  -38.951 1.00 41.69  ? 62   PHE L O   1 
ATOM   3748 C  CB  . PHE C 3 62  ? 3.695   12.603  -36.165 1.00 34.94  ? 62   PHE L CB  1 
ATOM   3749 C  CG  . PHE C 3 62  ? 3.956   13.503  -34.982 1.00 36.35  ? 62   PHE L CG  1 
ATOM   3750 C  CD1 . PHE C 3 62  ? 5.250   13.712  -34.515 1.00 39.66  ? 62   PHE L CD1 1 
ATOM   3751 C  CD2 . PHE C 3 62  ? 2.907   14.118  -34.314 1.00 37.79  ? 62   PHE L CD2 1 
ATOM   3752 C  CE1 . PHE C 3 62  ? 5.491   14.538  -33.420 1.00 41.39  ? 62   PHE L CE1 1 
ATOM   3753 C  CE2 . PHE C 3 62  ? 3.144   14.912  -33.194 1.00 41.51  ? 62   PHE L CE2 1 
ATOM   3754 C  CZ  . PHE C 3 62  ? 4.443   15.161  -32.784 1.00 40.81  ? 62   PHE L CZ  1 
ATOM   3755 N  N   . SER C 3 63  ? 5.239   11.526  -39.000 1.00 39.97  ? 63   SER L N   1 
ATOM   3756 C  CA  . SER C 3 63  ? 5.272   10.428  -39.966 1.00 39.32  ? 63   SER L CA  1 
ATOM   3757 C  C   . SER C 3 63  ? 6.411   9.490   -39.650 1.00 41.31  ? 63   SER L C   1 
ATOM   3758 O  O   . SER C 3 63  ? 7.480   9.909   -39.186 1.00 41.78  ? 63   SER L O   1 
ATOM   3759 C  CB  . SER C 3 63  ? 5.356   10.943  -41.405 1.00 43.89  ? 63   SER L CB  1 
ATOM   3760 O  OG  . SER C 3 63  ? 6.602   11.540  -41.726 1.00 49.57  ? 63   SER L OG  1 
ATOM   3761 N  N   . GLY C 3 64  ? 6.163   8.219   -39.865 1.00 35.10  ? 64   GLY L N   1 
ATOM   3762 C  CA  . GLY C 3 64  ? 7.156   7.193   -39.622 1.00 34.32  ? 64   GLY L CA  1 
ATOM   3763 C  C   . GLY C 3 64  ? 7.522   6.471   -40.893 1.00 37.22  ? 64   GLY L C   1 
ATOM   3764 O  O   . GLY C 3 64  ? 6.697   6.349   -41.798 1.00 37.26  ? 64   GLY L O   1 
ATOM   3765 N  N   . SER C 3 65  ? 8.752   5.999   -40.978 1.00 33.58  ? 65   SER L N   1 
ATOM   3766 C  CA  . SER C 3 65  ? 9.199   5.237   -42.129 1.00 33.82  ? 65   SER L CA  1 
ATOM   3767 C  C   . SER C 3 65  ? 10.264  4.243   -41.677 1.00 43.45  ? 65   SER L C   1 
ATOM   3768 O  O   . SER C 3 65  ? 10.690  4.270   -40.506 1.00 42.87  ? 65   SER L O   1 
ATOM   3769 C  CB  . SER C 3 65  ? 9.687   6.151   -43.255 1.00 35.79  ? 65   SER L CB  1 
ATOM   3770 O  OG  . SER C 3 65  ? 10.861  6.867   -42.904 1.00 40.02  ? 65   SER L OG  1 
ATOM   3771 N  N   . GLY C 3 66  ? 10.649  3.354   -42.595 1.00 43.92  ? 66   GLY L N   1 
ATOM   3772 C  CA  . GLY C 3 66  ? 11.652  2.332   -42.335 1.00 45.10  ? 66   GLY L CA  1 
ATOM   3773 C  C   . GLY C 3 66  ? 11.080  0.940   -42.277 1.00 51.08  ? 66   GLY L C   1 
ATOM   3774 O  O   . GLY C 3 66  ? 9.866   0.752   -42.180 1.00 52.61  ? 66   GLY L O   1 
ATOM   3775 N  N   . SER C 3 67  ? 11.956  -0.032  -42.357 1.00 48.39  ? 67   SER L N   1 
ATOM   3776 C  CA  . SER C 3 67  ? 11.623  -1.450  -42.333 1.00 48.41  ? 67   SER L CA  1 
ATOM   3777 C  C   . SER C 3 67  ? 12.891  -2.217  -42.015 1.00 53.21  ? 67   SER L C   1 
ATOM   3778 O  O   . SER C 3 67  ? 14.006  -1.724  -42.246 1.00 54.41  ? 67   SER L O   1 
ATOM   3779 C  CB  . SER C 3 67  ? 11.091  -1.897  -43.686 1.00 52.44  ? 67   SER L CB  1 
ATOM   3780 O  OG  . SER C 3 67  ? 10.389  -3.118  -43.541 1.00 66.78  ? 67   SER L OG  1 
ATOM   3781 N  N   . GLY C 3 68  ? 12.718  -3.402  -41.468 1.00 48.12  ? 68   GLY L N   1 
ATOM   3782 C  CA  . GLY C 3 68  ? 13.846  -4.230  -41.111 1.00 48.37  ? 68   GLY L CA  1 
ATOM   3783 C  C   . GLY C 3 68  ? 14.467  -3.786  -39.814 1.00 50.37  ? 68   GLY L C   1 
ATOM   3784 O  O   . GLY C 3 68  ? 13.912  -4.058  -38.755 1.00 49.59  ? 68   GLY L O   1 
ATOM   3785 N  N   . THR C 3 69  ? 15.615  -3.108  -39.895 1.00 46.45  ? 69   THR L N   1 
ATOM   3786 C  CA  . THR C 3 69  ? 16.367  -2.675  -38.717 1.00 47.05  ? 69   THR L CA  1 
ATOM   3787 C  C   . THR C 3 69  ? 16.453  -1.158  -38.544 1.00 48.00  ? 69   THR L C   1 
ATOM   3788 O  O   . THR C 3 69  ? 16.834  -0.707  -37.464 1.00 49.04  ? 69   THR L O   1 
ATOM   3789 C  CB  . THR C 3 69  ? 17.796  -3.226  -38.774 1.00 56.86  ? 69   THR L CB  1 
ATOM   3790 O  OG1 . THR C 3 69  ? 18.443  -2.677  -39.936 1.00 58.63  ? 69   THR L OG1 1 
ATOM   3791 C  CG2 . THR C 3 69  ? 17.848  -4.750  -38.758 1.00 52.31  ? 69   THR L CG2 1 
ATOM   3792 N  N   . ASP C 3 70  ? 16.184  -0.373  -39.598 1.00 40.28  ? 70   ASP L N   1 
ATOM   3793 C  CA  . ASP C 3 70  ? 16.317  1.084   -39.513 1.00 38.69  ? 70   ASP L CA  1 
ATOM   3794 C  C   . ASP C 3 70  ? 15.011  1.814   -39.690 1.00 39.46  ? 70   ASP L C   1 
ATOM   3795 O  O   . ASP C 3 70  ? 14.325  1.650   -40.703 1.00 38.26  ? 70   ASP L O   1 
ATOM   3796 C  CB  . ASP C 3 70  ? 17.378  1.592   -40.503 1.00 40.82  ? 70   ASP L CB  1 
ATOM   3797 C  CG  . ASP C 3 70  ? 18.793  1.064   -40.283 1.00 53.95  ? 70   ASP L CG  1 
ATOM   3798 O  OD1 . ASP C 3 70  ? 19.136  0.721   -39.123 1.00 55.30  ? 70   ASP L OD1 1 
ATOM   3799 O  OD2 . ASP C 3 70  ? 19.569  1.030   -41.259 1.00 61.29  ? 70   ASP L OD2 1 
ATOM   3800 N  N   . PHE C 3 71  ? 14.668  2.623   -38.699 1.00 35.46  ? 71   PHE L N   1 
ATOM   3801 C  CA  . PHE C 3 71  ? 13.401  3.338   -38.686 1.00 35.16  ? 71   PHE L CA  1 
ATOM   3802 C  C   . PHE C 3 71  ? 13.596  4.836   -38.479 1.00 39.15  ? 71   PHE L C   1 
ATOM   3803 O  O   . PHE C 3 71  ? 14.573  5.235   -37.851 1.00 39.22  ? 71   PHE L O   1 
ATOM   3804 C  CB  . PHE C 3 71  ? 12.488  2.729   -37.609 1.00 36.92  ? 71   PHE L CB  1 
ATOM   3805 C  CG  . PHE C 3 71  ? 12.136  1.284   -37.893 1.00 38.60  ? 71   PHE L CG  1 
ATOM   3806 C  CD1 . PHE C 3 71  ? 11.019  0.957   -38.648 1.00 40.32  ? 71   PHE L CD1 1 
ATOM   3807 C  CD2 . PHE C 3 71  ? 12.954  0.249   -37.452 1.00 41.21  ? 71   PHE L CD2 1 
ATOM   3808 C  CE1 . PHE C 3 71  ? 10.707  -0.380  -38.923 1.00 39.83  ? 71   PHE L CE1 1 
ATOM   3809 C  CE2 . PHE C 3 71  ? 12.674  -1.079  -37.784 1.00 41.80  ? 71   PHE L CE2 1 
ATOM   3810 C  CZ  . PHE C 3 71  ? 11.537  -1.382  -38.487 1.00 38.60  ? 71   PHE L CZ  1 
ATOM   3811 N  N   . THR C 3 72  ? 12.661  5.660   -38.989 1.00 33.97  ? 72   THR L N   1 
ATOM   3812 C  CA  . THR C 3 72  ? 12.727  7.110   -38.871 1.00 33.80  ? 72   THR L CA  1 
ATOM   3813 C  C   . THR C 3 72  ? 11.410  7.747   -38.461 1.00 36.37  ? 72   THR L C   1 
ATOM   3814 O  O   . THR C 3 72  ? 10.383  7.507   -39.088 1.00 37.51  ? 72   THR L O   1 
ATOM   3815 C  CB  . THR C 3 72  ? 13.254  7.732   -40.185 1.00 47.51  ? 72   THR L CB  1 
ATOM   3816 O  OG1 . THR C 3 72  ? 14.577  7.273   -40.404 1.00 59.33  ? 72   THR L OG1 1 
ATOM   3817 C  CG2 . THR C 3 72  ? 13.292  9.260   -40.162 1.00 45.29  ? 72   THR L CG2 1 
ATOM   3818 N  N   . LEU C 3 73  ? 11.447  8.590   -37.431 1.00 30.45  ? 73   LEU L N   1 
ATOM   3819 C  CA  . LEU C 3 73  ? 10.315  9.409   -37.043 1.00 29.52  ? 73   LEU L CA  1 
ATOM   3820 C  C   . LEU C 3 73  ? 10.641  10.836  -37.514 1.00 36.44  ? 73   LEU L C   1 
ATOM   3821 O  O   . LEU C 3 73  ? 11.675  11.408  -37.132 1.00 36.29  ? 73   LEU L O   1 
ATOM   3822 C  CB  . LEU C 3 73  ? 10.050  9.398   -35.533 1.00 29.04  ? 73   LEU L CB  1 
ATOM   3823 C  CG  . LEU C 3 73  ? 8.902   10.313  -35.068 1.00 31.36  ? 73   LEU L CG  1 
ATOM   3824 C  CD1 . LEU C 3 73  ? 7.571   9.769   -35.481 1.00 29.59  ? 73   LEU L CD1 1 
ATOM   3825 C  CD2 . LEU C 3 73  ? 8.933   10.493  -33.570 1.00 33.22  ? 73   LEU L CD2 1 
ATOM   3826 N  N   . THR C 3 74  ? 9.765   11.396  -38.359 1.00 32.73  ? 74   THR L N   1 
ATOM   3827 C  CA  . THR C 3 74  ? 9.930   12.745  -38.896 1.00 31.90  ? 74   THR L CA  1 
ATOM   3828 C  C   . THR C 3 74  ? 8.825   13.650  -38.379 1.00 33.26  ? 74   THR L C   1 
ATOM   3829 O  O   . THR C 3 74  ? 7.638   13.307  -38.476 1.00 31.37  ? 74   THR L O   1 
ATOM   3830 C  CB  . THR C 3 74  ? 9.951   12.722  -40.436 1.00 43.73  ? 74   THR L CB  1 
ATOM   3831 O  OG1 . THR C 3 74  ? 10.925  11.775  -40.910 1.00 44.46  ? 74   THR L OG1 1 
ATOM   3832 C  CG2 . THR C 3 74  ? 10.196  14.105  -41.050 1.00 43.36  ? 74   THR L CG2 1 
ATOM   3833 N  N   . ILE C 3 75  ? 9.208   14.824  -37.862 1.00 30.55  ? 75   ILE L N   1 
ATOM   3834 C  CA  . ILE C 3 75  ? 8.246   15.831  -37.424 1.00 30.89  ? 75   ILE L CA  1 
ATOM   3835 C  C   . ILE C 3 75  ? 8.460   16.983  -38.389 1.00 31.42  ? 75   ILE L C   1 
ATOM   3836 O  O   . ILE C 3 75  ? 9.528   17.568  -38.388 1.00 32.75  ? 75   ILE L O   1 
ATOM   3837 C  CB  . ILE C 3 75  ? 8.347   16.266  -35.920 1.00 35.58  ? 75   ILE L CB  1 
ATOM   3838 C  CG1 . ILE C 3 75  ? 8.480   15.058  -34.964 1.00 35.70  ? 75   ILE L CG1 1 
ATOM   3839 C  CG2 . ILE C 3 75  ? 7.142   17.149  -35.521 1.00 37.26  ? 75   ILE L CG2 1 
ATOM   3840 C  CD1 . ILE C 3 75  ? 8.932   15.419  -33.516 1.00 42.21  ? 75   ILE L CD1 1 
ATOM   3841 N  N   . SER C 3 76  ? 7.485   17.276  -39.228 1.00 26.33  ? 76   SER L N   1 
ATOM   3842 C  CA  . SER C 3 76  ? 7.641   18.327  -40.231 1.00 27.00  ? 76   SER L CA  1 
ATOM   3843 C  C   . SER C 3 76  ? 7.787   19.799  -39.683 1.00 33.35  ? 76   SER L C   1 
ATOM   3844 O  O   . SER C 3 76  ? 8.896   20.274  -39.740 1.00 36.19  ? 76   SER L O   1 
ATOM   3845 C  CB  . SER C 3 76  ? 6.550   18.234  -41.279 1.00 29.14  ? 76   SER L CB  1 
ATOM   3846 O  OG  . SER C 3 76  ? 5.378   17.649  -40.750 1.00 30.23  ? 76   SER L OG  1 
ATOM   3847 N  N   . SER C 3 77  ? 6.735   20.546  -39.294 1.00 30.52  ? 77   SER L N   1 
ATOM   3848 C  CA  . SER C 3 77  ? 6.844   21.884  -38.717 1.00 31.19  ? 77   SER L CA  1 
ATOM   3849 C  C   . SER C 3 77  ? 6.717   21.646  -37.215 1.00 37.17  ? 77   SER L C   1 
ATOM   3850 O  O   . SER C 3 77  ? 5.597   21.537  -36.705 1.00 36.93  ? 77   SER L O   1 
ATOM   3851 C  CB  . SER C 3 77  ? 5.668   22.732  -39.191 1.00 34.60  ? 77   SER L CB  1 
ATOM   3852 O  OG  . SER C 3 77  ? 6.091   24.001  -39.665 1.00 45.23  ? 77   SER L OG  1 
ATOM   3853 N  N   . LEU C 3 78  ? 7.853   21.456  -36.529 1.00 35.90  ? 78   LEU L N   1 
ATOM   3854 C  CA  . LEU C 3 78  ? 7.914   21.226  -35.080 1.00 35.81  ? 78   LEU L CA  1 
ATOM   3855 C  C   . LEU C 3 78  ? 7.186   22.359  -34.333 1.00 39.62  ? 78   LEU L C   1 
ATOM   3856 O  O   . LEU C 3 78  ? 7.482   23.543  -34.525 1.00 40.39  ? 78   LEU L O   1 
ATOM   3857 C  CB  . LEU C 3 78  ? 9.391   21.145  -34.608 1.00 36.19  ? 78   LEU L CB  1 
ATOM   3858 C  CG  . LEU C 3 78  ? 9.639   20.744  -33.157 1.00 40.13  ? 78   LEU L CG  1 
ATOM   3859 C  CD1 . LEU C 3 78  ? 9.526   19.274  -33.012 1.00 40.99  ? 78   LEU L CD1 1 
ATOM   3860 C  CD2 . LEU C 3 78  ? 10.991  21.079  -32.749 1.00 40.33  ? 78   LEU L CD2 1 
ATOM   3861 N  N   . GLN C 3 79  ? 6.201   21.985  -33.526 1.00 34.53  ? 79   GLN L N   1 
ATOM   3862 C  CA  . GLN C 3 79  ? 5.401   22.959  -32.772 1.00 34.06  ? 79   GLN L CA  1 
ATOM   3863 C  C   . GLN C 3 79  ? 5.913   23.061  -31.313 1.00 37.52  ? 79   GLN L C   1 
ATOM   3864 O  O   . GLN C 3 79  ? 6.692   22.197  -30.863 1.00 35.10  ? 79   GLN L O   1 
ATOM   3865 C  CB  . GLN C 3 79  ? 3.892   22.633  -32.875 1.00 33.94  ? 79   GLN L CB  1 
ATOM   3866 C  CG  . GLN C 3 79  ? 3.554   22.252  -34.282 1.00 28.21  ? 79   GLN L CG  1 
ATOM   3867 C  CD  . GLN C 3 79  ? 2.273   22.583  -34.925 1.00 24.70  ? 79   GLN L CD  1 
ATOM   3868 O  OE1 . GLN C 3 79  ? 1.229   22.737  -34.276 1.00 23.19  ? 79   GLN L OE1 1 
ATOM   3869 N  NE2 . GLN C 3 79  ? 2.340   22.558  -36.260 1.00 11.98  ? 79   GLN L NE2 1 
ATOM   3870 N  N   . PRO C 3 80  ? 5.522   24.115  -30.561 1.00 34.50  ? 80   PRO L N   1 
ATOM   3871 C  CA  . PRO C 3 80  ? 6.024   24.239  -29.180 1.00 35.17  ? 80   PRO L CA  1 
ATOM   3872 C  C   . PRO C 3 80  ? 5.721   23.040  -28.277 1.00 41.39  ? 80   PRO L C   1 
ATOM   3873 O  O   . PRO C 3 80  ? 6.549   22.651  -27.451 1.00 41.12  ? 80   PRO L O   1 
ATOM   3874 C  CB  . PRO C 3 80  ? 5.341   25.508  -28.679 1.00 37.32  ? 80   PRO L CB  1 
ATOM   3875 C  CG  . PRO C 3 80  ? 5.013   26.265  -29.913 1.00 41.60  ? 80   PRO L CG  1 
ATOM   3876 C  CD  . PRO C 3 80  ? 4.636   25.241  -30.911 1.00 35.84  ? 80   PRO L CD  1 
ATOM   3877 N  N   . GLU C 3 81  ? 4.533   22.442  -28.454 1.00 38.84  ? 81   GLU L N   1 
ATOM   3878 C  CA  . GLU C 3 81  ? 4.078   21.313  -27.663 1.00 37.89  ? 81   GLU L CA  1 
ATOM   3879 C  C   . GLU C 3 81  ? 4.788   19.999  -28.048 1.00 42.97  ? 81   GLU L C   1 
ATOM   3880 O  O   . GLU C 3 81  ? 4.532   18.981  -27.418 1.00 45.40  ? 81   GLU L O   1 
ATOM   3881 C  CB  . GLU C 3 81  ? 2.534   21.210  -27.717 1.00 38.94  ? 81   GLU L CB  1 
ATOM   3882 C  CG  . GLU C 3 81  ? 1.984   20.752  -29.060 1.00 46.05  ? 81   GLU L CG  1 
ATOM   3883 C  CD  . GLU C 3 81  ? 1.485   21.783  -30.055 1.00 56.44  ? 81   GLU L CD  1 
ATOM   3884 O  OE1 . GLU C 3 81  ? 2.158   22.828  -30.211 1.00 41.55  ? 81   GLU L OE1 1 
ATOM   3885 O  OE2 . GLU C 3 81  ? 0.495   21.494  -30.767 1.00 43.01  ? 81   GLU L OE2 1 
ATOM   3886 N  N   . ASP C 3 82  ? 5.688   20.005  -29.052 1.00 37.10  ? 82   ASP L N   1 
ATOM   3887 C  CA  . ASP C 3 82  ? 6.396   18.793  -29.490 1.00 34.96  ? 82   ASP L CA  1 
ATOM   3888 C  C   . ASP C 3 82  ? 7.704   18.592  -28.762 1.00 39.27  ? 82   ASP L C   1 
ATOM   3889 O  O   . ASP C 3 82  ? 8.369   17.579  -28.954 1.00 37.64  ? 82   ASP L O   1 
ATOM   3890 C  CB  . ASP C 3 82  ? 6.617   18.817  -31.003 1.00 35.75  ? 82   ASP L CB  1 
ATOM   3891 C  CG  . ASP C 3 82  ? 5.353   18.868  -31.813 1.00 46.63  ? 82   ASP L CG  1 
ATOM   3892 O  OD1 . ASP C 3 82  ? 4.279   18.528  -31.264 1.00 48.55  ? 82   ASP L OD1 1 
ATOM   3893 O  OD2 . ASP C 3 82  ? 5.434   19.211  -33.004 1.00 51.85  ? 82   ASP L OD2 1 
ATOM   3894 N  N   . PHE C 3 83  ? 8.106   19.579  -27.945 1.00 38.80  ? 83   PHE L N   1 
ATOM   3895 C  CA  . PHE C 3 83  ? 9.332   19.475  -27.161 1.00 39.79  ? 83   PHE L CA  1 
ATOM   3896 C  C   . PHE C 3 83  ? 9.020   18.497  -25.988 1.00 45.91  ? 83   PHE L C   1 
ATOM   3897 O  O   . PHE C 3 83  ? 8.169   18.757  -25.120 1.00 47.61  ? 83   PHE L O   1 
ATOM   3898 C  CB  . PHE C 3 83  ? 9.851   20.844  -26.737 1.00 42.57  ? 83   PHE L CB  1 
ATOM   3899 C  CG  . PHE C 3 83  ? 10.294  21.747  -27.875 1.00 44.62  ? 83   PHE L CG  1 
ATOM   3900 C  CD1 . PHE C 3 83  ? 9.372   22.536  -28.564 1.00 47.70  ? 83   PHE L CD1 1 
ATOM   3901 C  CD2 . PHE C 3 83  ? 11.646  21.930  -28.151 1.00 46.30  ? 83   PHE L CD2 1 
ATOM   3902 C  CE1 . PHE C 3 83  ? 9.791   23.416  -29.566 1.00 48.26  ? 83   PHE L CE1 1 
ATOM   3903 C  CE2 . PHE C 3 83  ? 12.063  22.822  -29.140 1.00 48.31  ? 83   PHE L CE2 1 
ATOM   3904 C  CZ  . PHE C 3 83  ? 11.136  23.559  -29.833 1.00 46.71  ? 83   PHE L CZ  1 
ATOM   3905 N  N   . ALA C 3 84  ? 9.615   17.298  -26.092 1.00 39.94  ? 84   ALA L N   1 
ATOM   3906 C  CA  . ALA C 3 84  ? 9.350   16.136  -25.274 1.00 38.38  ? 84   ALA L CA  1 
ATOM   3907 C  C   . ALA C 3 84  ? 10.388  15.092  -25.579 1.00 39.93  ? 84   ALA L C   1 
ATOM   3908 O  O   . ALA C 3 84  ? 11.322  15.355  -26.340 1.00 37.99  ? 84   ALA L O   1 
ATOM   3909 C  CB  . ALA C 3 84  ? 7.988   15.562  -25.670 1.00 38.19  ? 84   ALA L CB  1 
ATOM   3910 N  N   . THR C 3 85  ? 10.202  13.883  -24.993 1.00 36.45  ? 85   THR L N   1 
ATOM   3911 C  CA  . THR C 3 85  ? 11.035  12.708  -25.218 1.00 36.28  ? 85   THR L CA  1 
ATOM   3912 C  C   . THR C 3 85  ? 10.264  11.777  -26.129 1.00 38.51  ? 85   THR L C   1 
ATOM   3913 O  O   . THR C 3 85  ? 9.064   11.624  -25.969 1.00 38.16  ? 85   THR L O   1 
ATOM   3914 C  CB  . THR C 3 85  ? 11.525  12.078  -23.899 1.00 46.65  ? 85   THR L CB  1 
ATOM   3915 O  OG1 . THR C 3 85  ? 12.312  13.043  -23.187 1.00 54.15  ? 85   THR L OG1 1 
ATOM   3916 C  CG2 . THR C 3 85  ? 12.385  10.854  -24.124 1.00 40.58  ? 85   THR L CG2 1 
ATOM   3917 N  N   . TYR C 3 86  ? 10.938  11.208  -27.117 1.00 34.51  ? 86   TYR L N   1 
ATOM   3918 C  CA  . TYR C 3 86  ? 10.353  10.286  -28.084 1.00 33.59  ? 86   TYR L CA  1 
ATOM   3919 C  C   . TYR C 3 86  ? 11.007  8.918   -27.932 1.00 42.06  ? 86   TYR L C   1 
ATOM   3920 O  O   . TYR C 3 86  ? 12.217  8.845   -27.740 1.00 42.46  ? 86   TYR L O   1 
ATOM   3921 C  CB  . TYR C 3 86  ? 10.527  10.833  -29.510 1.00 33.06  ? 86   TYR L CB  1 
ATOM   3922 C  CG  . TYR C 3 86  ? 9.703   12.079  -29.734 1.00 33.57  ? 86   TYR L CG  1 
ATOM   3923 C  CD1 . TYR C 3 86  ? 10.195  13.335  -29.390 1.00 35.67  ? 86   TYR L CD1 1 
ATOM   3924 C  CD2 . TYR C 3 86  ? 8.387   11.996  -30.179 1.00 33.69  ? 86   TYR L CD2 1 
ATOM   3925 C  CE1 . TYR C 3 86  ? 9.401   14.480  -29.498 1.00 35.40  ? 86   TYR L CE1 1 
ATOM   3926 C  CE2 . TYR C 3 86  ? 7.587   13.135  -30.299 1.00 34.19  ? 86   TYR L CE2 1 
ATOM   3927 C  CZ  . TYR C 3 86  ? 8.099   14.371  -29.956 1.00 38.42  ? 86   TYR L CZ  1 
ATOM   3928 O  OH  . TYR C 3 86  ? 7.296   15.468  -30.069 1.00 39.66  ? 86   TYR L OH  1 
ATOM   3929 N  N   . TYR C 3 87  ? 10.209  7.839   -27.978 1.00 40.61  ? 87   TYR L N   1 
ATOM   3930 C  CA  . TYR C 3 87  ? 10.697  6.467   -27.845 1.00 41.60  ? 87   TYR L CA  1 
ATOM   3931 C  C   . TYR C 3 87  ? 10.213  5.601   -28.992 1.00 45.42  ? 87   TYR L C   1 
ATOM   3932 O  O   . TYR C 3 87  ? 9.052   5.686   -29.381 1.00 43.95  ? 87   TYR L O   1 
ATOM   3933 C  CB  . TYR C 3 87  ? 10.154  5.800   -26.559 1.00 44.18  ? 87   TYR L CB  1 
ATOM   3934 C  CG  . TYR C 3 87  ? 10.629  6.414   -25.269 1.00 47.71  ? 87   TYR L CG  1 
ATOM   3935 C  CD1 . TYR C 3 87  ? 11.771  5.953   -24.638 1.00 51.10  ? 87   TYR L CD1 1 
ATOM   3936 C  CD2 . TYR C 3 87  ? 9.900   7.413   -24.643 1.00 48.57  ? 87   TYR L CD2 1 
ATOM   3937 C  CE1 . TYR C 3 87  ? 12.204  6.501   -23.441 1.00 52.76  ? 87   TYR L CE1 1 
ATOM   3938 C  CE2 . TYR C 3 87  ? 10.329  7.975   -23.449 1.00 50.21  ? 87   TYR L CE2 1 
ATOM   3939 C  CZ  . TYR C 3 87  ? 11.477  7.508   -22.848 1.00 57.62  ? 87   TYR L CZ  1 
ATOM   3940 O  OH  . TYR C 3 87  ? 11.906  8.045   -21.671 1.00 62.71  ? 87   TYR L OH  1 
ATOM   3941 N  N   . CYS C 3 88  ? 11.065  4.713   -29.481 1.00 42.95  ? 88   CYS L N   1 
ATOM   3942 C  CA  . CYS C 3 88  ? 10.632  3.710   -30.433 1.00 41.86  ? 88   CYS L CA  1 
ATOM   3943 C  C   . CYS C 3 88  ? 10.440  2.419   -29.605 1.00 42.37  ? 88   CYS L C   1 
ATOM   3944 O  O   . CYS C 3 88  ? 10.945  2.334   -28.476 1.00 41.47  ? 88   CYS L O   1 
ATOM   3945 C  CB  . CYS C 3 88  ? 11.624  3.530   -31.580 1.00 43.03  ? 88   CYS L CB  1 
ATOM   3946 S  SG  . CYS C 3 88  ? 13.284  3.005   -31.076 1.00 49.09  ? 88   CYS L SG  1 
ATOM   3947 N  N   . GLN C 3 89  ? 9.659   1.459   -30.126 1.00 36.34  ? 89   GLN L N   1 
ATOM   3948 C  CA  . GLN C 3 89  ? 9.374   0.182   -29.456 1.00 35.28  ? 89   GLN L CA  1 
ATOM   3949 C  C   . GLN C 3 89  ? 9.145   -0.951  -30.467 1.00 36.56  ? 89   GLN L C   1 
ATOM   3950 O  O   . GLN C 3 89  ? 8.275   -0.852  -31.329 1.00 35.35  ? 89   GLN L O   1 
ATOM   3951 C  CB  . GLN C 3 89  ? 8.127   0.308   -28.547 1.00 36.18  ? 89   GLN L CB  1 
ATOM   3952 C  CG  . GLN C 3 89  ? 7.684   -0.994  -27.864 1.00 38.77  ? 89   GLN L CG  1 
ATOM   3953 C  CD  . GLN C 3 89  ? 6.283   -1.447  -28.252 1.00 43.22  ? 89   GLN L CD  1 
ATOM   3954 O  OE1 . GLN C 3 89  ? 5.371   -0.648  -28.481 1.00 30.99  ? 89   GLN L OE1 1 
ATOM   3955 N  NE2 . GLN C 3 89  ? 6.075   -2.762  -28.321 1.00 29.17  ? 89   GLN L NE2 1 
ATOM   3956 N  N   . GLN C 3 90  ? 9.869   -2.044  -30.335 1.00 32.23  ? 90   GLN L N   1 
ATOM   3957 C  CA  . GLN C 3 90  ? 9.597   -3.175  -31.214 1.00 30.68  ? 90   GLN L CA  1 
ATOM   3958 C  C   . GLN C 3 90  ? 8.422   -3.968  -30.625 1.00 34.86  ? 90   GLN L C   1 
ATOM   3959 O  O   . GLN C 3 90  ? 8.300   -4.109  -29.401 1.00 35.85  ? 90   GLN L O   1 
ATOM   3960 C  CB  . GLN C 3 90  ? 10.840  -4.099  -31.394 1.00 31.72  ? 90   GLN L CB  1 
ATOM   3961 C  CG  . GLN C 3 90  ? 10.560  -5.625  -31.228 1.00 17.75  ? 90   GLN L CG  1 
ATOM   3962 C  CD  . GLN C 3 90  ? 10.811  -6.112  -29.832 1.00 33.30  ? 90   GLN L CD  1 
ATOM   3963 O  OE1 . GLN C 3 90  ? 11.919  -6.097  -29.378 1.00 41.21  ? 90   GLN L OE1 1 
ATOM   3964 N  NE2 . GLN C 3 90  ? 9.821   -6.404  -29.027 1.00 29.01  ? 90   GLN L NE2 1 
ATOM   3965 N  N   . TYR C 3 91  ? 7.601   -4.533  -31.498 1.00 28.72  ? 91   TYR L N   1 
ATOM   3966 C  CA  . TYR C 3 91  ? 6.597   -5.420  -31.011 1.00 28.10  ? 91   TYR L CA  1 
ATOM   3967 C  C   . TYR C 3 91  ? 6.688   -6.798  -31.676 1.00 29.53  ? 91   TYR L C   1 
ATOM   3968 O  O   . TYR C 3 91  ? 5.767   -7.604  -31.538 1.00 29.96  ? 91   TYR L O   1 
ATOM   3969 C  CB  . TYR C 3 91  ? 5.193   -4.813  -31.041 1.00 30.29  ? 91   TYR L CB  1 
ATOM   3970 C  CG  . TYR C 3 91  ? 4.591   -4.463  -32.381 1.00 33.00  ? 91   TYR L CG  1 
ATOM   3971 C  CD1 . TYR C 3 91  ? 3.642   -5.289  -32.973 1.00 35.75  ? 91   TYR L CD1 1 
ATOM   3972 C  CD2 . TYR C 3 91  ? 4.816   -3.220  -32.960 1.00 33.23  ? 91   TYR L CD2 1 
ATOM   3973 C  CE1 . TYR C 3 91  ? 3.006   -4.927  -34.156 1.00 37.43  ? 91   TYR L CE1 1 
ATOM   3974 C  CE2 . TYR C 3 91  ? 4.160   -2.831  -34.124 1.00 33.43  ? 91   TYR L CE2 1 
ATOM   3975 C  CZ  . TYR C 3 91  ? 3.283   -3.702  -34.737 1.00 43.79  ? 91   TYR L CZ  1 
ATOM   3976 O  OH  . TYR C 3 91  ? 2.682   -3.353  -35.915 1.00 47.16  ? 91   TYR L OH  1 
ATOM   3977 N  N   . LEU C 3 92  ? 7.817   -7.123  -32.327 1.00 25.88  ? 92   LEU L N   1 
ATOM   3978 C  CA  . LEU C 3 92  ? 7.965   -8.432  -33.009 1.00 25.67  ? 92   LEU L CA  1 
ATOM   3979 C  C   . LEU C 3 92  ? 8.072   -9.684  -32.083 1.00 30.04  ? 92   LEU L C   1 
ATOM   3980 O  O   . LEU C 3 92  ? 7.437   -10.716 -32.352 1.00 31.42  ? 92   LEU L O   1 
ATOM   3981 C  CB  . LEU C 3 92  ? 9.139   -8.458  -33.998 1.00 25.00  ? 92   LEU L CB  1 
ATOM   3982 C  CG  . LEU C 3 92  ? 9.510   -9.880  -34.546 1.00 26.12  ? 92   LEU L CG  1 
ATOM   3983 C  CD1 . LEU C 3 92  ? 8.701   -10.267 -35.765 1.00 24.73  ? 92   LEU L CD1 1 
ATOM   3984 C  CD2 . LEU C 3 92  ? 10.926  -9.969  -34.801 1.00 26.34  ? 92   LEU L CD2 1 
ATOM   3985 N  N   . GLN C 3 93  ? 8.937   -9.613  -31.053 1.00 26.90  ? 93   GLN L N   1 
ATOM   3986 C  CA  . GLN C 3 93  ? 9.158   -10.704 -30.129 1.00 26.42  ? 93   GLN L CA  1 
ATOM   3987 C  C   . GLN C 3 93  ? 9.036   -10.243 -28.682 1.00 30.33  ? 93   GLN L C   1 
ATOM   3988 O  O   . GLN C 3 93  ? 9.205   -9.055  -28.370 1.00 29.00  ? 93   GLN L O   1 
ATOM   3989 C  CB  . GLN C 3 93  ? 10.567  -11.187 -30.314 1.00 27.37  ? 93   GLN L CB  1 
ATOM   3990 C  CG  . GLN C 3 93  ? 10.890  -11.859 -31.600 1.00 21.66  ? 93   GLN L CG  1 
ATOM   3991 C  CD  . GLN C 3 93  ? 12.293  -12.371 -31.501 1.00 36.03  ? 93   GLN L CD  1 
ATOM   3992 O  OE1 . GLN C 3 93  ? 13.098  -11.952 -30.639 1.00 35.60  ? 93   GLN L OE1 1 
ATOM   3993 N  NE2 . GLN C 3 93  ? 12.637  -13.238 -32.430 1.00 31.97  ? 93   GLN L NE2 1 
ATOM   3994 N  N   . TYR C 3 94  ? 8.814   -11.201 -27.780 1.00 31.15  ? 94   TYR L N   1 
ATOM   3995 C  CA  . TYR C 3 94  ? 8.775   -10.934 -26.343 1.00 33.42  ? 94   TYR L CA  1 
ATOM   3996 C  C   . TYR C 3 94  ? 10.210  -10.898 -25.832 1.00 39.60  ? 94   TYR L C   1 
ATOM   3997 O  O   . TYR C 3 94  ? 11.046  -11.657 -26.332 1.00 38.56  ? 94   TYR L O   1 
ATOM   3998 C  CB  . TYR C 3 94  ? 7.974   -12.013 -25.594 1.00 37.07  ? 94   TYR L CB  1 
ATOM   3999 C  CG  . TYR C 3 94  ? 6.477   -11.875 -25.779 1.00 38.95  ? 94   TYR L CG  1 
ATOM   4000 C  CD1 . TYR C 3 94  ? 5.819   -10.693 -25.435 1.00 40.05  ? 94   TYR L CD1 1 
ATOM   4001 C  CD2 . TYR C 3 94  ? 5.715   -12.926 -26.282 1.00 39.10  ? 94   TYR L CD2 1 
ATOM   4002 C  CE1 . TYR C 3 94  ? 4.452   -10.541 -25.632 1.00 38.18  ? 94   TYR L CE1 1 
ATOM   4003 C  CE2 . TYR C 3 94  ? 4.339   -12.789 -26.466 1.00 39.11  ? 94   TYR L CE2 1 
ATOM   4004 C  CZ  . TYR C 3 94  ? 3.712   -11.593 -26.135 1.00 41.76  ? 94   TYR L CZ  1 
ATOM   4005 O  OH  . TYR C 3 94  ? 2.360   -11.411 -26.278 1.00 37.06  ? 94   TYR L OH  1 
ATOM   4006 N  N   . PRO C 3 95  ? 10.550  -10.033 -24.861 1.00 39.60  ? 95   PRO L N   1 
ATOM   4007 C  CA  . PRO C 3 95  ? 9.702   -9.011  -24.218 1.00 39.53  ? 95   PRO L CA  1 
ATOM   4008 C  C   . PRO C 3 95  ? 9.592   -7.796  -25.134 1.00 42.28  ? 95   PRO L C   1 
ATOM   4009 O  O   . PRO C 3 95  ? 10.490  -7.561  -25.955 1.00 40.93  ? 95   PRO L O   1 
ATOM   4010 C  CB  . PRO C 3 95  ? 10.478  -8.711  -22.930 1.00 43.18  ? 95   PRO L CB  1 
ATOM   4011 C  CG  . PRO C 3 95  ? 11.945  -8.893  -23.327 1.00 48.30  ? 95   PRO L CG  1 
ATOM   4012 C  CD  . PRO C 3 95  ? 11.956  -9.961  -24.397 1.00 43.00  ? 95   PRO L CD  1 
ATOM   4013 N  N   . MET C 3 96  ? 8.516   -7.021  -25.024 1.00 39.64  ? 96   MET L N   1 
ATOM   4014 C  CA  . MET C 3 96  ? 8.431   -5.792  -25.825 1.00 38.50  ? 96   MET L CA  1 
ATOM   4015 C  C   . MET C 3 96  ? 9.573   -4.889  -25.336 1.00 48.47  ? 96   MET L C   1 
ATOM   4016 O  O   . MET C 3 96  ? 9.742   -4.768  -24.118 1.00 51.00  ? 96   MET L O   1 
ATOM   4017 C  CB  . MET C 3 96  ? 7.076   -5.073  -25.629 1.00 39.12  ? 96   MET L CB  1 
ATOM   4018 C  CG  . MET C 3 96  ? 5.881   -5.797  -26.186 1.00 41.39  ? 96   MET L CG  1 
ATOM   4019 S  SD  . MET C 3 96  ? 6.092   -6.380  -27.844 1.00 44.46  ? 96   MET L SD  1 
ATOM   4020 C  CE  . MET C 3 96  ? 6.194   -8.049  -27.590 1.00 42.11  ? 96   MET L CE  1 
ATOM   4021 N  N   . THR C 3 97  ? 10.426  -4.368  -26.251 1.00 46.22  ? 97   THR L N   1 
ATOM   4022 C  CA  . THR C 3 97  ? 11.572  -3.526  -25.852 1.00 47.66  ? 97   THR L CA  1 
ATOM   4023 C  C   . THR C 3 97  ? 11.515  -2.123  -26.486 1.00 51.13  ? 97   THR L C   1 
ATOM   4024 O  O   . THR C 3 97  ? 11.064  -1.977  -27.623 1.00 50.96  ? 97   THR L O   1 
ATOM   4025 C  CB  . THR C 3 97  ? 12.912  -4.231  -26.098 1.00 58.91  ? 97   THR L CB  1 
ATOM   4026 O  OG1 . THR C 3 97  ? 12.971  -4.646  -27.449 1.00 64.24  ? 97   THR L OG1 1 
ATOM   4027 C  CG2 . THR C 3 97  ? 13.127  -5.447  -25.200 1.00 55.54  ? 97   THR L CG2 1 
ATOM   4028 N  N   . PHE C 3 98  ? 11.983  -1.102  -25.741 1.00 46.20  ? 98   PHE L N   1 
ATOM   4029 C  CA  . PHE C 3 98  ? 11.970  0.298   -26.157 1.00 44.06  ? 98   PHE L CA  1 
ATOM   4030 C  C   . PHE C 3 98  ? 13.389  0.855   -26.379 1.00 46.84  ? 98   PHE L C   1 
ATOM   4031 O  O   . PHE C 3 98  ? 14.340  0.385   -25.734 1.00 45.71  ? 98   PHE L O   1 
ATOM   4032 C  CB  . PHE C 3 98  ? 11.307  1.146   -25.063 1.00 45.53  ? 98   PHE L CB  1 
ATOM   4033 C  CG  . PHE C 3 98  ? 9.861   0.859   -24.747 1.00 45.44  ? 98   PHE L CG  1 
ATOM   4034 C  CD1 . PHE C 3 98  ? 9.509   -0.143  -23.842 1.00 48.55  ? 98   PHE L CD1 1 
ATOM   4035 C  CD2 . PHE C 3 98  ? 8.854   1.643   -25.277 1.00 45.57  ? 98   PHE L CD2 1 
ATOM   4036 C  CE1 . PHE C 3 98  ? 8.161   -0.378  -23.516 1.00 48.83  ? 98   PHE L CE1 1 
ATOM   4037 C  CE2 . PHE C 3 98  ? 7.512   1.380   -24.981 1.00 47.26  ? 98   PHE L CE2 1 
ATOM   4038 C  CZ  . PHE C 3 98  ? 7.174   0.371   -24.102 1.00 45.95  ? 98   PHE L CZ  1 
ATOM   4039 N  N   . GLY C 3 99  ? 13.491  1.898   -27.229 1.00 41.98  ? 99   GLY L N   1 
ATOM   4040 C  CA  . GLY C 3 99  ? 14.724  2.640   -27.464 1.00 41.69  ? 99   GLY L CA  1 
ATOM   4041 C  C   . GLY C 3 99  ? 14.992  3.479   -26.239 1.00 46.08  ? 99   GLY L C   1 
ATOM   4042 O  O   . GLY C 3 99  ? 14.058  3.665   -25.464 1.00 44.15  ? 99   GLY L O   1 
ATOM   4043 N  N   . GLN C 3 100 ? 16.233  4.026   -26.042 1.00 43.98  ? 100  GLN L N   1 
ATOM   4044 C  CA  . GLN C 3 100 ? 16.474  4.760   -24.803 1.00 44.30  ? 100  GLN L CA  1 
ATOM   4045 C  C   . GLN C 3 100 ? 15.966  6.192   -24.780 1.00 46.84  ? 100  GLN L C   1 
ATOM   4046 O  O   . GLN C 3 100 ? 16.060  6.861   -23.751 1.00 46.80  ? 100  GLN L O   1 
ATOM   4047 C  CB  . GLN C 3 100 ? 17.907  4.681   -24.328 1.00 47.27  ? 100  GLN L CB  1 
ATOM   4048 C  CG  . GLN C 3 100 ? 18.030  3.674   -23.154 1.00 73.54  ? 100  GLN L CG  1 
ATOM   4049 C  CD  . GLN C 3 100 ? 16.862  3.640   -22.151 1.00 99.68  ? 100  GLN L CD  1 
ATOM   4050 O  OE1 . GLN C 3 100 ? 16.540  4.645   -21.487 1.00 95.84  ? 100  GLN L OE1 1 
ATOM   4051 N  NE2 . GLN C 3 100 ? 16.201  2.473   -22.019 1.00 89.85  ? 100  GLN L NE2 1 
ATOM   4052 N  N   . GLY C 3 101 ? 15.309  6.603   -25.842 1.00 42.65  ? 101  GLY L N   1 
ATOM   4053 C  CA  . GLY C 3 101 ? 14.670  7.902   -25.886 1.00 42.44  ? 101  GLY L CA  1 
ATOM   4054 C  C   . GLY C 3 101 ? 15.501  8.992   -26.506 1.00 48.46  ? 101  GLY L C   1 
ATOM   4055 O  O   . GLY C 3 101 ? 16.732  8.979   -26.392 1.00 49.93  ? 101  GLY L O   1 
ATOM   4056 N  N   . THR C 3 102 ? 14.808  9.951   -27.175 1.00 44.18  ? 102  THR L N   1 
ATOM   4057 C  CA  . THR C 3 102 ? 15.385  11.150  -27.789 1.00 43.50  ? 102  THR L CA  1 
ATOM   4058 C  C   . THR C 3 102 ? 14.700  12.360  -27.146 1.00 46.41  ? 102  THR L C   1 
ATOM   4059 O  O   . THR C 3 102 ? 13.491  12.526  -27.291 1.00 45.39  ? 102  THR L O   1 
ATOM   4060 C  CB  . THR C 3 102 ? 15.223  11.149  -29.318 1.00 41.06  ? 102  THR L CB  1 
ATOM   4061 O  OG1 . THR C 3 102 ? 15.933  10.043  -29.833 1.00 35.66  ? 102  THR L OG1 1 
ATOM   4062 C  CG2 . THR C 3 102 ? 15.752  12.427  -29.973 1.00 36.05  ? 102  THR L CG2 1 
ATOM   4063 N  N   . LYS C 3 103 ? 15.459  13.183  -26.419 1.00 41.99  ? 103  LYS L N   1 
ATOM   4064 C  CA  . LYS C 3 103 ? 14.880  14.356  -25.797 1.00 40.99  ? 103  LYS L CA  1 
ATOM   4065 C  C   . LYS C 3 103 ? 15.000  15.469  -26.797 1.00 43.48  ? 103  LYS L C   1 
ATOM   4066 O  O   . LYS C 3 103 ? 16.092  15.719  -27.308 1.00 42.98  ? 103  LYS L O   1 
ATOM   4067 C  CB  . LYS C 3 103 ? 15.584  14.701  -24.467 1.00 44.95  ? 103  LYS L CB  1 
ATOM   4068 C  CG  . LYS C 3 103 ? 14.836  15.736  -23.617 1.00 45.78  ? 103  LYS L CG  1 
ATOM   4069 C  CD  . LYS C 3 103 ? 15.668  16.181  -22.415 1.00 46.46  ? 103  LYS L CD  1 
ATOM   4070 C  CE  . LYS C 3 103 ? 14.805  16.621  -21.270 1.00 49.98  ? 103  LYS L CE  1 
ATOM   4071 N  NZ  . LYS C 3 103 ? 15.577  17.398  -20.272 1.00 62.86  ? 103  LYS L NZ  1 
ATOM   4072 N  N   . VAL C 3 104 ? 13.875  16.120  -27.116 1.00 40.05  ? 104  VAL L N   1 
ATOM   4073 C  CA  . VAL C 3 104 ? 13.847  17.251  -28.070 1.00 39.08  ? 104  VAL L CA  1 
ATOM   4074 C  C   . VAL C 3 104 ? 13.692  18.547  -27.245 1.00 43.78  ? 104  VAL L C   1 
ATOM   4075 O  O   . VAL C 3 104 ? 12.660  18.764  -26.620 1.00 43.05  ? 104  VAL L O   1 
ATOM   4076 C  CB  . VAL C 3 104 ? 12.785  17.063  -29.193 1.00 40.53  ? 104  VAL L CB  1 
ATOM   4077 C  CG1 . VAL C 3 104 ? 12.798  18.220  -30.154 1.00 39.65  ? 104  VAL L CG1 1 
ATOM   4078 C  CG2 . VAL C 3 104 ? 13.012  15.764  -29.956 1.00 40.08  ? 104  VAL L CG2 1 
ATOM   4079 N  N   . GLU C 3 105 ? 14.761  19.352  -27.178 1.00 42.27  ? 105  GLU L N   1 
ATOM   4080 C  CA  . GLU C 3 105 ? 14.878  20.583  -26.377 1.00 43.81  ? 105  GLU L CA  1 
ATOM   4081 C  C   . GLU C 3 105 ? 14.917  21.779  -27.324 1.00 49.38  ? 105  GLU L C   1 
ATOM   4082 O  O   . GLU C 3 105 ? 15.173  21.603  -28.525 1.00 48.70  ? 105  GLU L O   1 
ATOM   4083 C  CB  . GLU C 3 105 ? 16.151  20.543  -25.476 1.00 46.43  ? 105  GLU L CB  1 
ATOM   4084 C  CG  . GLU C 3 105 ? 16.540  19.121  -25.074 1.00 59.13  ? 105  GLU L CG  1 
ATOM   4085 C  CD  . GLU C 3 105 ? 17.967  18.800  -24.652 1.00 92.50  ? 105  GLU L CD  1 
ATOM   4086 O  OE1 . GLU C 3 105 ? 18.735  18.241  -25.475 1.00 74.67  ? 105  GLU L OE1 1 
ATOM   4087 O  OE2 . GLU C 3 105 ? 18.265  18.977  -23.448 1.00 98.54  ? 105  GLU L OE2 1 
ATOM   4088 N  N   . ILE C 3 106 ? 14.650  22.994  -26.785 1.00 46.60  ? 106  ILE L N   1 
ATOM   4089 C  CA  . ILE C 3 106 ? 14.589  24.249  -27.546 1.00 46.02  ? 106  ILE L CA  1 
ATOM   4090 C  C   . ILE C 3 106 ? 15.964  24.791  -27.776 1.00 49.54  ? 106  ILE L C   1 
ATOM   4091 O  O   . ILE C 3 106 ? 16.742  24.864  -26.822 1.00 47.36  ? 106  ILE L O   1 
ATOM   4092 C  CB  . ILE C 3 106 ? 13.725  25.348  -26.859 1.00 49.26  ? 106  ILE L CB  1 
ATOM   4093 C  CG1 . ILE C 3 106 ? 12.623  24.772  -25.935 1.00 48.35  ? 106  ILE L CG1 1 
ATOM   4094 C  CG2 . ILE C 3 106 ? 13.147  26.325  -27.894 1.00 50.90  ? 106  ILE L CG2 1 
ATOM   4095 C  CD1 . ILE C 3 106 ? 12.393  25.697  -24.585 1.00 60.37  ? 106  ILE L CD1 1 
ATOM   4096 N  N   . LYS C 3 107 ? 16.245  25.234  -29.031 1.00 48.66  ? 107  LYS L N   1 
ATOM   4097 C  CA  . LYS C 3 107 ? 17.513  25.879  -29.394 1.00 50.42  ? 107  LYS L CA  1 
ATOM   4098 C  C   . LYS C 3 107 ? 17.481  27.262  -28.858 1.00 56.94  ? 107  LYS L C   1 
ATOM   4099 O  O   . LYS C 3 107 ? 16.424  27.911  -28.839 1.00 57.63  ? 107  LYS L O   1 
ATOM   4100 C  CB  . LYS C 3 107 ? 17.697  25.984  -30.909 1.00 52.86  ? 107  LYS L CB  1 
ATOM   4101 C  CG  . LYS C 3 107 ? 18.305  24.751  -31.515 1.00 69.82  ? 107  LYS L CG  1 
ATOM   4102 C  CD  . LYS C 3 107 ? 18.653  24.918  -32.982 1.00 80.63  ? 107  LYS L CD  1 
ATOM   4103 C  CE  . LYS C 3 107 ? 20.031  25.476  -33.218 1.00 95.82  ? 107  LYS L CE  1 
ATOM   4104 N  NZ  . LYS C 3 107 ? 20.153  26.040  -34.588 1.00 104.60 ? 107  LYS L NZ  1 
ATOM   4105 N  N   . ARG C 3 108 ? 18.656  27.739  -28.494 1.00 54.39  ? 108  ARG L N   1 
ATOM   4106 C  CA  . ARG C 3 108 ? 18.873  29.053  -27.956 1.00 56.17  ? 108  ARG L CA  1 
ATOM   4107 C  C   . ARG C 3 108 ? 20.321  29.398  -28.342 1.00 66.67  ? 108  ARG L C   1 
ATOM   4108 O  O   . ARG C 3 108 ? 21.074  28.488  -28.696 1.00 68.12  ? 108  ARG L O   1 
ATOM   4109 C  CB  . ARG C 3 108 ? 18.755  28.911  -26.439 1.00 53.38  ? 108  ARG L CB  1 
ATOM   4110 C  CG  . ARG C 3 108 ? 18.478  30.181  -25.727 1.00 65.30  ? 108  ARG L CG  1 
ATOM   4111 C  CD  . ARG C 3 108 ? 19.347  30.265  -24.509 1.00 76.97  ? 108  ARG L CD  1 
ATOM   4112 N  NE  . ARG C 3 108 ? 19.028  31.468  -23.752 1.00 94.08  ? 108  ARG L NE  1 
ATOM   4113 C  CZ  . ARG C 3 108 ? 19.814  32.533  -23.685 1.00 116.47 ? 108  ARG L CZ  1 
ATOM   4114 N  NH1 . ARG C 3 108 ? 19.449  33.589  -22.970 1.00 106.64 ? 108  ARG L NH1 1 
ATOM   4115 N  NH2 . ARG C 3 108 ? 20.990  32.536  -24.298 1.00 108.18 ? 108  ARG L NH2 1 
ATOM   4116 N  N   . THR C 3 109 ? 20.738  30.670  -28.240 1.00 65.71  ? 109  THR L N   1 
ATOM   4117 C  CA  . THR C 3 109 ? 22.141  31.021  -28.473 1.00 67.29  ? 109  THR L CA  1 
ATOM   4118 C  C   . THR C 3 109 ? 22.964  30.526  -27.248 1.00 74.99  ? 109  THR L C   1 
ATOM   4119 O  O   . THR C 3 109 ? 22.390  30.340  -26.164 1.00 74.16  ? 109  THR L O   1 
ATOM   4120 C  CB  . THR C 3 109 ? 22.287  32.536  -28.641 1.00 68.10  ? 109  THR L CB  1 
ATOM   4121 O  OG1 . THR C 3 109 ? 21.767  33.178  -27.484 1.00 61.19  ? 109  THR L OG1 1 
ATOM   4122 C  CG2 . THR C 3 109 ? 21.578  33.067  -29.885 1.00 68.37  ? 109  THR L CG2 1 
ATOM   4123 N  N   . VAL C 3 110 ? 24.291  30.322  -27.419 1.00 74.06  ? 110  VAL L N   1 
ATOM   4124 C  CA  . VAL C 3 110 ? 25.196  29.936  -26.323 1.00 75.17  ? 110  VAL L CA  1 
ATOM   4125 C  C   . VAL C 3 110 ? 25.172  31.026  -25.238 1.00 77.75  ? 110  VAL L C   1 
ATOM   4126 O  O   . VAL C 3 110 ? 25.228  32.206  -25.557 1.00 76.89  ? 110  VAL L O   1 
ATOM   4127 C  CB  . VAL C 3 110 ? 26.648  29.696  -26.833 1.00 81.37  ? 110  VAL L CB  1 
ATOM   4128 C  CG1 . VAL C 3 110 ? 27.614  29.297  -25.698 1.00 82.13  ? 110  VAL L CG1 1 
ATOM   4129 C  CG2 . VAL C 3 110 ? 26.655  28.650  -27.943 1.00 80.71  ? 110  VAL L CG2 1 
ATOM   4130 N  N   . ALA C 3 111 ? 25.040  30.627  -23.977 1.00 74.34  ? 111  ALA L N   1 
ATOM   4131 C  CA  . ALA C 3 111 ? 25.051  31.538  -22.846 1.00 75.24  ? 111  ALA L CA  1 
ATOM   4132 C  C   . ALA C 3 111 ? 25.943  30.932  -21.780 1.00 83.32  ? 111  ALA L C   1 
ATOM   4133 O  O   . ALA C 3 111 ? 25.739  29.780  -21.378 1.00 82.62  ? 111  ALA L O   1 
ATOM   4134 C  CB  . ALA C 3 111 ? 23.647  31.743  -22.312 1.00 74.61  ? 111  ALA L CB  1 
ATOM   4135 N  N   . ALA C 3 112 ? 26.985  31.683  -21.383 1.00 83.41  ? 112  ALA L N   1 
ATOM   4136 C  CA  . ALA C 3 112 ? 27.925  31.273  -20.343 1.00 84.81  ? 112  ALA L CA  1 
ATOM   4137 C  C   . ALA C 3 112 ? 27.204  31.323  -18.989 1.00 89.52  ? 112  ALA L C   1 
ATOM   4138 O  O   . ALA C 3 112 ? 26.342  32.189  -18.791 1.00 88.99  ? 112  ALA L O   1 
ATOM   4139 C  CB  . ALA C 3 112 ? 29.121  32.209  -20.321 1.00 87.51  ? 112  ALA L CB  1 
ATOM   4140 N  N   . PRO C 3 113 ? 27.507  30.405  -18.047 1.00 86.58  ? 113  PRO L N   1 
ATOM   4141 C  CA  . PRO C 3 113 ? 26.852  30.494  -16.736 1.00 86.11  ? 113  PRO L CA  1 
ATOM   4142 C  C   . PRO C 3 113 ? 27.452  31.606  -15.883 1.00 89.43  ? 113  PRO L C   1 
ATOM   4143 O  O   . PRO C 3 113 ? 28.632  31.934  -16.015 1.00 90.26  ? 113  PRO L O   1 
ATOM   4144 C  CB  . PRO C 3 113 ? 27.171  29.139  -16.091 1.00 88.32  ? 113  PRO L CB  1 
ATOM   4145 C  CG  . PRO C 3 113 ? 28.484  28.742  -16.686 1.00 94.13  ? 113  PRO L CG  1 
ATOM   4146 C  CD  . PRO C 3 113 ? 28.494  29.301  -18.090 1.00 88.92  ? 113  PRO L CD  1 
ATOM   4147 N  N   . SER C 3 114 ? 26.653  32.166  -14.986 1.00 84.69  ? 114  SER L N   1 
ATOM   4148 C  CA  . SER C 3 114 ? 27.192  33.068  -13.985 1.00 85.46  ? 114  SER L CA  1 
ATOM   4149 C  C   . SER C 3 114 ? 27.404  32.082  -12.808 1.00 89.50  ? 114  SER L C   1 
ATOM   4150 O  O   . SER C 3 114 ? 26.538  31.232  -12.554 1.00 87.24  ? 114  SER L O   1 
ATOM   4151 C  CB  . SER C 3 114 ? 26.228  34.209  -13.668 1.00 86.18  ? 114  SER L CB  1 
ATOM   4152 O  OG  . SER C 3 114 ? 24.970  33.744  -13.219 1.00 87.09  ? 114  SER L OG  1 
ATOM   4153 N  N   . VAL C 3 115 ? 28.603  32.087  -12.203 1.00 87.66  ? 115  VAL L N   1 
ATOM   4154 C  CA  . VAL C 3 115 ? 28.944  31.114  -11.165 1.00 88.07  ? 115  VAL L CA  1 
ATOM   4155 C  C   . VAL C 3 115 ? 28.972  31.732  -9.766  1.00 92.42  ? 115  VAL L C   1 
ATOM   4156 O  O   . VAL C 3 115 ? 29.512  32.820  -9.594  1.00 93.40  ? 115  VAL L O   1 
ATOM   4157 C  CB  . VAL C 3 115 ? 30.262  30.377  -11.518 1.00 93.55  ? 115  VAL L CB  1 
ATOM   4158 C  CG1 . VAL C 3 115 ? 30.559  29.254  -10.525 1.00 94.54  ? 115  VAL L CG1 1 
ATOM   4159 C  CG2 . VAL C 3 115 ? 30.215  29.826  -12.945 1.00 91.85  ? 115  VAL L CG2 1 
ATOM   4160 N  N   . PHE C 3 116 ? 28.389  31.024  -8.775  1.00 88.13  ? 116  PHE L N   1 
ATOM   4161 C  CA  . PHE C 3 116 ? 28.314  31.445  -7.375  1.00 88.97  ? 116  PHE L CA  1 
ATOM   4162 C  C   . PHE C 3 116 ? 28.696  30.298  -6.453  1.00 94.95  ? 116  PHE L C   1 
ATOM   4163 O  O   . PHE C 3 116 ? 28.328  29.159  -6.712  1.00 92.70  ? 116  PHE L O   1 
ATOM   4164 C  CB  . PHE C 3 116 ? 26.893  31.937  -7.023  1.00 88.82  ? 116  PHE L CB  1 
ATOM   4165 C  CG  . PHE C 3 116 ? 26.351  33.014  -7.931  1.00 88.73  ? 116  PHE L CG  1 
ATOM   4166 C  CD1 . PHE C 3 116 ? 26.585  34.354  -7.666  1.00 93.16  ? 116  PHE L CD1 1 
ATOM   4167 C  CD2 . PHE C 3 116 ? 25.614  32.689  -9.055  1.00 88.61  ? 116  PHE L CD2 1 
ATOM   4168 C  CE1 . PHE C 3 116 ? 26.085  35.349  -8.512  1.00 92.97  ? 116  PHE L CE1 1 
ATOM   4169 C  CE2 . PHE C 3 116 ? 25.127  33.685  -9.904  1.00 90.39  ? 116  PHE L CE2 1 
ATOM   4170 C  CZ  . PHE C 3 116 ? 25.362  35.007  -9.624  1.00 89.34  ? 116  PHE L CZ  1 
ATOM   4171 N  N   . ILE C 3 117 ? 29.411  30.603  -5.365  1.00 96.10  ? 117  ILE L N   1 
ATOM   4172 C  CA  . ILE C 3 117 ? 29.812  29.609  -4.368  1.00 98.51  ? 117  ILE L CA  1 
ATOM   4173 C  C   . ILE C 3 117 ? 29.243  29.979  -2.992  1.00 105.73 ? 117  ILE L C   1 
ATOM   4174 O  O   . ILE C 3 117 ? 29.357  31.136  -2.573  1.00 106.03 ? 117  ILE L O   1 
ATOM   4175 C  CB  . ILE C 3 117 ? 31.353  29.336  -4.367  1.00 103.92 ? 117  ILE L CB  1 
ATOM   4176 C  CG1 . ILE C 3 117 ? 31.696  28.053  -3.550  1.00 105.87 ? 117  ILE L CG1 1 
ATOM   4177 C  CG2 . ILE C 3 117 ? 32.183  30.570  -3.930  1.00 106.23 ? 117  ILE L CG2 1 
ATOM   4178 C  CD1 . ILE C 3 117 ? 33.180  27.559  -3.640  1.00 116.92 ? 117  ILE L CD1 1 
ATOM   4179 N  N   . PHE C 3 118 ? 28.602  29.009  -2.313  1.00 103.84 ? 118  PHE L N   1 
ATOM   4180 C  CA  . PHE C 3 118 ? 28.027  29.212  -0.987  1.00 105.11 ? 118  PHE L CA  1 
ATOM   4181 C  C   . PHE C 3 118 ? 28.719  28.356  0.063   1.00 112.04 ? 118  PHE L C   1 
ATOM   4182 O  O   . PHE C 3 118 ? 28.640  27.122  -0.009  1.00 111.07 ? 118  PHE L O   1 
ATOM   4183 C  CB  . PHE C 3 118 ? 26.528  28.913  -0.957  1.00 104.97 ? 118  PHE L CB  1 
ATOM   4184 C  CG  . PHE C 3 118 ? 25.688  29.700  -1.919  1.00 104.90 ? 118  PHE L CG  1 
ATOM   4185 C  CD1 . PHE C 3 118 ? 25.210  30.960  -1.581  1.00 108.65 ? 118  PHE L CD1 1 
ATOM   4186 C  CD2 . PHE C 3 118 ? 25.352  29.176  -3.160  1.00 105.71 ? 118  PHE L CD2 1 
ATOM   4187 C  CE1 . PHE C 3 118 ? 24.379  31.665  -2.454  1.00 108.07 ? 118  PHE L CE1 1 
ATOM   4188 C  CE2 . PHE C 3 118 ? 24.543  29.895  -4.046  1.00 106.88 ? 118  PHE L CE2 1 
ATOM   4189 C  CZ  . PHE C 3 118 ? 24.057  31.132  -3.686  1.00 105.19 ? 118  PHE L CZ  1 
ATOM   4190 N  N   . PRO C 3 119 ? 29.349  28.978  1.089   1.00 111.58 ? 119  PRO L N   1 
ATOM   4191 C  CA  . PRO C 3 119 ? 29.943  28.172  2.169   1.00 113.96 ? 119  PRO L CA  1 
ATOM   4192 C  C   . PRO C 3 119 ? 28.836  27.513  3.001   1.00 117.26 ? 119  PRO L C   1 
ATOM   4193 O  O   . PRO C 3 119 ? 27.702  28.014  2.965   1.00 113.99 ? 119  PRO L O   1 
ATOM   4194 C  CB  . PRO C 3 119 ? 30.693  29.213  3.021   1.00 117.90 ? 119  PRO L CB  1 
ATOM   4195 C  CG  . PRO C 3 119 ? 30.767  30.454  2.176   1.00 121.05 ? 119  PRO L CG  1 
ATOM   4196 C  CD  . PRO C 3 119 ? 29.525  30.421  1.347   1.00 113.55 ? 119  PRO L CD  1 
ATOM   4197 N  N   . PRO C 3 120 ? 29.113  26.439  3.793   1.00 116.41 ? 120  PRO L N   1 
ATOM   4198 C  CA  . PRO C 3 120 ? 28.046  25.896  4.646   1.00 116.19 ? 120  PRO L CA  1 
ATOM   4199 C  C   . PRO C 3 120 ? 27.634  26.953  5.666   1.00 121.66 ? 120  PRO L C   1 
ATOM   4200 O  O   . PRO C 3 120 ? 28.472  27.743  6.106   1.00 123.26 ? 120  PRO L O   1 
ATOM   4201 C  CB  . PRO C 3 120 ? 28.694  24.687  5.330   1.00 120.12 ? 120  PRO L CB  1 
ATOM   4202 C  CG  . PRO C 3 120 ? 30.142  24.907  5.238   1.00 126.59 ? 120  PRO L CG  1 
ATOM   4203 C  CD  . PRO C 3 120 ? 30.388  25.717  3.999   1.00 120.42 ? 120  PRO L CD  1 
ATOM   4204 N  N   . SER C 3 121 ? 26.348  26.992  6.016   1.00 117.18 ? 121  SER L N   1 
ATOM   4205 C  CA  . SER C 3 121 ? 25.842  27.954  6.987   1.00 117.57 ? 121  SER L CA  1 
ATOM   4206 C  C   . SER C 3 121 ? 26.325  27.576  8.393   1.00 124.98 ? 121  SER L C   1 
ATOM   4207 O  O   . SER C 3 121 ? 26.659  26.408  8.636   1.00 125.94 ? 121  SER L O   1 
ATOM   4208 C  CB  . SER C 3 121 ? 24.317  27.983  6.944   1.00 118.38 ? 121  SER L CB  1 
ATOM   4209 O  OG  . SER C 3 121 ? 23.762  26.737  7.336   1.00 125.45 ? 121  SER L OG  1 
ATOM   4210 N  N   . ASP C 3 122 ? 26.348  28.553  9.318   1.00 122.96 ? 122  ASP L N   1 
ATOM   4211 C  CA  . ASP C 3 122 ? 26.722  28.294  10.708  1.00 125.76 ? 122  ASP L CA  1 
ATOM   4212 C  C   . ASP C 3 122 ? 25.692  27.356  11.341  1.00 129.07 ? 122  ASP L C   1 
ATOM   4213 O  O   . ASP C 3 122 ? 26.077  26.454  12.086  1.00 130.91 ? 122  ASP L O   1 
ATOM   4214 C  CB  . ASP C 3 122 ? 26.847  29.599  11.505  1.00 129.14 ? 122  ASP L CB  1 
ATOM   4215 C  CG  . ASP C 3 122 ? 27.984  30.494  11.052  1.00 143.29 ? 122  ASP L CG  1 
ATOM   4216 O  OD1 . ASP C 3 122 ? 29.091  29.968  10.793  1.00 145.36 ? 122  ASP L OD1 1 
ATOM   4217 O  OD2 . ASP C 3 122 ? 27.782  31.725  10.995  1.00 150.36 ? 122  ASP L OD2 1 
ATOM   4218 N  N   . GLU C 3 123 ? 24.397  27.516  10.965  1.00 122.56 ? 123  GLU L N   1 
ATOM   4219 C  CA  . GLU C 3 123 ? 23.275  26.683  11.410  1.00 121.54 ? 123  GLU L CA  1 
ATOM   4220 C  C   . GLU C 3 123 ? 23.547  25.204  11.106  1.00 126.36 ? 123  GLU L C   1 
ATOM   4221 O  O   . GLU C 3 123 ? 23.380  24.376  12.004  1.00 127.72 ? 123  GLU L O   1 
ATOM   4222 C  CB  . GLU C 3 123 ? 21.938  27.124  10.767  1.00 119.81 ? 123  GLU L CB  1 
ATOM   4223 C  CG  . GLU C 3 123 ? 21.510  28.551  11.067  1.00 129.14 ? 123  GLU L CG  1 
ATOM   4224 C  CD  . GLU C 3 123 ? 21.950  29.624  10.085  1.00 146.80 ? 123  GLU L CD  1 
ATOM   4225 O  OE1 . GLU C 3 123 ? 23.149  29.663  9.724   1.00 143.18 ? 123  GLU L OE1 1 
ATOM   4226 O  OE2 . GLU C 3 123 ? 21.106  30.483  9.741   1.00 136.18 ? 123  GLU L OE2 1 
ATOM   4227 N  N   . GLN C 3 124 ? 23.999  24.877  9.860   1.00 121.55 ? 124  GLN L N   1 
ATOM   4228 C  CA  . GLN C 3 124 ? 24.308  23.491  9.449   1.00 121.18 ? 124  GLN L CA  1 
ATOM   4229 C  C   . GLN C 3 124 ? 25.502  22.928  10.195  1.00 127.38 ? 124  GLN L C   1 
ATOM   4230 O  O   . GLN C 3 124 ? 25.457  21.773  10.635  1.00 127.64 ? 124  GLN L O   1 
ATOM   4231 C  CB  . GLN C 3 124 ? 24.511  23.357  7.928   1.00 120.15 ? 124  GLN L CB  1 
ATOM   4232 C  CG  . GLN C 3 124 ? 24.610  21.898  7.464   1.00 129.28 ? 124  GLN L CG  1 
ATOM   4233 C  CD  . GLN C 3 124 ? 25.074  21.703  6.043   1.00 140.06 ? 124  GLN L CD  1 
ATOM   4234 O  OE1 . GLN C 3 124 ? 25.614  22.601  5.391   1.00 132.56 ? 124  GLN L OE1 1 
ATOM   4235 N  NE2 . GLN C 3 124 ? 24.903  20.495  5.542   1.00 131.13 ? 124  GLN L NE2 1 
ATOM   4236 N  N   . LEU C 3 125 ? 26.569  23.745  10.323  1.00 125.20 ? 125  LEU L N   1 
ATOM   4237 C  CA  . LEU C 3 125 ? 27.810  23.396  11.013  1.00 128.00 ? 125  LEU L CA  1 
ATOM   4238 C  C   . LEU C 3 125 ? 27.565  22.845  12.418  1.00 133.75 ? 125  LEU L C   1 
ATOM   4239 O  O   . LEU C 3 125 ? 28.188  21.852  12.780  1.00 136.20 ? 125  LEU L O   1 
ATOM   4240 C  CB  . LEU C 3 125 ? 28.790  24.578  11.038  1.00 129.07 ? 125  LEU L CB  1 
ATOM   4241 C  CG  . LEU C 3 125 ? 29.908  24.631  9.965   1.00 133.60 ? 125  LEU L CG  1 
ATOM   4242 C  CD1 . LEU C 3 125 ? 31.015  25.516  10.392  1.00 136.18 ? 125  LEU L CD1 1 
ATOM   4243 C  CD2 . LEU C 3 125 ? 30.395  23.267  9.465   1.00 136.25 ? 125  LEU L CD2 1 
ATOM   4244 N  N   . LYS C 3 126 ? 26.575  23.406  13.152  1.00 128.35 ? 126  LYS L N   1 
ATOM   4245 C  CA  . LYS C 3 126 ? 26.161  22.944  14.488  1.00 129.17 ? 126  LYS L CA  1 
ATOM   4246 C  C   . LYS C 3 126 ? 25.787  21.447  14.491  1.00 132.82 ? 126  LYS L C   1 
ATOM   4247 O  O   . LYS C 3 126 ? 26.167  20.731  15.419  1.00 135.51 ? 126  LYS L O   1 
ATOM   4248 C  CB  . LYS C 3 126 ? 24.981  23.779  15.021  1.00 128.89 ? 126  LYS L CB  1 
ATOM   4249 C  CG  . LYS C 3 126 ? 25.280  25.263  15.169  1.00 123.34 ? 126  LYS L CG  1 
ATOM   4250 C  CD  . LYS C 3 126 ? 24.802  25.755  16.527  1.00 122.93 ? 126  LYS L CD  1 
ATOM   4251 C  CE  . LYS C 3 126 ? 25.017  27.228  16.761  1.00 118.37 ? 126  LYS L CE  1 
ATOM   4252 N  NZ  . LYS C 3 126 ? 24.599  27.639  18.131  1.00 119.60 ? 126  LYS L NZ  1 
ATOM   4253 N  N   . SER C 3 127 ? 25.090  20.975  13.433  1.00 125.48 ? 127  SER L N   1 
ATOM   4254 C  CA  . SER C 3 127 ? 24.658  19.581  13.294  1.00 124.70 ? 127  SER L CA  1 
ATOM   4255 C  C   . SER C 3 127 ? 25.810  18.574  13.013  1.00 130.87 ? 127  SER L C   1 
ATOM   4256 O  O   . SER C 3 127 ? 25.610  17.363  13.137  1.00 130.53 ? 127  SER L O   1 
ATOM   4257 C  CB  . SER C 3 127 ? 23.543  19.458  12.249  1.00 123.58 ? 127  SER L CB  1 
ATOM   4258 O  OG  . SER C 3 127 ? 23.062  20.718  11.804  1.00 126.84 ? 127  SER L OG  1 
ATOM   4259 N  N   . GLY C 3 128 ? 26.998  19.077  12.674  1.00 129.57 ? 128  GLY L N   1 
ATOM   4260 C  CA  . GLY C 3 128 ? 28.177  18.249  12.426  1.00 132.09 ? 128  GLY L CA  1 
ATOM   4261 C  C   . GLY C 3 128 ? 28.432  17.899  10.972  1.00 135.64 ? 128  GLY L C   1 
ATOM   4262 O  O   . GLY C 3 128 ? 29.295  17.064  10.670  1.00 137.34 ? 128  GLY L O   1 
ATOM   4263 N  N   . THR C 3 129 ? 27.693  18.548  10.057  1.00 129.09 ? 129  THR L N   1 
ATOM   4264 C  CA  . THR C 3 129 ? 27.808  18.333  8.614   1.00 126.40 ? 129  THR L CA  1 
ATOM   4265 C  C   . THR C 3 129 ? 28.056  19.647  7.871   1.00 128.07 ? 129  THR L C   1 
ATOM   4266 O  O   . THR C 3 129 ? 27.636  20.712  8.332   1.00 127.60 ? 129  THR L O   1 
ATOM   4267 C  CB  . THR C 3 129 ? 26.602  17.545  8.072   1.00 128.24 ? 129  THR L CB  1 
ATOM   4268 O  OG1 . THR C 3 129 ? 25.387  18.132  8.557   1.00 122.56 ? 129  THR L OG1 1 
ATOM   4269 C  CG2 . THR C 3 129 ? 26.662  16.064  8.421   1.00 127.49 ? 129  THR L CG2 1 
ATOM   4270 N  N   . ALA C 3 130 ? 28.761  19.566  6.728   1.00 122.29 ? 130  ALA L N   1 
ATOM   4271 C  CA  . ALA C 3 130 ? 29.084  20.722  5.900   1.00 119.67 ? 130  ALA L CA  1 
ATOM   4272 C  C   . ALA C 3 130 ? 28.774  20.482  4.416   1.00 118.58 ? 130  ALA L C   1 
ATOM   4273 O  O   . ALA C 3 130 ? 29.331  19.568  3.800   1.00 118.28 ? 130  ALA L O   1 
ATOM   4274 C  CB  . ALA C 3 130 ? 30.539  21.098  6.085   1.00 122.90 ? 130  ALA L CB  1 
ATOM   4275 N  N   . SER C 3 131 ? 27.858  21.293  3.858   1.00 110.79 ? 131  SER L N   1 
ATOM   4276 C  CA  . SER C 3 131 ? 27.482  21.247  2.444   1.00 106.81 ? 131  SER L CA  1 
ATOM   4277 C  C   . SER C 3 131 ? 27.949  22.547  1.786   1.00 107.34 ? 131  SER L C   1 
ATOM   4278 O  O   . SER C 3 131 ? 27.597  23.641  2.246   1.00 106.45 ? 131  SER L O   1 
ATOM   4279 C  CB  . SER C 3 131 ? 25.974  21.078  2.280   1.00 107.77 ? 131  SER L CB  1 
ATOM   4280 O  OG  . SER C 3 131 ? 25.514  19.857  2.835   1.00 116.03 ? 131  SER L OG  1 
ATOM   4281 N  N   . VAL C 3 132 ? 28.792  22.420  0.751   1.00 101.76 ? 132  VAL L N   1 
ATOM   4282 C  CA  . VAL C 3 132 ? 29.336  23.564  0.014   1.00 100.05 ? 132  VAL L CA  1 
ATOM   4283 C  C   . VAL C 3 132 ? 28.632  23.558  -1.329  1.00 99.01  ? 132  VAL L C   1 
ATOM   4284 O  O   . VAL C 3 132 ? 28.688  22.551  -2.028  1.00 97.17  ? 132  VAL L O   1 
ATOM   4285 C  CB  . VAL C 3 132 ? 30.887  23.522  -0.111  1.00 105.44 ? 132  VAL L CB  1 
ATOM   4286 C  CG1 . VAL C 3 132 ? 31.425  24.851  -0.630  1.00 105.07 ? 132  VAL L CG1 1 
ATOM   4287 C  CG2 . VAL C 3 132 ? 31.535  23.180  1.227   1.00 108.03 ? 132  VAL L CG2 1 
ATOM   4288 N  N   . VAL C 3 133 ? 27.922  24.643  -1.665  1.00 93.48  ? 133  VAL L N   1 
ATOM   4289 C  CA  . VAL C 3 133 ? 27.130  24.680  -2.896  1.00 90.47  ? 133  VAL L CA  1 
ATOM   4290 C  C   . VAL C 3 133 ? 27.706  25.621  -3.958  1.00 94.31  ? 133  VAL L C   1 
ATOM   4291 O  O   . VAL C 3 133 ? 27.944  26.797  -3.697  1.00 94.72  ? 133  VAL L O   1 
ATOM   4292 C  CB  . VAL C 3 133 ? 25.630  24.985  -2.609  1.00 92.34  ? 133  VAL L CB  1 
ATOM   4293 C  CG1 . VAL C 3 133 ? 24.805  24.990  -3.890  1.00 89.33  ? 133  VAL L CG1 1 
ATOM   4294 C  CG2 . VAL C 3 133 ? 25.043  23.991  -1.611  1.00 92.77  ? 133  VAL L CG2 1 
ATOM   4295 N  N   . CYS C 3 134 ? 27.894  25.088  -5.169  1.00 89.88  ? 134  CYS L N   1 
ATOM   4296 C  CA  . CYS C 3 134 ? 28.323  25.843  -6.338  1.00 89.19  ? 134  CYS L CA  1 
ATOM   4297 C  C   . CYS C 3 134 ? 27.156  25.890  -7.293  1.00 86.96  ? 134  CYS L C   1 
ATOM   4298 O  O   . CYS C 3 134 ? 26.613  24.847  -7.647  1.00 84.63  ? 134  CYS L O   1 
ATOM   4299 C  CB  . CYS C 3 134 ? 29.542  25.214  -6.996  1.00 91.68  ? 134  CYS L CB  1 
ATOM   4300 S  SG  . CYS C 3 134 ? 30.226  26.187  -8.359  1.00 95.87  ? 134  CYS L SG  1 
ATOM   4301 N  N   . LEU C 3 135 ? 26.758  27.094  -7.694  1.00 81.74  ? 135  LEU L N   1 
ATOM   4302 C  CA  . LEU C 3 135 ? 25.643  27.317  -8.601  1.00 78.88  ? 135  LEU L CA  1 
ATOM   4303 C  C   . LEU C 3 135 ? 26.121  27.818  -9.961  1.00 81.05  ? 135  LEU L C   1 
ATOM   4304 O  O   . LEU C 3 135 ? 26.890  28.784  -10.026 1.00 81.16  ? 135  LEU L O   1 
ATOM   4305 C  CB  . LEU C 3 135 ? 24.653  28.325  -7.975  1.00 78.72  ? 135  LEU L CB  1 
ATOM   4306 C  CG  . LEU C 3 135 ? 23.611  28.983  -8.899  1.00 82.11  ? 135  LEU L CG  1 
ATOM   4307 C  CD1 . LEU C 3 135 ? 22.530  28.003  -9.345  1.00 79.82  ? 135  LEU L CD1 1 
ATOM   4308 C  CD2 . LEU C 3 135 ? 22.982  30.167  -8.225  1.00 87.28  ? 135  LEU L CD2 1 
ATOM   4309 N  N   . LEU C 3 136 ? 25.661  27.160  -11.047 1.00 75.30  ? 136  LEU L N   1 
ATOM   4310 C  CA  . LEU C 3 136 ? 25.928  27.601  -12.417 1.00 73.87  ? 136  LEU L CA  1 
ATOM   4311 C  C   . LEU C 3 136 ? 24.565  28.050  -12.885 1.00 78.68  ? 136  LEU L C   1 
ATOM   4312 O  O   . LEU C 3 136 ? 23.641  27.243  -12.983 1.00 77.40  ? 136  LEU L O   1 
ATOM   4313 C  CB  . LEU C 3 136 ? 26.513  26.542  -13.377 1.00 72.67  ? 136  LEU L CB  1 
ATOM   4314 C  CG  . LEU C 3 136 ? 27.391  25.359  -12.913 1.00 77.07  ? 136  LEU L CG  1 
ATOM   4315 C  CD1 . LEU C 3 136 ? 28.089  24.731  -14.094 1.00 76.54  ? 136  LEU L CD1 1 
ATOM   4316 C  CD2 . LEU C 3 136 ? 28.337  25.688  -11.775 1.00 79.55  ? 136  LEU L CD2 1 
ATOM   4317 N  N   . ASN C 3 137 ? 24.413  29.351  -13.073 1.00 76.94  ? 137  ASN L N   1 
ATOM   4318 C  CA  . ASN C 3 137 ? 23.128  29.952  -13.374 1.00 75.70  ? 137  ASN L CA  1 
ATOM   4319 C  C   . ASN C 3 137 ? 22.925  30.339  -14.823 1.00 77.62  ? 137  ASN L C   1 
ATOM   4320 O  O   . ASN C 3 137 ? 23.760  31.024  -15.416 1.00 78.25  ? 137  ASN L O   1 
ATOM   4321 C  CB  . ASN C 3 137 ? 22.916  31.170  -12.454 1.00 81.86  ? 137  ASN L CB  1 
ATOM   4322 C  CG  . ASN C 3 137 ? 21.533  31.773  -12.509 1.00 115.66 ? 137  ASN L CG  1 
ATOM   4323 O  OD1 . ASN C 3 137 ? 21.303  32.797  -13.152 1.00 113.69 ? 137  ASN L OD1 1 
ATOM   4324 N  ND2 . ASN C 3 137 ? 20.574  31.137  -11.854 1.00 108.18 ? 137  ASN L ND2 1 
ATOM   4325 N  N   . ASN C 3 138 ? 21.775  29.933  -15.369 1.00 71.86  ? 138  ASN L N   1 
ATOM   4326 C  CA  . ASN C 3 138 ? 21.261  30.286  -16.696 1.00 70.42  ? 138  ASN L CA  1 
ATOM   4327 C  C   . ASN C 3 138 ? 22.265  30.155  -17.834 1.00 72.16  ? 138  ASN L C   1 
ATOM   4328 O  O   . ASN C 3 138 ? 22.688  31.147  -18.425 1.00 72.12  ? 138  ASN L O   1 
ATOM   4329 C  CB  . ASN C 3 138 ? 20.643  31.693  -16.667 1.00 74.00  ? 138  ASN L CB  1 
ATOM   4330 C  CG  . ASN C 3 138 ? 19.359  31.739  -15.884 1.00 115.08 ? 138  ASN L CG  1 
ATOM   4331 O  OD1 . ASN C 3 138 ? 19.284  31.317  -14.732 1.00 117.59 ? 138  ASN L OD1 1 
ATOM   4332 N  ND2 . ASN C 3 138 ? 18.304  32.199  -16.504 1.00 107.40 ? 138  ASN L ND2 1 
ATOM   4333 N  N   . PHE C 3 139 ? 22.621  28.922  -18.151 1.00 66.75  ? 139  PHE L N   1 
ATOM   4334 C  CA  . PHE C 3 139 ? 23.563  28.646  -19.221 1.00 65.93  ? 139  PHE L CA  1 
ATOM   4335 C  C   . PHE C 3 139 ? 22.921  27.799  -20.336 1.00 70.86  ? 139  PHE L C   1 
ATOM   4336 O  O   . PHE C 3 139 ? 21.884  27.155  -20.129 1.00 70.23  ? 139  PHE L O   1 
ATOM   4337 C  CB  . PHE C 3 139 ? 24.838  27.977  -18.665 1.00 67.87  ? 139  PHE L CB  1 
ATOM   4338 C  CG  . PHE C 3 139 ? 24.601  26.654  -17.961 1.00 67.75  ? 139  PHE L CG  1 
ATOM   4339 C  CD1 . PHE C 3 139 ? 24.319  26.610  -16.602 1.00 70.26  ? 139  PHE L CD1 1 
ATOM   4340 C  CD2 . PHE C 3 139 ? 24.653  25.453  -18.663 1.00 67.64  ? 139  PHE L CD2 1 
ATOM   4341 C  CE1 . PHE C 3 139 ? 24.076  25.392  -15.960 1.00 70.36  ? 139  PHE L CE1 1 
ATOM   4342 C  CE2 . PHE C 3 139 ? 24.412  24.237  -18.020 1.00 69.57  ? 139  PHE L CE2 1 
ATOM   4343 C  CZ  . PHE C 3 139 ? 24.137  24.212  -16.670 1.00 68.24  ? 139  PHE L CZ  1 
ATOM   4344 N  N   . TYR C 3 140 ? 23.537  27.819  -21.519 1.00 67.66  ? 140  TYR L N   1 
ATOM   4345 C  CA  . TYR C 3 140 ? 23.123  27.036  -22.678 1.00 66.48  ? 140  TYR L CA  1 
ATOM   4346 C  C   . TYR C 3 140 ? 24.368  26.824  -23.547 1.00 72.98  ? 140  TYR L C   1 
ATOM   4347 O  O   . TYR C 3 140 ? 25.114  27.786  -23.754 1.00 73.75  ? 140  TYR L O   1 
ATOM   4348 C  CB  . TYR C 3 140 ? 21.943  27.660  -23.465 1.00 66.43  ? 140  TYR L CB  1 
ATOM   4349 C  CG  . TYR C 3 140 ? 21.414  26.740  -24.552 1.00 66.81  ? 140  TYR L CG  1 
ATOM   4350 C  CD1 . TYR C 3 140 ? 21.994  26.720  -25.818 1.00 69.08  ? 140  TYR L CD1 1 
ATOM   4351 C  CD2 . TYR C 3 140 ? 20.378  25.845  -24.297 1.00 66.15  ? 140  TYR L CD2 1 
ATOM   4352 C  CE1 . TYR C 3 140 ? 21.558  25.834  -26.805 1.00 68.91  ? 140  TYR L CE1 1 
ATOM   4353 C  CE2 . TYR C 3 140 ? 19.937  24.947  -25.277 1.00 65.91  ? 140  TYR L CE2 1 
ATOM   4354 C  CZ  . TYR C 3 140 ? 20.517  24.960  -26.539 1.00 73.35  ? 140  TYR L CZ  1 
ATOM   4355 O  OH  . TYR C 3 140 ? 20.083  24.103  -27.534 1.00 71.49  ? 140  TYR L OH  1 
ATOM   4356 N  N   . PRO C 3 141 ? 24.673  25.585  -24.010 1.00 70.20  ? 141  PRO L N   1 
ATOM   4357 C  CA  . PRO C 3 141 ? 23.914  24.325  -23.859 1.00 68.51  ? 141  PRO L CA  1 
ATOM   4358 C  C   . PRO C 3 141 ? 23.999  23.706  -22.456 1.00 73.07  ? 141  PRO L C   1 
ATOM   4359 O  O   . PRO C 3 141 ? 24.735  24.203  -21.602 1.00 74.00  ? 141  PRO L O   1 
ATOM   4360 C  CB  . PRO C 3 141 ? 24.513  23.443  -24.959 1.00 69.88  ? 141  PRO L CB  1 
ATOM   4361 C  CG  . PRO C 3 141 ? 25.951  23.877  -24.997 1.00 76.27  ? 141  PRO L CG  1 
ATOM   4362 C  CD  . PRO C 3 141 ? 25.887  25.374  -24.827 1.00 72.67  ? 141  PRO L CD  1 
ATOM   4363 N  N   . ARG C 3 142 ? 23.212  22.650  -22.213 1.00 69.24  ? 142  ARG L N   1 
ATOM   4364 C  CA  . ARG C 3 142 ? 23.146  21.926  -20.938 1.00 70.51  ? 142  ARG L CA  1 
ATOM   4365 C  C   . ARG C 3 142 ? 24.511  21.356  -20.466 1.00 77.01  ? 142  ARG L C   1 
ATOM   4366 O  O   . ARG C 3 142 ? 24.716  21.211  -19.260 1.00 78.58  ? 142  ARG L O   1 
ATOM   4367 C  CB  . ARG C 3 142 ? 22.111  20.795  -21.040 1.00 70.21  ? 142  ARG L CB  1 
ATOM   4368 C  CG  . ARG C 3 142 ? 21.702  20.113  -19.723 1.00 83.76  ? 142  ARG L CG  1 
ATOM   4369 C  CD  . ARG C 3 142 ? 20.924  18.851  -20.070 1.00 99.44  ? 142  ARG L CD  1 
ATOM   4370 N  NE  . ARG C 3 142 ? 20.252  18.203  -18.938 1.00 107.42 ? 142  ARG L NE  1 
ATOM   4371 C  CZ  . ARG C 3 142 ? 20.828  17.328  -18.120 1.00 119.47 ? 142  ARG L CZ  1 
ATOM   4372 N  NH1 . ARG C 3 142 ? 22.117  17.036  -18.248 1.00 110.10 ? 142  ARG L NH1 1 
ATOM   4373 N  NH2 . ARG C 3 142 ? 20.128  16.766  -17.143 1.00 100.61 ? 142  ARG L NH2 1 
ATOM   4374 N  N   . GLU C 3 143 ? 25.434  21.042  -21.402 1.00 72.65  ? 143  GLU L N   1 
ATOM   4375 C  CA  . GLU C 3 143 ? 26.749  20.483  -21.080 1.00 73.64  ? 143  GLU L CA  1 
ATOM   4376 C  C   . GLU C 3 143 ? 27.596  21.456  -20.283 1.00 80.04  ? 143  GLU L C   1 
ATOM   4377 O  O   . GLU C 3 143 ? 27.842  22.583  -20.719 1.00 80.12  ? 143  GLU L O   1 
ATOM   4378 C  CB  . GLU C 3 143 ? 27.535  20.021  -22.325 1.00 74.95  ? 143  GLU L CB  1 
ATOM   4379 C  CG  . GLU C 3 143 ? 26.844  18.994  -23.203 1.00 85.01  ? 143  GLU L CG  1 
ATOM   4380 C  CD  . GLU C 3 143 ? 25.856  19.610  -24.178 1.00 110.11 ? 143  GLU L CD  1 
ATOM   4381 O  OE1 . GLU C 3 143 ? 24.672  19.194  -24.176 1.00 112.16 ? 143  GLU L OE1 1 
ATOM   4382 O  OE2 . GLU C 3 143 ? 26.261  20.530  -24.927 1.00 103.20 ? 143  GLU L OE2 1 
ATOM   4383 N  N   . ALA C 3 144 ? 28.039  21.014  -19.104 1.00 78.85  ? 144  ALA L N   1 
ATOM   4384 C  CA  . ALA C 3 144 ? 28.903  21.789  -18.218 1.00 81.00  ? 144  ALA L CA  1 
ATOM   4385 C  C   . ALA C 3 144 ? 29.727  20.841  -17.365 1.00 86.98  ? 144  ALA L C   1 
ATOM   4386 O  O   . ALA C 3 144 ? 29.271  19.732  -17.051 1.00 86.20  ? 144  ALA L O   1 
ATOM   4387 C  CB  . ALA C 3 144 ? 28.071  22.702  -17.337 1.00 81.56  ? 144  ALA L CB  1 
ATOM   4388 N  N   . LYS C 3 145 ? 30.951  21.267  -17.016 1.00 85.21  ? 145  LYS L N   1 
ATOM   4389 C  CA  . LYS C 3 145 ? 31.860  20.478  -16.188 1.00 86.75  ? 145  LYS L CA  1 
ATOM   4390 C  C   . LYS C 3 145 ? 32.185  21.272  -14.924 1.00 92.39  ? 145  LYS L C   1 
ATOM   4391 O  O   . LYS C 3 145 ? 32.578  22.435  -15.016 1.00 92.08  ? 145  LYS L O   1 
ATOM   4392 C  CB  . LYS C 3 145 ? 33.113  20.114  -16.996 1.00 89.92  ? 145  LYS L CB  1 
ATOM   4393 C  CG  . LYS C 3 145 ? 34.186  19.320  -16.263 1.00 100.49 ? 145  LYS L CG  1 
ATOM   4394 C  CD  . LYS C 3 145 ? 35.495  19.368  -17.044 1.00 105.48 ? 145  LYS L CD  1 
ATOM   4395 C  CE  . LYS C 3 145 ? 36.677  18.919  -16.234 1.00 108.68 ? 145  LYS L CE  1 
ATOM   4396 N  NZ  . LYS C 3 145 ? 37.929  19.068  -17.010 1.00 116.42 ? 145  LYS L NZ  1 
ATOM   4397 N  N   . VAL C 3 146 ? 31.957  20.662  -13.746 1.00 90.56  ? 146  VAL L N   1 
ATOM   4398 C  CA  . VAL C 3 146 ? 32.211  21.291  -12.444 1.00 92.67  ? 146  VAL L CA  1 
ATOM   4399 C  C   . VAL C 3 146 ? 33.282  20.484  -11.710 1.00 101.03 ? 146  VAL L C   1 
ATOM   4400 O  O   . VAL C 3 146 ? 33.104  19.279  -11.502 1.00 100.63 ? 146  VAL L O   1 
ATOM   4401 C  CB  . VAL C 3 146 ? 30.924  21.459  -11.588 1.00 95.15  ? 146  VAL L CB  1 
ATOM   4402 C  CG1 . VAL C 3 146 ? 31.224  22.169  -10.275 1.00 96.76  ? 146  VAL L CG1 1 
ATOM   4403 C  CG2 . VAL C 3 146 ? 29.854  22.220  -12.347 1.00 92.55  ? 146  VAL L CG2 1 
ATOM   4404 N  N   . GLN C 3 147 ? 34.386  21.154  -11.319 1.00 101.15 ? 147  GLN L N   1 
ATOM   4405 C  CA  . GLN C 3 147 ? 35.519  20.547  -10.618 1.00 104.20 ? 147  GLN L CA  1 
ATOM   4406 C  C   . GLN C 3 147 ? 35.722  21.208  -9.242  1.00 111.86 ? 147  GLN L C   1 
ATOM   4407 O  O   . GLN C 3 147 ? 35.895  22.421  -9.158  1.00 111.35 ? 147  GLN L O   1 
ATOM   4408 C  CB  . GLN C 3 147 ? 36.789  20.647  -11.494 1.00 106.64 ? 147  GLN L CB  1 
ATOM   4409 C  CG  . GLN C 3 147 ? 38.025  19.964  -10.914 1.00 130.01 ? 147  GLN L CG  1 
ATOM   4410 C  CD  . GLN C 3 147 ? 39.317  20.606  -11.367 1.00 161.77 ? 147  GLN L CD  1 
ATOM   4411 O  OE1 . GLN C 3 147 ? 39.642  21.752  -11.018 1.00 163.42 ? 147  GLN L OE1 1 
ATOM   4412 N  NE2 . GLN C 3 147 ? 40.120  19.854  -12.102 1.00 153.25 ? 147  GLN L NE2 1 
ATOM   4413 N  N   . TRP C 3 148 ? 35.695  20.410  -8.170  1.00 111.82 ? 148  TRP L N   1 
ATOM   4414 C  CA  . TRP C 3 148 ? 35.913  20.917  -6.815  1.00 114.45 ? 148  TRP L CA  1 
ATOM   4415 C  C   . TRP C 3 148 ? 37.363  20.725  -6.362  1.00 120.62 ? 148  TRP L C   1 
ATOM   4416 O  O   . TRP C 3 148 ? 37.950  19.654  -6.549  1.00 120.87 ? 148  TRP L O   1 
ATOM   4417 C  CB  . TRP C 3 148 ? 35.010  20.198  -5.815  1.00 113.58 ? 148  TRP L CB  1 
ATOM   4418 C  CG  . TRP C 3 148 ? 33.584  20.624  -5.823  1.00 112.31 ? 148  TRP L CG  1 
ATOM   4419 C  CD1 . TRP C 3 148 ? 32.536  19.949  -6.368  1.00 112.93 ? 148  TRP L CD1 1 
ATOM   4420 C  CD2 . TRP C 3 148 ? 33.028  21.761  -5.155  1.00 112.07 ? 148  TRP L CD2 1 
ATOM   4421 N  NE1 . TRP C 3 148 ? 31.359  20.607  -6.101  1.00 110.81 ? 148  TRP L NE1 1 
ATOM   4422 C  CE2 . TRP C 3 148 ? 31.633  21.732  -5.372  1.00 113.45 ? 148  TRP L CE2 1 
ATOM   4423 C  CE3 . TRP C 3 148 ? 33.573  22.809  -4.395  1.00 115.28 ? 148  TRP L CE3 1 
ATOM   4424 C  CZ2 . TRP C 3 148 ? 30.774  22.689  -4.832  1.00 111.97 ? 148  TRP L CZ2 1 
ATOM   4425 C  CZ3 . TRP C 3 148 ? 32.722  23.774  -3.882  1.00 115.89 ? 148  TRP L CZ3 1 
ATOM   4426 C  CH2 . TRP C 3 148 ? 31.340  23.706  -4.098  1.00 113.96 ? 148  TRP L CH2 1 
ATOM   4427 N  N   . LYS C 3 149 ? 37.915  21.748  -5.725  1.00 118.78 ? 149  LYS L N   1 
ATOM   4428 C  CA  . LYS C 3 149 ? 39.251  21.691  -5.156  1.00 122.38 ? 149  LYS L CA  1 
ATOM   4429 C  C   . LYS C 3 149 ? 39.203  22.195  -3.721  1.00 127.27 ? 149  LYS L C   1 
ATOM   4430 O  O   . LYS C 3 149 ? 38.588  23.226  -3.447  1.00 125.49 ? 149  LYS L O   1 
ATOM   4431 C  CB  . LYS C 3 149 ? 40.268  22.485  -5.995  1.00 126.42 ? 149  LYS L CB  1 
ATOM   4432 C  CG  . LYS C 3 149 ? 40.668  21.789  -7.293  1.00 140.63 ? 149  LYS L CG  1 
ATOM   4433 C  CD  . LYS C 3 149 ? 41.830  22.478  -7.977  1.00 151.89 ? 149  LYS L CD  1 
ATOM   4434 C  CE  . LYS C 3 149 ? 42.393  21.636  -9.089  1.00 162.62 ? 149  LYS L CE  1 
ATOM   4435 N  NZ  . LYS C 3 149 ? 43.566  22.290  -9.718  1.00 174.25 ? 149  LYS L NZ  1 
ATOM   4436 N  N   . VAL C 3 150 ? 39.798  21.437  -2.799  1.00 126.09 ? 150  VAL L N   1 
ATOM   4437 C  CA  . VAL C 3 150 ? 39.879  21.814  -1.392  1.00 127.82 ? 150  VAL L CA  1 
ATOM   4438 C  C   . VAL C 3 150 ? 41.379  21.901  -1.077  1.00 135.03 ? 150  VAL L C   1 
ATOM   4439 O  O   . VAL C 3 150 ? 42.076  20.883  -1.137  1.00 136.38 ? 150  VAL L O   1 
ATOM   4440 C  CB  . VAL C 3 150 ? 39.094  20.853  -0.467  1.00 131.53 ? 150  VAL L CB  1 
ATOM   4441 C  CG1 . VAL C 3 150 ? 39.310  21.205  0.993   1.00 133.82 ? 150  VAL L CG1 1 
ATOM   4442 C  CG2 . VAL C 3 150 ? 37.608  20.869  -0.793  1.00 127.76 ? 150  VAL L CG2 1 
ATOM   4443 N  N   . ASP C 3 151 ? 41.879  23.135  -0.812  1.00 132.12 ? 151  ASP L N   1 
ATOM   4444 C  CA  . ASP C 3 151 ? 43.296  23.453  -0.586  1.00 134.90 ? 151  ASP L CA  1 
ATOM   4445 C  C   . ASP C 3 151 ? 44.163  22.881  -1.728  1.00 138.75 ? 151  ASP L C   1 
ATOM   4446 O  O   . ASP C 3 151 ? 45.159  22.207  -1.469  1.00 141.34 ? 151  ASP L O   1 
ATOM   4447 C  CB  . ASP C 3 151 ? 43.781  22.974  0.796   1.00 139.76 ? 151  ASP L CB  1 
ATOM   4448 C  CG  . ASP C 3 151 ? 43.395  23.833  1.982   1.00 147.17 ? 151  ASP L CG  1 
ATOM   4449 O  OD1 . ASP C 3 151 ? 43.352  25.073  1.835   1.00 146.14 ? 151  ASP L OD1 1 
ATOM   4450 O  OD2 . ASP C 3 151 ? 43.252  23.281  3.080   1.00 154.05 ? 151  ASP L OD2 1 
ATOM   4451 N  N   . ASN C 3 152 ? 43.717  23.107  -2.996  1.00 131.42 ? 152  ASN L N   1 
ATOM   4452 C  CA  . ASN C 3 152 ? 44.314  22.683  -4.278  1.00 130.14 ? 152  ASN L CA  1 
ATOM   4453 C  C   . ASN C 3 152 ? 44.228  21.167  -4.549  1.00 131.40 ? 152  ASN L C   1 
ATOM   4454 O  O   . ASN C 3 152 ? 44.742  20.710  -5.572  1.00 130.06 ? 152  ASN L O   1 
ATOM   4455 C  CB  . ASN C 3 152 ? 45.754  23.194  -4.460  1.00 134.66 ? 152  ASN L CB  1 
ATOM   4456 C  CG  . ASN C 3 152 ? 45.902  24.337  -5.445  1.00 158.64 ? 152  ASN L CG  1 
ATOM   4457 O  OD1 . ASN C 3 152 ? 45.380  24.318  -6.562  1.00 154.58 ? 152  ASN L OD1 1 
ATOM   4458 N  ND2 . ASN C 3 152 ? 46.646  25.361  -5.045  1.00 148.51 ? 152  ASN L ND2 1 
ATOM   4459 N  N   . ALA C 3 153 ? 43.534  20.403  -3.678  1.00 127.13 ? 153  ALA L N   1 
ATOM   4460 C  CA  . ALA C 3 153 ? 43.334  18.962  -3.860  1.00 126.23 ? 153  ALA L CA  1 
ATOM   4461 C  C   . ALA C 3 153 ? 41.989  18.676  -4.539  1.00 126.37 ? 153  ALA L C   1 
ATOM   4462 O  O   . ALA C 3 153 ? 40.925  18.987  -3.988  1.00 124.89 ? 153  ALA L O   1 
ATOM   4463 C  CB  . ALA C 3 153 ? 43.428  18.228  -2.530  1.00 129.27 ? 153  ALA L CB  1 
ATOM   4464 N  N   . LEU C 3 154 ? 42.053  18.094  -5.748  1.00 120.79 ? 154  LEU L N   1 
ATOM   4465 C  CA  . LEU C 3 154 ? 40.907  17.709  -6.570  1.00 116.74 ? 154  LEU L CA  1 
ATOM   4466 C  C   . LEU C 3 154 ? 40.054  16.710  -5.777  1.00 120.47 ? 154  LEU L C   1 
ATOM   4467 O  O   . LEU C 3 154 ? 40.573  15.704  -5.278  1.00 122.08 ? 154  LEU L O   1 
ATOM   4468 C  CB  . LEU C 3 154 ? 41.433  17.091  -7.883  1.00 116.12 ? 154  LEU L CB  1 
ATOM   4469 C  CG  . LEU C 3 154 ? 40.462  16.877  -9.033  1.00 116.78 ? 154  LEU L CG  1 
ATOM   4470 C  CD1 . LEU C 3 154 ? 41.134  17.162  -10.345 1.00 116.48 ? 154  LEU L CD1 1 
ATOM   4471 C  CD2 . LEU C 3 154 ? 39.927  15.468  -9.012  1.00 117.91 ? 154  LEU L CD2 1 
ATOM   4472 N  N   . GLN C 3 155 ? 38.762  17.037  -5.611  1.00 114.70 ? 155  GLN L N   1 
ATOM   4473 C  CA  . GLN C 3 155 ? 37.795  16.213  -4.882  1.00 113.93 ? 155  GLN L CA  1 
ATOM   4474 C  C   . GLN C 3 155 ? 37.167  15.180  -5.799  1.00 117.90 ? 155  GLN L C   1 
ATOM   4475 O  O   . GLN C 3 155 ? 36.954  15.468  -6.979  1.00 115.52 ? 155  GLN L O   1 
ATOM   4476 C  CB  . GLN C 3 155 ? 36.704  17.081  -4.248  1.00 113.00 ? 155  GLN L CB  1 
ATOM   4477 C  CG  . GLN C 3 155 ? 37.224  18.097  -3.236  1.00 110.14 ? 155  GLN L CG  1 
ATOM   4478 C  CD  . GLN C 3 155 ? 37.879  17.445  -2.041  1.00 108.82 ? 155  GLN L CD  1 
ATOM   4479 O  OE1 . GLN C 3 155 ? 37.222  16.861  -1.177  1.00 97.92  ? 155  GLN L OE1 1 
ATOM   4480 N  NE2 . GLN C 3 155 ? 39.189  17.528  -1.973  1.00 97.89  ? 155  GLN L NE2 1 
ATOM   4481 N  N   . SER C 3 156 ? 36.865  13.984  -5.256  1.00 116.45 ? 156  SER L N   1 
ATOM   4482 C  CA  . SER C 3 156 ? 36.269  12.866  -5.993  1.00 114.98 ? 156  SER L CA  1 
ATOM   4483 C  C   . SER C 3 156 ? 35.287  12.079  -5.126  1.00 120.84 ? 156  SER L C   1 
ATOM   4484 O  O   . SER C 3 156 ? 35.596  11.789  -3.970  1.00 123.70 ? 156  SER L O   1 
ATOM   4485 C  CB  . SER C 3 156 ? 37.355  11.940  -6.542  1.00 119.70 ? 156  SER L CB  1 
ATOM   4486 O  OG  . SER C 3 156 ? 38.641  12.204  -5.992  1.00 131.36 ? 156  SER L OG  1 
ATOM   4487 N  N   . GLY C 3 157 ? 34.115  11.777  -5.690  1.00 115.43 ? 157  GLY L N   1 
ATOM   4488 C  CA  . GLY C 3 157 ? 33.059  10.982  -5.069  1.00 114.86 ? 157  GLY L CA  1 
ATOM   4489 C  C   . GLY C 3 157 ? 32.287  11.596  -3.917  1.00 118.74 ? 157  GLY L C   1 
ATOM   4490 O  O   . GLY C 3 157 ? 31.421  10.923  -3.350  1.00 118.76 ? 157  GLY L O   1 
ATOM   4491 N  N   . ASN C 3 158 ? 32.572  12.867  -3.563  1.00 114.43 ? 158  ASN L N   1 
ATOM   4492 C  CA  . ASN C 3 158 ? 31.903  13.574  -2.458  1.00 113.75 ? 158  ASN L CA  1 
ATOM   4493 C  C   . ASN C 3 158 ? 31.032  14.760  -2.923  1.00 112.66 ? 158  ASN L C   1 
ATOM   4494 O  O   . ASN C 3 158 ? 30.694  15.640  -2.125  1.00 111.48 ? 158  ASN L O   1 
ATOM   4495 C  CB  . ASN C 3 158 ? 32.926  14.003  -1.390  1.00 118.83 ? 158  ASN L CB  1 
ATOM   4496 C  CG  . ASN C 3 158 ? 34.105  14.785  -1.923  1.00 149.07 ? 158  ASN L CG  1 
ATOM   4497 O  OD1 . ASN C 3 158 ? 34.225  15.059  -3.127  1.00 142.04 ? 158  ASN L OD1 1 
ATOM   4498 N  ND2 . ASN C 3 158 ? 34.991  15.198  -1.027  1.00 145.67 ? 158  ASN L ND2 1 
ATOM   4499 N  N   . SER C 3 159 ? 30.648  14.766  -4.209  1.00 106.21 ? 159  SER L N   1 
ATOM   4500 C  CA  . SER C 3 159 ? 29.800  15.820  -4.775  1.00 102.51 ? 159  SER L CA  1 
ATOM   4501 C  C   . SER C 3 159 ? 28.638  15.266  -5.586  1.00 98.33  ? 159  SER L C   1 
ATOM   4502 O  O   . SER C 3 159 ? 28.744  14.196  -6.187  1.00 96.53  ? 159  SER L O   1 
ATOM   4503 C  CB  . SER C 3 159 ? 30.619  16.820  -5.588  1.00 107.43 ? 159  SER L CB  1 
ATOM   4504 O  OG  . SER C 3 159 ? 31.241  16.207  -6.703  1.00 121.05 ? 159  SER L OG  1 
ATOM   4505 N  N   . GLN C 3 160 ? 27.516  15.982  -5.559  1.00 90.57  ? 160  GLN L N   1 
ATOM   4506 C  CA  . GLN C 3 160 ? 26.291  15.615  -6.273  1.00 86.71  ? 160  GLN L CA  1 
ATOM   4507 C  C   . GLN C 3 160 ? 25.796  16.811  -7.052  1.00 86.02  ? 160  GLN L C   1 
ATOM   4508 O  O   . GLN C 3 160 ? 25.751  17.928  -6.527  1.00 85.46  ? 160  GLN L O   1 
ATOM   4509 C  CB  . GLN C 3 160 ? 25.182  15.143  -5.310  1.00 87.84  ? 160  GLN L CB  1 
ATOM   4510 C  CG  . GLN C 3 160 ? 25.546  13.917  -4.478  1.00 102.83 ? 160  GLN L CG  1 
ATOM   4511 C  CD  . GLN C 3 160 ? 24.500  13.579  -3.445  1.00 116.25 ? 160  GLN L CD  1 
ATOM   4512 O  OE1 . GLN C 3 160 ? 24.123  14.407  -2.602  1.00 113.04 ? 160  GLN L OE1 1 
ATOM   4513 N  NE2 . GLN C 3 160 ? 24.061  12.330  -3.449  1.00 101.02 ? 160  GLN L NE2 1 
ATOM   4514 N  N   . GLU C 3 161 ? 25.414  16.575  -8.303  1.00 78.96  ? 161  GLU L N   1 
ATOM   4515 C  CA  . GLU C 3 161 ? 24.886  17.620  -9.168  1.00 75.64  ? 161  GLU L CA  1 
ATOM   4516 C  C   . GLU C 3 161 ? 23.401  17.453  -9.348  1.00 76.44  ? 161  GLU L C   1 
ATOM   4517 O  O   . GLU C 3 161 ? 22.876  16.336  -9.322  1.00 76.16  ? 161  GLU L O   1 
ATOM   4518 C  CB  . GLU C 3 161 ? 25.539  17.581  -10.550 1.00 76.03  ? 161  GLU L CB  1 
ATOM   4519 C  CG  . GLU C 3 161 ? 26.894  18.252  -10.635 1.00 90.65  ? 161  GLU L CG  1 
ATOM   4520 C  CD  . GLU C 3 161 ? 27.556  18.185  -12.002 1.00 114.45 ? 161  GLU L CD  1 
ATOM   4521 O  OE1 . GLU C 3 161 ? 26.837  17.994  -13.014 1.00 98.29  ? 161  GLU L OE1 1 
ATOM   4522 O  OE2 . GLU C 3 161 ? 28.794  18.379  -12.066 1.00 112.28 ? 161  GLU L OE2 1 
ATOM   4523 N  N   . SER C 3 162 ? 22.722  18.565  -9.565  1.00 70.71  ? 162  SER L N   1 
ATOM   4524 C  CA  . SER C 3 162 ? 21.301  18.586  -9.885  1.00 67.68  ? 162  SER L CA  1 
ATOM   4525 C  C   . SER C 3 162 ? 21.136  19.648  -10.970 1.00 70.18  ? 162  SER L C   1 
ATOM   4526 O  O   . SER C 3 162 ? 21.786  20.700  -10.915 1.00 70.61  ? 162  SER L O   1 
ATOM   4527 C  CB  . SER C 3 162 ? 20.453  18.881  -8.654  1.00 69.52  ? 162  SER L CB  1 
ATOM   4528 O  OG  . SER C 3 162 ? 19.083  18.880  -8.998  1.00 70.31  ? 162  SER L OG  1 
ATOM   4529 N  N   . VAL C 3 163 ? 20.372  19.317  -12.015 1.00 64.28  ? 163  VAL L N   1 
ATOM   4530 C  CA  . VAL C 3 163 ? 20.139  20.221  -13.150 1.00 62.37  ? 163  VAL L CA  1 
ATOM   4531 C  C   . VAL C 3 163 ? 18.631  20.501  -13.252 1.00 64.02  ? 163  VAL L C   1 
ATOM   4532 O  O   . VAL C 3 163 ? 17.814  19.581  -13.149 1.00 61.18  ? 163  VAL L O   1 
ATOM   4533 C  CB  . VAL C 3 163 ? 20.713  19.661  -14.492 1.00 64.93  ? 163  VAL L CB  1 
ATOM   4534 C  CG1 . VAL C 3 163 ? 20.751  20.722  -15.587 1.00 63.60  ? 163  VAL L CG1 1 
ATOM   4535 C  CG2 . VAL C 3 163 ? 22.095  19.051  -14.304 1.00 66.23  ? 163  VAL L CG2 1 
ATOM   4536 N  N   . THR C 3 164 ? 18.264  21.769  -13.446 1.00 61.86  ? 164  THR L N   1 
ATOM   4537 C  CA  . THR C 3 164 ? 16.864  22.121  -13.619 1.00 61.13  ? 164  THR L CA  1 
ATOM   4538 C  C   . THR C 3 164 ? 16.460  21.738  -15.042 1.00 67.20  ? 164  THR L C   1 
ATOM   4539 O  O   . THR C 3 164 ? 17.311  21.555  -15.925 1.00 66.31  ? 164  THR L O   1 
ATOM   4540 C  CB  . THR C 3 164 ? 16.623  23.633  -13.429 1.00 63.37  ? 164  THR L CB  1 
ATOM   4541 O  OG1 . THR C 3 164 ? 17.394  24.386  -14.377 1.00 62.78  ? 164  THR L OG1 1 
ATOM   4542 C  CG2 . THR C 3 164 ? 16.853  24.096  -12.004 1.00 59.04  ? 164  THR L CG2 1 
ATOM   4543 N  N   . GLU C 3 165 ? 15.145  21.656  -15.270 1.00 65.26  ? 165  GLU L N   1 
ATOM   4544 C  CA  . GLU C 3 165 ? 14.590  21.428  -16.591 1.00 64.49  ? 165  GLU L CA  1 
ATOM   4545 C  C   . GLU C 3 165 ? 14.867  22.726  -17.355 1.00 67.86  ? 165  GLU L C   1 
ATOM   4546 O  O   . GLU C 3 165 ? 15.136  23.754  -16.719 1.00 68.33  ? 165  GLU L O   1 
ATOM   4547 C  CB  . GLU C 3 165 ? 13.069  21.170  -16.518 1.00 65.53  ? 165  GLU L CB  1 
ATOM   4548 C  CG  . GLU C 3 165 ? 12.358  21.404  -15.178 1.00 80.92  ? 165  GLU L CG  1 
ATOM   4549 C  CD  . GLU C 3 165 ? 12.307  22.813  -14.603 1.00 97.04  ? 165  GLU L CD  1 
ATOM   4550 O  OE1 . GLU C 3 165 ? 11.317  23.547  -14.849 1.00 75.56  ? 165  GLU L OE1 1 
ATOM   4551 O  OE2 . GLU C 3 165 ? 13.230  23.143  -13.824 1.00 92.29  ? 165  GLU L OE2 1 
ATOM   4552 N  N   . GLN C 3 166 ? 14.826  22.687  -18.691 1.00 63.17  ? 166  GLN L N   1 
ATOM   4553 C  CA  . GLN C 3 166 ? 15.032  23.876  -19.511 1.00 62.78  ? 166  GLN L CA  1 
ATOM   4554 C  C   . GLN C 3 166 ? 13.993  24.960  -19.138 1.00 69.55  ? 166  GLN L C   1 
ATOM   4555 O  O   . GLN C 3 166 ? 12.795  24.667  -19.032 1.00 69.08  ? 166  GLN L O   1 
ATOM   4556 C  CB  . GLN C 3 166 ? 14.945  23.494  -20.983 1.00 62.08  ? 166  GLN L CB  1 
ATOM   4557 C  CG  . GLN C 3 166 ? 15.366  24.603  -21.914 1.00 51.25  ? 166  GLN L CG  1 
ATOM   4558 C  CD  . GLN C 3 166 ? 15.617  24.096  -23.323 1.00 48.09  ? 166  GLN L CD  1 
ATOM   4559 O  OE1 . GLN C 3 166 ? 14.960  23.147  -23.838 1.00 27.10  ? 166  GLN L OE1 1 
ATOM   4560 N  NE2 . GLN C 3 166 ? 16.589  24.721  -23.980 1.00 39.69  ? 166  GLN L NE2 1 
ATOM   4561 N  N   . ASP C 3 167 ? 14.480  26.186  -18.873 1.00 68.07  ? 167  ASP L N   1 
ATOM   4562 C  CA  . ASP C 3 167 ? 13.656  27.312  -18.439 1.00 68.76  ? 167  ASP L CA  1 
ATOM   4563 C  C   . ASP C 3 167 ? 12.620  27.676  -19.487 1.00 72.14  ? 167  ASP L C   1 
ATOM   4564 O  O   . ASP C 3 167 ? 12.939  27.733  -20.684 1.00 71.96  ? 167  ASP L O   1 
ATOM   4565 C  CB  . ASP C 3 167 ? 14.536  28.517  -18.072 1.00 72.39  ? 167  ASP L CB  1 
ATOM   4566 C  CG  . ASP C 3 167 ? 13.808  29.630  -17.337 1.00 85.39  ? 167  ASP L CG  1 
ATOM   4567 O  OD1 . ASP C 3 167 ? 13.614  29.503  -16.107 1.00 85.98  ? 167  ASP L OD1 1 
ATOM   4568 O  OD2 . ASP C 3 167 ? 13.422  30.622  -17.996 1.00 92.87  ? 167  ASP L OD2 1 
ATOM   4569 N  N   . SER C 3 168 ? 11.367  27.888  -19.012 1.00 67.43  ? 168  SER L N   1 
ATOM   4570 C  CA  . SER C 3 168 ? 10.182  28.226  -19.810 1.00 65.36  ? 168  SER L CA  1 
ATOM   4571 C  C   . SER C 3 168 ? 10.262  29.605  -20.401 1.00 67.17  ? 168  SER L C   1 
ATOM   4572 O  O   . SER C 3 168 ? 9.659   29.836  -21.437 1.00 67.05  ? 168  SER L O   1 
ATOM   4573 C  CB  . SER C 3 168 ? 8.905   28.092  -18.984 1.00 67.65  ? 168  SER L CB  1 
ATOM   4574 O  OG  . SER C 3 168 ? 8.878   29.048  -17.937 1.00 74.20  ? 168  SER L OG  1 
ATOM   4575 N  N   . LYS C 3 169 ? 10.972  30.521  -19.751 1.00 63.03  ? 169  LYS L N   1 
ATOM   4576 C  CA  . LYS C 3 169 ? 11.099  31.893  -20.247 1.00 63.31  ? 169  LYS L CA  1 
ATOM   4577 C  C   . LYS C 3 169 ? 12.340  32.111  -21.146 1.00 64.34  ? 169  LYS L C   1 
ATOM   4578 O  O   . LYS C 3 169 ? 12.208  32.729  -22.208 1.00 62.30  ? 169  LYS L O   1 
ATOM   4579 C  CB  . LYS C 3 169 ? 11.081  32.919  -19.086 1.00 67.48  ? 169  LYS L CB  1 
ATOM   4580 C  CG  . LYS C 3 169 ? 9.784   32.986  -18.271 1.00 73.68  ? 169  LYS L CG  1 
ATOM   4581 C  CD  . LYS C 3 169 ? 9.899   34.085  -17.176 1.00 77.67  ? 169  LYS L CD  1 
ATOM   4582 C  CE  . LYS C 3 169 ? 8.793   34.037  -16.138 1.00 70.25  ? 169  LYS L CE  1 
ATOM   4583 N  NZ  . LYS C 3 169 ? 9.138   34.741  -14.865 1.00 60.24  ? 169  LYS L NZ  1 
ATOM   4584 N  N   . ASP C 3 170 ? 13.533  31.613  -20.733 1.00 60.60  ? 170  ASP L N   1 
ATOM   4585 C  CA  . ASP C 3 170 ? 14.739  31.894  -21.505 1.00 61.09  ? 170  ASP L CA  1 
ATOM   4586 C  C   . ASP C 3 170 ? 15.474  30.694  -22.101 1.00 66.10  ? 170  ASP L C   1 
ATOM   4587 O  O   . ASP C 3 170 ? 16.566  30.896  -22.631 1.00 67.68  ? 170  ASP L O   1 
ATOM   4588 C  CB  . ASP C 3 170 ? 15.720  32.754  -20.685 1.00 64.17  ? 170  ASP L CB  1 
ATOM   4589 C  CG  . ASP C 3 170 ? 16.364  32.115  -19.472 1.00 70.68  ? 170  ASP L CG  1 
ATOM   4590 O  OD1 . ASP C 3 170 ? 16.168  30.902  -19.262 1.00 69.90  ? 170  ASP L OD1 1 
ATOM   4591 O  OD2 . ASP C 3 170 ? 17.106  32.816  -18.770 1.00 75.89  ? 170  ASP L OD2 1 
ATOM   4592 N  N   . SER C 3 171 ? 14.897  29.469  -22.038 1.00 61.08  ? 171  SER L N   1 
ATOM   4593 C  CA  . SER C 3 171 ? 15.465  28.230  -22.620 1.00 59.49  ? 171  SER L CA  1 
ATOM   4594 C  C   . SER C 3 171 ? 16.892  27.858  -22.102 1.00 63.81  ? 171  SER L C   1 
ATOM   4595 O  O   . SER C 3 171 ? 17.624  27.118  -22.768 1.00 64.77  ? 171  SER L O   1 
ATOM   4596 C  CB  . SER C 3 171 ? 15.428  28.273  -24.143 1.00 61.17  ? 171  SER L CB  1 
ATOM   4597 O  OG  . SER C 3 171 ? 14.127  28.610  -24.591 1.00 64.74  ? 171  SER L OG  1 
ATOM   4598 N  N   . THR C 3 172 ? 17.259  28.332  -20.894 1.00 59.24  ? 172  THR L N   1 
ATOM   4599 C  CA  . THR C 3 172 ? 18.556  28.014  -20.285 1.00 59.32  ? 172  THR L CA  1 
ATOM   4600 C  C   . THR C 3 172 ? 18.421  26.896  -19.262 1.00 61.88  ? 172  THR L C   1 
ATOM   4601 O  O   . THR C 3 172 ? 17.308  26.499  -18.892 1.00 60.42  ? 172  THR L O   1 
ATOM   4602 C  CB  . THR C 3 172 ? 19.188  29.228  -19.600 1.00 66.01  ? 172  THR L CB  1 
ATOM   4603 O  OG1 . THR C 3 172 ? 18.365  29.635  -18.509 1.00 69.28  ? 172  THR L OG1 1 
ATOM   4604 C  CG2 . THR C 3 172 ? 19.482  30.367  -20.550 1.00 61.98  ? 172  THR L CG2 1 
ATOM   4605 N  N   . TYR C 3 173 ? 19.570  26.424  -18.783 1.00 58.62  ? 173  TYR L N   1 
ATOM   4606 C  CA  . TYR C 3 173 ? 19.683  25.415  -17.751 1.00 58.52  ? 173  TYR L CA  1 
ATOM   4607 C  C   . TYR C 3 173 ? 20.421  26.027  -16.588 1.00 62.34  ? 173  TYR L C   1 
ATOM   4608 O  O   . TYR C 3 173 ? 21.203  26.954  -16.775 1.00 63.34  ? 173  TYR L O   1 
ATOM   4609 C  CB  . TYR C 3 173 ? 20.482  24.201  -18.270 1.00 60.22  ? 173  TYR L CB  1 
ATOM   4610 C  CG  . TYR C 3 173 ? 19.773  23.444  -19.367 1.00 60.98  ? 173  TYR L CG  1 
ATOM   4611 C  CD1 . TYR C 3 173 ? 19.957  23.784  -20.703 1.00 62.54  ? 173  TYR L CD1 1 
ATOM   4612 C  CD2 . TYR C 3 173 ? 18.878  22.420  -19.067 1.00 61.04  ? 173  TYR L CD2 1 
ATOM   4613 C  CE1 . TYR C 3 173 ? 19.287  23.111  -21.718 1.00 62.27  ? 173  TYR L CE1 1 
ATOM   4614 C  CE2 . TYR C 3 173 ? 18.209  21.733  -20.073 1.00 61.06  ? 173  TYR L CE2 1 
ATOM   4615 C  CZ  . TYR C 3 173 ? 18.423  22.078  -21.399 1.00 70.43  ? 173  TYR L CZ  1 
ATOM   4616 O  OH  . TYR C 3 173 ? 17.747  21.429  -22.398 1.00 73.83  ? 173  TYR L OH  1 
ATOM   4617 N  N   . SER C 3 174 ? 20.173  25.516  -15.389 1.00 57.97  ? 174  SER L N   1 
ATOM   4618 C  CA  . SER C 3 174 ? 20.900  25.905  -14.198 1.00 59.29  ? 174  SER L CA  1 
ATOM   4619 C  C   . SER C 3 174 ? 21.320  24.650  -13.502 1.00 62.07  ? 174  SER L C   1 
ATOM   4620 O  O   . SER C 3 174 ? 20.632  23.641  -13.593 1.00 60.15  ? 174  SER L O   1 
ATOM   4621 C  CB  . SER C 3 174 ? 20.083  26.811  -13.293 1.00 64.56  ? 174  SER L CB  1 
ATOM   4622 O  OG  . SER C 3 174 ? 19.940  28.072  -13.921 1.00 76.87  ? 174  SER L OG  1 
ATOM   4623 N  N   . LEU C 3 175 ? 22.484  24.675  -12.875 1.00 60.23  ? 175  LEU L N   1 
ATOM   4624 C  CA  . LEU C 3 175 ? 23.011  23.483  -12.240 1.00 60.82  ? 175  LEU L CA  1 
ATOM   4625 C  C   . LEU C 3 175 ? 23.554  23.808  -10.855 1.00 67.19  ? 175  LEU L C   1 
ATOM   4626 O  O   . LEU C 3 175 ? 24.116  24.881  -10.652 1.00 66.81  ? 175  LEU L O   1 
ATOM   4627 C  CB  . LEU C 3 175 ? 24.100  22.894  -13.158 1.00 60.74  ? 175  LEU L CB  1 
ATOM   4628 C  CG  . LEU C 3 175 ? 24.819  21.616  -12.745 1.00 66.03  ? 175  LEU L CG  1 
ATOM   4629 C  CD1 . LEU C 3 175 ? 25.291  20.866  -13.972 1.00 65.53  ? 175  LEU L CD1 1 
ATOM   4630 C  CD2 . LEU C 3 175 ? 26.043  21.927  -11.889 1.00 70.93  ? 175  LEU L CD2 1 
ATOM   4631 N  N   . SER C 3 176 ? 23.378  22.884  -9.900  1.00 64.96  ? 176  SER L N   1 
ATOM   4632 C  CA  . SER C 3 176 ? 23.948  23.034  -8.569  1.00 66.24  ? 176  SER L CA  1 
ATOM   4633 C  C   . SER C 3 176 ? 24.838  21.851  -8.338  1.00 70.99  ? 176  SER L C   1 
ATOM   4634 O  O   . SER C 3 176 ? 24.457  20.725  -8.646  1.00 69.34  ? 176  SER L O   1 
ATOM   4635 C  CB  . SER C 3 176 ? 22.876  23.102  -7.480  1.00 69.02  ? 176  SER L CB  1 
ATOM   4636 O  OG  . SER C 3 176 ? 22.204  21.869  -7.266  1.00 74.57  ? 176  SER L OG  1 
ATOM   4637 N  N   . SER C 3 177 ? 26.029  22.100  -7.819  1.00 70.68  ? 177  SER L N   1 
ATOM   4638 C  CA  . SER C 3 177 ? 26.956  21.046  -7.432  1.00 72.41  ? 177  SER L CA  1 
ATOM   4639 C  C   . SER C 3 177 ? 27.162  21.232  -5.936  1.00 77.55  ? 177  SER L C   1 
ATOM   4640 O  O   . SER C 3 177 ? 27.499  22.333  -5.500  1.00 77.68  ? 177  SER L O   1 
ATOM   4641 C  CB  . SER C 3 177 ? 28.274  21.142  -8.197  1.00 77.02  ? 177  SER L CB  1 
ATOM   4642 O  OG  . SER C 3 177 ? 29.138  20.097  -7.790  1.00 86.67  ? 177  SER L OG  1 
ATOM   4643 N  N   . THR C 3 178 ? 26.861  20.192  -5.154  1.00 75.00  ? 178  THR L N   1 
ATOM   4644 C  CA  . THR C 3 178 ? 26.974  20.216  -3.704  1.00 77.67  ? 178  THR L CA  1 
ATOM   4645 C  C   . THR C 3 178 ? 28.099  19.294  -3.249  1.00 87.64  ? 178  THR L C   1 
ATOM   4646 O  O   . THR C 3 178 ? 28.014  18.081  -3.460  1.00 86.95  ? 178  THR L O   1 
ATOM   4647 C  CB  . THR C 3 178 ? 25.631  19.828  -3.062  1.00 83.68  ? 178  THR L CB  1 
ATOM   4648 O  OG1 . THR C 3 178 ? 24.595  20.668  -3.572  1.00 84.89  ? 178  THR L OG1 1 
ATOM   4649 C  CG2 . THR C 3 178 ? 25.656  19.901  -1.538  1.00 82.92  ? 178  THR L CG2 1 
ATOM   4650 N  N   . LEU C 3 179 ? 29.144  19.874  -2.612  1.00 89.28  ? 179  LEU L N   1 
ATOM   4651 C  CA  . LEU C 3 179 ? 30.268  19.141  -2.027  1.00 92.91  ? 179  LEU L CA  1 
ATOM   4652 C  C   . LEU C 3 179 ? 29.877  18.826  -0.569  1.00 100.07 ? 179  LEU L C   1 
ATOM   4653 O  O   . LEU C 3 179 ? 29.577  19.754  0.196   1.00 99.52  ? 179  LEU L O   1 
ATOM   4654 C  CB  . LEU C 3 179 ? 31.558  19.995  -2.053  1.00 94.82  ? 179  LEU L CB  1 
ATOM   4655 C  CG  . LEU C 3 179 ? 32.920  19.265  -2.232  1.00 101.29 ? 179  LEU L CG  1 
ATOM   4656 C  CD1 . LEU C 3 179 ? 34.073  20.123  -1.838  1.00 103.48 ? 179  LEU L CD1 1 
ATOM   4657 C  CD2 . LEU C 3 179 ? 33.022  17.999  -1.450  1.00 105.41 ? 179  LEU L CD2 1 
ATOM   4658 N  N   . THR C 3 180 ? 29.846  17.524  -0.200  1.00 98.47  ? 180  THR L N   1 
ATOM   4659 C  CA  . THR C 3 180 ? 29.465  17.117  1.152   1.00 100.31 ? 180  THR L CA  1 
ATOM   4660 C  C   . THR C 3 180 ? 30.654  16.558  1.916   1.00 109.17 ? 180  THR L C   1 
ATOM   4661 O  O   . THR C 3 180 ? 31.331  15.631  1.463   1.00 109.23 ? 180  THR L O   1 
ATOM   4662 C  CB  . THR C 3 180 ? 28.241  16.188  1.143   1.00 104.72 ? 180  THR L CB  1 
ATOM   4663 O  OG1 . THR C 3 180 ? 27.154  16.870  0.506   1.00 101.61 ? 180  THR L OG1 1 
ATOM   4664 C  CG2 . THR C 3 180 ? 27.807  15.763  2.550   1.00 103.36 ? 180  THR L CG2 1 
ATOM   4665 N  N   . LEU C 3 181 ? 30.902  17.156  3.083   1.00 109.30 ? 181  LEU L N   1 
ATOM   4666 C  CA  . LEU C 3 181 ? 31.979  16.784  3.984   1.00 113.31 ? 181  LEU L CA  1 
ATOM   4667 C  C   . LEU C 3 181 ? 31.467  16.793  5.407   1.00 119.88 ? 181  LEU L C   1 
ATOM   4668 O  O   . LEU C 3 181 ? 30.498  17.484  5.726   1.00 117.58 ? 181  LEU L O   1 
ATOM   4669 C  CB  . LEU C 3 181 ? 33.146  17.799  3.909   1.00 115.08 ? 181  LEU L CB  1 
ATOM   4670 C  CG  . LEU C 3 181 ? 33.692  18.247  2.551   1.00 119.00 ? 181  LEU L CG  1 
ATOM   4671 C  CD1 . LEU C 3 181 ? 34.502  19.510  2.696   1.00 120.53 ? 181  LEU L CD1 1 
ATOM   4672 C  CD2 . LEU C 3 181 ? 34.524  17.159  1.873   1.00 123.80 ? 181  LEU L CD2 1 
ATOM   4673 N  N   . SER C 3 182 ? 32.171  16.082  6.283   1.00 121.58 ? 182  SER L N   1 
ATOM   4674 C  CA  . SER C 3 182 ? 31.918  16.098  7.716   1.00 124.41 ? 182  SER L CA  1 
ATOM   4675 C  C   . SER C 3 182 ? 32.442  17.455  8.214   1.00 130.49 ? 182  SER L C   1 
ATOM   4676 O  O   . SER C 3 182 ? 33.318  18.045  7.568   1.00 129.50 ? 182  SER L O   1 
ATOM   4677 C  CB  . SER C 3 182 ? 32.684  14.968  8.401   1.00 132.33 ? 182  SER L CB  1 
ATOM   4678 O  OG  . SER C 3 182 ? 34.059  14.956  8.046   1.00 144.87 ? 182  SER L OG  1 
ATOM   4679 N  N   . LYS C 3 183 ? 31.902  17.959  9.338   1.00 129.52 ? 183  LYS L N   1 
ATOM   4680 C  CA  . LYS C 3 183 ? 32.359  19.218  9.939   1.00 131.38 ? 183  LYS L CA  1 
ATOM   4681 C  C   . LYS C 3 183 ? 33.875  19.104  10.241  1.00 141.15 ? 183  LYS L C   1 
ATOM   4682 O  O   . LYS C 3 183 ? 34.614  20.062  10.007  1.00 141.41 ? 183  LYS L O   1 
ATOM   4683 C  CB  . LYS C 3 183 ? 31.553  19.535  11.213  1.00 134.36 ? 183  LYS L CB  1 
ATOM   4684 C  CG  . LYS C 3 183 ? 31.906  20.856  11.890  1.00 149.27 ? 183  LYS L CG  1 
ATOM   4685 C  CD  . LYS C 3 183 ? 31.245  20.965  13.254  1.00 158.16 ? 183  LYS L CD  1 
ATOM   4686 C  CE  . LYS C 3 183 ? 31.415  22.319  13.895  1.00 163.78 ? 183  LYS L CE  1 
ATOM   4687 N  NZ  . LYS C 3 183 ? 30.458  22.514  15.013  1.00 170.39 ? 183  LYS L NZ  1 
ATOM   4688 N  N   . ALA C 3 184 ? 34.327  17.905  10.695  1.00 141.65 ? 184  ALA L N   1 
ATOM   4689 C  CA  . ALA C 3 184 ? 35.727  17.572  10.998  1.00 145.65 ? 184  ALA L CA  1 
ATOM   4690 C  C   . ALA C 3 184 ? 36.644  17.832  9.791   1.00 149.61 ? 184  ALA L C   1 
ATOM   4691 O  O   . ALA C 3 184 ? 37.622  18.573  9.926   1.00 150.79 ? 184  ALA L O   1 
ATOM   4692 C  CB  . ALA C 3 184 ? 35.836  16.120  11.447  1.00 148.57 ? 184  ALA L CB  1 
ATOM   4693 N  N   . ASP C 3 185 ? 36.295  17.273  8.608   1.00 143.91 ? 185  ASP L N   1 
ATOM   4694 C  CA  . ASP C 3 185 ? 37.049  17.487  7.370   1.00 142.73 ? 185  ASP L CA  1 
ATOM   4695 C  C   . ASP C 3 185 ? 36.984  18.945  6.907   1.00 144.97 ? 185  ASP L C   1 
ATOM   4696 O  O   . ASP C 3 185 ? 38.005  19.475  6.473   1.00 146.15 ? 185  ASP L O   1 
ATOM   4697 C  CB  . ASP C 3 185 ? 36.581  16.545  6.251   1.00 141.76 ? 185  ASP L CB  1 
ATOM   4698 C  CG  . ASP C 3 185 ? 37.180  15.155  6.291   1.00 151.29 ? 185  ASP L CG  1 
ATOM   4699 O  OD1 . ASP C 3 185 ? 38.106  14.928  7.104   1.00 154.91 ? 185  ASP L OD1 1 
ATOM   4700 O  OD2 . ASP C 3 185 ? 36.745  14.302  5.489   1.00 153.66 ? 185  ASP L OD2 1 
ATOM   4701 N  N   . TYR C 3 186 ? 35.809  19.600  7.028   1.00 137.92 ? 186  TYR L N   1 
ATOM   4702 C  CA  . TYR C 3 186 ? 35.631  21.002  6.633   1.00 135.43 ? 186  TYR L CA  1 
ATOM   4703 C  C   . TYR C 3 186 ? 36.534  21.966  7.426   1.00 138.52 ? 186  TYR L C   1 
ATOM   4704 O  O   . TYR C 3 186 ? 37.142  22.863  6.840   1.00 137.61 ? 186  TYR L O   1 
ATOM   4705 C  CB  . TYR C 3 186 ? 34.146  21.421  6.717   1.00 134.61 ? 186  TYR L CB  1 
ATOM   4706 C  CG  . TYR C 3 186 ? 33.901  22.880  6.372   1.00 135.99 ? 186  TYR L CG  1 
ATOM   4707 C  CD1 . TYR C 3 186 ? 33.975  23.330  5.052   1.00 135.93 ? 186  TYR L CD1 1 
ATOM   4708 C  CD2 . TYR C 3 186 ? 33.640  23.819  7.367   1.00 138.00 ? 186  TYR L CD2 1 
ATOM   4709 C  CE1 . TYR C 3 186 ? 33.814  24.680  4.735   1.00 135.71 ? 186  TYR L CE1 1 
ATOM   4710 C  CE2 . TYR C 3 186 ? 33.467  25.169  7.060   1.00 137.86 ? 186  TYR L CE2 1 
ATOM   4711 C  CZ  . TYR C 3 186 ? 33.555  25.596  5.742   1.00 143.65 ? 186  TYR L CZ  1 
ATOM   4712 O  OH  . TYR C 3 186 ? 33.377  26.922  5.420   1.00 144.34 ? 186  TYR L OH  1 
ATOM   4713 N  N   . GLU C 3 187 ? 36.641  21.754  8.745   1.00 135.34 ? 187  GLU L N   1 
ATOM   4714 C  CA  . GLU C 3 187 ? 37.443  22.606  9.617   1.00 136.93 ? 187  GLU L CA  1 
ATOM   4715 C  C   . GLU C 3 187 ? 38.940  22.398  9.482   1.00 142.79 ? 187  GLU L C   1 
ATOM   4716 O  O   . GLU C 3 187 ? 39.693  23.248  9.957   1.00 144.90 ? 187  GLU L O   1 
ATOM   4717 C  CB  . GLU C 3 187 ? 37.022  22.495  11.083  1.00 139.96 ? 187  GLU L CB  1 
ATOM   4718 C  CG  . GLU C 3 187 ? 35.564  22.776  11.377  1.00 147.88 ? 187  GLU L CG  1 
ATOM   4719 C  CD  . GLU C 3 187 ? 34.847  24.084  11.124  1.00 167.92 ? 187  GLU L CD  1 
ATOM   4720 O  OE1 . GLU C 3 187 ? 33.708  24.209  11.625  1.00 159.66 ? 187  GLU L OE1 1 
ATOM   4721 O  OE2 . GLU C 3 187 ? 35.405  24.979  10.450  1.00 161.46 ? 187  GLU L OE2 1 
ATOM   4722 N  N   . LYS C 3 188 ? 39.397  21.307  8.839   1.00 138.86 ? 188  LYS L N   1 
ATOM   4723 C  CA  . LYS C 3 188 ? 40.838  21.140  8.678   1.00 141.78 ? 188  LYS L CA  1 
ATOM   4724 C  C   . LYS C 3 188 ? 41.350  21.702  7.336   1.00 144.07 ? 188  LYS L C   1 
ATOM   4725 O  O   . LYS C 3 188 ? 42.535  21.555  7.029   1.00 145.90 ? 188  LYS L O   1 
ATOM   4726 C  CB  . LYS C 3 188 ? 41.286  19.691  8.931   1.00 146.82 ? 188  LYS L CB  1 
ATOM   4727 C  CG  . LYS C 3 188 ? 42.104  19.543  10.208  1.00 163.61 ? 188  LYS L CG  1 
ATOM   4728 C  CD  . LYS C 3 188 ? 41.254  19.472  11.487  1.00 171.09 ? 188  LYS L CD  1 
ATOM   4729 C  CE  . LYS C 3 188 ? 42.044  19.748  12.758  1.00 178.01 ? 188  LYS L CE  1 
ATOM   4730 N  NZ  . LYS C 3 188 ? 42.977  18.646  13.112  1.00 181.56 ? 188  LYS L NZ  1 
ATOM   4731 N  N   . HIS C 3 189 ? 40.478  22.407  6.573   1.00 136.90 ? 189  HIS L N   1 
ATOM   4732 C  CA  . HIS C 3 189 ? 40.877  23.017  5.303   1.00 135.01 ? 189  HIS L CA  1 
ATOM   4733 C  C   . HIS C 3 189 ? 40.460  24.490  5.163   1.00 138.42 ? 189  HIS L C   1 
ATOM   4734 O  O   . HIS C 3 189 ? 39.473  24.918  5.756   1.00 136.67 ? 189  HIS L O   1 
ATOM   4735 C  CB  . HIS C 3 189 ? 40.411  22.188  4.117   1.00 132.63 ? 189  HIS L CB  1 
ATOM   4736 C  CG  . HIS C 3 189 ? 40.983  20.804  4.095   1.00 137.39 ? 189  HIS L CG  1 
ATOM   4737 N  ND1 . HIS C 3 189 ? 42.220  20.541  3.532   1.00 140.76 ? 189  HIS L ND1 1 
ATOM   4738 C  CD2 . HIS C 3 189 ? 40.438  19.639  4.510   1.00 138.69 ? 189  HIS L CD2 1 
ATOM   4739 C  CE1 . HIS C 3 189 ? 42.402  19.237  3.660   1.00 141.05 ? 189  HIS L CE1 1 
ATOM   4740 N  NE2 . HIS C 3 189 ? 41.351  18.650  4.230   1.00 140.29 ? 189  HIS L NE2 1 
ATOM   4741 N  N   . LYS C 3 190 ? 41.240  25.270  4.393   1.00 135.79 ? 190  LYS L N   1 
ATOM   4742 C  CA  . LYS C 3 190 ? 41.009  26.709  4.219   1.00 134.38 ? 190  LYS L CA  1 
ATOM   4743 C  C   . LYS C 3 190 ? 40.318  27.115  2.907   1.00 134.80 ? 190  LYS L C   1 
ATOM   4744 O  O   . LYS C 3 190 ? 39.257  27.740  2.959   1.00 131.91 ? 190  LYS L O   1 
ATOM   4745 C  CB  . LYS C 3 190 ? 42.326  27.490  4.380   1.00 139.57 ? 190  LYS L CB  1 
ATOM   4746 C  CG  . LYS C 3 190 ? 42.797  27.682  5.817   1.00 152.56 ? 190  LYS L CG  1 
ATOM   4747 C  CD  . LYS C 3 190 ? 44.169  28.372  5.844   1.00 160.92 ? 190  LYS L CD  1 
ATOM   4748 C  CE  . LYS C 3 190 ? 44.901  28.157  7.147   1.00 167.05 ? 190  LYS L CE  1 
ATOM   4749 N  NZ  . LYS C 3 190 ? 46.179  28.907  7.190   1.00 172.63 ? 190  LYS L NZ  1 
ATOM   4750 N  N   . VAL C 3 191 ? 40.943  26.800  1.742   1.00 130.95 ? 191  VAL L N   1 
ATOM   4751 C  CA  . VAL C 3 191 ? 40.496  27.209  0.397   1.00 127.16 ? 191  VAL L CA  1 
ATOM   4752 C  C   . VAL C 3 191 ? 39.523  26.212  -0.242  1.00 125.57 ? 191  VAL L C   1 
ATOM   4753 O  O   . VAL C 3 191 ? 39.900  25.077  -0.528  1.00 125.26 ? 191  VAL L O   1 
ATOM   4754 C  CB  . VAL C 3 191 ? 41.687  27.539  -0.560  1.00 132.45 ? 191  VAL L CB  1 
ATOM   4755 C  CG1 . VAL C 3 191 ? 41.209  28.316  -1.784  1.00 129.48 ? 191  VAL L CG1 1 
ATOM   4756 C  CG2 . VAL C 3 191 ? 42.790  28.317  0.155   1.00 135.71 ? 191  VAL L CG2 1 
ATOM   4757 N  N   . TYR C 3 192 ? 38.282  26.667  -0.494  1.00 117.97 ? 192  TYR L N   1 
ATOM   4758 C  CA  . TYR C 3 192 ? 37.207  25.895  -1.133  1.00 114.39 ? 192  TYR L CA  1 
ATOM   4759 C  C   . TYR C 3 192 ? 36.898  26.516  -2.491  1.00 115.08 ? 192  TYR L C   1 
ATOM   4760 O  O   . TYR C 3 192 ? 36.456  27.655  -2.550  1.00 113.47 ? 192  TYR L O   1 
ATOM   4761 C  CB  . TYR C 3 192 ? 35.960  25.826  -0.224  1.00 114.15 ? 192  TYR L CB  1 
ATOM   4762 C  CG  . TYR C 3 192 ? 36.202  24.965  0.996   1.00 118.21 ? 192  TYR L CG  1 
ATOM   4763 C  CD1 . TYR C 3 192 ? 36.838  25.480  2.123   1.00 123.42 ? 192  TYR L CD1 1 
ATOM   4764 C  CD2 . TYR C 3 192 ? 35.917  23.603  0.979   1.00 118.26 ? 192  TYR L CD2 1 
ATOM   4765 C  CE1 . TYR C 3 192 ? 37.172  24.663  3.206   1.00 126.82 ? 192  TYR L CE1 1 
ATOM   4766 C  CE2 . TYR C 3 192 ? 36.212  22.785  2.067   1.00 121.39 ? 192  TYR L CE2 1 
ATOM   4767 C  CZ  . TYR C 3 192 ? 36.857  23.314  3.170   1.00 132.18 ? 192  TYR L CZ  1 
ATOM   4768 O  OH  . TYR C 3 192 ? 37.153  22.495  4.230   1.00 136.19 ? 192  TYR L OH  1 
ATOM   4769 N  N   . ALA C 3 193 ? 37.195  25.794  -3.579  1.00 110.67 ? 193  ALA L N   1 
ATOM   4770 C  CA  . ALA C 3 193 ? 37.027  26.302  -4.935  1.00 108.38 ? 193  ALA L CA  1 
ATOM   4771 C  C   . ALA C 3 193 ? 36.228  25.403  -5.847  1.00 109.87 ? 193  ALA L C   1 
ATOM   4772 O  O   . ALA C 3 193 ? 36.349  24.175  -5.825  1.00 110.08 ? 193  ALA L O   1 
ATOM   4773 C  CB  . ALA C 3 193 ? 38.382  26.579  -5.556  1.00 111.03 ? 193  ALA L CB  1 
ATOM   4774 N  N   . CYS C 3 194 ? 35.438  26.048  -6.682  1.00 103.75 ? 194  CYS L N   1 
ATOM   4775 C  CA  . CYS C 3 194 ? 34.589  25.434  -7.676  1.00 100.49 ? 194  CYS L CA  1 
ATOM   4776 C  C   . CYS C 3 194 ? 35.110  25.905  -9.032  1.00 104.24 ? 194  CYS L C   1 
ATOM   4777 O  O   . CYS C 3 194 ? 35.194  27.108  -9.262  1.00 104.30 ? 194  CYS L O   1 
ATOM   4778 C  CB  . CYS C 3 194 ? 33.144  25.871  -7.453  1.00 98.14  ? 194  CYS L CB  1 
ATOM   4779 S  SG  . CYS C 3 194 ? 31.999  25.260  -8.707  1.00 98.43  ? 194  CYS L SG  1 
ATOM   4780 N  N   . GLU C 3 195 ? 35.464  24.979  -9.922  1.00 100.43 ? 195  GLU L N   1 
ATOM   4781 C  CA  . GLU C 3 195 ? 35.953  25.321  -11.257 1.00 100.01 ? 195  GLU L CA  1 
ATOM   4782 C  C   . GLU C 3 195 ? 34.936  24.883  -12.311 1.00 99.64  ? 195  GLU L C   1 
ATOM   4783 O  O   . GLU C 3 195 ? 34.517  23.725  -12.343 1.00 97.34  ? 195  GLU L O   1 
ATOM   4784 C  CB  . GLU C 3 195 ? 37.337  24.716  -11.507 1.00 104.04 ? 195  GLU L CB  1 
ATOM   4785 C  CG  . GLU C 3 195 ? 37.999  25.181  -12.792 1.00 117.48 ? 195  GLU L CG  1 
ATOM   4786 C  CD  . GLU C 3 195 ? 39.088  24.231  -13.243 1.00 145.83 ? 195  GLU L CD  1 
ATOM   4787 O  OE1 . GLU C 3 195 ? 40.272  24.480  -12.916 1.00 132.18 ? 195  GLU L OE1 1 
ATOM   4788 O  OE2 . GLU C 3 195 ? 38.745  23.195  -13.862 1.00 146.89 ? 195  GLU L OE2 1 
ATOM   4789 N  N   . VAL C 3 196 ? 34.536  25.822  -13.165 1.00 95.11  ? 196  VAL L N   1 
ATOM   4790 C  CA  . VAL C 3 196 ? 33.500  25.601  -14.170 1.00 92.22  ? 196  VAL L CA  1 
ATOM   4791 C  C   . VAL C 3 196 ? 34.019  25.707  -15.591 1.00 97.64  ? 196  VAL L C   1 
ATOM   4792 O  O   . VAL C 3 196 ? 34.592  26.727  -15.967 1.00 98.55  ? 196  VAL L O   1 
ATOM   4793 C  CB  . VAL C 3 196 ? 32.300  26.552  -13.914 1.00 93.68  ? 196  VAL L CB  1 
ATOM   4794 C  CG1 . VAL C 3 196 ? 31.247  26.466  -15.017 1.00 90.48  ? 196  VAL L CG1 1 
ATOM   4795 C  CG2 . VAL C 3 196 ? 31.685  26.284  -12.550 1.00 93.61  ? 196  VAL L CG2 1 
ATOM   4796 N  N   . THR C 3 197 ? 33.774  24.653  -16.384 1.00 93.52  ? 197  THR L N   1 
ATOM   4797 C  CA  . THR C 3 197 ? 34.113  24.579  -17.801 1.00 92.54  ? 197  THR L CA  1 
ATOM   4798 C  C   . THR C 3 197 ? 32.795  24.514  -18.594 1.00 91.11  ? 197  THR L C   1 
ATOM   4799 O  O   . THR C 3 197 ? 31.964  23.636  -18.340 1.00 88.26  ? 197  THR L O   1 
ATOM   4800 C  CB  . THR C 3 197 ? 35.120  23.439  -18.116 1.00 106.91 ? 197  THR L CB  1 
ATOM   4801 O  OG1 . THR C 3 197 ? 34.441  22.270  -18.577 1.00 110.62 ? 197  THR L OG1 1 
ATOM   4802 C  CG2 . THR C 3 197 ? 36.083  23.121  -16.952 1.00 106.53 ? 197  THR L CG2 1 
ATOM   4803 N  N   . HIS C 3 198 ? 32.592  25.492  -19.496 1.00 85.77  ? 198  HIS L N   1 
ATOM   4804 C  CA  . HIS C 3 198 ? 31.417  25.612  -20.355 1.00 82.31  ? 198  HIS L CA  1 
ATOM   4805 C  C   . HIS C 3 198 ? 31.785  26.321  -21.645 1.00 84.07  ? 198  HIS L C   1 
ATOM   4806 O  O   . HIS C 3 198 ? 32.678  27.174  -21.662 1.00 85.83  ? 198  HIS L O   1 
ATOM   4807 C  CB  . HIS C 3 198 ? 30.271  26.349  -19.639 1.00 82.02  ? 198  HIS L CB  1 
ATOM   4808 C  CG  . HIS C 3 198 ? 29.009  26.484  -20.452 1.00 82.86  ? 198  HIS L CG  1 
ATOM   4809 N  ND1 . HIS C 3 198 ? 28.148  25.428  -20.662 1.00 82.65  ? 198  HIS L ND1 1 
ATOM   4810 C  CD2 . HIS C 3 198 ? 28.542  27.562  -21.128 1.00 83.80  ? 198  HIS L CD2 1 
ATOM   4811 C  CE1 . HIS C 3 198 ? 27.181  25.899  -21.435 1.00 80.34  ? 198  HIS L CE1 1 
ATOM   4812 N  NE2 . HIS C 3 198 ? 27.357  27.180  -21.720 1.00 81.43  ? 198  HIS L NE2 1 
ATOM   4813 N  N   . GLN C 3 199 ? 31.067  25.972  -22.715 1.00 76.62  ? 199  GLN L N   1 
ATOM   4814 C  CA  . GLN C 3 199 ? 31.195  26.470  -24.079 1.00 75.21  ? 199  GLN L CA  1 
ATOM   4815 C  C   . GLN C 3 199 ? 31.275  27.997  -24.190 1.00 81.68  ? 199  GLN L C   1 
ATOM   4816 O  O   . GLN C 3 199 ? 32.119  28.504  -24.941 1.00 82.94  ? 199  GLN L O   1 
ATOM   4817 C  CB  . GLN C 3 199 ? 30.040  25.898  -24.915 1.00 73.56  ? 199  GLN L CB  1 
ATOM   4818 C  CG  . GLN C 3 199 ? 30.144  26.124  -26.405 1.00 81.72  ? 199  GLN L CG  1 
ATOM   4819 C  CD  . GLN C 3 199 ? 30.104  24.806  -27.164 1.00 100.85 ? 199  GLN L CD  1 
ATOM   4820 O  OE1 . GLN C 3 199 ? 31.133  24.221  -27.523 1.00 94.20  ? 199  GLN L OE1 1 
ATOM   4821 N  NE2 . GLN C 3 199 ? 28.910  24.295  -27.437 1.00 97.27  ? 199  GLN L NE2 1 
ATOM   4822 N  N   . GLY C 3 200 ? 30.430  28.699  -23.421 1.00 78.22  ? 200  GLY L N   1 
ATOM   4823 C  CA  . GLY C 3 200 ? 30.353  30.160  -23.388 1.00 78.36  ? 200  GLY L CA  1 
ATOM   4824 C  C   . GLY C 3 200 ? 31.482  30.872  -22.661 1.00 82.67  ? 200  GLY L C   1 
ATOM   4825 O  O   . GLY C 3 200 ? 31.541  32.097  -22.695 1.00 82.90  ? 200  GLY L O   1 
ATOM   4826 N  N   . LEU C 3 201 ? 32.348  30.130  -21.958 1.00 80.21  ? 201  LEU L N   1 
ATOM   4827 C  CA  . LEU C 3 201 ? 33.477  30.671  -21.203 1.00 82.75  ? 201  LEU L CA  1 
ATOM   4828 C  C   . LEU C 3 201 ? 34.758  30.460  -21.985 1.00 90.86  ? 201  LEU L C   1 
ATOM   4829 O  O   . LEU C 3 201 ? 35.036  29.318  -22.405 1.00 90.00  ? 201  LEU L O   1 
ATOM   4830 C  CB  . LEU C 3 201 ? 33.612  29.993  -19.829 1.00 83.19  ? 201  LEU L CB  1 
ATOM   4831 C  CG  . LEU C 3 201 ? 32.463  30.141  -18.843 1.00 86.31  ? 201  LEU L CG  1 
ATOM   4832 C  CD1 . LEU C 3 201 ? 32.648  29.198  -17.681 1.00 87.56  ? 201  LEU L CD1 1 
ATOM   4833 C  CD2 . LEU C 3 201 ? 32.330  31.562  -18.358 1.00 88.22  ? 201  LEU L CD2 1 
ATOM   4834 N  N   . SER C 3 202 ? 35.545  31.570  -22.167 1.00 90.75  ? 202  SER L N   1 
ATOM   4835 C  CA  . SER C 3 202 ? 36.835  31.597  -22.882 1.00 93.29  ? 202  SER L CA  1 
ATOM   4836 C  C   . SER C 3 202 ? 37.847  30.683  -22.204 1.00 101.65 ? 202  SER L C   1 
ATOM   4837 O  O   . SER C 3 202 ? 38.617  29.996  -22.871 1.00 102.38 ? 202  SER L O   1 
ATOM   4838 C  CB  . SER C 3 202 ? 37.401  33.010  -22.965 1.00 97.99  ? 202  SER L CB  1 
ATOM   4839 O  OG  . SER C 3 202 ? 36.516  33.903  -23.613 1.00 104.79 ? 202  SER L OG  1 
ATOM   4840 N  N   . SER C 3 203 ? 37.816  30.663  -20.874 1.00 99.74  ? 203  SER L N   1 
ATOM   4841 C  CA  . SER C 3 203 ? 38.666  29.817  -20.049 1.00 101.13 ? 203  SER L CA  1 
ATOM   4842 C  C   . SER C 3 203 ? 37.827  29.334  -18.867 1.00 104.31 ? 203  SER L C   1 
ATOM   4843 O  O   . SER C 3 203 ? 36.917  30.071  -18.448 1.00 103.45 ? 203  SER L O   1 
ATOM   4844 C  CB  . SER C 3 203 ? 39.885  30.596  -19.549 1.00 106.53 ? 203  SER L CB  1 
ATOM   4845 O  OG  . SER C 3 203 ? 39.542  31.704  -18.734 1.00 113.34 ? 203  SER L OG  1 
ATOM   4846 N  N   . PRO C 3 204 ? 38.127  28.143  -18.273 1.00 100.02 ? 204  PRO L N   1 
ATOM   4847 C  CA  . PRO C 3 204 ? 37.372  27.718  -17.082 1.00 98.80  ? 204  PRO L CA  1 
ATOM   4848 C  C   . PRO C 3 204 ? 37.379  28.794  -15.990 1.00 103.34 ? 204  PRO L C   1 
ATOM   4849 O  O   . PRO C 3 204 ? 38.400  29.471  -15.798 1.00 105.07 ? 204  PRO L O   1 
ATOM   4850 C  CB  . PRO C 3 204 ? 38.098  26.443  -16.641 1.00 101.40 ? 204  PRO L CB  1 
ATOM   4851 C  CG  . PRO C 3 204 ? 38.700  25.918  -17.887 1.00 105.60 ? 204  PRO L CG  1 
ATOM   4852 C  CD  . PRO C 3 204 ? 39.149  27.138  -18.635 1.00 102.10 ? 204  PRO L CD  1 
ATOM   4853 N  N   . VAL C 3 205 ? 36.220  29.000  -15.337 1.00 97.84  ? 205  VAL L N   1 
ATOM   4854 C  CA  . VAL C 3 205 ? 36.063  30.015  -14.297 1.00 98.50  ? 205  VAL L CA  1 
ATOM   4855 C  C   . VAL C 3 205 ? 36.086  29.407  -12.909 1.00 103.02 ? 205  VAL L C   1 
ATOM   4856 O  O   . VAL C 3 205 ? 35.469  28.370  -12.689 1.00 100.80 ? 205  VAL L O   1 
ATOM   4857 C  CB  . VAL C 3 205 ? 34.844  30.944  -14.510 1.00 100.77 ? 205  VAL L CB  1 
ATOM   4858 C  CG1 . VAL C 3 205 ? 35.070  31.891  -15.687 1.00 100.67 ? 205  VAL L CG1 1 
ATOM   4859 C  CG2 . VAL C 3 205 ? 33.539  30.176  -14.647 1.00 98.06  ? 205  VAL L CG2 1 
ATOM   4860 N  N   . THR C 3 206 ? 36.819  30.050  -11.981 1.00 102.37 ? 206  THR L N   1 
ATOM   4861 C  CA  . THR C 3 206 ? 36.952  29.597  -10.600 1.00 103.57 ? 206  THR L CA  1 
ATOM   4862 C  C   . THR C 3 206 ? 36.376  30.600  -9.613  1.00 107.85 ? 206  THR L C   1 
ATOM   4863 O  O   . THR C 3 206 ? 36.710  31.788  -9.654  1.00 107.91 ? 206  THR L O   1 
ATOM   4864 C  CB  . THR C 3 206 ? 38.401  29.199  -10.252 1.00 113.78 ? 206  THR L CB  1 
ATOM   4865 O  OG1 . THR C 3 206 ? 38.599  29.352  -8.844  1.00 115.34 ? 206  THR L OG1 1 
ATOM   4866 C  CG2 . THR C 3 206 ? 39.445  30.022  -10.996 1.00 113.72 ? 206  THR L CG2 1 
ATOM   4867 N  N   . LYS C 3 207 ? 35.487  30.106  -8.741  1.00 104.17 ? 207  LYS L N   1 
ATOM   4868 C  CA  . LYS C 3 207 ? 34.883  30.855  -7.642  1.00 104.28 ? 207  LYS L CA  1 
ATOM   4869 C  C   . LYS C 3 207 ? 35.321  30.122  -6.388  1.00 109.90 ? 207  LYS L C   1 
ATOM   4870 O  O   . LYS C 3 207 ? 35.247  28.888  -6.317  1.00 109.91 ? 207  LYS L O   1 
ATOM   4871 C  CB  . LYS C 3 207 ? 33.340  30.951  -7.735  1.00 104.14 ? 207  LYS L CB  1 
ATOM   4872 C  CG  . LYS C 3 207 ? 32.806  31.684  -8.971  1.00 117.67 ? 207  LYS L CG  1 
ATOM   4873 C  CD  . LYS C 3 207 ? 33.113  33.178  -9.019  1.00 130.63 ? 207  LYS L CD  1 
ATOM   4874 C  CE  . LYS C 3 207 ? 32.731  33.755  -10.359 1.00 142.03 ? 207  LYS L CE  1 
ATOM   4875 N  NZ  . LYS C 3 207 ? 33.218  35.152  -10.516 1.00 153.07 ? 207  LYS L NZ  1 
ATOM   4876 N  N   . SER C 3 208 ? 35.861  30.871  -5.435  1.00 107.17 ? 208  SER L N   1 
ATOM   4877 C  CA  . SER C 3 208 ? 36.375  30.284  -4.208  1.00 108.20 ? 208  SER L CA  1 
ATOM   4878 C  C   . SER C 3 208 ? 36.154  31.170  -2.994  1.00 110.61 ? 208  SER L C   1 
ATOM   4879 O  O   . SER C 3 208 ? 35.788  32.337  -3.132  1.00 110.39 ? 208  SER L O   1 
ATOM   4880 C  CB  . SER C 3 208 ? 37.864  29.989  -4.364  1.00 114.13 ? 208  SER L CB  1 
ATOM   4881 O  OG  . SER C 3 208 ? 38.624  31.181  -4.445  1.00 124.26 ? 208  SER L OG  1 
ATOM   4882 N  N   . PHE C 3 209 ? 36.396  30.610  -1.804  1.00 105.62 ? 209  PHE L N   1 
ATOM   4883 C  CA  . PHE C 3 209 ? 36.349  31.314  -0.532  1.00 105.06 ? 209  PHE L CA  1 
ATOM   4884 C  C   . PHE C 3 209 ? 37.348  30.677  0.418   1.00 108.09 ? 209  PHE L C   1 
ATOM   4885 O  O   . PHE C 3 209 ? 37.794  29.545  0.199   1.00 107.09 ? 209  PHE L O   1 
ATOM   4886 C  CB  . PHE C 3 209 ? 34.918  31.342  0.073   1.00 104.79 ? 209  PHE L CB  1 
ATOM   4887 C  CG  . PHE C 3 209 ? 34.388  30.017  0.574   1.00 105.53 ? 209  PHE L CG  1 
ATOM   4888 C  CD1 . PHE C 3 209 ? 34.655  29.585  1.873   1.00 110.63 ? 209  PHE L CD1 1 
ATOM   4889 C  CD2 . PHE C 3 209 ? 33.614  29.208  -0.244  1.00 104.32 ? 209  PHE L CD2 1 
ATOM   4890 C  CE1 . PHE C 3 209 ? 34.190  28.345  2.327   1.00 111.12 ? 209  PHE L CE1 1 
ATOM   4891 C  CE2 . PHE C 3 209 ? 33.130  27.985  0.220   1.00 106.72 ? 209  PHE L CE2 1 
ATOM   4892 C  CZ  . PHE C 3 209 ? 33.435  27.553  1.497   1.00 107.19 ? 209  PHE L CZ  1 
ATOM   4893 N  N   . ASN C 3 210 ? 37.695  31.413  1.470   1.00 105.74 ? 210  ASN L N   1 
ATOM   4894 C  CA  . ASN C 3 210 ? 38.559  30.933  2.537   1.00 108.38 ? 210  ASN L CA  1 
ATOM   4895 C  C   . ASN C 3 210 ? 37.644  30.749  3.742   1.00 110.62 ? 210  ASN L C   1 
ATOM   4896 O  O   . ASN C 3 210 ? 36.905  31.680  4.095   1.00 109.25 ? 210  ASN L O   1 
ATOM   4897 C  CB  . ASN C 3 210 ? 39.689  31.935  2.852   1.00 111.13 ? 210  ASN L CB  1 
ATOM   4898 C  CG  . ASN C 3 210 ? 40.744  32.077  1.785   1.00 126.05 ? 210  ASN L CG  1 
ATOM   4899 O  OD1 . ASN C 3 210 ? 40.883  31.251  0.871   1.00 117.20 ? 210  ASN L OD1 1 
ATOM   4900 N  ND2 . ASN C 3 210 ? 41.523  33.136  1.895   1.00 118.18 ? 210  ASN L ND2 1 
ATOM   4901 N  N   . ARG C 3 211 ? 37.645  29.536  4.332   1.00 106.46 ? 211  ARG L N   1 
ATOM   4902 C  CA  . ARG C 3 211 ? 36.856  29.197  5.517   1.00 105.77 ? 211  ARG L CA  1 
ATOM   4903 C  C   . ARG C 3 211 ? 37.178  30.192  6.659   1.00 111.62 ? 211  ARG L C   1 
ATOM   4904 O  O   . ARG C 3 211 ? 38.351  30.423  6.970   1.00 114.00 ? 211  ARG L O   1 
ATOM   4905 C  CB  . ARG C 3 211 ? 37.132  27.739  5.927   1.00 106.01 ? 211  ARG L CB  1 
ATOM   4906 C  CG  . ARG C 3 211 ? 36.533  27.321  7.269   1.00 115.52 ? 211  ARG L CG  1 
ATOM   4907 C  CD  . ARG C 3 211 ? 37.126  26.019  7.786   1.00 125.05 ? 211  ARG L CD  1 
ATOM   4908 N  NE  . ARG C 3 211 ? 38.558  26.122  8.076   1.00 141.08 ? 211  ARG L NE  1 
ATOM   4909 C  CZ  . ARG C 3 211 ? 39.084  26.243  9.293   1.00 159.13 ? 211  ARG L CZ  1 
ATOM   4910 N  NH1 . ARG C 3 211 ? 38.301  26.250  10.364  1.00 151.15 ? 211  ARG L NH1 1 
ATOM   4911 N  NH2 . ARG C 3 211 ? 40.399  26.338  9.449   1.00 145.67 ? 211  ARG L NH2 1 
ATOM   4912 N  N   . GLY C 3 212 ? 36.137  30.831  7.195   1.00 106.70 ? 212  GLY L N   1 
ATOM   4913 C  CA  . GLY C 3 212 ? 36.258  31.847  8.241   1.00 135.00 ? 212  GLY L CA  1 
ATOM   4914 C  C   . GLY C 3 212 ? 36.727  33.216  7.765   1.00 133.34 ? 212  GLY L C   1 
ATOM   4915 O  O   . GLY C 3 212 ? 36.008  33.936  7.061   1.00 75.88  ? 212  GLY L O   1 
HETATM 4916 CA CA  . CA  D 4 .   ? 5.856   -34.455 -49.908 1.00 61.28  2 5001 CA  A CA  1 
HETATM 4917 CA CA  . CA  E 4 .   ? -1.803  -22.475 -27.936 1.00 55.08  2 5002 CA  A CA  1 
HETATM 4918 CA CA  . CA  F 4 .   ? -23.705 -8.902  -47.539 1.00 40.23  2 5003 CA  A CA  1 
HETATM 4919 C  C1  . NAG G 5 .   ? -5.145  -30.039 -34.962 1.00 112.44 ? 5004 NAG A C1  1 
HETATM 4920 C  C2  . NAG G 5 .   ? -4.733  -31.508 -34.824 1.00 112.93 ? 5004 NAG A C2  1 
HETATM 4921 C  C3  . NAG G 5 .   ? -5.778  -32.256 -35.656 1.00 113.50 ? 5004 NAG A C3  1 
HETATM 4922 C  C4  . NAG G 5 .   ? -7.186  -31.993 -35.123 1.00 114.96 ? 5004 NAG A C4  1 
HETATM 4923 C  C5  . NAG G 5 .   ? -7.481  -30.492 -35.112 1.00 112.91 ? 5004 NAG A C5  1 
HETATM 4924 C  C6  . NAG G 5 .   ? -8.786  -30.133 -34.437 1.00 114.46 ? 5004 NAG A C6  1 
HETATM 4925 C  C7  . NAG G 5 .   ? -2.404  -32.328 -34.606 1.00 113.08 ? 5004 NAG A C7  1 
HETATM 4926 C  C8  . NAG G 5 .   ? -1.140  -32.625 -35.354 1.00 114.22 ? 5004 NAG A C8  1 
HETATM 4927 N  N2  . NAG G 5 .   ? -3.396  -31.774 -35.331 1.00 111.96 ? 5004 NAG A N2  1 
HETATM 4928 O  O3  . NAG G 5 .   ? -5.511  -33.653 -35.645 1.00 114.47 ? 5004 NAG A O3  1 
HETATM 4929 O  O4  . NAG G 5 .   ? -8.149  -32.687 -35.916 1.00 115.38 ? 5004 NAG A O4  1 
HETATM 4930 O  O5  . NAG G 5 .   ? -6.441  -29.805 -34.396 1.00 110.82 ? 5004 NAG A O5  1 
HETATM 4931 O  O6  . NAG G 5 .   ? -9.906  -30.796 -35.028 1.00 115.64 ? 5004 NAG A O6  1 
HETATM 4932 O  O7  . NAG G 5 .   ? -2.522  -32.572 -33.407 1.00 113.55 ? 5004 NAG A O7  1 
HETATM 4933 O  O   . HOH H 6 .   ? -5.863  -10.601 -39.166 1.00 21.83  ? 5101 HOH A O   1 
HETATM 4934 O  O   . HOH H 6 .   ? 2.669   -21.217 -31.717 1.00 10.28  ? 5102 HOH A O   1 
HETATM 4935 O  O   . HOH I 6 .   ? 12.082  26.600  -10.322 1.00 27.65  ? 301  HOH H O   1 
HETATM 4936 O  O   . HOH I 6 .   ? 11.820  20.660  -7.749  1.00 16.91  ? 302  HOH H O   1 
HETATM 4937 O  O   . HOH J 6 .   ? 13.296  3.564   -23.080 1.00 11.23  ? 301  HOH L O   1 
HETATM 4938 O  O   . HOH J 6 .   ? 21.144  -2.237  -40.538 1.00 17.28  ? 302  HOH L O   1 
HETATM 4939 O  O   . HOH J 6 .   ? 18.376  -8.507  -39.853 1.00 9.19   ? 303  HOH L O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ALA A 14  ? 1.0996 0.7542 2.2559 0.3586  -0.1367 -0.0763 1391 ALA A N   
2    C  CA  . ALA A 14  ? 1.1158 0.7264 2.2385 0.3437  -0.1373 -0.0645 1391 ALA A CA  
3    C  C   . ALA A 14  ? 1.1975 0.8101 2.2905 0.3249  -0.1171 -0.0972 1391 ALA A C   
4    O  O   . ALA A 14  ? 1.2192 0.8064 2.3356 0.3285  -0.1085 -0.1209 1391 ALA A O   
5    C  CB  . ALA A 14  ? 1.1067 0.7125 2.1832 0.3313  -0.1518 -0.0236 1391 ALA A CB  
6    N  N   . CYS A 15  ? 1.1503 0.7921 2.1931 0.3051  -0.1102 -0.0988 1392 CYS A N   
7    C  CA  . CYS A 15  ? 1.1496 0.7972 2.1591 0.2862  -0.0930 -0.1264 1392 CYS A CA  
8    C  C   . CYS A 15  ? 1.1940 0.8925 2.1776 0.2753  -0.0820 -0.1408 1392 CYS A C   
9    O  O   . CYS A 15  ? 1.1463 0.8531 2.0797 0.2551  -0.0787 -0.1357 1392 CYS A O   
10   C  CB  . CYS A 15  ? 1.1508 0.7653 2.1171 0.2681  -0.0969 -0.1087 1392 CYS A CB  
11   S  SG  . CYS A 15  ? 1.1726 0.7940 2.0911 0.2558  -0.1118 -0.0651 1392 CYS A SG  
12   N  N   . GLN A 16  ? 1.1927 0.9251 2.2133 0.2888  -0.0757 -0.1596 1393 GLN A N   
13   C  CA  . GLN A 16  ? 1.1798 0.9622 2.1837 0.2796  -0.0637 -0.1747 1393 GLN A CA  
14   C  C   . GLN A 16  ? 1.2248 1.0164 2.2034 0.2643  -0.0438 -0.2079 1393 GLN A C   
15   O  O   . GLN A 16  ? 1.1895 1.0132 2.1337 0.2486  -0.0351 -0.2125 1393 GLN A O   
16   C  CB  . GLN A 16  ? 1.2122 1.0289 2.2687 0.2990  -0.0617 -0.1873 1393 GLN A CB  
17   C  CG  . GLN A 16  ? 1.5361 1.3686 2.6028 0.3072  -0.0792 -0.1560 1393 GLN A CG  
18   C  CD  . GLN A 16  ? 1.8588 1.6556 2.9582 0.3261  -0.0984 -0.1320 1393 GLN A CD  
19   O  OE1 . GLN A 16  ? 1.7805 1.5771 2.9363 0.3484  -0.1010 -0.1415 1393 GLN A OE1 
20   N  NE2 . GLN A 16  ? 1.8343 1.6004 2.8992 0.3174  -0.1121 -0.0999 1393 GLN A NE2 
21   N  N   . ALA A 17  ? 1.2076 0.9708 2.2038 0.2686  -0.0372 -0.2307 1394 ALA A N   
22   C  CA  . ALA A 17  ? 1.2044 0.9725 2.1803 0.2558  -0.0196 -0.2647 1394 ALA A CA  
23   C  C   . ALA A 17  ? 1.2149 0.9681 2.1305 0.2321  -0.0215 -0.2522 1394 ALA A C   
24   O  O   . ALA A 17  ? 1.2118 0.9756 2.1001 0.2181  -0.0086 -0.2760 1394 ALA A O   
25   C  CB  . ALA A 17  ? 1.2475 0.9874 2.2663 0.2693  -0.0147 -0.2917 1394 ALA A CB  
26   N  N   . LYS A 18  ? 1.1334 0.8643 2.0285 0.2279  -0.0377 -0.2150 1395 LYS A N   
27   C  CA  . LYS A 18  ? 1.1051 0.8222 1.9477 0.2073  -0.0411 -0.2002 1395 LYS A CA  
28   C  C   . LYS A 18  ? 1.0982 0.8418 1.9018 0.1951  -0.0454 -0.1773 1395 LYS A C   
29   O  O   . LYS A 18  ? 1.0805 0.8202 1.8400 0.1775  -0.0460 -0.1694 1395 LYS A O   
30   C  CB  . LYS A 18  ? 1.1499 0.8193 1.9966 0.2092  -0.0539 -0.1791 1395 LYS A CB  
31   C  CG  . LYS A 18  ? 1.3504 0.9922 2.2047 0.2059  -0.0468 -0.2043 1395 LYS A CG  
32   C  CD  . LYS A 18  ? 1.4424 1.0372 2.3294 0.2167  -0.0572 -0.1906 1395 LYS A CD  
33   C  CE  . LYS A 18  ? 1.5524 1.1380 2.4986 0.2380  -0.0539 -0.2112 1395 LYS A CE  
34   N  NZ  . LYS A 18  ? 1.6259 1.2358 2.6012 0.2555  -0.0587 -0.2009 1395 LYS A NZ  
35   N  N   . ARG A 19  ? 1.0255 0.7967 1.8475 0.2042  -0.0486 -0.1681 1396 ARG A N   
36   C  CA  . ARG A 19  ? 0.9879 0.7855 1.7785 0.1931  -0.0524 -0.1487 1396 ARG A CA  
37   C  C   . ARG A 19  ? 1.0192 0.8480 1.7792 0.1768  -0.0370 -0.1687 1396 ARG A C   
38   O  O   . ARG A 19  ? 1.0326 0.8882 1.8128 0.1810  -0.0233 -0.1950 1396 ARG A O   
39   C  CB  . ARG A 19  ? 0.9706 0.7910 1.7940 0.2075  -0.0599 -0.1368 1396 ARG A CB  
40   C  CG  . ARG A 19  ? 1.0549 0.8491 1.8888 0.2175  -0.0794 -0.1048 1396 ARG A CG  
41   C  CD  . ARG A 19  ? 1.1031 0.9146 1.9113 0.2096  -0.0900 -0.0784 1396 ARG A CD  
42   N  NE  . ARG A 19  ? 1.1686 1.0165 2.0067 0.2198  -0.0920 -0.0792 1396 ARG A NE  
43   C  CZ  . ARG A 19  ? 1.2442 1.1137 2.0701 0.2154  -0.1013 -0.0603 1396 ARG A CZ  
44   N  NH1 . ARG A 19  ? 1.0403 0.9442 1.8985 0.2250  -0.1027 -0.0638 1396 ARG A NH1 
45   N  NH2 . ARG A 19  ? 1.0110 0.8698 1.7939 0.2007  -0.1085 -0.0399 1396 ARG A NH2 
46   N  N   . GLY A 20  ? 0.9376 0.7619 1.6497 0.1584  -0.0391 -0.1563 1397 GLY A N   
47   C  CA  . GLY A 20  ? 0.9215 0.7713 1.5990 0.1413  -0.0269 -0.1696 1397 GLY A CA  
48   C  C   . GLY A 20  ? 0.9880 0.8351 1.6605 0.1369  -0.0138 -0.2002 1397 GLY A C   
49   O  O   . GLY A 20  ? 0.9715 0.8481 1.6283 0.1276  -0.0004 -0.2183 1397 GLY A O   
50   N  N   . ASP A 21  ? 0.9852 0.7973 1.6697 0.1425  -0.0177 -0.2060 1398 ASP A N   
51   C  CA  . ASP A 21  ? 1.0136 0.8197 1.6967 0.1390  -0.0068 -0.2372 1398 ASP A CA  
52   C  C   . ASP A 21  ? 1.0637 0.8594 1.6988 0.1197  -0.0082 -0.2349 1398 ASP A C   
53   O  O   . ASP A 21  ? 1.0777 0.8629 1.7095 0.1158  -0.0028 -0.2577 1398 ASP A O   
54   C  CB  . ASP A 21  ? 1.0619 0.8369 1.7898 0.1556  -0.0091 -0.2490 1398 ASP A CB  
55   C  CG  . ASP A 21  ? 1.2021 0.9328 1.9272 0.1548  -0.0225 -0.2293 1398 ASP A CG  
56   O  OD1 . ASP A 21  ? 1.1826 0.9059 1.8804 0.1468  -0.0332 -0.1994 1398 ASP A OD1 
57   O  OD2 . ASP A 21  ? 1.3118 1.0154 2.0635 0.1620  -0.0217 -0.2444 1398 ASP A OD2 
58   N  N   . GLN A 22  ? 1.0039 0.8044 1.6036 0.1079  -0.0158 -0.2088 1399 GLN A N   
59   C  CA  . GLN A 22  ? 1.0005 0.7938 1.5556 0.0904  -0.0195 -0.2014 1399 GLN A CA  
60   C  C   . GLN A 22  ? 1.0581 0.8129 1.6145 0.0897  -0.0277 -0.1990 1399 GLN A C   
61   O  O   . GLN A 22  ? 1.0592 0.8089 1.5869 0.0769  -0.0282 -0.2045 1399 GLN A O   
62   C  CB  . GLN A 22  ? 1.0270 0.8488 1.5537 0.0776  -0.0069 -0.2235 1399 GLN A CB  
63   C  CG  . GLN A 22  ? 1.1389 0.9906 1.6376 0.0670  -0.0046 -0.2096 1399 GLN A CG  
64   C  CD  . GLN A 22  ? 1.4134 1.2977 1.9351 0.0737  0.0069  -0.2207 1399 GLN A CD  
65   O  OE1 . GLN A 22  ? 1.3114 1.1963 1.8653 0.0865  0.0032  -0.2113 1399 GLN A OE1 
66   N  NE2 . GLN A 22  ? 1.3994 1.3137 1.9049 0.0649  0.0211  -0.2407 1399 GLN A NE2 
67   N  N   . ARG A 23  ? 1.0011 0.7296 1.5912 0.1032  -0.0348 -0.1890 1400 ARG A N   
68   C  CA  . ARG A 23  ? 0.9930 0.6836 1.5906 0.1033  -0.0425 -0.1830 1400 ARG A CA  
69   C  C   . ARG A 23  ? 1.0201 0.6908 1.6351 0.1130  -0.0544 -0.1525 1400 ARG A C   
70   O  O   . ARG A 23  ? 1.0187 0.6931 1.6664 0.1280  -0.0547 -0.1510 1400 ARG A O   
71   C  CB  . ARG A 23  ? 1.0024 0.6789 1.6303 0.1101  -0.0351 -0.2137 1400 ARG A CB  
72   C  CG  . ARG A 23  ? 1.1293 0.8201 1.7338 0.0974  -0.0256 -0.2436 1400 ARG A CG  
73   C  CD  . ARG A 23  ? 1.2934 0.9644 1.8724 0.0832  -0.0321 -0.2396 1400 ARG A CD  
74   N  NE  . ARG A 23  ? 1.4333 1.1293 1.9676 0.0673  -0.0301 -0.2431 1400 ARG A NE  
75   C  CZ  . ARG A 23  ? 1.5997 1.2867 2.1065 0.0539  -0.0367 -0.2372 1400 ARG A CZ  
76   N  NH1 . ARG A 23  ? 1.4730 1.1280 1.9923 0.0533  -0.0444 -0.2287 1400 ARG A NH1 
77   N  NH2 . ARG A 23  ? 1.3713 1.0820 1.8393 0.0409  -0.0357 -0.2392 1400 ARG A NH2 
78   N  N   . CYS A 24  ? 0.9488 0.6020 1.5414 0.1045  -0.0642 -0.1278 1401 CYS A N   
79   C  CA  . CYS A 24  ? 0.9288 0.5651 1.5336 0.1124  -0.0752 -0.0981 1401 CYS A CA  
80   C  C   . CYS A 24  ? 0.9957 0.5979 1.6369 0.1232  -0.0782 -0.0978 1401 CYS A C   
81   O  O   . CYS A 24  ? 0.9929 0.5717 1.6356 0.1172  -0.0769 -0.1069 1401 CYS A O   
82   C  CB  . CYS A 24  ? 0.9006 0.5327 1.4719 0.1010  -0.0837 -0.0720 1401 CYS A CB  
83   S  SG  . CYS A 24  ? 0.9479 0.5506 1.5333 0.1083  -0.0960 -0.0391 1401 CYS A SG  
84   N  N   . ASP A 25  ? 0.9645 0.5642 1.6357 0.1390  -0.0834 -0.0856 1402 ASP A N   
85   C  CA  . ASP A 25  ? 0.9918 0.5596 1.7015 0.1521  -0.0883 -0.0794 1402 ASP A CA  
86   C  C   . ASP A 25  ? 1.0491 0.6067 1.7563 0.1565  -0.1017 -0.0416 1402 ASP A C   
87   O  O   . ASP A 25  ? 1.0390 0.6161 1.7550 0.1665  -0.1067 -0.0307 1402 ASP A O   
88   C  CB  . ASP A 25  ? 1.0264 0.6035 1.7781 0.1690  -0.0824 -0.1019 1402 ASP A CB  
89   C  CG  . ASP A 25  ? 1.0839 0.6767 1.8349 0.1642  -0.0680 -0.1408 1402 ASP A CG  
90   O  OD1 . ASP A 25  ? 1.1052 0.6752 1.8613 0.1592  -0.0640 -0.1578 1402 ASP A OD1 
91   O  OD2 . ASP A 25  ? 1.0910 0.7196 1.8357 0.1645  -0.0606 -0.1542 1402 ASP A OD2 
92   N  N   . ARG A 26  ? 1.0085 0.5382 1.7025 0.1480  -0.1074 -0.0221 1403 ARG A N   
93   C  CA  . ARG A 26  ? 1.0036 0.5239 1.6878 0.1488  -0.1191 0.0139  1403 ARG A CA  
94   C  C   . ARG A 26  ? 1.0694 0.5802 1.7889 0.1677  -0.1281 0.0305  1403 ARG A C   
95   O  O   . ARG A 26  ? 1.0415 0.5586 1.7501 0.1701  -0.1383 0.0582  1403 ARG A O   
96   C  CB  . ARG A 26  ? 1.0314 0.5237 1.6987 0.1356  -0.1209 0.0283  1403 ARG A CB  
97   C  CG  . ARG A 26  ? 1.2755 0.7301 1.9725 0.1372  -0.1185 0.0209  1403 ARG A CG  
98   C  CD  . ARG A 26  ? 1.4136 0.8360 2.1230 0.1404  -0.1274 0.0527  1403 ARG A CD  
99   N  NE  . ARG A 26  ? 1.5125 0.9395 2.1864 0.1292  -0.1327 0.0808  1403 ARG A NE  
100  C  CZ  . ARG A 26  ? 1.6428 1.0601 2.3159 0.1337  -0.1422 0.1135  1403 ARG A CZ  
101  N  NH1 . ARG A 26  ? 1.3602 0.7608 2.0669 0.1496  -0.1489 0.1247  1403 ARG A NH1 
102  N  NH2 . ARG A 26  ? 1.5058 0.9310 2.1443 0.1225  -0.1454 0.1351  1403 ARG A NH2 
103  N  N   . GLU A 27  ? 1.0706 0.5679 1.8324 0.1812  -0.1249 0.0130  1404 GLU A N   
104  C  CA  . GLU A 27  ? 1.0931 0.5814 1.8951 0.2014  -0.1337 0.0255  1404 GLU A CA  
105  C  C   . GLU A 27  ? 1.1567 0.6836 1.9633 0.2115  -0.1368 0.0257  1404 GLU A C   
106  O  O   . GLU A 27  ? 1.1736 0.7005 2.0000 0.2253  -0.1485 0.0468  1404 GLU A O   
107  C  CB  . GLU A 27  ? 1.1357 0.6006 1.9832 0.2126  -0.1278 0.0015  1404 GLU A CB  
108  C  CG  . GLU A 27  ? 1.3035 0.7214 2.1706 0.2146  -0.1344 0.0207  1404 GLU A CG  
109  C  CD  . GLU A 27  ? 1.4262 0.8235 2.2590 0.1948  -0.1345 0.0365  1404 GLU A CD  
110  O  OE1 . GLU A 27  ? 1.2738 0.6835 2.0776 0.1789  -0.1255 0.0182  1404 GLU A OE1 
111  O  OE2 . GLU A 27  ? 1.1835 0.5531 2.0195 0.1951  -0.1435 0.0676  1404 GLU A OE2 
112  N  N   . CYS A 28  ? 1.0932 0.6537 1.8807 0.2036  -0.1268 0.0031  1405 CYS A N   
113  C  CA  . CYS A 28  ? 1.0691 0.6705 1.8585 0.2092  -0.1268 -0.0013 1405 CYS A CA  
114  C  C   . CYS A 28  ? 1.0570 0.6805 1.8011 0.1948  -0.1303 0.0148  1405 CYS A C   
115  O  O   . CYS A 28  ? 1.0368 0.6940 1.7785 0.1965  -0.1312 0.0140  1405 CYS A O   
116  C  CB  . CYS A 28  ? 1.0756 0.6989 1.8804 0.2111  -0.1118 -0.0388 1405 CYS A CB  
117  S  SG  . CYS A 28  ? 1.1630 0.7598 2.0219 0.2273  -0.1058 -0.0640 1405 CYS A SG  
118  N  N   . ASN A 29  ? 0.9819 0.5864 1.6924 0.1803  -0.1323 0.0288  1406 ASN A N   
119  C  CA  . ASN A 29  ? 0.9400 0.5615 1.6088 0.1667  -0.1356 0.0433  1406 ASN A CA  
120  C  C   . ASN A 29  ? 0.9711 0.5929 1.6370 0.1724  -0.1504 0.0752  1406 ASN A C   
121  O  O   . ASN A 29  ? 0.9748 0.5725 1.6291 0.1688  -0.1569 0.0969  1406 ASN A O   
122  C  CB  . ASN A 29  ? 0.8828 0.4888 1.5189 0.1492  -0.1304 0.0411  1406 ASN A CB  
123  C  CG  . ASN A 29  ? 0.9402 0.5626 1.5366 0.1362  -0.1335 0.0542  1406 ASN A CG  
124  O  OD1 . ASN A 29  ? 0.7091 0.3611 1.2946 0.1337  -0.1321 0.0488  1406 ASN A OD1 
125  N  ND2 . ASN A 29  ? 0.8783 0.4815 1.4546 0.1277  -0.1377 0.0719  1406 ASN A ND2 
126  N  N   . SER A 30  ? 0.9000 0.5512 1.5771 0.1809  -0.1556 0.0773  1407 SER A N   
127  C  CA  . SER A 30  ? 0.8940 0.5536 1.5703 0.1874  -0.1706 0.1042  1407 SER A CA  
128  C  C   . SER A 30  ? 0.9030 0.6038 1.5761 0.1868  -0.1714 0.0976  1407 SER A C   
129  O  O   . SER A 30  ? 0.8705 0.5900 1.5560 0.1870  -0.1605 0.0729  1407 SER A O   
130  C  CB  . SER A 30  ? 0.9835 0.6270 1.7015 0.2070  -0.1796 0.1146  1407 SER A CB  
131  O  OG  . SER A 30  ? 1.1171 0.7703 1.8362 0.2147  -0.1958 0.1412  1407 SER A OG  
132  N  N   . PRO A 31  ? 0.8720 0.5891 1.5287 0.1851  -0.1834 0.1178  1408 PRO A N   
133  C  CA  . PRO A 31  ? 0.8601 0.6165 1.5167 0.1834  -0.1840 0.1101  1408 PRO A CA  
134  C  C   . PRO A 31  ? 0.9621 0.7397 1.6642 0.1997  -0.1841 0.0975  1408 PRO A C   
135  O  O   . PRO A 31  ? 0.9608 0.7686 1.6680 0.1961  -0.1763 0.0799  1408 PRO A O   
136  C  CB  . PRO A 31  ? 0.8793 0.6437 1.5136 0.1803  -0.1990 0.1353  1408 PRO A CB  
137  C  CG  . PRO A 31  ? 0.9597 0.6938 1.5978 0.1880  -0.2085 0.1578  1408 PRO A CG  
138  C  CD  . PRO A 31  ? 0.9060 0.6085 1.5432 0.1837  -0.1965 0.1475  1408 PRO A CD  
139  N  N   . GLY A 32  ? 0.9427 0.7040 1.6784 0.2172  -0.1922 0.1067  1409 GLY A N   
140  C  CA  . GLY A 32  ? 0.9441 0.7218 1.7293 0.2356  -0.1931 0.0950  1409 GLY A CA  
141  C  C   . GLY A 32  ? 0.9761 0.7606 1.7781 0.2348  -0.1741 0.0617  1409 GLY A C   
142  O  O   . GLY A 32  ? 0.9585 0.7771 1.7818 0.2385  -0.1683 0.0443  1409 GLY A O   
143  N  N   . CYS A 33  ? 0.9316 0.6857 1.7210 0.2279  -0.1639 0.0521  1410 CYS A N   
144  C  CA  . CYS A 33  ? 0.9272 0.6848 1.7262 0.2252  -0.1458 0.0200  1410 CYS A CA  
145  C  C   . CYS A 33  ? 0.9133 0.6897 1.6719 0.2045  -0.1340 0.0074  1410 CYS A C   
146  O  O   . CYS A 33  ? 0.9029 0.6794 1.6579 0.1984  -0.1193 -0.0167 1410 CYS A O   
147  C  CB  . CYS A 33  ? 0.9643 0.6816 1.7752 0.2292  -0.1419 0.0139  1410 CYS A CB  
148  S  SG  . CYS A 33  ? 1.0575 0.7557 1.9294 0.2561  -0.1510 0.0178  1410 CYS A SG  
149  N  N   . GLY A 34  ? 0.8253 0.6181 1.5553 0.1944  -0.1411 0.0237  1411 GLY A N   
150  C  CA  . GLY A 34  ? 0.7897 0.6004 1.4829 0.1756  -0.1331 0.0172  1411 GLY A CA  
151  C  C   . GLY A 34  ? 0.8150 0.6024 1.4744 0.1612  -0.1253 0.0120  1411 GLY A C   
152  O  O   . GLY A 34  ? 0.8141 0.6150 1.4560 0.1495  -0.1135 -0.0045 1411 GLY A O   
153  N  N   . TRP A 35  ? 0.7377 0.4912 1.3883 0.1617  -0.1323 0.0273  1412 TRP A N   
154  C  CA  . TRP A 35  ? 0.7016 0.4299 1.3243 0.1493  -0.1273 0.0252  1412 TRP A CA  
155  C  C   . TRP A 35  ? 0.7259 0.4501 1.3606 0.1491  -0.1135 -0.0030 1412 TRP A C   
156  O  O   . TRP A 35  ? 0.7087 0.4336 1.3172 0.1356  -0.1054 -0.0146 1412 TRP A O   
157  C  CB  . TRP A 35  ? 0.6508 0.3891 1.2313 0.1321  -0.1279 0.0329  1412 TRP A CB  
158  C  CG  . TRP A 35  ? 0.6485 0.3949 1.2183 0.1320  -0.1406 0.0564  1412 TRP A CG  
159  C  CD1 . TRP A 35  ? 0.6687 0.4444 1.2327 0.1288  -0.1436 0.0589  1412 TRP A CD1 
160  C  CD2 . TRP A 35  ? 0.6554 0.3816 1.2203 0.1354  -0.1521 0.0799  1412 TRP A CD2 
161  N  NE1 . TRP A 35  ? 0.6645 0.4397 1.2192 0.1299  -0.1566 0.0809  1412 TRP A NE1 
162  C  CE2 . TRP A 35  ? 0.7001 0.4459 1.2538 0.1339  -0.1619 0.0947  1412 TRP A CE2 
163  C  CE3 . TRP A 35  ? 0.6846 0.3781 1.2528 0.1383  -0.1547 0.0901  1412 TRP A CE3 
164  C  CZ2 . TRP A 35  ? 0.6982 0.4339 1.2419 0.1358  -0.1741 0.1188  1412 TRP A CZ2 
165  C  CZ3 . TRP A 35  ? 0.7097 0.3924 1.2684 0.1397  -0.1662 0.1159  1412 TRP A CZ3 
166  C  CH2 . TRP A 35  ? 0.7086 0.4131 1.2540 0.1386  -0.1758 0.1298  1412 TRP A CH2 
167  N  N   . ASP A 36  ? 0.6817 0.4019 1.3573 0.1650  -0.1116 -0.0143 1413 ASP A N   
168  C  CA  . ASP A 36  ? 0.6883 0.4065 1.3838 0.1684  -0.0987 -0.0440 1413 ASP A CA  
169  C  C   . ASP A 36  ? 0.7150 0.4702 1.4007 0.1609  -0.0862 -0.0652 1413 ASP A C   
170  O  O   . ASP A 36  ? 0.7079 0.4650 1.3793 0.1518  -0.0748 -0.0860 1413 ASP A O   
171  C  CB  . ASP A 36  ? 0.7273 0.4121 1.4102 0.1605  -0.0956 -0.0498 1413 ASP A CB  
172  C  CG  . ASP A 36  ? 0.9480 0.6287 1.6486 0.1625  -0.0828 -0.0823 1413 ASP A CG  
173  O  OD1 . ASP A 36  ? 0.9760 0.6674 1.7136 0.1766  -0.0781 -0.0984 1413 ASP A OD1 
174  O  OD2 . ASP A 36  ? 1.0623 0.7309 1.7408 0.1501  -0.0777 -0.0928 1413 ASP A OD2 
175  N  N   . GLY A 37  ? 0.6781 0.4632 1.3705 0.1640  -0.0888 -0.0588 1414 GLY A N   
176  C  CA  . GLY A 37  ? 0.6835 0.5058 1.3678 0.1559  -0.0773 -0.0749 1414 GLY A CA  
177  C  C   . GLY A 37  ? 0.7584 0.5845 1.3951 0.1352  -0.0731 -0.0729 1414 GLY A C   
178  O  O   . GLY A 37  ? 0.7531 0.5990 1.3780 0.1263  -0.0602 -0.0916 1414 GLY A O   
179  N  N   . GLY A 38  ? 0.7229 0.5300 1.3327 0.1280  -0.0840 -0.0503 1415 GLY A N   
180  C  CA  . GLY A 38  ? 0.7059 0.5126 1.2730 0.1099  -0.0828 -0.0451 1415 GLY A CA  
181  C  C   . GLY A 38  ? 0.7695 0.5525 1.3177 0.1023  -0.0788 -0.0541 1415 GLY A C   
182  O  O   . GLY A 38  ? 0.7623 0.5399 1.2771 0.0891  -0.0810 -0.0460 1415 GLY A O   
183  N  N   . ASP A 39  ? 0.7390 0.5077 1.3101 0.1106  -0.0734 -0.0716 1416 ASP A N   
184  C  CA  . ASP A 39  ? 0.7517 0.4988 1.3094 0.1035  -0.0696 -0.0837 1416 ASP A CA  
185  C  C   . ASP A 39  ? 0.8101 0.5280 1.3511 0.0982  -0.0797 -0.0639 1416 ASP A C   
186  O  O   . ASP A 39  ? 0.8136 0.5201 1.3339 0.0877  -0.0780 -0.0697 1416 ASP A O   
187  C  CB  . ASP A 39  ? 0.7920 0.5280 1.3830 0.1145  -0.0627 -0.1069 1416 ASP A CB  
188  C  CG  . ASP A 39  ? 0.8830 0.6478 1.4960 0.1214  -0.0510 -0.1302 1416 ASP A CG  
189  O  OD1 . ASP A 39  ? 0.8882 0.6818 1.4796 0.1112  -0.0430 -0.1382 1416 ASP A OD1 
190  O  OD2 . ASP A 39  ? 0.9249 0.6834 1.5777 0.1367  -0.0493 -0.1409 1416 ASP A OD2 
191  N  N   . CYS A 40  ? 0.7685 0.4758 1.3193 0.1055  -0.0901 -0.0411 1417 CYS A N   
192  C  CA  . CYS A 40  ? 0.7779 0.4602 1.3139 0.1005  -0.0987 -0.0214 1417 CYS A CA  
193  C  C   . CYS A 40  ? 0.7100 0.4037 1.2159 0.0913  -0.1051 -0.0022 1417 CYS A C   
194  O  O   . CYS A 40  ? 0.6712 0.3485 1.1607 0.0853  -0.1108 0.0126  1417 CYS A O   
195  C  CB  . CYS A 40  ? 0.8331 0.4913 1.3976 0.1133  -0.1057 -0.0085 1417 CYS A CB  
196  S  SG  . CYS A 40  ? 0.9183 0.5373 1.4797 0.1073  -0.1075 -0.0033 1417 CYS A SG  
197  N  N   . SER A 41  ? 0.6195 0.3417 1.1192 0.0894  -0.1033 -0.0040 1418 SER A N   
198  C  CA  . SER A 41  ? 0.5776 0.3118 1.0511 0.0803  -0.1086 0.0109  1418 SER A CA  
199  C  C   . SER A 41  ? 0.5950 0.3464 1.0444 0.0675  -0.1017 0.0001  1418 SER A C   
200  O  O   . SER A 41  ? 0.5673 0.3361 1.0036 0.0615  -0.1034 0.0069  1418 SER A O   
201  C  CB  . SER A 41  ? 0.5963 0.3473 1.0833 0.0880  -0.1153 0.0230  1418 SER A CB  
202  O  OG  . SER A 41  ? 0.7021 0.4765 1.2105 0.0939  -0.1086 0.0085  1418 SER A OG  
203  N  N   . LEU A 42  ? 0.5469 0.2922 0.9899 0.0626  -0.0945 -0.0162 1419 LEU A N   
204  C  CA  . LEU A 42  ? 0.5141 0.2726 0.9318 0.0501  -0.0885 -0.0259 1419 LEU A CA  
205  C  C   . LEU A 42  ? 0.5221 0.3109 0.9408 0.0480  -0.0818 -0.0323 1419 LEU A C   
206  O  O   . LEU A 42  ? 0.5126 0.3128 0.9074 0.0367  -0.0808 -0.0291 1419 LEU A O   
207  C  CB  . LEU A 42  ? 0.4936 0.2430 0.8826 0.0393  -0.0955 -0.0116 1419 LEU A CB  
208  C  CG  . LEU A 42  ? 0.5532 0.2766 0.9388 0.0383  -0.1002 -0.0074 1419 LEU A CG  
209  C  CD1 . LEU A 42  ? 0.5346 0.2528 0.8987 0.0306  -0.1075 0.0087  1419 LEU A CD1 
210  C  CD2 . LEU A 42  ? 0.6161 0.3334 0.9979 0.0338  -0.0947 -0.0258 1419 LEU A CD2 
211  N  N   . SER A 43  ? 0.4649 0.2668 0.9129 0.0588  -0.0766 -0.0421 1420 SER A N   
212  C  CA  . SER A 43  ? 0.4631 0.2966 0.9208 0.0586  -0.0686 -0.0503 1420 SER A CA  
213  C  C   . SER A 43  ? 0.5280 0.3756 0.9874 0.0578  -0.0755 -0.0331 1420 SER A C   
214  O  O   . SER A 43  ? 0.5273 0.4023 0.9948 0.0558  -0.0694 -0.0379 1420 SER A O   
215  C  CB  . SER A 43  ? 0.4933 0.3438 0.9284 0.0460  -0.0577 -0.0641 1420 SER A CB  
216  O  OG  . SER A 43  ? 0.4990 0.3544 0.9044 0.0325  -0.0612 -0.0503 1420 SER A OG  
217  N  N   . VAL A 44  ? 0.4826 0.3128 0.9354 0.0589  -0.0876 -0.0143 1421 VAL A N   
218  C  CA  . VAL A 44  ? 0.4656 0.3076 0.9204 0.0585  -0.0957 0.0009  1421 VAL A CA  
219  C  C   . VAL A 44  ? 0.4953 0.3433 0.9856 0.0744  -0.0993 0.0013  1421 VAL A C   
220  O  O   . VAL A 44  ? 0.4755 0.3025 0.9774 0.0843  -0.1046 0.0058  1421 VAL A O   
221  C  CB  . VAL A 44  ? 0.5165 0.3399 0.9477 0.0526  -0.1064 0.0189  1421 VAL A CB  
222  C  CG1 . VAL A 44  ? 0.5109 0.3482 0.9440 0.0517  -0.1147 0.0319  1421 VAL A CG1 
223  C  CG2 . VAL A 44  ? 0.5125 0.3290 0.9126 0.0387  -0.1033 0.0173  1421 VAL A CG2 
224  N  N   . GLY A 45  ? 0.4703 0.3471 0.9793 0.0765  -0.0959 -0.0038 1422 GLY A N   
225  C  CA  . GLY A 45  ? 0.4923 0.3804 1.0390 0.0923  -0.0998 -0.0043 1422 GLY A CA  
226  C  C   . GLY A 45  ? 0.5624 0.4350 1.1129 0.1004  -0.1157 0.0159  1422 GLY A C   
227  O  O   . GLY A 45  ? 0.5819 0.4353 1.1492 0.1128  -0.1200 0.0188  1422 GLY A O   
228  N  N   . ASP A 46  ? 0.4854 0.3660 1.0192 0.0926  -0.1242 0.0299  1423 ASP A N   
229  C  CA  . ASP A 46  ? 0.4604 0.3305 0.9901 0.0971  -0.1392 0.0494  1423 ASP A CA  
230  C  C   . ASP A 46  ? 0.4621 0.3233 0.9554 0.0826  -0.1425 0.0586  1423 ASP A C   
231  O  O   . ASP A 46  ? 0.4255 0.3050 0.9109 0.0735  -0.1436 0.0592  1423 ASP A O   
232  C  CB  . ASP A 46  ? 0.4776 0.3736 1.0334 0.1058  -0.1484 0.0549  1423 ASP A CB  
233  C  CG  . ASP A 46  ? 0.5220 0.4096 1.0739 0.1117  -0.1648 0.0752  1423 ASP A CG  
234  O  OD1 . ASP A 46  ? 0.5918 0.4512 1.1294 0.1133  -0.1682 0.0852  1423 ASP A OD1 
235  O  OD2 . ASP A 46  ? 0.4272 0.3377 0.9912 0.1147  -0.1743 0.0809  1423 ASP A OD2 
236  N  N   . PRO A 47  ? 0.4230 0.2561 0.8954 0.0797  -0.1436 0.0647  1424 PRO A N   
237  C  CA  . PRO A 47  ? 0.4140 0.2394 0.8546 0.0669  -0.1465 0.0723  1424 PRO A CA  
238  C  C   . PRO A 47  ? 0.5267 0.3633 0.9629 0.0662  -0.1582 0.0851  1424 PRO A C   
239  O  O   . PRO A 47  ? 0.5247 0.3661 0.9420 0.0551  -0.1595 0.0863  1424 PRO A O   
240  C  CB  . PRO A 47  ? 0.4275 0.2233 0.8556 0.0673  -0.1462 0.0766  1424 PRO A CB  
241  C  CG  . PRO A 47  ? 0.4890 0.2779 0.9371 0.0750  -0.1386 0.0648  1424 PRO A CG  
242  C  CD  . PRO A 47  ? 0.4450 0.2526 0.9238 0.0871  -0.1416 0.0640  1424 PRO A CD  
243  N  N   . TRP A 48  ? 0.5352 0.3774 0.9906 0.0782  -0.1671 0.0936  1425 TRP A N   
244  C  CA  . TRP A 48  ? 0.5527 0.4081 1.0052 0.0790  -0.1799 0.1055  1425 TRP A CA  
245  C  C   . TRP A 48  ? 0.6015 0.4892 1.0757 0.0805  -0.1827 0.1000  1425 TRP A C   
246  O  O   . TRP A 48  ? 0.5847 0.4860 1.0622 0.0835  -0.1947 0.1089  1425 TRP A O   
247  C  CB  . TRP A 48  ? 0.5645 0.4072 1.0229 0.0909  -0.1899 0.1212  1425 TRP A CB  
248  C  CG  . TRP A 48  ? 0.5916 0.4052 1.0281 0.0876  -0.1885 0.1296  1425 TRP A CG  
249  C  CD1 . TRP A 48  ? 0.6287 0.4358 1.0387 0.0808  -0.1940 0.1406  1425 TRP A CD1 
250  C  CD2 . TRP A 48  ? 0.6020 0.3909 1.0433 0.0908  -0.1809 0.1267  1425 TRP A CD2 
251  N  NE1 . TRP A 48  ? 0.6286 0.4097 1.0271 0.0790  -0.1895 0.1453  1425 TRP A NE1 
252  C  CE2 . TRP A 48  ? 0.6556 0.4244 1.0728 0.0846  -0.1819 0.1369  1425 TRP A CE2 
253  C  CE3 . TRP A 48  ? 0.6282 0.4110 1.0928 0.0979  -0.1729 0.1148  1425 TRP A CE3 
254  C  CZ2 . TRP A 48  ? 0.6598 0.4027 1.0763 0.0845  -0.1756 0.1364  1425 TRP A CZ2 
255  C  CZ3 . TRP A 48  ? 0.6630 0.4190 1.1258 0.0979  -0.1671 0.1133  1425 TRP A CZ3 
256  C  CH2 . TRP A 48  ? 0.6749 0.4112 1.1144 0.0909  -0.1687 0.1245  1425 TRP A CH2 
257  N  N   . ARG A 49  ? 0.5780 0.4798 1.0655 0.0772  -0.1717 0.0852  1426 ARG A N   
258  C  CA  . ARG A 49  ? 0.5689 0.5039 1.0822 0.0783  -0.1718 0.0779  1426 ARG A CA  
259  C  C   . ARG A 49  ? 0.5576 0.5117 1.0639 0.0693  -0.1810 0.0825  1426 ARG A C   
260  O  O   . ARG A 49  ? 0.5427 0.5243 1.0738 0.0733  -0.1862 0.0806  1426 ARG A O   
261  C  CB  . ARG A 49  ? 0.5963 0.5426 1.1194 0.0732  -0.1558 0.0612  1426 ARG A CB  
262  C  CG  . ARG A 49  ? 0.7217 0.6809 1.2300 0.0556  -0.1492 0.0558  1426 ARG A CG  
263  C  CD  . ARG A 49  ? 0.9270 0.8633 1.4038 0.0443  -0.1412 0.0543  1426 ARG A CD  
264  N  NE  . ARG A 49  ? 1.2925 1.2185 1.7722 0.0490  -0.1302 0.0446  1426 ARG A NE  
265  C  CZ  . ARG A 49  ? 1.5283 1.4388 1.9850 0.0405  -0.1221 0.0403  1426 ARG A CZ  
266  N  NH1 . ARG A 49  ? 1.4605 1.3639 1.9217 0.0453  -0.1130 0.0297  1426 ARG A NH1 
267  N  NH2 . ARG A 49  ? 1.2158 1.1184 1.6463 0.0274  -0.1235 0.0459  1426 ARG A NH2 
268  N  N   . GLN A 50  ? 0.4868 0.4275 0.9626 0.0580  -0.1834 0.0874  1427 GLN A N   
269  C  CA  . GLN A 50  ? 0.4667 0.4232 0.9354 0.0487  -0.1921 0.0895  1427 GLN A CA  
270  C  C   . GLN A 50  ? 0.4901 0.4397 0.9442 0.0529  -0.2063 0.1023  1427 GLN A C   
271  O  O   . GLN A 50  ? 0.4576 0.4221 0.9071 0.0473  -0.2157 0.1036  1427 GLN A O   
272  C  CB  . GLN A 50  ? 0.4741 0.4230 0.9213 0.0319  -0.1844 0.0839  1427 GLN A CB  
273  C  CG  . GLN A 50  ? 0.6465 0.6049 1.1046 0.0257  -0.1705 0.0731  1427 GLN A CG  
274  C  CD  . GLN A 50  ? 0.9631 0.9151 1.4021 0.0091  -0.1642 0.0701  1427 GLN A CD  
275  O  OE1 . GLN A 50  ? 0.8945 0.8285 1.3103 0.0028  -0.1681 0.0744  1427 GLN A OE1 
276  N  NE2 . GLN A 50  ? 0.9361 0.9025 1.3854 0.0020  -0.1534 0.0625  1427 GLN A NE2 
277  N  N   . CYS A 51  ? 0.4618 0.3893 0.9084 0.0621  -0.2075 0.1113  1428 CYS A N   
278  C  CA  . CYS A 51  ? 0.4541 0.3733 0.8841 0.0658  -0.2192 0.1254  1428 CYS A CA  
279  C  C   . CYS A 51  ? 0.5375 0.4816 0.9857 0.0744  -0.2334 0.1319  1428 CYS A C   
280  O  O   . CYS A 51  ? 0.5461 0.5020 1.0244 0.0852  -0.2341 0.1305  1428 CYS A O   
281  C  CB  . CYS A 51  ? 0.4445 0.3354 0.8675 0.0731  -0.2159 0.1339  1428 CYS A CB  
282  S  SG  . CYS A 51  ? 0.5009 0.3808 0.8999 0.0754  -0.2276 0.1530  1428 CYS A SG  
283  N  N   . GLU A 52  ? 0.5226 0.4780 0.9546 0.0689  -0.2445 0.1366  1429 GLU A N   
284  C  CA  . GLU A 52  ? 0.5561 0.5392 1.0025 0.0751  -0.2602 0.1421  1429 GLU A CA  
285  C  C   . GLU A 52  ? 0.7034 0.6807 1.1526 0.0898  -0.2714 0.1604  1429 GLU A C   
286  O  O   . GLU A 52  ? 0.7147 0.7146 1.1866 0.0995  -0.2837 0.1654  1429 GLU A O   
287  C  CB  . GLU A 52  ? 0.5698 0.5697 0.9986 0.0629  -0.2685 0.1379  1429 GLU A CB  
288  C  CG  . GLU A 52  ? 0.6660 0.6488 1.0572 0.0561  -0.2701 0.1436  1429 GLU A CG  
289  C  CD  . GLU A 52  ? 0.6986 0.6584 1.0696 0.0446  -0.2564 0.1350  1429 GLU A CD  
290  O  OE1 . GLU A 52  ? 0.8581 0.8126 1.2412 0.0408  -0.2449 0.1253  1429 GLU A OE1 
291  O  OE2 . GLU A 52  ? 0.3243 0.2721 0.6675 0.0397  -0.2570 0.1386  1429 GLU A OE2 
292  N  N   . ALA A 53  ? 0.7090 0.6567 1.1384 0.0917  -0.2673 0.1708  1430 ALA A N   
293  C  CA  . ALA A 53  ? 0.7464 0.6839 1.1779 0.1046  -0.2766 0.1904  1430 ALA A CA  
294  C  C   . ALA A 53  ? 0.8295 0.7446 1.2831 0.1147  -0.2670 0.1905  1430 ALA A C   
295  O  O   . ALA A 53  ? 0.8178 0.7107 1.2620 0.1086  -0.2529 0.1828  1430 ALA A O   
296  C  CB  . ALA A 53  ? 0.7702 0.6927 1.1639 0.0982  -0.2793 0.2031  1430 ALA A CB  
297  N  N   . LEU A 54  ? 0.8224 0.7440 1.3068 0.1305  -0.2754 0.1982  1431 LEU A N   
298  C  CA  . LEU A 54  ? 0.8318 0.7360 1.3447 0.1418  -0.2672 0.1950  1431 LEU A CA  
299  C  C   . LEU A 54  ? 0.8836 0.7504 1.3839 0.1438  -0.2625 0.2069  1431 LEU A C   
300  O  O   . LEU A 54  ? 0.8985 0.7467 1.4126 0.1462  -0.2501 0.1968  1431 LEU A O   
301  C  CB  . LEU A 54  ? 0.8461 0.7693 1.4002 0.1593  -0.2783 0.1988  1431 LEU A CB  
302  C  CG  . LEU A 54  ? 0.8951 0.8515 1.4804 0.1602  -0.2747 0.1789  1431 LEU A CG  
303  C  CD1 . LEU A 54  ? 0.8894 0.8365 1.4906 0.1589  -0.2549 0.1585  1431 LEU A CD1 
304  C  CD2 . LEU A 54  ? 0.9009 0.8852 1.4693 0.1460  -0.2785 0.1721  1431 LEU A CD2 
305  N  N   . GLN A 55  ? 0.8034 0.6597 1.2784 0.1422  -0.2714 0.2272  1432 GLN A N   
306  C  CA  . GLN A 55  ? 0.7943 0.6155 1.2621 0.1438  -0.2662 0.2391  1432 GLN A CA  
307  C  C   . GLN A 55  ? 0.7651 0.5697 1.1967 0.1275  -0.2549 0.2355  1432 GLN A C   
308  O  O   . GLN A 55  ? 0.7733 0.5550 1.1886 0.1252  -0.2540 0.2505  1432 GLN A O   
309  C  CB  . GLN A 55  ? 0.8495 0.6654 1.3192 0.1546  -0.2822 0.2667  1432 GLN A CB  
310  C  CG  . GLN A 55  ? 1.0145 0.8304 1.5286 0.1747  -0.2911 0.2732  1432 GLN A CG  
311  C  CD  . GLN A 55  ? 1.1987 1.0351 1.7534 0.1841  -0.2883 0.2522  1432 GLN A CD  
312  O  OE1 . GLN A 55  ? 1.1849 1.0491 1.7609 0.1936  -0.3013 0.2547  1432 GLN A OE1 
313  N  NE2 . GLN A 55  ? 0.9704 0.7921 1.5414 0.1839  -0.2722 0.2332  1432 GLN A NE2 
314  N  N   . CYS A 56  ? 0.6549 0.4699 1.0777 0.1165  -0.2454 0.2154  1433 CYS A N   
315  C  CA  . CYS A 56  ? 0.6272 0.4291 1.0196 0.1020  -0.2353 0.2099  1433 CYS A CA  
316  C  C   . CYS A 56  ? 0.7164 0.4886 1.1127 0.1007  -0.2224 0.2052  1433 CYS A C   
317  O  O   . CYS A 56  ? 0.7114 0.4667 1.0857 0.0929  -0.2181 0.2116  1433 CYS A O   
318  C  CB  . CYS A 56  ? 0.5817 0.4029 0.9633 0.0909  -0.2314 0.1927  1433 CYS A CB  
319  S  SG  . CYS A 56  ? 0.6183 0.4661 0.9776 0.0850  -0.2447 0.1989  1433 CYS A SG  
320  N  N   . TRP A 57  ? 0.6981 0.4651 1.1232 0.1083  -0.2166 0.1939  1434 TRP A N   
321  C  CA  . TRP A 57  ? 0.7148 0.4552 1.1464 0.1076  -0.2054 0.1872  1434 TRP A CA  
322  C  C   . TRP A 57  ? 0.7790 0.4927 1.2070 0.1100  -0.2077 0.2062  1434 TRP A C   
323  O  O   . TRP A 57  ? 0.7848 0.4773 1.2050 0.1031  -0.1987 0.2027  1434 TRP A O   
324  C  CB  . TRP A 57  ? 0.7137 0.4556 1.1788 0.1171  -0.2000 0.1720  1434 TRP A CB  
325  C  CG  . TRP A 57  ? 0.7578 0.5032 1.2539 0.1337  -0.2096 0.1814  1434 TRP A CG  
326  C  CD1 . TRP A 57  ? 0.8206 0.5430 1.3318 0.1436  -0.2144 0.1963  1434 TRP A CD1 
327  C  CD2 . TRP A 57  ? 0.7593 0.5324 1.2799 0.1426  -0.2148 0.1749  1434 TRP A CD2 
328  N  NE1 . TRP A 57  ? 0.8296 0.5635 1.3723 0.1593  -0.2238 0.2010  1434 TRP A NE1 
329  C  CE2 . TRP A 57  ? 0.8352 0.6018 1.3850 0.1591  -0.2241 0.1872  1434 TRP A CE2 
330  C  CE3 . TRP A 57  ? 0.7582 0.5617 1.2803 0.1378  -0.2127 0.1606  1434 TRP A CE3 
331  C  CZ2 . TRP A 57  ? 0.8341 0.6258 1.4153 0.1719  -0.2320 0.1849  1434 TRP A CZ2 
332  C  CZ3 . TRP A 57  ? 0.7808 0.6093 1.3340 0.1491  -0.2189 0.1573  1434 TRP A CZ3 
333  C  CH2 . TRP A 57  ? 0.8139 0.6374 1.3967 0.1664  -0.2287 0.1688  1434 TRP A CH2 
334  N  N   . ARG A 58  ? 0.7394 0.4546 1.1733 0.1192  -0.2203 0.2269  1435 ARG A N   
335  C  CA  . ARG A 58  ? 0.7632 0.4537 1.1935 0.1214  -0.2239 0.2493  1435 ARG A CA  
336  C  C   . ARG A 58  ? 0.8209 0.5069 1.2139 0.1069  -0.2206 0.2580  1435 ARG A C   
337  O  O   . ARG A 58  ? 0.8319 0.4940 1.2192 0.1033  -0.2171 0.2708  1435 ARG A O   
338  C  CB  . ARG A 58  ? 0.7781 0.4763 1.2193 0.1340  -0.2401 0.2713  1435 ARG A CB  
339  C  CG  . ARG A 58  ? 0.8780 0.5849 1.3594 0.1505  -0.2458 0.2651  1435 ARG A CG  
340  C  CD  . ARG A 58  ? 0.9500 0.6491 1.4466 0.1642  -0.2609 0.2917  1435 ARG A CD  
341  N  NE  . ARG A 58  ? 0.9875 0.7120 1.5122 0.1786  -0.2728 0.2904  1435 ARG A NE  
342  C  CZ  . ARG A 58  ? 1.1448 0.8679 1.7119 0.1927  -0.2715 0.2786  1435 ARG A CZ  
343  N  NH1 . ARG A 58  ? 1.0111 0.7075 1.5961 0.1941  -0.2589 0.2661  1435 ARG A NH1 
344  N  NH2 . ARG A 58  ? 0.9453 0.6954 1.5382 0.2053  -0.2827 0.2775  1435 ARG A NH2 
345  N  N   . LEU A 59  ? 0.7540 0.4639 1.1237 0.0984  -0.2216 0.2509  1436 LEU A N   
346  C  CA  . LEU A 59  ? 0.7466 0.4587 1.0817 0.0852  -0.2187 0.2554  1436 LEU A CA  
347  C  C   . LEU A 59  ? 0.7915 0.5001 1.1171 0.0739  -0.2057 0.2348  1436 LEU A C   
348  O  O   . LEU A 59  ? 0.7806 0.4911 1.0811 0.0632  -0.2018 0.2352  1436 LEU A O   
349  C  CB  . LEU A 59  ? 0.7410 0.4821 1.0583 0.0840  -0.2297 0.2601  1436 LEU A CB  
350  C  CG  . LEU A 59  ? 0.8080 0.5571 1.1282 0.0939  -0.2450 0.2827  1436 LEU A CG  
351  C  CD1 . LEU A 59  ? 0.8049 0.5869 1.1215 0.0954  -0.2561 0.2777  1436 LEU A CD1 
352  C  CD2 . LEU A 59  ? 0.8360 0.5753 1.1300 0.0884  -0.2467 0.3053  1436 LEU A CD2 
353  N  N   . PHE A 60  ? 0.7497 0.4548 1.0955 0.0764  -0.1993 0.2168  1437 PHE A N   
354  C  CA  . PHE A 60  ? 0.7287 0.4319 1.0669 0.0668  -0.1888 0.1978  1437 PHE A CA  
355  C  C   . PHE A 60  ? 0.8007 0.4806 1.1331 0.0598  -0.1800 0.1989  1437 PHE A C   
356  O  O   . PHE A 60  ? 0.7865 0.4674 1.1024 0.0497  -0.1742 0.1908  1437 PHE A O   
357  C  CB  . PHE A 60  ? 0.7287 0.4375 1.0885 0.0714  -0.1850 0.1798  1437 PHE A CB  
358  C  CG  . PHE A 60  ? 0.7092 0.4201 1.0607 0.0621  -0.1761 0.1614  1437 PHE A CG  
359  C  CD1 . PHE A 60  ? 0.7107 0.4405 1.0494 0.0557  -0.1774 0.1541  1437 PHE A CD1 
360  C  CD2 . PHE A 60  ? 0.7323 0.4264 1.0904 0.0598  -0.1674 0.1513  1437 PHE A CD2 
361  C  CE1 . PHE A 60  ? 0.7098 0.4403 1.0418 0.0477  -0.1703 0.1393  1437 PHE A CE1 
362  C  CE2 . PHE A 60  ? 0.7485 0.4456 1.0980 0.0515  -0.1608 0.1358  1437 PHE A CE2 
363  C  CZ  . PHE A 60  ? 0.7078 0.4225 1.0442 0.0458  -0.1624 0.1310  1437 PHE A CZ  
364  N  N   . ASN A 61  ? 0.7820 0.4412 1.1296 0.0654  -0.1800 0.2097  1438 ASN A N   
365  C  CA  . ASN A 61  ? 0.7898 0.4247 1.1396 0.0598  -0.1721 0.2113  1438 ASN A CA  
366  C  C   . ASN A 61  ? 0.8386 0.4652 1.1708 0.0533  -0.1725 0.2319  1438 ASN A C   
367  O  O   . ASN A 61  ? 0.8409 0.4499 1.1738 0.0461  -0.1650 0.2324  1438 ASN A O   
368  C  CB  . ASN A 61  ? 0.8777 0.4936 1.2586 0.0696  -0.1715 0.2092  1438 ASN A CB  
369  C  CG  . ASN A 61  ? 1.4839 1.0711 1.8757 0.0658  -0.1649 0.2115  1438 ASN A CG  
370  O  OD1 . ASN A 61  ? 1.4885 1.0597 1.8832 0.0672  -0.1680 0.2322  1438 ASN A OD1 
371  N  ND2 . ASN A 61  ? 1.4313 1.0121 1.8292 0.0604  -0.1562 0.1904  1438 ASN A ND2 
372  N  N   . ASN A 62  ? 0.7878 0.4296 1.1024 0.0540  -0.1804 0.2472  1439 ASN A N   
373  C  CA  . ASN A 62  ? 0.8027 0.4400 1.0989 0.0485  -0.1814 0.2693  1439 ASN A CA  
374  C  C   . ASN A 62  ? 0.8397 0.4838 1.1093 0.0343  -0.1733 0.2669  1439 ASN A C   
375  O  O   . ASN A 62  ? 0.8587 0.5017 1.1121 0.0294  -0.1733 0.2858  1439 ASN A O   
376  C  CB  . ASN A 62  ? 0.8322 0.4848 1.1196 0.0556  -0.1943 0.2873  1439 ASN A CB  
377  C  CG  . ASN A 62  ? 1.0148 0.6976 1.2828 0.0536  -0.1998 0.2793  1439 ASN A CG  
378  O  OD1 . ASN A 62  ? 0.9465 0.6396 1.2050 0.0464  -0.1938 0.2608  1439 ASN A OD1 
379  N  ND2 . ASN A 62  ? 0.9151 0.6123 1.1771 0.0599  -0.2121 0.2938  1439 ASN A ND2 
380  N  N   . SER A 63  ? 0.7737 0.4249 1.0397 0.0280  -0.1665 0.2454  1440 SER A N   
381  C  CA  . SER A 63  ? 0.7718 0.4304 1.0178 0.0161  -0.1588 0.2409  1440 SER A CA  
382  C  C   . SER A 63  ? 0.8292 0.5087 1.0483 0.0128  -0.1630 0.2503  1440 SER A C   
383  O  O   . SER A 63  ? 0.8513 0.5346 1.0535 0.0035  -0.1564 0.2547  1440 SER A O   
384  C  CB  . SER A 63  ? 0.8561 0.4953 1.1067 0.0086  -0.1498 0.2481  1440 SER A CB  
385  O  OG  . SER A 63  ? 1.0189 0.6414 1.2921 0.0094  -0.1453 0.2350  1440 SER A OG  
386  N  N   . ARG A 64  ? 0.7531 0.4477 0.9688 0.0201  -0.1737 0.2528  1441 ARG A N   
387  C  CA  . ARG A 64  ? 0.7408 0.4573 0.9309 0.0172  -0.1790 0.2595  1441 ARG A CA  
388  C  C   . ARG A 64  ? 0.7392 0.4758 0.9298 0.0217  -0.1875 0.2464  1441 ARG A C   
389  O  O   . ARG A 64  ? 0.7022 0.4362 0.9137 0.0296  -0.1918 0.2404  1441 ARG A O   
390  C  CB  . ARG A 64  ? 0.7524 0.4659 0.9323 0.0191  -0.1849 0.2873  1441 ARG A CB  
391  C  CG  . ARG A 64  ? 0.7238 0.4568 0.8939 0.0258  -0.1993 0.2978  1441 ARG A CG  
392  C  CD  . ARG A 64  ? 0.6471 0.3674 0.8242 0.0333  -0.2072 0.3246  1441 ARG A CD  
393  N  NE  . ARG A 64  ? 0.5694 0.3044 0.7540 0.0444  -0.2227 0.3291  1441 ARG A NE  
394  C  CZ  . ARG A 64  ? 0.6727 0.3963 0.8796 0.0564  -0.2318 0.3440  1441 ARG A CZ  
395  N  NH1 . ARG A 64  ? 0.5944 0.2888 0.8183 0.0586  -0.2268 0.3555  1441 ARG A NH1 
396  N  NH2 . ARG A 64  ? 0.5084 0.2715 0.7289 0.0545  -0.2387 0.3293  1441 ARG A NH2 
397  N  N   . CYS A 65  ? 0.6990 0.4562 0.8675 0.0157  -0.1889 0.2405  1442 CYS A N   
398  C  CA  . CYS A 65  ? 0.6807 0.4576 0.8487 0.0178  -0.1968 0.2275  1442 CYS A CA  
399  C  C   . CYS A 65  ? 0.6703 0.4593 0.8402 0.0261  -0.2107 0.2410  1442 CYS A C   
400  O  O   . CYS A 65  ? 0.6720 0.4671 0.8252 0.0261  -0.2162 0.2590  1442 CYS A O   
401  C  CB  . CYS A 65  ? 0.6998 0.4934 0.8462 0.0087  -0.1937 0.2145  1442 CYS A CB  
402  S  SG  . CYS A 65  ? 0.7523 0.5696 0.8985 0.0093  -0.2037 0.1979  1442 CYS A SG  
403  N  N   . ASP A 66  ? 0.5847 0.3780 0.7761 0.0330  -0.2165 0.2327  1443 ASP A N   
404  C  CA  . ASP A 66  ? 0.5795 0.3878 0.7796 0.0419  -0.2304 0.2412  1443 ASP A CA  
405  C  C   . ASP A 66  ? 0.5890 0.4186 0.7911 0.0389  -0.2343 0.2218  1443 ASP A C   
406  O  O   . ASP A 66  ? 0.5496 0.3771 0.7724 0.0407  -0.2313 0.2084  1443 ASP A O   
407  C  CB  . ASP A 66  ? 0.5905 0.3841 0.8206 0.0534  -0.2324 0.2487  1443 ASP A CB  
408  C  CG  . ASP A 66  ? 0.4978 0.2686 0.7280 0.0560  -0.2297 0.2686  1443 ASP A CG  
409  O  OD1 . ASP A 66  ? 0.4715 0.2469 0.6856 0.0566  -0.2371 0.2887  1443 ASP A OD1 
410  O  OD2 . ASP A 66  ? 0.5639 0.3127 0.8107 0.0571  -0.2207 0.2644  1443 ASP A OD2 
411  N  N   . PRO A 67  ? 0.5595 0.4089 0.7384 0.0326  -0.2395 0.2192  1444 PRO A N   
412  C  CA  . PRO A 67  ? 0.5467 0.4142 0.7268 0.0275  -0.2424 0.1994  1444 PRO A CA  
413  C  C   . PRO A 67  ? 0.5854 0.4656 0.7908 0.0339  -0.2510 0.1945  1444 PRO A C   
414  O  O   . PRO A 67  ? 0.5678 0.4526 0.7836 0.0294  -0.2480 0.1771  1444 PRO A O   
415  C  CB  . PRO A 67  ? 0.5904 0.4776 0.7415 0.0215  -0.2486 0.2009  1444 PRO A CB  
416  C  CG  . PRO A 67  ? 0.6634 0.5380 0.7948 0.0189  -0.2412 0.2144  1444 PRO A CG  
417  C  CD  . PRO A 67  ? 0.6109 0.4672 0.7602 0.0283  -0.2419 0.2327  1444 PRO A CD  
418  N  N   . ALA A 68  ? 0.5418 0.4271 0.7596 0.0443  -0.2609 0.2101  1445 ALA A N   
419  C  CA  . ALA A 68  ? 0.5308 0.4309 0.7765 0.0513  -0.2687 0.2057  1445 ALA A CA  
420  C  C   . ALA A 68  ? 0.5665 0.4516 0.8382 0.0537  -0.2578 0.1952  1445 ALA A C   
421  O  O   . ALA A 68  ? 0.5567 0.4554 0.8500 0.0554  -0.2598 0.1849  1445 ALA A O   
422  C  CB  . ALA A 68  ? 0.5661 0.4744 0.8201 0.0630  -0.2824 0.2257  1445 ALA A CB  
423  N  N   . CYS A 69  ? 0.5233 0.3823 0.7916 0.0526  -0.2458 0.1966  1446 CYS A N   
424  C  CA  . CYS A 69  ? 0.5101 0.3537 0.7983 0.0541  -0.2350 0.1868  1446 CYS A CA  
425  C  C   . CYS A 69  ? 0.4949 0.3294 0.7718 0.0430  -0.2238 0.1717  1446 CYS A C   
426  O  O   . CYS A 69  ? 0.4770 0.2963 0.7638 0.0428  -0.2142 0.1651  1446 CYS A O   
427  C  CB  . CYS A 69  ? 0.5482 0.3692 0.8454 0.0621  -0.2314 0.1995  1446 CYS A CB  
428  S  SG  . CYS A 69  ? 0.6346 0.4627 0.9538 0.0779  -0.2448 0.2173  1446 CYS A SG  
429  N  N   . SER A 70  ? 0.4137 0.2578 0.6703 0.0340  -0.2256 0.1657  1447 SER A N   
430  C  CA  . SER A 70  ? 0.3780 0.2124 0.6240 0.0244  -0.2164 0.1530  1447 SER A CA  
431  C  C   . SER A 70  ? 0.3749 0.2164 0.6311 0.0187  -0.2146 0.1373  1447 SER A C   
432  O  O   . SER A 70  ? 0.3882 0.2186 0.6393 0.0121  -0.2071 0.1283  1447 SER A O   
433  C  CB  . SER A 70  ? 0.4331 0.2705 0.6534 0.0180  -0.2170 0.1538  1447 SER A CB  
434  O  OG  . SER A 70  ? 0.5145 0.3741 0.7271 0.0150  -0.2265 0.1495  1447 SER A OG  
435  N  N   . SER A 71  ? 0.2852 0.1447 0.5578 0.0212  -0.2210 0.1348  1448 SER A N   
436  C  CA  . SER A 71  ? 0.2617 0.1292 0.5457 0.0145  -0.2189 0.1214  1448 SER A CA  
437  C  C   . SER A 71  ? 0.3079 0.1602 0.6015 0.0135  -0.2079 0.1164  1448 SER A C   
438  O  O   . SER A 71  ? 0.3169 0.1566 0.6146 0.0202  -0.2034 0.1224  1448 SER A O   
439  C  CB  . SER A 71  ? 0.3057 0.1977 0.6083 0.0176  -0.2276 0.1208  1448 SER A CB  
440  O  OG  . SER A 71  ? 0.4211 0.3141 0.7442 0.0276  -0.2264 0.1263  1448 SER A OG  
441  N  N   . PRO A 72  ? 0.2604 0.1128 0.5571 0.0049  -0.2035 0.1060  1449 PRO A N   
442  C  CA  . PRO A 72  ? 0.2526 0.0929 0.5558 0.0038  -0.1936 0.1025  1449 PRO A CA  
443  C  C   . PRO A 72  ? 0.3015 0.1499 0.6249 0.0117  -0.1913 0.1040  1449 PRO A C   
444  O  O   . PRO A 72  ? 0.2896 0.1255 0.6156 0.0150  -0.1839 0.1036  1449 PRO A O   
445  C  CB  . PRO A 72  ? 0.2592 0.1019 0.5624 -0.0072 -0.1917 0.0938  1449 PRO A CB  
446  C  CG  . PRO A 72  ? 0.3055 0.1541 0.5995 -0.0120 -0.1991 0.0911  1449 PRO A CG  
447  C  CD  . PRO A 72  ? 0.2655 0.1281 0.5603 -0.0046 -0.2073 0.0974  1449 PRO A CD  
448  N  N   . ALA A 73  ? 0.2642 0.1347 0.6034 0.0153  -0.1981 0.1046  1450 ALA A N   
449  C  CA  . ALA A 73  ? 0.2684 0.1512 0.6318 0.0241  -0.1970 0.1048  1450 ALA A CA  
450  C  C   . ALA A 73  ? 0.3795 0.2490 0.7454 0.0360  -0.1974 0.1135  1450 ALA A C   
451  O  O   . ALA A 73  ? 0.3685 0.2361 0.7511 0.0429  -0.1918 0.1110  1450 ALA A O   
452  C  CB  . ALA A 73  ? 0.2708 0.1810 0.6501 0.0257  -0.2067 0.1047  1450 ALA A CB  
453  N  N   . CYS A 74  ? 0.3845 0.2443 0.7334 0.0377  -0.2035 0.1231  1451 CYS A N   
454  C  CA  . CYS A 74  ? 0.3967 0.2415 0.7443 0.0469  -0.2050 0.1346  1451 CYS A CA  
455  C  C   . CYS A 74  ? 0.4523 0.2714 0.7843 0.0428  -0.1962 0.1343  1451 CYS A C   
456  O  O   . CYS A 74  ? 0.4709 0.2756 0.7963 0.0466  -0.1970 0.1444  1451 CYS A O   
457  C  CB  . CYS A 74  ? 0.4215 0.2753 0.7605 0.0505  -0.2173 0.1471  1451 CYS A CB  
458  S  SG  . CYS A 74  ? 0.4873 0.3725 0.8495 0.0578  -0.2298 0.1488  1451 CYS A SG  
459  N  N   . LEU A 75  ? 0.4018 0.2160 0.7300 0.0349  -0.1879 0.1232  1452 LEU A N   
460  C  CA  . LEU A 75  ? 0.4085 0.2020 0.7258 0.0305  -0.1797 0.1199  1452 LEU A CA  
461  C  C   . LEU A 75  ? 0.5183 0.2997 0.8156 0.0271  -0.1811 0.1267  1452 LEU A C   
462  O  O   . LEU A 75  ? 0.5013 0.2654 0.7950 0.0277  -0.1764 0.1293  1452 LEU A O   
463  C  CB  . LEU A 75  ? 0.4027 0.1849 0.7346 0.0372  -0.1733 0.1177  1452 LEU A CB  
464  C  CG  . LEU A 75  ? 0.4517 0.2484 0.8039 0.0406  -0.1701 0.1090  1452 LEU A CG  
465  C  CD1 . LEU A 75  ? 0.4624 0.2508 0.8333 0.0505  -0.1663 0.1077  1452 LEU A CD1 
466  C  CD2 . LEU A 75  ? 0.4873 0.2881 0.8332 0.0307  -0.1631 0.0979  1452 LEU A CD2 
467  N  N   . TYR A 76  ? 0.5196 0.3121 0.8047 0.0226  -0.1871 0.1278  1453 TYR A N   
468  C  CA  . TYR A 76  ? 0.5436 0.3307 0.8090 0.0180  -0.1878 0.1312  1453 TYR A CA  
469  C  C   . TYR A 76  ? 0.5846 0.3618 0.8449 0.0228  -0.1881 0.1444  1453 TYR A C   
470  O  O   . TYR A 76  ? 0.5848 0.3542 0.8304 0.0183  -0.1848 0.1465  1453 TYR A O   
471  C  CB  . TYR A 76  ? 0.5680 0.3435 0.8254 0.0103  -0.1809 0.1219  1453 TYR A CB  
472  C  CG  . TYR A 76  ? 0.5853 0.3666 0.8478 0.0049  -0.1802 0.1115  1453 TYR A CG  
473  C  CD1 . TYR A 76  ? 0.5996 0.3942 0.8596 0.0002  -0.1855 0.1070  1453 TYR A CD1 
474  C  CD2 . TYR A 76  ? 0.5939 0.3672 0.8629 0.0034  -0.1741 0.1062  1453 TYR A CD2 
475  C  CE1 . TYR A 76  ? 0.5987 0.3966 0.8644 -0.0060 -0.1846 0.0990  1453 TYR A CE1 
476  C  CE2 . TYR A 76  ? 0.6006 0.3787 0.8725 -0.0027 -0.1732 0.0992  1453 TYR A CE2 
477  C  CZ  . TYR A 76  ? 0.6803 0.4702 0.9517 -0.0074 -0.1783 0.0963  1453 TYR A CZ  
478  O  OH  . TYR A 76  ? 0.6385 0.4315 0.9140 -0.0145 -0.1771 0.0909  1453 TYR A OH  
479  N  N   . ASP A 77  ? 0.5328 0.3105 0.8066 0.0318  -0.1918 0.1535  1454 ASP A N   
480  C  CA  . ASP A 77  ? 0.5634 0.3287 0.8364 0.0370  -0.1924 0.1683  1454 ASP A CA  
481  C  C   . ASP A 77  ? 0.6615 0.4055 0.9313 0.0326  -0.1825 0.1660  1454 ASP A C   
482  O  O   . ASP A 77  ? 0.6935 0.4298 0.9505 0.0293  -0.1805 0.1745  1454 ASP A O   
483  C  CB  . ASP A 77  ? 0.5994 0.3747 0.8546 0.0363  -0.2000 0.1812  1454 ASP A CB  
484  C  CG  . ASP A 77  ? 0.7746 0.5376 1.0292 0.0416  -0.2018 0.2002  1454 ASP A CG  
485  O  OD1 . ASP A 77  ? 0.7730 0.5250 1.0483 0.0499  -0.2020 0.2050  1454 ASP A OD1 
486  O  OD2 . ASP A 77  ? 0.9143 0.6785 1.1484 0.0371  -0.2025 0.2101  1454 ASP A OD2 
487  N  N   . ASN A 78  ? 0.5877 0.3249 0.8684 0.0316  -0.1762 0.1534  1455 ASN A N   
488  C  CA  . ASN A 78  ? 0.5633 0.2831 0.8435 0.0273  -0.1680 0.1484  1455 ASN A CA  
489  C  C   . ASN A 78  ? 0.6114 0.3302 0.8732 0.0187  -0.1652 0.1474  1455 ASN A C   
490  O  O   . ASN A 78  ? 0.6196 0.3258 0.8791 0.0157  -0.1603 0.1504  1455 ASN A O   
491  C  CB  . ASN A 78  ? 0.5425 0.2454 0.8347 0.0329  -0.1662 0.1574  1455 ASN A CB  
492  C  CG  . ASN A 78  ? 0.6876 0.3735 0.9857 0.0294  -0.1583 0.1498  1455 ASN A CG  
493  O  OD1 . ASN A 78  ? 0.6938 0.3639 0.9966 0.0296  -0.1558 0.1573  1455 ASN A OD1 
494  N  ND2 . ASN A 78  ? 0.4407 0.1296 0.7381 0.0253  -0.1548 0.1354  1455 ASN A ND2 
495  N  N   . PHE A 79  ? 0.5546 0.2876 0.8055 0.0146  -0.1684 0.1422  1456 PHE A N   
496  C  CA  . PHE A 79  ? 0.5448 0.2801 0.7807 0.0075  -0.1663 0.1383  1456 PHE A CA  
497  C  C   . PHE A 79  ? 0.5789 0.3140 0.8024 0.0059  -0.1654 0.1493  1456 PHE A C   
498  O  O   . PHE A 79  ? 0.5681 0.3042 0.7819 0.0001  -0.1612 0.1450  1456 PHE A O   
499  C  CB  . PHE A 79  ? 0.5684 0.2936 0.8071 0.0029  -0.1603 0.1281  1456 PHE A CB  
500  C  CG  . PHE A 79  ? 0.5937 0.3212 0.8388 0.0019  -0.1611 0.1178  1456 PHE A CG  
501  C  CD1 . PHE A 79  ? 0.6500 0.3880 0.8905 -0.0013 -0.1648 0.1118  1456 PHE A CD1 
502  C  CD2 . PHE A 79  ? 0.6359 0.3552 0.8911 0.0033  -0.1579 0.1137  1456 PHE A CD2 
503  C  CE1 . PHE A 79  ? 0.6713 0.4107 0.9173 -0.0034 -0.1651 0.1045  1456 PHE A CE1 
504  C  CE2 . PHE A 79  ? 0.6881 0.4110 0.9463 0.0013  -0.1579 0.1055  1456 PHE A CE2 
505  C  CZ  . PHE A 79  ? 0.6721 0.4045 0.9256 -0.0023 -0.1614 0.1022  1456 PHE A CZ  
506  N  N   . ASP A 80  ? 0.5633 0.2985 0.7869 0.0108  -0.1692 0.1638  1457 ASP A N   
507  C  CA  . ASP A 80  ? 0.5946 0.3293 0.8043 0.0083  -0.1677 0.1771  1457 ASP A CA  
508  C  C   . ASP A 80  ? 0.6789 0.4329 0.8684 0.0048  -0.1718 0.1775  1457 ASP A C   
509  O  O   . ASP A 80  ? 0.6824 0.4393 0.8563 0.0006  -0.1688 0.1860  1457 ASP A O   
510  C  CB  . ASP A 80  ? 0.6408 0.3649 0.8584 0.0145  -0.1703 0.1946  1457 ASP A CB  
511  C  CG  . ASP A 80  ? 0.8502 0.5530 1.0861 0.0157  -0.1640 0.1928  1457 ASP A CG  
512  O  OD1 . ASP A 80  ? 0.8537 0.5500 1.0897 0.0093  -0.1563 0.1829  1457 ASP A OD1 
513  O  OD2 . ASP A 80  ? 0.9231 0.6165 1.1748 0.0233  -0.1671 0.2002  1457 ASP A OD2 
514  N  N   . CYS A 81  ? 0.6625 0.4301 0.8521 0.0052  -0.1775 0.1668  1458 CYS A N   
515  C  CA  . CYS A 81  ? 0.6843 0.4706 0.8565 0.0012  -0.1815 0.1622  1458 CYS A CA  
516  C  C   . CYS A 81  ? 0.8417 0.6275 1.0112 -0.0054 -0.1750 0.1449  1458 CYS A C   
517  O  O   . CYS A 81  ? 0.8506 0.6457 1.0048 -0.0105 -0.1722 0.1408  1458 CYS A O   
518  C  CB  . CYS A 81  ? 0.6651 0.4666 0.8419 0.0050  -0.1923 0.1602  1458 CYS A CB  
519  S  SG  . CYS A 81  ? 0.7230 0.5297 0.9026 0.0139  -0.2024 0.1813  1458 CYS A SG  
520  N  N   . HIS A 82  ? 0.8650 0.6397 1.0498 -0.0051 -0.1721 0.1356  1459 HIS A N   
521  C  CA  . HIS A 82  ? 0.8872 0.6590 1.0739 -0.0099 -0.1677 0.1207  1459 HIS A CA  
522  C  C   . HIS A 82  ? 0.9691 0.7325 1.1541 -0.0130 -0.1589 0.1207  1459 HIS A C   
523  O  O   . HIS A 82  ? 0.9644 0.7339 1.1429 -0.0170 -0.1554 0.1118  1459 HIS A O   
524  C  CB  . HIS A 82  ? 0.8888 0.6534 1.0908 -0.0087 -0.1692 0.1134  1459 HIS A CB  
525  C  CG  . HIS A 82  ? 0.9266 0.6842 1.1329 -0.0124 -0.1657 0.1017  1459 HIS A CG  
526  N  ND1 . HIS A 82  ? 0.9437 0.6885 1.1598 -0.0119 -0.1624 0.1008  1459 HIS A ND1 
527  C  CD2 . HIS A 82  ? 0.9513 0.7133 1.1547 -0.0161 -0.1662 0.0905  1459 HIS A CD2 
528  C  CE1 . HIS A 82  ? 0.9331 0.6752 1.1514 -0.0151 -0.1617 0.0910  1459 HIS A CE1 
529  N  NE2 . HIS A 82  ? 0.9411 0.6922 1.1534 -0.0173 -0.1636 0.0844  1459 HIS A NE2 
530  N  N   . ALA A 83  ? 0.9619 0.7123 1.1547 -0.0112 -0.1551 0.1293  1460 ALA A N   
531  C  CA  . ALA A 83  ? 0.9895 0.7319 1.1842 -0.0148 -0.1468 0.1298  1460 ALA A CA  
532  C  C   . ALA A 83  ? 1.1172 0.8562 1.3064 -0.0148 -0.1443 0.1467  1460 ALA A C   
533  O  O   . ALA A 83  ? 1.1057 0.8312 1.3057 -0.0120 -0.1439 0.1547  1460 ALA A O   
534  C  CB  . ALA A 83  ? 0.9842 0.7130 1.1948 -0.0142 -0.1449 0.1237  1460 ALA A CB  
535  N  N   . GLY A 84  ? 1.1345 0.8862 1.3067 -0.0180 -0.1431 0.1521  1461 GLY A N   
536  C  CA  . GLY A 84  ? 1.1684 0.9187 1.3312 -0.0191 -0.1412 0.1708  1461 GLY A CA  
537  C  C   . GLY A 84  ? 1.2442 0.9854 1.4106 -0.0250 -0.1308 0.1764  1461 GLY A C   
538  O  O   . GLY A 84  ? 1.2686 0.9983 1.4375 -0.0249 -0.1298 0.1931  1461 GLY A O   
539  N  N   . GLY A 85  ? 1.1686 0.9150 1.3374 -0.0302 -0.1235 0.1625  1462 GLY A N   
540  C  CA  . GLY A 85  ? 1.1494 0.8918 1.3238 -0.0371 -0.1128 0.1645  1462 GLY A CA  
541  C  C   . GLY A 85  ? 1.1275 0.8548 1.3244 -0.0367 -0.1112 0.1571  1462 GLY A C   
542  O  O   . GLY A 85  ? 1.1082 0.8252 1.3149 -0.0308 -0.1179 0.1541  1462 GLY A O   
543  N  N   . ARG A 86  ? 1.0480 0.7760 1.2532 -0.0434 -0.1021 0.1534  1463 ARG A N   
544  C  CA  . ARG A 86  ? 1.0105 0.7274 1.2370 -0.0450 -0.1000 0.1452  1463 ARG A CA  
545  C  C   . ARG A 86  ? 0.9967 0.7114 1.2325 -0.0393 -0.1073 0.1300  1463 ARG A C   
546  O  O   . ARG A 86  ? 0.9704 0.6733 1.2204 -0.0384 -0.1093 0.1261  1463 ARG A O   
547  C  CB  . ARG A 86  ? 0.9874 0.7139 1.2206 -0.0533 -0.0895 0.1403  1463 ARG A CB  
548  C  CG  . ARG A 86  ? 1.0209 0.7687 1.2456 -0.0544 -0.0860 0.1286  1463 ARG A CG  
549  C  CD  . ARG A 86  ? 1.0859 0.8444 1.3226 -0.0618 -0.0753 0.1216  1463 ARG A CD  
550  N  NE  . ARG A 86  ? 1.0913 0.8697 1.3255 -0.0613 -0.0721 0.1064  1463 ARG A NE  
551  C  CZ  . ARG A 86  ? 1.2565 1.0536 1.4799 -0.0671 -0.0618 0.1062  1463 ARG A CZ  
552  N  NH1 . ARG A 86  ? 1.0521 0.8506 1.2642 -0.0747 -0.0538 0.1229  1463 ARG A NH1 
553  N  NH2 . ARG A 86  ? 1.1359 0.9505 1.3603 -0.0655 -0.0592 0.0891  1463 ARG A NH2 
554  N  N   . GLU A 87  ? 0.9313 0.6573 1.1582 -0.0362 -0.1114 0.1214  1464 GLU A N   
555  C  CA  . GLU A 87  ? 0.8984 0.6226 1.1321 -0.0317 -0.1184 0.1092  1464 GLU A CA  
556  C  C   . GLU A 87  ? 0.9307 0.6433 1.1664 -0.0266 -0.1253 0.1136  1464 GLU A C   
557  O  O   . GLU A 87  ? 0.9195 0.6290 1.1610 -0.0241 -0.1302 0.1054  1464 GLU A O   
558  C  CB  . GLU A 87  ? 0.9073 0.6445 1.1331 -0.0304 -0.1207 0.0992  1464 GLU A CB  
559  C  CG  . GLU A 87  ? 1.0494 0.7917 1.2605 -0.0276 -0.1261 0.1039  1464 GLU A CG  
560  C  CD  . GLU A 87  ? 1.2846 1.0326 1.4946 -0.0253 -0.1320 0.0919  1464 GLU A CD  
561  O  OE1 . GLU A 87  ? 1.1619 0.9036 1.3834 -0.0239 -0.1351 0.0835  1464 GLU A OE1 
562  O  OE2 . GLU A 87  ? 1.1477 0.9059 1.3452 -0.0253 -0.1343 0.0917  1464 GLU A OE2 
563  N  N   . ARG A 88  ? 0.8814 0.5875 1.1139 -0.0253 -0.1251 0.1268  1465 ARG A N   
564  C  CA  . ARG A 88  ? 0.8694 0.5656 1.1073 -0.0198 -0.1303 0.1306  1465 ARG A CA  
565  C  C   . ARG A 88  ? 0.8532 0.5376 1.1061 -0.0203 -0.1294 0.1237  1465 ARG A C   
566  O  O   . ARG A 88  ? 0.8564 0.5366 1.1140 -0.0162 -0.1335 0.1196  1465 ARG A O   
567  C  CB  . ARG A 88  ? 0.9334 0.6244 1.1679 -0.0178 -0.1304 0.1470  1465 ARG A CB  
568  C  CG  . ARG A 88  ? 1.1829 0.8739 1.4183 -0.0102 -0.1378 0.1503  1465 ARG A CG  
569  C  CD  . ARG A 88  ? 1.4372 1.1125 1.6877 -0.0060 -0.1380 0.1548  1465 ARG A CD  
570  N  NE  . ARG A 88  ? 1.5885 1.2657 1.8454 0.0013  -0.1438 0.1514  1465 ARG A NE  
571  C  CZ  . ARG A 88  ? 1.7750 1.4537 2.0378 0.0020  -0.1445 0.1381  1465 ARG A CZ  
572  N  NH1 . ARG A 88  ? 1.5530 1.2304 1.8156 -0.0033 -0.1414 0.1276  1465 ARG A NH1 
573  N  NH2 . ARG A 88  ? 1.6462 1.3275 1.9163 0.0080  -0.1480 0.1358  1465 ARG A NH2 
574  N  N   . THR A 89  ? 0.7514 0.4326 1.0120 -0.0259 -0.1239 0.1212  1466 THR A N   
575  C  CA  . THR A 89  ? 0.7210 0.3928 0.9955 -0.0273 -0.1237 0.1132  1466 THR A CA  
576  C  C   . THR A 89  ? 0.7218 0.4004 1.0026 -0.0324 -0.1218 0.1033  1466 THR A C   
577  O  O   . THR A 89  ? 0.7260 0.4139 1.0044 -0.0360 -0.1173 0.1043  1466 THR A O   
578  C  CB  . THR A 89  ? 0.7857 0.4427 1.0707 -0.0290 -0.1199 0.1209  1466 THR A CB  
579  O  OG1 . THR A 89  ? 0.7367 0.3945 1.0214 -0.0353 -0.1132 0.1298  1466 THR A OG1 
580  C  CG2 . THR A 89  ? 0.8074 0.4561 1.0921 -0.0223 -0.1230 0.1291  1466 THR A CG2 
581  N  N   . CYS A 90  ? 0.6144 0.2896 0.9039 -0.0326 -0.1251 0.0933  1467 CYS A N   
582  C  CA  . CYS A 90  ? 0.5793 0.2604 0.8787 -0.0368 -0.1251 0.0840  1467 CYS A CA  
583  C  C   . CYS A 90  ? 0.5985 0.2749 0.9103 -0.0435 -0.1182 0.0867  1467 CYS A C   
584  O  O   . CYS A 90  ? 0.5972 0.2607 0.9130 -0.0442 -0.1161 0.0921  1467 CYS A O   
585  C  CB  . CYS A 90  ? 0.5679 0.2471 0.8704 -0.0354 -0.1320 0.0743  1467 CYS A CB  
586  S  SG  . CYS A 90  ? 0.6069 0.2968 0.9202 -0.0383 -0.1361 0.0635  1467 CYS A SG  
587  N  N   . ASN A 91  ? 0.5198 0.2065 0.8403 -0.0486 -0.1145 0.0827  1468 ASN A N   
588  C  CA  . ASN A 91  ? 0.5037 0.1871 0.8378 -0.0566 -0.1072 0.0853  1468 ASN A CA  
589  C  C   . ASN A 91  ? 0.5061 0.1796 0.8540 -0.0590 -0.1107 0.0773  1468 ASN A C   
590  O  O   . ASN A 91  ? 0.5082 0.1886 0.8607 -0.0578 -0.1174 0.0658  1468 ASN A O   
591  C  CB  . ASN A 91  ? 0.4634 0.1633 0.8067 -0.0619 -0.1017 0.0809  1468 ASN A CB  
592  C  CG  . ASN A 91  ? 0.7927 0.4911 1.1457 -0.0714 -0.0913 0.0883  1468 ASN A CG  
593  O  OD1 . ASN A 91  ? 0.5992 0.2867 0.9657 -0.0766 -0.0903 0.0880  1468 ASN A OD1 
594  N  ND2 . ASN A 91  ? 0.8293 0.5374 1.1740 -0.0743 -0.0831 0.0961  1468 ASN A ND2 
595  N  N   . PRO A 92  ? 0.3798 0.0642 0.7346 -0.0584 -0.1073 0.0802  1469 PRO A N   
596  C  CA  . PRO A 92  ? 0.3541 0.0573 0.7222 -0.0565 -0.1107 0.0680  1469 PRO A CA  
597  C  C   . PRO A 92  ? 0.3701 0.0577 0.7548 -0.0670 -0.1113 0.0588  1469 PRO A C   
598  O  O   . PRO A 92  ? 0.3438 0.0547 0.7339 -0.0626 -0.1177 0.0459  1469 PRO A O   
599  C  CB  . PRO A 92  ? 0.3959 0.0578 0.7726 -0.0634 -0.1045 0.0788  1469 PRO A CB  
600  C  CG  . PRO A 92  ? 0.4670 0.0944 0.8289 -0.0634 -0.1017 0.0975  1469 PRO A CG  
601  C  CD  . PRO A 92  ? 0.4004 0.0642 0.7514 -0.0611 -0.1008 0.0967  1469 PRO A CD  
602  N  N   . VAL A 93  ? 0.3254 0.0576 0.7154 -0.0648 -0.1057 0.0598  1470 VAL A N   
603  C  CA  . VAL A 93  ? 0.3197 0.0594 0.7278 -0.0705 -0.1068 0.0497  1470 VAL A CA  
604  C  C   . VAL A 93  ? 0.3878 0.0873 0.7948 -0.0774 -0.1170 0.0413  1470 VAL A C   
605  O  O   . VAL A 93  ? 0.4069 0.1157 0.8281 -0.0804 -0.1228 0.0300  1470 VAL A O   
606  C  CB  . VAL A 93  ? 0.3616 0.0737 0.7858 -0.0888 -0.0961 0.0549  1470 VAL A CB  
607  C  CG1 . VAL A 93  ? 0.3757 0.0796 0.8219 -0.1003 -0.0911 0.0529  1470 VAL A CG1 
608  C  CG2 . VAL A 93  ? 0.3591 0.0771 0.7682 -0.0869 -0.0872 0.0690  1470 VAL A CG2 
609  N  N   . TYR A 94  ? 0.3369 0.0596 0.7238 -0.0638 -0.1207 0.0449  1471 TYR A N   
610  C  CA  . TYR A 94  ? 0.3238 0.0610 0.7053 -0.0565 -0.1310 0.0383  1471 TYR A CA  
611  C  C   . TYR A 94  ? 0.3705 0.0705 0.7395 -0.0576 -0.1387 0.0368  1471 TYR A C   
612  O  O   . TYR A 94  ? 0.3664 0.0723 0.7296 -0.0534 -0.1479 0.0324  1471 TYR A O   
613  C  CB  . TYR A 94  ? 0.3313 0.0658 0.7022 -0.0531 -0.1291 0.0437  1471 TYR A CB  
614  C  CG  . TYR A 94  ? 0.3427 0.0713 0.7227 -0.0601 -0.1193 0.0463  1471 TYR A CG  
615  C  CD1 . TYR A 94  ? 0.3599 0.0966 0.7603 -0.0682 -0.1136 0.0424  1471 TYR A CD1 
616  C  CD2 . TYR A 94  ? 0.3561 0.0895 0.7240 -0.0563 -0.1151 0.0510  1471 TYR A CD2 
617  C  CE1 . TYR A 94  ? 0.3480 0.0971 0.7553 -0.0729 -0.1025 0.0448  1471 TYR A CE1 
618  C  CE2 . TYR A 94  ? 0.3753 0.1211 0.7482 -0.0606 -0.1046 0.0523  1471 TYR A CE2 
619  C  CZ  . TYR A 94  ? 0.4712 0.2255 0.8637 -0.0688 -0.0979 0.0494  1471 TYR A CZ  
620  O  OH  . TYR A 94  ? 0.5347 0.3035 0.9312 -0.0738 -0.0861 0.0507  1471 TYR A OH  
621  N  N   . GLU A 95  ? 0.3068 0.0504 0.6691 -0.0480 -0.1348 0.0392  1472 GLU A N   
622  C  CA  . GLU A 95  ? 0.3007 0.0483 0.6510 -0.0429 -0.1398 0.0363  1472 GLU A CA  
623  C  C   . GLU A 95  ? 0.3913 0.0736 0.7461 -0.0560 -0.1480 0.0255  1472 GLU A C   
624  O  O   . GLU A 95  ? 0.3793 0.0666 0.7207 -0.0516 -0.1550 0.0246  1472 GLU A O   
625  C  CB  . GLU A 95  ? 0.3212 0.0485 0.6710 -0.0438 -0.1339 0.0407  1472 GLU A CB  
626  C  CG  . GLU A 95  ? 0.3695 0.0528 0.7074 -0.0439 -0.1369 0.0404  1472 GLU A CG  
627  C  CD  . GLU A 95  ? 0.5843 0.2495 0.9064 -0.0418 -0.1418 0.0444  1472 GLU A CD  
628  O  OE1 . GLU A 95  ? 0.6067 0.2732 0.9220 -0.0384 -0.1396 0.0539  1472 GLU A OE1 
629  O  OE2 . GLU A 95  ? 0.4760 0.1478 0.7925 -0.0418 -0.1485 0.0371  1472 GLU A OE2 
630  N  N   . LYS A 96  ? 0.3695 0.0538 0.7411 -0.0630 -0.1482 0.0161  1473 LYS A N   
631  C  CA  . LYS A 96  ? 0.3656 0.0576 0.7382 -0.0654 -0.1581 0.0033  1473 LYS A CA  
632  C  C   . LYS A 96  ? 0.4718 0.1799 0.8412 -0.0623 -0.1678 0.0036  1473 LYS A C   
633  O  O   . LYS A 96  ? 0.4668 0.1796 0.8229 -0.0599 -0.1769 0.0005  1473 LYS A O   
634  C  CB  . LYS A 96  ? 0.3687 0.0611 0.7612 -0.0741 -0.1577 -0.0078 1473 LYS A CB  
635  C  CG  . LYS A 96  ? 0.3833 0.0860 0.7737 -0.0767 -0.1691 -0.0221 1473 LYS A CG  
636  C  CD  . LYS A 96  ? 0.5396 0.2331 0.9187 -0.0767 -0.1692 -0.0314 1473 LYS A CD  
637  C  CE  . LYS A 96  ? 0.6374 0.3368 0.9913 -0.0707 -0.1757 -0.0297 1473 LYS A CE  
638  N  NZ  . LYS A 96  ? 0.7517 0.4403 1.0945 -0.0683 -0.1703 -0.0340 1473 LYS A NZ  
639  N  N   . TYR A 97  ? 0.4504 0.1671 0.8324 -0.0624 -0.1657 0.0074  1474 TYR A N   
640  C  CA  . TYR A 97  ? 0.4397 0.1701 0.8233 -0.0580 -0.1745 0.0079  1474 TYR A CA  
641  C  C   . TYR A 97  ? 0.4978 0.2239 0.8599 -0.0507 -0.1790 0.0150  1474 TYR A C   
642  O  O   . TYR A 97  ? 0.5101 0.2424 0.8666 -0.0483 -0.1901 0.0138  1474 TYR A O   
643  C  CB  . TYR A 97  ? 0.4423 0.1814 0.8421 -0.0581 -0.1681 0.0106  1474 TYR A CB  
644  C  CG  . TYR A 97  ? 0.4281 0.1810 0.8351 -0.0525 -0.1770 0.0093  1474 TYR A CG  
645  C  CD1 . TYR A 97  ? 0.4486 0.1982 0.8424 -0.0449 -0.1795 0.0158  1474 TYR A CD1 
646  C  CD2 . TYR A 97  ? 0.4236 0.1925 0.8531 -0.0546 -0.1831 0.0013  1474 TYR A CD2 
647  C  CE1 . TYR A 97  ? 0.4603 0.2196 0.8629 -0.0390 -0.1886 0.0147  1474 TYR A CE1 
648  C  CE2 . TYR A 97  ? 0.4305 0.2117 0.8701 -0.0480 -0.1920 0.0003  1474 TYR A CE2 
649  C  CZ  . TYR A 97  ? 0.5133 0.2882 0.9393 -0.0399 -0.1947 0.0072  1474 TYR A CZ  
650  O  OH  . TYR A 97  ? 0.5063 0.2900 0.9440 -0.0327 -0.2035 0.0066  1474 TYR A OH  
651  N  N   . CYS A 98  ? 0.4536 0.1697 0.8043 -0.0478 -0.1710 0.0232  1475 CYS A N   
652  C  CA  . CYS A 98  ? 0.4426 0.1551 0.7754 -0.0420 -0.1744 0.0298  1475 CYS A CA  
653  C  C   . CYS A 98  ? 0.4796 0.1890 0.7967 -0.0421 -0.1801 0.0279  1475 CYS A C   
654  O  O   . CYS A 98  ? 0.4449 0.1568 0.7512 -0.0393 -0.1877 0.0314  1475 CYS A O   
655  C  CB  . CYS A 98  ? 0.4388 0.1443 0.7650 -0.0395 -0.1652 0.0377  1475 CYS A CB  
656  S  SG  . CYS A 98  ? 0.4814 0.1949 0.8197 -0.0387 -0.1595 0.0397  1475 CYS A SG  
657  N  N   . ALA A 99  ? 0.4597 0.1646 0.7770 -0.0460 -0.1768 0.0215  1476 ALA A N   
658  C  CA  . ALA A 99  ? 0.4785 0.1831 0.7818 -0.0471 -0.1806 0.0163  1476 ALA A CA  
659  C  C   . ALA A 99  ? 0.5767 0.2930 0.8783 -0.0494 -0.1927 0.0110  1476 ALA A C   
660  O  O   . ALA A 99  ? 0.5900 0.3099 0.8743 -0.0487 -0.1990 0.0128  1476 ALA A O   
661  C  CB  . ALA A 99  ? 0.4960 0.1928 0.8050 -0.0505 -0.1736 0.0080  1476 ALA A CB  
662  N  N   . ASP A 100 ? 0.5494 0.2730 0.8690 -0.0523 -0.1963 0.0054  1477 ASP A N   
663  C  CA  . ASP A 100 ? 0.5509 0.2878 0.8724 -0.0541 -0.2095 0.0005  1477 ASP A CA  
664  C  C   . ASP A 100 ? 0.5656 0.3080 0.8832 -0.0484 -0.2191 0.0103  1477 ASP A C   
665  O  O   . ASP A 100 ? 0.5809 0.3314 0.8896 -0.0485 -0.2314 0.0108  1477 ASP A O   
666  C  CB  . ASP A 100 ? 0.5811 0.3255 0.9276 -0.0590 -0.2099 -0.0088 1477 ASP A CB  
667  C  CG  . ASP A 100 ? 0.7475 0.4875 1.0989 -0.0662 -0.2048 -0.0212 1477 ASP A CG  
668  O  OD1 . ASP A 100 ? 0.7718 0.5054 1.1066 -0.0666 -0.2027 -0.0246 1477 ASP A OD1 
669  O  OD2 . ASP A 100 ? 0.7906 0.5344 1.1644 -0.0717 -0.2029 -0.0283 1477 ASP A OD2 
670  N  N   . HIS A 101 ? 0.4771 0.2144 0.8004 -0.0437 -0.2138 0.0183  1478 HIS A N   
671  C  CA  . HIS A 101 ? 0.4574 0.1975 0.7827 -0.0378 -0.2218 0.0261  1478 HIS A CA  
672  C  C   . HIS A 101 ? 0.5011 0.2310 0.8082 -0.0342 -0.2202 0.0364  1478 HIS A C   
673  O  O   . HIS A 101 ? 0.4974 0.2267 0.8072 -0.0295 -0.2265 0.0430  1478 HIS A O   
674  C  CB  . HIS A 101 ? 0.4455 0.1911 0.7956 -0.0353 -0.2182 0.0240  1478 HIS A CB  
675  C  CG  . HIS A 101 ? 0.4756 0.2343 0.8468 -0.0391 -0.2218 0.0145  1478 HIS A CG  
676  N  ND1 . HIS A 101 ? 0.4846 0.2436 0.8675 -0.0450 -0.2112 0.0079  1478 HIS A ND1 
677  C  CD2 . HIS A 101 ? 0.4967 0.2685 0.8787 -0.0383 -0.2355 0.0111  1478 HIS A CD2 
678  C  CE1 . HIS A 101 ? 0.4778 0.2506 0.8793 -0.0484 -0.2179 -0.0004 1478 HIS A CE1 
679  N  NE2 . HIS A 101 ? 0.4878 0.2696 0.8894 -0.0442 -0.2330 0.0008  1478 HIS A NE2 
680  N  N   . PHE A 102 ? 0.4362 0.1588 0.7269 -0.0365 -0.2125 0.0372  1479 PHE A N   
681  C  CA  . PHE A 102 ? 0.4183 0.1334 0.6930 -0.0346 -0.2102 0.0459  1479 PHE A CA  
682  C  C   . PHE A 102 ? 0.4821 0.1997 0.7421 -0.0352 -0.2214 0.0523  1479 PHE A C   
683  O  O   . PHE A 102 ? 0.5236 0.2477 0.7744 -0.0389 -0.2266 0.0484  1479 PHE A O   
684  C  CB  . PHE A 102 ? 0.4317 0.1419 0.6961 -0.0369 -0.2000 0.0433  1479 PHE A CB  
685  C  CG  . PHE A 102 ? 0.4353 0.1408 0.6847 -0.0360 -0.1966 0.0506  1479 PHE A CG  
686  C  CD1 . PHE A 102 ? 0.4636 0.1721 0.6953 -0.0389 -0.1997 0.0525  1479 PHE A CD1 
687  C  CD2 . PHE A 102 ? 0.4310 0.1310 0.6837 -0.0331 -0.1897 0.0549  1479 PHE A CD2 
688  C  CE1 . PHE A 102 ? 0.4513 0.1575 0.6716 -0.0391 -0.1952 0.0585  1479 PHE A CE1 
689  C  CE2 . PHE A 102 ? 0.4477 0.1454 0.6891 -0.0329 -0.1866 0.0603  1479 PHE A CE2 
690  C  CZ  . PHE A 102 ? 0.4223 0.1231 0.6489 -0.0361 -0.1888 0.0619  1479 PHE A CZ  
691  N  N   . ALA A 103 ? 0.3951 0.1072 0.6520 -0.0322 -0.2250 0.0622  1480 ALA A N   
692  C  CA  . ALA A 103 ? 0.3949 0.1067 0.6375 -0.0333 -0.2354 0.0719  1480 ALA A CA  
693  C  C   . ALA A 103 ? 0.4391 0.1605 0.6812 -0.0344 -0.2486 0.0710  1480 ALA A C   
694  O  O   . ALA A 103 ? 0.4326 0.1588 0.6547 -0.0389 -0.2534 0.0739  1480 ALA A O   
695  C  CB  . ALA A 103 ? 0.4113 0.1214 0.6318 -0.0380 -0.2292 0.0753  1480 ALA A CB  
696  N  N   . ASP A 104 ? 0.3915 0.1181 0.6558 -0.0307 -0.2539 0.0659  1481 ASP A N   
697  C  CA  . ASP A 104 ? 0.4008 0.1388 0.6698 -0.0307 -0.2681 0.0645  1481 ASP A CA  
698  C  C   . ASP A 104 ? 0.5016 0.2374 0.7805 -0.0245 -0.2818 0.0754  1481 ASP A C   
699  O  O   . ASP A 104 ? 0.5119 0.2578 0.8010 -0.0224 -0.2953 0.0751  1481 ASP A O   
700  C  CB  . ASP A 104 ? 0.4022 0.1502 0.6926 -0.0314 -0.2656 0.0506  1481 ASP A CB  
701  C  CG  . ASP A 104 ? 0.3931 0.1410 0.7115 -0.0262 -0.2608 0.0471  1481 ASP A CG  
702  O  OD1 . ASP A 104 ? 0.4163 0.1549 0.7374 -0.0216 -0.2575 0.0533  1481 ASP A OD1 
703  O  OD2 . ASP A 104 ? 0.3638 0.1217 0.7016 -0.0275 -0.2594 0.0370  1481 ASP A OD2 
704  N  N   . GLY A 105 ? 0.4777 0.2004 0.7566 -0.0213 -0.2788 0.0840  1482 GLY A N   
705  C  CA  . GLY A 105 ? 0.5036 0.2200 0.7948 -0.0148 -0.2909 0.0941  1482 GLY A CA  
706  C  C   . GLY A 105 ? 0.5896 0.3098 0.9143 -0.0069 -0.2924 0.0862  1482 GLY A C   
707  O  O   . GLY A 105 ? 0.6167 0.3335 0.9569 -0.0001 -0.3042 0.0924  1482 GLY A O   
708  N  N   . ARG A 106 ? 0.5246 0.2518 0.8617 -0.0077 -0.2801 0.0726  1483 ARG A N   
709  C  CA  . ARG A 106 ? 0.5028 0.2366 0.8712 -0.0016 -0.2781 0.0635  1483 ARG A CA  
710  C  C   . ARG A 106 ? 0.4819 0.2116 0.8520 -0.0028 -0.2604 0.0565  1483 ARG A C   
711  O  O   . ARG A 106 ? 0.4379 0.1676 0.7939 -0.0090 -0.2498 0.0535  1483 ARG A O   
712  C  CB  . ARG A 106 ? 0.5440 0.2960 0.9289 -0.0024 -0.2830 0.0544  1483 ARG A CB  
713  C  CG  . ARG A 106 ? 0.7594 0.5190 1.1528 0.0020  -0.3035 0.0604  1483 ARG A CG  
714  C  CD  . ARG A 106 ? 0.9385 0.7042 1.3080 -0.0051 -0.3115 0.0634  1483 ARG A CD  
715  N  NE  . ARG A 106 ? 1.0450 0.8304 1.4307 -0.0072 -0.3171 0.0525  1483 ARG A NE  
716  C  CZ  . ARG A 106 ? 1.2406 1.0339 1.6124 -0.0158 -0.3153 0.0453  1483 ARG A CZ  
717  N  NH1 . ARG A 106 ? 1.1203 0.9317 1.5103 -0.0180 -0.3214 0.0346  1483 ARG A NH1 
718  N  NH2 . ARG A 106 ? 1.0652 0.8489 1.4068 -0.0222 -0.3072 0.0475  1483 ARG A NH2 
719  N  N   . CYS A 107 ? 0.4444 0.1701 0.8309 0.0033  -0.2577 0.0541  1484 CYS A N   
720  C  CA  . CYS A 107 ? 0.4333 0.1568 0.8199 0.0022  -0.2420 0.0477  1484 CYS A CA  
721  C  C   . CYS A 107 ? 0.4833 0.2211 0.8831 -0.0003 -0.2314 0.0368  1484 CYS A C   
722  O  O   . CYS A 107 ? 0.4720 0.2220 0.8971 0.0034  -0.2337 0.0294  1484 CYS A O   
723  C  CB  . CYS A 107 ? 0.4332 0.1494 0.8324 0.0087  -0.2421 0.0462  1484 CYS A CB  
724  S  SG  . CYS A 107 ? 0.4701 0.1875 0.8675 0.0070  -0.2236 0.0370  1484 CYS A SG  
725  N  N   . ASP A 108 ? 0.4329 0.1690 0.8170 -0.0069 -0.2197 0.0364  1485 ASP A N   
726  C  CA  . ASP A 108 ? 0.4161 0.1619 0.8085 -0.0113 -0.2078 0.0291  1485 ASP A CA  
727  C  C   . ASP A 108 ? 0.4550 0.1966 0.8396 -0.0118 -0.1946 0.0288  1485 ASP A C   
728  O  O   . ASP A 108 ? 0.4484 0.1806 0.8126 -0.0148 -0.1899 0.0344  1485 ASP A O   
729  C  CB  . ASP A 108 ? 0.4398 0.1850 0.8207 -0.0183 -0.2070 0.0300  1485 ASP A CB  
730  C  CG  . ASP A 108 ? 0.5674 0.3187 0.9528 -0.0184 -0.2210 0.0294  1485 ASP A CG  
731  O  OD1 . ASP A 108 ? 0.5587 0.3233 0.9666 -0.0176 -0.2248 0.0229  1485 ASP A OD1 
732  O  OD2 . ASP A 108 ? 0.6423 0.3868 1.0085 -0.0194 -0.2283 0.0355  1485 ASP A OD2 
733  N  N   . GLN A 109 ? 0.4056 0.1555 0.8065 -0.0084 -0.1893 0.0218  1486 GLN A N   
734  C  CA  . GLN A 109 ? 0.3935 0.1424 0.7865 -0.0088 -0.1779 0.0202  1486 GLN A CA  
735  C  C   . GLN A 109 ? 0.4329 0.1824 0.8125 -0.0158 -0.1656 0.0234  1486 GLN A C   
736  O  O   . GLN A 109 ? 0.4425 0.1860 0.8053 -0.0166 -0.1605 0.0273  1486 GLN A O   
737  C  CB  . GLN A 109 ? 0.4068 0.1674 0.8207 -0.0042 -0.1739 0.0094  1486 GLN A CB  
738  C  CG  . GLN A 109 ? 0.4465 0.2006 0.8706 0.0039  -0.1847 0.0071  1486 GLN A CG  
739  C  CD  . GLN A 109 ? 0.5548 0.2943 0.9606 0.0046  -0.1856 0.0115  1486 GLN A CD  
740  O  OE1 . GLN A 109 ? 0.4348 0.1721 0.8216 0.0001  -0.1772 0.0141  1486 GLN A OE1 
741  N  NE2 . GLN A 109 ? 0.4395 0.1685 0.8522 0.0101  -0.1965 0.0128  1486 GLN A NE2 
742  N  N   . GLY A 110 ? 0.3791 0.1349 0.7665 -0.0209 -0.1621 0.0225  1487 GLY A N   
743  C  CA  . GLY A 110 ? 0.3905 0.1437 0.7674 -0.0275 -0.1515 0.0272  1487 GLY A CA  
744  C  C   . GLY A 110 ? 0.4497 0.1880 0.8050 -0.0284 -0.1536 0.0357  1487 GLY A C   
745  O  O   . GLY A 110 ? 0.4442 0.1781 0.7885 -0.0314 -0.1456 0.0412  1487 GLY A O   
746  N  N   . CYS A 111 ? 0.4247 0.1561 0.7741 -0.0257 -0.1644 0.0372  1488 CYS A N   
747  C  CA  . CYS A 111 ? 0.4261 0.1459 0.7568 -0.0262 -0.1665 0.0435  1488 CYS A CA  
748  C  C   . CYS A 111 ? 0.4979 0.2125 0.8170 -0.0223 -0.1694 0.0473  1488 CYS A C   
749  O  O   . CYS A 111 ? 0.5317 0.2390 0.8364 -0.0228 -0.1700 0.0523  1488 CYS A O   
750  C  CB  . CYS A 111 ? 0.4298 0.1481 0.7602 -0.0276 -0.1751 0.0422  1488 CYS A CB  
751  S  SG  . CYS A 111 ? 0.4800 0.2047 0.8263 -0.0336 -0.1726 0.0355  1488 CYS A SG  
752  N  N   . ASN A 112 ? 0.4266 0.1454 0.7538 -0.0188 -0.1706 0.0436  1489 ASN A N   
753  C  CA  . ASN A 112 ? 0.4168 0.1303 0.7369 -0.0157 -0.1738 0.0452  1489 ASN A CA  
754  C  C   . ASN A 112 ? 0.4710 0.1853 0.7805 -0.0167 -0.1654 0.0463  1489 ASN A C   
755  O  O   . ASN A 112 ? 0.4430 0.1614 0.7560 -0.0147 -0.1633 0.0411  1489 ASN A O   
756  C  CB  . ASN A 112 ? 0.4794 0.1955 0.8156 -0.0110 -0.1797 0.0393  1489 ASN A CB  
757  C  CG  . ASN A 112 ? 0.8565 0.5635 1.1890 -0.0083 -0.1858 0.0411  1489 ASN A CG  
758  O  OD1 . ASN A 112 ? 0.7061 0.4046 1.0249 -0.0103 -0.1895 0.0486  1489 ASN A OD1 
759  N  ND2 . ASN A 112 ? 0.7965 0.5055 1.1430 -0.0041 -0.1866 0.0336  1489 ASN A ND2 
760  N  N   . THR A 113 ? 0.4666 0.1778 0.7637 -0.0194 -0.1611 0.0525  1490 THR A N   
761  C  CA  . THR A 113 ? 0.4758 0.1881 0.7612 -0.0202 -0.1550 0.0562  1490 THR A CA  
762  C  C   . THR A 113 ? 0.5374 0.2426 0.8122 -0.0206 -0.1571 0.0629  1490 THR A C   
763  O  O   . THR A 113 ? 0.5137 0.2148 0.7899 -0.0216 -0.1593 0.0638  1490 THR A O   
764  C  CB  . THR A 113 ? 0.6709 0.3890 0.9571 -0.0230 -0.1457 0.0577  1490 THR A CB  
765  O  OG1 . THR A 113 ? 0.5932 0.3066 0.8828 -0.0254 -0.1443 0.0611  1490 THR A OG1 
766  C  CG2 . THR A 113 ? 0.7549 0.4839 1.0522 -0.0234 -0.1411 0.0501  1490 THR A CG2 
767  N  N   . GLU A 114 ? 0.5350 0.2406 0.7999 -0.0200 -0.1564 0.0664  1491 GLU A N   
768  C  CA  . GLU A 114 ? 0.5324 0.2340 0.7900 -0.0199 -0.1577 0.0718  1491 GLU A CA  
769  C  C   . GLU A 114 ? 0.5547 0.2532 0.8129 -0.0202 -0.1535 0.0755  1491 GLU A C   
770  O  O   . GLU A 114 ? 0.5564 0.2511 0.8135 -0.0200 -0.1550 0.0762  1491 GLU A O   
771  C  CB  . GLU A 114 ? 0.5529 0.2583 0.8030 -0.0191 -0.1584 0.0742  1491 GLU A CB  
772  C  CG  . GLU A 114 ? 0.6915 0.4030 0.9366 -0.0186 -0.1538 0.0774  1491 GLU A CG  
773  C  CD  . GLU A 114 ? 0.9402 0.6580 1.1784 -0.0182 -0.1565 0.0781  1491 GLU A CD  
774  O  OE1 . GLU A 114 ? 0.6512 0.3709 0.8858 -0.0167 -0.1569 0.0843  1491 GLU A OE1 
775  O  OE2 . GLU A 114 ? 1.0571 0.7782 1.2954 -0.0191 -0.1587 0.0715  1491 GLU A OE2 
776  N  N   . GLU A 115 ? 0.5027 0.2025 0.7631 -0.0210 -0.1479 0.0777  1492 GLU A N   
777  C  CA  . GLU A 115 ? 0.5108 0.2047 0.7744 -0.0217 -0.1438 0.0819  1492 GLU A CA  
778  C  C   . GLU A 115 ? 0.5697 0.2591 0.8425 -0.0240 -0.1444 0.0765  1492 GLU A C   
779  O  O   . GLU A 115 ? 0.5742 0.2568 0.8505 -0.0243 -0.1423 0.0775  1492 GLU A O   
780  C  CB  . GLU A 115 ? 0.5311 0.2268 0.7937 -0.0231 -0.1376 0.0883  1492 GLU A CB  
781  C  CG  . GLU A 115 ? 0.5940 0.2960 0.8623 -0.0268 -0.1334 0.0844  1492 GLU A CG  
782  C  CD  . GLU A 115 ? 0.7061 0.4190 0.9691 -0.0264 -0.1331 0.0805  1492 GLU A CD  
783  O  OE1 . GLU A 115 ? 0.3668 0.0904 0.6242 -0.0235 -0.1384 0.0767  1492 GLU A OE1 
784  O  OE2 . GLU A 115 ? 0.7090 0.4296 0.9751 -0.0294 -0.1271 0.0787  1492 GLU A OE2 
785  N  N   . CYS A 116 ? 0.5215 0.2148 0.7994 -0.0253 -0.1478 0.0702  1493 CYS A N   
786  C  CA  . CYS A 116 ? 0.5226 0.2149 0.8092 -0.0278 -0.1503 0.0643  1493 CYS A CA  
787  C  C   . CYS A 116 ? 0.5912 0.2827 0.8725 -0.0270 -0.1578 0.0614  1493 CYS A C   
788  O  O   . CYS A 116 ? 0.5965 0.2887 0.8823 -0.0291 -0.1613 0.0563  1493 CYS A O   
789  C  CB  . CYS A 116 ? 0.5295 0.2290 0.8278 -0.0296 -0.1497 0.0598  1493 CYS A CB  
790  S  SG  . CYS A 116 ? 0.5920 0.2939 0.8977 -0.0337 -0.1391 0.0630  1493 CYS A SG  
791  N  N   . GLY A 117 ? 0.5547 0.2459 0.8262 -0.0248 -0.1603 0.0647  1494 GLY A N   
792  C  CA  . GLY A 117 ? 0.5600 0.2510 0.8243 -0.0252 -0.1663 0.0643  1494 GLY A CA  
793  C  C   . GLY A 117 ? 0.6516 0.3441 0.9163 -0.0247 -0.1736 0.0650  1494 GLY A C   
794  O  O   . GLY A 117 ? 0.6789 0.3710 0.9375 -0.0260 -0.1795 0.0663  1494 GLY A O   
795  N  N   . TRP A 118 ? 0.5881 0.2823 0.8599 -0.0228 -0.1733 0.0642  1495 TRP A N   
796  C  CA  . TRP A 118 ? 0.5812 0.2748 0.8573 -0.0211 -0.1800 0.0639  1495 TRP A CA  
797  C  C   . TRP A 118 ? 0.6279 0.3222 0.9103 -0.0208 -0.1887 0.0629  1495 TRP A C   
798  O  O   . TRP A 118 ? 0.6308 0.3216 0.9146 -0.0194 -0.1965 0.0657  1495 TRP A O   
799  C  CB  . TRP A 118 ? 0.5759 0.2653 0.8427 -0.0217 -0.1825 0.0688  1495 TRP A CB  
800  C  CG  . TRP A 118 ? 0.5946 0.2853 0.8589 -0.0211 -0.1775 0.0687  1495 TRP A CG  
801  C  CD1 . TRP A 118 ? 0.6332 0.3244 0.8889 -0.0225 -0.1750 0.0723  1495 TRP A CD1 
802  C  CD2 . TRP A 118 ? 0.5918 0.2856 0.8624 -0.0192 -0.1753 0.0639  1495 TRP A CD2 
803  N  NE1 . TRP A 118 ? 0.6281 0.3224 0.8838 -0.0216 -0.1727 0.0708  1495 TRP A NE1 
804  C  CE2 . TRP A 118 ? 0.6422 0.3381 0.9056 -0.0199 -0.1725 0.0653  1495 TRP A CE2 
805  C  CE3 . TRP A 118 ? 0.6060 0.3029 0.8883 -0.0170 -0.1752 0.0576  1495 TRP A CE3 
806  C  CZ2 . TRP A 118 ? 0.6314 0.3323 0.8960 -0.0190 -0.1699 0.0604  1495 TRP A CZ2 
807  C  CZ3 . TRP A 118 ? 0.6286 0.3305 0.9131 -0.0160 -0.1713 0.0520  1495 TRP A CZ3 
808  C  CH2 . TRP A 118 ? 0.6392 0.3430 0.9133 -0.0173 -0.1687 0.0534  1495 TRP A CH2 
809  N  N   . ASP A 119 ? 0.5697 0.2681 0.8569 -0.0224 -0.1882 0.0592  1496 ASP A N   
810  C  CA  . ASP A 119 ? 0.5460 0.2480 0.8391 -0.0226 -0.1974 0.0575  1496 ASP A CA  
811  C  C   . ASP A 119 ? 0.5311 0.2296 0.8097 -0.0240 -0.2055 0.0638  1496 ASP A C   
812  O  O   . ASP A 119 ? 0.5096 0.2097 0.7911 -0.0231 -0.2160 0.0661  1496 ASP A O   
813  C  CB  . ASP A 119 ? 0.5626 0.2693 0.8745 -0.0186 -0.2020 0.0540  1496 ASP A CB  
814  C  CG  . ASP A 119 ? 0.6663 0.3802 0.9882 -0.0186 -0.2111 0.0512  1496 ASP A CG  
815  O  OD1 . ASP A 119 ? 0.7497 0.4668 1.0671 -0.0228 -0.2106 0.0486  1496 ASP A OD1 
816  O  OD2 . ASP A 119 ? 0.5544 0.2710 0.8898 -0.0143 -0.2194 0.0510  1496 ASP A OD2 
817  N  N   . GLY A 120 ? 0.4608 0.1559 0.7245 -0.0265 -0.2006 0.0671  1497 GLY A N   
818  C  CA  . GLY A 120 ? 0.4670 0.1607 0.7152 -0.0294 -0.2054 0.0733  1497 GLY A CA  
819  C  C   . GLY A 120 ? 0.5119 0.2000 0.7604 -0.0283 -0.2134 0.0815  1497 GLY A C   
820  O  O   . GLY A 120 ? 0.5339 0.2215 0.7720 -0.0308 -0.2210 0.0884  1497 GLY A O   
821  N  N   . LEU A 121 ? 0.4192 0.1030 0.6798 -0.0247 -0.2119 0.0805  1498 LEU A N   
822  C  CA  . LEU A 121 ? 0.3942 0.0812 0.6614 -0.0230 -0.2183 0.0839  1498 LEU A CA  
823  C  C   . LEU A 121 ? 0.4517 0.1266 0.7314 -0.0186 -0.2301 0.0872  1498 LEU A C   
824  O  O   . LEU A 121 ? 0.4852 0.1512 0.7705 -0.0168 -0.2374 0.0932  1498 LEU A O   
825  C  CB  . LEU A 121 ? 0.3888 0.0813 0.6423 -0.0281 -0.2193 0.0913  1498 LEU A CB  
826  C  CG  . LEU A 121 ? 0.4107 0.0836 0.6558 -0.0305 -0.2093 0.0935  1498 LEU A CG  
827  C  CD1 . LEU A 121 ? 0.3924 0.0790 0.6263 -0.0364 -0.2103 0.0997  1498 LEU A CD1 
828  C  CD2 . LEU A 121 ? 0.4508 0.1216 0.7071 -0.0272 -0.2045 0.0873  1498 LEU A CD2 
829  N  N   . ASP A 122 ? 0.3836 0.0677 0.6715 -0.0169 -0.2322 0.0813  1499 ASP A N   
830  C  CA  . ASP A 122 ? 0.3906 0.0770 0.6944 -0.0121 -0.2437 0.0815  1499 ASP A CA  
831  C  C   . ASP A 122 ? 0.4426 0.1255 0.7689 -0.0055 -0.2444 0.0768  1499 ASP A C   
832  O  O   . ASP A 122 ? 0.4581 0.1396 0.7994 -0.0003 -0.2555 0.0791  1499 ASP A O   
833  C  CB  . ASP A 122 ? 0.4241 0.1236 0.7355 -0.0124 -0.2437 0.0733  1499 ASP A CB  
834  C  CG  . ASP A 122 ? 0.5272 0.2322 0.8210 -0.0181 -0.2461 0.0747  1499 ASP A CG  
835  O  OD1 . ASP A 122 ? 0.5642 0.2655 0.8403 -0.0209 -0.2527 0.0843  1499 ASP A OD1 
836  O  OD2 . ASP A 122 ? 0.4735 0.1870 0.7715 -0.0204 -0.2414 0.0658  1499 ASP A OD2 
837  N  N   . CYS A 123 ? 0.4045 0.0872 0.7340 -0.0053 -0.2329 0.0696  1500 CYS A N   
838  C  CA  . CYS A 123 ? 0.4192 0.1006 0.7687 0.0004  -0.2316 0.0620  1500 CYS A CA  
839  C  C   . CYS A 123 ? 0.5089 0.1764 0.8558 0.0005  -0.2335 0.0661  1500 CYS A C   
840  O  O   . CYS A 123 ? 0.4801 0.1442 0.8444 0.0054  -0.2340 0.0591  1500 CYS A O   
841  C  CB  . CYS A 123 ? 0.4142 0.1060 0.7677 -0.0001 -0.2182 0.0511  1500 CYS A CB  
842  S  SG  . CYS A 123 ? 0.4581 0.1652 0.8189 -0.0017 -0.2148 0.0457  1500 CYS A SG  
843  N  N   . ALA A 124 ? 0.5224 0.1828 0.8490 -0.0054 -0.2337 0.0761  1501 ALA A N   
844  C  CA  . ALA A 124 ? 0.5414 0.1894 0.8643 -0.0078 -0.2345 0.0807  1501 ALA A CA  
845  C  C   . ALA A 124 ? 0.6625 0.2997 0.9760 -0.0114 -0.2444 0.0959  1501 ALA A C   
846  O  O   . ALA A 124 ? 0.6762 0.3067 0.9783 -0.0173 -0.2421 0.1024  1501 ALA A O   
847  C  CB  . ALA A 124 ? 0.5351 0.1871 0.8439 -0.0128 -0.2233 0.0778  1501 ALA A CB  
848  N  N   . SER A 125 ? 0.6479 0.2843 0.9672 -0.0080 -0.2557 0.1023  1502 SER A N   
849  C  CA  . SER A 125 ? 0.6645 0.2913 0.9737 -0.0114 -0.2666 0.1189  1502 SER A CA  
850  C  C   . SER A 125 ? 0.6741 0.2819 0.9917 -0.0121 -0.2710 0.1261  1502 SER A C   
851  O  O   . SER A 125 ? 0.6528 0.2519 0.9564 -0.0188 -0.2750 0.1411  1502 SER A O   
852  C  CB  . SER A 125 ? 0.7445 0.3755 1.0612 -0.0063 -0.2796 0.1235  1502 SER A CB  
853  O  OG  . SER A 125 ? 0.9071 0.5350 1.2532 0.0034  -0.2856 0.1166  1502 SER A OG  
854  N  N   . GLU A 126 ? 0.6214 0.2235 0.9615 -0.0063 -0.2691 0.1144  1503 GLU A N   
855  C  CA  . GLU A 126 ? 0.6418 0.2246 0.9943 -0.0068 -0.2732 0.1179  1503 GLU A CA  
856  C  C   . GLU A 126 ? 0.6976 0.2787 1.0421 -0.0141 -0.2624 0.1125  1503 GLU A C   
857  O  O   . GLU A 126 ? 0.7093 0.2747 1.0644 -0.0161 -0.2649 0.1136  1503 GLU A O   
858  C  CB  . GLU A 126 ? 0.6630 0.2395 1.0474 0.0041  -0.2790 0.1074  1503 GLU A CB  
859  C  CG  . GLU A 126 ? 0.8305 0.4054 1.2270 0.0114  -0.2934 0.1163  1503 GLU A CG  
860  C  CD  . GLU A 126 ? 1.1101 0.6855 1.5410 0.0239  -0.2982 0.1032  1503 GLU A CD  
861  O  OE1 . GLU A 126 ? 0.9904 0.5695 1.4354 0.0270  -0.2886 0.0846  1503 GLU A OE1 
862  O  OE2 . GLU A 126 ? 0.9800 0.5546 1.4237 0.0308  -0.3116 0.1112  1503 GLU A OE2 
863  N  N   . VAL A 127 ? 0.6285 0.2253 0.9560 -0.0182 -0.2512 0.1069  1504 VAL A N   
864  C  CA  . VAL A 127 ? 0.6067 0.2052 0.9267 -0.0247 -0.2421 0.1023  1504 VAL A CA  
865  C  C   . VAL A 127 ? 0.6599 0.2581 0.9598 -0.0342 -0.2414 0.1171  1504 VAL A C   
866  O  O   . VAL A 127 ? 0.6534 0.2622 0.9378 -0.0353 -0.2397 0.1217  1504 VAL A O   
867  C  CB  . VAL A 127 ? 0.6202 0.2358 0.9355 -0.0230 -0.2309 0.0884  1504 VAL A CB  
868  C  CG1 . VAL A 127 ? 0.6061 0.2239 0.9160 -0.0289 -0.2242 0.0842  1504 VAL A CG1 
869  C  CG2 . VAL A 127 ? 0.6168 0.2366 0.9496 -0.0145 -0.2300 0.0740  1504 VAL A CG2 
870  N  N   . PRO A 128 ? 0.6030 0.1902 0.9034 -0.0417 -0.2422 0.1240  1505 PRO A N   
871  C  CA  . PRO A 128 ? 0.6000 0.1898 0.8815 -0.0517 -0.2399 0.1380  1505 PRO A CA  
872  C  C   . PRO A 128 ? 0.6191 0.2284 0.8856 -0.0547 -0.2286 0.1323  1505 PRO A C   
873  O  O   . PRO A 128 ? 0.5921 0.2097 0.8636 -0.0517 -0.2224 0.1192  1505 PRO A O   
874  C  CB  . PRO A 128 ? 0.6360 0.2114 0.9270 -0.0591 -0.2414 0.1427  1505 PRO A CB  
875  C  CG  . PRO A 128 ? 0.6992 0.2588 1.0137 -0.0518 -0.2489 0.1358  1505 PRO A CG  
876  C  CD  . PRO A 128 ? 0.6212 0.1940 0.9404 -0.0422 -0.2446 0.1186  1505 PRO A CD  
877  N  N   . ALA A 129 ? 0.5648 0.1816 0.8130 -0.0606 -0.2264 0.1424  1506 ALA A N   
878  C  CA  . ALA A 129 ? 0.5372 0.1716 0.7727 -0.0633 -0.2160 0.1378  1506 ALA A CA  
879  C  C   . ALA A 129 ? 0.5069 0.1448 0.7481 -0.0688 -0.2097 0.1340  1506 ALA A C   
880  O  O   . ALA A 129 ? 0.4818 0.1096 0.7297 -0.0753 -0.2123 0.1400  1506 ALA A O   
881  C  CB  . ALA A 129 ? 0.5632 0.2047 0.7791 -0.0696 -0.2148 0.1486  1506 ALA A CB  
882  N  N   . LEU A 130 ? 0.4196 0.0716 0.6599 -0.0658 -0.2022 0.1238  1507 LEU A N   
883  C  CA  . LEU A 130 ? 0.3799 0.0679 0.6256 -0.0666 -0.1970 0.1143  1507 LEU A CA  
884  C  C   . LEU A 130 ? 0.3804 0.0770 0.6161 -0.0668 -0.1888 0.1138  1507 LEU A C   
885  O  O   . LEU A 130 ? 0.3418 0.0716 0.5788 -0.0576 -0.1861 0.1016  1507 LEU A O   
886  C  CB  . LEU A 130 ? 0.3593 0.0622 0.6168 -0.0592 -0.1981 0.1004  1507 LEU A CB  
887  C  CG  . LEU A 130 ? 0.4052 0.0611 0.6762 -0.0634 -0.2036 0.1018  1507 LEU A CG  
888  C  CD1 . LEU A 130 ? 0.3930 0.0579 0.6708 -0.0611 -0.2014 0.0891  1507 LEU A CD1 
889  C  CD2 . LEU A 130 ? 0.4410 0.0772 0.7160 -0.0746 -0.2063 0.1129  1507 LEU A CD2 
890  N  N   . LEU A 131 ? 0.3346 0.0772 0.5611 -0.0686 -0.1862 0.1142  1508 LEU A N   
891  C  CA  . LEU A 131 ? 0.3064 0.0746 0.5248 -0.0664 -0.1783 0.1094  1508 LEU A CA  
892  C  C   . LEU A 131 ? 0.3665 0.0860 0.5929 -0.0754 -0.1705 0.1151  1508 LEU A C   
893  O  O   . LEU A 131 ? 0.3942 0.1089 0.6289 -0.0825 -0.1710 0.1180  1508 LEU A O   
894  C  CB  . LEU A 131 ? 0.3129 0.0776 0.5164 -0.0744 -0.1758 0.1188  1508 LEU A CB  
895  C  CG  . LEU A 131 ? 0.3678 0.0850 0.5588 -0.0812 -0.1820 0.1342  1508 LEU A CG  
896  C  CD1 . LEU A 131 ? 0.3771 0.0887 0.5500 -0.0919 -0.1773 0.1454  1508 LEU A CD1 
897  C  CD2 . LEU A 131 ? 0.4285 0.1216 0.6174 -0.0747 -0.1841 0.1314  1508 LEU A CD2 
898  N  N   . ALA A 132 ? 0.3182 0.0813 0.5448 -0.0644 -0.1659 0.1027  1509 ALA A N   
899  C  CA  . ALA A 132 ? 0.3203 0.0865 0.5563 -0.0654 -0.1602 0.1002  1509 ALA A CA  
900  C  C   . ALA A 132 ? 0.3815 0.1363 0.6145 -0.0785 -0.1525 0.1079  1509 ALA A C   
901  O  O   . ALA A 132 ? 0.3742 0.1261 0.5941 -0.0837 -0.1512 0.1136  1509 ALA A O   
902  C  CB  . ALA A 132 ? 0.3179 0.0848 0.5561 -0.0567 -0.1568 0.0939  1509 ALA A CB  
903  N  N   . ARG A 133 ? 0.3496 0.1201 0.5945 -0.0809 -0.1481 0.1051  1510 ARG A N   
904  C  CA  . ARG A 133 ? 0.3570 0.1439 0.6017 -0.0895 -0.1394 0.1071  1510 ARG A CA  
905  C  C   . ARG A 133 ? 0.4162 0.2146 0.6542 -0.0846 -0.1313 0.1010  1510 ARG A C   
906  O  O   . ARG A 133 ? 0.3676 0.1686 0.6118 -0.0738 -0.1308 0.0930  1510 ARG A O   
907  C  CB  . ARG A 133 ? 0.3146 0.1186 0.5783 -0.0924 -0.1370 0.1037  1510 ARG A CB  
908  C  CG  . ARG A 133 ? 0.3543 0.1496 0.6249 -0.1008 -0.1431 0.1085  1510 ARG A CG  
909  C  CD  . ARG A 133 ? 0.3628 0.1751 0.6533 -0.1018 -0.1433 0.1027  1510 ARG A CD  
910  N  NE  . ARG A 133 ? 0.4112 0.2113 0.7082 -0.1042 -0.1525 0.1020  1510 ARG A NE  
911  C  CZ  . ARG A 133 ? 0.5091 0.3050 0.8086 -0.0950 -0.1595 0.0957  1510 ARG A CZ  
912  N  NH1 . ARG A 133 ? 0.1272 0.0585 0.4134 -0.0414 -0.1704 0.0827  1510 ARG A NH1 
913  N  NH2 . ARG A 133 ? 0.4510 0.2525 0.7478 -0.0830 -0.1588 0.0917  1510 ARG A NH2 
914  N  N   . GLY A 134 ? 0.4220 0.2267 0.6471 -0.0929 -0.1251 0.1048  1511 GLY A N   
915  C  CA  . GLY A 134 ? 0.4402 0.2581 0.6587 -0.0901 -0.1163 0.0969  1511 GLY A CA  
916  C  C   . GLY A 134 ? 0.5475 0.3532 0.7513 -0.0843 -0.1199 0.0941  1511 GLY A C   
917  O  O   . GLY A 134 ? 0.5766 0.3635 0.7744 -0.0825 -0.1295 0.0997  1511 GLY A O   
918  N  N   . VAL A 135 ? 0.4985 0.3167 0.6980 -0.0817 -0.1117 0.0841  1512 VAL A N   
919  C  CA  . VAL A 135 ? 0.5021 0.3134 0.6890 -0.0773 -0.1133 0.0781  1512 VAL A CA  
920  C  C   . VAL A 135 ? 0.5302 0.3448 0.7324 -0.0656 -0.1093 0.0640  1512 VAL A C   
921  O  O   . VAL A 135 ? 0.4929 0.3230 0.7102 -0.0629 -0.1014 0.0570  1512 VAL A O   
922  C  CB  . VAL A 135 ? 0.5802 0.4009 0.7435 -0.0873 -0.1086 0.0797  1512 VAL A CB  
923  C  CG1 . VAL A 135 ? 0.5927 0.4371 0.7580 -0.0882 -0.0947 0.0668  1512 VAL A CG1 
924  C  CG2 . VAL A 135 ? 0.5842 0.3929 0.7313 -0.0854 -0.1163 0.0790  1512 VAL A CG2 
925  N  N   . LEU A 136 ? 0.4985 0.2978 0.7000 -0.0585 -0.1155 0.0609  1513 LEU A N   
926  C  CA  . LEU A 136 ? 0.4842 0.2815 0.7003 -0.0478 -0.1130 0.0496  1513 LEU A CA  
927  C  C   . LEU A 136 ? 0.5382 0.3423 0.7446 -0.0491 -0.1068 0.0374  1513 LEU A C   
928  O  O   . LEU A 136 ? 0.5614 0.3597 0.7502 -0.0538 -0.1111 0.0386  1513 LEU A O   
929  C  CB  . LEU A 136 ? 0.4761 0.2539 0.6967 -0.0415 -0.1221 0.0532  1513 LEU A CB  
930  C  CG  . LEU A 136 ? 0.5496 0.3213 0.7854 -0.0313 -0.1206 0.0451  1513 LEU A CG  
931  C  CD1 . LEU A 136 ? 0.5553 0.3352 0.8109 -0.0246 -0.1175 0.0447  1513 LEU A CD1 
932  C  CD2 . LEU A 136 ? 0.5755 0.3297 0.8110 -0.0283 -0.1283 0.0495  1513 LEU A CD2 
933  N  N   . VAL A 137 ? 0.4666 0.2851 0.6848 -0.0453 -0.0967 0.0250  1514 VAL A N   
934  C  CA  . VAL A 137 ? 0.4691 0.2971 0.6793 -0.0467 -0.0891 0.0099  1514 VAL A CA  
935  C  C   . VAL A 137 ? 0.5326 0.3511 0.7603 -0.0359 -0.0882 -0.0033 1514 VAL A C   
936  O  O   . VAL A 137 ? 0.5418 0.3610 0.7931 -0.0269 -0.0857 -0.0059 1514 VAL A O   
937  C  CB  . VAL A 137 ? 0.5232 0.3771 0.7319 -0.0523 -0.0765 0.0031  1514 VAL A CB  
938  C  CG1 . VAL A 137 ? 0.5270 0.3918 0.7236 -0.0548 -0.0687 -0.0141 1514 VAL A CG1 
939  C  CG2 . VAL A 137 ? 0.5332 0.3947 0.7262 -0.0645 -0.0774 0.0189  1514 VAL A CG2 
940  N  N   . LEU A 138 ? 0.4729 0.2822 0.6904 -0.0369 -0.0911 -0.0109 1515 LEU A N   
941  C  CA  . LEU A 138 ? 0.4468 0.2439 0.6809 -0.0283 -0.0907 -0.0233 1515 LEU A CA  
942  C  C   . LEU A 138 ? 0.5131 0.3186 0.7410 -0.0305 -0.0839 -0.0435 1515 LEU A C   
943  O  O   . LEU A 138 ? 0.5053 0.3161 0.7090 -0.0394 -0.0862 -0.0450 1515 LEU A O   
944  C  CB  . LEU A 138 ? 0.4312 0.2067 0.6642 -0.0272 -0.1015 -0.0150 1515 LEU A CB  
945  C  CG  . LEU A 138 ? 0.4680 0.2337 0.7010 -0.0270 -0.1099 0.0039  1515 LEU A CG  
946  C  CD1 . LEU A 138 ? 0.4511 0.2206 0.6999 -0.0214 -0.1081 0.0109  1515 LEU A CD1 
947  C  CD2 . LEU A 138 ? 0.4826 0.2519 0.6929 -0.0365 -0.1155 0.0140  1515 LEU A CD2 
948  N  N   . THR A 139 ? 0.4912 0.2974 0.7415 -0.0220 -0.0764 -0.0595 1516 THR A N   
949  C  CA  . THR A 139 ? 0.4952 0.3074 0.7437 -0.0230 -0.0696 -0.0826 1516 THR A CA  
950  C  C   . THR A 139 ? 0.4406 0.2295 0.7019 -0.0183 -0.0755 -0.0883 1516 THR A C   
951  O  O   . THR A 139 ? 0.3788 0.1525 0.6653 -0.0088 -0.0768 -0.0848 1516 THR A O   
952  C  CB  . THR A 139 ? 0.7153 0.5446 0.9816 -0.0173 -0.0565 -0.0992 1516 THR A CB  
953  O  OG1 . THR A 139 ? 0.8266 0.6424 1.1254 -0.0046 -0.0575 -0.0971 1516 THR A OG1 
954  C  CG2 . THR A 139 ? 0.6358 0.4917 0.8892 -0.0241 -0.0492 -0.0937 1516 THR A CG2 
955  N  N   . VAL A 140 ? 0.4064 0.1925 0.6497 -0.0258 -0.0803 -0.0944 1517 VAL A N   
956  C  CA  . VAL A 140 ? 0.4125 0.1784 0.6662 -0.0244 -0.0862 -0.1008 1517 VAL A CA  
957  C  C   . VAL A 140 ? 0.4733 0.2465 0.7244 -0.0274 -0.0806 -0.1279 1517 VAL A C   
958  O  O   . VAL A 140 ? 0.4720 0.2633 0.6964 -0.0363 -0.0801 -0.1342 1517 VAL A O   
959  C  CB  . VAL A 140 ? 0.4565 0.2136 0.6945 -0.0308 -0.0984 -0.0850 1517 VAL A CB  
960  C  CG1 . VAL A 140 ? 0.4549 0.1918 0.7087 -0.0293 -0.1033 -0.0904 1517 VAL A CG1 
961  C  CG2 . VAL A 140 ? 0.4374 0.1910 0.6742 -0.0290 -0.1031 -0.0608 1517 VAL A CG2 
962  N  N   . LEU A 141 ? 0.4306 0.1894 0.7087 -0.0204 -0.0769 -0.1436 1518 LEU A N   
963  C  CA  . LEU A 141 ? 0.4494 0.2140 0.7301 -0.0223 -0.0706 -0.1731 1518 LEU A CA  
964  C  C   . LEU A 141 ? 0.4927 0.2520 0.7600 -0.0315 -0.0791 -0.1809 1518 LEU A C   
965  O  O   . LEU A 141 ? 0.5042 0.2498 0.7893 -0.0306 -0.0790 -0.1983 1518 LEU A O   
966  C  CB  . LEU A 141 ? 0.4604 0.2113 0.7785 -0.0107 -0.0631 -0.1880 1518 LEU A CB  
967  C  CG  . LEU A 141 ? 0.5179 0.2768 0.8528 -0.0006 -0.0555 -0.1819 1518 LEU A CG  
968  C  CD1 . LEU A 141 ? 0.5437 0.2839 0.9194 0.0124  -0.0515 -0.1921 1518 LEU A CD1 
969  C  CD2 . LEU A 141 ? 0.5282 0.3193 0.8457 -0.0046 -0.0451 -0.1944 1518 LEU A CD2 
970  N  N   . LEU A 142 ? 0.4351 0.2071 0.6716 -0.0405 -0.0865 -0.1687 1519 LEU A N   
971  C  CA  . LEU A 142 ? 0.4405 0.2134 0.6599 -0.0498 -0.0968 -0.1718 1519 LEU A CA  
972  C  C   . LEU A 142 ? 0.5833 0.3829 0.7645 -0.0591 -0.0982 -0.1703 1519 LEU A C   
973  O  O   . LEU A 142 ? 0.5968 0.4055 0.7657 -0.0591 -0.0962 -0.1527 1519 LEU A O   
974  C  CB  . LEU A 142 ? 0.4040 0.1598 0.6292 -0.0491 -0.1076 -0.1475 1519 LEU A CB  
975  C  CG  . LEU A 142 ? 0.4612 0.2015 0.6996 -0.0519 -0.1156 -0.1519 1519 LEU A CG  
976  C  CD1 . LEU A 142 ? 0.4823 0.2056 0.7516 -0.0473 -0.1090 -0.1709 1519 LEU A CD1 
977  C  CD2 . LEU A 142 ? 0.4524 0.1793 0.6978 -0.0498 -0.1226 -0.1271 1519 LEU A CD2 
978  N  N   . PRO A 143 ? 0.5987 0.4120 0.7604 -0.0677 -0.1017 -0.1880 1520 PRO A N   
979  C  CA  . PRO A 143 ? 0.6164 0.4557 0.7390 -0.0770 -0.1034 -0.1838 1520 PRO A CA  
980  C  C   . PRO A 143 ? 0.6407 0.4782 0.7461 -0.0805 -0.1164 -0.1534 1520 PRO A C   
981  O  O   . PRO A 143 ? 0.6185 0.4383 0.7383 -0.0782 -0.1264 -0.1432 1520 PRO A O   
982  C  CB  . PRO A 143 ? 0.6737 0.5257 0.7822 -0.0849 -0.1065 -0.2101 1520 PRO A CB  
983  C  CG  . PRO A 143 ? 0.7365 0.5694 0.8795 -0.0793 -0.1032 -0.2315 1520 PRO A CG  
984  C  CD  . PRO A 143 ? 0.6499 0.4560 0.8232 -0.0702 -0.1048 -0.2117 1520 PRO A CD  
985  N  N   . PRO A 144 ? 0.6002 0.4552 0.6767 -0.0862 -0.1158 -0.1389 1521 PRO A N   
986  C  CA  . PRO A 144 ? 0.5897 0.4399 0.6536 -0.0885 -0.1281 -0.1095 1521 PRO A CA  
987  C  C   . PRO A 144 ? 0.6406 0.4841 0.7016 -0.0911 -0.1451 -0.1044 1521 PRO A C   
988  O  O   . PRO A 144 ? 0.5993 0.4278 0.6722 -0.0873 -0.1533 -0.0856 1521 PRO A O   
989  C  CB  . PRO A 144 ? 0.6370 0.5099 0.6667 -0.0970 -0.1246 -0.1010 1521 PRO A CB  
990  C  CG  . PRO A 144 ? 0.6947 0.5801 0.7297 -0.0955 -0.1065 -0.1193 1521 PRO A CG  
991  C  CD  . PRO A 144 ? 0.6382 0.5171 0.6950 -0.0907 -0.1028 -0.1478 1521 PRO A CD  
992  N  N   . GLU A 145 ? 0.6637 0.5195 0.7112 -0.0973 -0.1501 -0.1228 1522 GLU A N   
993  C  CA  . GLU A 145 ? 0.6979 0.5526 0.7433 -0.1007 -0.1667 -0.1225 1522 GLU A CA  
994  C  C   . GLU A 145 ? 0.7446 0.5760 0.8270 -0.0940 -0.1697 -0.1233 1522 GLU A C   
995  O  O   . GLU A 145 ? 0.7304 0.5542 0.8189 -0.0930 -0.1819 -0.1072 1522 GLU A O   
996  C  CB  . GLU A 145 ? 0.7558 0.6301 0.7827 -0.1086 -0.1679 -0.1488 1522 GLU A CB  
997  C  CG  . GLU A 145 ? 0.9737 0.8548 0.9926 -0.1141 -0.1862 -0.1506 1522 GLU A CG  
998  C  CD  . GLU A 145 ? 1.3500 1.2563 1.3409 -0.1234 -0.1873 -0.1739 1522 GLU A CD  
999  O  OE1 . GLU A 145 ? 1.1870 1.1135 1.1406 -0.1300 -0.1913 -0.1635 1522 GLU A OE1 
1000 O  OE2 . GLU A 145 ? 1.3425 1.2483 1.3483 -0.1245 -0.1834 -0.2029 1522 GLU A OE2 
1001 N  N   . GLU A 146 ? 0.6918 0.5121 0.7992 -0.0895 -0.1581 -0.1420 1523 GLU A N   
1002 C  CA  . GLU A 146 ? 0.6642 0.4618 0.8069 -0.0840 -0.1580 -0.1437 1523 GLU A CA  
1003 C  C   . GLU A 146 ? 0.6508 0.4334 0.8056 -0.0771 -0.1580 -0.1174 1523 GLU A C   
1004 O  O   . GLU A 146 ? 0.6289 0.4009 0.7975 -0.0760 -0.1661 -0.1069 1523 GLU A O   
1005 C  CB  . GLU A 146 ? 0.6918 0.4808 0.8564 -0.0804 -0.1450 -0.1677 1523 GLU A CB  
1006 C  CG  . GLU A 146 ? 0.8567 0.6221 1.0563 -0.0770 -0.1455 -0.1709 1523 GLU A CG  
1007 C  CD  . GLU A 146 ? 1.1543 0.9079 1.3789 -0.0743 -0.1355 -0.1953 1523 GLU A CD  
1008 O  OE1 . GLU A 146 ? 0.9735 0.7079 1.2252 -0.0738 -0.1371 -0.1979 1523 GLU A OE1 
1009 O  OE2 . GLU A 146 ? 1.1749 0.9383 1.3931 -0.0731 -0.1258 -0.2122 1523 GLU A OE2 
1010 N  N   . LEU A 147 ? 0.5850 0.3694 0.7343 -0.0732 -0.1491 -0.1080 1524 LEU A N   
1011 C  CA  . LEU A 147 ? 0.5517 0.3249 0.7099 -0.0673 -0.1484 -0.0850 1524 LEU A CA  
1012 C  C   . LEU A 147 ? 0.6037 0.3778 0.7506 -0.0699 -0.1614 -0.0651 1524 LEU A C   
1013 O  O   . LEU A 147 ? 0.5607 0.3213 0.7241 -0.0656 -0.1647 -0.0526 1524 LEU A O   
1014 C  CB  . LEU A 147 ? 0.5453 0.3269 0.6951 -0.0652 -0.1376 -0.0807 1524 LEU A CB  
1015 C  CG  . LEU A 147 ? 0.5669 0.3367 0.7337 -0.0576 -0.1328 -0.0650 1524 LEU A CG  
1016 C  CD1 . LEU A 147 ? 0.5511 0.3199 0.7073 -0.0591 -0.1408 -0.0415 1524 LEU A CD1 
1017 C  CD2 . LEU A 147 ? 0.5779 0.3278 0.7751 -0.0504 -0.1307 -0.0682 1524 LEU A CD2 
1018 N  N   . LEU A 148 ? 0.6108 0.4012 0.7300 -0.0766 -0.1689 -0.0620 1525 LEU A N   
1019 C  CA  . LEU A 148 ? 0.6130 0.4036 0.7231 -0.0781 -0.1824 -0.0421 1525 LEU A CA  
1020 C  C   . LEU A 148 ? 0.6514 0.4395 0.7732 -0.0789 -0.1947 -0.0460 1525 LEU A C   
1021 O  O   . LEU A 148 ? 0.6287 0.4129 0.7542 -0.0772 -0.2050 -0.0304 1525 LEU A O   
1022 C  CB  . LEU A 148 ? 0.6402 0.4463 0.7179 -0.0844 -0.1873 -0.0310 1525 LEU A CB  
1023 C  CG  . LEU A 148 ? 0.7466 0.5724 0.7984 -0.0915 -0.1821 -0.0443 1525 LEU A CG  
1024 C  CD1 . LEU A 148 ? 0.7796 0.6193 0.8139 -0.0980 -0.1956 -0.0524 1525 LEU A CD1 
1025 C  CD2 . LEU A 148 ? 0.7700 0.6043 0.7995 -0.0953 -0.1774 -0.0283 1525 LEU A CD2 
1026 N  N   . ARG A 149 ? 0.6166 0.4062 0.7479 -0.0812 -0.1932 -0.0676 1526 ARG A N   
1027 C  CA  . ARG A 149 ? 0.6159 0.4043 0.7627 -0.0830 -0.2034 -0.0740 1526 ARG A CA  
1028 C  C   . ARG A 149 ? 0.6420 0.4121 0.8188 -0.0772 -0.2011 -0.0654 1526 ARG A C   
1029 O  O   . ARG A 149 ? 0.6610 0.4308 0.8518 -0.0779 -0.2100 -0.0636 1526 ARG A O   
1030 C  CB  . ARG A 149 ? 0.6629 0.4570 0.8132 -0.0881 -0.2010 -0.1009 1526 ARG A CB  
1031 C  CG  . ARG A 149 ? 0.9189 0.7208 1.0759 -0.0931 -0.2152 -0.1084 1526 ARG A CG  
1032 C  CD  . ARG A 149 ? 1.1173 0.9065 1.3066 -0.0938 -0.2110 -0.1238 1526 ARG A CD  
1033 N  NE  . ARG A 149 ? 1.2799 1.0749 1.4665 -0.0992 -0.2067 -0.1511 1526 ARG A NE  
1034 C  CZ  . ARG A 149 ? 1.3784 1.1622 1.5744 -0.0967 -0.1923 -0.1640 1526 ARG A CZ  
1035 N  NH1 . ARG A 149 ? 1.0437 0.8105 1.2525 -0.0890 -0.1818 -0.1510 1526 ARG A NH1 
1036 N  NH2 . ARG A 149 ? 1.2590 1.0492 1.4529 -0.1016 -0.1889 -0.1909 1526 ARG A NH2 
1037 N  N   . SER A 150 ? 0.5594 0.3166 0.7459 -0.0716 -0.1893 -0.0597 1527 SER A N   
1038 C  CA  . SER A 150 ? 0.5291 0.2706 0.7389 -0.0663 -0.1863 -0.0493 1527 SER A CA  
1039 C  C   . SER A 150 ? 0.5897 0.3268 0.7931 -0.0610 -0.1821 -0.0310 1527 SER A C   
1040 O  O   . SER A 150 ? 0.5776 0.3026 0.7956 -0.0561 -0.1744 -0.0259 1527 SER A O   
1041 C  CB  . SER A 150 ? 0.5416 0.2700 0.7743 -0.0651 -0.1767 -0.0618 1527 SER A CB  
1042 O  OG  . SER A 150 ? 0.6208 0.3428 0.8538 -0.0604 -0.1653 -0.0625 1527 SER A OG  
1043 N  N   . SER A 151 ? 0.5509 0.2978 0.7324 -0.0627 -0.1878 -0.0209 1528 SER A N   
1044 C  CA  . SER A 151 ? 0.5432 0.2870 0.7181 -0.0595 -0.1845 -0.0050 1528 SER A CA  
1045 C  C   . SER A 151 ? 0.5583 0.2914 0.7486 -0.0547 -0.1870 0.0083  1528 SER A C   
1046 O  O   . SER A 151 ? 0.5482 0.2746 0.7431 -0.0509 -0.1800 0.0153  1528 SER A O   
1047 C  CB  . SER A 151 ? 0.6382 0.3938 0.7869 -0.0640 -0.1903 0.0034  1528 SER A CB  
1048 O  OG  . SER A 151 ? 0.8708 0.6305 1.0146 -0.0660 -0.2046 0.0100  1528 SER A OG  
1049 N  N   . ALA A 152 ? 0.4742 0.2073 0.6735 -0.0548 -0.1966 0.0107  1529 ALA A N   
1050 C  CA  . ALA A 152 ? 0.4343 0.1594 0.6492 -0.0504 -0.1979 0.0207  1529 ALA A CA  
1051 C  C   . ALA A 152 ? 0.4469 0.1618 0.6792 -0.0475 -0.1871 0.0170  1529 ALA A C   
1052 O  O   . ALA A 152 ? 0.3846 0.0933 0.6207 -0.0436 -0.1826 0.0257  1529 ALA A O   
1053 C  CB  . ALA A 152 ? 0.4471 0.1770 0.6715 -0.0510 -0.2090 0.0205  1529 ALA A CB  
1054 N  N   . ASP A 153 ? 0.4457 0.1589 0.6877 -0.0497 -0.1833 0.0041  1530 ASP A N   
1055 C  CA  . ASP A 153 ? 0.4328 0.1347 0.6914 -0.0477 -0.1735 0.0012  1530 ASP A CA  
1056 C  C   . ASP A 153 ? 0.4677 0.1650 0.7209 -0.0435 -0.1652 0.0052  1530 ASP A C   
1057 O  O   . ASP A 153 ? 0.4721 0.1618 0.7337 -0.0395 -0.1603 0.0132  1530 ASP A O   
1058 C  CB  . ASP A 153 ? 0.4643 0.1643 0.7336 -0.0519 -0.1718 -0.0144 1530 ASP A CB  
1059 C  CG  . ASP A 153 ? 0.6523 0.3381 0.9401 -0.0503 -0.1625 -0.0158 1530 ASP A CG  
1060 O  OD1 . ASP A 153 ? 0.6822 0.3618 0.9691 -0.0467 -0.1554 -0.0173 1530 ASP A OD1 
1061 O  OD2 . ASP A 153 ? 0.7119 0.3932 1.0163 -0.0531 -0.1623 -0.0158 1530 ASP A OD2 
1062 N  N   . PHE A 154 ? 0.3954 0.0997 0.6342 -0.0446 -0.1639 -0.0003 1531 PHE A N   
1063 C  CA  . PHE A 154 ? 0.3815 0.0857 0.6164 -0.0410 -0.1562 0.0014  1531 PHE A CA  
1064 C  C   . PHE A 154 ? 0.4210 0.1248 0.6522 -0.0380 -0.1570 0.0171  1531 PHE A C   
1065 O  O   . PHE A 154 ? 0.3900 0.0888 0.6292 -0.0334 -0.1514 0.0219  1531 PHE A O   
1066 C  CB  . PHE A 154 ? 0.4178 0.1345 0.6356 -0.0447 -0.1553 -0.0078 1531 PHE A CB  
1067 C  CG  . PHE A 154 ? 0.4378 0.1587 0.6527 -0.0418 -0.1465 -0.0086 1531 PHE A CG  
1068 C  CD1 . PHE A 154 ? 0.4851 0.2031 0.7122 -0.0384 -0.1380 -0.0214 1531 PHE A CD1 
1069 C  CD2 . PHE A 154 ? 0.4555 0.1840 0.6575 -0.0427 -0.1467 0.0027  1531 PHE A CD2 
1070 C  CE1 . PHE A 154 ? 0.4985 0.2230 0.7265 -0.0349 -0.1299 -0.0230 1531 PHE A CE1 
1071 C  CE2 . PHE A 154 ? 0.4895 0.2247 0.6916 -0.0406 -0.1382 0.0014  1531 PHE A CE2 
1072 C  CZ  . PHE A 154 ? 0.4701 0.2043 0.6857 -0.0363 -0.1299 -0.0116 1531 PHE A CZ  
1073 N  N   . LEU A 155 ? 0.3836 0.0926 0.6033 -0.0406 -0.1647 0.0250  1532 LEU A N   
1074 C  CA  . LEU A 155 ? 0.3743 0.0823 0.5910 -0.0388 -0.1662 0.0380  1532 LEU A CA  
1075 C  C   . LEU A 155 ? 0.3945 0.0946 0.6254 -0.0351 -0.1662 0.0432  1532 LEU A C   
1076 O  O   . LEU A 155 ? 0.3856 0.0835 0.6188 -0.0322 -0.1634 0.0500  1532 LEU A O   
1077 C  CB  . LEU A 155 ? 0.3813 0.0945 0.5841 -0.0425 -0.1751 0.0452  1532 LEU A CB  
1078 C  CG  . LEU A 155 ? 0.4491 0.1719 0.6333 -0.0474 -0.1749 0.0443  1532 LEU A CG  
1079 C  CD1 . LEU A 155 ? 0.4552 0.1808 0.6269 -0.0511 -0.1857 0.0536  1532 LEU A CD1 
1080 C  CD2 . LEU A 155 ? 0.5033 0.2289 0.6846 -0.0471 -0.1670 0.0477  1532 LEU A CD2 
1081 N  N   . GLN A 156 ? 0.3251 0.0466 0.5650 -0.0338 -0.1696 0.0386  1533 GLN A N   
1082 C  CA  . GLN A 156 ? 0.3104 0.0481 0.5631 -0.0301 -0.1685 0.0413  1533 GLN A CA  
1083 C  C   . GLN A 156 ? 0.3740 0.0602 0.6345 -0.0308 -0.1597 0.0449  1533 GLN A C   
1084 O  O   . GLN A 156 ? 0.3529 0.0540 0.6153 -0.0272 -0.1578 0.0510  1533 GLN A O   
1085 C  CB  . GLN A 156 ? 0.3189 0.0473 0.5819 -0.0329 -0.1726 0.0371  1533 GLN A CB  
1086 C  CG  . GLN A 156 ? 0.3058 0.0488 0.5818 -0.0305 -0.1708 0.0399  1533 GLN A CG  
1087 C  CD  . GLN A 156 ? 0.4298 0.1163 0.7172 -0.0357 -0.1624 0.0406  1533 GLN A CD  
1088 O  OE1 . GLN A 156 ? 0.3734 0.0563 0.6650 -0.0381 -0.1602 0.0337  1533 GLN A OE1 
1089 N  NE2 . GLN A 156 ? 0.3047 0.0459 0.5971 -0.0297 -0.1581 0.0437  1533 GLN A NE2 
1090 N  N   . ARG A 157 ? 0.3594 0.0643 0.6239 -0.0294 -0.1554 0.0366  1534 ARG A N   
1091 C  CA  . ARG A 157 ? 0.3524 0.0653 0.6261 -0.0252 -0.1485 0.0375  1534 ARG A CA  
1092 C  C   . ARG A 157 ? 0.4334 0.1115 0.7013 -0.0231 -0.1462 0.0454  1534 ARG A C   
1093 O  O   . ARG A 157 ? 0.4483 0.1231 0.7209 -0.0196 -0.1440 0.0532  1534 ARG A O   
1094 C  CB  . ARG A 157 ? 0.2972 0.0521 0.5794 -0.0223 -0.1450 0.0259  1534 ARG A CB  
1095 C  CG  . ARG A 157 ? 0.3104 0.0455 0.6026 -0.0270 -0.1464 0.0223  1534 ARG A CG  
1096 C  CD  . ARG A 157 ? 0.5186 0.1784 0.8207 -0.0360 -0.1439 0.0097  1534 ARG A CD  
1097 N  NE  . ARG A 157 ? 0.6040 0.2574 0.9217 -0.0413 -0.1436 0.0050  1534 ARG A NE  
1098 C  CZ  . ARG A 157 ? 0.7336 0.3901 1.0567 -0.0451 -0.1461 0.0094  1534 ARG A CZ  
1099 N  NH1 . ARG A 157 ? 0.5062 0.1575 0.8459 -0.0508 -0.1446 0.0041  1534 ARG A NH1 
1100 N  NH2 . ARG A 157 ? 0.6676 0.3331 0.9817 -0.0436 -0.1501 0.0178  1534 ARG A NH2 
1101 N  N   . LEU A 158 ? 0.3934 0.0813 0.6508 -0.0240 -0.1473 0.0424  1535 LEU A N   
1102 C  CA  . LEU A 158 ? 0.4021 0.0937 0.6561 -0.0211 -0.1452 0.0477  1535 LEU A CA  
1103 C  C   . LEU A 158 ? 0.4596 0.1527 0.7097 -0.0211 -0.1491 0.0578  1535 LEU A C   
1104 O  O   . LEU A 158 ? 0.4374 0.1324 0.6900 -0.0179 -0.1477 0.0633  1535 LEU A O   
1105 C  CB  . LEU A 158 ? 0.4139 0.1154 0.6571 -0.0241 -0.1444 0.0422  1535 LEU A CB  
1106 C  CG  . LEU A 158 ? 0.4730 0.1812 0.7201 -0.0212 -0.1375 0.0365  1535 LEU A CG  
1107 C  CD1 . LEU A 158 ? 0.4673 0.1675 0.7317 -0.0145 -0.1332 0.0340  1535 LEU A CD1 
1108 C  CD2 . LEU A 158 ? 0.5318 0.2479 0.7695 -0.0255 -0.1352 0.0253  1535 LEU A CD2 
1109 N  N   . SER A 159 ? 0.4407 0.1336 0.6861 -0.0244 -0.1545 0.0593  1536 SER A N   
1110 C  CA  . SER A 159 ? 0.4377 0.1310 0.6817 -0.0243 -0.1582 0.0661  1536 SER A CA  
1111 C  C   . SER A 159 ? 0.4569 0.1467 0.7085 -0.0213 -0.1554 0.0694  1536 SER A C   
1112 O  O   . SER A 159 ? 0.4590 0.1513 0.7093 -0.0196 -0.1555 0.0743  1536 SER A O   
1113 C  CB  . SER A 159 ? 0.4883 0.1813 0.7300 -0.0271 -0.1648 0.0658  1536 SER A CB  
1114 O  OG  . SER A 159 ? 0.6196 0.3161 0.8512 -0.0304 -0.1684 0.0660  1536 SER A OG  
1115 N  N   . ALA A 160 ? 0.3635 0.0961 0.6232 -0.0207 -0.1528 0.0615  1537 ALA A N   
1116 C  CA  . ALA A 160 ? 0.3487 0.0950 0.6147 -0.0196 -0.1493 0.0636  1537 ALA A CA  
1117 C  C   . ALA A 160 ? 0.4394 0.1199 0.7052 -0.0159 -0.1463 0.0770  1537 ALA A C   
1118 O  O   . ALA A 160 ? 0.4574 0.1400 0.7213 -0.0146 -0.1458 0.0835  1537 ALA A O   
1119 C  CB  . ALA A 160 ? 0.3590 0.0924 0.6339 -0.0213 -0.1469 0.0614  1537 ALA A CB  
1120 N  N   . ILE A 161 ? 0.4069 0.0954 0.6756 -0.0138 -0.1446 0.0727  1538 ILE A N   
1121 C  CA  . ILE A 161 ? 0.3911 0.0888 0.6647 -0.0089 -0.1425 0.0758  1538 ILE A CA  
1122 C  C   . ILE A 161 ? 0.4275 0.1171 0.6947 -0.0068 -0.1454 0.0826  1538 ILE A C   
1123 O  O   . ILE A 161 ? 0.4094 0.1013 0.6780 -0.0033 -0.1462 0.0899  1538 ILE A O   
1124 C  CB  . ILE A 161 ? 0.4244 0.1007 0.7056 -0.0060 -0.1394 0.0705  1538 ILE A CB  
1125 C  CG1 . ILE A 161 ? 0.4227 0.0864 0.7143 -0.0068 -0.1365 0.0671  1538 ILE A CG1 
1126 C  CG2 . ILE A 161 ? 0.4444 0.1252 0.7325 0.0006  -0.1384 0.0736  1538 ILE A CG2 
1127 C  CD1 . ILE A 161 ? 0.5102 0.1715 0.8069 -0.0076 -0.1341 0.0542  1538 ILE A CD1 
1128 N  N   . LEU A 162 ? 0.4123 0.1084 0.6730 -0.0100 -0.1474 0.0784  1539 LEU A N   
1129 C  CA  . LEU A 162 ? 0.4207 0.1262 0.6775 -0.0104 -0.1499 0.0813  1539 LEU A CA  
1130 C  C   . LEU A 162 ? 0.4960 0.2026 0.7475 -0.0125 -0.1537 0.0847  1539 LEU A C   
1131 O  O   . LEU A 162 ? 0.4842 0.1980 0.7341 -0.0129 -0.1561 0.0867  1539 LEU A O   
1132 C  CB  . LEU A 162 ? 0.4175 0.1292 0.6705 -0.0139 -0.1495 0.0769  1539 LEU A CB  
1133 C  CG  . LEU A 162 ? 0.4880 0.2031 0.7471 -0.0113 -0.1446 0.0715  1539 LEU A CG  
1134 C  CD1 . LEU A 162 ? 0.4915 0.2123 0.7430 -0.0165 -0.1430 0.0664  1539 LEU A CD1 
1135 C  CD2 . LEU A 162 ? 0.5386 0.2617 0.8075 -0.0060 -0.1434 0.0741  1539 LEU A CD2 
1136 N  N   . ARG A 163 ? 0.4771 0.1777 0.7275 -0.0140 -0.1538 0.0840  1540 ARG A N   
1137 C  CA  . ARG A 163 ? 0.4825 0.1843 0.7297 -0.0156 -0.1560 0.0846  1540 ARG A CA  
1138 C  C   . ARG A 163 ? 0.5492 0.2528 0.7936 -0.0187 -0.1604 0.0821  1540 ARG A C   
1139 O  O   . ARG A 163 ? 0.5188 0.2255 0.7618 -0.0194 -0.1628 0.0817  1540 ARG A O   
1140 C  CB  . ARG A 163 ? 0.4828 0.1898 0.7280 -0.0133 -0.1556 0.0895  1540 ARG A CB  
1141 C  CG  . ARG A 163 ? 0.4960 0.1994 0.7439 -0.0107 -0.1520 0.0951  1540 ARG A CG  
1142 C  CD  . ARG A 163 ? 0.6001 0.3098 0.8423 -0.0094 -0.1525 0.1015  1540 ARG A CD  
1143 N  NE  . ARG A 163 ? 0.7901 0.5021 1.0273 -0.0127 -0.1507 0.0994  1540 ARG A NE  
1144 C  CZ  . ARG A 163 ? 1.0566 0.7645 1.2955 -0.0146 -0.1459 0.1011  1540 ARG A CZ  
1145 N  NH1 . ARG A 163 ? 0.9844 0.6979 1.2200 -0.0175 -0.1434 0.0978  1540 ARG A NH1 
1146 N  NH2 . ARG A 163 ? 0.9090 0.6078 1.1548 -0.0140 -0.1429 0.1050  1540 ARG A NH2 
1147 N  N   . THR A 164 ? 0.5594 0.2609 0.8026 -0.0209 -0.1616 0.0804  1541 THR A N   
1148 C  CA  . THR A 164 ? 0.5762 0.2771 0.8163 -0.0245 -0.1661 0.0806  1541 THR A CA  
1149 C  C   . THR A 164 ? 0.6343 0.3318 0.8715 -0.0267 -0.1680 0.0794  1541 THR A C   
1150 O  O   . THR A 164 ? 0.6255 0.3219 0.8640 -0.0255 -0.1655 0.0765  1541 THR A O   
1151 C  CB  . THR A 164 ? 0.6971 0.4040 0.9358 -0.0265 -0.1659 0.0829  1541 THR A CB  
1152 O  OG1 . THR A 164 ? 0.7141 0.4178 0.9508 -0.0310 -0.1703 0.0846  1541 THR A OG1 
1153 C  CG2 . THR A 164 ? 0.6979 0.4101 0.9358 -0.0264 -0.1616 0.0826  1541 THR A CG2 
1154 N  N   . SER A 165 ? 0.5970 0.2924 0.8303 -0.0302 -0.1729 0.0820  1542 SER A N   
1155 C  CA  . SER A 165 ? 0.6040 0.2978 0.8324 -0.0324 -0.1765 0.0822  1542 SER A CA  
1156 C  C   . SER A 165 ? 0.6106 0.3098 0.8293 -0.0362 -0.1738 0.0832  1542 SER A C   
1157 O  O   . SER A 165 ? 0.6003 0.3021 0.8152 -0.0397 -0.1731 0.0876  1542 SER A O   
1158 C  CB  . SER A 165 ? 0.6762 0.3641 0.9062 -0.0334 -0.1846 0.0859  1542 SER A CB  
1159 O  OG  . SER A 165 ? 0.8656 0.5535 1.0912 -0.0347 -0.1894 0.0863  1542 SER A OG  
1160 N  N   . LEU A 166 ? 0.5424 0.2441 0.7577 -0.0361 -0.1718 0.0782  1543 LEU A N   
1161 C  CA  . LEU A 166 ? 0.5263 0.2354 0.7313 -0.0399 -0.1684 0.0764  1543 LEU A CA  
1162 C  C   . LEU A 166 ? 0.5353 0.2454 0.7294 -0.0438 -0.1744 0.0771  1543 LEU A C   
1163 O  O   . LEU A 166 ? 0.5446 0.2510 0.7428 -0.0421 -0.1797 0.0748  1543 LEU A O   
1164 C  CB  . LEU A 166 ? 0.5182 0.2313 0.7284 -0.0367 -0.1602 0.0681  1543 LEU A CB  
1165 C  CG  . LEU A 166 ? 0.5669 0.2845 0.7830 -0.0348 -0.1552 0.0702  1543 LEU A CG  
1166 C  CD1 . LEU A 166 ? 0.5673 0.2797 0.7949 -0.0292 -0.1549 0.0713  1543 LEU A CD1 
1167 C  CD2 . LEU A 166 ? 0.5802 0.3080 0.7950 -0.0355 -0.1480 0.0647  1543 LEU A CD2 
1168 N  N   . ARG A 167 ? 0.4519 0.1683 0.6320 -0.0496 -0.1741 0.0811  1544 ARG A N   
1169 C  CA  . ARG A 167 ? 0.4570 0.1767 0.6221 -0.0545 -0.1804 0.0839  1544 ARG A CA  
1170 C  C   . ARG A 167 ? 0.5366 0.2689 0.6863 -0.0604 -0.1734 0.0816  1544 ARG A C   
1171 O  O   . ARG A 167 ? 0.5352 0.2726 0.6876 -0.0613 -0.1651 0.0813  1544 ARG A O   
1172 C  CB  . ARG A 167 ? 0.4266 0.1388 0.5891 -0.0567 -0.1903 0.0974  1544 ARG A CB  
1173 C  CG  . ARG A 167 ? 0.7044 0.4164 0.8629 -0.0618 -0.1870 0.1069  1544 ARG A CG  
1174 C  CD  . ARG A 167 ? 0.8791 0.5810 1.0361 -0.0647 -0.1968 0.1209  1544 ARG A CD  
1175 N  NE  . ARG A 167 ? 0.9350 0.6389 1.0830 -0.0730 -0.1935 0.1311  1544 ARG A NE  
1176 C  CZ  . ARG A 167 ? 1.2769 0.9696 1.4292 -0.0762 -0.1990 0.1429  1544 ARG A CZ  
1177 N  NH1 . ARG A 167 ? 1.1922 0.8711 1.3584 -0.0705 -0.2079 0.1446  1544 ARG A NH1 
1178 N  NH2 . ARG A 167 ? 1.1869 0.8822 1.3315 -0.0853 -0.1949 0.1523  1544 ARG A NH2 
1179 N  N   . PHE A 168 ? 0.5213 0.2607 0.6549 -0.0647 -0.1769 0.0795  1545 PHE A N   
1180 C  CA  . PHE A 168 ? 0.5355 0.2895 0.6515 -0.0713 -0.1696 0.0765  1545 PHE A CA  
1181 C  C   . PHE A 168 ? 0.6158 0.3711 0.7202 -0.0785 -0.1707 0.0923  1545 PHE A C   
1182 O  O   . PHE A 168 ? 0.6327 0.3791 0.7331 -0.0800 -0.1816 0.1053  1545 PHE A O   
1183 C  CB  . PHE A 168 ? 0.5760 0.3388 0.6749 -0.0750 -0.1742 0.0698  1545 PHE A CB  
1184 C  CG  . PHE A 168 ? 0.5923 0.3557 0.7012 -0.0704 -0.1719 0.0518  1545 PHE A CG  
1185 C  CD1 . PHE A 168 ? 0.6452 0.4138 0.7621 -0.0680 -0.1596 0.0374  1545 PHE A CD1 
1186 C  CD2 . PHE A 168 ? 0.6236 0.3830 0.7357 -0.0687 -0.1822 0.0488  1545 PHE A CD2 
1187 C  CE1 . PHE A 168 ? 0.6648 0.4310 0.7932 -0.0641 -0.1576 0.0211  1545 PHE A CE1 
1188 C  CE2 . PHE A 168 ? 0.6685 0.4277 0.7914 -0.0659 -0.1798 0.0320  1545 PHE A CE2 
1189 C  CZ  . PHE A 168 ? 0.6508 0.4120 0.7817 -0.0638 -0.1675 0.0185  1545 PHE A CZ  
1190 N  N   . ARG A 169 ? 0.5966 0.3630 0.6972 -0.0830 -0.1595 0.0913  1546 ARG A N   
1191 C  CA  . ARG A 169 ? 0.6219 0.3916 0.7103 -0.0923 -0.1590 0.1067  1546 ARG A CA  
1192 C  C   . ARG A 169 ? 0.7115 0.4888 0.7724 -0.0999 -0.1645 0.1126  1546 ARG A C   
1193 O  O   . ARG A 169 ? 0.7312 0.5203 0.7816 -0.0999 -0.1614 0.0993  1546 ARG A O   
1194 C  CB  . ARG A 169 ? 0.6212 0.4057 0.7131 -0.0961 -0.1444 0.1018  1546 ARG A CB  
1195 C  CG  . ARG A 169 ? 0.7798 0.5673 0.8629 -0.1071 -0.1425 0.1182  1546 ARG A CG  
1196 C  CD  . ARG A 169 ? 0.8800 0.6870 0.9676 -0.1114 -0.1272 0.1114  1546 ARG A CD  
1197 N  NE  . ARG A 169 ? 0.9542 0.7685 1.0291 -0.1247 -0.1233 0.1263  1546 ARG A NE  
1198 C  CZ  . ARG A 169 ? 1.1232 0.9600 1.1921 -0.1326 -0.1094 0.1223  1546 ARG A CZ  
1199 N  NH1 . ARG A 169 ? 0.9559 0.8097 1.0320 -0.1271 -0.0984 0.1025  1546 ARG A NH1 
1200 N  NH2 . ARG A 169 ? 0.9135 0.7561 0.9709 -0.1462 -0.1058 0.1379  1546 ARG A NH2 
1201 N  N   . LEU A 170 ? 0.6684 0.4378 0.7186 -0.1057 -0.1740 0.1319  1547 LEU A N   
1202 C  CA  . LEU A 170 ? 0.7052 0.4820 0.7277 -0.1128 -0.1812 0.1404  1547 LEU A CA  
1203 C  C   . LEU A 170 ? 0.8196 0.6093 0.8213 -0.1257 -0.1726 0.1514  1547 LEU A C   
1204 O  O   . LEU A 170 ? 0.8097 0.5951 0.8219 -0.1292 -0.1667 0.1595  1547 LEU A O   
1205 C  CB  . LEU A 170 ? 0.7144 0.4740 0.7382 -0.1101 -0.1993 0.1562  1547 LEU A CB  
1206 C  CG  . LEU A 170 ? 0.7666 0.5173 0.8081 -0.0989 -0.2091 0.1462  1547 LEU A CG  
1207 C  CD1 . LEU A 170 ? 0.7576 0.4921 0.8287 -0.0906 -0.2087 0.1441  1547 LEU A CD1 
1208 C  CD2 . LEU A 170 ? 0.8070 0.5516 0.8404 -0.0987 -0.2267 0.1598  1547 LEU A CD2 
1209 N  N   . ASP A 171 ? 0.8357 0.6431 0.8080 -0.1334 -0.1712 0.1508  1548 ASP A N   
1210 C  CA  . ASP A 171 ? 0.8775 0.7002 0.8261 -0.1474 -0.1621 0.1620  1548 ASP A CA  
1211 C  C   . ASP A 171 ? 1.0130 0.8252 0.9431 -0.1550 -0.1760 0.1901  1548 ASP A C   
1212 O  O   . ASP A 171 ? 1.0146 0.8082 0.9536 -0.1477 -0.1925 0.1978  1548 ASP A O   
1213 C  CB  . ASP A 171 ? 0.9144 0.7649 0.8404 -0.1525 -0.1505 0.1446  1548 ASP A CB  
1214 C  CG  . ASP A 171 ? 1.0842 0.9417 0.9876 -0.1521 -0.1615 0.1393  1548 ASP A CG  
1215 O  OD1 . ASP A 171 ? 1.0830 0.9264 0.9822 -0.1502 -0.1794 0.1546  1548 ASP A OD1 
1216 O  OD2 . ASP A 171 ? 1.2173 1.0955 1.1080 -0.1538 -0.1525 0.1189  1548 ASP A OD2 
1217 N  N   . ALA A 172 ? 1.0273 0.8512 0.9328 -0.1695 -0.1695 0.2057  1549 ALA A N   
1218 C  CA  . ALA A 172 ? 1.0733 0.8871 0.9593 -0.1786 -0.1817 0.2358  1549 ALA A CA  
1219 C  C   . ALA A 172 ? 1.1719 0.9816 1.0407 -0.1746 -0.2016 0.2430  1549 ALA A C   
1220 O  O   . ALA A 172 ? 1.1792 0.9698 1.0481 -0.1745 -0.2176 0.2662  1549 ALA A O   
1221 C  CB  . ALA A 172 ? 1.1179 0.9516 0.9754 -0.1959 -0.1687 0.2475  1549 ALA A CB  
1222 N  N   . HIS A 173 ? 1.1577 0.9851 1.0150 -0.1707 -0.2010 0.2221  1550 HIS A N   
1223 C  CA  . HIS A 173 ? 1.1880 1.0172 1.0297 -0.1671 -0.2192 0.2240  1550 HIS A CA  
1224 C  C   . HIS A 173 ? 1.1919 1.0047 1.0658 -0.1513 -0.2307 0.2115  1550 HIS A C   
1225 O  O   . HIS A 173 ? 1.2040 1.0215 1.0712 -0.1470 -0.2445 0.2068  1550 HIS A O   
1226 C  CB  . HIS A 173 ? 1.2339 1.0939 1.0433 -0.1739 -0.2122 0.2073  1550 HIS A CB  
1227 C  CG  . HIS A 173 ? 1.3211 1.2011 1.1012 -0.1895 -0.1965 0.2151  1550 HIS A CG  
1228 N  ND1 . HIS A 173 ? 1.3378 1.2344 1.1241 -0.1923 -0.1737 0.1946  1550 HIS A ND1 
1229 C  CD2 . HIS A 173 ? 1.3927 1.2778 1.1406 -0.2030 -0.2006 0.2425  1550 HIS A CD2 
1230 C  CE1 . HIS A 173 ? 1.3666 1.2801 1.1241 -0.2076 -0.1636 0.2082  1550 HIS A CE1 
1231 N  NE2 . HIS A 173 ? 1.4051 1.3120 1.1373 -0.2152 -0.1789 0.2379  1550 HIS A NE2 
1232 N  N   . GLY A 174 ? 1.0882 0.8840 0.9963 -0.1435 -0.2250 0.2062  1551 GLY A N   
1233 C  CA  . GLY A 174 ? 1.0423 0.8227 0.9826 -0.1295 -0.2328 0.1951  1551 GLY A CA  
1234 C  C   . GLY A 174 ? 1.0596 0.8522 1.0063 -0.1233 -0.2277 0.1672  1551 GLY A C   
1235 O  O   . GLY A 174 ? 1.0339 0.8186 0.9993 -0.1139 -0.2373 0.1593  1551 GLY A O   
1236 N  N   . GLN A 175 ? 1.0197 0.8314 0.9527 -0.1288 -0.2122 0.1517  1552 GLN A N   
1237 C  CA  . GLN A 175 ? 1.0008 0.8227 0.9411 -0.1236 -0.2061 0.1241  1552 GLN A CA  
1238 C  C   . GLN A 175 ? 0.9736 0.7894 0.9422 -0.1170 -0.1914 0.1097  1552 GLN A C   
1239 O  O   . GLN A 175 ? 0.9517 0.7678 0.9236 -0.1205 -0.1804 0.1157  1552 GLN A O   
1240 C  CB  . GLN A 175 ? 1.0502 0.8981 0.9586 -0.1329 -0.1989 0.1129  1552 GLN A CB  
1241 C  CG  . GLN A 175 ? 1.1957 1.0538 1.1007 -0.1300 -0.2046 0.0914  1552 GLN A CG  
1242 C  CD  . GLN A 175 ? 1.3996 1.2766 1.2984 -0.1327 -0.1876 0.0648  1552 GLN A CD  
1243 O  OE1 . GLN A 175 ? 1.2706 1.1448 1.1903 -0.1257 -0.1838 0.0424  1552 GLN A OE1 
1244 N  NE2 . GLN A 175 ? 1.3393 1.2363 1.2101 -0.1432 -0.1769 0.0662  1552 GLN A NE2 
1245 N  N   . ALA A 176 ? 0.8957 0.7073 0.8847 -0.1082 -0.1913 0.0911  1553 ALA A N   
1246 C  CA  . ALA A 176 ? 0.8678 0.6736 0.8832 -0.1011 -0.1791 0.0773  1553 ALA A CA  
1247 C  C   . ALA A 176 ? 0.9384 0.7616 0.9458 -0.1056 -0.1619 0.0647  1553 ALA A C   
1248 O  O   . ALA A 176 ? 0.9761 0.8165 0.9632 -0.1110 -0.1588 0.0534  1553 ALA A O   
1249 C  CB  . ALA A 176 ? 0.8613 0.6614 0.8949 -0.0931 -0.1828 0.0604  1553 ALA A CB  
1250 N  N   . MET A 177 ? 0.8518 0.6726 0.8755 -0.1035 -0.1510 0.0658  1554 MET A N   
1251 C  CA  . MET A 177 ? 0.8386 0.6775 0.8598 -0.1069 -0.1343 0.0541  1554 MET A CA  
1252 C  C   . MET A 177 ? 0.8557 0.6967 0.8959 -0.0984 -0.1260 0.0293  1554 MET A C   
1253 O  O   . MET A 177 ? 0.8331 0.6701 0.8975 -0.0916 -0.1183 0.0239  1554 MET A O   
1254 C  CB  . MET A 177 ? 0.8571 0.6959 0.8871 -0.1098 -0.1271 0.0670  1554 MET A CB  
1255 C  CG  . MET A 177 ? 0.9315 0.7734 0.9377 -0.1215 -0.1312 0.0886  1554 MET A CG  
1256 S  SD  . MET A 177 ? 0.9911 0.8317 1.0092 -0.1272 -0.1239 0.1045  1554 MET A SD  
1257 C  CE  . MET A 177 ? 0.9632 0.8347 0.9753 -0.1337 -0.1027 0.0895  1554 MET A CE  
1258 N  N   . VAL A 178 ? 0.8072 0.6542 0.8363 -0.0992 -0.1290 0.0145  1555 VAL A N   
1259 C  CA  . VAL A 178 ? 0.7974 0.6462 0.8413 -0.0930 -0.1224 -0.0106 1555 VAL A CA  
1260 C  C   . VAL A 178 ? 0.8474 0.7208 0.8687 -0.1005 -0.1126 -0.0269 1555 VAL A C   
1261 O  O   . VAL A 178 ? 0.8667 0.7506 0.8598 -0.1086 -0.1193 -0.0257 1555 VAL A O   
1262 C  CB  . VAL A 178 ? 0.8424 0.6758 0.8975 -0.0877 -0.1341 -0.0167 1555 VAL A CB  
1263 C  CG1 . VAL A 178 ? 0.8677 0.7083 0.8972 -0.0949 -0.1466 -0.0143 1555 VAL A CG1 
1264 C  CG2 . VAL A 178 ? 0.8358 0.6668 0.9115 -0.0813 -0.1261 -0.0412 1555 VAL A CG2 
1265 N  N   . PHE A 179 ? 0.7796 0.6638 0.8135 -0.0978 -0.0968 -0.0419 1556 PHE A N   
1266 C  CA  . PHE A 179 ? 0.7994 0.7095 0.8152 -0.1044 -0.0844 -0.0596 1556 PHE A CA  
1267 C  C   . PHE A 179 ? 0.8588 0.7707 0.8939 -0.0971 -0.0760 -0.0904 1556 PHE A C   
1268 O  O   . PHE A 179 ? 0.8497 0.7451 0.9180 -0.0861 -0.0745 -0.0951 1556 PHE A O   
1269 C  CB  . PHE A 179 ? 0.8235 0.7500 0.8385 -0.1087 -0.0707 -0.0523 1556 PHE A CB  
1270 C  CG  . PHE A 179 ? 0.8381 0.7583 0.8426 -0.1150 -0.0778 -0.0219 1556 PHE A CG  
1271 C  CD1 . PHE A 179 ? 0.8929 0.8211 0.8621 -0.1270 -0.0844 -0.0060 1556 PHE A CD1 
1272 C  CD2 . PHE A 179 ? 0.8339 0.7399 0.8640 -0.1090 -0.0784 -0.0091 1556 PHE A CD2 
1273 C  CE1 . PHE A 179 ? 0.8920 0.8114 0.8544 -0.1326 -0.0912 0.0222  1556 PHE A CE1 
1274 C  CE2 . PHE A 179 ? 0.8602 0.7590 0.8827 -0.1151 -0.0850 0.0169  1556 PHE A CE2 
1275 C  CZ  . PHE A 179 ? 0.8544 0.7587 0.8444 -0.1267 -0.0912 0.0324  1556 PHE A CZ  
1276 N  N   . PRO A 180 ? 0.8134 0.7453 0.8290 -0.1031 -0.0700 -0.1122 1557 PRO A N   
1277 C  CA  . PRO A 180 ? 0.8009 0.7334 0.8384 -0.0959 -0.0611 -0.1438 1557 PRO A CA  
1278 C  C   . PRO A 180 ? 0.8176 0.7564 0.8827 -0.0882 -0.0446 -0.1533 1557 PRO A C   
1279 O  O   . PRO A 180 ? 0.8084 0.7657 0.8644 -0.0930 -0.0350 -0.1451 1557 PRO A O   
1280 C  CB  . PRO A 180 ? 0.8618 0.8188 0.8671 -0.1060 -0.0578 -0.1635 1557 PRO A CB  
1281 C  CG  . PRO A 180 ? 0.9376 0.9135 0.9060 -0.1182 -0.0582 -0.1424 1557 PRO A CG  
1282 C  CD  . PRO A 180 ? 0.8578 0.8127 0.8308 -0.1167 -0.0712 -0.1092 1557 PRO A CD  
1283 N  N   . TYR A 181 ? 0.7706 0.6932 0.8713 -0.0762 -0.0423 -0.1686 1558 TYR A N   
1284 C  CA  . TYR A 181 ? 0.7676 0.6937 0.9009 -0.0661 -0.0288 -0.1790 1558 TYR A CA  
1285 C  C   . TYR A 181 ? 0.8394 0.7792 0.9816 -0.0635 -0.0160 -0.2152 1558 TYR A C   
1286 O  O   . TYR A 181 ? 0.8289 0.7576 0.9743 -0.0624 -0.0207 -0.2329 1558 TYR A O   
1287 C  CB  . TYR A 181 ? 0.7603 0.6573 0.9284 -0.0538 -0.0362 -0.1667 1558 TYR A CB  
1288 C  CG  . TYR A 181 ? 0.7812 0.6780 0.9871 -0.0411 -0.0256 -0.1775 1558 TYR A CG  
1289 C  CD1 . TYR A 181 ? 0.7961 0.7082 1.0105 -0.0396 -0.0180 -0.1675 1558 TYR A CD1 
1290 C  CD2 . TYR A 181 ? 0.8047 0.6847 1.0410 -0.0305 -0.0246 -0.1962 1558 TYR A CD2 
1291 C  CE1 . TYR A 181 ? 0.8132 0.7267 1.0650 -0.0269 -0.0099 -0.1767 1558 TYR A CE1 
1292 C  CE2 . TYR A 181 ? 0.8208 0.6998 1.0943 -0.0176 -0.0163 -0.2049 1558 TYR A CE2 
1293 C  CZ  . TYR A 181 ? 0.9042 0.8008 1.1855 -0.0153 -0.0095 -0.1949 1558 TYR A CZ  
1294 O  OH  . TYR A 181 ? 0.8924 0.7893 1.2126 -0.0017 -0.0030 -0.2026 1558 TYR A OH  
1295 N  N   . HIS A 182 ? 0.8184 0.7841 0.9646 -0.0634 0.0005  -0.2268 1559 HIS A N   
1296 C  CA  . HIS A 182 ? 1.3777 1.3629 1.5320 -0.0614 0.0158  -0.2625 1559 HIS A CA  
1297 C  C   . HIS A 182 ? 1.5481 1.5267 1.7516 -0.0451 0.0251  -0.2766 1559 HIS A C   
1298 O  O   . HIS A 182 ? 0.9860 0.9523 1.2137 -0.0367 0.0269  -0.3012 1559 HIS A O   
1299 C  CB  . HIS A 182 ? 1.4127 1.4368 1.5341 -0.0742 0.0293  -0.2668 1559 HIS A CB  
1300 C  CG  . HIS A 182 ? 1.4662 1.4976 1.5387 -0.0901 0.0195  -0.2478 1559 HIS A CG  
1301 N  ND1 . HIS A 182 ? 1.5076 1.5365 1.5554 -0.0964 0.0104  -0.2591 1559 HIS A ND1 
1302 C  CD2 . HIS A 182 ? 1.4842 1.5247 1.5308 -0.1004 0.0169  -0.2185 1559 HIS A CD2 
1303 C  CE1 . HIS A 182 ? 1.5085 1.5456 1.5162 -0.1093 0.0019  -0.2354 1559 HIS A CE1 
1304 N  NE2 . HIS A 182 ? 1.4996 1.5424 1.5053 -0.1122 0.0056  -0.2102 1559 HIS A NE2 
1305 N  N   . ILE A 201 ? 0.9538 0.8432 1.1112 -0.0644 -0.0415 -0.2819 1578 ILE A N   
1306 C  CA  . ILE A 201 ? 0.9434 0.8125 1.1437 -0.0502 -0.0359 -0.2798 1578 ILE A CA  
1307 C  C   . ILE A 201 ? 0.9539 0.7998 1.1631 -0.0464 -0.0479 -0.2453 1578 ILE A C   
1308 O  O   . ILE A 201 ? 0.9538 0.7723 1.1902 -0.0399 -0.0538 -0.2430 1578 ILE A O   
1309 C  CB  . ILE A 201 ? 0.9974 0.8880 1.2076 -0.0446 -0.0184 -0.2903 1578 ILE A CB  
1310 C  CG1 . ILE A 201 ? 1.0462 0.9480 1.2686 -0.0425 -0.0058 -0.3313 1578 ILE A CG1 
1311 C  CG2 . ILE A 201 ? 0.9666 0.8434 1.2112 -0.0315 -0.0160 -0.2724 1578 ILE A CG2 
1312 C  CD1 . ILE A 201 ? 1.1802 1.1171 1.3968 -0.0429 0.0129  -0.3480 1578 ILE A CD1 
1313 N  N   . GLY A 202 ? 0.8501 0.7071 1.0354 -0.0516 -0.0513 -0.2196 1579 GLY A N   
1314 C  CA  . GLY A 202 ? 0.7872 0.6260 0.9772 -0.0490 -0.0620 -0.1886 1579 GLY A CA  
1315 C  C   . GLY A 202 ? 0.7704 0.6217 0.9279 -0.0580 -0.0681 -0.1646 1579 GLY A C   
1316 O  O   . GLY A 202 ? 0.7742 0.6440 0.8999 -0.0683 -0.0695 -0.1684 1579 GLY A O   
1317 N  N   . SER A 203 ? 0.6848 0.5253 0.8507 -0.0541 -0.0725 -0.1395 1580 SER A N   
1318 C  CA  . SER A 203 ? 0.6672 0.5140 0.8092 -0.0612 -0.0789 -0.1144 1580 SER A CA  
1319 C  C   . SER A 203 ? 0.6646 0.5123 0.8191 -0.0568 -0.0742 -0.0982 1580 SER A C   
1320 O  O   . SER A 203 ? 0.6204 0.4562 0.8041 -0.0467 -0.0717 -0.0987 1580 SER A O   
1321 C  CB  . SER A 203 ? 0.7094 0.5378 0.8475 -0.0625 -0.0946 -0.0984 1580 SER A CB  
1322 O  OG  . SER A 203 ? 0.8628 0.6951 0.9838 -0.0692 -0.1017 -0.1093 1580 SER A OG  
1323 N  N   . VAL A 204 ? 0.6378 0.4992 0.7703 -0.0649 -0.0739 -0.0827 1581 VAL A N   
1324 C  CA  . VAL A 204 ? 0.6239 0.4869 0.7653 -0.0635 -0.0715 -0.0650 1581 VAL A CA  
1325 C  C   . VAL A 204 ? 0.6410 0.4910 0.7670 -0.0686 -0.0856 -0.0409 1581 VAL A C   
1326 O  O   . VAL A 204 ? 0.6232 0.4813 0.7211 -0.0785 -0.0899 -0.0331 1581 VAL A O   
1327 C  CB  . VAL A 204 ? 0.6864 0.5767 0.8195 -0.0696 -0.0577 -0.0683 1581 VAL A CB  
1328 C  CG1 . VAL A 204 ? 0.6666 0.5576 0.8176 -0.0667 -0.0554 -0.0535 1581 VAL A CG1 
1329 C  CG2 . VAL A 204 ? 0.6964 0.6021 0.8407 -0.0655 -0.0439 -0.0965 1581 VAL A CG2 
1330 N  N   . VAL A 205 ? 0.5918 0.4210 0.7368 -0.0612 -0.0935 -0.0309 1582 VAL A N   
1331 C  CA  . VAL A 205 ? 0.6014 0.4162 0.7391 -0.0634 -0.1067 -0.0117 1582 VAL A CA  
1332 C  C   . VAL A 205 ? 0.6595 0.4732 0.8024 -0.0639 -0.1069 0.0059  1582 VAL A C   
1333 O  O   . VAL A 205 ? 0.6562 0.4684 0.8210 -0.0570 -0.1020 0.0047  1582 VAL A O   
1334 C  CB  . VAL A 205 ? 0.6474 0.4416 0.8018 -0.0561 -0.1145 -0.0141 1582 VAL A CB  
1335 C  CG1 . VAL A 205 ? 0.6379 0.4194 0.7871 -0.0577 -0.1273 0.0038  1582 VAL A CG1 
1336 C  CG2 . VAL A 205 ? 0.6554 0.4502 0.8078 -0.0565 -0.1144 -0.0333 1582 VAL A CG2 
1337 N  N   . MET A 206 ? 0.5970 0.4110 0.7211 -0.0721 -0.1134 0.0224  1583 MET A N   
1338 C  CA  . MET A 206 ? 0.5804 0.3927 0.7090 -0.0744 -0.1141 0.0385  1583 MET A CA  
1339 C  C   . MET A 206 ? 0.5952 0.3876 0.7278 -0.0719 -0.1271 0.0518  1583 MET A C   
1340 O  O   . MET A 206 ? 0.6121 0.3988 0.7303 -0.0755 -0.1363 0.0582  1583 MET A O   
1341 C  CB  . MET A 206 ? 0.6351 0.4632 0.7429 -0.0863 -0.1095 0.0469  1583 MET A CB  
1342 C  CG  . MET A 206 ? 0.7058 0.5567 0.8105 -0.0889 -0.0949 0.0318  1583 MET A CG  
1343 S  SD  . MET A 206 ? 0.8050 0.6771 0.8900 -0.1036 -0.0860 0.0429  1583 MET A SD  
1344 C  CE  . MET A 206 ? 0.7763 0.6751 0.8704 -0.1015 -0.0674 0.0186  1583 MET A CE  
1345 N  N   . LEU A 207 ? 0.5079 0.2910 0.6608 -0.0652 -0.1280 0.0548  1584 LEU A N   
1346 C  CA  . LEU A 207 ? 0.4819 0.2480 0.6410 -0.0620 -0.1385 0.0643  1584 LEU A CA  
1347 C  C   . LEU A 207 ? 0.4958 0.2583 0.6611 -0.0642 -0.1406 0.0766  1584 LEU A C   
1348 O  O   . LEU A 207 ? 0.4623 0.2338 0.6370 -0.0642 -0.1338 0.0756  1584 LEU A O   
1349 C  CB  . LEU A 207 ? 0.4686 0.2248 0.6452 -0.0524 -0.1393 0.0564  1584 LEU A CB  
1350 C  CG  . LEU A 207 ? 0.5547 0.3091 0.7308 -0.0499 -0.1390 0.0439  1584 LEU A CG  
1351 C  CD1 . LEU A 207 ? 0.5614 0.3041 0.7566 -0.0415 -0.1393 0.0397  1584 LEU A CD1 
1352 C  CD2 . LEU A 207 ? 0.5708 0.3220 0.7326 -0.0543 -0.1479 0.0468  1584 LEU A CD2 
1353 N  N   . GLU A 208 ? 0.4347 0.1841 0.5978 -0.0651 -0.1506 0.0867  1585 GLU A N   
1354 C  CA  . GLU A 208 ? 0.4237 0.1667 0.5953 -0.0664 -0.1538 0.0958  1585 GLU A CA  
1355 C  C   . GLU A 208 ? 0.4304 0.1621 0.6164 -0.0580 -0.1585 0.0932  1585 GLU A C   
1356 O  O   . GLU A 208 ? 0.3985 0.1243 0.5851 -0.0535 -0.1619 0.0888  1585 GLU A O   
1357 C  CB  . GLU A 208 ? 0.4613 0.1976 0.6214 -0.0741 -0.1610 0.1092  1585 GLU A CB  
1358 C  CG  . GLU A 208 ? 0.6767 0.4257 0.8219 -0.0842 -0.1549 0.1146  1585 GLU A CG  
1359 C  CD  . GLU A 208 ? 1.2467 0.9880 1.3784 -0.0924 -0.1626 0.1305  1585 GLU A CD  
1360 O  OE1 . GLU A 208 ? 1.4281 1.1588 1.5544 -0.0898 -0.1730 0.1347  1585 GLU A OE1 
1361 O  OE2 . GLU A 208 ? 1.2517 0.9980 1.3793 -0.1017 -0.1583 0.1394  1585 GLU A OE2 
1362 N  N   . ILE A 209 ? 0.3987 0.1293 0.5963 -0.0568 -0.1582 0.0952  1586 ILE A N   
1363 C  CA  . ILE A 209 ? 0.3901 0.1126 0.5991 -0.0502 -0.1618 0.0932  1586 ILE A CA  
1364 C  C   . ILE A 209 ? 0.4731 0.1852 0.6840 -0.0531 -0.1693 0.1000  1586 ILE A C   
1365 O  O   . ILE A 209 ? 0.5052 0.2189 0.7189 -0.0582 -0.1692 0.1042  1586 ILE A O   
1366 C  CB  . ILE A 209 ? 0.4225 0.1536 0.6427 -0.0464 -0.1567 0.0892  1586 ILE A CB  
1367 C  CG1 . ILE A 209 ? 0.4359 0.1739 0.6586 -0.0415 -0.1502 0.0820  1586 ILE A CG1 
1368 C  CG2 . ILE A 209 ? 0.4219 0.1471 0.6506 -0.0416 -0.1607 0.0890  1586 ILE A CG2 
1369 C  CD1 . ILE A 209 ? 0.6236 0.3752 0.8575 -0.0394 -0.1445 0.0795  1586 ILE A CD1 
1370 N  N   . ASP A 210 ? 0.4282 0.1301 0.6402 -0.0499 -0.1756 0.1000  1587 ASP A N   
1371 C  CA  . ASP A 210 ? 0.4488 0.1400 0.6662 -0.0508 -0.1827 0.1042  1587 ASP A CA  
1372 C  C   . ASP A 210 ? 0.5129 0.2023 0.7413 -0.0451 -0.1827 0.0977  1587 ASP A C   
1373 O  O   . ASP A 210 ? 0.4997 0.1879 0.7309 -0.0397 -0.1828 0.0930  1587 ASP A O   
1374 C  CB  . ASP A 210 ? 0.5008 0.1835 0.7141 -0.0505 -0.1905 0.1085  1587 ASP A CB  
1375 C  CG  . ASP A 210 ? 0.6573 0.3273 0.8779 -0.0517 -0.1987 0.1145  1587 ASP A CG  
1376 O  OD1 . ASP A 210 ? 0.6444 0.3110 0.8750 -0.0515 -0.1981 0.1117  1587 ASP A OD1 
1377 O  OD2 . ASP A 210 ? 0.7197 0.3831 0.9369 -0.0524 -0.2063 0.1214  1587 ASP A OD2 
1378 N  N   . ASN A 211 ? 0.5063 0.1969 0.7406 -0.0471 -0.1823 0.0972  1588 ASN A N   
1379 C  CA  . ASN A 211 ? 0.5064 0.1979 0.7485 -0.0431 -0.1824 0.0907  1588 ASN A CA  
1380 C  C   . ASN A 211 ? 0.6133 0.2938 0.8631 -0.0426 -0.1885 0.0884  1588 ASN A C   
1381 O  O   . ASN A 211 ? 0.6256 0.3077 0.8814 -0.0416 -0.1887 0.0822  1588 ASN A O   
1382 C  CB  . ASN A 211 ? 0.4256 0.1272 0.6706 -0.0458 -0.1795 0.0896  1588 ASN A CB  
1383 C  CG  . ASN A 211 ? 0.5451 0.2587 0.7878 -0.0433 -0.1737 0.0893  1588 ASN A CG  
1384 O  OD1 . ASN A 211 ? 0.4512 0.1652 0.6917 -0.0380 -0.1713 0.0876  1588 ASN A OD1 
1385 N  ND2 . ASN A 211 ? 0.5406 0.2643 0.7863 -0.0469 -0.1713 0.0904  1588 ASN A ND2 
1386 N  N   . ARG A 212 ? 0.5757 0.2461 0.8262 -0.0426 -0.1937 0.0926  1589 ARG A N   
1387 C  CA  . ARG A 212 ? 0.5746 0.2338 0.8364 -0.0407 -0.2000 0.0898  1589 ARG A CA  
1388 C  C   . ARG A 212 ? 0.6011 0.2636 0.8704 -0.0341 -0.1982 0.0789  1589 ARG A C   
1389 O  O   . ARG A 212 ? 0.6225 0.2794 0.9026 -0.0326 -0.2010 0.0724  1589 ARG A O   
1390 C  CB  . ARG A 212 ? 0.5551 0.2037 0.8177 -0.0407 -0.2074 0.0978  1589 ARG A CB  
1391 C  CG  . ARG A 212 ? 0.4784 0.1309 0.7390 -0.0356 -0.2083 0.0965  1589 ARG A CG  
1392 C  CD  . ARG A 212 ? 0.4534 0.0966 0.7169 -0.0348 -0.2179 0.1040  1589 ARG A CD  
1393 N  NE  . ARG A 212 ? 0.4849 0.1281 0.7333 -0.0411 -0.2198 0.1159  1589 ARG A NE  
1394 C  CZ  . ARG A 212 ? 0.6145 0.2537 0.8586 -0.0413 -0.2283 0.1246  1589 ARG A CZ  
1395 N  NH1 . ARG A 212 ? 0.4316 0.0661 0.6887 -0.0347 -0.2364 0.1229  1589 ARG A NH1 
1396 N  NH2 . ARG A 212 ? 0.3921 0.0691 0.6207 -0.0483 -0.2286 0.1272  1589 ARG A NH2 
1397 N  N   . LEU A 213 ? 0.5003 0.1720 0.7645 -0.0308 -0.1930 0.0763  1590 LEU A N   
1398 C  CA  . LEU A 213 ? 0.4757 0.1525 0.7450 -0.0262 -0.1898 0.0676  1590 LEU A CA  
1399 C  C   . LEU A 213 ? 0.5335 0.2208 0.7962 -0.0265 -0.1838 0.0651  1590 LEU A C   
1400 O  O   . LEU A 213 ? 0.5146 0.2077 0.7788 -0.0241 -0.1808 0.0582  1590 LEU A O   
1401 C  CB  . LEU A 213 ? 0.4624 0.1409 0.7336 -0.0228 -0.1890 0.0673  1590 LEU A CB  
1402 C  CG  . LEU A 213 ? 0.4867 0.1576 0.7665 -0.0210 -0.1963 0.0689  1590 LEU A CG  
1403 C  CD1 . LEU A 213 ? 0.4497 0.1261 0.7333 -0.0181 -0.1950 0.0665  1590 LEU A CD1 
1404 C  CD2 . LEU A 213 ? 0.5017 0.1667 0.7954 -0.0183 -0.2003 0.0628  1590 LEU A CD2 
1405 N  N   . CYS A 214 ? 0.5097 0.2010 0.7651 -0.0292 -0.1822 0.0708  1591 CYS A N   
1406 C  CA  . CYS A 214 ? 0.5100 0.2116 0.7607 -0.0287 -0.1784 0.0701  1591 CYS A CA  
1407 C  C   . CYS A 214 ? 0.5869 0.2915 0.8406 -0.0305 -0.1808 0.0638  1591 CYS A C   
1408 O  O   . CYS A 214 ? 0.6143 0.3270 0.8650 -0.0287 -0.1788 0.0592  1591 CYS A O   
1409 C  CB  . CYS A 214 ? 0.5098 0.2159 0.7568 -0.0305 -0.1768 0.0762  1591 CYS A CB  
1410 S  SG  . CYS A 214 ? 0.5556 0.2744 0.7995 -0.0274 -0.1733 0.0775  1591 CYS A SG  
1411 N  N   . LEU A 215 ? 0.5195 0.2167 0.7791 -0.0346 -0.1852 0.0634  1592 LEU A N   
1412 C  CA  . LEU A 215 ? 0.5188 0.2161 0.7842 -0.0380 -0.1884 0.0563  1592 LEU A CA  
1413 C  C   . LEU A 215 ? 0.6293 0.3200 0.9025 -0.0355 -0.1901 0.0465  1592 LEU A C   
1414 O  O   . LEU A 215 ? 0.6403 0.3301 0.9200 -0.0378 -0.1926 0.0374  1592 LEU A O   
1415 C  CB  . LEU A 215 ? 0.5105 0.2020 0.7802 -0.0447 -0.1915 0.0619  1592 LEU A CB  
1416 C  CG  . LEU A 215 ? 0.5413 0.2430 0.8051 -0.0467 -0.1883 0.0694  1592 LEU A CG  
1417 C  CD1 . LEU A 215 ? 0.5523 0.2483 0.8176 -0.0532 -0.1891 0.0773  1592 LEU A CD1 
1418 C  CD2 . LEU A 215 ? 0.5258 0.2424 0.7891 -0.0470 -0.1877 0.0652  1592 LEU A CD2 
1419 N  N   . GLN A 216 ? 0.6146 0.3031 0.8886 -0.0305 -0.1882 0.0465  1593 GLN A N   
1420 C  CA  . GLN A 216 ? 0.6408 0.3266 0.9243 -0.0268 -0.1883 0.0361  1593 GLN A CA  
1421 C  C   . GLN A 216 ? 0.7684 0.4692 1.0445 -0.0248 -0.1821 0.0286  1593 GLN A C   
1422 O  O   . GLN A 216 ? 0.7836 0.4883 1.0630 -0.0212 -0.1782 0.0232  1593 GLN A O   
1423 C  CB  . GLN A 216 ? 0.6525 0.3303 0.9431 -0.0230 -0.1902 0.0401  1593 GLN A CB  
1424 C  CG  . GLN A 216 ? 0.7076 0.3756 1.0156 -0.0199 -0.1949 0.0321  1593 GLN A CG  
1425 C  CD  . GLN A 216 ? 0.8632 0.5158 1.1781 -0.0205 -0.2029 0.0421  1593 GLN A CD  
1426 O  OE1 . GLN A 216 ? 0.7940 0.4420 1.1188 -0.0158 -0.2068 0.0432  1593 GLN A OE1 
1427 N  NE2 . GLN A 216 ? 0.6558 0.3014 0.9659 -0.0267 -0.2060 0.0501  1593 GLN A NE2 
1428 N  N   . SER A 217 ? 0.7584 0.4691 1.0244 -0.0278 -0.1813 0.0292  1594 SER A N   
1429 C  CA  . SER A 217 ? 0.7680 0.4942 1.0229 -0.0274 -0.1771 0.0250  1594 SER A CA  
1430 C  C   . SER A 217 ? 0.8213 0.5527 1.0690 -0.0244 -0.1708 0.0318  1594 SER A C   
1431 O  O   . SER A 217 ? 0.8010 0.5243 1.0525 -0.0230 -0.1706 0.0394  1594 SER A O   
1432 C  CB  . SER A 217 ? 0.8338 0.5646 1.0928 -0.0278 -0.1768 0.0085  1594 SER A CB  
1433 O  OG  . SER A 217 ? 0.9433 0.6754 1.2037 -0.0322 -0.1819 0.0026  1594 SER A OG  
1434 N  N   . PRO A 218 ? 0.8072 0.5518 1.0442 -0.0242 -0.1659 0.0302  1595 PRO A N   
1435 C  CA  . PRO A 218 ? 0.8205 0.5786 1.0482 -0.0262 -0.1659 0.0216  1595 PRO A CA  
1436 C  C   . PRO A 218 ? 0.8847 0.6483 1.1051 -0.0282 -0.1714 0.0280  1595 PRO A C   
1437 O  O   . PRO A 218 ? 0.8852 0.6500 1.1097 -0.0311 -0.1766 0.0202  1595 PRO A O   
1438 C  CB  . PRO A 218 ? 0.8538 0.6231 1.0715 -0.0256 -0.1580 0.0224  1595 PRO A CB  
1439 C  CG  . PRO A 218 ? 0.9093 0.6717 1.1268 -0.0239 -0.1555 0.0374  1595 PRO A CG  
1440 C  CD  . PRO A 218 ? 0.8415 0.5886 1.0733 -0.0226 -0.1598 0.0385  1595 PRO A CD  
1441 N  N   . GLU A 219 ? 0.8392 0.6055 1.0523 -0.0266 -0.1706 0.0420  1596 GLU A N   
1442 C  CA  . GLU A 219 ? 0.8332 0.6054 1.0438 -0.0270 -0.1760 0.0490  1596 GLU A CA  
1443 C  C   . GLU A 219 ? 0.8144 0.5736 1.0369 -0.0268 -0.1773 0.0539  1596 GLU A C   
1444 O  O   . GLU A 219 ? 0.7992 0.5518 1.0230 -0.0242 -0.1744 0.0627  1596 GLU A O   
1445 C  CB  . GLU A 219 ? 0.8654 0.6463 1.0645 -0.0242 -0.1748 0.0615  1596 GLU A CB  
1446 C  CG  . GLU A 219 ? 1.0690 0.8663 1.2523 -0.0255 -0.1750 0.0593  1596 GLU A CG  
1447 C  CD  . GLU A 219 ? 1.4661 1.2680 1.6375 -0.0230 -0.1724 0.0742  1596 GLU A CD  
1448 O  OE1 . GLU A 219 ? 1.2337 1.0285 1.4106 -0.0194 -0.1732 0.0866  1596 GLU A OE1 
1449 O  OE2 . GLU A 219 ? 1.5534 1.3661 1.7100 -0.0250 -0.1692 0.0732  1596 GLU A OE2 
1450 N  N   . ASN A 220 ? 0.7238 0.4789 0.9548 -0.0305 -0.1814 0.0471  1597 ASN A N   
1451 C  CA  . ASN A 220 ? 0.6993 0.4437 0.9399 -0.0324 -0.1829 0.0511  1597 ASN A CA  
1452 C  C   . ASN A 220 ? 0.7432 0.4956 0.9861 -0.0342 -0.1855 0.0571  1597 ASN A C   
1453 O  O   . ASN A 220 ? 0.7551 0.5015 1.0054 -0.0376 -0.1863 0.0595  1597 ASN A O   
1454 C  CB  . ASN A 220 ? 0.6678 0.4018 0.9180 -0.0359 -0.1857 0.0423  1597 ASN A CB  
1455 C  CG  . ASN A 220 ? 0.8769 0.6172 1.1297 -0.0399 -0.1897 0.0306  1597 ASN A CG  
1456 O  OD1 . ASN A 220 ? 0.7578 0.4912 1.0207 -0.0449 -0.1934 0.0272  1597 ASN A OD1 
1457 N  ND2 . ASN A 220 ? 0.8058 0.5589 1.0496 -0.0386 -0.1888 0.0236  1597 ASN A ND2 
1458 N  N   . ASP A 221 ? 0.6571 0.4241 0.8945 -0.0319 -0.1869 0.0602  1598 ASP A N   
1459 C  CA  . ASP A 221 ? 0.6231 0.4012 0.8660 -0.0324 -0.1898 0.0648  1598 ASP A CA  
1460 C  C   . ASP A 221 ? 0.6627 0.4409 0.9066 -0.0267 -0.1865 0.0751  1598 ASP A C   
1461 O  O   . ASP A 221 ? 0.6400 0.4267 0.8920 -0.0262 -0.1875 0.0784  1598 ASP A O   
1462 C  CB  . ASP A 221 ? 0.6307 0.4265 0.8705 -0.0334 -0.1958 0.0608  1598 ASP A CB  
1463 C  CG  . ASP A 221 ? 0.5560 0.3571 0.7819 -0.0317 -0.1962 0.0571  1598 ASP A CG  
1464 O  OD1 . ASP A 221 ? 0.5018 0.2986 0.7196 -0.0272 -0.1918 0.0638  1598 ASP A OD1 
1465 O  OD2 . ASP A 221 ? 0.6108 0.4224 0.8338 -0.0355 -0.2009 0.0476  1598 ASP A OD2 
1466 N  N   . HIS A 222 ? 0.6374 0.4065 0.8751 -0.0227 -0.1821 0.0789  1599 HIS A N   
1467 C  CA  . HIS A 222 ? 0.6452 0.4098 0.8840 -0.0174 -0.1781 0.0870  1599 HIS A CA  
1468 C  C   . HIS A 222 ? 0.6340 0.3865 0.8775 -0.0189 -0.1740 0.0862  1599 HIS A C   
1469 O  O   . HIS A 222 ? 0.6259 0.3694 0.8684 -0.0164 -0.1700 0.0886  1599 HIS A O   
1470 C  CB  . HIS A 222 ? 0.6825 0.4445 0.9120 -0.0144 -0.1759 0.0906  1599 HIS A CB  
1471 C  CG  . HIS A 222 ? 0.7537 0.5292 0.9764 -0.0125 -0.1802 0.0946  1599 HIS A CG  
1472 N  ND1 . HIS A 222 ? 0.7944 0.5736 1.0186 -0.0068 -0.1815 0.1052  1599 HIS A ND1 
1473 C  CD2 . HIS A 222 ? 0.7967 0.5830 1.0112 -0.0155 -0.1840 0.0893  1599 HIS A CD2 
1474 C  CE1 . HIS A 222 ? 0.8050 0.5976 1.0204 -0.0065 -0.1869 0.1078  1599 HIS A CE1 
1475 N  NE2 . HIS A 222 ? 0.8106 0.6089 1.0189 -0.0120 -0.1883 0.0976  1599 HIS A NE2 
1476 N  N   . CYS A 223 ? 0.5342 0.2880 0.7828 -0.0240 -0.1755 0.0830  1600 CYS A N   
1477 C  CA  . CYS A 223 ? 0.5036 0.2491 0.7542 -0.0274 -0.1731 0.0830  1600 CYS A CA  
1478 C  C   . CYS A 223 ? 0.4985 0.2530 0.7556 -0.0286 -0.1711 0.0848  1600 CYS A C   
1479 O  O   . CYS A 223 ? 0.5074 0.2737 0.7705 -0.0307 -0.1736 0.0839  1600 CYS A O   
1480 C  CB  . CYS A 223 ? 0.5104 0.2486 0.7611 -0.0334 -0.1763 0.0792  1600 CYS A CB  
1481 S  SG  . CYS A 223 ? 0.5609 0.2902 0.8077 -0.0314 -0.1776 0.0740  1600 CYS A SG  
1482 N  N   . PHE A 224 ? 0.4199 0.1709 0.6767 -0.0277 -0.1665 0.0861  1601 PHE A N   
1483 C  CA  . PHE A 224 ? 0.4103 0.1718 0.6736 -0.0290 -0.1628 0.0862  1601 PHE A CA  
1484 C  C   . PHE A 224 ? 0.4198 0.1837 0.6836 -0.0383 -0.1630 0.0864  1601 PHE A C   
1485 O  O   . PHE A 224 ? 0.3858 0.1389 0.6424 -0.0429 -0.1632 0.0880  1601 PHE A O   
1486 C  CB  . PHE A 224 ? 0.4393 0.1977 0.7017 -0.0253 -0.1571 0.0852  1601 PHE A CB  
1487 C  CG  . PHE A 224 ? 0.4694 0.2250 0.7352 -0.0167 -0.1566 0.0858  1601 PHE A CG  
1488 C  CD1 . PHE A 224 ? 0.4920 0.2583 0.7688 -0.0106 -0.1568 0.0870  1601 PHE A CD1 
1489 C  CD2 . PHE A 224 ? 0.5055 0.2480 0.7654 -0.0148 -0.1565 0.0862  1601 PHE A CD2 
1490 C  CE1 . PHE A 224 ? 0.4941 0.2553 0.7746 -0.0028 -0.1571 0.0900  1601 PHE A CE1 
1491 C  CE2 . PHE A 224 ? 0.5375 0.2758 0.8012 -0.0082 -0.1556 0.0883  1601 PHE A CE2 
1492 C  CZ  . PHE A 224 ? 0.4981 0.2446 0.7715 -0.0022 -0.1560 0.0910  1601 PHE A CZ  
1493 N  N   . PRO A 225 ? 0.3996 0.1775 0.6728 -0.0418 -0.1635 0.0858  1602 PRO A N   
1494 C  CA  . PRO A 225 ? 0.4279 0.2070 0.7029 -0.0523 -0.1631 0.0871  1602 PRO A CA  
1495 C  C   . PRO A 225 ? 0.5141 0.2972 0.7862 -0.0571 -0.1558 0.0894  1602 PRO A C   
1496 O  O   . PRO A 225 ? 0.5044 0.2832 0.7728 -0.0666 -0.1553 0.0935  1602 PRO A O   
1497 C  CB  . PRO A 225 ? 0.4486 0.2436 0.7365 -0.0546 -0.1660 0.0846  1602 PRO A CB  
1498 C  CG  . PRO A 225 ? 0.4818 0.2891 0.7759 -0.0449 -0.1656 0.0832  1602 PRO A CG  
1499 C  CD  . PRO A 225 ? 0.4130 0.2071 0.6973 -0.0367 -0.1650 0.0844  1602 PRO A CD  
1500 N  N   . ASP A 226 ? 0.4933 0.2846 0.7672 -0.0509 -0.1502 0.0867  1603 ASP A N   
1501 C  CA  . ASP A 226 ? 0.5077 0.3065 0.7784 -0.0545 -0.1420 0.0859  1603 ASP A CA  
1502 C  C   . ASP A 226 ? 0.5665 0.3629 0.8341 -0.0461 -0.1382 0.0812  1603 ASP A C   
1503 O  O   . ASP A 226 ? 0.5730 0.3649 0.8456 -0.0369 -0.1410 0.0795  1603 ASP A O   
1504 C  CB  . ASP A 226 ? 0.5485 0.3695 0.8337 -0.0586 -0.1369 0.0839  1603 ASP A CB  
1505 C  CG  . ASP A 226 ? 0.8127 0.6508 1.1078 -0.0528 -0.1286 0.0772  1603 ASP A CG  
1506 O  OD1 . ASP A 226 ? 0.8266 0.6682 1.1135 -0.0563 -0.1208 0.0749  1603 ASP A OD1 
1507 O  OD2 . ASP A 226 ? 0.9636 0.8136 1.2757 -0.0453 -0.1301 0.0738  1603 ASP A OD2 
1508 N  N   . ALA A 227 ? 0.5100 0.3102 0.7695 -0.0498 -0.1314 0.0790  1604 ALA A N   
1509 C  CA  . ALA A 227 ? 0.4900 0.2894 0.7472 -0.0435 -0.1266 0.0718  1604 ALA A CA  
1510 C  C   . ALA A 227 ? 0.5005 0.3111 0.7764 -0.0337 -0.1224 0.0645  1604 ALA A C   
1511 O  O   . ALA A 227 ? 0.4837 0.2859 0.7618 -0.0258 -0.1222 0.0600  1604 ALA A O   
1512 C  CB  . ALA A 227 ? 0.5090 0.3148 0.7528 -0.0513 -0.1199 0.0699  1604 ALA A CB  
1513 N  N   . GLN A 228 ? 0.4312 0.2603 0.7226 -0.0340 -0.1197 0.0635  1605 GLN A N   
1514 C  CA  . GLN A 228 ? 0.4207 0.2608 0.7329 -0.0232 -0.1172 0.0573  1605 GLN A CA  
1515 C  C   . GLN A 228 ? 0.4820 0.3109 0.8005 -0.0137 -0.1260 0.0619  1605 GLN A C   
1516 O  O   . GLN A 228 ? 0.4823 0.3085 0.8119 -0.0035 -0.1253 0.0585  1605 GLN A O   
1517 C  CB  . GLN A 228 ? 0.4324 0.2981 0.7627 -0.0253 -0.1126 0.0544  1605 GLN A CB  
1518 C  CG  . GLN A 228 ? 0.5865 0.4654 0.9413 -0.0129 -0.1091 0.0464  1605 GLN A CG  
1519 C  CD  . GLN A 228 ? 0.8549 0.7306 1.2098 -0.0075 -0.1006 0.0355  1605 GLN A CD  
1520 O  OE1 . GLN A 228 ? 0.7468 0.6291 1.0908 -0.0151 -0.0916 0.0292  1605 GLN A OE1 
1521 N  NE2 . GLN A 228 ? 0.8222 0.6882 1.1895 0.0051  -0.1032 0.0328  1605 GLN A NE2 
1522 N  N   . SER A 229 ? 0.4491 0.2708 0.7603 -0.0174 -0.1341 0.0695  1606 SER A N   
1523 C  CA  . SER A 229 ? 0.4395 0.2522 0.7519 -0.0105 -0.1423 0.0748  1606 SER A CA  
1524 C  C   . SER A 229 ? 0.4175 0.2115 0.7222 -0.0055 -0.1420 0.0749  1606 SER A C   
1525 O  O   . SER A 229 ? 0.3864 0.1760 0.6990 0.0034  -0.1443 0.0771  1606 SER A O   
1526 C  CB  . SER A 229 ? 0.5166 0.3255 0.8197 -0.0175 -0.1492 0.0798  1606 SER A CB  
1527 O  OG  . SER A 229 ? 0.7064 0.5331 1.0208 -0.0210 -0.1513 0.0796  1606 SER A OG  
1528 N  N   . ALA A 230 ? 0.3357 0.1191 0.6259 -0.0117 -0.1395 0.0731  1607 ALA A N   
1529 C  CA  . ALA A 230 ? 0.3107 0.0779 0.5941 -0.0090 -0.1389 0.0716  1607 ALA A CA  
1530 C  C   . ALA A 230 ? 0.3351 0.1037 0.6295 -0.0025 -0.1327 0.0639  1607 ALA A C   
1531 O  O   . ALA A 230 ? 0.2937 0.0633 0.5927 0.0023  -0.1333 0.0623  1607 ALA A O   
1532 C  CB  . ALA A 230 ? 0.3132 0.0731 0.5806 -0.0172 -0.1389 0.0710  1607 ALA A CB  
1533 N  N   . ALA A 231 ? 0.3062 0.0896 0.6063 -0.0039 -0.1260 0.0567  1608 ALA A N   
1534 C  CA  . ALA A 231 ? 0.3093 0.0964 0.6221 0.0024  -0.1191 0.0463  1608 ALA A CA  
1535 C  C   . ALA A 231 ? 0.4015 0.1889 0.7358 0.0140  -0.1216 0.0485  1608 ALA A C   
1536 O  O   . ALA A 231 ? 0.4255 0.2017 0.7689 0.0210  -0.1201 0.0444  1608 ALA A O   
1537 C  CB  . ALA A 231 ? 0.3210 0.1280 0.6351 -0.0025 -0.1107 0.0382  1608 ALA A CB  
1538 N  N   . ASP A 232 ? 0.3615 0.1606 0.7042 0.0159  -0.1265 0.0557  1609 ASP A N   
1539 C  CA  . ASP A 232 ? 0.3648 0.1656 0.7266 0.0272  -0.1315 0.0607  1609 ASP A CA  
1540 C  C   . ASP A 232 ? 0.4037 0.1836 0.7595 0.0310  -0.1375 0.0698  1609 ASP A C   
1541 O  O   . ASP A 232 ? 0.3876 0.1596 0.7578 0.0405  -0.1384 0.0714  1609 ASP A O   
1542 C  CB  . ASP A 232 ? 0.3988 0.2176 0.7665 0.0262  -0.1376 0.0670  1609 ASP A CB  
1543 C  CG  . ASP A 232 ? 0.5947 0.4375 0.9735 0.0224  -0.1318 0.0596  1609 ASP A CG  
1544 O  OD1 . ASP A 232 ? 0.6502 0.4984 1.0347 0.0226  -0.1223 0.0489  1609 ASP A OD1 
1545 O  OD2 . ASP A 232 ? 0.5732 0.4307 0.9551 0.0185  -0.1365 0.0636  1609 ASP A OD2 
1546 N  N   . TYR A 233 ? 0.3839 0.1548 0.7197 0.0234  -0.1412 0.0758  1610 TYR A N   
1547 C  CA  . TYR A 233 ? 0.3920 0.1454 0.7205 0.0251  -0.1452 0.0838  1610 TYR A CA  
1548 C  C   . TYR A 233 ? 0.4780 0.2148 0.8105 0.0274  -0.1401 0.0783  1610 TYR A C   
1549 O  O   . TYR A 233 ? 0.5013 0.2261 0.8418 0.0336  -0.1419 0.0844  1610 TYR A O   
1550 C  CB  . TYR A 233 ? 0.3946 0.1442 0.7034 0.0164  -0.1485 0.0878  1610 TYR A CB  
1551 C  CG  . TYR A 233 ? 0.4410 0.1751 0.7425 0.0169  -0.1505 0.0945  1610 TYR A CG  
1552 C  CD1 . TYR A 233 ? 0.4826 0.2157 0.7863 0.0221  -0.1553 0.1050  1610 TYR A CD1 
1553 C  CD2 . TYR A 233 ? 0.4667 0.1884 0.7596 0.0119  -0.1475 0.0908  1610 TYR A CD2 
1554 C  CE1 . TYR A 233 ? 0.5335 0.2533 0.8303 0.0214  -0.1556 0.1121  1610 TYR A CE1 
1555 C  CE2 . TYR A 233 ? 0.4991 0.2084 0.7877 0.0115  -0.1481 0.0964  1610 TYR A CE2 
1556 C  CZ  . TYR A 233 ? 0.6244 0.3327 0.9147 0.0159  -0.1514 0.1072  1610 TYR A CZ  
1557 O  OH  . TYR A 233 ? 0.6230 0.3204 0.9079 0.0138  -0.1506 0.1132  1610 TYR A OH  
1558 N  N   . LEU A 234 ? 0.4239 0.1605 0.7513 0.0223  -0.1341 0.0671  1611 LEU A N   
1559 C  CA  . LEU A 234 ? 0.4267 0.1499 0.7583 0.0234  -0.1295 0.0587  1611 LEU A CA  
1560 C  C   . LEU A 234 ? 0.5197 0.2422 0.8745 0.0335  -0.1264 0.0535  1611 LEU A C   
1561 O  O   . LEU A 234 ? 0.5569 0.2628 0.9209 0.0372  -0.1253 0.0517  1611 LEU A O   
1562 C  CB  . LEU A 234 ? 0.4286 0.1562 0.7479 0.0154  -0.1247 0.0472  1611 LEU A CB  
1563 C  CG  . LEU A 234 ? 0.4979 0.2216 0.7968 0.0062  -0.1282 0.0511  1611 LEU A CG  
1564 C  CD1 . LEU A 234 ? 0.4966 0.2286 0.7831 -0.0012 -0.1248 0.0423  1611 LEU A CD1 
1565 C  CD2 . LEU A 234 ? 0.5513 0.2577 0.8488 0.0056  -0.1304 0.0532  1611 LEU A CD2 
1566 N  N   . GLY A 235 ? 0.4630 0.2033 0.8298 0.0380  -0.1250 0.0507  1612 GLY A N   
1567 C  CA  . GLY A 235 ? 0.4724 0.2150 0.8655 0.0493  -0.1224 0.0449  1612 GLY A CA  
1568 C  C   . GLY A 235 ? 0.5431 0.2736 0.9489 0.0584  -0.1298 0.0590  1612 GLY A C   
1569 O  O   . GLY A 235 ? 0.5440 0.2616 0.9691 0.0669  -0.1287 0.0566  1612 GLY A O   
1570 N  N   . ALA A 236 ? 0.5167 0.2508 0.9110 0.0562  -0.1376 0.0738  1613 ALA A N   
1571 C  CA  . ALA A 236 ? 0.5279 0.2534 0.9272 0.0629  -0.1458 0.0903  1613 ALA A CA  
1572 C  C   . ALA A 236 ? 0.6111 0.3110 1.0057 0.0613  -0.1451 0.0958  1613 ALA A C   
1573 O  O   . ALA A 236 ? 0.6582 0.3458 1.0657 0.0691  -0.1490 0.1065  1613 ALA A O   
1574 C  CB  . ALA A 236 ? 0.5275 0.2651 0.9101 0.0580  -0.1529 0.1012  1613 ALA A CB  
1575 N  N   . LEU A 237 ? 0.5247 0.2169 0.9023 0.0512  -0.1407 0.0896  1614 LEU A N   
1576 C  CA  . LEU A 237 ? 0.5197 0.1900 0.8941 0.0478  -0.1392 0.0927  1614 LEU A CA  
1577 C  C   . LEU A 237 ? 0.5644 0.2206 0.9598 0.0529  -0.1341 0.0818  1614 LEU A C   
1578 O  O   . LEU A 237 ? 0.5782 0.2146 0.9839 0.0554  -0.1347 0.0887  1614 LEU A O   
1579 C  CB  . LEU A 237 ? 0.5125 0.1826 0.8659 0.0361  -0.1369 0.0876  1614 LEU A CB  
1580 C  CG  . LEU A 237 ? 0.5715 0.2484 0.9058 0.0305  -0.1414 0.0981  1614 LEU A CG  
1581 C  CD1 . LEU A 237 ? 0.5497 0.2277 0.8684 0.0208  -0.1394 0.0906  1614 LEU A CD1 
1582 C  CD2 . LEU A 237 ? 0.6601 0.3255 0.9931 0.0314  -0.1442 0.1134  1614 LEU A CD2 
1583 N  N   . SER A 238 ? 0.4928 0.1595 0.8949 0.0538  -0.1286 0.0643  1615 SER A N   
1584 C  CA  . SER A 238 ? 0.4878 0.1440 0.9104 0.0588  -0.1230 0.0496  1615 SER A CA  
1585 C  C   . SER A 238 ? 0.5570 0.2073 1.0078 0.0726  -0.1258 0.0558  1615 SER A C   
1586 O  O   . SER A 238 ? 0.5864 0.2170 1.0565 0.0775  -0.1240 0.0518  1615 SER A O   
1587 C  CB  . SER A 238 ? 0.4953 0.1693 0.9153 0.0560  -0.1159 0.0294  1615 SER A CB  
1588 O  OG  . SER A 238 ? 0.5257 0.1917 0.9646 0.0605  -0.1096 0.0117  1615 SER A OG  
1589 N  N   . ALA A 239 ? 0.4880 0.1552 0.9425 0.0789  -0.1310 0.0654  1616 ALA A N   
1590 C  CA  . ALA A 239 ? 0.4810 0.1474 0.9625 0.0931  -0.1360 0.0733  1616 ALA A CA  
1591 C  C   . ALA A 239 ? 0.5534 0.1964 1.0375 0.0961  -0.1431 0.0943  1616 ALA A C   
1592 O  O   . ALA A 239 ? 0.5722 0.2001 1.0825 0.1069  -0.1452 0.0978  1616 ALA A O   
1593 C  CB  . ALA A 239 ? 0.4729 0.1665 0.9537 0.0963  -0.1411 0.0789  1616 ALA A CB  
1594 N  N   . VAL A 240 ? 0.4904 0.1304 0.9480 0.0865  -0.1465 0.1083  1617 VAL A N   
1595 C  CA  . VAL A 240 ? 0.4944 0.1147 0.9501 0.0870  -0.1519 0.1295  1617 VAL A CA  
1596 C  C   . VAL A 240 ? 0.5740 0.1698 1.0275 0.0787  -0.1458 0.1261  1617 VAL A C   
1597 O  O   . VAL A 240 ? 0.5912 0.1712 1.0394 0.0756  -0.1483 0.1434  1617 VAL A O   
1598 C  CB  . VAL A 240 ? 0.5098 0.1424 0.9411 0.0826  -0.1592 0.1481  1617 VAL A CB  
1599 C  CG1 . VAL A 240 ? 0.4905 0.1468 0.9277 0.0909  -0.1666 0.1518  1617 VAL A CG1 
1600 C  CG2 . VAL A 240 ? 0.4862 0.1265 0.8895 0.0689  -0.1552 0.1422  1617 VAL A CG2 
1601 N  N   . GLU A 241 ? 0.5319 0.1260 0.9894 0.0746  -0.1379 0.1037  1618 GLU A N   
1602 C  CA  . GLU A 241 ? 0.5426 0.1166 1.0007 0.0663  -0.1324 0.0961  1618 GLU A CA  
1603 C  C   . GLU A 241 ? 0.5991 0.1721 1.0319 0.0537  -0.1327 0.1062  1618 GLU A C   
1604 O  O   . GLU A 241 ? 0.6302 0.1839 1.0665 0.0480  -0.1307 0.1109  1618 GLU A O   
1605 C  CB  . GLU A 241 ? 0.5917 0.1376 1.0782 0.0731  -0.1326 0.1009  1618 GLU A CB  
1606 C  CG  . GLU A 241 ? 0.7909 0.3331 1.3060 0.0828  -0.1287 0.0805  1618 GLU A CG  
1607 C  CD  . GLU A 241 ? 1.1439 0.6635 1.6924 0.0955  -0.1319 0.0887  1618 GLU A CD  
1608 O  OE1 . GLU A 241 ? 1.3381 0.8319 1.8924 0.0926  -0.1337 0.1038  1618 GLU A OE1 
1609 O  OE2 . GLU A 241 ? 0.9260 0.4537 1.4969 0.1083  -0.1323 0.0798  1618 GLU A OE2 
1610 N  N   . ARG A 242 ? 0.5418 0.1356 0.9514 0.0491  -0.1348 0.1089  1619 ARG A N   
1611 C  CA  . ARG A 242 ? 0.5381 0.1338 0.9254 0.0381  -0.1347 0.1163  1619 ARG A CA  
1612 C  C   . ARG A 242 ? 0.6006 0.2086 0.9733 0.0299  -0.1316 0.0999  1619 ARG A C   
1613 O  O   . ARG A 242 ? 0.6102 0.2241 0.9655 0.0222  -0.1322 0.1038  1619 ARG A O   
1614 C  CB  . ARG A 242 ? 0.5332 0.1394 0.9058 0.0394  -0.1407 0.1356  1619 ARG A CB  
1615 C  CG  . ARG A 242 ? 0.7002 0.3129 1.0494 0.0291  -0.1402 0.1416  1619 ARG A CG  
1616 C  CD  . ARG A 242 ? 0.9136 0.5148 1.2591 0.0260  -0.1404 0.1609  1619 ARG A CD  
1617 N  NE  . ARG A 242 ? 1.0042 0.6178 1.3359 0.0288  -0.1464 0.1769  1619 ARG A NE  
1618 C  CZ  . ARG A 242 ? 1.0615 0.6885 1.3716 0.0221  -0.1466 0.1807  1619 ARG A CZ  
1619 N  NH1 . ARG A 242 ? 0.7363 0.3658 1.0383 0.0132  -0.1413 0.1704  1619 ARG A NH1 
1620 N  NH2 . ARG A 242 ? 0.9017 0.5410 1.1992 0.0247  -0.1526 0.1936  1619 ARG A NH2 
1621 N  N   . LEU A 243 ? 0.5724 0.1842 0.9528 0.0315  -0.1283 0.0816  1620 LEU A N   
1622 C  CA  . LEU A 243 ? 0.5739 0.1967 0.9404 0.0238  -0.1262 0.0672  1620 LEU A CA  
1623 C  C   . LEU A 243 ? 0.6827 0.2916 1.0539 0.0170  -0.1231 0.0577  1620 LEU A C   
1624 O  O   . LEU A 243 ? 0.6856 0.2824 1.0750 0.0200  -0.1199 0.0477  1620 LEU A O   
1625 C  CB  . LEU A 243 ? 0.5730 0.2106 0.9420 0.0277  -0.1238 0.0533  1620 LEU A CB  
1626 C  CG  . LEU A 243 ? 0.6353 0.2848 0.9885 0.0197  -0.1219 0.0398  1620 LEU A CG  
1627 C  CD1 . LEU A 243 ? 0.6308 0.2903 0.9634 0.0135  -0.1260 0.0488  1620 LEU A CD1 
1628 C  CD2 . LEU A 243 ? 0.6617 0.3260 1.0182 0.0229  -0.1179 0.0268  1620 LEU A CD2 
1629 N  N   . ASP A 244 ? 0.6549 0.2661 1.0120 0.0079  -0.1243 0.0603  1621 ASP A N   
1630 C  CA  . ASP A 244 ? 0.6588 0.2603 1.0201 -0.0001 -0.1224 0.0524  1621 ASP A CA  
1631 C  C   . ASP A 244 ? 0.6796 0.2944 1.0279 -0.0059 -0.1237 0.0387  1621 ASP A C   
1632 O  O   . ASP A 244 ? 0.6597 0.2814 0.9964 -0.0118 -0.1263 0.0417  1621 ASP A O   
1633 C  CB  . ASP A 244 ? 0.6870 0.2816 1.0465 -0.0057 -0.1226 0.0666  1621 ASP A CB  
1634 C  CG  . ASP A 244 ? 0.9027 0.4876 1.2681 -0.0007 -0.1226 0.0853  1621 ASP A CG  
1635 O  OD1 . ASP A 244 ? 0.9123 0.4811 1.2958 0.0042  -0.1212 0.0865  1621 ASP A OD1 
1636 O  OD2 . ASP A 244 ? 1.0098 0.6030 1.3618 -0.0015 -0.1245 0.0985  1621 ASP A OD2 
1637 N  N   . PHE A 245 ? 0.6398 0.2592 0.9903 -0.0037 -0.1218 0.0236  1622 PHE A N   
1638 C  CA  . PHE A 245 ? 0.6274 0.2608 0.9635 -0.0090 -0.1231 0.0109  1622 PHE A CA  
1639 C  C   . PHE A 245 ? 0.6431 0.2712 0.9883 -0.0119 -0.1205 -0.0086 1622 PHE A C   
1640 O  O   . PHE A 245 ? 0.6487 0.2740 1.0055 -0.0065 -0.1161 -0.0187 1622 PHE A O   
1641 C  CB  . PHE A 245 ? 0.6483 0.2974 0.9736 -0.0050 -0.1227 0.0113  1622 PHE A CB  
1642 C  CG  . PHE A 245 ? 0.6650 0.3292 0.9706 -0.0112 -0.1252 0.0056  1622 PHE A CG  
1643 C  CD1 . PHE A 245 ? 0.6804 0.3470 0.9747 -0.0170 -0.1308 0.0119  1622 PHE A CD1 
1644 C  CD2 . PHE A 245 ? 0.7157 0.3926 1.0148 -0.0110 -0.1220 -0.0054 1622 PHE A CD2 
1645 C  CE1 . PHE A 245 ? 0.6993 0.3783 0.9763 -0.0220 -0.1345 0.0090  1622 PHE A CE1 
1646 C  CE2 . PHE A 245 ? 0.7514 0.4419 1.0303 -0.0174 -0.1247 -0.0077 1622 PHE A CE2 
1647 C  CZ  . PHE A 245 ? 0.7139 0.4042 0.9820 -0.0226 -0.1317 0.0005  1622 PHE A CZ  
1648 N  N   . PRO A 246 ? 0.5723 0.2000 0.9148 -0.0202 -0.1235 -0.0151 1623 PRO A N   
1649 C  CA  . PRO A 246 ? 0.5775 0.2002 0.9299 -0.0242 -0.1218 -0.0351 1623 PRO A CA  
1650 C  C   . PRO A 246 ? 0.6165 0.2552 0.9550 -0.0258 -0.1214 -0.0526 1623 PRO A C   
1651 O  O   . PRO A 246 ? 0.6272 0.2720 0.9596 -0.0331 -0.1246 -0.0658 1623 PRO A O   
1652 C  CB  . PRO A 246 ? 0.5957 0.2152 0.9508 -0.0329 -0.1259 -0.0341 1623 PRO A CB  
1653 C  CG  . PRO A 246 ? 0.6352 0.2673 0.9728 -0.0341 -0.1308 -0.0204 1623 PRO A CG  
1654 C  CD  . PRO A 246 ? 0.5748 0.2071 0.9080 -0.0262 -0.1286 -0.0057 1623 PRO A CD  
1655 N  N   . TYR A 247 ? 0.5330 0.1801 0.8670 -0.0193 -0.1173 -0.0531 1624 TYR A N   
1656 C  CA  . TYR A 247 ? 0.5270 0.1917 0.8469 -0.0209 -0.1148 -0.0683 1624 TYR A CA  
1657 C  C   . TYR A 247 ? 0.6080 0.2728 0.9417 -0.0125 -0.1067 -0.0768 1624 TYR A C   
1658 O  O   . TYR A 247 ? 0.6048 0.2630 0.9503 -0.0048 -0.1055 -0.0634 1624 TYR A O   
1659 C  CB  . TYR A 247 ? 0.5212 0.2035 0.8154 -0.0243 -0.1189 -0.0570 1624 TYR A CB  
1660 C  CG  . TYR A 247 ? 0.5331 0.2178 0.8147 -0.0319 -0.1276 -0.0517 1624 TYR A CG  
1661 C  CD1 . TYR A 247 ? 0.5695 0.2653 0.8370 -0.0392 -0.1315 -0.0647 1624 TYR A CD1 
1662 C  CD2 . TYR A 247 ? 0.5229 0.2001 0.8075 -0.0317 -0.1323 -0.0346 1624 TYR A CD2 
1663 C  CE1 . TYR A 247 ? 0.5681 0.2671 0.8273 -0.0452 -0.1408 -0.0599 1624 TYR A CE1 
1664 C  CE2 . TYR A 247 ? 0.5236 0.2039 0.8013 -0.0377 -0.1401 -0.0314 1624 TYR A CE2 
1665 C  CZ  . TYR A 247 ? 0.5924 0.2835 0.8585 -0.0440 -0.1449 -0.0435 1624 TYR A CZ  
1666 O  OH  . TYR A 247 ? 0.5522 0.2481 0.8136 -0.0489 -0.1539 -0.0397 1624 TYR A OH  
1667 N  N   . PRO A 248 ? 0.6072 0.2814 0.9401 -0.0134 -0.1012 -0.0994 1625 PRO A N   
1668 C  CA  . PRO A 248 ? 0.6263 0.3031 0.9758 -0.0042 -0.0925 -0.1093 1625 PRO A CA  
1669 C  C   . PRO A 248 ? 0.6410 0.3384 0.9776 -0.0016 -0.0896 -0.1006 1625 PRO A C   
1670 O  O   . PRO A 248 ? 0.6414 0.3586 0.9671 -0.0038 -0.0835 -0.1145 1625 PRO A O   
1671 C  CB  . PRO A 248 ? 0.6806 0.3623 1.0321 -0.0074 -0.0874 -0.1386 1625 PRO A CB  
1672 C  CG  . PRO A 248 ? 0.7355 0.4302 1.0579 -0.0194 -0.0934 -0.1411 1625 PRO A CG  
1673 C  CD  . PRO A 248 ? 0.6481 0.3333 0.9648 -0.0226 -0.1028 -0.1176 1625 PRO A CD  
1674 N  N   . LEU A 249 ? 0.5469 0.2407 0.8845 0.0020  -0.0937 -0.0776 1626 LEU A N   
1675 C  CA  . LEU A 249 ? 0.5114 0.2223 0.8402 0.0037  -0.0924 -0.0667 1626 LEU A CA  
1676 C  C   . LEU A 249 ? 0.5865 0.3026 0.9389 0.0143  -0.0849 -0.0739 1626 LEU A C   
1677 O  O   . LEU A 249 ? 0.5907 0.2921 0.9663 0.0235  -0.0865 -0.0668 1626 LEU A O   
1678 C  CB  . LEU A 249 ? 0.4825 0.1868 0.8051 0.0031  -0.1003 -0.0425 1626 LEU A CB  
1679 C  CG  . LEU A 249 ? 0.5100 0.2294 0.8258 0.0042  -0.1006 -0.0293 1626 LEU A CG  
1680 C  CD1 . LEU A 249 ? 0.5174 0.2553 0.8088 -0.0048 -0.0994 -0.0316 1626 LEU A CD1 
1681 C  CD2 . LEU A 249 ? 0.4440 0.1541 0.7579 0.0049  -0.1083 -0.0087 1626 LEU A CD2 
1682 N  N   . ARG A 250 ? 0.5493 0.2877 0.8961 0.0131  -0.0768 -0.0877 1627 ARG A N   
1683 C  CA  . ARG A 250 ? 0.5510 0.3004 0.9211 0.0227  -0.0683 -0.0986 1627 ARG A CA  
1684 C  C   . ARG A 250 ? 0.5726 0.3342 0.9471 0.0267  -0.0695 -0.0819 1627 ARG A C   
1685 O  O   . ARG A 250 ? 0.5674 0.3238 0.9685 0.0381  -0.0702 -0.0778 1627 ARG A O   
1686 C  CB  . ARG A 250 ? 0.5835 0.3544 0.9449 0.0182  -0.0575 -0.1231 1627 ARG A CB  
1687 C  CG  . ARG A 250 ? 0.7336 0.5182 1.1222 0.0284  -0.0466 -0.1403 1627 ARG A CG  
1688 C  CD  . ARG A 250 ? 1.0612 0.8387 1.4663 0.0323  -0.0401 -0.1682 1627 ARG A CD  
1689 N  NE  . ARG A 250 ? 1.3674 1.1729 1.7627 0.0278  -0.0275 -0.1923 1627 ARG A NE  
1690 C  CZ  . ARG A 250 ? 1.6807 1.4868 2.0854 0.0291  -0.0199 -0.2215 1627 ARG A CZ  
1691 N  NH1 . ARG A 250 ? 1.5382 1.3165 1.9645 0.0347  -0.0238 -0.2299 1627 ARG A NH1 
1692 N  NH2 . ARG A 250 ? 1.5881 1.4231 1.9810 0.0243  -0.0076 -0.2429 1627 ARG A NH2 
1693 N  N   . ASP A 251 ? 0.5090 0.2869 0.8587 0.0173  -0.0704 -0.0722 1628 ASP A N   
1694 C  CA  . ASP A 251 ? 0.4838 0.2756 0.8368 0.0188  -0.0713 -0.0582 1628 ASP A CA  
1695 C  C   . ASP A 251 ? 0.5250 0.3189 0.8517 0.0084  -0.0780 -0.0405 1628 ASP A C   
1696 O  O   . ASP A 251 ? 0.5331 0.3233 0.8364 -0.0007 -0.0804 -0.0405 1628 ASP A O   
1697 C  CB  . ASP A 251 ? 0.5129 0.3320 0.8752 0.0201  -0.0596 -0.0723 1628 ASP A CB  
1698 C  CG  . ASP A 251 ? 0.6957 0.5318 1.0336 0.0088  -0.0514 -0.0856 1628 ASP A CG  
1699 O  OD1 . ASP A 251 ? 0.7361 0.5784 1.0466 -0.0027 -0.0543 -0.0738 1628 ASP A OD1 
1700 O  OD2 . ASP A 251 ? 0.7635 0.6063 1.1093 0.0114  -0.0424 -0.1077 1628 ASP A OD2 
1701 N  N   . VAL A 252 ? 0.4534 0.2538 0.7855 0.0101  -0.0815 -0.0261 1629 VAL A N   
1702 C  CA  . VAL A 252 ? 0.4273 0.2298 0.7399 0.0012  -0.0876 -0.0100 1629 VAL A CA  
1703 C  C   . VAL A 252 ? 0.5185 0.3425 0.8388 0.0001  -0.0843 -0.0057 1629 VAL A C   
1704 O  O   . VAL A 252 ? 0.5137 0.3456 0.8587 0.0094  -0.0821 -0.0089 1629 VAL A O   
1705 C  CB  . VAL A 252 ? 0.4382 0.2202 0.7482 0.0029  -0.0986 0.0053  1629 VAL A CB  
1706 C  CG1 . VAL A 252 ? 0.4405 0.2045 0.7402 0.0006  -0.1017 0.0022  1629 VAL A CG1 
1707 C  CG2 . VAL A 252 ? 0.4218 0.1986 0.7550 0.0141  -0.1020 0.0112  1629 VAL A CG2 
1708 N  N   . ARG A 253 ? 0.4970 0.3297 0.7977 -0.0113 -0.0847 0.0023  1630 ARG A N   
1709 C  CA  . ARG A 253 ? 0.4996 0.3520 0.8062 -0.0155 -0.0820 0.0077  1630 ARG A CA  
1710 C  C   . ARG A 253 ? 0.5811 0.4300 0.8660 -0.0275 -0.0874 0.0215  1630 ARG A C   
1711 O  O   . ARG A 253 ? 0.5917 0.4292 0.8551 -0.0335 -0.0903 0.0240  1630 ARG A O   
1712 C  CB  . ARG A 253 ? 0.4957 0.3741 0.8095 -0.0176 -0.0685 -0.0062 1630 ARG A CB  
1713 C  CG  . ARG A 253 ? 0.5960 0.4813 0.8832 -0.0292 -0.0614 -0.0120 1630 ARG A CG  
1714 C  CD  . ARG A 253 ? 0.6760 0.5891 0.9707 -0.0309 -0.0465 -0.0277 1630 ARG A CD  
1715 N  NE  . ARG A 253 ? 0.7504 0.6738 1.0153 -0.0444 -0.0400 -0.0298 1630 ARG A NE  
1716 C  CZ  . ARG A 253 ? 0.9965 0.9166 1.2451 -0.0457 -0.0373 -0.0418 1630 ARG A CZ  
1717 N  NH1 . ARG A 253 ? 0.8300 0.7349 1.0913 -0.0347 -0.0400 -0.0536 1630 ARG A NH1 
1718 N  NH2 . ARG A 253 ? 0.8474 0.7793 1.0665 -0.0587 -0.0325 -0.0417 1630 ARG A NH2 
1719 N  N   . GLY A 254 ? 0.5423 0.4013 0.8348 -0.0309 -0.0890 0.0297  1631 GLY A N   
1720 C  CA  . GLY A 254 ? 0.5421 0.3990 0.8188 -0.0427 -0.0931 0.0420  1631 GLY A CA  
1721 C  C   . GLY A 254 ? 0.6105 0.4899 0.8836 -0.0533 -0.0827 0.0400  1631 GLY A C   
1722 O  O   . GLY A 254 ? 0.6135 0.5141 0.9055 -0.0505 -0.0744 0.0316  1631 GLY A O   
1723 N  N   . GLU A 255 ? 0.5736 0.4495 0.8230 -0.0655 -0.0826 0.0477  1632 GLU A N   
1724 C  CA  . GLU A 255 ? 0.5833 0.4789 0.8237 -0.0785 -0.0727 0.0494  1632 GLU A CA  
1725 C  C   . GLU A 255 ? 0.6656 0.5514 0.8921 -0.0912 -0.0790 0.0667  1632 GLU A C   
1726 O  O   . GLU A 255 ? 0.6722 0.5363 0.8837 -0.0915 -0.0889 0.0748  1632 GLU A O   
1727 C  CB  . GLU A 255 ? 0.6147 0.5181 0.8356 -0.0819 -0.0643 0.0404  1632 GLU A CB  
1728 C  CG  . GLU A 255 ? 0.7728 0.6927 1.0101 -0.0726 -0.0538 0.0207  1632 GLU A CG  
1729 C  CD  . GLU A 255 ? 0.9976 0.9452 1.2584 -0.0730 -0.0428 0.0144  1632 GLU A CD  
1730 O  OE1 . GLU A 255 ? 0.7435 0.6940 1.0328 -0.0607 -0.0440 0.0076  1632 GLU A OE1 
1731 O  OE2 . GLU A 255 ? 0.9135 0.8804 1.1651 -0.0861 -0.0335 0.0175  1632 GLU A OE2 
1732 N  N   . PRO A 256 ? 0.6381 0.5397 0.8706 -0.1021 -0.0732 0.0725  1633 PRO A N   
1733 C  CA  . PRO A 256 ? 0.7095 0.5989 0.9304 -0.1148 -0.0792 0.0895  1633 PRO A CA  
1734 C  C   . PRO A 256 ? 1.2109 1.0950 1.4014 -0.1251 -0.0781 0.0986  1633 PRO A C   
1735 O  O   . PRO A 256 ? 0.5929 0.4543 0.7697 -0.1270 -0.0891 0.1101  1633 PRO A O   
1736 C  CB  . PRO A 256 ? 0.7265 0.6374 0.9648 -0.1244 -0.0712 0.0912  1633 PRO A CB  
1737 C  CG  . PRO A 256 ? 0.7507 0.6834 1.0135 -0.1135 -0.0642 0.0751  1633 PRO A CG  
1738 C  CD  . PRO A 256 ? 0.6776 0.6084 0.9306 -0.1035 -0.0612 0.0639  1633 PRO A CD  
1739 N  N   . GLN B 1   ? 0.5980 0.9124 1.1346 0.1527  -0.3884 0.0266  1    GLN H N   
1740 C  CA  . GLN B 1   ? 0.6011 0.8473 1.0563 0.1441  -0.3801 0.0491  1    GLN H CA  
1741 C  C   . GLN B 1   ? 0.6208 0.8605 1.0558 0.1180  -0.3394 0.0515  1    GLN H C   
1742 O  O   . GLN B 1   ? 0.5685 0.8364 1.0350 0.1164  -0.3128 0.0413  1    GLN H O   
1743 C  CB  . GLN B 1   ? 0.6308 0.8332 1.0577 0.1702  -0.3875 0.0604  1    GLN H CB  
1744 C  CG  . GLN B 1   ? 0.8282 1.0195 1.2589 0.1969  -0.4316 0.0642  1    GLN H CG  
1745 C  CD  . GLN B 1   ? 0.9443 1.0637 1.2961 0.1991  -0.4497 0.0872  1    GLN H CD  
1746 O  OE1 . GLN B 1   ? 0.8232 0.9038 1.1187 0.1786  -0.4312 0.0987  1    GLN H OE1 
1747 N  NE2 . GLN B 1   ? 0.7228 0.8223 1.0694 0.2241  -0.4865 0.0938  1    GLN H NE2 
1748 N  N   . VAL B 2   ? 0.6228 0.8233 1.0037 0.0980  -0.3348 0.0646  2    VAL H N   
1749 C  CA  . VAL B 2   ? 0.6218 0.8091 0.9800 0.0749  -0.3004 0.0693  2    VAL H CA  
1750 C  C   . VAL B 2   ? 0.6774 0.8302 1.0033 0.0839  -0.2816 0.0793  2    VAL H C   
1751 O  O   . VAL B 2   ? 0.6847 0.7971 0.9746 0.0973  -0.2937 0.0899  2    VAL H O   
1752 C  CB  . VAL B 2   ? 0.6861 0.8470 1.0072 0.0510  -0.3001 0.0763  2    VAL H CB  
1753 C  CG1 . VAL B 2   ? 0.6914 0.8923 1.0496 0.0380  -0.3150 0.0626  2    VAL H CG1 
1754 C  CG2 . VAL B 2   ? 0.7052 0.8105 0.9674 0.0566  -0.3157 0.0907  2    VAL H CG2 
1755 N  N   . GLN B 3   ? 0.6200 0.7887 0.9575 0.0751  -0.2520 0.0753  3    GLN H N   
1756 C  CA  . GLN B 3   ? 0.6059 0.7494 0.9169 0.0818  -0.2342 0.0818  3    GLN H CA  
1757 C  C   . GLN B 3   ? 0.6325 0.7694 0.9244 0.0606  -0.2066 0.0868  3    GLN H C   
1758 O  O   . GLN B 3   ? 0.6460 0.8128 0.9620 0.0438  -0.1930 0.0798  3    GLN H O   
1759 C  CB  . GLN B 3   ? 0.6252 0.7985 0.9743 0.1009  -0.2302 0.0684  3    GLN H CB  
1760 C  CG  . GLN B 3   ? 0.9743 1.1180 1.2958 0.1132  -0.2201 0.0728  3    GLN H CG  
1761 C  CD  . GLN B 3   ? 1.2038 1.3196 1.5162 0.1370  -0.2423 0.0762  3    GLN H CD  
1762 O  OE1 . GLN B 3   ? 1.0657 1.1999 1.4126 0.1546  -0.2614 0.0683  3    GLN H OE1 
1763 N  NE2 . GLN B 3   ? 1.1294 1.1993 1.3966 0.1382  -0.2395 0.0876  3    GLN H NE2 
1764 N  N   . LEU B 4   ? 0.5613 0.6582 0.8105 0.0609  -0.1988 0.0988  4    LEU H N   
1765 C  CA  . LEU B 4   ? 0.5480 0.6325 0.7744 0.0448  -0.1765 0.1060  4    LEU H CA  
1766 C  C   . LEU B 4   ? 0.5639 0.6454 0.7798 0.0550  -0.1641 0.1049  4    LEU H C   
1767 O  O   . LEU B 4   ? 0.5701 0.6267 0.7674 0.0688  -0.1721 0.1082  4    LEU H O   
1768 C  CB  . LEU B 4   ? 0.5518 0.5936 0.7400 0.0358  -0.1794 0.1194  4    LEU H CB  
1769 C  CG  . LEU B 4   ? 0.6078 0.6431 0.7959 0.0236  -0.1906 0.1202  4    LEU H CG  
1770 C  CD1 . LEU B 4   ? 0.6007 0.5918 0.7519 0.0180  -0.1902 0.1306  4    LEU H CD1 
1771 C  CD2 . LEU B 4   ? 0.6590 0.7199 0.8699 0.0039  -0.1795 0.1152  4    LEU H CD2 
1772 N  N   . VAL B 5   ? 0.4798 0.5868 0.7072 0.0466  -0.1438 0.0984  5    VAL H N   
1773 C  CA  . VAL B 5   ? 0.4646 0.5742 0.6819 0.0533  -0.1301 0.0939  5    VAL H CA  
1774 C  C   . VAL B 5   ? 0.5269 0.6168 0.7065 0.0377  -0.1143 0.1052  5    VAL H C   
1775 O  O   . VAL B 5   ? 0.5172 0.6160 0.6967 0.0188  -0.1003 0.1078  5    VAL H O   
1776 C  CB  . VAL B 5   ? 0.5073 0.6619 0.7670 0.0596  -0.1200 0.0739  5    VAL H CB  
1777 C  CG1 . VAL B 5   ? 0.5049 0.6979 0.8009 0.0431  -0.1099 0.0652  5    VAL H CG1 
1778 C  CG2 . VAL B 5   ? 0.5182 0.6748 0.7609 0.0605  -0.1005 0.0676  5    VAL H CG2 
1779 N  N   . GLN B 6   ? 0.5125 0.5737 0.6595 0.0455  -0.1175 0.1122  6    GLN H N   
1780 C  CA  . GLN B 6   ? 0.5336 0.5711 0.6411 0.0351  -0.1091 0.1248  6    GLN H CA  
1781 C  C   . GLN B 6   ? 0.6276 0.6760 0.7184 0.0333  -0.0932 0.1187  6    GLN H C   
1782 O  O   . GLN B 6   ? 0.6210 0.6912 0.7300 0.0436  -0.0891 0.1029  6    GLN H O   
1783 C  CB  . GLN B 6   ? 0.5325 0.5339 0.6169 0.0432  -0.1242 0.1351  6    GLN H CB  
1784 C  CG  . GLN B 6   ? 0.3914 0.3784 0.4850 0.0418  -0.1363 0.1403  6    GLN H CG  
1785 C  CD  . GLN B 6   ? 0.3684 0.3217 0.4407 0.0454  -0.1452 0.1491  6    GLN H CD  
1786 O  OE1 . GLN B 6   ? 0.2495 0.1975 0.3089 0.0225  -0.1269 0.1374  6    GLN H OE1 
1787 N  NE2 . GLN B 6   ? 0.2798 0.2235 0.3584 0.0463  -0.1505 0.1400  6    GLN H NE2 
1788 N  N   . SER B 7   ? 0.6228 0.6529 0.6763 0.0202  -0.0846 0.1312  7    SER H N   
1789 C  CA  . SER B 7   ? 0.6594 0.6928 0.6835 0.0156  -0.0705 0.1280  7    SER H CA  
1790 C  C   . SER B 7   ? 0.7119 0.7322 0.7191 0.0320  -0.0831 0.1242  7    SER H C   
1791 O  O   . SER B 7   ? 0.6850 0.6895 0.7005 0.0441  -0.1010 0.1272  7    SER H O   
1792 C  CB  . SER B 7   ? 0.7645 0.7751 0.7471 -0.0033 -0.0611 0.1457  7    SER H CB  
1793 O  OG  . SER B 7   ? 0.9150 0.8897 0.8795 -0.0011 -0.0781 0.1640  7    SER H OG  
1794 N  N   . GLY B 8   ? 0.6879 0.7164 0.6732 0.0307  -0.0718 0.1149  8    GLY H N   
1795 C  CA  . GLY B 8   ? 0.6863 0.7064 0.6567 0.0435  -0.0814 0.1072  8    GLY H CA  
1796 C  C   . GLY B 8   ? 0.7531 0.7421 0.6870 0.0447  -0.0982 0.1225  8    GLY H C   
1797 O  O   . GLY B 8   ? 0.7689 0.7395 0.6773 0.0344  -0.0998 0.1408  8    GLY H O   
1798 N  N   . ALA B 9   ? 0.7019 0.6847 0.6357 0.0575  -0.1110 0.1140  9    ALA H N   
1799 C  CA  . ALA B 9   ? 0.7141 0.6741 0.6238 0.0615  -0.1296 0.1229  9    ALA H CA  
1800 C  C   . ALA B 9   ? 0.8232 0.7710 0.6822 0.0515  -0.1302 0.1349  9    ALA H C   
1801 O  O   . ALA B 9   ? 0.8480 0.8060 0.6817 0.0418  -0.1140 0.1295  9    ALA H O   
1802 C  CB  . ALA B 9   ? 0.7127 0.6748 0.6328 0.0733  -0.1382 0.1061  9    ALA H CB  
1803 N  N   . GLU B 10  ? 0.7984 0.7225 0.6424 0.0537  -0.1486 0.1516  10   GLU H N   
1804 C  CA  . GLU B 10  ? 0.8406 0.7437 0.6346 0.0467  -0.1558 0.1690  10   GLU H CA  
1805 C  C   . GLU B 10  ? 0.8801 0.7733 0.6583 0.0573  -0.1811 0.1684  10   GLU H C   
1806 O  O   . GLU B 10  ? 0.8555 0.7515 0.6687 0.0691  -0.1945 0.1606  10   GLU H O   
1807 C  CB  . GLU B 10  ? 0.8635 0.7440 0.6570 0.0407  -0.1572 0.1913  10   GLU H CB  
1808 C  CG  . GLU B 10  ? 1.0470 0.9387 0.8569 0.0276  -0.1334 0.1913  10   GLU H CG  
1809 C  CD  . GLU B 10  ? 1.5184 1.4071 1.2881 0.0084  -0.1128 0.1987  10   GLU H CD  
1810 O  OE1 . GLU B 10  ? 1.4363 1.3119 1.1546 0.0042  -0.1156 0.2044  10   GLU H OE1 
1811 O  OE2 . GLU B 10  ? 1.5404 1.4399 1.3290 -0.0040 -0.0934 0.1978  10   GLU H OE2 
1812 N  N   . VAL B 11  ? 0.8441 0.7263 0.5683 0.0519  -0.1873 0.1756  11   VAL H N   
1813 C  CA  . VAL B 11  ? 0.8416 0.7149 0.5435 0.0608  -0.2150 0.1765  11   VAL H CA  
1814 C  C   . VAL B 11  ? 0.9162 0.7573 0.5692 0.0560  -0.2266 0.2043  11   VAL H C   
1815 O  O   . VAL B 11  ? 0.9431 0.7736 0.5480 0.0408  -0.2103 0.2140  11   VAL H O   
1816 C  CB  . VAL B 11  ? 0.9064 0.7960 0.5823 0.0592  -0.2145 0.1557  11   VAL H CB  
1817 C  CG1 . VAL B 11  ? 0.9085 0.7975 0.5846 0.0710  -0.2462 0.1502  11   VAL H CG1 
1818 C  CG2 . VAL B 11  ? 0.8626 0.7788 0.5765 0.0594  -0.1926 0.1301  11   VAL H CG2 
1819 N  N   . LYS B 12  ? 0.8703 0.6939 0.5379 0.0685  -0.2527 0.2170  12   LYS H N   
1820 C  CA  . LYS B 12  ? 0.9232 0.7098 0.5507 0.0679  -0.2681 0.2454  12   LYS H CA  
1821 C  C   . LYS B 12  ? 1.0143 0.7911 0.6356 0.0843  -0.3062 0.2500  12   LYS H C   
1822 O  O   . LYS B 12  ? 0.9719 0.7705 0.6424 0.0974  -0.3198 0.2322  12   LYS H O   
1823 C  CB  . LYS B 12  ? 0.9206 0.6896 0.5798 0.0673  -0.2602 0.2597  12   LYS H CB  
1824 C  CG  . LYS B 12  ? 0.9421 0.7187 0.6074 0.0500  -0.2257 0.2580  12   LYS H CG  
1825 C  CD  . LYS B 12  ? 1.0682 0.8207 0.6722 0.0310  -0.2103 0.2764  12   LYS H CD  
1826 C  CE  . LYS B 12  ? 1.1547 0.9327 0.7719 0.0142  -0.1746 0.2632  12   LYS H CE  
1827 N  NZ  . LYS B 12  ? 1.3757 1.1307 0.9432 -0.0083 -0.1534 0.2802  12   LYS H NZ  
1828 N  N   . LYS B 13  ? 1.0493 0.7918 0.6106 0.0834  -0.3241 0.2743  13   LYS H N   
1829 C  CA  . LYS B 13  ? 1.0820 0.8126 0.6338 0.1008  -0.3658 0.2816  13   LYS H CA  
1830 C  C   . LYS B 13  ? 1.1368 0.8416 0.7232 0.1139  -0.3803 0.2994  13   LYS H C   
1831 O  O   . LYS B 13  ? 1.1414 0.8234 0.7237 0.1038  -0.3590 0.3144  13   LYS H O   
1832 C  CB  . LYS B 13  ? 1.2052 0.9082 0.6658 0.0933  -0.3802 0.2996  13   LYS H CB  
1833 C  CG  . LYS B 13  ? 1.4293 1.1559 0.8717 0.0992  -0.4042 0.2808  13   LYS H CG  
1834 C  CD  . LYS B 13  ? 1.4879 1.2454 0.9167 0.0829  -0.3742 0.2547  13   LYS H CD  
1835 C  CE  . LYS B 13  ? 1.4225 1.2078 0.8477 0.0881  -0.3948 0.2293  13   LYS H CE  
1836 N  NZ  . LYS B 13  ? 1.5069 1.2690 0.8637 0.0925  -0.4333 0.2446  13   LYS H NZ  
1837 N  N   . PRO B 14  ? 1.0842 0.7926 0.7078 0.1356  -0.4150 0.2961  14   PRO H N   
1838 C  CA  . PRO B 14  ? 1.0793 0.7611 0.7378 0.1494  -0.4281 0.3115  14   PRO H CA  
1839 C  C   . PRO B 14  ? 1.1952 0.8210 0.7916 0.1439  -0.4312 0.3473  14   PRO H C   
1840 O  O   . PRO B 14  ? 1.2586 0.8612 0.7809 0.1392  -0.4451 0.3642  14   PRO H O   
1841 C  CB  . PRO B 14  ? 1.1025 0.8002 0.7997 0.1734  -0.4689 0.3009  14   PRO H CB  
1842 C  CG  . PRO B 14  ? 1.1270 0.8700 0.8369 0.1696  -0.4666 0.2717  14   PRO H CG  
1843 C  CD  . PRO B 14  ? 1.1006 0.8381 0.7395 0.1484  -0.4441 0.2766  14   PRO H CD  
1844 N  N   . GLY B 15  ? 1.1401 0.7423 0.7630 0.1422  -0.4162 0.3579  15   GLY H N   
1845 C  CA  . GLY B 15  ? 1.2124 0.7573 0.7851 0.1352  -0.4146 0.3908  15   GLY H CA  
1846 C  C   . GLY B 15  ? 1.2738 0.8100 0.8082 0.1058  -0.3730 0.3971  15   GLY H C   
1847 O  O   . GLY B 15  ? 1.2912 0.7847 0.8030 0.0956  -0.3611 0.4188  15   GLY H O   
1848 N  N   . SER B 16  ? 1.2221 0.7994 0.7536 0.0920  -0.3499 0.3764  16   SER H N   
1849 C  CA  . SER B 16  ? 1.2323 0.8123 0.7386 0.0649  -0.3093 0.3764  16   SER H CA  
1850 C  C   . SER B 16  ? 1.2368 0.8274 0.8052 0.0594  -0.2847 0.3672  16   SER H C   
1851 O  O   . SER B 16  ? 1.2063 0.7957 0.8283 0.0755  -0.2981 0.3631  16   SER H O   
1852 C  CB  . SER B 16  ? 1.2691 0.8927 0.7645 0.0561  -0.2946 0.3531  16   SER H CB  
1853 O  OG  . SER B 16  ? 1.4844 1.1019 0.9304 0.0302  -0.2624 0.3582  16   SER H OG  
1854 N  N   . SER B 17  ? 1.1786 0.7797 0.7391 0.0361  -0.2490 0.3631  17   SER H N   
1855 C  CA  . SER B 17  ? 1.1154 0.7297 0.7275 0.0273  -0.2251 0.3533  17   SER H CA  
1856 C  C   . SER B 17  ? 1.1050 0.7699 0.7410 0.0175  -0.2003 0.3279  17   SER H C   
1857 O  O   . SER B 17  ? 1.1404 0.8197 0.7400 0.0094  -0.1916 0.3228  17   SER H O   
1858 C  CB  . SER B 17  ? 1.2113 0.7847 0.7915 0.0066  -0.2066 0.3749  17   SER H CB  
1859 O  OG  . SER B 17  ? 1.2901 0.8584 0.9205 0.0059  -0.1991 0.3716  17   SER H OG  
1860 N  N   . VAL B 18  ? 0.9653 0.6557 0.6612 0.0189  -0.1897 0.3112  18   VAL H N   
1861 C  CA  . VAL B 18  ? 0.8995 0.6352 0.6248 0.0121  -0.1686 0.2880  18   VAL H CA  
1862 C  C   . VAL B 18  ? 0.9189 0.6577 0.6711 -0.0031 -0.1473 0.2867  18   VAL H C   
1863 O  O   . VAL B 18  ? 0.9172 0.6335 0.6889 -0.0009 -0.1534 0.2943  18   VAL H O   
1864 C  CB  . VAL B 18  ? 0.8790 0.6477 0.6521 0.0294  -0.1787 0.2654  18   VAL H CB  
1865 C  CG1 . VAL B 18  ? 0.8820 0.6700 0.6379 0.0369  -0.1865 0.2538  18   VAL H CG1 
1866 C  CG2 . VAL B 18  ? 0.8463 0.6034 0.6582 0.0437  -0.1957 0.2652  18   VAL H CG2 
1867 N  N   . LYS B 19  ? 0.8350 0.6046 0.5941 -0.0176 -0.1229 0.2740  19   LYS H N   
1868 C  CA  . LYS B 19  ? 0.7978 0.5800 0.5911 -0.0318 -0.1044 0.2680  19   LYS H CA  
1869 C  C   . LYS B 19  ? 0.7885 0.6191 0.6220 -0.0280 -0.0959 0.2434  19   LYS H C   
1870 O  O   . LYS B 19  ? 0.7919 0.6469 0.6149 -0.0332 -0.0820 0.2331  19   LYS H O   
1871 C  CB  . LYS B 19  ? 0.8804 0.6452 0.6434 -0.0578 -0.0815 0.2804  19   LYS H CB  
1872 C  CG  . LYS B 19  ? 0.8354 0.6131 0.6393 -0.0727 -0.0659 0.2729  19   LYS H CG  
1873 C  CD  . LYS B 19  ? 0.9244 0.6846 0.7000 -0.1015 -0.0407 0.2836  19   LYS H CD  
1874 C  CE  . LYS B 19  ? 1.0833 0.8193 0.8767 -0.1154 -0.0357 0.2906  19   LYS H CE  
1875 N  NZ  . LYS B 19  ? 1.1477 0.8655 0.9669 -0.0968 -0.0596 0.2924  19   LYS H NZ  
1876 N  N   . VAL B 20  ? 0.6921 0.5339 0.5700 -0.0180 -0.1050 0.2337  20   VAL H N   
1877 C  CA  . VAL B 20  ? 0.6286 0.5092 0.5463 -0.0107 -0.1028 0.2126  20   VAL H CA  
1878 C  C   . VAL B 20  ? 0.6948 0.5932 0.6437 -0.0245 -0.0898 0.2062  20   VAL H C   
1879 O  O   . VAL B 20  ? 0.7003 0.5776 0.6518 -0.0339 -0.0900 0.2154  20   VAL H O   
1880 C  CB  . VAL B 20  ? 0.6187 0.4961 0.5573 0.0088  -0.1225 0.2066  20   VAL H CB  
1881 C  CG1 . VAL B 20  ? 0.5828 0.4925 0.5554 0.0164  -0.1213 0.1878  20   VAL H CG1 
1882 C  CG2 . VAL B 20  ? 0.6234 0.4868 0.5361 0.0210  -0.1362 0.2109  20   VAL H CG2 
1883 N  N   . SER B 21  ? 0.6612 0.5989 0.6354 -0.0258 -0.0788 0.1891  21   SER H N   
1884 C  CA  . SER B 21  ? 0.6650 0.6284 0.6757 -0.0379 -0.0687 0.1795  21   SER H CA  
1885 C  C   . SER B 21  ? 0.7078 0.6963 0.7598 -0.0228 -0.0818 0.1642  21   SER H C   
1886 O  O   . SER B 21  ? 0.6763 0.6703 0.7304 -0.0051 -0.0912 0.1575  21   SER H O   
1887 C  CB  . SER B 21  ? 0.7343 0.7251 0.7459 -0.0543 -0.0436 0.1713  21   SER H CB  
1888 O  OG  . SER B 21  ? 0.8528 0.8756 0.8789 -0.0421 -0.0404 0.1541  21   SER H OG  
1889 N  N   . CYS B 22  ? 0.6885 0.6901 0.7712 -0.0308 -0.0830 0.1588  22   CYS H N   
1890 C  CA  . CYS B 22  ? 0.6723 0.6952 0.7899 -0.0181 -0.0975 0.1461  22   CYS H CA  
1891 C  C   . CYS B 22  ? 0.7357 0.7958 0.8935 -0.0305 -0.0910 0.1334  22   CYS H C   
1892 O  O   . CYS B 22  ? 0.7320 0.7853 0.8930 -0.0481 -0.0870 0.1370  22   CYS H O   
1893 C  CB  . CYS B 22  ? 0.6707 0.6624 0.7791 -0.0114 -0.1152 0.1535  22   CYS H CB  
1894 S  SG  . CYS B 22  ? 0.7020 0.7096 0.8400 0.0008  -0.1346 0.1417  22   CYS H SG  
1895 N  N   . LYS B 23  ? 0.7033 0.8035 0.8943 -0.0215 -0.0894 0.1169  23   LYS H N   
1896 C  CA  . LYS B 23  ? 0.7043 0.8484 0.9432 -0.0306 -0.0846 0.1009  23   LYS H CA  
1897 C  C   . LYS B 23  ? 0.7637 0.9203 1.0328 -0.0163 -0.1109 0.0933  23   LYS H C   
1898 O  O   . LYS B 23  ? 0.7473 0.9008 1.0175 0.0059  -0.1261 0.0911  23   LYS H O   
1899 C  CB  . LYS B 23  ? 0.7325 0.9167 0.9957 -0.0299 -0.0652 0.0847  23   LYS H CB  
1900 C  CG  . LYS B 23  ? 0.8194 1.0534 1.1369 -0.0442 -0.0544 0.0662  23   LYS H CG  
1901 C  CD  . LYS B 23  ? 0.8826 1.1600 1.2311 -0.0431 -0.0329 0.0461  23   LYS H CD  
1902 C  CE  . LYS B 23  ? 1.0032 1.2881 1.3400 -0.0734 0.0028  0.0446  23   LYS H CE  
1903 N  NZ  . LYS B 23  ? 1.1441 1.4537 1.5175 -0.0974 0.0105  0.0371  23   LYS H NZ  
1904 N  N   . ALA B 24  ? 0.7456 0.9135 1.0359 -0.0303 -0.1165 0.0895  24   ALA H N   
1905 C  CA  . ALA B 24  ? 0.7444 0.9257 1.0602 -0.0200 -0.1432 0.0820  24   ALA H CA  
1906 C  C   . ALA B 24  ? 0.8413 1.0816 1.2179 -0.0175 -0.1439 0.0608  24   ALA H C   
1907 O  O   . ALA B 24  ? 0.8475 1.1181 1.2500 -0.0370 -0.1220 0.0510  24   ALA H O   
1908 C  CB  . ALA B 24  ? 0.7587 0.9201 1.0631 -0.0376 -0.1500 0.0871  24   ALA H CB  
1909 N  N   . SER B 25  ? 0.8243 1.0796 1.2242 0.0065  -0.1687 0.0534  25   SER H N   
1910 C  CA  . SER B 25  ? 0.8367 1.1487 1.3012 0.0156  -0.1766 0.0321  25   SER H CA  
1911 C  C   . SER B 25  ? 0.9178 1.2310 1.3946 0.0314  -0.2151 0.0308  25   SER H C   
1912 O  O   . SER B 25  ? 0.9145 1.1823 1.3465 0.0424  -0.2325 0.0459  25   SER H O   
1913 C  CB  . SER B 25  ? 0.8826 1.2128 1.3659 0.0342  -0.1652 0.0226  25   SER H CB  
1914 O  OG  . SER B 25  ? 0.9703 1.2661 1.4258 0.0597  -0.1831 0.0320  25   SER H OG  
1915 N  N   . GLY B 26  ? 0.9002 1.2655 1.4370 0.0314  -0.2276 0.0121  26   GLY H N   
1916 C  CA  . GLY B 26  ? 0.9220 1.2953 1.4748 0.0454  -0.2677 0.0090  26   GLY H CA  
1917 C  C   . GLY B 26  ? 1.0141 1.3890 1.5620 0.0192  -0.2737 0.0079  26   GLY H C   
1918 O  O   . GLY B 26  ? 1.0201 1.4455 1.6229 0.0107  -0.2829 -0.0107 26   GLY H O   
1919 N  N   . GLY B 27  ? 0.9891 1.3106 1.4749 0.0052  -0.2661 0.0255  27   GLY H N   
1920 C  CA  . GLY B 27  ? 1.0051 1.3166 1.4768 -0.0210 -0.2677 0.0254  27   GLY H CA  
1921 C  C   . GLY B 27  ? 1.0597 1.3806 1.5416 -0.0501 -0.2314 0.0218  27   GLY H C   
1922 O  O   . GLY B 27  ? 1.0530 1.3643 1.5233 -0.0511 -0.2036 0.0282  27   GLY H O   
1923 N  N   . THR B 28  ? 1.0211 1.3575 1.5210 -0.0752 -0.2318 0.0116  28   THR H N   
1924 C  CA  . THR B 28  ? 1.0222 1.3612 1.5287 -0.1062 -0.1971 0.0090  28   THR H CA  
1925 C  C   . THR B 28  ? 1.0654 1.3420 1.5120 -0.1198 -0.1914 0.0259  28   THR H C   
1926 O  O   . THR B 28  ? 1.0706 1.3351 1.5076 -0.1305 -0.2078 0.0222  28   THR H O   
1927 C  CB  . THR B 28  ? 1.1755 1.5760 1.7495 -0.1252 -0.1955 -0.0159 28   THR H CB  
1928 O  OG1 . THR B 28  ? 1.2141 1.6193 1.7932 -0.1299 -0.2268 -0.0239 28   THR H OG1 
1929 C  CG2 . THR B 28  ? 1.1524 1.6152 1.7901 -0.1066 -0.1988 -0.0335 28   THR H CG2 
1930 N  N   . PHE B 29  ? 1.0052 1.2411 1.4099 -0.1148 -0.1714 0.0441  29   PHE H N   
1931 C  CA  . PHE B 29  ? 0.9980 1.1708 1.3449 -0.1186 -0.1637 0.0631  29   PHE H CA  
1932 C  C   . PHE B 29  ? 1.0296 1.1786 1.3671 -0.1488 -0.1508 0.0628  29   PHE H C   
1933 O  O   . PHE B 29  ? 1.0272 1.1246 1.3234 -0.1532 -0.1407 0.0774  29   PHE H O   
1934 C  CB  . PHE B 29  ? 1.0137 1.1643 1.3335 -0.1083 -0.1439 0.0783  29   PHE H CB  
1935 C  CG  . PHE B 29  ? 1.0476 1.1839 1.3555 -0.1289 -0.1121 0.0861  29   PHE H CG  
1936 C  CD1 . PHE B 29  ? 1.0952 1.2593 1.4350 -0.1557 -0.0941 0.0747  29   PHE H CD1 
1937 C  CD2 . PHE B 29  ? 1.0723 1.1681 1.3368 -0.1217 -0.1006 0.1046  29   PHE H CD2 
1938 C  CE1 . PHE B 29  ? 1.1284 1.2715 1.4488 -0.1765 -0.0640 0.0843  29   PHE H CE1 
1939 C  CE2 . PHE B 29  ? 1.1292 1.2069 1.3753 -0.1399 -0.0742 0.1142  29   PHE H CE2 
1940 C  CZ  . PHE B 29  ? 1.1258 1.2242 1.3968 -0.1676 -0.0552 0.1051  29   PHE H CZ  
1941 N  N   . SER B 30  ? 0.9724 1.1587 1.3509 -0.1683 -0.1536 0.0445  30   SER H N   
1942 C  CA  . SER B 30  ? 0.9873 1.1560 1.3641 -0.1984 -0.1442 0.0392  30   SER H CA  
1943 C  C   . SER B 30  ? 0.9988 1.1280 1.3403 -0.1962 -0.1645 0.0411  30   SER H C   
1944 O  O   . SER B 30  ? 1.0068 1.0932 1.3233 -0.2131 -0.1518 0.0460  30   SER H O   
1945 C  CB  . SER B 30  ? 1.0542 1.2821 1.4912 -0.2184 -0.1459 0.0148  30   SER H CB  
1946 O  OG  . SER B 30  ? 1.1744 1.4404 1.6372 -0.2018 -0.1812 0.0010  30   SER H OG  
1947 N  N   . SER B 31  ? 0.9152 1.0558 1.2528 -0.1762 -0.1948 0.0370  31   SER H N   
1948 C  CA  . SER B 31  ? 0.9125 1.0183 1.2136 -0.1765 -0.2131 0.0363  31   SER H CA  
1949 C  C   . SER B 31  ? 0.9310 0.9871 1.1807 -0.1558 -0.2143 0.0540  31   SER H C   
1950 O  O   . SER B 31  ? 0.9356 0.9667 1.1540 -0.1537 -0.2300 0.0521  31   SER H O   
1951 C  CB  . SER B 31  ? 0.9520 1.0969 1.2743 -0.1719 -0.2471 0.0202  31   SER H CB  
1952 O  OG  . SER B 31  ? 1.0094 1.1852 1.3498 -0.1447 -0.2625 0.0231  31   SER H OG  
1953 N  N   . TYR B 32  ? 0.8602 0.9013 1.0999 -0.1433 -0.1963 0.0695  32   TYR H N   
1954 C  CA  . TYR B 32  ? 0.8416 0.8440 1.0421 -0.1230 -0.1963 0.0845  32   TYR H CA  
1955 C  C   . TYR B 32  ? 0.8139 0.7753 0.9924 -0.1254 -0.1721 0.0991  32   TYR H C   
1956 O  O   . TYR B 32  ? 0.8113 0.7696 0.9999 -0.1418 -0.1534 0.1014  32   TYR H O   
1957 C  CB  . TYR B 32  ? 0.8565 0.8850 1.0671 -0.0977 -0.2071 0.0881  32   TYR H CB  
1958 C  CG  . TYR B 32  ? 0.9139 0.9668 1.1335 -0.0869 -0.2368 0.0789  32   TYR H CG  
1959 C  CD1 . TYR B 32  ? 0.9538 0.9760 1.1348 -0.0748 -0.2537 0.0838  32   TYR H CD1 
1960 C  CD2 . TYR B 32  ? 0.9300 1.0361 1.1968 -0.0887 -0.2483 0.0652  32   TYR H CD2 
1961 C  CE1 . TYR B 32  ? 0.9812 1.0193 1.1631 -0.0635 -0.2834 0.0787  32   TYR H CE1 
1962 C  CE2 . TYR B 32  ? 0.9518 1.0791 1.2275 -0.0756 -0.2804 0.0580  32   TYR H CE2 
1963 C  CZ  . TYR B 32  ? 1.0370 1.1273 1.2663 -0.0629 -0.2989 0.0662  32   TYR H CZ  
1964 O  OH  . TYR B 32  ? 1.0015 1.1060 1.2320 -0.0502 -0.3328 0.0617  32   TYR H OH  
1965 N  N   . THR B 33  ? 0.7031 0.6320 0.8512 -0.1087 -0.1740 0.1088  33   THR H N   
1966 C  CA  . THR B 33  ? 0.6687 0.5613 0.7973 -0.1039 -0.1583 0.1224  33   THR H CA  
1967 C  C   . THR B 33  ? 0.6619 0.5627 0.7853 -0.0814 -0.1604 0.1313  33   THR H C   
1968 O  O   . THR B 33  ? 0.6501 0.5661 0.7735 -0.0674 -0.1746 0.1277  33   THR H O   
1969 C  CB  . THR B 33  ? 0.6742 0.5218 0.7790 -0.1077 -0.1562 0.1214  33   THR H CB  
1970 O  OG1 . THR B 33  ? 0.5780 0.3996 0.6651 -0.0907 -0.1527 0.1311  33   THR H OG1 
1971 C  CG2 . THR B 33  ? 0.6874 0.5351 0.7827 -0.1129 -0.1706 0.1079  33   THR H CG2 
1972 N  N   . ILE B 34  ? 0.5932 0.4825 0.7108 -0.0787 -0.1469 0.1427  34   ILE H N   
1973 C  CA  . ILE B 34  ? 0.5636 0.4576 0.6738 -0.0597 -0.1471 0.1503  34   ILE H CA  
1974 C  C   . ILE B 34  ? 0.6082 0.4616 0.6958 -0.0521 -0.1439 0.1599  34   ILE H C   
1975 O  O   . ILE B 34  ? 0.6153 0.4436 0.6965 -0.0614 -0.1348 0.1668  34   ILE H O   
1976 C  CB  . ILE B 34  ? 0.5968 0.5175 0.7190 -0.0634 -0.1353 0.1532  34   ILE H CB  
1977 C  CG1 . ILE B 34  ? 0.5830 0.5513 0.7356 -0.0612 -0.1422 0.1401  34   ILE H CG1 
1978 C  CG2 . ILE B 34  ? 0.5935 0.5060 0.6982 -0.0476 -0.1323 0.1628  34   ILE H CG2 
1979 C  CD1 . ILE B 34  ? 0.7169 0.7110 0.8984 -0.0819 -0.1413 0.1282  34   ILE H CD1 
1980 N  N   . SER B 35  ? 0.5450 0.3918 0.6232 -0.0354 -0.1516 0.1595  35   SER H N   
1981 C  CA  . SER B 35  ? 0.5376 0.3537 0.6027 -0.0262 -0.1504 0.1644  35   SER H CA  
1982 C  C   . SER B 35  ? 0.5986 0.4207 0.6586 -0.0106 -0.1513 0.1709  35   SER H C   
1983 O  O   . SER B 35  ? 0.5962 0.4438 0.6603 -0.0040 -0.1542 0.1684  35   SER H O   
1984 C  CB  . SER B 35  ? 0.5285 0.3304 0.5871 -0.0238 -0.1559 0.1552  35   SER H CB  
1985 O  OG  . SER B 35  ? 0.4980 0.2905 0.5565 -0.0394 -0.1549 0.1479  35   SER H OG  
1986 N  N   . TRP B 36  ? 0.5684 0.3676 0.6214 -0.0043 -0.1501 0.1776  36   TRP H N   
1987 C  CA  . TRP B 36  ? 0.5731 0.3767 0.6198 0.0095  -0.1533 0.1824  36   TRP H CA  
1988 C  C   . TRP B 36  ? 0.6239 0.4123 0.6740 0.0202  -0.1580 0.1765  36   TRP H C   
1989 O  O   . TRP B 36  ? 0.6417 0.4072 0.6966 0.0185  -0.1565 0.1752  36   TRP H O   
1990 C  CB  . TRP B 36  ? 0.5907 0.3841 0.6249 0.0071  -0.1500 0.1963  36   TRP H CB  
1991 C  CG  . TRP B 36  ? 0.6097 0.4235 0.6397 -0.0044 -0.1413 0.1996  36   TRP H CG  
1992 C  CD1 . TRP B 36  ? 0.6612 0.4723 0.6935 -0.0220 -0.1320 0.2023  36   TRP H CD1 
1993 C  CD2 . TRP B 36  ? 0.5982 0.4411 0.6263 -0.0004 -0.1388 0.1965  36   TRP H CD2 
1994 N  NE1 . TRP B 36  ? 0.6562 0.4949 0.6894 -0.0298 -0.1229 0.2012  36   TRP H NE1 
1995 C  CE2 . TRP B 36  ? 0.6617 0.5203 0.6924 -0.0161 -0.1267 0.1972  36   TRP H CE2 
1996 C  CE3 . TRP B 36  ? 0.5977 0.4544 0.6233 0.0140  -0.1442 0.1914  36   TRP H CE3 
1997 C  CZ2 . TRP B 36  ? 0.6550 0.5443 0.6875 -0.0168 -0.1187 0.1922  36   TRP H CZ2 
1998 C  CZ3 . TRP B 36  ? 0.6156 0.4997 0.6408 0.0138  -0.1375 0.1869  36   TRP H CZ3 
1999 C  CH2 . TRP B 36  ? 0.6382 0.5393 0.6677 -0.0009 -0.1245 0.1868  36   TRP H CH2 
2000 N  N   . VAL B 37  ? 0.5566 0.3580 0.6070 0.0301  -0.1619 0.1706  37   VAL H N   
2001 C  CA  . VAL B 37  ? 0.5415 0.3330 0.5971 0.0381  -0.1637 0.1623  37   VAL H CA  
2002 C  C   . VAL B 37  ? 0.5768 0.3799 0.6318 0.0499  -0.1687 0.1627  37   VAL H C   
2003 O  O   . VAL B 37  ? 0.5582 0.3791 0.6072 0.0521  -0.1695 0.1634  37   VAL H O   
2004 C  CB  . VAL B 37  ? 0.5797 0.3697 0.6320 0.0343  -0.1621 0.1526  37   VAL H CB  
2005 C  CG1 . VAL B 37  ? 0.5751 0.3547 0.6308 0.0393  -0.1598 0.1432  37   VAL H CG1 
2006 C  CG2 . VAL B 37  ? 0.5816 0.3603 0.6306 0.0214  -0.1589 0.1504  37   VAL H CG2 
2007 N  N   . ARG B 38  ? 0.5391 0.3341 0.6028 0.0575  -0.1725 0.1604  38   ARG H N   
2008 C  CA  . ARG B 38  ? 0.5311 0.3388 0.5937 0.0673  -0.1791 0.1585  38   ARG H CA  
2009 C  C   . ARG B 38  ? 0.6069 0.4151 0.6831 0.0714  -0.1783 0.1445  38   ARG H C   
2010 O  O   . ARG B 38  ? 0.6200 0.4162 0.7079 0.0676  -0.1725 0.1369  38   ARG H O   
2011 C  CB  . ARG B 38  ? 0.5211 0.3246 0.5791 0.0735  -0.1885 0.1683  38   ARG H CB  
2012 C  CG  . ARG B 38  ? 0.5955 0.3843 0.6734 0.0799  -0.1945 0.1659  38   ARG H CG  
2013 C  CD  . ARG B 38  ? 0.7347 0.5208 0.8044 0.0893  -0.2094 0.1762  38   ARG H CD  
2014 N  NE  . ARG B 38  ? 0.8677 0.6429 0.9632 0.0994  -0.2191 0.1727  38   ARG H NE  
2015 C  CZ  . ARG B 38  ? 1.0265 0.7912 1.1175 0.1097  -0.2359 0.1839  38   ARG H CZ  
2016 N  NH1 . ARG B 38  ? 0.9135 0.6743 0.9678 0.1085  -0.2428 0.2002  38   ARG H NH1 
2017 N  NH2 . ARG B 38  ? 0.7597 0.5169 0.8823 0.1212  -0.2462 0.1785  38   ARG H NH2 
2018 N  N   . GLN B 39  ? 0.5697 0.3912 0.6440 0.0774  -0.1823 0.1395  39   GLN H N   
2019 C  CA  . GLN B 39  ? 0.5623 0.3847 0.6497 0.0794  -0.1804 0.1252  39   GLN H CA  
2020 C  C   . GLN B 39  ? 0.6666 0.5031 0.7582 0.0875  -0.1904 0.1206  39   GLN H C   
2021 O  O   . GLN B 39  ? 0.6583 0.5055 0.7352 0.0896  -0.1924 0.1213  39   GLN H O   
2022 C  CB  . GLN B 39  ? 0.5657 0.3851 0.6428 0.0751  -0.1729 0.1208  39   GLN H CB  
2023 C  CG  . GLN B 39  ? 0.6892 0.5034 0.7744 0.0741  -0.1679 0.1070  39   GLN H CG  
2024 C  CD  . GLN B 39  ? 0.7784 0.5780 0.8481 0.0691  -0.1611 0.1066  39   GLN H CD  
2025 O  OE1 . GLN B 39  ? 0.8465 0.6507 0.9044 0.0727  -0.1644 0.1118  39   GLN H OE1 
2026 N  NE2 . GLN B 39  ? 0.3968 0.1776 0.4658 0.0608  -0.1516 0.0999  39   GLN H NE2 
2027 N  N   . ALA B 40  ? 0.6733 0.5112 0.7871 0.0922  -0.1971 0.1140  40   ALA H N   
2028 C  CA  . ALA B 40  ? 0.7005 0.5534 0.8220 0.0997  -0.2101 0.1069  40   ALA H CA  
2029 C  C   . ALA B 40  ? 0.8366 0.6963 0.9642 0.0960  -0.2030 0.0904  40   ALA H C   
2030 O  O   . ALA B 40  ? 0.8214 0.6699 0.9541 0.0886  -0.1889 0.0841  40   ALA H O   
2031 C  CB  . ALA B 40  ? 0.7126 0.5672 0.8643 0.1067  -0.2204 0.1021  40   ALA H CB  
2032 N  N   . PRO B 41  ? 0.8763 0.7503 0.9987 0.0999  -0.2118 0.0837  41   PRO H N   
2033 C  CA  . PRO B 41  ? 0.8929 0.7688 1.0172 0.0955  -0.2038 0.0686  41   PRO H CA  
2034 C  C   . PRO B 41  ? 0.9980 0.8613 1.1411 0.0867  -0.1884 0.0561  41   PRO H C   
2035 O  O   . PRO B 41  ? 1.0076 0.8547 1.1340 0.0819  -0.1769 0.0598  41   PRO H O   
2036 C  CB  . PRO B 41  ? 0.9257 0.8203 1.0544 0.1004  -0.2189 0.0585  41   PRO H CB  
2037 C  CG  . PRO B 41  ? 0.9976 0.8952 1.0987 0.1064  -0.2307 0.0761  41   PRO H CG  
2038 C  CD  . PRO B 41  ? 0.9320 0.8171 1.0383 0.1071  -0.2290 0.0906  41   PRO H CD  
2039 N  N   . GLY B 42  ? 0.9760 0.8456 1.1510 0.0838  -0.1875 0.0409  42   GLY H N   
2040 C  CA  . GLY B 42  ? 0.9847 0.8388 1.1704 0.0717  -0.1683 0.0289  42   GLY H CA  
2041 C  C   . GLY B 42  ? 1.0513 0.8892 1.2386 0.0659  -0.1562 0.0341  42   GLY H C   
2042 O  O   . GLY B 42  ? 1.0678 0.8869 1.2528 0.0536  -0.1381 0.0269  42   GLY H O   
2043 N  N   . GLN B 43  ? 0.9924 0.8337 1.1782 0.0733  -0.1654 0.0471  43   GLN H N   
2044 C  CA  . GLN B 43  ? 0.9832 0.8120 1.1736 0.0697  -0.1571 0.0509  43   GLN H CA  
2045 C  C   . GLN B 43  ? 0.9848 0.7903 1.1416 0.0618  -0.1465 0.0627  43   GLN H C   
2046 O  O   . GLN B 43  ? 0.9650 0.7637 1.0951 0.0608  -0.1466 0.0700  43   GLN H O   
2047 C  CB  . GLN B 43  ? 1.0044 0.8429 1.2051 0.0816  -0.1735 0.0610  43   GLN H CB  
2048 C  CG  . GLN B 43  ? 1.2265 1.0861 1.4642 0.0916  -0.1883 0.0501  43   GLN H CG  
2049 C  CD  . GLN B 43  ? 1.4201 1.2767 1.6816 0.0992  -0.1942 0.0530  43   GLN H CD  
2050 O  OE1 . GLN B 43  ? 1.3423 1.1807 1.5974 0.0939  -0.1822 0.0579  43   GLN H OE1 
2051 N  NE2 . GLN B 43  ? 1.2751 1.1483 1.5653 0.1125  -0.2142 0.0490  43   GLN H NE2 
2052 N  N   . GLY B 44  ? 0.9216 0.7164 1.0834 0.0571  -0.1389 0.0629  44   GLY H N   
2053 C  CA  . GLY B 44  ? 0.9194 0.6940 1.0526 0.0490  -0.1313 0.0721  44   GLY H CA  
2054 C  C   . GLY B 44  ? 0.9382 0.7161 1.0594 0.0550  -0.1429 0.0888  44   GLY H C   
2055 O  O   . GLY B 44  ? 0.9253 0.7182 1.0494 0.0649  -0.1561 0.0967  44   GLY H O   
2056 N  N   . LEU B 45  ? 0.8644 0.6271 0.9695 0.0470  -0.1370 0.0935  45   LEU H N   
2057 C  CA  . LEU B 45  ? 0.8378 0.6014 0.9303 0.0480  -0.1445 0.1076  45   LEU H CA  
2058 C  C   . LEU B 45  ? 0.8487 0.6059 0.9573 0.0481  -0.1438 0.1081  45   LEU H C   
2059 O  O   . LEU B 45  ? 0.8532 0.6000 0.9766 0.0435  -0.1334 0.0958  45   LEU H O   
2060 C  CB  . LEU B 45  ? 0.8438 0.5964 0.9076 0.0389  -0.1418 0.1118  45   LEU H CB  
2061 C  CG  . LEU B 45  ? 0.9045 0.6576 0.9518 0.0410  -0.1443 0.1128  45   LEU H CG  
2062 C  CD1 . LEU B 45  ? 0.9222 0.6572 0.9415 0.0322  -0.1427 0.1149  45   LEU H CD1 
2063 C  CD2 . LEU B 45  ? 0.9326 0.7065 0.9813 0.0511  -0.1553 0.1214  45   LEU H CD2 
2064 N  N   . GLU B 46  ? 0.7657 0.5275 0.8717 0.0528  -0.1534 0.1215  46   GLU H N   
2065 C  CA  . GLU B 46  ? 0.7529 0.5033 0.8713 0.0542  -0.1548 0.1253  46   GLU H CA  
2066 C  C   . GLU B 46  ? 0.7741 0.5199 0.8739 0.0475  -0.1567 0.1390  46   GLU H C   
2067 O  O   . GLU B 46  ? 0.7952 0.5526 0.8829 0.0502  -0.1635 0.1504  46   GLU H O   
2068 C  CB  . GLU B 46  ? 0.7675 0.5249 0.9051 0.0685  -0.1670 0.1282  46   GLU H CB  
2069 C  CG  . GLU B 46  ? 0.8846 0.6258 1.0337 0.0737  -0.1725 0.1356  46   GLU H CG  
2070 C  CD  . GLU B 46  ? 1.0174 0.7639 1.1860 0.0901  -0.1887 0.1377  46   GLU H CD  
2071 O  OE1 . GLU B 46  ? 1.0696 0.8297 1.2231 0.0955  -0.2002 0.1459  46   GLU H OE1 
2072 O  OE2 . GLU B 46  ? 0.6757 0.4133 0.8752 0.0979  -0.1908 0.1301  46   GLU H OE2 
2073 N  N   . TRP B 47  ? 0.6750 0.4045 0.7734 0.0372  -0.1489 0.1357  47   TRP H N   
2074 C  CA  . TRP B 47  ? 0.6541 0.3795 0.7393 0.0278  -0.1491 0.1454  47   TRP H CA  
2075 C  C   . TRP B 47  ? 0.6905 0.4039 0.7819 0.0328  -0.1540 0.1574  47   TRP H C   
2076 O  O   . TRP B 47  ? 0.7262 0.4237 0.8358 0.0398  -0.1544 0.1537  47   TRP H O   
2077 C  CB  . TRP B 47  ? 0.6412 0.3518 0.7218 0.0138  -0.1398 0.1350  47   TRP H CB  
2078 C  CG  . TRP B 47  ? 0.6645 0.3708 0.7364 0.0015  -0.1392 0.1409  47   TRP H CG  
2079 C  CD1 . TRP B 47  ? 0.7030 0.4256 0.7620 -0.0069 -0.1427 0.1440  47   TRP H CD1 
2080 C  CD2 . TRP B 47  ? 0.6827 0.3664 0.7619 -0.0051 -0.1343 0.1411  47   TRP H CD2 
2081 N  NE1 . TRP B 47  ? 0.7184 0.4331 0.7773 -0.0200 -0.1397 0.1455  47   TRP H NE1 
2082 C  CE2 . TRP B 47  ? 0.7472 0.4353 0.8161 -0.0198 -0.1338 0.1442  47   TRP H CE2 
2083 C  CE3 . TRP B 47  ? 0.7151 0.3750 0.8120 0.0009  -0.1308 0.1383  47   TRP H CE3 
2084 C  CZ2 . TRP B 47  ? 0.7623 0.4293 0.8347 -0.0312 -0.1282 0.1445  47   TRP H CZ2 
2085 C  CZ3 . TRP B 47  ? 0.7653 0.4013 0.8650 -0.0081 -0.1260 0.1396  47   TRP H CZ3 
2086 C  CH2 . TRP B 47  ? 0.7819 0.4203 0.8677 -0.0250 -0.1241 0.1433  47   TRP H CH2 
2087 N  N   . MET B 48  ? 0.6025 0.3220 0.6792 0.0295  -0.1574 0.1715  48   MET H N   
2088 C  CA  . MET B 48  ? 0.6100 0.3121 0.6824 0.0322  -0.1617 0.1865  48   MET H CA  
2089 C  C   . MET B 48  ? 0.6796 0.3616 0.7476 0.0170  -0.1538 0.1908  48   MET H C   
2090 O  O   . MET B 48  ? 0.6860 0.3389 0.7564 0.0188  -0.1550 0.1986  48   MET H O   
2091 C  CB  . MET B 48  ? 0.6333 0.3509 0.6872 0.0362  -0.1678 0.1990  48   MET H CB  
2092 C  CG  . MET B 48  ? 0.6524 0.3879 0.7108 0.0504  -0.1764 0.1934  48   MET H CG  
2093 S  SD  . MET B 48  ? 0.7023 0.4563 0.7350 0.0528  -0.1813 0.2042  48   MET H SD  
2094 C  CE  . MET B 48  ? 0.6351 0.4159 0.6680 0.0445  -0.1718 0.1948  48   MET H CE  
2095 N  N   . GLY B 49  ? 0.6322 0.3284 0.6954 0.0027  -0.1471 0.1848  49   GLY H N   
2096 C  CA  . GLY B 49  ? 0.6511 0.3339 0.7125 -0.0149 -0.1393 0.1853  49   GLY H CA  
2097 C  C   . GLY B 49  ? 0.6805 0.3920 0.7379 -0.0281 -0.1368 0.1813  49   GLY H C   
2098 O  O   . GLY B 49  ? 0.6529 0.3911 0.7096 -0.0216 -0.1415 0.1769  49   GLY H O   
2099 N  N   . TRP B 50  ? 0.6378 0.3445 0.6953 -0.0464 -0.1297 0.1826  50   TRP H N   
2100 C  CA  . TRP B 50  ? 0.6170 0.3547 0.6792 -0.0602 -0.1282 0.1762  50   TRP H CA  
2101 C  C   . TRP B 50  ? 0.7216 0.4554 0.7849 -0.0794 -0.1182 0.1818  50   TRP H C   
2102 O  O   . TRP B 50  ? 0.7628 0.4610 0.8202 -0.0846 -0.1121 0.1898  50   TRP H O   
2103 C  CB  . TRP B 50  ? 0.5876 0.3305 0.6546 -0.0674 -0.1320 0.1594  50   TRP H CB  
2104 C  CG  . TRP B 50  ? 0.6178 0.3281 0.6851 -0.0790 -0.1262 0.1514  50   TRP H CG  
2105 C  CD1 . TRP B 50  ? 0.6549 0.3452 0.7188 -0.0744 -0.1260 0.1411  50   TRP H CD1 
2106 C  CD2 . TRP B 50  ? 0.6399 0.3370 0.7123 -0.0997 -0.1184 0.1486  50   TRP H CD2 
2107 N  NE1 . TRP B 50  ? 0.6677 0.3320 0.7338 -0.0891 -0.1185 0.1320  50   TRP H NE1 
2108 C  CE2 . TRP B 50  ? 0.7022 0.3694 0.7733 -0.1049 -0.1146 0.1366  50   TRP H CE2 
2109 C  CE3 . TRP B 50  ? 0.6647 0.3727 0.7435 -0.1164 -0.1121 0.1531  50   TRP H CE3 
2110 C  CZ2 . TRP B 50  ? 0.7209 0.3658 0.7963 -0.1248 -0.1062 0.1297  50   TRP H CZ2 
2111 C  CZ3 . TRP B 50  ? 0.7051 0.3905 0.7883 -0.1370 -0.1032 0.1475  50   TRP H CZ3 
2112 C  CH2 . TRP B 50  ? 0.7280 0.3814 0.8093 -0.1406 -0.1012 0.1361  50   TRP H CH2 
2113 N  N   . ILE B 51  ? 0.6859 0.4553 0.7603 -0.0911 -0.1162 0.1756  51   ILE H N   
2114 C  CA  . ILE B 51  ? 0.7140 0.4875 0.7958 -0.1141 -0.1041 0.1760  51   ILE H CA  
2115 C  C   . ILE B 51  ? 0.7869 0.5978 0.8920 -0.1272 -0.1082 0.1581  51   ILE H C   
2116 O  O   . ILE B 51  ? 0.7777 0.6222 0.8918 -0.1155 -0.1196 0.1509  51   ILE H O   
2117 C  CB  . ILE B 51  ? 0.7609 0.5434 0.8338 -0.1169 -0.0932 0.1891  51   ILE H CB  
2118 C  CG1 . ILE B 51  ? 0.8114 0.5876 0.8883 -0.1448 -0.0760 0.1905  51   ILE H CG1 
2119 C  CG2 . ILE B 51  ? 0.7244 0.5549 0.8082 -0.1065 -0.0972 0.1830  51   ILE H CG2 
2120 C  CD1 . ILE B 51  ? 0.9841 0.7575 1.0430 -0.1533 -0.0603 0.2048  51   ILE H CD1 
2121 N  N   . LYS B 52  ? 0.7569 0.5618 0.8726 -0.1513 -0.0999 0.1512  52   LYS H N   
2122 C  CA  . LYS B 52  ? 0.7416 0.5860 0.8838 -0.1666 -0.1045 0.1333  52   LYS H CA  
2123 C  C   . LYS B 52  ? 0.8084 0.6730 0.9661 -0.1852 -0.0872 0.1355  52   LYS H C   
2124 O  O   . LYS B 52  ? 0.8228 0.6594 0.9763 -0.2060 -0.0716 0.1394  52   LYS H O   
2125 C  CB  . LYS B 52  ? 0.7811 0.6057 0.9244 -0.1823 -0.1080 0.1199  52   LYS H CB  
2126 C  CG  . LYS B 52  ? 0.8311 0.6274 0.9533 -0.1669 -0.1185 0.1179  52   LYS H CG  
2127 C  CD  . LYS B 52  ? 0.7976 0.5988 0.9209 -0.1784 -0.1297 0.0983  52   LYS H CD  
2128 C  CE  . LYS B 52  ? 0.6552 0.4400 0.7552 -0.1633 -0.1405 0.0944  52   LYS H CE  
2129 N  NZ  . LYS B 52  ? 0.6115 0.3502 0.6961 -0.1545 -0.1294 0.1014  52   LYS H NZ  
2130 N  N   . PRO B 53  ? 0.7747 0.6831 0.9479 -0.1776 -0.0869 0.1338  53   PRO H N   
2131 C  CA  . PRO B 53  ? 0.8031 0.7307 0.9888 -0.1961 -0.0657 0.1349  53   PRO H CA  
2132 C  C   . PRO B 53  ? 0.9304 0.8728 1.1441 -0.2275 -0.0544 0.1209  53   PRO H C   
2133 O  O   . PRO B 53  ? 0.9690 0.9024 1.1793 -0.2482 -0.0309 0.1269  53   PRO H O   
2134 C  CB  . PRO B 53  ? 0.7931 0.7725 0.9998 -0.1806 -0.0707 0.1278  53   PRO H CB  
2135 C  CG  . PRO B 53  ? 0.8226 0.7881 1.0088 -0.1509 -0.0898 0.1344  53   PRO H CG  
2136 C  CD  . PRO B 53  ? 0.7641 0.7026 0.9425 -0.1523 -0.1034 0.1306  53   PRO H CD  
2137 N  N   . ARG B 54  ? 0.9127 0.8742 1.1501 -0.2331 -0.0704 0.1026  54   ARG H N   
2138 C  CA  . ARG B 54  ? 0.9487 0.9276 1.2169 -0.2645 -0.0623 0.0856  54   ARG H CA  
2139 C  C   . ARG B 54  ? 1.0817 1.0032 1.3266 -0.2876 -0.0418 0.0955  54   ARG H C   
2140 O  O   . ARG B 54  ? 1.1114 1.0400 1.3743 -0.3170 -0.0213 0.0896  54   ARG H O   
2141 C  CB  . ARG B 54  ? 0.9220 0.9263 1.2116 -0.2648 -0.0875 0.0648  54   ARG H CB  
2142 C  CG  . ARG B 54  ? 1.0197 1.0676 1.3564 -0.2941 -0.0840 0.0415  54   ARG H CG  
2143 C  CD  . ARG B 54  ? 1.0554 1.1617 1.4273 -0.2831 -0.1144 0.0212  54   ARG H CD  
2144 N  NE  . ARG B 54  ? 1.0685 1.1689 1.4387 -0.2937 -0.1346 0.0056  54   ARG H NE  
2145 C  CZ  . ARG B 54  ? 1.0389 1.1041 1.3698 -0.2791 -0.1529 0.0100  54   ARG H CZ  
2146 N  NH1 . ARG B 54  ? 0.8860 0.9172 1.1793 -0.2538 -0.1528 0.0298  54   ARG H NH1 
2147 N  NH2 . ARG B 54  ? 0.6206 0.6831 0.9486 -0.2923 -0.1694 -0.0067 54   ARG H NH2 
2148 N  N   . TRP B 55  ? 1.0576 0.9214 1.2652 -0.2751 -0.0461 0.1097  55   TRP H N   
2149 C  CA  . TRP B 55  ? 1.1075 0.9146 1.2959 -0.2953 -0.0269 0.1198  55   TRP H CA  
2150 C  C   . TRP B 55  ? 1.1577 0.9130 1.3053 -0.2796 -0.0200 0.1472  55   TRP H C   
2151 O  O   . TRP B 55  ? 1.2028 0.9032 1.3301 -0.2923 -0.0066 0.1594  55   TRP H O   
2152 C  CB  . TRP B 55  ? 1.1199 0.9009 1.3120 -0.3086 -0.0323 0.1056  55   TRP H CB  
2153 C  CG  . TRP B 55  ? 1.1548 0.9731 1.3843 -0.3411 -0.0245 0.0841  55   TRP H CG  
2154 C  CD1 . TRP B 55  ? 1.2274 1.0422 1.4670 -0.3702 0.0012  0.0860  55   TRP H CD1 
2155 C  CD2 . TRP B 55  ? 1.1315 1.0092 1.3969 -0.3450 -0.0432 0.0584  55   TRP H CD2 
2156 N  NE1 . TRP B 55  ? 1.2177 1.0870 1.5029 -0.3939 0.0011  0.0601  55   TRP H NE1 
2157 C  CE2 . TRP B 55  ? 1.1997 1.1088 1.5020 -0.3779 -0.0282 0.0428  55   TRP H CE2 
2158 C  CE3 . TRP B 55  ? 1.1203 1.0234 1.3878 -0.3253 -0.0719 0.0469  55   TRP H CE3 
2159 C  CZ2 . TRP B 55  ? 1.1786 1.1477 1.5251 -0.3897 -0.0439 0.0148  55   TRP H CZ2 
2160 C  CZ3 . TRP B 55  ? 1.1327 1.0894 1.4361 -0.3367 -0.0885 0.0220  55   TRP H CZ3 
2161 C  CH2 . TRP B 55  ? 1.1554 1.1481 1.5010 -0.3671 -0.0761 0.0057  55   TRP H CH2 
2162 N  N   . GLY B 56  ? 1.0744 0.8491 1.2117 -0.2548 -0.0278 0.1568  56   GLY H N   
2163 C  CA  . GLY B 56  ? 1.0808 0.8157 1.1804 -0.2392 -0.0241 0.1819  56   GLY H CA  
2164 C  C   . GLY B 56  ? 1.1170 0.7988 1.1943 -0.2205 -0.0354 0.1924  56   GLY H C   
2165 O  O   . GLY B 56  ? 1.1429 0.7874 1.1903 -0.2087 -0.0344 0.2136  56   GLY H O   
2166 N  N   . ALA B 57  ? 1.0390 0.7179 1.1303 -0.2174 -0.0469 0.1766  57   ALA H N   
2167 C  CA  . ALA B 57  ? 1.0379 0.6714 1.1158 -0.2001 -0.0554 0.1811  57   ALA H CA  
2168 C  C   . ALA B 57  ? 1.0339 0.6819 1.1043 -0.1689 -0.0708 0.1857  57   ALA H C   
2169 O  O   . ALA B 57  ? 0.9808 0.6740 1.0626 -0.1614 -0.0801 0.1750  57   ALA H O   
2170 C  CB  . ALA B 57  ? 1.0495 0.6752 1.1422 -0.2112 -0.0582 0.1599  57   ALA H CB  
2171 N  N   . ALA B 58  ? 1.0048 0.6138 1.0573 -0.1509 -0.0741 0.2017  58   ALA H N   
2172 C  CA  . ALA B 58  ? 0.9630 0.5807 1.0100 -0.1227 -0.0876 0.2059  58   ALA H CA  
2173 C  C   . ALA B 58  ? 1.0035 0.5852 1.0542 -0.1085 -0.0936 0.2025  58   ALA H C   
2174 O  O   . ALA B 58  ? 1.0456 0.5836 1.0956 -0.1152 -0.0877 0.2057  58   ALA H O   
2175 C  CB  . ALA B 58  ? 0.9860 0.5965 1.0106 -0.1133 -0.0878 0.2275  58   ALA H CB  
2176 N  N   . HIS B 59  ? 0.9141 0.5123 0.9697 -0.0883 -0.1040 0.1961  59   HIS H N   
2177 C  CA  . HIS B 59  ? 0.9156 0.4890 0.9801 -0.0727 -0.1084 0.1896  59   HIS H CA  
2178 C  C   . HIS B 59  ? 0.9508 0.5398 1.0135 -0.0491 -0.1195 0.1961  59   HIS H C   
2179 O  O   . HIS B 59  ? 0.9204 0.5459 0.9781 -0.0467 -0.1232 0.1958  59   HIS H O   
2180 C  CB  . HIS B 59  ? 0.9097 0.4944 0.9844 -0.0802 -0.1061 0.1661  59   HIS H CB  
2181 C  CG  . HIS B 59  ? 0.9550 0.5158 1.0411 -0.0687 -0.1051 0.1543  59   HIS H CG  
2182 N  ND1 . HIS B 59  ? 1.0128 0.5302 1.1085 -0.0654 -0.1007 0.1565  59   HIS H ND1 
2183 C  CD2 . HIS B 59  ? 0.9519 0.5261 1.0423 -0.0606 -0.1064 0.1394  59   HIS H CD2 
2184 C  CE1 . HIS B 59  ? 1.0011 0.5117 1.1117 -0.0545 -0.0991 0.1408  59   HIS H CE1 
2185 N  NE2 . HIS B 59  ? 0.9696 0.5133 1.0757 -0.0529 -0.1010 0.1301  59   HIS H NE2 
2186 N  N   . TYR B 60  ? 0.9324 0.4946 1.0021 -0.0314 -0.1255 0.2007  60   TYR H N   
2187 C  CA  . TYR B 60  ? 0.9212 0.4976 0.9929 -0.0093 -0.1376 0.2054  60   TYR H CA  
2188 C  C   . TYR B 60  ? 0.9953 0.5641 1.0927 0.0057  -0.1402 0.1901  60   TYR H C   
2189 O  O   . TYR B 60  ? 1.0285 0.5697 1.1407 0.0027  -0.1336 0.1809  60   TYR H O   
2190 C  CB  . TYR B 60  ? 0.9611 0.5147 1.0160 0.0001  -0.1467 0.2290  60   TYR H CB  
2191 C  CG  . TYR B 60  ? 1.0005 0.5522 1.0270 -0.0166 -0.1403 0.2454  60   TYR H CG  
2192 C  CD1 . TYR B 60  ? 1.0087 0.5986 1.0218 -0.0209 -0.1388 0.2469  60   TYR H CD1 
2193 C  CD2 . TYR B 60  ? 1.0621 0.5715 1.0752 -0.0278 -0.1345 0.2594  60   TYR H CD2 
2194 C  CE1 . TYR B 60  ? 1.0595 0.6500 1.0489 -0.0374 -0.1295 0.2596  60   TYR H CE1 
2195 C  CE2 . TYR B 60  ? 1.1003 0.6065 1.0858 -0.0461 -0.1250 0.2740  60   TYR H CE2 
2196 C  CZ  . TYR B 60  ? 1.1583 0.7075 1.1331 -0.0514 -0.1216 0.2731  60   TYR H CZ  
2197 O  OH  . TYR B 60  ? 1.1641 0.7135 1.1153 -0.0714 -0.1084 0.2841  60   TYR H OH  
2198 N  N   . ALA B 61  ? 0.9189 0.5115 1.0239 0.0213  -0.1484 0.1862  61   ALA H N   
2199 C  CA  . ALA B 61  ? 0.9131 0.5031 1.0473 0.0363  -0.1504 0.1714  61   ALA H CA  
2200 C  C   . ALA B 61  ? 0.9790 0.5403 1.1241 0.0529  -0.1629 0.1846  61   ALA H C   
2201 O  O   . ALA B 61  ? 0.9927 0.5512 1.1165 0.0582  -0.1748 0.2052  61   ALA H O   
2202 C  CB  . ALA B 61  ? 0.8916 0.5155 1.0292 0.0458  -0.1559 0.1653  61   ALA H CB  
2203 N  N   . GLN B 62  ? 0.9306 0.4687 1.1066 0.0612  -0.1605 0.1727  62   GLN H N   
2204 C  CA  . GLN B 62  ? 0.9546 0.4606 1.1467 0.0804  -0.1750 0.1841  62   GLN H CA  
2205 C  C   . GLN B 62  ? 1.0000 0.5201 1.1895 0.1004  -0.1979 0.1981  62   GLN H C   
2206 O  O   . GLN B 62  ? 1.0196 0.5124 1.1923 0.1095  -0.2136 0.2207  62   GLN H O   
2207 C  CB  . GLN B 62  ? 0.9700 0.4627 1.2099 0.0917  -0.1697 0.1614  62   GLN H CB  
2208 C  CG  . GLN B 62  ? 0.9224 0.4057 1.1700 0.0734  -0.1459 0.1391  62   GLN H CG  
2209 C  CD  . GLN B 62  ? 0.9881 0.4269 1.2245 0.0636  -0.1408 0.1483  62   GLN H CD  
2210 O  OE1 . GLN B 62  ? 0.8725 0.3039 1.0728 0.0472  -0.1394 0.1653  62   GLN H OE1 
2211 N  NE2 . GLN B 62  ? 0.9476 0.3559 1.2180 0.0726  -0.1362 0.1351  62   GLN H NE2 
2212 N  N   . LYS B 63  ? 0.9315 0.4915 1.1344 0.1061  -0.2002 0.1847  63   LYS H N   
2213 C  CA  . LYS B 63  ? 0.9340 0.5114 1.1374 0.1241  -0.2225 0.1934  63   LYS H CA  
2214 C  C   . LYS B 63  ? 1.0339 0.6105 1.1860 0.1186  -0.2318 0.2191  63   LYS H C   
2215 O  O   . LYS B 63  ? 1.0560 0.6358 1.1984 0.1330  -0.2531 0.2309  63   LYS H O   
2216 C  CB  . LYS B 63  ? 0.8993 0.5178 1.1302 0.1280  -0.2197 0.1706  63   LYS H CB  
2217 C  CG  . LYS B 63  ? 0.7091 0.3551 0.9139 0.1110  -0.2064 0.1662  63   LYS H CG  
2218 C  CD  . LYS B 63  ? 0.6622 0.3427 0.8883 0.1176  -0.2092 0.1496  63   LYS H CD  
2219 C  CE  . LYS B 63  ? 0.8158 0.5111 1.0315 0.1307  -0.2319 0.1611  63   LYS H CE  
2220 N  NZ  . LYS B 63  ? 0.9226 0.6521 1.1559 0.1327  -0.2319 0.1435  63   LYS H NZ  
2221 N  N   . PHE B 64  ? 0.9905 0.5637 1.1110 0.0972  -0.2159 0.2260  64   PHE H N   
2222 C  CA  . PHE B 64  ? 0.9990 0.5725 1.0737 0.0881  -0.2181 0.2468  64   PHE H CA  
2223 C  C   . PHE B 64  ? 1.0960 0.6246 1.1439 0.0784  -0.2151 0.2680  64   PHE H C   
2224 O  O   . PHE B 64  ? 1.1030 0.6280 1.1113 0.0656  -0.2111 0.2844  64   PHE H O   
2225 C  CB  . PHE B 64  ? 0.9757 0.5841 1.0388 0.0714  -0.2025 0.2374  64   PHE H CB  
2226 C  CG  . PHE B 64  ? 0.9459 0.5917 1.0269 0.0790  -0.2048 0.2200  64   PHE H CG  
2227 C  CD1 . PHE B 64  ? 0.9788 0.6428 1.0496 0.0899  -0.2189 0.2240  64   PHE H CD1 
2228 C  CD2 . PHE B 64  ? 0.9400 0.5999 1.0437 0.0732  -0.1921 0.1994  64   PHE H CD2 
2229 C  CE1 . PHE B 64  ? 0.9541 0.6498 1.0420 0.0950  -0.2194 0.2069  64   PHE H CE1 
2230 C  CE2 . PHE B 64  ? 0.9474 0.6359 1.0637 0.0780  -0.1923 0.1846  64   PHE H CE2 
2231 C  CZ  . PHE B 64  ? 0.9176 0.6239 1.0283 0.0888  -0.2055 0.1880  64   PHE H CZ  
2232 N  N   . GLN B 65  ? 1.0843 0.5767 1.1540 0.0845  -0.2163 0.2671  65   GLN H N   
2233 C  CA  . GLN B 65  ? 1.1387 0.5810 1.1857 0.0754  -0.2128 0.2864  65   GLN H CA  
2234 C  C   . GLN B 65  ? 1.2280 0.6407 1.2358 0.0851  -0.2323 0.3157  65   GLN H C   
2235 O  O   . GLN B 65  ? 1.2333 0.6417 1.2522 0.1097  -0.2565 0.3198  65   GLN H O   
2236 C  CB  . GLN B 65  ? 1.1773 0.5861 1.2612 0.0815  -0.2093 0.2753  65   GLN H CB  
2237 C  CG  . GLN B 65  ? 1.3870 0.7571 1.4561 0.0592  -0.1914 0.2810  65   GLN H CG  
2238 C  CD  . GLN B 65  ? 1.6054 1.0057 1.6737 0.0330  -0.1687 0.2640  65   GLN H CD  
2239 O  OE1 . GLN B 65  ? 1.5317 0.9758 1.6169 0.0330  -0.1646 0.2443  65   GLN H OE1 
2240 N  NE2 . GLN B 65  ? 1.4773 0.8534 1.5256 0.0096  -0.1542 0.2714  65   GLN H NE2 
2241 N  N   . GLY B 66  ? 1.2074 0.6024 1.1688 0.0645  -0.2215 0.3345  66   GLY H N   
2242 C  CA  . GLY B 66  ? 1.2650 0.6264 1.1749 0.0672  -0.2354 0.3646  66   GLY H CA  
2243 C  C   . GLY B 66  ? 1.2829 0.6807 1.1598 0.0661  -0.2406 0.3689  66   GLY H C   
2244 O  O   . GLY B 66  ? 1.3264 0.7006 1.1486 0.0571  -0.2418 0.3920  66   GLY H O   
2245 N  N   . ARG B 67  ? 1.1601 0.6126 1.0675 0.0741  -0.2423 0.3461  67   ARG H N   
2246 C  CA  . ARG B 67  ? 1.1263 0.6165 1.0092 0.0739  -0.2461 0.3449  67   ARG H CA  
2247 C  C   . ARG B 67  ? 1.1359 0.6633 1.0158 0.0515  -0.2202 0.3325  67   ARG H C   
2248 O  O   . ARG B 67  ? 1.1405 0.6865 0.9875 0.0438  -0.2160 0.3367  67   ARG H O   
2249 C  CB  . ARG B 67  ? 1.0441 0.5676 0.9610 0.0970  -0.2659 0.3282  67   ARG H CB  
2250 C  CG  . ARG B 67  ? 1.0749 0.5722 0.9853 0.1207  -0.2980 0.3423  67   ARG H CG  
2251 C  CD  . ARG B 67  ? 0.9691 0.5025 0.9249 0.1419  -0.3160 0.3216  67   ARG H CD  
2252 N  NE  . ARG B 67  ? 0.9278 0.5063 0.8735 0.1374  -0.3133 0.3095  67   ARG H NE  
2253 C  CZ  . ARG B 67  ? 1.1016 0.7212 1.0870 0.1368  -0.3029 0.2836  67   ARG H CZ  
2254 N  NH1 . ARG B 67  ? 0.9313 0.5541 0.9657 0.1391  -0.2932 0.2667  67   ARG H NH1 
2255 N  NH2 . ARG B 67  ? 0.9473 0.6017 0.9212 0.1331  -0.3010 0.2739  67   ARG H NH2 
2256 N  N   . VAL B 68  ? 1.0530 0.5917 0.9674 0.0415  -0.2036 0.3161  68   VAL H N   
2257 C  CA  . VAL B 68  ? 1.0150 0.5903 0.9324 0.0227  -0.1829 0.3035  68   VAL H CA  
2258 C  C   . VAL B 68  ? 1.0757 0.6306 0.9766 -0.0024 -0.1631 0.3122  68   VAL H C   
2259 O  O   . VAL B 68  ? 1.0888 0.6058 0.9954 -0.0069 -0.1607 0.3178  68   VAL H O   
2260 C  CB  . VAL B 68  ? 1.0082 0.6190 0.9684 0.0261  -0.1786 0.2777  68   VAL H CB  
2261 C  CG1 . VAL B 68  ? 0.9776 0.6136 0.9531 0.0457  -0.1930 0.2668  68   VAL H CG1 
2262 C  CG2 . VAL B 68  ? 1.0038 0.5940 0.9923 0.0227  -0.1731 0.2689  68   VAL H CG2 
2263 N  N   . THR B 69  ? 1.0270 0.6085 0.9116 -0.0194 -0.1476 0.3108  69   THR H N   
2264 C  CA  . THR B 69  ? 1.0415 0.6157 0.9190 -0.0463 -0.1259 0.3135  69   THR H CA  
2265 C  C   . THR B 69  ? 1.0108 0.6392 0.9136 -0.0563 -0.1132 0.2927  69   THR H C   
2266 O  O   . THR B 69  ? 0.9851 0.6466 0.8797 -0.0535 -0.1115 0.2884  69   THR H O   
2267 C  CB  . THR B 69  ? 1.2539 0.7952 1.0806 -0.0601 -0.1180 0.3370  69   THR H CB  
2268 O  OG1 . THR B 69  ? 1.2999 0.7906 1.1020 -0.0445 -0.1371 0.3574  69   THR H OG1 
2269 C  CG2 . THR B 69  ? 1.2766 0.8033 1.1000 -0.0904 -0.0936 0.3393  69   THR H CG2 
2270 N  N   . ILE B 70  ? 0.9369 0.5736 0.8708 -0.0668 -0.1060 0.2789  70   ILE H N   
2271 C  CA  . ILE B 70  ? 0.8959 0.5821 0.8565 -0.0750 -0.0981 0.2593  70   ILE H CA  
2272 C  C   . ILE B 70  ? 0.9996 0.6894 0.9625 -0.1033 -0.0782 0.2583  70   ILE H C   
2273 O  O   . ILE B 70  ? 1.0275 0.6844 0.9913 -0.1167 -0.0725 0.2620  70   ILE H O   
2274 C  CB  . ILE B 70  ? 0.8837 0.5856 0.8763 -0.0640 -0.1085 0.2414  70   ILE H CB  
2275 C  CG1 . ILE B 70  ? 0.8588 0.5637 0.8509 -0.0385 -0.1244 0.2403  70   ILE H CG1 
2276 C  CG2 . ILE B 70  ? 0.8549 0.6029 0.8715 -0.0725 -0.1038 0.2238  70   ILE H CG2 
2277 C  CD1 . ILE B 70  ? 0.8393 0.5468 0.8555 -0.0286 -0.1324 0.2250  70   ILE H CD1 
2278 N  N   . THR B 71  ? 0.9552 0.6844 0.9204 -0.1130 -0.0662 0.2520  71   THR H N   
2279 C  CA  . THR B 71  ? 0.9691 0.7127 0.9428 -0.1414 -0.0445 0.2472  71   THR H CA  
2280 C  C   . THR B 71  ? 1.0005 0.8067 1.0130 -0.1422 -0.0423 0.2246  71   THR H C   
2281 O  O   . THR B 71  ? 0.9718 0.8023 0.9952 -0.1207 -0.0565 0.2167  71   THR H O   
2282 C  CB  . THR B 71  ? 1.0251 0.7482 0.9573 -0.1556 -0.0273 0.2644  71   THR H CB  
2283 O  OG1 . THR B 71  ? 0.9858 0.7310 0.9014 -0.1403 -0.0312 0.2649  71   THR H OG1 
2284 C  CG2 . THR B 71  ? 1.0486 0.7038 0.9411 -0.1578 -0.0298 0.2890  71   THR H CG2 
2285 N  N   . ALA B 72  ? 0.9692 0.8007 1.0049 -0.1666 -0.0251 0.2137  72   ALA H N   
2286 C  CA  . ALA B 72  ? 0.9311 0.8251 1.0104 -0.1676 -0.0238 0.1910  72   ALA H CA  
2287 C  C   . ALA B 72  ? 1.0381 0.9557 1.1317 -0.1967 0.0027  0.1837  72   ALA H C   
2288 O  O   . ALA B 72  ? 1.0879 0.9716 1.1645 -0.2206 0.0185  0.1933  72   ALA H O   
2289 C  CB  . ALA B 72  ? 0.9033 0.8133 1.0170 -0.1627 -0.0416 0.1759  72   ALA H CB  
2290 N  N   . ASP B 73  ? 0.9831 0.9570 1.1084 -0.1951 0.0093  0.1663  73   ASP H N   
2291 C  CA  . ASP B 73  ? 1.0049 1.0140 1.1551 -0.2220 0.0365  0.1532  73   ASP H CA  
2292 C  C   . ASP B 73  ? 0.9913 1.0609 1.2073 -0.2192 0.0255  0.1265  73   ASP H C   
2293 O  O   . ASP B 73  ? 0.9510 1.0589 1.1919 -0.1963 0.0122  0.1146  73   ASP H O   
2294 C  CB  . ASP B 73  ? 1.0542 1.0765 1.1828 -0.2221 0.0566  0.1548  73   ASP H CB  
2295 C  CG  . ASP B 73  ? 1.2824 1.3357 1.4313 -0.2542 0.0912  0.1417  73   ASP H CG  
2296 O  OD1 . ASP B 73  ? 1.3480 1.3630 1.4656 -0.2825 0.1126  0.1549  73   ASP H OD1 
2297 O  OD2 . ASP B 73  ? 1.3630 1.4774 1.5596 -0.2512 0.0980  0.1177  73   ASP H OD2 
2298 N  N   . GLU B 74  ? 0.9373 1.0108 1.1797 -0.2412 0.0277  0.1177  74   GLU H N   
2299 C  CA  . GLU B 74  ? 0.8980 1.0254 1.2023 -0.2431 0.0140  0.0923  74   GLU H CA  
2300 C  C   . GLU B 74  ? 0.9292 1.1268 1.2858 -0.2414 0.0230  0.0695  74   GLU H C   
2301 O  O   . GLU B 74  ? 0.8946 1.1339 1.2910 -0.2200 -0.0010 0.0542  74   GLU H O   
2302 C  CB  . GLU B 74  ? 0.9378 1.0553 1.2576 -0.2751 0.0225  0.0859  74   GLU H CB  
2303 C  CG  . GLU B 74  ? 1.0183 1.0988 1.3237 -0.2692 -0.0017 0.0906  74   GLU H CG  
2304 C  CD  . GLU B 74  ? 1.1282 1.2090 1.4582 -0.3007 0.0043  0.0774  74   GLU H CD  
2305 O  OE1 . GLU B 74  ? 1.1450 1.2850 1.5308 -0.3129 0.0032  0.0528  74   GLU H OE1 
2306 O  OE2 . GLU B 74  ? 0.8575 0.8800 1.1540 -0.3124 0.0091  0.0903  74   GLU H OE2 
2307 N  N   . SER B 75  ? 0.9037 1.1116 1.2583 -0.2637 0.0579  0.0673  75   SER H N   
2308 C  CA  . SER B 75  ? 0.8891 1.1640 1.2959 -0.2666 0.0745  0.0429  75   SER H CA  
2309 C  C   . SER B 75  ? 0.8974 1.1960 1.3106 -0.2311 0.0598  0.0384  75   SER H C   
2310 O  O   . SER B 75  ? 0.8788 1.2396 1.3541 -0.2212 0.0555  0.0134  75   SER H O   
2311 C  CB  . SER B 75  ? 0.9846 1.2539 1.3733 -0.3001 0.1193  0.0442  75   SER H CB  
2312 O  OG  . SER B 75  ? 1.1083 1.3162 1.4183 -0.2974 0.1294  0.0723  75   SER H OG  
2313 N  N   . THR B 76  ? 0.8351 1.0848 1.1881 -0.2115 0.0512  0.0610  76   THR H N   
2314 C  CA  . THR B 76  ? 0.7987 1.0623 1.1508 -0.1793 0.0385  0.0580  76   THR H CA  
2315 C  C   . THR B 76  ? 0.7952 1.0442 1.1458 -0.1484 -0.0012 0.0638  76   THR H C   
2316 O  O   . THR B 76  ? 0.7771 1.0346 1.1292 -0.1212 -0.0143 0.0610  76   THR H O   
2317 C  CB  . THR B 76  ? 0.9239 1.1498 1.2127 -0.1800 0.0578  0.0752  76   THR H CB  
2318 O  OG1 . THR B 76  ? 0.9359 1.0960 1.1647 -0.1849 0.0516  0.1028  76   THR H OG1 
2319 C  CG2 . THR B 76  ? 0.9517 1.1992 1.2419 -0.2075 0.0986  0.0653  76   THR H CG2 
2320 N  N   . SER B 77  ? 0.7199 0.9456 1.0663 -0.1543 -0.0185 0.0706  77   SER H N   
2321 C  CA  . SER B 77  ? 0.6753 0.8799 1.0112 -0.1307 -0.0524 0.0770  77   SER H CA  
2322 C  C   . SER B 77  ? 0.6677 0.8269 0.9497 -0.1113 -0.0568 0.0964  77   SER H C   
2323 O  O   . SER B 77  ? 0.6339 0.7937 0.9157 -0.0858 -0.0770 0.0957  77   SER H O   
2324 C  CB  . SER B 77  ? 0.6942 0.9473 1.0823 -0.1111 -0.0765 0.0576  77   SER H CB  
2325 O  OG  . SER B 77  ? 0.7741 1.0707 1.2150 -0.1283 -0.0774 0.0386  77   SER H OG  
2326 N  N   . THR B 78  ? 0.6303 0.7502 0.8670 -0.1241 -0.0383 0.1135  78   THR H N   
2327 C  CA  . THR B 78  ? 0.6266 0.7082 0.8150 -0.1081 -0.0417 0.1304  78   THR H CA  
2328 C  C   . THR B 78  ? 0.6774 0.7013 0.8240 -0.1132 -0.0464 0.1510  78   THR H C   
2329 O  O   . THR B 78  ? 0.7095 0.7146 0.8476 -0.1361 -0.0329 0.1573  78   THR H O   
2330 C  CB  . THR B 78  ? 0.7653 0.8584 0.9379 -0.1133 -0.0178 0.1296  78   THR H CB  
2331 O  OG1 . THR B 78  ? 0.7237 0.8728 0.9439 -0.1070 -0.0132 0.1067  78   THR H OG1 
2332 C  CG2 . THR B 78  ? 0.7599 0.8218 0.8865 -0.0956 -0.0240 0.1430  78   THR H CG2 
2333 N  N   . ALA B 79  ? 0.5960 0.5924 0.7202 -0.0917 -0.0650 0.1599  79   ALA H N   
2334 C  CA  . ALA B 79  ? 0.6003 0.5446 0.6907 -0.0898 -0.0723 0.1770  79   ALA H CA  
2335 C  C   . ALA B 79  ? 0.6876 0.6100 0.7402 -0.0784 -0.0712 0.1902  79   ALA H C   
2336 O  O   . ALA B 79  ? 0.6655 0.6112 0.7203 -0.0653 -0.0726 0.1834  79   ALA H O   
2337 C  CB  . ALA B 79  ? 0.5763 0.5120 0.6760 -0.0748 -0.0937 0.1728  79   ALA H CB  
2338 N  N   . TYR B 80  ? 0.6934 0.5704 0.7120 -0.0827 -0.0704 0.2083  80   TYR H N   
2339 C  CA  . TYR B 80  ? 0.7101 0.5636 0.6895 -0.0728 -0.0730 0.2222  80   TYR H CA  
2340 C  C   . TYR B 80  ? 0.7544 0.5673 0.7196 -0.0599 -0.0899 0.2339  80   TYR H C   
2341 O  O   . TYR B 80  ? 0.7426 0.5302 0.7139 -0.0672 -0.0911 0.2379  80   TYR H O   
2342 C  CB  . TYR B 80  ? 0.7764 0.6125 0.7213 -0.0930 -0.0535 0.2353  80   TYR H CB  
2343 C  CG  . TYR B 80  ? 0.7963 0.6740 0.7563 -0.1092 -0.0311 0.2217  80   TYR H CG  
2344 C  CD1 . TYR B 80  ? 0.8224 0.7241 0.7706 -0.1032 -0.0242 0.2152  80   TYR H CD1 
2345 C  CD2 . TYR B 80  ? 0.8076 0.7018 0.7958 -0.1316 -0.0155 0.2133  80   TYR H CD2 
2346 C  CE1 . TYR B 80  ? 0.8311 0.7736 0.7985 -0.1176 -0.0012 0.1995  80   TYR H CE1 
2347 C  CE2 . TYR B 80  ? 0.8226 0.7605 0.8332 -0.1464 0.0061  0.1976  80   TYR H CE2 
2348 C  CZ  . TYR B 80  ? 0.9277 0.8892 0.9278 -0.1392 0.0143  0.1908  80   TYR H CZ  
2349 O  OH  . TYR B 80  ? 0.9714 0.9779 0.9980 -0.1535 0.0380  0.1724  80   TYR H OH  
2350 N  N   . MET B 81  ? 0.7079 0.5149 0.6558 -0.0415 -0.1023 0.2378  81   MET H N   
2351 C  CA  . MET B 81  ? 0.7160 0.4889 0.6540 -0.0271 -0.1190 0.2474  81   MET H CA  
2352 C  C   . MET B 81  ? 0.8065 0.5603 0.7034 -0.0229 -0.1232 0.2625  81   MET H C   
2353 O  O   . MET B 81  ? 0.7740 0.5503 0.6599 -0.0172 -0.1231 0.2570  81   MET H O   
2354 C  CB  . MET B 81  ? 0.7053 0.4940 0.6682 -0.0086 -0.1327 0.2337  81   MET H CB  
2355 C  CG  . MET B 81  ? 0.7670 0.5263 0.7346 0.0037  -0.1467 0.2376  81   MET H CG  
2356 S  SD  . MET B 81  ? 0.8645 0.6065 0.8063 0.0206  -0.1630 0.2491  81   MET H SD  
2357 C  CE  . MET B 81  ? 0.7893 0.5714 0.7326 0.0285  -0.1635 0.2348  81   MET H CE  
2358 N  N   . GLU B 82  ? 0.8283 0.5381 0.7001 -0.0261 -0.1272 0.2815  82   GLU H N   
2359 C  CA  . GLU B 82  ? 0.8725 0.5556 0.6985 -0.0211 -0.1361 0.2994  82   GLU H CA  
2360 C  C   . GLU B 82  ? 0.9255 0.5825 0.7590 0.0002  -0.1608 0.3053  82   GLU H C   
2361 O  O   . GLU B 82  ? 0.9250 0.5581 0.7786 0.0011  -0.1634 0.3076  82   GLU H O   
2362 C  CB  . GLU B 82  ? 0.9524 0.6011 0.7381 -0.0427 -0.1213 0.3190  82   GLU H CB  
2363 C  CG  . GLU B 82  ? 1.1557 0.7724 0.8827 -0.0395 -0.1312 0.3399  82   GLU H CG  
2364 C  CD  . GLU B 82  ? 1.5329 1.1099 1.2146 -0.0640 -0.1134 0.3604  82   GLU H CD  
2365 O  OE1 . GLU B 82  ? 1.6422 1.1689 1.3122 -0.0639 -0.1211 0.3787  82   GLU H OE1 
2366 O  OE2 . GLU B 82  ? 1.3971 0.9935 1.0597 -0.0847 -0.0891 0.3563  82   GLU H OE2 
2367 N  N   . LEU B 83  ? 0.8806 0.5456 0.7035 0.0172  -0.1783 0.3043  83   LEU H N   
2368 C  CA  . LEU B 83  ? 0.8802 0.5275 0.7161 0.0388  -0.2032 0.3070  83   LEU H CA  
2369 C  C   . LEU B 83  ? 1.0061 0.6276 0.7930 0.0452  -0.2206 0.3265  83   LEU H C   
2370 O  O   . LEU B 83  ? 1.0186 0.6584 0.7758 0.0428  -0.2200 0.3247  83   LEU H O   
2371 C  CB  . LEU B 83  ? 0.8180 0.5023 0.6941 0.0533  -0.2106 0.2841  83   LEU H CB  
2372 C  CG  . LEU B 83  ? 0.8653 0.5406 0.7697 0.0740  -0.2325 0.2801  83   LEU H CG  
2373 C  CD1 . LEU B 83  ? 0.8696 0.5191 0.8014 0.0744  -0.2302 0.2813  83   LEU H CD1 
2374 C  CD2 . LEU B 83  ? 0.8313 0.5431 0.7682 0.0829  -0.2349 0.2573  83   LEU H CD2 
2375 N  N   . SER B 84  ? 1.0108 0.5871 0.7859 0.0525  -0.2357 0.3455  84   SER H N   
2376 C  CA  . SER B 84  ? 1.0823 0.6237 0.8043 0.0592  -0.2562 0.3687  84   SER H CA  
2377 C  C   . SER B 84  ? 1.1583 0.6989 0.9011 0.0875  -0.2909 0.3666  84   SER H C   
2378 O  O   . SER B 84  ? 1.1113 0.6745 0.9133 0.1002  -0.2951 0.3470  84   SER H O   
2379 C  CB  . SER B 84  ? 1.1699 0.6544 0.8570 0.0470  -0.2502 0.3948  84   SER H CB  
2380 O  OG  . SER B 84  ? 1.2345 0.7248 0.9045 0.0185  -0.2171 0.3944  84   SER H OG  
2381 N  N   . SER B 85  ? 1.1699 0.6854 0.8631 0.0964  -0.3159 0.3856  85   SER H N   
2382 C  CA  . SER B 85  ? 1.1726 0.6886 0.8825 0.1239  -0.3539 0.3847  85   SER H CA  
2383 C  C   . SER B 85  ? 1.1352 0.7098 0.9012 0.1334  -0.3554 0.3520  85   SER H C   
2384 O  O   . SER B 85  ? 1.1029 0.6896 0.9281 0.1504  -0.3673 0.3377  85   SER H O   
2385 C  CB  . SER B 85  ? 1.2240 0.6989 0.9622 0.1404  -0.3710 0.3965  85   SER H CB  
2386 O  OG  . SER B 85  ? 1.2896 0.7708 1.0610 0.1690  -0.4073 0.3912  85   SER H OG  
2387 N  N   . LEU B 86  ? 1.0510 0.6597 0.7982 0.1205  -0.3398 0.3396  86   LEU H N   
2388 C  CA  . LEU B 86  ? 0.9852 0.6442 0.7764 0.1250  -0.3363 0.3100  86   LEU H CA  
2389 C  C   . LEU B 86  ? 1.0625 0.7376 0.8775 0.1465  -0.3691 0.2996  86   LEU H C   
2390 O  O   . LEU B 86  ? 1.1033 0.7632 0.8772 0.1541  -0.3952 0.3131  86   LEU H O   
2391 C  CB  . LEU B 86  ? 0.9663 0.6522 0.7281 0.1079  -0.3142 0.3004  86   LEU H CB  
2392 C  CG  . LEU B 86  ? 0.9918 0.6815 0.7555 0.0878  -0.2794 0.2990  86   LEU H CG  
2393 C  CD1 . LEU B 86  ? 0.9895 0.7028 0.7226 0.0740  -0.2613 0.2908  86   LEU H CD1 
2394 C  CD2 . LEU B 86  ? 0.9510 0.6617 0.7773 0.0902  -0.2677 0.2802  86   LEU H CD2 
2395 N  N   . ARG B 87  ? 0.9841 0.6891 0.8653 0.1551  -0.3677 0.2750  87   ARG H N   
2396 C  CA  . ARG B 87  ? 0.9778 0.7073 0.8999 0.1733  -0.3938 0.2577  87   ARG H CA  
2397 C  C   . ARG B 87  ? 0.9964 0.7688 0.9409 0.1662  -0.3795 0.2301  87   ARG H C   
2398 O  O   . ARG B 87  ? 0.9615 0.7414 0.9044 0.1514  -0.3502 0.2243  87   ARG H O   
2399 C  CB  . ARG B 87  ? 0.9614 0.6862 0.9481 0.1873  -0.3992 0.2501  87   ARG H CB  
2400 C  CG  . ARG B 87  ? 1.2309 0.9094 1.2060 0.1954  -0.4104 0.2748  87   ARG H CG  
2401 C  CD  . ARG B 87  ? 1.4215 1.0823 1.4125 0.1833  -0.3802 0.2761  87   ARG H CD  
2402 N  NE  . ARG B 87  ? 1.7321 1.3422 1.7012 0.1874  -0.3883 0.3018  87   ARG H NE  
2403 C  CZ  . ARG B 87  ? 2.0193 1.6092 2.0320 0.2015  -0.3958 0.3004  87   ARG H CZ  
2404 N  NH1 . ARG B 87  ? 1.7994 1.4186 1.8807 0.2111  -0.3934 0.2731  87   ARG H NH1 
2405 N  NH2 . ARG B 87  ? 1.9785 1.5166 1.9664 0.2049  -0.4033 0.3252  87   ARG H NH2 
2406 N  N   . SER B 88  ? 0.9526 0.7524 0.9220 0.1768  -0.4005 0.2119  88   SER H N   
2407 C  CA  . SER B 88  ? 0.8972 0.7331 0.8894 0.1694  -0.3867 0.1849  88   SER H CA  
2408 C  C   . SER B 88  ? 0.8530 0.6979 0.8946 0.1630  -0.3588 0.1695  88   SER H C   
2409 O  O   . SER B 88  ? 0.8016 0.6604 0.8419 0.1515  -0.3372 0.1572  88   SER H O   
2410 C  CB  . SER B 88  ? 0.9514 0.8139 0.9671 0.1807  -0.4146 0.1668  88   SER H CB  
2411 O  OG  . SER B 88  ? 1.0945 0.9608 1.1668 0.1966  -0.4327 0.1607  88   SER H OG  
2412 N  N   . GLU B 89  ? 0.7848 0.6167 0.8639 0.1701  -0.3589 0.1717  89   GLU H N   
2413 C  CA  . GLU B 89  ? 0.7292 0.5639 0.8480 0.1632  -0.3334 0.1587  89   GLU H CA  
2414 C  C   . GLU B 89  ? 0.7549 0.5746 0.8424 0.1479  -0.3075 0.1699  89   GLU H C   
2415 O  O   . GLU B 89  ? 0.7212 0.5434 0.8309 0.1399  -0.2866 0.1594  89   GLU H O   
2416 C  CB  . GLU B 89  ? 0.7500 0.5733 0.9148 0.1746  -0.3396 0.1566  89   GLU H CB  
2417 C  CG  . GLU B 89  ? 0.9492 0.7854 1.1493 0.1937  -0.3706 0.1488  89   GLU H CG  
2418 C  CD  . GLU B 89  ? 1.4145 1.2235 1.5822 0.2073  -0.3995 0.1748  89   GLU H CD  
2419 O  OE1 . GLU B 89  ? 1.3258 1.1058 1.5023 0.2137  -0.4000 0.1873  89   GLU H OE1 
2420 O  OE2 . GLU B 89  ? 1.4846 1.2963 1.6102 0.2093  -0.4193 0.1842  89   GLU H OE2 
2421 N  N   . ASP B 90  ? 0.7458 0.5499 0.7823 0.1428  -0.3088 0.1905  90   ASP H N   
2422 C  CA  . ASP B 90  ? 0.7500 0.5455 0.7620 0.1276  -0.2848 0.1990  90   ASP H CA  
2423 C  C   . ASP B 90  ? 0.8149 0.6337 0.8139 0.1186  -0.2707 0.1871  90   ASP H C   
2424 O  O   . ASP B 90  ? 0.7817 0.6004 0.7705 0.1075  -0.2514 0.1895  90   ASP H O   
2425 C  CB  . ASP B 90  ? 0.8182 0.5854 0.7854 0.1230  -0.2871 0.2246  90   ASP H CB  
2426 C  CG  . ASP B 90  ? 0.9596 0.6954 0.9382 0.1303  -0.2967 0.2382  90   ASP H CG  
2427 O  OD1 . ASP B 90  ? 0.9527 0.6854 0.9695 0.1302  -0.2867 0.2293  90   ASP H OD1 
2428 O  OD2 . ASP B 90  ? 1.0351 0.7459 0.9808 0.1353  -0.3134 0.2581  90   ASP H OD2 
2429 N  N   . THR B 91  ? 0.7994 0.6385 0.8016 0.1238  -0.2812 0.1730  91   THR H N   
2430 C  CA  . THR B 91  ? 0.7828 0.6413 0.7768 0.1171  -0.2685 0.1592  91   THR H CA  
2431 C  C   . THR B 91  ? 0.7798 0.6413 0.8048 0.1119  -0.2494 0.1482  91   THR H C   
2432 O  O   . THR B 91  ? 0.7630 0.6259 0.8232 0.1152  -0.2506 0.1370  91   THR H O   
2433 C  CB  . THR B 91  ? 0.9560 0.8334 0.9569 0.1231  -0.2835 0.1422  91   THR H CB  
2434 O  OG1 . THR B 91  ? 1.0133 0.8982 1.0622 0.1290  -0.2890 0.1274  91   THR H OG1 
2435 C  CG2 . THR B 91  ? 0.9668 0.8415 0.9321 0.1284  -0.3062 0.1518  91   THR H CG2 
2436 N  N   . ALA B 92  ? 0.7043 0.5657 0.7159 0.1033  -0.2321 0.1516  92   ALA H N   
2437 C  CA  . ALA B 92  ? 0.6473 0.5075 0.6797 0.0985  -0.2171 0.1445  92   ALA H CA  
2438 C  C   . ALA B 92  ? 0.6538 0.5206 0.6706 0.0920  -0.2038 0.1467  92   ALA H C   
2439 O  O   . ALA B 92  ? 0.6563 0.5278 0.6483 0.0892  -0.2024 0.1542  92   ALA H O   
2440 C  CB  . ALA B 92  ? 0.6482 0.4916 0.6949 0.0966  -0.2152 0.1524  92   ALA H CB  
2441 N  N   . VAL B 93  ? 0.5738 0.4399 0.6052 0.0892  -0.1940 0.1401  93   VAL H N   
2442 C  CA  . VAL B 93  ? 0.5551 0.4279 0.5820 0.0849  -0.1839 0.1415  93   VAL H CA  
2443 C  C   . VAL B 93  ? 0.5878 0.4498 0.6177 0.0780  -0.1810 0.1523  93   VAL H C   
2444 O  O   . VAL B 93  ? 0.5876 0.4359 0.6296 0.0771  -0.1819 0.1510  93   VAL H O   
2445 C  CB  . VAL B 93  ? 0.5885 0.4623 0.6265 0.0874  -0.1795 0.1296  93   VAL H CB  
2446 C  CG1 . VAL B 93  ? 0.5855 0.4671 0.6248 0.0854  -0.1733 0.1317  93   VAL H CG1 
2447 C  CG2 . VAL B 93  ? 0.5907 0.4725 0.6266 0.0930  -0.1812 0.1174  93   VAL H CG2 
2448 N  N   . TYR B 94  ? 0.5345 0.4023 0.5536 0.0715  -0.1757 0.1612  94   TYR H N   
2449 C  CA  . TYR B 94  ? 0.5327 0.3908 0.5539 0.0625  -0.1719 0.1702  94   TYR H CA  
2450 C  C   . TYR B 94  ? 0.5987 0.4702 0.6300 0.0578  -0.1656 0.1655  94   TYR H C   
2451 O  O   . TYR B 94  ? 0.5867 0.4784 0.6177 0.0574  -0.1604 0.1621  94   TYR H O   
2452 C  CB  . TYR B 94  ? 0.5658 0.4186 0.5671 0.0562  -0.1700 0.1836  94   TYR H CB  
2453 C  CG  . TYR B 94  ? 0.5827 0.4165 0.5743 0.0626  -0.1814 0.1913  94   TYR H CG  
2454 C  CD1 . TYR B 94  ? 0.6109 0.4507 0.5923 0.0714  -0.1905 0.1878  94   TYR H CD1 
2455 C  CD2 . TYR B 94  ? 0.5887 0.3988 0.5848 0.0608  -0.1847 0.2002  94   TYR H CD2 
2456 C  CE1 . TYR B 94  ? 0.6366 0.4620 0.6144 0.0794  -0.2054 0.1934  94   TYR H CE1 
2457 C  CE2 . TYR B 94  ? 0.6050 0.3984 0.5991 0.0701  -0.1982 0.2061  94   TYR H CE2 
2458 C  CZ  . TYR B 94  ? 0.6786 0.4811 0.6643 0.0798  -0.2099 0.2030  94   TYR H CZ  
2459 O  OH  . TYR B 94  ? 0.6508 0.4399 0.6392 0.0907  -0.2270 0.2077  94   TYR H OH  
2460 N  N   . TYR B 95  ? 0.5791 0.4404 0.6203 0.0547  -0.1667 0.1634  95   TYR H N   
2461 C  CA  . TYR B 95  ? 0.5808 0.4530 0.6311 0.0510  -0.1657 0.1592  95   TYR H CA  
2462 C  C   . TYR B 95  ? 0.6703 0.5424 0.7238 0.0383  -0.1622 0.1642  95   TYR H C   
2463 O  O   . TYR B 95  ? 0.6791 0.5310 0.7289 0.0321  -0.1612 0.1692  95   TYR H O   
2464 C  CB  . TYR B 95  ? 0.5827 0.4411 0.6345 0.0541  -0.1704 0.1530  95   TYR H CB  
2465 C  CG  . TYR B 95  ? 0.6000 0.4570 0.6504 0.0646  -0.1725 0.1462  95   TYR H CG  
2466 C  CD1 . TYR B 95  ? 0.6353 0.5068 0.6902 0.0718  -0.1744 0.1414  95   TYR H CD1 
2467 C  CD2 . TYR B 95  ? 0.5990 0.4398 0.6474 0.0668  -0.1722 0.1428  95   TYR H CD2 
2468 C  CE1 . TYR B 95  ? 0.6631 0.5287 0.7163 0.0805  -0.1754 0.1345  95   TYR H CE1 
2469 C  CE2 . TYR B 95  ? 0.6049 0.4431 0.6532 0.0737  -0.1727 0.1350  95   TYR H CE2 
2470 C  CZ  . TYR B 95  ? 0.7629 0.6109 0.8114 0.0802  -0.1742 0.1315  95   TYR H CZ  
2471 O  OH  . TYR B 95  ? 0.8728 0.7139 0.9207 0.0862  -0.1738 0.1234  95   TYR H OH  
2472 N  N   . CYS B 96  ? 0.6261 0.5215 0.6908 0.0346  -0.1606 0.1606  96   CYS H N   
2473 C  CA  . CYS B 96  ? 0.6289 0.5323 0.7033 0.0212  -0.1578 0.1610  96   CYS H CA  
2474 C  C   . CYS B 96  ? 0.6555 0.5592 0.7368 0.0233  -0.1683 0.1540  96   CYS H C   
2475 O  O   . CYS B 96  ? 0.6415 0.5536 0.7267 0.0349  -0.1754 0.1489  96   CYS H O   
2476 C  CB  . CYS B 96  ? 0.6453 0.5799 0.7321 0.0170  -0.1495 0.1582  96   CYS H CB  
2477 S  SG  . CYS B 96  ? 0.7057 0.6626 0.8164 0.0004  -0.1468 0.1528  96   CYS H SG  
2478 N  N   . ALA B 97  ? 0.6024 0.4924 0.6814 0.0122  -0.1702 0.1540  97   ALA H N   
2479 C  CA  . ALA B 97  ? 0.5976 0.4834 0.6741 0.0119  -0.1815 0.1481  97   ALA H CA  
2480 C  C   . ALA B 97  ? 0.6460 0.5403 0.7318 -0.0039 -0.1829 0.1445  97   ALA H C   
2481 O  O   . ALA B 97  ? 0.6611 0.5515 0.7503 -0.0159 -0.1725 0.1476  97   ALA H O   
2482 C  CB  . ALA B 97  ? 0.6124 0.4644 0.6680 0.0136  -0.1817 0.1482  97   ALA H CB  
2483 N  N   . ARG B 98  ? 0.5852 0.4891 0.6738 -0.0046 -0.1967 0.1382  98   ARG H N   
2484 C  CA  . ARG B 98  ? 0.5763 0.4909 0.6752 -0.0208 -0.2004 0.1320  98   ARG H CA  
2485 C  C   . ARG B 98  ? 0.5952 0.4804 0.6681 -0.0285 -0.2075 0.1286  98   ARG H C   
2486 O  O   . ARG B 98  ? 0.5950 0.4624 0.6453 -0.0198 -0.2160 0.1293  98   ARG H O   
2487 C  CB  . ARG B 98  ? 0.5633 0.5204 0.6924 -0.0176 -0.2117 0.1248  98   ARG H CB  
2488 C  CG  . ARG B 98  ? 0.6603 0.6381 0.8079 -0.0340 -0.2191 0.1151  98   ARG H CG  
2489 C  CD  . ARG B 98  ? 0.8708 0.8856 1.0446 -0.0230 -0.2402 0.1069  98   ARG H CD  
2490 N  NE  . ARG B 98  ? 1.1230 1.1832 1.3414 -0.0340 -0.2365 0.0961  98   ARG H NE  
2491 C  CZ  . ARG B 98  ? 1.2607 1.3635 1.5186 -0.0232 -0.2400 0.0885  98   ARG H CZ  
2492 N  NH1 . ARG B 98  ? 1.0321 1.1350 1.2889 0.0004  -0.2484 0.0916  98   ARG H NH1 
2493 N  NH2 . ARG B 98  ? 1.0154 1.1607 1.3166 -0.0368 -0.2328 0.0763  98   ARG H NH2 
2494 N  N   . GLY B 99  ? 0.5247 0.4023 0.5987 -0.0463 -0.2015 0.1242  99   GLY H N   
2495 C  CA  . GLY B 99  ? 0.5325 0.3806 0.5816 -0.0571 -0.2031 0.1183  99   GLY H CA  
2496 C  C   . GLY B 99  ? 0.5613 0.3786 0.6038 -0.0601 -0.1847 0.1217  99   GLY H C   
2497 O  O   . GLY B 99  ? 0.5373 0.3528 0.5854 -0.0487 -0.1768 0.1303  99   GLY H O   
2498 N  N   . SER B 100 ? 0.5259 0.3199 0.5589 -0.0751 -0.1787 0.1140  100  SER H N   
2499 C  CA  . SER B 100 ? 0.5213 0.2844 0.5537 -0.0778 -0.1623 0.1149  100  SER H CA  
2500 C  C   . SER B 100 ? 0.5407 0.2765 0.5531 -0.0719 -0.1574 0.1102  100  SER H C   
2501 O  O   . SER B 100 ? 0.4925 0.2183 0.5111 -0.0599 -0.1497 0.1156  100  SER H O   
2502 C  CB  . SER B 100 ? 0.6033 0.3550 0.6416 -0.0978 -0.1559 0.1068  100  SER H CB  
2503 O  OG  . SER B 100 ? 0.7666 0.5324 0.7983 -0.1109 -0.1679 0.0955  100  SER H OG  
2504 N  N   . PHE B 101 ? 0.5323 0.2572 0.5201 -0.0813 -0.1619 0.0993  101  PHE H N   
2505 C  CA  . PHE B 101 ? 0.5514 0.2493 0.5151 -0.0807 -0.1539 0.0921  101  PHE H CA  
2506 C  C   . PHE B 101 ? 0.5901 0.2922 0.5365 -0.0680 -0.1616 0.0984  101  PHE H C   
2507 O  O   . PHE B 101 ? 0.5714 0.2570 0.5120 -0.0627 -0.1505 0.0965  101  PHE H O   
2508 C  CB  . PHE B 101 ? 0.6111 0.2883 0.5490 -0.1000 -0.1512 0.0764  101  PHE H CB  
2509 C  CG  . PHE B 101 ? 0.6418 0.3093 0.5966 -0.1135 -0.1417 0.0678  101  PHE H CG  
2510 C  CD1 . PHE B 101 ? 0.6686 0.3203 0.6480 -0.1082 -0.1260 0.0687  101  PHE H CD1 
2511 C  CD2 . PHE B 101 ? 0.6929 0.3652 0.6395 -0.1313 -0.1498 0.0585  101  PHE H CD2 
2512 C  CE1 . PHE B 101 ? 0.6940 0.3300 0.6876 -0.1202 -0.1172 0.0617  101  PHE H CE1 
2513 C  CE2 . PHE B 101 ? 0.7422 0.4015 0.7041 -0.1456 -0.1395 0.0493  101  PHE H CE2 
2514 C  CZ  . PHE B 101 ? 0.7095 0.3482 0.6938 -0.1398 -0.1225 0.0516  101  PHE H CZ  
2515 N  N   . TRP B 102 ? 0.5581 0.2818 0.5002 -0.0630 -0.1800 0.1049  102  TRP H N   
2516 C  CA  . TRP B 102 ? 0.5628 0.2869 0.4901 -0.0497 -0.1883 0.1120  102  TRP H CA  
2517 C  C   . TRP B 102 ? 0.6142 0.3719 0.5637 -0.0375 -0.2038 0.1203  102  TRP H C   
2518 O  O   . TRP B 102 ? 0.6333 0.4135 0.5956 -0.0428 -0.2154 0.1183  102  TRP H O   
2519 C  CB  . TRP B 102 ? 0.5849 0.2832 0.4659 -0.0571 -0.1946 0.1082  102  TRP H CB  
2520 C  CG  . TRP B 102 ? 0.6132 0.3205 0.4774 -0.0637 -0.2170 0.1069  102  TRP H CG  
2521 C  CD1 . TRP B 102 ? 0.6455 0.3768 0.5182 -0.0522 -0.2401 0.1142  102  TRP H CD1 
2522 C  CD2 . TRP B 102 ? 0.6452 0.3367 0.4798 -0.0825 -0.2200 0.0962  102  TRP H CD2 
2523 N  NE1 . TRP B 102 ? 0.6691 0.4040 0.5235 -0.0618 -0.2598 0.1091  102  TRP H NE1 
2524 C  CE2 . TRP B 102 ? 0.7092 0.4186 0.5361 -0.0815 -0.2482 0.0982  102  TRP H CE2 
2525 C  CE3 . TRP B 102 ? 0.6831 0.3479 0.4987 -0.1001 -0.2018 0.0830  102  TRP H CE3 
2526 C  CZ2 . TRP B 102 ? 0.7388 0.4408 0.5366 -0.0984 -0.2608 0.0883  102  TRP H CZ2 
2527 C  CZ3 . TRP B 102 ? 0.7417 0.3966 0.5259 -0.1178 -0.2111 0.0724  102  TRP H CZ3 
2528 C  CH2 . TRP B 102 ? 0.7656 0.4391 0.5393 -0.1174 -0.2413 0.0755  102  TRP H CH2 
2529 N  N   . PHE B 103 ? 0.5479 0.3100 0.5034 -0.0220 -0.2036 0.1273  103  PHE H N   
2530 C  CA  . PHE B 103 ? 0.5277 0.3221 0.5096 -0.0093 -0.2127 0.1328  103  PHE H CA  
2531 C  C   . PHE B 103 ? 0.5545 0.3503 0.5254 0.0036  -0.2289 0.1365  103  PHE H C   
2532 O  O   . PHE B 103 ? 0.5318 0.3091 0.4888 0.0123  -0.2251 0.1399  103  PHE H O   
2533 C  CB  . PHE B 103 ? 0.5341 0.3355 0.5371 -0.0015 -0.1986 0.1368  103  PHE H CB  
2534 C  CG  . PHE B 103 ? 0.5681 0.3508 0.5718 -0.0102 -0.1831 0.1346  103  PHE H CG  
2535 C  CD1 . PHE B 103 ? 0.6289 0.3835 0.6165 -0.0117 -0.1738 0.1302  103  PHE H CD1 
2536 C  CD2 . PHE B 103 ? 0.6051 0.3964 0.6267 -0.0175 -0.1772 0.1359  103  PHE H CD2 
2537 C  CE1 . PHE B 103 ? 0.6396 0.3785 0.6347 -0.0176 -0.1605 0.1258  103  PHE H CE1 
2538 C  CE2 . PHE B 103 ? 0.6489 0.4184 0.6726 -0.0231 -0.1650 0.1343  103  PHE H CE2 
2539 C  CZ  . PHE B 103 ? 0.6216 0.3668 0.6350 -0.0217 -0.1576 0.1286  103  PHE H CZ  
2540 N  N   . GLY B 104 ? 0.5252 0.3435 0.5059 0.0051  -0.2476 0.1352  104  GLY H N   
2541 C  CA  . GLY B 104 ? 0.5446 0.3664 0.5212 0.0205  -0.2675 0.1391  104  GLY H CA  
2542 C  C   . GLY B 104 ? 0.5867 0.4383 0.6004 0.0370  -0.2660 0.1400  104  GLY H C   
2543 O  O   . GLY B 104 ? 0.5924 0.4338 0.6007 0.0523  -0.2709 0.1439  104  GLY H O   
2544 N  N   . TYR B 105 ? 0.5317 0.4171 0.5807 0.0321  -0.2567 0.1357  105  TYR H N   
2545 C  CA  . TYR B 105 ? 0.5085 0.4265 0.5928 0.0438  -0.2518 0.1337  105  TYR H CA  
2546 C  C   . TYR B 105 ? 0.5641 0.4773 0.6491 0.0416  -0.2296 0.1365  105  TYR H C   
2547 O  O   . TYR B 105 ? 0.5367 0.4397 0.6148 0.0279  -0.2179 0.1381  105  TYR H O   
2548 C  CB  . TYR B 105 ? 0.5113 0.4741 0.6350 0.0397  -0.2589 0.1255  105  TYR H CB  
2549 C  CG  . TYR B 105 ? 0.5513 0.5179 0.6722 0.0407  -0.2853 0.1223  105  TYR H CG  
2550 C  CD1 . TYR B 105 ? 0.5905 0.5574 0.7131 0.0604  -0.3071 0.1234  105  TYR H CD1 
2551 C  CD2 . TYR B 105 ? 0.5775 0.5405 0.6878 0.0222  -0.2901 0.1187  105  TYR H CD2 
2552 C  CE1 . TYR B 105 ? 0.6306 0.5957 0.7435 0.0626  -0.3357 0.1227  105  TYR H CE1 
2553 C  CE2 . TYR B 105 ? 0.6215 0.5850 0.7216 0.0223  -0.3171 0.1157  105  TYR H CE2 
2554 C  CZ  . TYR B 105 ? 0.7532 0.7177 0.8533 0.0430  -0.3413 0.1186  105  TYR H CZ  
2555 O  OH  . TYR B 105 ? 0.8179 0.7805 0.9038 0.0442  -0.3720 0.1173  105  TYR H OH  
2556 N  N   . TRP B 106 ? 0.5710 0.4863 0.6608 0.0557  -0.2255 0.1370  106  TRP H N   
2557 C  CA  . TRP B 106 ? 0.5863 0.4979 0.6741 0.0558  -0.2084 0.1391  106  TRP H CA  
2558 C  C   . TRP B 106 ? 0.6605 0.6036 0.7729 0.0640  -0.2018 0.1345  106  TRP H C   
2559 O  O   . TRP B 106 ? 0.6614 0.6238 0.7933 0.0755  -0.2103 0.1284  106  TRP H O   
2560 C  CB  . TRP B 106 ? 0.5805 0.4592 0.6444 0.0623  -0.2064 0.1416  106  TRP H CB  
2561 C  CG  . TRP B 106 ? 0.6049 0.4516 0.6442 0.0521  -0.2048 0.1440  106  TRP H CG  
2562 C  CD1 . TRP B 106 ? 0.6634 0.4908 0.6827 0.0477  -0.2144 0.1443  106  TRP H CD1 
2563 C  CD2 . TRP B 106 ? 0.5966 0.4256 0.6279 0.0460  -0.1925 0.1447  106  TRP H CD2 
2564 N  NE1 . TRP B 106 ? 0.6596 0.4592 0.6585 0.0370  -0.2053 0.1437  106  TRP H NE1 
2565 C  CE2 . TRP B 106 ? 0.6579 0.4594 0.6681 0.0370  -0.1921 0.1433  106  TRP H CE2 
2566 C  CE3 . TRP B 106 ? 0.5986 0.4328 0.6385 0.0474  -0.1830 0.1458  106  TRP H CE3 
2567 C  CZ2 . TRP B 106 ? 0.6474 0.4297 0.6525 0.0302  -0.1804 0.1407  106  TRP H CZ2 
2568 C  CZ3 . TRP B 106 ? 0.6160 0.4303 0.6505 0.0427  -0.1757 0.1452  106  TRP H CZ3 
2569 C  CH2 . TRP B 106 ? 0.6361 0.4264 0.6571 0.0347  -0.1734 0.1416  106  TRP H CH2 
2570 N  N   . GLY B 107 ? 0.6117 0.5565 0.7204 0.0591  -0.1872 0.1368  107  GLY H N   
2571 C  CA  . GLY B 107 ? 0.6002 0.5681 0.7208 0.0645  -0.1775 0.1321  107  GLY H CA  
2572 C  C   . GLY B 107 ? 0.6343 0.5871 0.7440 0.0781  -0.1789 0.1296  107  GLY H C   
2573 O  O   . GLY B 107 ? 0.6104 0.5354 0.7046 0.0816  -0.1858 0.1324  107  GLY H O   
2574 N  N   . GLN B 108 ? 0.6008 0.5707 0.7174 0.0842  -0.1705 0.1229  108  GLN H N   
2575 C  CA  . GLN B 108 ? 0.6056 0.5611 0.7130 0.0957  -0.1714 0.1182  108  GLN H CA  
2576 C  C   . GLN B 108 ? 0.7088 0.6444 0.7926 0.0908  -0.1674 0.1232  108  GLN H C   
2577 O  O   . GLN B 108 ? 0.7271 0.6448 0.8027 0.0970  -0.1701 0.1200  108  GLN H O   
2578 C  CB  . GLN B 108 ? 0.6151 0.5951 0.7398 0.1050  -0.1647 0.1056  108  GLN H CB  
2579 C  CG  . GLN B 108 ? 0.5151 0.5102 0.6299 0.0973  -0.1495 0.1030  108  GLN H CG  
2580 C  CD  . GLN B 108 ? 0.5875 0.6101 0.7143 0.0856  -0.1388 0.1030  108  GLN H CD  
2581 O  OE1 . GLN B 108 ? 0.4000 0.4306 0.5427 0.0799  -0.1432 0.1065  108  GLN H OE1 
2582 N  NE2 . GLN B 108 ? 0.5244 0.5614 0.6420 0.0798  -0.1234 0.0980  108  GLN H NE2 
2583 N  N   . GLY B 109 ? 0.6804 0.6186 0.7552 0.0799  -0.1617 0.1307  109  GLY H N   
2584 C  CA  . GLY B 109 ? 0.6861 0.6077 0.7419 0.0771  -0.1614 0.1363  109  GLY H CA  
2585 C  C   . GLY B 109 ? 0.7555 0.6893 0.7986 0.0763  -0.1546 0.1347  109  GLY H C   
2586 O  O   . GLY B 109 ? 0.7578 0.7069 0.8052 0.0821  -0.1500 0.1239  109  GLY H O   
2587 N  N   . THR B 110 ? 0.7195 0.6442 0.7447 0.0689  -0.1540 0.1453  110  THR H N   
2588 C  CA  . THR B 110 ? 0.7335 0.6641 0.7358 0.0662  -0.1490 0.1466  110  THR H CA  
2589 C  C   . THR B 110 ? 0.7735 0.6877 0.7608 0.0719  -0.1606 0.1487  110  THR H C   
2590 O  O   . THR B 110 ? 0.7792 0.6754 0.7646 0.0708  -0.1682 0.1588  110  THR H O   
2591 C  CB  . THR B 110 ? 0.7821 0.7140 0.7710 0.0522  -0.1392 0.1581  110  THR H CB  
2592 O  OG1 . THR B 110 ? 0.7099 0.6649 0.7213 0.0469  -0.1283 0.1512  110  THR H OG1 
2593 C  CG2 . THR B 110 ? 0.7693 0.6997 0.7225 0.0470  -0.1340 0.1625  110  THR H CG2 
2594 N  N   . LEU B 111 ? 0.7093 0.6309 0.6890 0.0780  -0.1622 0.1375  111  LEU H N   
2595 C  CA  . LEU B 111 ? 0.7065 0.6178 0.6758 0.0830  -0.1752 0.1367  111  LEU H CA  
2596 C  C   . LEU B 111 ? 0.7702 0.6750 0.7054 0.0785  -0.1803 0.1489  111  LEU H C   
2597 O  O   . LEU B 111 ? 0.7844 0.6985 0.6946 0.0737  -0.1727 0.1466  111  LEU H O   
2598 C  CB  . LEU B 111 ? 0.7032 0.6233 0.6776 0.0897  -0.1759 0.1183  111  LEU H CB  
2599 C  CG  . LEU B 111 ? 0.7772 0.6926 0.7443 0.0936  -0.1902 0.1134  111  LEU H CG  
2600 C  CD1 . LEU B 111 ? 0.7622 0.6747 0.7548 0.0985  -0.1924 0.0988  111  LEU H CD1 
2601 C  CD2 . LEU B 111 ? 0.8420 0.7667 0.7774 0.0918  -0.1914 0.1081  111  LEU H CD2 
2602 N  N   . VAL B 112 ? 0.7215 0.6082 0.6540 0.0803  -0.1932 0.1613  112  VAL H N   
2603 C  CA  . VAL B 112 ? 0.7526 0.6265 0.6495 0.0789  -0.2038 0.1750  112  VAL H CA  
2604 C  C   . VAL B 112 ? 0.8463 0.7194 0.7477 0.0899  -0.2250 0.1683  112  VAL H C   
2605 O  O   . VAL B 112 ? 0.8275 0.7019 0.7645 0.0964  -0.2302 0.1595  112  VAL H O   
2606 C  CB  . VAL B 112 ? 0.8013 0.6524 0.6848 0.0725  -0.2035 0.1964  112  VAL H CB  
2607 C  CG1 . VAL B 112 ? 0.7760 0.6315 0.6762 0.0626  -0.1847 0.1974  112  VAL H CG1 
2608 C  CG2 . VAL B 112 ? 0.7963 0.6285 0.6965 0.0820  -0.2216 0.2033  112  VAL H CG2 
2609 N  N   . THR B 113 ? 0.8406 0.7132 0.7060 0.0906  -0.2363 0.1702  113  THR H N   
2610 C  CA  . THR B 113 ? 0.8363 0.7132 0.7057 0.1003  -0.2590 0.1616  113  THR H CA  
2611 C  C   . THR B 113 ? 0.9365 0.7946 0.7668 0.1027  -0.2790 0.1805  113  THR H C   
2612 O  O   . THR B 113 ? 0.9841 0.8359 0.7639 0.0946  -0.2752 0.1888  113  THR H O   
2613 C  CB  . THR B 113 ? 0.8707 0.7677 0.7318 0.0986  -0.2547 0.1404  113  THR H CB  
2614 O  OG1 . THR B 113 ? 0.8311 0.7391 0.7265 0.0975  -0.2366 0.1256  113  THR H OG1 
2615 C  CG2 . THR B 113 ? 0.8327 0.7379 0.6977 0.1063  -0.2787 0.1282  113  THR H CG2 
2616 N  N   . VAL B 114 ? 0.8737 0.7208 0.7258 0.1136  -0.2997 0.1874  114  VAL H N   
2617 C  CA  . VAL B 114 ? 0.9199 0.7457 0.7370 0.1198  -0.3249 0.2063  114  VAL H CA  
2618 C  C   . VAL B 114 ? 0.9930 0.8360 0.8131 0.1299  -0.3520 0.1917  114  VAL H C   
2619 O  O   . VAL B 114 ? 0.9538 0.8139 0.8269 0.1392  -0.3614 0.1750  114  VAL H O   
2620 C  CB  . VAL B 114 ? 0.9596 0.7598 0.7973 0.1279  -0.3345 0.2236  114  VAL H CB  
2621 C  CG1 . VAL B 114 ? 1.0187 0.7845 0.8024 0.1296  -0.3528 0.2509  114  VAL H CG1 
2622 C  CG2 . VAL B 114 ? 0.9195 0.7142 0.7797 0.1185  -0.3068 0.2258  114  VAL H CG2 
2623 N  N   . SER B 115 ? 1.0009 0.8402 0.7636 0.1263  -0.3635 0.1964  115  SER H N   
2624 C  CA  . SER B 115 ? 1.0271 0.8820 0.7845 0.1344  -0.3926 0.1831  115  SER H CA  
2625 C  C   . SER B 115 ? 1.1712 1.0043 0.8508 0.1312  -0.4100 0.2017  115  SER H C   
2626 O  O   . SER B 115 ? 1.1829 1.0042 0.8100 0.1160  -0.3878 0.2101  115  SER H O   
2627 C  CB  . SER B 115 ? 1.0347 0.9215 0.8120 0.1285  -0.3796 0.1521  115  SER H CB  
2628 O  OG  . SER B 115 ? 1.1161 1.0223 0.9084 0.1368  -0.4085 0.1347  115  SER H OG  
2629 N  N   . SER B 116 ? 1.1884 1.0164 0.8609 0.1455  -0.4505 0.2075  116  SER H N   
2630 C  CA  . SER B 116 ? 1.2810 1.0840 0.8756 0.1457  -0.4773 0.2270  116  SER H CA  
2631 C  C   . SER B 116 ? 1.3932 1.2170 0.9473 0.1370  -0.4823 0.2068  116  SER H C   
2632 O  O   . SER B 116 ? 1.4786 1.2834 0.9605 0.1351  -0.5052 0.2198  116  SER H O   
2633 C  CB  . SER B 116 ? 1.3470 1.1372 0.9588 0.1678  -0.5226 0.2402  116  SER H CB  
2634 O  OG  . SER B 116 ? 1.4131 1.2429 1.0942 0.1806  -0.5424 0.2119  116  SER H OG  
2635 N  N   . ALA B 117 ? 1.3038 1.1625 0.8999 0.1305  -0.4598 0.1753  117  ALA H N   
2636 C  CA  . ALA B 117 ? 1.3240 1.2048 0.8941 0.1215  -0.4593 0.1498  117  ALA H CA  
2637 C  C   . ALA B 117 ? 1.3960 1.2717 0.9182 0.1017  -0.4196 0.1470  117  ALA H C   
2638 O  O   . ALA B 117 ? 1.3339 1.2106 0.8845 0.0959  -0.3850 0.1473  117  ALA H O   
2639 C  CB  . ALA B 117 ? 1.2703 1.1883 0.9169 0.1266  -0.4595 0.1161  117  ALA H CB  
2640 N  N   . SER B 118 ? 1.4405 1.3113 0.8894 0.0915  -0.4259 0.1433  118  SER H N   
2641 C  CA  . SER B 118 ? 1.4691 1.3369 0.8654 0.0717  -0.3897 0.1366  118  SER H CA  
2642 C  C   . SER B 118 ? 1.4625 1.3619 0.9048 0.0666  -0.3606 0.1011  118  SER H C   
2643 O  O   . SER B 118 ? 1.3960 1.3179 0.8965 0.0759  -0.3725 0.0797  118  SER H O   
2644 C  CB  . SER B 118 ? 1.6111 1.4619 0.9113 0.0618  -0.4070 0.1421  118  SER H CB  
2645 O  OG  . SER B 118 ? 1.7695 1.5820 1.0015 0.0518  -0.3983 0.1751  118  SER H OG  
2646 N  N   . THR B 119 ? 1.4471 1.3468 0.8636 0.0515  -0.3218 0.0943  119  THR H N   
2647 C  CA  . THR B 119 ? 1.4095 1.3335 0.8660 0.0474  -0.2906 0.0631  119  THR H CA  
2648 C  C   . THR B 119 ? 1.4933 1.4328 0.9291 0.0433  -0.2995 0.0312  119  THR H C   
2649 O  O   . THR B 119 ? 1.5047 1.4499 0.9094 0.0309  -0.2741 0.0115  119  THR H O   
2650 C  CB  . THR B 119 ? 1.5718 1.4932 1.0166 0.0349  -0.2481 0.0670  119  THR H CB  
2651 O  OG1 . THR B 119 ? 1.5539 1.4978 1.0335 0.0329  -0.2210 0.0350  119  THR H OG1 
2652 C  CG2 . THR B 119 ? 1.6435 1.5437 0.9979 0.0178  -0.2396 0.0826  119  THR H CG2 
2653 N  N   . LYS B 120 ? 1.4601 1.4089 0.9218 0.0537  -0.3345 0.0229  120  LYS H N   
2654 C  CA  . LYS B 120 ? 1.4884 1.4537 0.9417 0.0507  -0.3497 -0.0085 120  LYS H CA  
2655 C  C   . LYS B 120 ? 1.4976 1.4807 1.0070 0.0492  -0.3213 -0.0413 120  LYS H C   
2656 O  O   . LYS B 120 ? 1.4331 1.4172 0.9990 0.0549  -0.3004 -0.0373 120  LYS H O   
2657 C  CB  . LYS B 120 ? 1.5238 1.4971 1.0010 0.0630  -0.3964 -0.0072 120  LYS H CB  
2658 C  CG  . LYS B 120 ? 1.7799 1.7326 1.1950 0.0668  -0.4318 0.0233  120  LYS H CG  
2659 C  CD  . LYS B 120 ? 1.8424 1.8046 1.3026 0.0843  -0.4771 0.0286  120  LYS H CD  
2660 C  CE  . LYS B 120 ? 1.9167 1.8561 1.3134 0.0908  -0.5176 0.0576  120  LYS H CE  
2661 N  NZ  . LYS B 120 ? 1.9587 1.8657 1.3407 0.0951  -0.5092 0.0968  120  LYS H NZ  
2662 N  N   . GLY B 121 ? 1.4885 1.4823 0.9785 0.0413  -0.3221 -0.0731 121  GLY H N   
2663 C  CA  . GLY B 121 ? 1.4498 1.4548 0.9837 0.0389  -0.2965 -0.1066 121  GLY H CA  
2664 C  C   . GLY B 121 ? 1.4447 1.4633 1.0359 0.0438  -0.3154 -0.1292 121  GLY H C   
2665 O  O   . GLY B 121 ? 1.4700 1.4973 1.0531 0.0452  -0.3516 -0.1312 121  GLY H O   
2666 N  N   . PRO B 122 ? 1.3190 1.3391 0.9685 0.0457  -0.2912 -0.1476 122  PRO H N   
2667 C  CA  . PRO B 122 ? 1.2805 1.3100 0.9853 0.0469  -0.3036 -0.1702 122  PRO H CA  
2668 C  C   . PRO B 122 ? 1.3623 1.4019 1.0457 0.0361  -0.3135 -0.2064 122  PRO H C   
2669 O  O   . PRO B 122 ? 1.4095 1.4469 1.0364 0.0274  -0.3043 -0.2188 122  PRO H O   
2670 C  CB  . PRO B 122 ? 1.2492 1.2680 1.0070 0.0506  -0.2711 -0.1758 122  PRO H CB  
2671 C  CG  . PRO B 122 ? 1.3232 1.3345 1.0477 0.0485  -0.2420 -0.1748 122  PRO H CG  
2672 C  CD  . PRO B 122 ? 1.3016 1.3132 0.9702 0.0470  -0.2525 -0.1478 122  PRO H CD  
2673 N  N   . SER B 123 ? 1.2863 1.3369 1.0183 0.0351  -0.3292 -0.2263 123  SER H N   
2674 C  CA  . SER B 123 ? 1.3120 1.3738 1.0405 0.0236  -0.3389 -0.2651 123  SER H CA  
2675 C  C   . SER B 123 ? 1.3082 1.3667 1.1086 0.0212  -0.3238 -0.2869 123  SER H C   
2676 O  O   . SER B 123 ? 1.2522 1.3147 1.1051 0.0266  -0.3314 -0.2757 123  SER H O   
2677 C  CB  . SER B 123 ? 1.3896 1.4725 1.0976 0.0225  -0.3845 -0.2667 123  SER H CB  
2678 O  OG  . SER B 123 ? 1.5492 1.6292 1.1736 0.0187  -0.3962 -0.2584 123  SER H OG  
2679 N  N   . VAL B 124 ? 1.2895 1.3369 1.0904 0.0127  -0.2996 -0.3173 124  VAL H N   
2680 C  CA  . VAL B 124 ? 1.2641 1.2984 1.1249 0.0091  -0.2808 -0.3369 124  VAL H CA  
2681 C  C   . VAL B 124 ? 1.3666 1.4152 1.2486 -0.0046 -0.2977 -0.3729 124  VAL H C   
2682 O  O   . VAL B 124 ? 1.4211 1.4761 1.2659 -0.0146 -0.3030 -0.4005 124  VAL H O   
2683 C  CB  . VAL B 124 ? 1.3132 1.3205 1.1710 0.0107  -0.2424 -0.3464 124  VAL H CB  
2684 C  CG1 . VAL B 124 ? 1.2809 1.2649 1.1962 0.0088  -0.2233 -0.3596 124  VAL H CG1 
2685 C  CG2 . VAL B 124 ? 1.2915 1.2913 1.1300 0.0233  -0.2274 -0.3130 124  VAL H CG2 
2686 N  N   . PHE B 125 ? 1.3012 1.3545 1.2438 -0.0070 -0.3036 -0.3757 125  PHE H N   
2687 C  CA  . PHE B 125 ? 1.3174 1.3861 1.2929 -0.0224 -0.3167 -0.4127 125  PHE H CA  
2688 C  C   . PHE B 125 ? 1.3591 1.4002 1.3847 -0.0308 -0.2863 -0.4286 125  PHE H C   
2689 O  O   . PHE B 125 ? 1.3218 1.3437 1.3756 -0.0234 -0.2692 -0.4045 125  PHE H O   
2690 C  CB  . PHE B 125 ? 1.3266 1.4325 1.3275 -0.0214 -0.3558 -0.4091 125  PHE H CB  
2691 C  CG  . PHE B 125 ? 1.3730 1.4975 1.3125 -0.0134 -0.3874 -0.3937 125  PHE H CG  
2692 C  CD1 . PHE B 125 ? 1.4664 1.5958 1.3483 -0.0222 -0.3972 -0.4163 125  PHE H CD1 
2693 C  CD2 . PHE B 125 ? 1.3717 1.5025 1.3042 0.0023  -0.4043 -0.3554 125  PHE H CD2 
2694 C  CE1 . PHE B 125 ? 1.5170 1.6563 1.3314 -0.0164 -0.4242 -0.3993 125  PHE H CE1 
2695 C  CE2 . PHE B 125 ? 1.4479 1.5874 1.3170 0.0090  -0.4324 -0.3383 125  PHE H CE2 
2696 C  CZ  . PHE B 125 ? 1.4862 1.6292 1.2943 -0.0008 -0.4425 -0.3594 125  PHE H CZ  
2697 N  N   . PRO B 126 ? 1.3450 1.3777 1.3745 -0.0463 -0.2771 -0.4682 126  PRO H N   
2698 C  CA  . PRO B 126 ? 1.3333 1.3299 1.4034 -0.0550 -0.2460 -0.4823 126  PRO H CA  
2699 C  C   . PRO B 126 ? 1.3611 1.3689 1.4921 -0.0695 -0.2519 -0.4964 126  PRO H C   
2700 O  O   . PRO B 126 ? 1.3627 1.4105 1.5086 -0.0780 -0.2809 -0.5144 126  PRO H O   
2701 C  CB  . PRO B 126 ? 1.4072 1.3870 1.4509 -0.0649 -0.2322 -0.5189 126  PRO H CB  
2702 C  CG  . PRO B 126 ? 1.5008 1.5158 1.4940 -0.0664 -0.2601 -0.5300 126  PRO H CG  
2703 C  CD  . PRO B 126 ? 1.4199 1.4706 1.4123 -0.0575 -0.2934 -0.5018 126  PRO H CD  
2704 N  N   . LEU B 127 ? 1.2944 1.2667 1.4603 -0.0725 -0.2244 -0.4881 127  LEU H N   
2705 C  CA  . LEU B 127 ? 1.2773 1.2521 1.5013 -0.0895 -0.2201 -0.5016 127  LEU H CA  
2706 C  C   . LEU B 127 ? 1.3577 1.2873 1.5947 -0.1070 -0.1902 -0.5296 127  LEU H C   
2707 O  O   . LEU B 127 ? 1.3612 1.2417 1.5824 -0.0992 -0.1640 -0.5146 127  LEU H O   
2708 C  CB  . LEU B 127 ? 1.2291 1.1942 1.4756 -0.0804 -0.2109 -0.4651 127  LEU H CB  
2709 C  CG  . LEU B 127 ? 1.2485 1.2439 1.4795 -0.0602 -0.2336 -0.4308 127  LEU H CG  
2710 C  CD1 . LEU B 127 ? 1.2082 1.1815 1.4558 -0.0530 -0.2164 -0.3982 127  LEU H CD1 
2711 C  CD2 . LEU B 127 ? 1.2702 1.3213 1.5255 -0.0629 -0.2696 -0.4434 127  LEU H CD2 
2712 N  N   . ALA B 128 ? 1.3382 1.2835 1.6036 -0.1300 -0.1958 -0.5707 128  ALA H N   
2713 C  CA  . ALA B 128 ? 1.3809 1.2840 1.6573 -0.1495 -0.1698 -0.6027 128  ALA H CA  
2714 C  C   . ALA B 128 ? 1.4286 1.3053 1.7560 -0.1708 -0.1464 -0.6094 128  ALA H C   
2715 O  O   . ALA B 128 ? 1.4059 1.3189 1.7734 -0.1782 -0.1577 -0.6080 128  ALA H O   
2716 C  CB  . ALA B 128 ? 1.4351 1.3684 1.7052 -0.1643 -0.1884 -0.6474 128  ALA H CB  
2717 N  N   . PRO B 129 ? 1.4025 1.2147 1.7295 -0.1814 -0.1132 -0.6178 129  PRO H N   
2718 C  CA  . PRO B 129 ? 1.4318 1.2130 1.8000 -0.2049 -0.0884 -0.6229 129  PRO H CA  
2719 C  C   . PRO B 129 ? 1.7102 1.5216 2.1246 -0.2370 -0.0929 -0.6705 129  PRO H C   
2720 O  O   . PRO B 129 ? 1.1863 1.0155 1.5932 -0.2441 -0.1057 -0.7050 129  PRO H O   
2721 C  CB  . PRO B 129 ? 1.4853 1.1836 1.8289 -0.2031 -0.0557 -0.6148 129  PRO H CB  
2722 C  CG  . PRO B 129 ? 1.5574 1.2530 1.8671 -0.1914 -0.0626 -0.6325 129  PRO H CG  
2723 C  CD  . PRO B 129 ? 1.4610 1.2230 1.7505 -0.1724 -0.0959 -0.6225 129  PRO H CD  
2724 N  N   . ALA B 140 ? 1.1655 0.7812 1.5072 -0.1917 -0.0142 -0.5120 140  ALA H N   
2725 C  CA  . ALA B 140 ? 1.1262 0.7509 1.4345 -0.1585 -0.0283 -0.4734 140  ALA H CA  
2726 C  C   . ALA B 140 ? 1.1498 0.8375 1.4499 -0.1421 -0.0588 -0.4829 140  ALA H C   
2727 O  O   . ALA B 140 ? 1.1281 0.8716 1.4551 -0.1535 -0.0770 -0.5066 140  ALA H O   
2728 C  CB  . ALA B 140 ? 1.0966 0.7328 1.4135 -0.1565 -0.0271 -0.4428 140  ALA H CB  
2729 N  N   . LEU B 141 ? 1.1139 0.7916 1.3767 -0.1166 -0.0640 -0.4664 141  LEU H N   
2730 C  CA  . LEU B 141 ? 1.1064 0.8372 1.3516 -0.1029 -0.0894 -0.4739 141  LEU H CA  
2731 C  C   . LEU B 141 ? 1.1275 0.8821 1.3515 -0.0782 -0.1032 -0.4352 141  LEU H C   
2732 O  O   . LEU B 141 ? 1.1197 0.8388 1.3280 -0.0632 -0.0910 -0.4054 141  LEU H O   
2733 C  CB  . LEU B 141 ? 1.1486 0.8603 1.3701 -0.0991 -0.0840 -0.4988 141  LEU H CB  
2734 C  CG  . LEU B 141 ? 1.2187 0.8807 1.4138 -0.0776 -0.0674 -0.4796 141  LEU H CG  
2735 C  CD1 . LEU B 141 ? 1.2271 0.9136 1.3925 -0.0619 -0.0762 -0.4888 141  LEU H CD1 
2736 C  CD2 . LEU B 141 ? 1.2943 0.8890 1.4981 -0.0881 -0.0421 -0.4949 141  LEU H CD2 
2737 N  N   . GLY B 142 ? 1.0574 0.8703 1.2807 -0.0744 -0.1298 -0.4362 142  GLY H N   
2738 C  CA  . GLY B 142 ? 1.0155 0.8518 1.2179 -0.0531 -0.1437 -0.4015 142  GLY H CA  
2739 C  C   . GLY B 142 ? 1.0789 0.9463 1.2446 -0.0410 -0.1618 -0.4047 142  GLY H C   
2740 O  O   . GLY B 142 ? 1.0918 0.9666 1.2461 -0.0490 -0.1655 -0.4358 142  GLY H O   
2741 N  N   . CYS B 143 ? 1.0377 0.9210 1.1822 -0.0232 -0.1716 -0.3725 143  CYS H N   
2742 C  CA  . CYS B 143 ? 1.0460 0.9583 1.1501 -0.0118 -0.1882 -0.3667 143  CYS H CA  
2743 C  C   . CYS B 143 ? 1.0076 0.9490 1.1119 -0.0027 -0.2082 -0.3371 143  CYS H C   
2744 O  O   . CYS B 143 ? 0.9552 0.8828 1.0766 0.0033  -0.1998 -0.3115 143  CYS H O   
2745 C  CB  . CYS B 143 ? 1.0728 0.9602 1.1468 0.0020  -0.1696 -0.3572 143  CYS H CB  
2746 S  SG  . CYS B 143 ? 1.1807 1.0832 1.2108 0.0000  -0.1721 -0.3866 143  CYS H SG  
2747 N  N   . LEU B 144 ? 0.9610 0.9395 1.0436 -0.0015 -0.2351 -0.3404 144  LEU H N   
2748 C  CA  . LEU B 144 ? 0.9307 0.9347 1.0111 0.0085  -0.2573 -0.3125 144  LEU H CA  
2749 C  C   . LEU B 144 ? 0.9993 1.0110 1.0239 0.0200  -0.2658 -0.2935 144  LEU H C   
2750 O  O   . LEU B 144 ? 1.0354 1.0536 1.0227 0.0157  -0.2703 -0.3117 144  LEU H O   
2751 C  CB  . LEU B 144 ? 0.9303 0.9706 1.0391 0.0007  -0.2868 -0.3295 144  LEU H CB  
2752 C  CG  . LEU B 144 ? 0.9543 1.0185 1.0742 0.0121  -0.3106 -0.3034 144  LEU H CG  
2753 C  CD1 . LEU B 144 ? 0.9195 0.9880 1.1021 0.0068  -0.3053 -0.3058 144  LEU H CD1 
2754 C  CD2 . LEU B 144 ? 1.0111 1.1105 1.1102 0.0143  -0.3493 -0.3110 144  LEU H CD2 
2755 N  N   . VAL B 145 ? 0.9252 0.9343 0.9430 0.0325  -0.2659 -0.2581 145  VAL H N   
2756 C  CA  . VAL B 145 ? 0.9395 0.9534 0.9073 0.0418  -0.2714 -0.2351 145  VAL H CA  
2757 C  C   . VAL B 145 ? 0.9969 1.0314 0.9673 0.0479  -0.3009 -0.2145 145  VAL H C   
2758 O  O   . VAL B 145 ? 0.9514 0.9825 0.9560 0.0535  -0.2993 -0.1960 145  VAL H O   
2759 C  CB  . VAL B 145 ? 0.9668 0.9571 0.9298 0.0506  -0.2442 -0.2130 145  VAL H CB  
2760 C  CG1 . VAL B 145 ? 0.9781 0.9745 0.8922 0.0569  -0.2465 -0.1913 145  VAL H CG1 
2761 C  CG2 . VAL B 145 ? 0.9733 0.9408 0.9440 0.0477  -0.2174 -0.2343 145  VAL H CG2 
2762 N  N   . LYS B 146 ? 1.0097 1.0644 0.9456 0.0465  -0.3289 -0.2203 146  LYS H N   
2763 C  CA  . LYS B 146 ? 1.0168 1.0907 0.9560 0.0538  -0.3631 -0.2046 146  LYS H CA  
2764 C  C   . LYS B 146 ? 1.1236 1.1950 0.9990 0.0606  -0.3785 -0.1785 146  LYS H C   
2765 O  O   . LYS B 146 ? 1.1576 1.2242 0.9762 0.0549  -0.3740 -0.1846 146  LYS H O   
2766 C  CB  . LYS B 146 ? 1.0705 1.1717 1.0348 0.0469  -0.3913 -0.2346 146  LYS H CB  
2767 C  CG  . LYS B 146 ? 1.2379 1.3595 1.2588 0.0538  -0.4141 -0.2289 146  LYS H CG  
2768 C  CD  . LYS B 146 ? 1.3596 1.5155 1.3985 0.0502  -0.4518 -0.2553 146  LYS H CD  
2769 C  CE  . LYS B 146 ? 1.4292 1.6087 1.5157 0.0625  -0.4817 -0.2450 146  LYS H CE  
2770 N  NZ  . LYS B 146 ? 1.5289 1.7023 1.5679 0.0789  -0.5080 -0.2102 146  LYS H NZ  
2771 N  N   . ASP B 147 ? 1.0946 1.1672 0.9801 0.0719  -0.3957 -0.1502 147  ASP H N   
2772 C  CA  . ASP B 147 ? 1.1390 1.2040 0.9720 0.0799  -0.4140 -0.1191 147  ASP H CA  
2773 C  C   . ASP B 147 ? 1.2596 1.3027 1.0340 0.0763  -0.3875 -0.1018 147  ASP H C   
2774 O  O   . ASP B 147 ? 1.3305 1.3702 1.0388 0.0708  -0.3950 -0.1013 147  ASP H O   
2775 C  CB  . ASP B 147 ? 1.2130 1.2938 1.0113 0.0808  -0.4566 -0.1258 147  ASP H CB  
2776 C  CG  . ASP B 147 ? 1.2820 1.3919 1.1419 0.0823  -0.4831 -0.1507 147  ASP H CG  
2777 O  OD1 . ASP B 147 ? 1.2923 1.4156 1.1658 0.0707  -0.4790 -0.1849 147  ASP H OD1 
2778 O  OD2 . ASP B 147 ? 1.3311 1.4507 1.2292 0.0946  -0.5065 -0.1377 147  ASP H OD2 
2779 N  N   . TYR B 148 ? 1.1836 1.2127 0.9813 0.0788  -0.3575 -0.0874 148  TYR H N   
2780 C  CA  . TYR B 148 ? 1.1979 1.2110 0.9531 0.0759  -0.3316 -0.0712 148  TYR H CA  
2781 C  C   . TYR B 148 ? 1.2501 1.2503 1.0138 0.0833  -0.3275 -0.0374 148  TYR H C   
2782 O  O   . TYR B 148 ? 1.2070 1.2078 1.0222 0.0905  -0.3318 -0.0306 148  TYR H O   
2783 C  CB  . TYR B 148 ? 1.1850 1.1946 0.9565 0.0706  -0.2961 -0.0912 148  TYR H CB  
2784 C  CG  . TYR B 148 ? 1.1430 1.1462 0.9762 0.0759  -0.2795 -0.0890 148  TYR H CG  
2785 C  CD1 . TYR B 148 ? 1.1455 1.1527 1.0272 0.0749  -0.2827 -0.1093 148  TYR H CD1 
2786 C  CD2 . TYR B 148 ? 1.1246 1.1165 0.9651 0.0802  -0.2601 -0.0672 148  TYR H CD2 
2787 C  CE1 . TYR B 148 ? 1.1111 1.1072 1.0407 0.0777  -0.2667 -0.1057 148  TYR H CE1 
2788 C  CE2 . TYR B 148 ? 1.0897 1.0732 0.9795 0.0845  -0.2473 -0.0641 148  TYR H CE2 
2789 C  CZ  . TYR B 148 ? 1.1552 1.1386 1.0860 0.0831  -0.2502 -0.0826 148  TYR H CZ  
2790 O  OH  . TYR B 148 ? 1.1096 1.0795 1.0800 0.0854  -0.2361 -0.0787 148  TYR H OH  
2791 N  N   . PHE B 149 ? 1.2424 1.2303 0.9562 0.0796  -0.3154 -0.0184 149  PHE H N   
2792 C  CA  . PHE B 149 ? 1.2258 1.1996 0.9438 0.0836  -0.3075 0.0119  149  PHE H CA  
2793 C  C   . PHE B 149 ? 1.3087 1.2750 0.9884 0.0747  -0.2778 0.0188  149  PHE H C   
2794 O  O   . PHE B 149 ? 1.3516 1.3174 0.9755 0.0655  -0.2747 0.0124  149  PHE H O   
2795 C  CB  . PHE B 149 ? 1.2758 1.2398 0.9751 0.0906  -0.3396 0.0372  149  PHE H CB  
2796 C  CG  . PHE B 149 ? 1.2705 1.2183 0.9856 0.0953  -0.3324 0.0655  149  PHE H CG  
2797 C  CD1 . PHE B 149 ? 1.2526 1.2035 1.0318 0.1034  -0.3317 0.0659  149  PHE H CD1 
2798 C  CD2 . PHE B 149 ? 1.3321 1.2605 0.9968 0.0891  -0.3229 0.0898  149  PHE H CD2 
2799 C  CE1 . PHE B 149 ? 1.2422 1.1776 1.0345 0.1062  -0.3236 0.0892  149  PHE H CE1 
2800 C  CE2 . PHE B 149 ? 1.3431 1.2560 1.0241 0.0915  -0.3149 0.1136  149  PHE H CE2 
2801 C  CZ  . PHE B 149 ? 1.2617 1.1787 1.0065 0.1005  -0.3157 0.1124  149  PHE H CZ  
2802 N  N   . PRO B 150 ? 1.2440 1.2057 0.9520 0.0759  -0.2552 0.0306  150  PRO H N   
2803 C  CA  . PRO B 150 ? 1.1881 1.1478 0.9551 0.0843  -0.2540 0.0379  150  PRO H CA  
2804 C  C   . PRO B 150 ? 1.2161 1.1836 1.0271 0.0860  -0.2364 0.0146  150  PRO H C   
2805 O  O   . PRO B 150 ? 1.2319 1.2071 1.0372 0.0831  -0.2349 -0.0098 150  PRO H O   
2806 C  CB  . PRO B 150 ? 1.2070 1.1554 0.9628 0.0814  -0.2396 0.0632  150  PRO H CB  
2807 C  CG  . PRO B 150 ? 1.3123 1.2619 1.0150 0.0697  -0.2213 0.0612  150  PRO H CG  
2808 C  CD  . PRO B 150 ? 1.2841 1.2437 0.9646 0.0670  -0.2264 0.0355  150  PRO H CD  
2809 N  N   . GLU B 151 ? 1.1348 1.0973 0.9859 0.0901  -0.2240 0.0219  151  GLU H N   
2810 C  CA  . GLU B 151 ? 1.1035 1.0657 0.9930 0.0929  -0.2085 0.0053  151  GLU H CA  
2811 C  C   . GLU B 151 ? 1.1729 1.1381 1.0585 0.0919  -0.1838 0.0031  151  GLU H C   
2812 O  O   . GLU B 151 ? 1.1681 1.1356 1.0328 0.0882  -0.1770 0.0189  151  GLU H O   
2813 C  CB  . GLU B 151 ? 1.0783 1.0312 1.0092 0.0975  -0.2117 0.0148  151  GLU H CB  
2814 C  CG  . GLU B 151 ? 1.1805 1.1343 1.1349 0.0983  -0.2283 0.0045  151  GLU H CG  
2815 C  CD  . GLU B 151 ? 1.4466 1.3916 1.4375 0.0979  -0.2179 -0.0107 151  GLU H CD  
2816 O  OE1 . GLU B 151 ? 1.3501 1.2928 1.3400 0.0965  -0.2070 -0.0287 151  GLU H OE1 
2817 O  OE2 . GLU B 151 ? 1.3837 1.3216 1.4027 0.0983  -0.2198 -0.0050 151  GLU H OE2 
2818 N  N   . PRO B 152 ? 1.1584 1.1239 1.0644 0.0948  -0.1698 -0.0175 152  PRO H N   
2819 C  CA  . PRO B 152 ? 1.1592 1.1165 1.0914 0.0975  -0.1725 -0.0368 152  PRO H CA  
2820 C  C   . PRO B 152 ? 1.2534 1.2154 1.1708 0.0939  -0.1689 -0.0650 152  PRO H C   
2821 O  O   . PRO B 152 ? 1.2843 1.2573 1.1650 0.0886  -0.1657 -0.0707 152  PRO H O   
2822 C  CB  . PRO B 152 ? 1.1563 1.1031 1.1208 0.1047  -0.1583 -0.0346 152  PRO H CB  
2823 C  CG  . PRO B 152 ? 1.2162 1.1765 1.1690 0.1055  -0.1426 -0.0325 152  PRO H CG  
2824 C  CD  . PRO B 152 ? 1.1814 1.1532 1.0937 0.0968  -0.1481 -0.0213 152  PRO H CD  
2825 N  N   . VAL B 153 ? 1.2029 1.1534 1.1466 0.0950  -0.1679 -0.0834 153  VAL H N   
2826 C  CA  . VAL B 153 ? 1.2243 1.1742 1.1624 0.0914  -0.1623 -0.1136 153  VAL H CA  
2827 C  C   . VAL B 153 ? 1.2454 1.1746 1.2160 0.0975  -0.1471 -0.1266 153  VAL H C   
2828 O  O   . VAL B 153 ? 1.2200 1.1310 1.2177 0.0994  -0.1493 -0.1196 153  VAL H O   
2829 C  CB  . VAL B 153 ? 1.2963 1.2527 1.2256 0.0830  -0.1810 -0.1287 153  VAL H CB  
2830 C  CG1 . VAL B 153 ? 1.3272 1.3016 1.2107 0.0780  -0.1954 -0.1230 153  VAL H CG1 
2831 C  CG2 . VAL B 153 ? 1.2655 1.2156 1.2279 0.0825  -0.1938 -0.1211 153  VAL H CG2 
2832 N  N   . THR B 154 ? 1.2053 1.1350 1.1713 0.1004  -0.1309 -0.1456 154  THR H N   
2833 C  CA  . THR B 154 ? 1.1946 1.1014 1.1894 0.1082  -0.1176 -0.1604 154  THR H CA  
2834 C  C   . THR B 154 ? 1.2377 1.1319 1.2345 0.0994  -0.1217 -0.1849 154  THR H C   
2835 O  O   . THR B 154 ? 1.2482 1.1595 1.2210 0.0891  -0.1314 -0.1962 154  THR H O   
2836 C  CB  . THR B 154 ? 1.2809 1.1966 1.2735 0.1149  -0.0986 -0.1760 154  THR H CB  
2837 O  OG1 . THR B 154 ? 1.2377 1.1788 1.2117 0.1140  -0.0955 -0.1604 154  THR H OG1 
2838 C  CG2 . THR B 154 ? 1.2654 1.1585 1.2948 0.1299  -0.0878 -0.1793 154  THR H CG2 
2839 N  N   . VAL B 155 ? 1.1755 1.0385 1.1994 0.1025  -0.1157 -0.1924 155  VAL H N   
2840 C  CA  . VAL B 155 ? 1.1891 1.0363 1.2193 0.0921  -0.1162 -0.2179 155  VAL H CA  
2841 C  C   . VAL B 155 ? 1.2491 1.0538 1.3044 0.0991  -0.1026 -0.2254 155  VAL H C   
2842 O  O   . VAL B 155 ? 1.2389 1.0177 1.3096 0.1015  -0.1035 -0.2072 155  VAL H O   
2843 C  CB  . VAL B 155 ? 1.2207 1.0773 1.2532 0.0784  -0.1332 -0.2155 155  VAL H CB  
2844 C  CG1 . VAL B 155 ? 1.1850 1.0327 1.2339 0.0807  -0.1383 -0.1867 155  VAL H CG1 
2845 C  CG2 . VAL B 155 ? 1.2421 1.0832 1.2874 0.0659  -0.1313 -0.2452 155  VAL H CG2 
2846 N  N   . SER B 156 ? 1.2204 1.0159 1.2764 0.1030  -0.0896 -0.2518 156  SER H N   
2847 C  CA  . SER B 156 ? 1.2311 0.9831 1.3090 0.1116  -0.0772 -0.2622 156  SER H CA  
2848 C  C   . SER B 156 ? 1.3217 1.0627 1.3971 0.0996  -0.0706 -0.2989 156  SER H C   
2849 O  O   . SER B 156 ? 1.3266 1.0989 1.3813 0.0914  -0.0719 -0.3186 156  SER H O   
2850 C  CB  . SER B 156 ? 1.2568 1.0095 1.3455 0.1321  -0.0669 -0.2599 156  SER H CB  
2851 O  OG  . SER B 156 ? 1.3133 1.0281 1.4228 0.1456  -0.0675 -0.2410 156  SER H OG  
2852 N  N   . TRP B 157 ? 1.3120 1.0066 1.4045 0.0964  -0.0641 -0.3079 157  TRP H N   
2853 C  CA  . TRP B 157 ? 1.3543 1.0307 1.4488 0.0830  -0.0564 -0.3445 157  TRP H CA  
2854 C  C   . TRP B 157 ? 1.4302 1.0773 1.5356 0.0975  -0.0394 -0.3657 157  TRP H C   
2855 O  O   . TRP B 157 ? 1.4220 1.0382 1.5435 0.1161  -0.0351 -0.3487 157  TRP H O   
2856 C  CB  . TRP B 157 ? 1.3500 0.9906 1.4575 0.0671  -0.0569 -0.3435 157  TRP H CB  
2857 C  CG  . TRP B 157 ? 1.3275 0.9966 1.4332 0.0530  -0.0716 -0.3271 157  TRP H CG  
2858 C  CD1 . TRP B 157 ? 1.3254 1.0024 1.4311 0.0591  -0.0795 -0.2923 157  TRP H CD1 
2859 C  CD2 . TRP B 157 ? 1.3287 1.0209 1.4375 0.0310  -0.0802 -0.3474 157  TRP H CD2 
2860 N  NE1 . TRP B 157 ? 1.2981 1.0014 1.4078 0.0433  -0.0910 -0.2898 157  TRP H NE1 
2861 C  CE2 . TRP B 157 ? 1.3409 1.0556 1.4547 0.0265  -0.0928 -0.3231 157  TRP H CE2 
2862 C  CE3 . TRP B 157 ? 1.3779 1.0758 1.4878 0.0146  -0.0794 -0.3857 157  TRP H CE3 
2863 C  CZ2 . TRP B 157 ? 1.3256 1.0705 1.4502 0.0084  -0.1056 -0.3357 157  TRP H CZ2 
2864 C  CZ3 . TRP B 157 ? 1.3900 1.1185 1.5084 -0.0047 -0.0935 -0.3978 157  TRP H CZ3 
2865 C  CH2 . TRP B 157 ? 1.3583 1.1110 1.4863 -0.0067 -0.1068 -0.3729 157  TRP H CH2 
2866 N  N   . ASN B 158 ? 1.4188 1.0754 1.5157 0.0893  -0.0310 -0.4042 158  ASN H N   
2867 C  CA  . ASN B 158 ? 1.4548 1.0900 1.5624 0.1013  -0.0126 -0.4336 158  ASN H CA  
2868 C  C   . ASN B 158 ? 1.4754 1.1275 1.5926 0.1264  -0.0066 -0.4200 158  ASN H C   
2869 O  O   . ASN B 158 ? 1.4805 1.1003 1.6241 0.1464  0.0037  -0.4240 158  ASN H O   
2870 C  CB  . ASN B 158 ? 1.4848 1.0535 1.6146 0.1016  -0.0028 -0.4459 158  ASN H CB  
2871 C  CG  . ASN B 158 ? 1.6882 1.2418 1.8135 0.0741  -0.0045 -0.4661 158  ASN H CG  
2872 O  OD1 . ASN B 158 ? 1.5600 1.1523 1.6679 0.0555  -0.0106 -0.4874 158  ASN H OD1 
2873 N  ND2 . ASN B 158 ? 1.5856 1.0809 1.7263 0.0701  0.0007  -0.4609 158  ASN H ND2 
2874 N  N   . SER B 159 ? 1.3990 1.1029 1.4959 0.1245  -0.0143 -0.4036 159  SER H N   
2875 C  CA  . SER B 159 ? 1.3708 1.1058 1.4717 0.1409  -0.0113 -0.3860 159  SER H CA  
2876 C  C   . SER B 159 ? 1.3990 1.1124 1.5268 0.1597  -0.0190 -0.3506 159  SER H C   
2877 O  O   . SER B 159 ? 1.3747 1.1107 1.5149 0.1749  -0.0171 -0.3373 159  SER H O   
2878 C  CB  . SER B 159 ? 1.4362 1.1857 1.5430 0.1499  0.0098  -0.4181 159  SER H CB  
2879 O  OG  . SER B 159 ? 1.5182 1.3086 1.5849 0.1323  0.0128  -0.4341 159  SER H OG  
2880 N  N   . GLY B 160 ? 1.3618 1.0343 1.4949 0.1555  -0.0282 -0.3357 160  GLY H N   
2881 C  CA  . GLY B 160 ? 1.3474 0.9917 1.4958 0.1692  -0.0374 -0.3018 160  GLY H CA  
2882 C  C   . GLY B 160 ? 1.4478 1.0255 1.6088 0.1729  -0.0353 -0.3028 160  GLY H C   
2883 O  O   . GLY B 160 ? 1.4354 0.9823 1.5958 0.1755  -0.0446 -0.2736 160  GLY H O   
2884 N  N   . ALA B 161 ? 1.4658 1.0172 1.6351 0.1722  -0.0222 -0.3363 161  ALA H N   
2885 C  CA  . ALA B 161 ? 1.5179 0.9987 1.6979 0.1754  -0.0175 -0.3410 161  ALA H CA  
2886 C  C   . ALA B 161 ? 1.5708 1.0161 1.7356 0.1561  -0.0239 -0.3206 161  ALA H C   
2887 O  O   . ALA B 161 ? 1.5974 0.9897 1.7637 0.1650  -0.0276 -0.2973 161  ALA H O   
2888 C  CB  . ALA B 161 ? 1.5740 1.0397 1.7601 0.1695  -0.0012 -0.3854 161  ALA H CB  
2889 N  N   . LEU B 162 ? 1.4877 0.9625 1.6378 0.1297  -0.0255 -0.3292 162  LEU H N   
2890 C  CA  . LEU B 162 ? 1.4723 0.9182 1.6142 0.1085  -0.0274 -0.3170 162  LEU H CA  
2891 C  C   . LEU B 162 ? 1.4390 0.9040 1.5715 0.1078  -0.0399 -0.2795 162  LEU H C   
2892 O  O   . LEU B 162 ? 1.3866 0.8994 1.5128 0.0939  -0.0473 -0.2774 162  LEU H O   
2893 C  CB  . LEU B 162 ? 1.4792 0.9431 1.6187 0.0802  -0.0234 -0.3486 162  LEU H CB  
2894 C  CG  . LEU B 162 ? 1.5543 0.9753 1.6957 0.0558  -0.0172 -0.3500 162  LEU H CG  
2895 C  CD1 . LEU B 162 ? 1.6189 0.9593 1.7645 0.0606  -0.0034 -0.3542 162  LEU H CD1 
2896 C  CD2 . LEU B 162 ? 1.5706 1.0240 1.7160 0.0293  -0.0170 -0.3835 162  LEU H CD2 
2897 N  N   . THR B 163 ? 1.3874 0.8118 1.5183 0.1231  -0.0433 -0.2504 163  THR H N   
2898 C  CA  . THR B 163 ? 1.3411 0.7714 1.4604 0.1230  -0.0539 -0.2142 163  THR H CA  
2899 C  C   . THR B 163 ? 1.3775 0.7651 1.4845 0.0994  -0.0481 -0.2048 163  THR H C   
2900 O  O   . THR B 163 ? 1.3418 0.7486 1.4404 0.0883  -0.0530 -0.1860 163  THR H O   
2901 C  CB  . THR B 163 ? 1.4247 0.8337 1.5458 0.1509  -0.0624 -0.1888 163  THR H CB  
2902 O  OG1 . THR B 163 ? 1.4760 0.8331 1.6073 0.1662  -0.0566 -0.2010 163  THR H OG1 
2903 C  CG2 . THR B 163 ? 1.3608 0.8321 1.4919 0.1671  -0.0708 -0.1844 163  THR H CG2 
2904 N  N   . SER B 164 ? 1.3530 0.6824 1.4601 0.0906  -0.0355 -0.2202 164  SER H N   
2905 C  CA  . SER B 164 ? 1.3661 0.6410 1.4610 0.0666  -0.0242 -0.2153 164  SER H CA  
2906 C  C   . SER B 164 ? 1.3328 0.6444 1.4347 0.0352  -0.0188 -0.2293 164  SER H C   
2907 O  O   . SER B 164 ? 1.3159 0.6480 1.4334 0.0202  -0.0133 -0.2623 164  SER H O   
2908 C  CB  . SER B 164 ? 1.4802 0.6859 1.5761 0.0653  -0.0110 -0.2330 164  SER H CB  
2909 O  OG  . SER B 164 ? 1.6009 0.8003 1.7076 0.0949  -0.0158 -0.2399 164  SER H OG  
2910 N  N   . GLY B 165 ? 1.2484 0.5654 1.3399 0.0257  -0.0208 -0.2050 165  GLY H N   
2911 C  CA  . GLY B 165 ? 1.2127 0.5645 1.3157 -0.0014 -0.0164 -0.2142 165  GLY H CA  
2912 C  C   . GLY B 165 ? 1.1737 0.6088 1.2944 0.0003  -0.0310 -0.2244 165  GLY H C   
2913 O  O   . GLY B 165 ? 1.1305 0.5974 1.2703 -0.0207 -0.0294 -0.2442 165  GLY H O   
2914 N  N   . VAL B 166 ? 1.0980 0.5681 1.2128 0.0249  -0.0459 -0.2101 166  VAL H N   
2915 C  CA  . VAL B 166 ? 1.0452 0.5871 1.1683 0.0292  -0.0607 -0.2156 166  VAL H CA  
2916 C  C   . VAL B 166 ? 1.0686 0.6388 1.1893 0.0295  -0.0694 -0.1897 166  VAL H C   
2917 O  O   . VAL B 166 ? 1.0675 0.6207 1.1739 0.0424  -0.0717 -0.1617 166  VAL H O   
2918 C  CB  . VAL B 166 ? 1.0854 0.6487 1.2033 0.0513  -0.0674 -0.2211 166  VAL H CB  
2919 C  CG1 . VAL B 166 ? 1.0390 0.6679 1.1546 0.0563  -0.0823 -0.2176 166  VAL H CG1 
2920 C  CG2 . VAL B 166 ? 1.1217 0.6701 1.2457 0.0469  -0.0589 -0.2553 166  VAL H CG2 
2921 N  N   . HIS B 167 ? 0.9942 0.6074 1.1311 0.0150  -0.0753 -0.2012 167  HIS H N   
2922 C  CA  . HIS B 167 ? 0.9492 0.5924 1.0901 0.0138  -0.0832 -0.1826 167  HIS H CA  
2923 C  C   . HIS B 167 ? 0.9544 0.6572 1.0973 0.0235  -0.1023 -0.1839 167  HIS H C   
2924 O  O   . HIS B 167 ? 0.9545 0.6917 1.1121 0.0145  -0.1110 -0.2052 167  HIS H O   
2925 C  CB  . HIS B 167 ? 0.9678 0.6057 1.1293 -0.0104 -0.0730 -0.1927 167  HIS H CB  
2926 C  CG  . HIS B 167 ? 1.0560 0.6290 1.2049 -0.0212 -0.0525 -0.1844 167  HIS H CG  
2927 N  ND1 . HIS B 167 ? 1.1313 0.6619 1.2797 -0.0320 -0.0388 -0.2029 167  HIS H ND1 
2928 C  CD2 . HIS B 167 ? 1.0865 0.6268 1.2171 -0.0222 -0.0446 -0.1586 167  HIS H CD2 
2929 C  CE1 . HIS B 167 ? 1.1590 0.6302 1.2874 -0.0392 -0.0233 -0.1859 167  HIS H CE1 
2930 N  NE2 . HIS B 167 ? 1.1373 0.6130 1.2528 -0.0343 -0.0264 -0.1594 167  HIS H NE2 
2931 N  N   . THR B 168 ? 0.8826 0.5961 1.0091 0.0415  -0.1097 -0.1612 168  THR H N   
2932 C  CA  . THR B 168 ? 0.8611 0.6237 0.9824 0.0496  -0.1260 -0.1585 168  THR H CA  
2933 C  C   . THR B 168 ? 0.8884 0.6717 1.0174 0.0478  -0.1343 -0.1397 168  THR H C   
2934 O  O   . THR B 168 ? 0.8789 0.6481 1.0009 0.0538  -0.1311 -0.1157 168  THR H O   
2935 C  CB  . THR B 168 ? 0.9980 0.7641 1.1002 0.0670  -0.1266 -0.1516 168  THR H CB  
2936 O  OG1 . THR B 168 ? 1.0048 0.7672 1.1050 0.0653  -0.1219 -0.1788 168  THR H OG1 
2937 C  CG2 . THR B 168 ? 0.9566 0.7643 1.0462 0.0747  -0.1401 -0.1385 168  THR H CG2 
2938 N  N   . PHE B 169 ? 0.8161 0.6327 0.9617 0.0394  -0.1457 -0.1531 169  PHE H N   
2939 C  CA  . PHE B 169 ? 0.7773 0.6172 0.9383 0.0378  -0.1551 -0.1421 169  PHE H CA  
2940 C  C   . PHE B 169 ? 0.8099 0.6735 0.9528 0.0522  -0.1694 -0.1203 169  PHE H C   
2941 O  O   . PHE B 169 ? 0.8087 0.6917 0.9331 0.0586  -0.1801 -0.1242 169  PHE H O   
2942 C  CB  . PHE B 169 ? 0.7989 0.6689 0.9898 0.0260  -0.1656 -0.1670 169  PHE H CB  
2943 C  CG  . PHE B 169 ? 0.8248 0.6718 1.0410 0.0075  -0.1477 -0.1853 169  PHE H CG  
2944 C  CD1 . PHE B 169 ? 0.8428 0.6789 1.0786 -0.0016 -0.1355 -0.1783 169  PHE H CD1 
2945 C  CD2 . PHE B 169 ? 0.8776 0.7087 1.0946 -0.0024 -0.1395 -0.2095 169  PHE H CD2 
2946 C  CE1 . PHE B 169 ? 0.8756 0.6849 1.1292 -0.0217 -0.1144 -0.1941 169  PHE H CE1 
2947 C  CE2 . PHE B 169 ? 0.9348 0.7384 1.1724 -0.0220 -0.1200 -0.2254 169  PHE H CE2 
2948 C  CZ  . PHE B 169 ? 0.9015 0.6945 1.1565 -0.0323 -0.1070 -0.2173 169  PHE H CZ  
2949 N  N   . PRO B 170 ? 0.7512 0.6134 0.8980 0.0554  -0.1693 -0.0989 170  PRO H N   
2950 C  CA  . PRO B 170 ? 0.7357 0.6181 0.8666 0.0671  -0.1825 -0.0785 170  PRO H CA  
2951 C  C   . PRO B 170 ? 0.8053 0.7229 0.9405 0.0687  -0.2043 -0.0858 170  PRO H C   
2952 O  O   . PRO B 170 ? 0.8002 0.7318 0.9642 0.0615  -0.2112 -0.1025 170  PRO H O   
2953 C  CB  . PRO B 170 ? 0.7370 0.6072 0.8771 0.0664  -0.1761 -0.0602 170  PRO H CB  
2954 C  CG  . PRO B 170 ? 0.7933 0.6484 0.9588 0.0526  -0.1636 -0.0748 170  PRO H CG  
2955 C  CD  . PRO B 170 ? 0.7604 0.5992 0.9225 0.0466  -0.1552 -0.0932 170  PRO H CD  
2956 N  N   . ALA B 171 ? 0.7809 0.7119 0.8871 0.0776  -0.2156 -0.0740 171  ALA H N   
2957 C  CA  . ALA B 171 ? 0.7931 0.7508 0.8891 0.0806  -0.2389 -0.0766 171  ALA H CA  
2958 C  C   . ALA B 171 ? 0.8329 0.8036 0.9490 0.0849  -0.2550 -0.0649 171  ALA H C   
2959 O  O   . ALA B 171 ? 0.8106 0.7760 0.9141 0.0916  -0.2562 -0.0414 171  ALA H O   
2960 C  CB  . ALA B 171 ? 0.8170 0.7772 0.8685 0.0862  -0.2408 -0.0657 171  ALA H CB  
2961 N  N   . VAL B 172 ? 0.8077 0.7964 0.9585 0.0811  -0.2676 -0.0831 172  VAL H N   
2962 C  CA  . VAL B 172 ? 0.8043 0.8088 0.9835 0.0872  -0.2849 -0.0767 172  VAL H CA  
2963 C  C   . VAL B 172 ? 0.8764 0.8977 1.0312 0.0973  -0.3152 -0.0682 172  VAL H C   
2964 O  O   . VAL B 172 ? 0.8911 0.9239 1.0238 0.0954  -0.3283 -0.0810 172  VAL H O   
2965 C  CB  . VAL B 172 ? 0.8542 0.8737 1.0907 0.0794  -0.2840 -0.1007 172  VAL H CB  
2966 C  CG1 . VAL B 172 ? 0.8316 0.8292 1.0896 0.0717  -0.2558 -0.0973 172  VAL H CG1 
2967 C  CG2 . VAL B 172 ? 0.8723 0.9037 1.1187 0.0686  -0.2857 -0.1309 172  VAL H CG2 
2968 N  N   . LEU B 173 ? 0.8413 0.8608 0.9968 0.1075  -0.3265 -0.0466 173  LEU H N   
2969 C  CA  . LEU B 173 ? 0.8754 0.9031 1.0043 0.1183  -0.3571 -0.0334 173  LEU H CA  
2970 C  C   . LEU B 173 ? 0.9507 1.0078 1.1173 0.1223  -0.3863 -0.0540 173  LEU H C   
2971 O  O   . LEU B 173 ? 0.9151 0.9857 1.1411 0.1213  -0.3835 -0.0692 173  LEU H O   
2972 C  CB  . LEU B 173 ? 0.8685 0.8803 0.9934 0.1278  -0.3587 -0.0050 173  LEU H CB  
2973 C  CG  . LEU B 173 ? 0.9517 0.9448 1.0148 0.1307  -0.3612 0.0219  173  LEU H CG  
2974 C  CD1 . LEU B 173 ? 0.9374 0.9093 1.0019 0.1331  -0.3467 0.0450  173  LEU H CD1 
2975 C  CD2 . LEU B 173 ? 1.0302 1.0281 1.0647 0.1400  -0.3966 0.0308  173  LEU H CD2 
2976 N  N   . GLN B 174 ? 0.9650 1.0330 1.0968 0.1255  -0.4137 -0.0566 174  GLN H N   
2977 C  CA  . GLN B 174 ? 0.9899 1.0884 1.1513 0.1309  -0.4487 -0.0754 174  GLN H CA  
2978 C  C   . GLN B 174 ? 1.0600 1.1581 1.2226 0.1494  -0.4810 -0.0533 174  GLN H C   
2979 O  O   . GLN B 174 ? 1.0487 1.1195 1.1779 0.1552  -0.4746 -0.0234 174  GLN H O   
2980 C  CB  . GLN B 174 ? 1.0516 1.1590 1.1663 0.1247  -0.4646 -0.0891 174  GLN H CB  
2981 C  CG  . GLN B 174 ? 1.2467 1.3584 1.3716 0.1076  -0.4392 -0.1183 174  GLN H CG  
2982 C  CD  . GLN B 174 ? 1.4891 1.6076 1.5641 0.1014  -0.4540 -0.1325 174  GLN H CD  
2983 O  OE1 . GLN B 174 ? 1.4258 1.5713 1.5213 0.0982  -0.4780 -0.1585 174  GLN H OE1 
2984 N  NE2 . GLN B 174 ? 1.3901 1.4859 1.3996 0.0986  -0.4395 -0.1177 174  GLN H NE2 
2985 N  N   . SER B 175 ? 1.0451 1.1729 1.2465 0.1588  -0.5173 -0.0687 175  SER H N   
2986 C  CA  . SER B 175 ? 1.0779 1.2066 1.2853 0.1797  -0.5557 -0.0505 175  SER H CA  
2987 C  C   . SER B 175 ? 1.1881 1.2928 1.3066 0.1856  -0.5805 -0.0230 175  SER H C   
2988 O  O   . SER B 175 ? 1.2086 1.2954 1.3105 0.2017  -0.6044 0.0035  175  SER H O   
2989 C  CB  . SER B 175 ? 1.1388 1.3105 1.4153 0.1881  -0.5895 -0.0787 175  SER H CB  
2990 O  OG  . SER B 175 ? 1.2903 1.4631 1.5697 0.2112  -0.6338 -0.0619 175  SER H OG  
2991 N  N   . SER B 176 ? 1.1665 1.2679 1.2269 0.1714  -0.5726 -0.0300 176  SER H N   
2992 C  CA  . SER B 176 ? 1.2233 1.3010 1.1909 0.1707  -0.5872 -0.0081 176  SER H CA  
2993 C  C   . SER B 176 ? 1.2602 1.2984 1.1786 0.1667  -0.5560 0.0241  176  SER H C   
2994 O  O   . SER B 176 ? 1.3044 1.3164 1.1511 0.1686  -0.5685 0.0501  176  SER H O   
2995 C  CB  . SER B 176 ? 1.2886 1.3794 1.2190 0.1548  -0.5836 -0.0329 176  SER H CB  
2996 O  OG  . SER B 176 ? 1.3246 1.4138 1.2705 0.1394  -0.5380 -0.0486 176  SER H OG  
2997 N  N   . GLY B 177 ? 1.1566 1.1904 1.1127 0.1602  -0.5166 0.0214  177  GLY H N   
2998 C  CA  . GLY B 177 ? 1.1416 1.1449 1.0641 0.1548  -0.4847 0.0460  177  GLY H CA  
2999 C  C   . GLY B 177 ? 1.1836 1.1840 1.0723 0.1383  -0.4513 0.0358  177  GLY H C   
3000 O  O   . GLY B 177 ? 1.1714 1.1506 1.0272 0.1326  -0.4264 0.0539  177  GLY H O   
3001 N  N   . LEU B 178 ? 1.1362 1.1590 1.0382 0.1305  -0.4501 0.0044  178  LEU H N   
3002 C  CA  . LEU B 178 ? 1.1240 1.1466 1.0024 0.1164  -0.4212 -0.0126 178  LEU H CA  
3003 C  C   . LEU B 178 ? 1.1034 1.1339 1.0427 0.1108  -0.3945 -0.0346 178  LEU H C   
3004 O  O   . LEU B 178 ? 1.0699 1.1182 1.0639 0.1123  -0.4050 -0.0526 178  LEU H O   
3005 C  CB  . LEU B 178 ? 1.1739 1.2098 1.0120 0.1104  -0.4413 -0.0326 178  LEU H CB  
3006 C  CG  . LEU B 178 ? 1.2942 1.3154 1.0496 0.1100  -0.4594 -0.0131 178  LEU H CG  
3007 C  CD1 . LEU B 178 ? 1.3459 1.3843 1.0818 0.1115  -0.4996 -0.0286 178  LEU H CD1 
3008 C  CD2 . LEU B 178 ? 1.3266 1.3340 1.0267 0.0968  -0.4265 -0.0135 178  LEU H CD2 
3009 N  N   . TYR B 179 ? 1.0316 1.0484 0.9604 0.1038  -0.3604 -0.0340 179  TYR H N   
3010 C  CA  . TYR B 179 ? 0.9836 0.9987 0.9580 0.0986  -0.3347 -0.0507 179  TYR H CA  
3011 C  C   . TYR B 179 ? 1.0631 1.0898 1.0482 0.0896  -0.3330 -0.0845 179  TYR H C   
3012 O  O   . TYR B 179 ? 1.1018 1.1343 1.0463 0.0856  -0.3413 -0.0952 179  TYR H O   
3013 C  CB  . TYR B 179 ? 0.9694 0.9653 0.9290 0.0969  -0.3039 -0.0373 179  TYR H CB  
3014 C  CG  . TYR B 179 ? 0.9632 0.9472 0.9287 0.1029  -0.3008 -0.0090 179  TYR H CG  
3015 C  CD1 . TYR B 179 ? 0.9489 0.9278 0.9607 0.1046  -0.2927 -0.0070 179  TYR H CD1 
3016 C  CD2 . TYR B 179 ? 0.9935 0.9691 0.9158 0.1050  -0.3043 0.0146  179  TYR H CD2 
3017 C  CE1 . TYR B 179 ? 0.9366 0.9039 0.9532 0.1091  -0.2895 0.0164  179  TYR H CE1 
3018 C  CE2 . TYR B 179 ? 0.9870 0.9498 0.9158 0.1092  -0.3011 0.0390  179  TYR H CE2 
3019 C  CZ  . TYR B 179 ? 1.0279 0.9874 1.0048 0.1117  -0.2944 0.0390  179  TYR H CZ  
3020 O  OH  . TYR B 179 ? 1.0089 0.9552 0.9914 0.1148  -0.2909 0.0606  179  TYR H OH  
3021 N  N   . SER B 180 ? 0.9935 1.0209 1.0304 0.0847  -0.3208 -0.1019 180  SER H N   
3022 C  CA  . SER B 180 ? 1.0012 1.0340 1.0540 0.0740  -0.3147 -0.1347 180  SER H CA  
3023 C  C   . SER B 180 ? 1.0319 1.0435 1.1159 0.0676  -0.2839 -0.1423 180  SER H C   
3024 O  O   . SER B 180 ? 1.0038 1.0127 1.1297 0.0654  -0.2780 -0.1416 180  SER H O   
3025 C  CB  . SER B 180 ? 1.0459 1.1067 1.1294 0.0712  -0.3422 -0.1560 180  SER H CB  
3026 O  OG  . SER B 180 ? 1.1612 1.2361 1.2008 0.0733  -0.3687 -0.1586 180  SER H OG  
3027 N  N   . LEU B 181 ? 0.9954 0.9899 1.0566 0.0645  -0.2640 -0.1497 181  LEU H N   
3028 C  CA  . LEU B 181 ? 0.9767 0.9445 1.0577 0.0601  -0.2372 -0.1559 181  LEU H CA  
3029 C  C   . LEU B 181 ? 1.0559 1.0222 1.1515 0.0480  -0.2332 -0.1901 181  LEU H C   
3030 O  O   . LEU B 181 ? 1.0825 1.0662 1.1600 0.0443  -0.2466 -0.2088 181  LEU H O   
3031 C  CB  . LEU B 181 ? 0.9753 0.9248 1.0261 0.0674  -0.2194 -0.1420 181  LEU H CB  
3032 C  CG  . LEU B 181 ? 1.0164 0.9340 1.0827 0.0685  -0.1956 -0.1382 181  LEU H CG  
3033 C  CD1 . LEU B 181 ? 1.0026 0.9125 1.0541 0.0792  -0.1877 -0.1114 181  LEU H CD1 
3034 C  CD2 . LEU B 181 ? 1.0579 0.9592 1.1222 0.0645  -0.1822 -0.1630 181  LEU H CD2 
3035 N  N   . SER B 182 ? 0.9998 0.9428 1.1250 0.0403  -0.2146 -0.1982 182  SER H N   
3036 C  CA  . SER B 182 ? 1.0161 0.9488 1.1564 0.0269  -0.2057 -0.2297 182  SER H CA  
3037 C  C   . SER B 182 ? 1.0611 0.9494 1.2012 0.0264  -0.1786 -0.2266 182  SER H C   
3038 O  O   . SER B 182 ? 1.0365 0.9054 1.1741 0.0340  -0.1689 -0.2012 182  SER H O   
3039 C  CB  . SER B 182 ? 1.0499 0.9999 1.2341 0.0136  -0.2133 -0.2477 182  SER H CB  
3040 O  OG  . SER B 182 ? 1.1509 1.1418 1.3371 0.0183  -0.2429 -0.2475 182  SER H OG  
3041 N  N   . SER B 183 ? 1.0377 0.9080 1.1791 0.0179  -0.1677 -0.2527 183  SER H N   
3042 C  CA  . SER B 183 ? 1.0461 0.8684 1.1870 0.0182  -0.1441 -0.2519 183  SER H CA  
3043 C  C   . SER B 183 ? 1.0959 0.8992 1.2549 0.0007  -0.1340 -0.2844 183  SER H C   
3044 O  O   . SER B 183 ? 1.1025 0.9297 1.2615 -0.0070 -0.1440 -0.3116 183  SER H O   
3045 C  CB  . SER B 183 ? 1.1107 0.9235 1.2230 0.0343  -0.1385 -0.2449 183  SER H CB  
3046 O  OG  . SER B 183 ? 1.2299 0.9956 1.3447 0.0394  -0.1198 -0.2390 183  SER H OG  
3047 N  N   . VAL B 184 ? 1.0471 0.8053 1.2188 -0.0071 -0.1145 -0.2811 184  VAL H N   
3048 C  CA  . VAL B 184 ? 1.0750 0.8052 1.2650 -0.0269 -0.1004 -0.3091 184  VAL H CA  
3049 C  C   . VAL B 184 ? 1.1308 0.7965 1.3095 -0.0240 -0.0789 -0.3017 184  VAL H C   
3050 O  O   . VAL B 184 ? 1.1209 0.7621 1.2868 -0.0120 -0.0743 -0.2713 184  VAL H O   
3051 C  CB  . VAL B 184 ? 1.1240 0.8643 1.3480 -0.0478 -0.0977 -0.3166 184  VAL H CB  
3052 C  CG1 . VAL B 184 ? 1.1514 0.9124 1.4013 -0.0684 -0.1011 -0.3569 184  VAL H CG1 
3053 C  CG2 . VAL B 184 ? 1.0773 0.8595 1.3109 -0.0410 -0.1135 -0.2963 184  VAL H CG2 
3054 N  N   . VAL B 185 ? 1.1047 0.7411 1.2885 -0.0355 -0.0670 -0.3298 185  VAL H N   
3055 C  CA  . VAL B 185 ? 1.1364 0.7038 1.3112 -0.0342 -0.0471 -0.3272 185  VAL H CA  
3056 C  C   . VAL B 185 ? 1.2135 0.7497 1.4078 -0.0629 -0.0308 -0.3498 185  VAL H C   
3057 O  O   . VAL B 185 ? 1.2137 0.7859 1.4304 -0.0812 -0.0359 -0.3799 185  VAL H O   
3058 C  CB  . VAL B 185 ? 1.2045 0.7583 1.3647 -0.0166 -0.0456 -0.3392 185  VAL H CB  
3059 C  CG1 . VAL B 185 ? 1.2224 0.8007 1.3901 -0.0293 -0.0481 -0.3809 185  VAL H CG1 
3060 C  CG2 . VAL B 185 ? 1.2431 0.7228 1.3950 -0.0082 -0.0291 -0.3294 185  VAL H CG2 
3061 N  N   . THR B 186 ? 1.1888 0.6567 1.3734 -0.0676 -0.0119 -0.3355 186  THR H N   
3062 C  CA  . THR B 186 ? 1.2242 0.6474 1.4211 -0.0965 0.0092  -0.3534 186  THR H CA  
3063 C  C   . THR B 186 ? 1.3186 0.6768 1.5021 -0.0917 0.0218  -0.3642 186  THR H C   
3064 O  O   . THR B 186 ? 1.3273 0.6392 1.4867 -0.0705 0.0235  -0.3383 186  THR H O   
3065 C  CB  . THR B 186 ? 1.3169 0.7138 1.5105 -0.1110 0.0223  -0.3292 186  THR H CB  
3066 O  OG1 . THR B 186 ? 1.3927 0.7044 1.5668 -0.1219 0.0449  -0.3222 186  THR H OG1 
3067 C  CG2 . THR B 186 ? 1.2544 0.6691 1.4294 -0.0892 0.0099  -0.2906 186  THR H CG2 
3068 N  N   . VAL B 187 ? 1.3024 0.6609 1.5033 -0.1093 0.0282  -0.4038 187  VAL H N   
3069 C  CA  . VAL B 187 ? 1.3611 0.6618 1.5546 -0.1062 0.0405  -0.4221 187  VAL H CA  
3070 C  C   . VAL B 187 ? 1.4826 0.7413 1.6924 -0.1419 0.0622  -0.4513 187  VAL H C   
3071 O  O   . VAL B 187 ? 1.4613 0.7517 1.6936 -0.1684 0.0651  -0.4618 187  VAL H O   
3072 C  CB  . VAL B 187 ? 1.3965 0.7414 1.5916 -0.0901 0.0270  -0.4479 187  VAL H CB  
3073 C  CG1 . VAL B 187 ? 1.3515 0.7256 1.5293 -0.0559 0.0114  -0.4207 187  VAL H CG1 
3074 C  CG2 . VAL B 187 ? 1.3740 0.7870 1.5905 -0.1110 0.0160  -0.4834 187  VAL H CG2 
3075 N  N   . PRO B 188 ? 1.5144 0.7085 1.7192 -0.1446 0.0773  -0.4702 188  PRO H N   
3076 C  CA  . PRO B 188 ? 1.5712 0.7260 1.7927 -0.1819 0.0992  -0.5001 188  PRO H CA  
3077 C  C   . PRO B 188 ? 1.6303 0.8396 1.8817 -0.2017 0.0939  -0.5511 188  PRO H C   
3078 O  O   . PRO B 188 ? 1.6118 0.8591 1.8607 -0.1839 0.0788  -0.5683 188  PRO H O   
3079 C  CB  . PRO B 188 ? 1.6681 0.7215 1.8672 -0.1733 0.1165  -0.4929 188  PRO H CB  
3080 C  CG  . PRO B 188 ? 1.7012 0.7640 1.8871 -0.1321 0.1004  -0.4824 188  PRO H CG  
3081 C  CD  . PRO B 188 ? 1.5621 0.7116 1.7489 -0.1145 0.0770  -0.4650 188  PRO H CD  
3082 N  N   . SER B 189 ? 1.6109 0.8220 1.8897 -0.2403 0.1076  -0.5764 189  SER H N   
3083 C  CA  . SER B 189 ? 1.6167 0.8784 1.9288 -0.2653 0.1024  -0.6272 189  SER H CA  
3084 C  C   . SER B 189 ? 1.7315 0.9578 2.0385 -0.2658 0.1090  -0.6633 189  SER H C   
3085 O  O   . SER B 189 ? 1.7212 1.0043 2.0422 -0.2716 0.0940  -0.7008 189  SER H O   
3086 C  CB  . SER B 189 ? 1.6792 0.9420 2.0260 -0.3075 0.1198  -0.6451 189  SER H CB  
3087 O  OG  . SER B 189 ? 1.8618 1.0272 2.1955 -0.3260 0.1526  -0.6371 189  SER H OG  
3088 N  N   . SER B 190 ? 1.7474 0.8796 2.0334 -0.2593 0.1302  -0.6527 190  SER H N   
3089 C  CA  . SER B 190 ? 1.8043 0.8922 2.0867 -0.2578 0.1397  -0.6862 190  SER H CA  
3090 C  C   . SER B 190 ? 1.8328 0.9566 2.0991 -0.2211 0.1210  -0.6888 190  SER H C   
3091 O  O   . SER B 190 ? 1.8385 0.9876 2.1111 -0.2265 0.1173  -0.7309 190  SER H O   
3092 C  CB  . SER B 190 ? 1.9178 0.8896 2.1828 -0.2591 0.1664  -0.6701 190  SER H CB  
3093 O  OG  . SER B 190 ? 1.9825 0.9213 2.2216 -0.2375 0.1652  -0.6157 190  SER H OG  
3094 N  N   . SER B 191 ? 1.7628 0.8913 2.0081 -0.1861 0.1100  -0.6452 191  SER H N   
3095 C  CA  . SER B 191 ? 1.7372 0.8975 1.9672 -0.1498 0.0955  -0.6407 191  SER H CA  
3096 C  C   . SER B 191 ? 1.7497 1.0049 1.9813 -0.1505 0.0742  -0.6650 191  SER H C   
3097 O  O   . SER B 191 ? 1.7505 1.0197 1.9706 -0.1323 0.0711  -0.6818 191  SER H O   
3098 C  CB  . SER B 191 ? 1.7279 0.8816 1.9404 -0.1184 0.0872  -0.5872 191  SER H CB  
3099 O  OG  . SER B 191 ? 1.6721 0.8915 1.8865 -0.1234 0.0710  -0.5658 191  SER H OG  
3100 N  N   . LEU B 192 ? 1.6597 0.9789 1.9031 -0.1681 0.0588  -0.6625 192  LEU H N   
3101 C  CA  . LEU B 192 ? 1.6121 1.0218 1.8539 -0.1690 0.0331  -0.6778 192  LEU H CA  
3102 C  C   . LEU B 192 ? 1.6913 1.1204 1.9232 -0.1722 0.0298  -0.7237 192  LEU H C   
3103 O  O   . LEU B 192 ? 1.6646 1.1389 1.8730 -0.1533 0.0151  -0.7220 192  LEU H O   
3104 C  CB  . LEU B 192 ? 1.5849 1.0430 1.8544 -0.1970 0.0217  -0.6850 192  LEU H CB  
3105 C  CG  . LEU B 192 ? 1.6144 1.0588 1.8970 -0.2009 0.0277  -0.6472 192  LEU H CG  
3106 C  CD1 . LEU B 192 ? 1.6075 1.0925 1.9285 -0.2340 0.0235  -0.6690 192  LEU H CD1 
3107 C  CD2 . LEU B 192 ? 1.5837 1.0635 1.8476 -0.1715 0.0105  -0.6036 192  LEU H CD2 
3108 N  N   . GLY B 193 ? 1.6949 1.0879 1.9424 -0.1978 0.0452  -0.7644 193  GLY H N   
3109 C  CA  . GLY B 193 ? 1.7287 1.1342 1.9683 -0.2072 0.0448  -0.8147 193  GLY H CA  
3110 C  C   . GLY B 193 ? 1.7875 1.1631 2.0028 -0.1795 0.0561  -0.8188 193  GLY H C   
3111 O  O   . GLY B 193 ? 1.7913 1.1999 1.9881 -0.1795 0.0502  -0.8521 193  GLY H O   
3112 N  N   . THR B 194 ? 1.7470 1.0604 1.9624 -0.1560 0.0721  -0.7862 194  THR H N   
3113 C  CA  . THR B 194 ? 1.7673 1.0486 1.9701 -0.1264 0.0841  -0.7887 194  THR H CA  
3114 C  C   . THR B 194 ? 1.7414 1.0660 1.9267 -0.0939 0.0706  -0.7504 194  THR H C   
3115 O  O   . THR B 194 ? 1.7246 1.0800 1.8932 -0.0783 0.0697  -0.7649 194  THR H O   
3116 C  CB  . THR B 194 ? 1.9209 1.1032 2.1374 -0.1186 0.1075  -0.7787 194  THR H CB  
3117 O  OG1 . THR B 194 ? 1.9054 1.0638 2.1245 -0.1132 0.1046  -0.7289 194  THR H OG1 
3118 C  CG2 . THR B 194 ? 1.9492 1.0797 2.1809 -0.1500 0.1255  -0.8220 194  THR H CG2 
3119 N  N   . GLN B 195 ? 1.6570 0.9811 1.8458 -0.0857 0.0625  -0.7025 195  GLN H N   
3120 C  CA  . GLN B 195 ? 1.6028 0.9605 1.7790 -0.0570 0.0503  -0.6611 195  GLN H CA  
3121 C  C   . GLN B 195 ? 1.6243 1.0692 1.7818 -0.0601 0.0284  -0.6619 195  GLN H C   
3122 O  O   . GLN B 195 ? 1.5824 1.0658 1.7429 -0.0779 0.0125  -0.6547 195  GLN H O   
3123 C  CB  . GLN B 195 ? 1.5872 0.9125 1.7702 -0.0503 0.0490  -0.6127 195  GLN H CB  
3124 C  CG  . GLN B 195 ? 1.6711 0.9089 1.8607 -0.0336 0.0656  -0.5967 195  GLN H CG  
3125 C  CD  . GLN B 195 ? 1.7533 0.9904 1.9381 0.0048  0.0609  -0.5657 195  GLN H CD  
3126 O  OE1 . GLN B 195 ? 1.7153 0.9099 1.9075 0.0264  0.0713  -0.5742 195  GLN H OE1 
3127 N  NE2 . GLN B 195 ? 1.5257 0.8075 1.7020 0.0146  0.0453  -0.5296 195  GLN H NE2 
3128 N  N   . THR B 196 ? 1.5969 1.0707 1.7351 -0.0413 0.0283  -0.6692 196  THR H N   
3129 C  CA  . THR B 196 ? 1.5700 1.1173 1.6804 -0.0417 0.0101  -0.6693 196  THR H CA  
3130 C  C   . THR B 196 ? 1.5709 1.1423 1.6762 -0.0207 -0.0008 -0.6193 196  THR H C   
3131 O  O   . THR B 196 ? 1.5507 1.1352 1.6444 0.0012  0.0037  -0.6080 196  THR H O   
3132 C  CB  . THR B 196 ? 1.7324 1.2949 1.8198 -0.0392 0.0198  -0.7086 196  THR H CB  
3133 O  OG1 . THR B 196 ? 1.8117 1.3410 1.9085 -0.0590 0.0321  -0.7550 196  THR H OG1 
3134 C  CG2 . THR B 196 ? 1.6853 1.3183 1.7336 -0.0460 0.0002  -0.7121 196  THR H CG2 
3135 N  N   . TYR B 197 ? 1.5072 1.0825 1.6250 -0.0291 -0.0129 -0.5914 197  TYR H N   
3136 C  CA  . TYR B 197 ? 1.4537 1.0484 1.5699 -0.0146 -0.0244 -0.5444 197  TYR H CA  
3137 C  C   . TYR B 197 ? 1.4628 1.1232 1.5512 -0.0109 -0.0423 -0.5380 197  TYR H C   
3138 O  O   . TYR B 197 ? 1.4669 1.1648 1.5425 -0.0284 -0.0567 -0.5598 197  TYR H O   
3139 C  CB  . TYR B 197 ? 1.4561 1.0438 1.5919 -0.0311 -0.0315 -0.5270 197  TYR H CB  
3140 C  CG  . TYR B 197 ? 1.5256 1.0431 1.6823 -0.0380 -0.0130 -0.5262 197  TYR H CG  
3141 C  CD1 . TYR B 197 ? 1.5567 1.0245 1.7143 -0.0170 -0.0027 -0.4963 197  TYR H CD1 
3142 C  CD2 . TYR B 197 ? 1.5695 1.0696 1.7439 -0.0667 -0.0071 -0.5534 197  TYR H CD2 
3143 C  CE1 . TYR B 197 ? 1.6095 1.0054 1.7780 -0.0236 0.0130  -0.4921 197  TYR H CE1 
3144 C  CE2 . TYR B 197 ? 1.6212 1.0508 1.8094 -0.0758 0.0121  -0.5509 197  TYR H CE2 
3145 C  CZ  . TYR B 197 ? 1.7272 1.1019 1.9090 -0.0539 0.0218  -0.5187 197  TYR H CZ  
3146 O  OH  . TYR B 197 ? 1.7793 1.0770 1.9668 -0.0627 0.0397  -0.5137 197  TYR H OH  
3147 N  N   . ILE B 198 ? 1.3778 1.0508 1.4559 0.0114  -0.0423 -0.5082 198  ILE H N   
3148 C  CA  . ILE B 198 ? 1.3424 1.0699 1.3902 0.0160  -0.0561 -0.4966 198  ILE H CA  
3149 C  C   . ILE B 198 ? 1.3222 1.0625 1.3742 0.0281  -0.0666 -0.4501 198  ILE H C   
3150 O  O   . ILE B 198 ? 1.3015 1.0082 1.3739 0.0410  -0.0580 -0.4278 198  ILE H O   
3151 C  CB  . ILE B 198 ? 1.4094 1.1432 1.4372 0.0275  -0.0403 -0.5162 198  ILE H CB  
3152 C  CG1 . ILE B 198 ? 1.4621 1.2118 1.4644 0.0089  -0.0403 -0.5615 198  ILE H CG1 
3153 C  CG2 . ILE B 198 ? 1.3878 1.1562 1.3949 0.0424  -0.0430 -0.4885 198  ILE H CG2 
3154 C  CD1 . ILE B 198 ? 1.5591 1.2936 1.5546 0.0153  -0.0154 -0.5965 198  ILE H CD1 
3155 N  N   . CYS B 199 ? 1.2448 1.0311 1.2754 0.0238  -0.0864 -0.4360 199  CYS H N   
3156 C  CA  . CYS B 199 ? 1.1902 0.9934 1.2200 0.0345  -0.0969 -0.3945 199  CYS H CA  
3157 C  C   . CYS B 199 ? 1.2599 1.0960 1.2548 0.0433  -0.0982 -0.3868 199  CYS H C   
3158 O  O   . CYS B 199 ? 1.2928 1.1534 1.2562 0.0335  -0.1044 -0.4081 199  CYS H O   
3159 C  CB  . CYS B 199 ? 1.1583 0.9818 1.1974 0.0222  -0.1181 -0.3833 199  CYS H CB  
3160 S  SG  . CYS B 199 ? 1.1847 1.0632 1.1892 0.0212  -0.1452 -0.3689 199  CYS H SG  
3161 N  N   . ASN B 200 ? 1.1924 1.0268 1.1913 0.0601  -0.0905 -0.3594 200  ASN H N   
3162 C  CA  . ASN B 200 ? 1.1974 1.0603 1.1668 0.0666  -0.0866 -0.3524 200  ASN H CA  
3163 C  C   . ASN B 200 ? 1.2420 1.1220 1.2082 0.0721  -0.0993 -0.3129 200  ASN H C   
3164 O  O   . ASN B 200 ? 1.2184 1.0803 1.2127 0.0815  -0.0983 -0.2901 200  ASN H O   
3165 C  CB  . ASN B 200 ? 1.2033 1.0519 1.1863 0.0815  -0.0620 -0.3631 200  ASN H CB  
3166 C  CG  . ASN B 200 ? 1.5331 1.3505 1.5337 0.0811  -0.0467 -0.3990 200  ASN H CG  
3167 O  OD1 . ASN B 200 ? 1.4236 1.2037 1.4542 0.0837  -0.0455 -0.3981 200  ASN H OD1 
3168 N  ND2 . ASN B 200 ? 1.4821 1.3100 1.4631 0.0773  -0.0326 -0.4315 200  ASN H ND2 
3169 N  N   . VAL B 201 ? 1.2179 1.1291 1.1465 0.0658  -0.1116 -0.3043 201  VAL H N   
3170 C  CA  . VAL B 201 ? 1.1859 1.1122 1.1078 0.0698  -0.1246 -0.2674 201  VAL H CA  
3171 C  C   . VAL B 201 ? 1.2484 1.1960 1.1333 0.0710  -0.1175 -0.2580 201  VAL H C   
3172 O  O   . VAL B 201 ? 1.2902 1.2522 1.1326 0.0610  -0.1193 -0.2737 201  VAL H O   
3173 C  CB  . VAL B 201 ? 1.2270 1.1646 1.1464 0.0608  -0.1518 -0.2586 201  VAL H CB  
3174 C  CG1 . VAL B 201 ? 1.2662 1.2166 1.1606 0.0473  -0.1641 -0.2881 201  VAL H CG1 
3175 C  CG2 . VAL B 201 ? 1.2030 1.1575 1.1058 0.0643  -0.1663 -0.2243 201  VAL H CG2 
3176 N  N   . ASN B 202 ? 1.1639 1.1122 1.0630 0.0815  -0.1089 -0.2332 202  ASN H N   
3177 C  CA  . ASN B 202 ? 1.1705 1.1384 1.0386 0.0803  -0.0999 -0.2224 202  ASN H CA  
3178 C  C   . ASN B 202 ? 1.1934 1.1695 1.0482 0.0790  -0.1176 -0.1866 202  ASN H C   
3179 O  O   . ASN B 202 ? 1.1464 1.1138 1.0332 0.0864  -0.1239 -0.1654 202  ASN H O   
3180 C  CB  . ASN B 202 ? 1.1706 1.1386 1.0661 0.0917  -0.0744 -0.2266 202  ASN H CB  
3181 C  CG  . ASN B 202 ? 1.4339 1.4233 1.3091 0.0896  -0.0634 -0.2106 202  ASN H CG  
3182 O  OD1 . ASN B 202 ? 1.3882 1.3916 1.2157 0.0773  -0.0579 -0.2167 202  ASN H OD1 
3183 N  ND2 . ASN B 202 ? 1.2625 1.2533 1.1709 0.0999  -0.0599 -0.1898 202  ASN H ND2 
3184 N  N   . HIS B 203 ? 1.1756 1.1651 0.9796 0.0691  -0.1255 -0.1801 203  HIS H N   
3185 C  CA  . HIS B 203 ? 1.1599 1.1537 0.9456 0.0680  -0.1400 -0.1464 203  HIS H CA  
3186 C  C   . HIS B 203 ? 1.2325 1.2359 0.9869 0.0630  -0.1189 -0.1408 203  HIS H C   
3187 O  O   . HIS B 203 ? 1.2745 1.2841 0.9835 0.0526  -0.1100 -0.1574 203  HIS H O   
3188 C  CB  . HIS B 203 ? 1.1960 1.1925 0.9468 0.0611  -0.1697 -0.1406 203  HIS H CB  
3189 C  CG  . HIS B 203 ? 1.2315 1.2272 0.9670 0.0623  -0.1858 -0.1053 203  HIS H CG  
3190 N  ND1 . HIS B 203 ? 1.3005 1.2974 0.9756 0.0544  -0.1978 -0.0932 203  HIS H ND1 
3191 C  CD2 . HIS B 203 ? 1.2088 1.1989 0.9795 0.0701  -0.1915 -0.0812 203  HIS H CD2 
3192 C  CE1 . HIS B 203 ? 1.2747 1.2655 0.9535 0.0587  -0.2105 -0.0620 203  HIS H CE1 
3193 N  NE2 . HIS B 203 ? 1.2218 1.2099 0.9583 0.0679  -0.2064 -0.0550 203  HIS H NE2 
3194 N  N   . LYS B 204 ? 1.1553 1.1604 0.9354 0.0690  -0.1084 -0.1206 204  LYS H N   
3195 C  CA  . LYS B 204 ? 1.1648 1.1821 0.9270 0.0632  -0.0845 -0.1174 204  LYS H CA  
3196 C  C   . LYS B 204 ? 1.2400 1.2564 0.9495 0.0514  -0.0912 -0.0908 204  LYS H C   
3197 O  O   . LYS B 204 ? 1.2773 1.3008 0.9454 0.0393  -0.0720 -0.0984 204  LYS H O   
3198 C  CB  . LYS B 204 ? 1.1433 1.1660 0.9614 0.0744  -0.0687 -0.1138 204  LYS H CB  
3199 C  CG  . LYS B 204 ? 1.1250 1.1560 0.9715 0.0806  -0.0445 -0.1458 204  LYS H CG  
3200 C  CD  . LYS B 204 ? 1.1637 1.2167 1.0139 0.0765  -0.0163 -0.1505 204  LYS H CD  
3201 C  CE  . LYS B 204 ? 1.2765 1.3391 1.0683 0.0587  0.0012  -0.1652 204  LYS H CE  
3202 N  NZ  . LYS B 204 ? 1.3929 1.4793 1.1968 0.0535  0.0341  -0.1756 204  LYS H NZ  
3203 N  N   . PRO B 205 ? 1.1838 1.1894 0.8886 0.0532  -0.1159 -0.0616 205  PRO H N   
3204 C  CA  . PRO B 205 ? 1.2264 1.2248 0.8746 0.0420  -0.1219 -0.0370 205  PRO H CA  
3205 C  C   . PRO B 205 ? 1.3659 1.3600 0.9421 0.0297  -0.1291 -0.0459 205  PRO H C   
3206 O  O   . PRO B 205 ? 1.4084 1.3960 0.9287 0.0166  -0.1204 -0.0328 205  PRO H O   
3207 C  CB  . PRO B 205 ? 1.2112 1.1972 0.8782 0.0501  -0.1495 -0.0098 205  PRO H CB  
3208 C  CG  . PRO B 205 ? 1.2009 1.1900 0.9355 0.0630  -0.1494 -0.0175 205  PRO H CG  
3209 C  CD  . PRO B 205 ? 1.1496 1.1467 0.8982 0.0648  -0.1375 -0.0505 205  PRO H CD  
3210 N  N   . SER B 206 ? 1.3372 1.3337 0.9123 0.0323  -0.1438 -0.0693 206  SER H N   
3211 C  CA  . SER B 206 ? 1.3982 1.3922 0.9048 0.0204  -0.1526 -0.0826 206  SER H CA  
3212 C  C   . SER B 206 ? 1.4642 1.4693 0.9665 0.0142  -0.1268 -0.1225 206  SER H C   
3213 O  O   . SER B 206 ? 1.5214 1.5250 0.9669 0.0033  -0.1330 -0.1385 206  SER H O   
3214 C  CB  . SER B 206 ? 1.4375 1.4266 0.9368 0.0256  -0.1943 -0.0785 206  SER H CB  
3215 O  OG  . SER B 206 ? 1.4677 1.4660 1.0065 0.0306  -0.2004 -0.1085 206  SER H OG  
3216 N  N   . ASN B 207 ? 1.3718 1.3866 0.9319 0.0214  -0.0989 -0.1386 207  ASN H N   
3217 C  CA  . ASN B 207 ? 1.3835 1.4076 0.9556 0.0196  -0.0714 -0.1771 207  ASN H CA  
3218 C  C   . ASN B 207 ? 1.4531 1.4740 1.0105 0.0170  -0.0865 -0.2066 207  ASN H C   
3219 O  O   . ASN B 207 ? 1.5079 1.5314 1.0170 0.0043  -0.0747 -0.2319 207  ASN H O   
3220 C  CB  . ASN B 207 ? 1.4428 1.4760 0.9749 0.0056  -0.0370 -0.1856 207  ASN H CB  
3221 C  CG  . ASN B 207 ? 1.7384 1.7838 1.3232 0.0123  -0.0113 -0.1780 207  ASN H CG  
3222 O  OD1 . ASN B 207 ? 1.6645 1.7080 1.2505 0.0114  -0.0153 -0.1467 207  ASN H OD1 
3223 N  ND2 . ASN B 207 ? 1.6452 1.7033 1.2787 0.0201  0.0140  -0.2077 207  ASN H ND2 
3224 N  N   . THR B 208 ? 1.3522 1.3674 0.9532 0.0275  -0.1111 -0.2045 208  THR H N   
3225 C  CA  . THR B 208 ? 1.3523 1.3652 0.9576 0.0257  -0.1265 -0.2324 208  THR H CA  
3226 C  C   . THR B 208 ? 1.3200 1.3275 0.9921 0.0364  -0.1072 -0.2539 208  THR H C   
3227 O  O   . THR B 208 ? 1.2624 1.2639 0.9864 0.0487  -0.1078 -0.2362 208  THR H O   
3228 C  CB  . THR B 208 ? 1.4597 1.4708 1.0701 0.0282  -0.1666 -0.2159 208  THR H CB  
3229 O  OG1 . THR B 208 ? 1.4512 1.4603 1.0532 0.0322  -0.1794 -0.1766 208  THR H OG1 
3230 C  CG2 . THR B 208 ? 1.4942 1.5098 1.0525 0.0166  -0.1905 -0.2335 208  THR H CG2 
3231 N  N   . LYS B 209 ? 1.2746 1.2811 0.9427 0.0320  -0.0893 -0.2916 209  LYS H N   
3232 C  CA  . LYS B 209 ? 1.2328 1.2281 0.9616 0.0433  -0.0714 -0.3123 209  LYS H CA  
3233 C  C   . LYS B 209 ? 1.2929 1.2770 1.0310 0.0385  -0.0818 -0.3425 209  LYS H C   
3234 O  O   . LYS B 209 ? 1.3084 1.2812 1.0700 0.0411  -0.0624 -0.3737 209  LYS H O   
3235 C  CB  . LYS B 209 ? 1.2692 1.2708 1.0036 0.0463  -0.0348 -0.3314 209  LYS H CB  
3236 C  CG  . LYS B 209 ? 1.2771 1.2870 1.0418 0.0573  -0.0218 -0.3047 209  LYS H CG  
3237 C  CD  . LYS B 209 ? 1.3064 1.3309 1.0227 0.0466  -0.0238 -0.2763 209  LYS H CD  
3238 C  CE  . LYS B 209 ? 1.3714 1.4097 1.0362 0.0317  0.0025  -0.2940 209  LYS H CE  
3239 N  NZ  . LYS B 209 ? 1.4057 1.4593 1.1073 0.0379  0.0355  -0.2993 209  LYS H NZ  
3240 N  N   . VAL B 210 ? 1.2341 1.2209 0.9593 0.0319  -0.1132 -0.3334 210  VAL H N   
3241 C  CA  . VAL B 210 ? 1.2443 1.2258 0.9776 0.0238  -0.1278 -0.3615 210  VAL H CA  
3242 C  C   . VAL B 210 ? 1.2554 1.2135 1.0518 0.0313  -0.1152 -0.3763 210  VAL H C   
3243 O  O   . VAL B 210 ? 1.1910 1.1378 1.0299 0.0416  -0.1174 -0.3529 210  VAL H O   
3244 C  CB  . VAL B 210 ? 1.2843 1.2781 1.0044 0.0177  -0.1662 -0.3469 210  VAL H CB  
3245 C  CG1 . VAL B 210 ? 1.3003 1.2938 1.0328 0.0070  -0.1803 -0.3806 210  VAL H CG1 
3246 C  CG2 . VAL B 210 ? 1.3210 1.3304 0.9717 0.0108  -0.1815 -0.3315 210  VAL H CG2 
3247 N  N   . ASP B 211 ? 1.2514 1.1989 1.0484 0.0246  -0.1022 -0.4162 211  ASP H N   
3248 C  CA  . ASP B 211 ? 1.2407 1.1592 1.0883 0.0283  -0.0909 -0.4358 211  ASP H CA  
3249 C  C   . ASP B 211 ? 1.3123 1.2319 1.1542 0.0110  -0.1081 -0.4645 211  ASP H C   
3250 O  O   . ASP B 211 ? 1.3551 1.2891 1.1536 -0.0016 -0.1115 -0.4907 211  ASP H O   
3251 C  CB  . ASP B 211 ? 1.2874 1.1895 1.1465 0.0365  -0.0581 -0.4608 211  ASP H CB  
3252 C  CG  . ASP B 211 ? 1.3566 1.2676 1.2194 0.0516  -0.0405 -0.4398 211  ASP H CG  
3253 O  OD1 . ASP B 211 ? 1.2971 1.2142 1.1717 0.0596  -0.0509 -0.4018 211  ASP H OD1 
3254 O  OD2 . ASP B 211 ? 1.4648 1.3778 1.3223 0.0547  -0.0153 -0.4636 211  ASP H OD2 
3255 N  N   . LYS B 212 ? 1.2441 1.1506 1.1276 0.0087  -0.1193 -0.4600 212  LYS H N   
3256 C  CA  . LYS B 212 ? 1.2709 1.1821 1.1599 -0.0089 -0.1363 -0.4873 212  LYS H CA  
3257 C  C   . LYS B 212 ? 1.3567 1.2319 1.2916 -0.0140 -0.1212 -0.5105 212  LYS H C   
3258 O  O   . LYS B 212 ? 1.3226 1.1667 1.2907 -0.0022 -0.1049 -0.4940 212  LYS H O   
3259 C  CB  . LYS B 212 ? 1.2647 1.2026 1.1579 -0.0127 -0.1686 -0.4643 212  LYS H CB  
3260 C  CG  . LYS B 212 ? 1.3392 1.3111 1.1827 -0.0228 -0.1954 -0.4742 212  LYS H CG  
3261 C  CD  . LYS B 212 ? 1.4045 1.3891 1.2669 -0.0396 -0.2170 -0.5042 212  LYS H CD  
3262 C  CE  . LYS B 212 ? 1.5382 1.5577 1.3531 -0.0477 -0.2515 -0.5105 212  LYS H CE  
3263 N  NZ  . LYS B 212 ? 1.6483 1.6818 1.4820 -0.0654 -0.2704 -0.5486 212  LYS H NZ  
3264 N  N   . ARG B 213 ? 1.3790 1.2569 1.3133 -0.0328 -0.1284 -0.5487 213  ARG H N   
3265 C  CA  . ARG B 213 ? 1.4069 1.2497 1.3800 -0.0435 -0.1145 -0.5768 213  ARG H CA  
3266 C  C   . ARG B 213 ? 1.4674 1.3253 1.4686 -0.0620 -0.1361 -0.5856 213  ARG H C   
3267 O  O   . ARG B 213 ? 1.4788 1.3779 1.4602 -0.0716 -0.1636 -0.5939 213  ARG H O   
3268 C  CB  . ARG B 213 ? 1.4745 1.3030 1.4280 -0.0512 -0.0973 -0.6220 213  ARG H CB  
3269 C  CG  . ARG B 213 ? 1.6274 1.4040 1.6195 -0.0555 -0.0735 -0.6464 213  ARG H CG  
3270 N  N   . VAL B 214 ? 1.4107 1.2345 1.4579 -0.0669 -0.1235 -0.5837 214  VAL H N   
3271 C  CA  . VAL B 214 ? 1.3965 1.2303 1.4815 -0.0855 -0.1361 -0.5922 214  VAL H CA  
3272 C  C   . VAL B 214 ? 1.4885 1.2968 1.5931 -0.1075 -0.1234 -0.6376 214  VAL H C   
3273 O  O   . VAL B 214 ? 1.5000 1.2560 1.6130 -0.1052 -0.0960 -0.6453 214  VAL H O   
3274 C  CB  . VAL B 214 ? 1.3981 1.2111 1.5166 -0.0786 -0.1283 -0.5550 214  VAL H CB  
3275 C  CG1 . VAL B 214 ? 1.3944 1.2104 1.5578 -0.1010 -0.1319 -0.5692 214  VAL H CG1 
3276 C  CG2 . VAL B 214 ? 1.3459 1.1892 1.4486 -0.0602 -0.1443 -0.5132 214  VAL H CG2 
3277 N  N   . GLU B 215 ? 1.4756 1.3196 1.5908 -0.1284 -0.1444 -0.6673 215  GLU H N   
3278 C  CA  . GLU B 215 ? 1.5324 1.3590 1.6695 -0.1536 -0.1353 -0.7141 215  GLU H CA  
3279 C  C   . GLU B 215 ? 1.5855 1.4427 1.7698 -0.1753 -0.1524 -0.7263 215  GLU H C   
3280 O  O   . GLU B 215 ? 1.5680 1.4815 1.7509 -0.1745 -0.1852 -0.7215 215  GLU H O   
3281 C  CB  . GLU B 215 ? 1.6043 1.4492 1.7000 -0.1604 -0.1437 -0.7530 215  GLU H CB  
3282 C  CG  . GLU B 215 ? 1.8162 1.6250 1.9246 -0.1813 -0.1234 -0.8019 215  GLU H CG  
3283 C  CD  . GLU B 215 ? 2.1329 1.8741 2.2413 -0.1706 -0.0856 -0.8025 215  GLU H CD  
3284 O  OE1 . GLU B 215 ? 2.0271 1.7547 2.1169 -0.1446 -0.0754 -0.7696 215  GLU H OE1 
3285 O  OE2 . GLU B 215 ? 2.1125 1.8147 2.2409 -0.1883 -0.0670 -0.8382 215  GLU H OE2 
3286 N  N   . PRO B 216 ? 1.5566 1.3778 1.7846 -0.1952 -0.1308 -0.7428 216  PRO H N   
3287 C  CA  . PRO B 216 ? 1.5865 1.4425 1.8652 -0.2186 -0.1446 -0.7599 216  PRO H CA  
3288 C  C   . PRO B 216 ? 1.9478 1.8372 2.2316 -0.2421 -0.1627 -0.8132 216  PRO H C   
3289 O  O   . PRO B 216 ? 1.3910 1.3169 1.7204 -0.2634 -0.1772 -0.8367 216  PRO H O   
3290 C  CB  . PRO B 216 ? 1.6071 1.4039 1.9223 -0.2323 -0.1093 -0.7553 216  PRO H CB  
3291 C  CG  . PRO B 216 ? 1.6860 1.4145 1.9705 -0.2226 -0.0807 -0.7548 216  PRO H CG  
3292 C  CD  . PRO B 216 ? 1.6212 1.3681 1.8548 -0.1988 -0.0935 -0.7495 216  PRO H CD  
3293 N  N   . ILE C 2   ? 0.5670 0.3515 0.8939 0.0921  -0.2038 0.1978  2    ILE L N   
3294 C  CA  . ILE C 2   ? 0.5153 0.3279 0.8879 0.0792  -0.1970 0.1878  2    ILE L CA  
3295 C  C   . ILE C 2   ? 0.5953 0.4248 0.9783 0.0826  -0.2138 0.1763  2    ILE L C   
3296 O  O   . ILE C 2   ? 0.6083 0.4322 0.9596 0.0831  -0.2164 0.1780  2    ILE L O   
3297 C  CB  . ILE C 2   ? 0.5062 0.3216 0.8754 0.0600  -0.1705 0.1927  2    ILE L CB  
3298 C  CG1 . ILE C 2   ? 0.5063 0.3056 0.8666 0.0560  -0.1530 0.2030  2    ILE L CG1 
3299 C  CG2 . ILE C 2   ? 0.4387 0.2785 0.8497 0.0474  -0.1652 0.1827  2    ILE L CG2 
3300 C  CD1 . ILE C 2   ? 0.4857 0.2874 0.8403 0.0384  -0.1273 0.2078  2    ILE L CD1 
3301 N  N   . GLN C 3   ? 0.5550 0.4044 0.9817 0.0849  -0.2250 0.1633  3    GLN L N   
3302 C  CA  . GLN C 3   ? 0.5503 0.4170 0.9914 0.0875  -0.2405 0.1499  3    GLN L CA  
3303 C  C   . GLN C 3   ? 0.5716 0.4524 1.0323 0.0701  -0.2262 0.1437  3    GLN L C   
3304 O  O   . GLN C 3   ? 0.5543 0.4417 1.0436 0.0588  -0.2128 0.1414  3    GLN L O   
3305 C  CB  . GLN C 3   ? 0.5684 0.4502 1.0456 0.0996  -0.2610 0.1361  3    GLN L CB  
3306 C  CG  . GLN C 3   ? 0.7365 0.6089 1.2191 0.1136  -0.2690 0.1399  3    GLN L CG  
3307 C  CD  . GLN C 3   ? 0.9866 0.8286 1.4171 0.1252  -0.2719 0.1566  3    GLN L CD  
3308 O  OE1 . GLN C 3   ? 0.9103 0.7422 1.3051 0.1340  -0.2847 0.1593  3    GLN L OE1 
3309 N  NE2 . GLN C 3   ? 0.8882 0.7127 1.3103 0.1235  -0.2576 0.1679  3    GLN L NE2 
3310 N  N   . MET C 4   ? 0.5267 0.4096 0.9695 0.0678  -0.2283 0.1415  4    MET L N   
3311 C  CA  . MET C 4   ? 0.5091 0.4015 0.9654 0.0534  -0.2163 0.1360  4    MET L CA  
3312 C  C   . MET C 4   ? 0.5698 0.4776 1.0510 0.0547  -0.2295 0.1195  4    MET L C   
3313 O  O   . MET C 4   ? 0.5865 0.4960 1.0541 0.0648  -0.2455 0.1156  4    MET L O   
3314 C  CB  . MET C 4   ? 0.5419 0.4258 0.9617 0.0493  -0.2074 0.1439  4    MET L CB  
3315 C  CG  . MET C 4   ? 0.5911 0.4610 0.9834 0.0466  -0.1926 0.1579  4    MET L CG  
3316 S  SD  . MET C 4   ? 0.6200 0.4911 1.0365 0.0347  -0.1731 0.1628  4    MET L SD  
3317 C  CE  . MET C 4   ? 0.5370 0.4189 0.9705 0.0210  -0.1627 0.1568  4    MET L CE  
3318 N  N   . THR C 5   ? 0.5061 0.4245 1.0226 0.0436  -0.2224 0.1090  5    THR L N   
3319 C  CA  . THR C 5   ? 0.4877 0.4202 1.0289 0.0422  -0.2319 0.0910  5    THR L CA  
3320 C  C   . THR C 5   ? 0.4859 0.4163 1.0270 0.0281  -0.2189 0.0873  5    THR L C   
3321 O  O   . THR C 5   ? 0.4711 0.3973 1.0229 0.0156  -0.2031 0.0894  5    THR L O   
3322 C  CB  . THR C 5   ? 0.5195 0.4658 1.1028 0.0431  -0.2379 0.0776  5    THR L CB  
3323 O  OG1 . THR C 5   ? 0.4876 0.4344 1.0651 0.0605  -0.2544 0.0809  5    THR L OG1 
3324 C  CG2 . THR C 5   ? 0.4513 0.4138 1.0633 0.0382  -0.2440 0.0559  5    THR L CG2 
3325 N  N   . GLN C 6   ? 0.4166 0.3485 0.9442 0.0303  -0.2257 0.0817  6    GLN L N   
3326 C  CA  . GLN C 6   ? 0.3977 0.3249 0.9231 0.0190  -0.2150 0.0773  6    GLN L CA  
3327 C  C   . GLN C 6   ? 0.4693 0.4053 1.0232 0.0120  -0.2172 0.0577  6    GLN L C   
3328 O  O   . GLN C 6   ? 0.4733 0.4230 1.0419 0.0190  -0.2316 0.0458  6    GLN L O   
3329 C  CB  . GLN C 6   ? 0.4085 0.3297 0.9009 0.0241  -0.2178 0.0827  6    GLN L CB  
3330 C  CG  . GLN C 6   ? 0.2759 0.1864 0.7426 0.0227  -0.2064 0.0982  6    GLN L CG  
3331 C  CD  . GLN C 6   ? 0.5589 0.4659 0.9955 0.0285  -0.2105 0.1011  6    GLN L CD  
3332 O  OE1 . GLN C 6   ? 0.5159 0.4203 0.9297 0.0362  -0.2154 0.1087  6    GLN L OE1 
3333 N  NE2 . GLN C 6   ? 0.6392 0.5440 1.0735 0.0242  -0.2073 0.0947  6    GLN L NE2 
3334 N  N   . SER C 7   ? 0.4203 0.3475 0.9797 -0.0020 -0.2029 0.0535  7    SER L N   
3335 C  CA  . SER C 7   ? 0.4143 0.3449 0.9967 -0.0121 -0.2005 0.0341  7    SER L CA  
3336 C  C   . SER C 7   ? 0.4913 0.4041 1.0557 -0.0217 -0.1888 0.0339  7    SER L C   
3337 O  O   . SER C 7   ? 0.4932 0.3912 1.0436 -0.0272 -0.1767 0.0455  7    SER L O   
3338 C  CB  . SER C 7   ? 0.4284 0.3638 1.0443 -0.0224 -0.1931 0.0255  7    SER L CB  
3339 O  OG  . SER C 7   ? 0.4902 0.4274 1.1080 -0.0171 -0.1928 0.0387  7    SER L OG  
3340 N  N   . PRO C 8   ? 0.4582 0.3712 1.0220 -0.0235 -0.1920 0.0201  8    PRO L N   
3341 C  CA  . PRO C 8   ? 0.4541 0.3860 1.0321 -0.0173 -0.2065 0.0047  8    PRO L CA  
3342 C  C   . PRO C 8   ? 0.5050 0.4427 1.0588 -0.0014 -0.2207 0.0149  8    PRO L C   
3343 O  O   . PRO C 8   ? 0.5109 0.4379 1.0388 0.0030  -0.2175 0.0317  8    PRO L O   
3344 C  CB  . PRO C 8   ? 0.4783 0.4019 1.0586 -0.0290 -0.1987 -0.0120 8    PRO L CB  
3345 C  CG  . PRO C 8   ? 0.5500 0.4477 1.1014 -0.0333 -0.1860 0.0007  8    PRO L CG  
3346 C  CD  . PRO C 8   ? 0.4856 0.3781 1.0298 -0.0311 -0.1812 0.0199  8    PRO L CD  
3347 N  N   . SER C 9   ? 0.4486 0.4033 1.0101 0.0066  -0.2362 0.0041  9    SER L N   
3348 C  CA  . SER C 9   ? 0.4506 0.4081 0.9860 0.0200  -0.2495 0.0124  9    SER L CA  
3349 C  C   . SER C 9   ? 0.4988 0.4477 1.0142 0.0165  -0.2454 0.0089  9    SER L C   
3350 O  O   . SER C 9   ? 0.4809 0.4242 0.9680 0.0235  -0.2487 0.0194  9    SER L O   
3351 C  CB  . SER C 9   ? 0.4986 0.4768 1.0481 0.0303  -0.2690 0.0018  9    SER L CB  
3352 O  OG  . SER C 9   ? 0.5801 0.5732 1.1595 0.0233  -0.2706 -0.0214 9    SER L OG  
3353 N  N   . SER C 10  ? 0.4578 0.4050 0.9882 0.0051  -0.2375 -0.0074 10   SER L N   
3354 C  CA  . SER C 10  ? 0.4549 0.3919 0.9707 0.0001  -0.2316 -0.0141 10   SER L CA  
3355 C  C   . SER C 10  ? 0.4687 0.3870 0.9901 -0.0142 -0.2137 -0.0190 10   SER L C   
3356 O  O   . SER C 10  ? 0.4288 0.3503 0.9752 -0.0236 -0.2083 -0.0299 10   SER L O   
3357 C  CB  . SER C 10  ? 0.5402 0.4947 1.0673 0.0006  -0.2420 -0.0333 10   SER L CB  
3358 O  OG  . SER C 10  ? 0.7118 0.6813 1.2298 0.0140  -0.2599 -0.0292 10   SER L OG  
3359 N  N   . LEU C 11  ? 0.4537 0.3512 0.9508 -0.0157 -0.2046 -0.0117 11   LEU L N   
3360 C  CA  . LEU C 11  ? 0.4689 0.3418 0.9617 -0.0274 -0.1881 -0.0135 11   LEU L CA  
3361 C  C   . LEU C 11  ? 0.5695 0.4263 1.0420 -0.0284 -0.1835 -0.0187 11   LEU L C   
3362 O  O   . LEU C 11  ? 0.5866 0.4450 1.0402 -0.0183 -0.1896 -0.0107 11   LEU L O   
3363 C  CB  . LEU C 11  ? 0.4561 0.3169 0.9363 -0.0251 -0.1820 0.0061  11   LEU L CB  
3364 C  CG  . LEU C 11  ? 0.5263 0.3596 0.9987 -0.0358 -0.1662 0.0088  11   LEU L CG  
3365 C  CD1 . LEU C 11  ? 0.5395 0.3660 1.0317 -0.0518 -0.1570 -0.0087 11   LEU L CD1 
3366 C  CD2 . LEU C 11  ? 0.5658 0.3980 1.0374 -0.0349 -0.1627 0.0245  11   LEU L CD2 
3367 N  N   . SER C 12  ? 0.5285 0.3690 1.0047 -0.0413 -0.1720 -0.0333 12   SER L N   
3368 C  CA  . SER C 12  ? 0.5482 0.3680 1.0043 -0.0437 -0.1651 -0.0394 12   SER L CA  
3369 C  C   . SER C 12  ? 0.6035 0.3880 1.0398 -0.0487 -0.1511 -0.0304 12   SER L C   
3370 O  O   . SER C 12  ? 0.6199 0.3929 1.0645 -0.0599 -0.1418 -0.0328 12   SER L O   
3371 C  CB  . SER C 12  ? 0.6286 0.4523 1.1000 -0.0556 -0.1608 -0.0636 12   SER L CB  
3372 O  OG  . SER C 12  ? 0.7970 0.6023 1.2765 -0.0715 -0.1462 -0.0733 12   SER L OG  
3373 N  N   . ALA C 13  ? 0.5363 0.3036 0.9461 -0.0400 -0.1503 -0.0206 13   ALA L N   
3374 C  CA  . ALA C 13  ? 0.5333 0.2662 0.9206 -0.0416 -0.1397 -0.0118 13   ALA L CA  
3375 C  C   . ALA C 13  ? 0.5938 0.3045 0.9547 -0.0347 -0.1374 -0.0121 13   ALA L C   
3376 O  O   . ALA C 13  ? 0.6095 0.3347 0.9704 -0.0285 -0.1441 -0.0173 13   ALA L O   
3377 C  CB  . ALA C 13  ? 0.5209 0.2596 0.9053 -0.0340 -0.1431 0.0068  13   ALA L CB  
3378 N  N   . SER C 14  ? 0.5180 0.1920 0.8559 -0.0361 -0.1279 -0.0071 14   SER L N   
3379 C  CA  . SER C 14  ? 0.5111 0.1592 0.8225 -0.0280 -0.1255 -0.0063 14   SER L CA  
3380 C  C   . SER C 14  ? 0.5047 0.1437 0.7988 -0.0149 -0.1290 0.0110  14   SER L C   
3381 O  O   . SER C 14  ? 0.4839 0.1267 0.7826 -0.0165 -0.1289 0.0210  14   SER L O   
3382 C  CB  . SER C 14  ? 0.6067 0.2130 0.9012 -0.0406 -0.1109 -0.0170 14   SER L CB  
3383 O  OG  . SER C 14  ? 0.8181 0.4344 1.1302 -0.0544 -0.1061 -0.0359 14   SER L OG  
3384 N  N   . VAL C 15  ? 0.4401 0.0677 0.7153 -0.0021 -0.1316 0.0134  15   VAL L N   
3385 C  CA  . VAL C 15  ? 0.4172 0.0658 0.6756 0.0107  -0.1354 0.0252  15   VAL L CA  
3386 C  C   . VAL C 15  ? 0.5012 0.0843 0.7429 0.0061  -0.1274 0.0326  15   VAL L C   
3387 O  O   . VAL C 15  ? 0.5288 0.0783 0.7581 -0.0050 -0.1172 0.0245  15   VAL L O   
3388 C  CB  . VAL C 15  ? 0.4480 0.0574 0.6893 0.0257  -0.1382 0.0238  15   VAL L CB  
3389 C  CG1 . VAL C 15  ? 0.4512 0.0645 0.6753 0.0393  -0.1423 0.0335  15   VAL L CG1 
3390 C  CG2 . VAL C 15  ? 0.4168 0.0592 0.6731 0.0304  -0.1457 0.0185  15   VAL L CG2 
3391 N  N   . GLY C 16  ? 0.4571 0.0882 0.6985 0.0090  -0.1307 0.0421  16   GLY L N   
3392 C  CA  . GLY C 16  ? 0.4860 0.0876 0.7101 0.0043  -0.1243 0.0486  16   GLY L CA  
3393 C  C   . GLY C 16  ? 0.5327 0.0980 0.7733 -0.0117 -0.1179 0.0521  16   GLY L C   
3394 O  O   . GLY C 16  ? 0.5516 0.0987 0.7812 -0.0164 -0.1135 0.0597  16   GLY L O   
3395 N  N   . ASP C 17  ? 0.4465 0.0767 0.7142 -0.0196 -0.1178 0.0408  17   ASP L N   
3396 C  CA  . ASP C 17  ? 0.4256 0.0799 0.7138 -0.0328 -0.1123 0.0380  17   ASP L CA  
3397 C  C   . ASP C 17  ? 0.4469 0.0926 0.7474 -0.0317 -0.1170 0.0527  17   ASP L C   
3398 O  O   . ASP C 17  ? 0.4059 0.0974 0.7090 -0.0180 -0.1262 0.0581  17   ASP L O   
3399 C  CB  . ASP C 17  ? 0.4312 0.0861 0.7472 -0.0411 -0.1141 0.0259  17   ASP L CB  
3400 C  CG  . ASP C 17  ? 0.6152 0.2243 0.9289 -0.0560 -0.1054 0.0085  17   ASP L CG  
3401 O  OD1 . ASP C 17  ? 0.7132 0.2808 0.9991 -0.0591 -0.0965 0.0066  17   ASP L OD1 
3402 O  OD2 . ASP C 17  ? 0.6224 0.2563 0.9604 -0.0618 -0.1075 -0.0041 17   ASP L OD2 
3403 N  N   . ARG C 18  ? 0.4132 0.0871 0.7221 -0.0415 -0.1097 0.0520  18   ARG L N   
3404 C  CA  . ARG C 18  ? 0.3748 0.0923 0.6997 -0.0396 -0.1119 0.0601  18   ARG L CA  
3405 C  C   . ARG C 18  ? 0.3814 0.1033 0.7383 -0.0457 -0.1153 0.0552  18   ARG L C   
3406 O  O   . ARG C 18  ? 0.3770 0.0965 0.7463 -0.0559 -0.1101 0.0426  18   ARG L O   
3407 C  CB  . ARG C 18  ? 0.3923 0.0919 0.7113 -0.0509 -0.1015 0.0636  18   ARG L CB  
3408 C  CG  . ARG C 18  ? 0.5122 0.1671 0.8509 -0.0626 -0.1013 0.0790  18   ARG L CG  
3409 C  CD  . ARG C 18  ? 0.8015 0.4394 1.1407 -0.0796 -0.0898 0.0808  18   ARG L CD  
3410 N  NE  . ARG C 18  ? 1.2087 0.8154 1.5156 -0.0779 -0.0866 0.0899  18   ARG L NE  
3411 C  CZ  . ARG C 18  ? 1.5201 1.1366 1.8181 -0.0688 -0.0903 0.1030  18   ARG L CZ  
3412 N  NH1 . ARG C 18  ? 1.3891 1.0440 1.7070 -0.0619 -0.0954 0.1089  18   ARG L NH1 
3413 N  NH2 . ARG C 18  ? 1.3964 0.9833 1.6639 -0.0664 -0.0889 0.1098  18   ARG L NH2 
3414 N  N   . VAL C 19  ? 0.3328 0.1080 0.7006 -0.0339 -0.1246 0.0601  19   VAL L N   
3415 C  CA  . VAL C 19  ? 0.3259 0.1151 0.7197 -0.0350 -0.1308 0.0566  19   VAL L CA  
3416 C  C   . VAL C 19  ? 0.3765 0.1397 0.7849 -0.0416 -0.1303 0.0695  19   VAL L C   
3417 O  O   . VAL C 19  ? 0.3867 0.1533 0.7829 -0.0345 -0.1307 0.0818  19   VAL L O   
3418 C  CB  . VAL C 19  ? 0.3691 0.1296 0.7584 -0.0267 -0.1415 0.0584  19   VAL L CB  
3419 C  CG1 . VAL C 19  ? 0.3459 0.1382 0.7543 -0.0224 -0.1506 0.0587  19   VAL L CG1 
3420 C  CG2 . VAL C 19  ? 0.3776 0.1226 0.7601 -0.0287 -0.1407 0.0450  19   VAL L CG2 
3421 N  N   . THR C 20  ? 0.3293 0.1090 0.7638 -0.0495 -0.1296 0.0627  20   THR L N   
3422 C  CA  . THR C 20  ? 0.3263 0.1208 0.7769 -0.0514 -0.1290 0.0707  20   THR L CA  
3423 C  C   . THR C 20  ? 0.4128 0.2342 0.8831 -0.0446 -0.1399 0.0665  20   THR L C   
3424 O  O   . THR C 20  ? 0.4405 0.2676 0.9279 -0.0483 -0.1435 0.0523  20   THR L O   
3425 C  CB  . THR C 20  ? 0.3975 0.1785 0.8594 -0.0683 -0.1165 0.0680  20   THR L CB  
3426 O  OG1 . THR C 20  ? 0.4086 0.1764 0.8513 -0.0691 -0.1097 0.0810  20   THR L OG1 
3427 C  CG2 . THR C 20  ? 0.3098 0.1108 0.8019 -0.0735 -0.1163 0.0652  20   THR L CG2 
3428 N  N   . ILE C 21  ? 0.3673 0.2042 0.8338 -0.0350 -0.1450 0.0781  21   ILE L N   
3429 C  CA  . ILE C 21  ? 0.3781 0.2360 0.8576 -0.0274 -0.1558 0.0768  21   ILE L CA  
3430 C  C   . ILE C 21  ? 0.4315 0.2968 0.9230 -0.0301 -0.1513 0.0852  21   ILE L C   
3431 O  O   . ILE C 21  ? 0.4484 0.3100 0.9268 -0.0304 -0.1442 0.0973  21   ILE L O   
3432 C  CB  . ILE C 21  ? 0.4300 0.2957 0.8886 -0.0135 -0.1657 0.0822  21   ILE L CB  
3433 C  CG1 . ILE C 21  ? 0.4559 0.3147 0.9047 -0.0113 -0.1695 0.0728  21   ILE L CG1 
3434 C  CG2 . ILE C 21  ? 0.4405 0.3232 0.9065 -0.0052 -0.1770 0.0830  21   ILE L CG2 
3435 C  CD1 . ILE C 21  ? 0.5991 0.4613 1.0239 0.0000  -0.1754 0.0783  21   ILE L CD1 
3436 N  N   . THR C 22  ? 0.3715 0.2481 0.8882 -0.0316 -0.1555 0.0781  22   THR L N   
3437 C  CA  . THR C 22  ? 0.3634 0.2459 0.8930 -0.0340 -0.1508 0.0853  22   THR L CA  
3438 C  C   . THR C 22  ? 0.4294 0.3251 0.9566 -0.0203 -0.1626 0.0910  22   THR L C   
3439 O  O   . THR C 22  ? 0.4353 0.3383 0.9600 -0.0107 -0.1760 0.0852  22   THR L O   
3440 C  CB  . THR C 22  ? 0.4553 0.3375 1.0156 -0.0476 -0.1437 0.0736  22   THR L CB  
3441 O  OG1 . THR C 22  ? 0.5237 0.4186 1.1053 -0.0442 -0.1548 0.0580  22   THR L OG1 
3442 C  CG2 . THR C 22  ? 0.3974 0.2605 0.9532 -0.0625 -0.1308 0.0688  22   THR L CG2 
3443 N  N   . CYS C 23  ? 0.3863 0.2826 0.9113 -0.0199 -0.1568 0.1026  23   CYS L N   
3444 C  CA  . CYS C 23  ? 0.3992 0.3013 0.9161 -0.0082 -0.1647 0.1102  23   CYS L CA  
3445 C  C   . CYS C 23  ? 0.4015 0.3059 0.9394 -0.0125 -0.1584 0.1128  23   CYS L C   
3446 O  O   . CYS C 23  ? 0.3612 0.2605 0.9012 -0.0234 -0.1434 0.1186  23   CYS L O   
3447 C  CB  . CYS C 23  ? 0.4251 0.3220 0.9080 -0.0034 -0.1609 0.1233  23   CYS L CB  
3448 S  SG  . CYS C 23  ? 0.4985 0.3953 0.9613 0.0096  -0.1684 0.1332  23   CYS L SG  
3449 N  N   . ARG C 24  ? 0.3625 0.2747 0.9157 -0.0035 -0.1704 0.1079  24   ARG L N   
3450 C  CA  . ARG C 24  ? 0.3559 0.2709 0.9312 -0.0047 -0.1669 0.1088  24   ARG L CA  
3451 C  C   . ARG C 24  ? 0.4244 0.3349 0.9793 0.0092  -0.1734 0.1209  24   ARG L C   
3452 O  O   . ARG C 24  ? 0.4570 0.3688 0.9997 0.0231  -0.1898 0.1195  24   ARG L O   
3453 C  CB  . ARG C 24  ? 0.3362 0.2638 0.9504 -0.0054 -0.1754 0.0905  24   ARG L CB  
3454 N  N   . ALA C 25  ? 0.3404 0.2436 0.8885 0.0048  -0.1598 0.1327  25   ALA L N   
3455 C  CA  . ALA C 25  ? 0.3440 0.2381 0.8705 0.0160  -0.1626 0.1441  25   ALA L CA  
3456 C  C   . ALA C 25  ? 0.4211 0.3183 0.9771 0.0206  -0.1670 0.1397  25   ALA L C   
3457 O  O   . ALA C 25  ? 0.4383 0.3421 1.0264 0.0088  -0.1571 0.1331  25   ALA L O   
3458 C  CB  . ALA C 25  ? 0.3452 0.2299 0.8479 0.0077  -0.1438 0.1575  25   ALA L CB  
3459 N  N   . SER C 26  ? 0.3545 0.2457 0.8988 0.0379  -0.1820 0.1427  26   SER L N   
3460 C  CA  . SER C 26  ? 0.3260 0.2194 0.8962 0.0467  -0.1896 0.1383  26   SER L CA  
3461 C  C   . SER C 26  ? 0.3690 0.2546 0.9474 0.0378  -0.1704 0.1464  26   SER L C   
3462 O  O   . SER C 26  ? 0.3776 0.2691 0.9891 0.0397  -0.1722 0.1393  26   SER L O   
3463 C  CB  . SER C 26  ? 0.3696 0.2536 0.9165 0.0686  -0.2105 0.1419  26   SER L CB  
3464 O  OG  . SER C 26  ? 0.4497 0.3120 0.9475 0.0717  -0.2047 0.1583  26   SER L OG  
3465 N  N   . GLN C 27  ? 0.3135 0.1879 0.8637 0.0276  -0.1518 0.1596  27   GLN L N   
3466 C  CA  . GLN C 27  ? 0.2992 0.1666 0.8524 0.0165  -0.1307 0.1679  27   GLN L CA  
3467 C  C   . GLN C 27  ? 0.3604 0.2295 0.8994 -0.0003 -0.1126 0.1727  27   GLN L C   
3468 O  O   . GLN C 27  ? 0.3471 0.2179 0.8658 0.0009  -0.1178 0.1726  27   GLN L O   
3469 C  CB  . GLN C 27  ? 0.3460 0.1920 0.8650 0.0276  -0.1292 0.1815  27   GLN L CB  
3470 C  CG  . GLN C 27  ? 0.7638 0.6018 1.2835 0.0493  -0.1506 0.1795  27   GLN L CG  
3471 C  CD  . GLN C 27  ? 0.7993 0.6147 1.2673 0.0634  -0.1591 0.1907  27   GLN L CD  
3472 O  OE1 . GLN C 27  ? 0.6102 0.4071 1.0431 0.0583  -0.1428 0.2030  27   GLN L OE1 
3473 N  NE2 . GLN C 27  ? 0.5254 0.3411 0.9871 0.0809  -0.1843 0.1854  27   GLN L NE2 
3474 N  N   . GLY C 28  ? 0.3333 0.2021 0.8821 -0.0153 -0.0921 0.1767  28   GLY L N   
3475 C  CA  . GLY C 28  ? 0.3294 0.2006 0.8647 -0.0308 -0.0750 0.1813  28   GLY L CA  
3476 C  C   . GLY C 28  ? 0.3998 0.2623 0.8910 -0.0265 -0.0711 0.1915  28   GLY L C   
3477 O  O   . GLY C 28  ? 0.4128 0.2620 0.8823 -0.0196 -0.0683 0.1995  28   GLY L O   
3478 N  N   . ILE C 29  ? 0.3348 0.2034 0.8115 -0.0303 -0.0710 0.1902  29   ILE L N   
3479 C  CA  . ILE C 29  ? 0.3388 0.2030 0.7768 -0.0278 -0.0669 0.1964  29   ILE L CA  
3480 C  C   . ILE C 29  ? 0.3584 0.2311 0.7913 -0.0419 -0.0500 0.1978  29   ILE L C   
3481 O  O   . ILE C 29  ? 0.3434 0.2179 0.7501 -0.0410 -0.0475 0.1991  29   ILE L O   
3482 C  CB  . ILE C 29  ? 0.3931 0.2564 0.8142 -0.0150 -0.0856 0.1925  29   ILE L CB  
3483 C  CG1 . ILE C 29  ? 0.3797 0.2546 0.8206 -0.0179 -0.0937 0.1831  29   ILE L CG1 
3484 C  CG2 . ILE C 29  ? 0.4340 0.2866 0.8504 0.0004  -0.1019 0.1930  29   ILE L CG2 
3485 C  CD1 . ILE C 29  ? 0.4721 0.3479 0.8965 -0.0084 -0.1085 0.1787  29   ILE L CD1 
3486 N  N   . ASN C 30  ? 0.3128 0.1909 0.7706 -0.0552 -0.0382 0.1969  30   ASN L N   
3487 C  CA  . ASN C 30  ? 0.2912 0.1880 0.7478 -0.0655 -0.0241 0.1944  30   ASN L CA  
3488 C  C   . ASN C 30  ? 0.3418 0.2339 0.7897 -0.0660 -0.0325 0.1930  30   ASN L C   
3489 O  O   . ASN C 30  ? 0.3244 0.2157 0.7874 -0.0629 -0.0449 0.1866  30   ASN L O   
3490 C  CB  . ASN C 30  ? 0.2630 0.1770 0.6973 -0.0644 -0.0079 0.1948  30   ASN L CB  
3491 C  CG  . ASN C 30  ? 0.3605 0.2398 0.8050 -0.0811 0.0081  0.2095  30   ASN L CG  
3492 N  N   . ASN C 31  ? 0.3285 0.2259 0.7519 -0.0658 -0.0271 0.1947  31   ASN L N   
3493 C  CA  . ASN C 31  ? 0.3305 0.2328 0.7452 -0.0610 -0.0363 0.1898  31   ASN L CA  
3494 C  C   . ASN C 31  ? 0.4247 0.3265 0.8130 -0.0493 -0.0440 0.1890  31   ASN L C   
3495 O  O   . ASN C 31  ? 0.4547 0.3617 0.8329 -0.0451 -0.0496 0.1847  31   ASN L O   
3496 C  CB  . ASN C 31  ? 0.2835 0.2122 0.6946 -0.0633 -0.0275 0.1835  31   ASN L CB  
3497 C  CG  . ASN C 31  ? 0.3224 0.2311 0.7558 -0.0818 -0.0213 0.1887  31   ASN L CG  
3498 O  OD1 . ASN C 31  ? 0.2866 0.1904 0.7261 -0.0808 -0.0301 0.1842  31   ASN L OD1 
3499 N  ND2 . ASN C 31  ? 0.1639 0.1669 0.5892 -0.0364 -0.0233 0.1567  31   ASN L ND2 
3500 N  N   . TYR C 32  ? 0.3765 0.2696 0.7526 -0.0437 -0.0450 0.1927  32   TYR L N   
3501 C  CA  . TYR C 32  ? 0.3870 0.2751 0.7344 -0.0341 -0.0514 0.1920  32   TYR L CA  
3502 C  C   . TYR C 32  ? 0.4025 0.2873 0.7522 -0.0225 -0.0723 0.1870  32   TYR L C   
3503 O  O   . TYR C 32  ? 0.4093 0.2838 0.7500 -0.0137 -0.0825 0.1883  32   TYR L O   
3504 C  CB  . TYR C 32  ? 0.4293 0.3034 0.7588 -0.0324 -0.0451 0.1984  32   TYR L CB  
3505 C  CG  . TYR C 32  ? 0.4579 0.3329 0.7836 -0.0441 -0.0234 0.2029  32   TYR L CG  
3506 C  CD1 . TYR C 32  ? 0.4853 0.3600 0.8357 -0.0513 -0.0159 0.2064  32   TYR L CD1 
3507 C  CD2 . TYR C 32  ? 0.4673 0.3419 0.7634 -0.0484 -0.0095 0.2028  32   TYR L CD2 
3508 C  CE1 . TYR C 32  ? 0.5198 0.3950 0.8662 -0.0628 0.0051  0.2104  32   TYR L CE1 
3509 C  CE2 . TYR C 32  ? 0.4717 0.3476 0.7635 -0.0601 0.0119  0.2058  32   TYR L CE2 
3510 C  CZ  . TYR C 32  ? 0.5863 0.4621 0.9029 -0.0671 0.0190  0.2102  32   TYR L CZ  
3511 O  OH  . TYR C 32  ? 0.5966 0.4739 0.9087 -0.0796 0.0412  0.2127  32   TYR L OH  
3512 N  N   . LEU C 33  ? 0.3214 0.2140 0.6810 -0.0223 -0.0786 0.1811  33   LEU L N   
3513 C  CA  . LEU C 33  ? 0.3242 0.2146 0.6869 -0.0132 -0.0962 0.1752  33   LEU L CA  
3514 C  C   . LEU C 33  ? 0.3778 0.2741 0.7274 -0.0103 -0.0994 0.1697  33   LEU L C   
3515 O  O   . LEU C 33  ? 0.3664 0.2692 0.7204 -0.0154 -0.0927 0.1682  33   LEU L O   
3516 C  CB  . LEU C 33  ? 0.3098 0.2000 0.7043 -0.0157 -0.1029 0.1711  33   LEU L CB  
3517 C  CG  . LEU C 33  ? 0.3614 0.2507 0.7642 -0.0080 -0.1202 0.1629  33   LEU L CG  
3518 C  CD1 . LEU C 33  ? 0.3760 0.2674 0.7722 -0.0069 -0.1238 0.1572  33   LEU L CD1 
3519 C  CD2 . LEU C 33  ? 0.3603 0.2456 0.7593 0.0019  -0.1327 0.1628  33   LEU L CD2 
3520 N  N   . ASN C 34  ? 0.3392 0.2327 0.6740 -0.0017 -0.1108 0.1660  34   ASN L N   
3521 C  CA  . ASN C 34  ? 0.3323 0.2307 0.6560 0.0022  -0.1152 0.1594  34   ASN L CA  
3522 C  C   . ASN C 34  ? 0.3794 0.2751 0.7136 0.0079  -0.1304 0.1531  34   ASN L C   
3523 O  O   . ASN C 34  ? 0.3667 0.2579 0.7093 0.0112  -0.1397 0.1529  34   ASN L O   
3524 C  CB  . ASN C 34  ? 0.3549 0.2523 0.6491 0.0053  -0.1133 0.1585  34   ASN L CB  
3525 C  CG  . ASN C 34  ? 0.6367 0.5338 0.9170 -0.0010 -0.0978 0.1637  34   ASN L CG  
3526 O  OD1 . ASN C 34  ? 0.5520 0.4596 0.8340 -0.0071 -0.0855 0.1627  34   ASN L OD1 
3527 N  ND2 . ASN C 34  ? 0.5018 0.3863 0.7668 0.0008  -0.0983 0.1687  34   ASN L ND2 
3528 N  N   . TRP C 35  ? 0.3415 0.2405 0.6746 0.0097  -0.1328 0.1469  35   TRP L N   
3529 C  CA  . TRP C 35  ? 0.3469 0.2430 0.6868 0.0142  -0.1449 0.1394  35   TRP L CA  
3530 C  C   . TRP C 35  ? 0.4646 0.3633 0.7843 0.0202  -0.1489 0.1340  35   TRP L C   
3531 O  O   . TRP C 35  ? 0.4923 0.3966 0.8013 0.0199  -0.1414 0.1332  35   TRP L O   
3532 C  CB  . TRP C 35  ? 0.3072 0.1999 0.6636 0.0101  -0.1428 0.1364  35   TRP L CB  
3533 C  CG  . TRP C 35  ? 0.3010 0.1898 0.6795 0.0029  -0.1401 0.1383  35   TRP L CG  
3534 C  CD1 . TRP C 35  ? 0.3215 0.2098 0.7082 -0.0052 -0.1290 0.1437  35   TRP L CD1 
3535 C  CD2 . TRP C 35  ? 0.3017 0.1877 0.6984 0.0022  -0.1481 0.1328  35   TRP L CD2 
3536 N  NE1 . TRP C 35  ? 0.3006 0.1847 0.7094 -0.0115 -0.1290 0.1419  35   TRP L NE1 
3537 C  CE2 . TRP C 35  ? 0.3348 0.2183 0.7511 -0.0069 -0.1407 0.1345  35   TRP L CE2 
3538 C  CE3 . TRP C 35  ? 0.3378 0.2244 0.7370 0.0078  -0.1606 0.1250  35   TRP L CE3 
3539 C  CZ2 . TRP C 35  ? 0.3405 0.2229 0.7804 -0.0106 -0.1451 0.1274  35   TRP L CZ2 
3540 C  CZ3 . TRP C 35  ? 0.3645 0.2513 0.7870 0.0047  -0.1656 0.1180  35   TRP L CZ3 
3541 C  CH2 . TRP C 35  ? 0.3632 0.2482 0.8064 -0.0044 -0.1578 0.1186  35   TRP L CH2 
3542 N  N   . TYR C 36  ? 0.4338 0.3298 0.7491 0.0252  -0.1605 0.1293  36   TYR L N   
3543 C  CA  . TYR C 36  ? 0.4362 0.3337 0.7331 0.0298  -0.1650 0.1230  36   TYR L CA  
3544 C  C   . TYR C 36  ? 0.4658 0.3613 0.7722 0.0326  -0.1746 0.1146  36   TYR L C   
3545 O  O   . TYR C 36  ? 0.4741 0.3671 0.7973 0.0317  -0.1807 0.1130  36   TYR L O   
3546 C  CB  . TYR C 36  ? 0.4600 0.3538 0.7357 0.0322  -0.1697 0.1250  36   TYR L CB  
3547 C  CG  . TYR C 36  ? 0.4719 0.3638 0.7327 0.0288  -0.1589 0.1325  36   TYR L CG  
3548 C  CD1 . TYR C 36  ? 0.4997 0.3953 0.7406 0.0262  -0.1488 0.1301  36   TYR L CD1 
3549 C  CD2 . TYR C 36  ? 0.4768 0.3636 0.7446 0.0274  -0.1575 0.1406  36   TYR L CD2 
3550 C  CE1 . TYR C 36  ? 0.5259 0.4193 0.7522 0.0213  -0.1365 0.1355  36   TYR L CE1 
3551 C  CE2 . TYR C 36  ? 0.4894 0.3726 0.7427 0.0233  -0.1455 0.1473  36   TYR L CE2 
3552 C  CZ  . TYR C 36  ? 0.5837 0.4697 0.8152 0.0198  -0.1345 0.1446  36   TYR L CZ  
3553 O  OH  . TYR C 36  ? 0.5768 0.4587 0.7923 0.0142  -0.1208 0.1496  36   TYR L OH  
3554 N  N   . GLN C 37  ? 0.3809 0.2781 0.6769 0.0356  -0.1751 0.1080  37   GLN L N   
3555 C  CA  . GLN C 37  ? 0.3611 0.2553 0.6614 0.0381  -0.1829 0.0991  37   GLN L CA  
3556 C  C   . GLN C 37  ? 0.4124 0.3087 0.6936 0.0409  -0.1891 0.0946  37   GLN L C   
3557 O  O   . GLN C 37  ? 0.4114 0.3108 0.6745 0.0410  -0.1841 0.0952  37   GLN L O   
3558 C  CB  . GLN C 37  ? 0.3711 0.2631 0.6734 0.0398  -0.1780 0.0947  37   GLN L CB  
3559 C  CG  . GLN C 37  ? 0.5000 0.3862 0.8044 0.0422  -0.1841 0.0852  37   GLN L CG  
3560 C  CD  . GLN C 37  ? 0.5998 0.4823 0.9002 0.0464  -0.1800 0.0808  37   GLN L CD  
3561 O  OE1 . GLN C 37  ? 0.4532 0.3432 0.7420 0.0502  -0.1779 0.0778  37   GLN L OE1 
3562 N  NE2 . GLN C 37  ? 0.5711 0.4408 0.8800 0.0459  -0.1788 0.0793  37   GLN L NE2 
3563 N  N   . GLN C 38  ? 0.3872 0.2821 0.6717 0.0422  -0.1992 0.0888  38   GLN L N   
3564 C  CA  . GLN C 38  ? 0.4097 0.3055 0.6752 0.0440  -0.2058 0.0838  38   GLN L CA  
3565 C  C   . GLN C 38  ? 0.4771 0.3729 0.7496 0.0447  -0.2126 0.0732  38   GLN L C   
3566 O  O   . GLN C 38  ? 0.4681 0.3638 0.7584 0.0438  -0.2180 0.0701  38   GLN L O   
3567 C  CB  . GLN C 38  ? 0.4391 0.3326 0.6922 0.0451  -0.2131 0.0894  38   GLN L CB  
3568 C  CG  . GLN C 38  ? 0.5677 0.4587 0.7946 0.0460  -0.2191 0.0850  38   GLN L CG  
3569 C  CD  . GLN C 38  ? 0.5786 0.4629 0.7880 0.0484  -0.2282 0.0905  38   GLN L CD  
3570 O  OE1 . GLN C 38  ? 0.4178 0.3026 0.6410 0.0518  -0.2366 0.0938  38   GLN L OE1 
3571 N  NE2 . GLN C 38  ? 0.4604 0.3373 0.6380 0.0470  -0.2271 0.0905  38   GLN L NE2 
3572 N  N   . LYS C 39  ? 0.4513 0.3479 0.7099 0.0454  -0.2116 0.0664  39   LYS L N   
3573 C  CA  . LYS C 39  ? 0.4601 0.3564 0.7213 0.0453  -0.2166 0.0556  39   LYS L CA  
3574 C  C   . LYS C 39  ? 0.5665 0.4648 0.8094 0.0448  -0.2256 0.0523  39   LYS L C   
3575 O  O   . LYS C 39  ? 0.5622 0.4592 0.7845 0.0445  -0.2249 0.0573  39   LYS L O   
3576 C  CB  . LYS C 39  ? 0.4697 0.3642 0.7291 0.0468  -0.2089 0.0493  39   LYS L CB  
3577 C  CG  . LYS C 39  ? 0.3343 0.2233 0.6088 0.0482  -0.2023 0.0526  39   LYS L CG  
3578 C  CD  . LYS C 39  ? 0.3303 0.2148 0.6039 0.0520  -0.1974 0.0457  39   LYS L CD  
3579 C  CE  . LYS C 39  ? 0.3784 0.2563 0.6608 0.0543  -0.1915 0.0513  39   LYS L CE  
3580 N  NZ  . LYS C 39  ? 0.5602 0.4332 0.8394 0.0608  -0.1876 0.0458  39   LYS L NZ  
3581 N  N   . PRO C 40  ? 0.5718 0.4723 0.8200 0.0440  -0.2338 0.0436  40   PRO L N   
3582 C  CA  . PRO C 40  ? 0.6014 0.5035 0.8301 0.0436  -0.2436 0.0404  40   PRO L CA  
3583 C  C   . PRO C 40  ? 0.6439 0.5430 0.8461 0.0413  -0.2384 0.0383  40   PRO L C   
3584 O  O   . PRO C 40  ? 0.6158 0.5155 0.8199 0.0402  -0.2295 0.0322  40   PRO L O   
3585 C  CB  . PRO C 40  ? 0.6317 0.5388 0.8740 0.0420  -0.2503 0.0287  40   PRO L CB  
3586 C  CG  . PRO C 40  ? 0.6777 0.5817 0.9395 0.0408  -0.2407 0.0245  40   PRO L CG  
3587 C  CD  . PRO C 40  ? 0.5995 0.4998 0.8690 0.0426  -0.2337 0.0354  40   PRO L CD  
3588 N  N   . GLY C 41  ? 0.6044 0.4988 0.7811 0.0408  -0.2434 0.0430  41   GLY L N   
3589 C  CA  . GLY C 41  ? 0.6142 0.5034 0.7617 0.0364  -0.2378 0.0403  41   GLY L CA  
3590 C  C   . GLY C 41  ? 0.6498 0.5382 0.7930 0.0349  -0.2235 0.0436  41   GLY L C   
3591 O  O   . GLY C 41  ? 0.6695 0.5556 0.7918 0.0300  -0.2161 0.0384  41   GLY L O   
3592 N  N   . LYS C 42  ? 0.5626 0.4537 0.7255 0.0381  -0.2190 0.0511  42   LYS L N   
3593 C  CA  . LYS C 42  ? 0.5371 0.4302 0.6986 0.0370  -0.2059 0.0539  42   LYS L CA  
3594 C  C   . LYS C 42  ? 0.5764 0.4647 0.7342 0.0373  -0.2041 0.0662  42   LYS L C   
3595 O  O   . LYS C 42  ? 0.5957 0.4807 0.7614 0.0404  -0.2132 0.0729  42   LYS L O   
3596 C  CB  . LYS C 42  ? 0.5402 0.4409 0.7275 0.0402  -0.2001 0.0500  42   LYS L CB  
3597 C  CG  . LYS C 42  ? 0.7685 0.6739 0.9536 0.0397  -0.1952 0.0373  42   LYS L CG  
3598 C  CD  . LYS C 42  ? 0.9872 0.8912 1.1839 0.0415  -0.2019 0.0298  42   LYS L CD  
3599 C  CE  . LYS C 42  ? 1.0844 0.9921 1.2824 0.0425  -0.1962 0.0175  42   LYS L CE  
3600 N  NZ  . LYS C 42  ? 1.0811 0.9894 1.2985 0.0491  -0.1915 0.0174  42   LYS L NZ  
3601 N  N   . ALA C 43  ? 0.4960 0.3846 0.6423 0.0340  -0.1917 0.0679  43   ALA L N   
3602 C  CA  . ALA C 43  ? 0.4739 0.3571 0.6149 0.0331  -0.1870 0.0790  43   ALA L CA  
3603 C  C   . ALA C 43  ? 0.4391 0.3296 0.6112 0.0363  -0.1852 0.0847  43   ALA L C   
3604 O  O   . ALA C 43  ? 0.4377 0.3368 0.6288 0.0381  -0.1828 0.0792  43   ALA L O   
3605 C  CB  . ALA C 43  ? 0.4929 0.3760 0.6127 0.0266  -0.1719 0.0762  43   ALA L CB  
3606 N  N   . PRO C 44  ? 0.3083 0.1939 0.4847 0.0368  -0.1853 0.0955  44   PRO L N   
3607 C  CA  . PRO C 44  ? 0.2597 0.1547 0.4625 0.0325  -0.1782 0.0963  44   PRO L CA  
3608 C  C   . PRO C 44  ? 0.2936 0.1947 0.4999 0.0349  -0.1672 0.0976  44   PRO L C   
3609 O  O   . PRO C 44  ? 0.2877 0.1911 0.4745 0.0315  -0.1588 0.0929  44   PRO L O   
3610 C  CB  . PRO C 44  ? 0.2680 0.1566 0.4695 0.0317  -0.1786 0.1063  44   PRO L CB  
3611 C  CG  . PRO C 44  ? 0.3473 0.2206 0.5264 0.0397  -0.1924 0.1117  44   PRO L CG  
3612 C  CD  . PRO C 44  ? 0.3187 0.1911 0.4735 0.0366  -0.1887 0.1036  44   PRO L CD  
3613 N  N   . LYS C 45  ? 0.2277 0.1423 0.4537 0.0235  -0.1582 0.0897  45   LYS L N   
3614 C  CA  . LYS C 45  ? 0.2034 0.1307 0.4337 0.0181  -0.1456 0.0842  45   LYS L CA  
3615 C  C   . LYS C 45  ? 0.2344 0.1544 0.4840 0.0279  -0.1471 0.1024  45   LYS L C   
3616 O  O   . LYS C 45  ? 0.1859 0.1200 0.4457 0.0057  -0.1416 0.0890  45   LYS L O   
3617 C  CB  . LYS C 45  ? 0.2301 0.1522 0.4749 0.0335  -0.1553 0.0839  45   LYS L CB  
3618 C  CG  . LYS C 45  ? 0.5198 0.4475 0.7749 0.0434  -0.1518 0.0856  45   LYS L CG  
3619 C  CD  . LYS C 45  ? 0.4787 0.4041 0.7421 0.0504  -0.1570 0.0782  45   LYS L CD  
3620 C  CE  . LYS C 45  ? 0.7996 0.7338 1.0681 0.0548  -0.1517 0.0753  45   LYS L CE  
3621 N  NZ  . LYS C 45  ? 1.0407 0.9916 1.2997 0.0552  -0.1453 0.0654  45   LYS L NZ  
3622 N  N   . LEU C 46  ? 0.2533 0.1762 0.4984 0.0288  -0.1376 0.1086  46   LEU L N   
3623 C  CA  . LEU C 46  ? 0.2580 0.1817 0.5164 0.0250  -0.1311 0.1172  46   LEU L CA  
3624 C  C   . LEU C 46  ? 0.3335 0.2609 0.6095 0.0274  -0.1316 0.1156  46   LEU L C   
3625 O  O   . LEU C 46  ? 0.3645 0.3008 0.6379 0.0311  -0.1295 0.1082  46   LEU L O   
3626 C  CB  . LEU C 46  ? 0.2575 0.1878 0.5036 0.0186  -0.1167 0.1193  46   LEU L CB  
3627 C  CG  . LEU C 46  ? 0.3082 0.2408 0.5678 0.0133  -0.1081 0.1275  46   LEU L CG  
3628 C  CD1 . LEU C 46  ? 0.3223 0.2424 0.5882 0.0113  -0.1115 0.1371  46   LEU L CD1 
3629 C  CD2 . LEU C 46  ? 0.3073 0.2503 0.5554 0.0067  -0.0923 0.1261  46   LEU L CD2 
3630 N  N   . LEU C 47  ? 0.2657 0.1851 0.5582 0.0255  -0.1342 0.1217  47   LEU L N   
3631 C  CA  . LEU C 47  ? 0.2651 0.1817 0.5698 0.0266  -0.1343 0.1212  47   LEU L CA  
3632 C  C   . LEU C 47  ? 0.3331 0.2534 0.6445 0.0201  -0.1243 0.1281  47   LEU L C   
3633 O  O   . LEU C 47  ? 0.3187 0.2448 0.6300 0.0214  -0.1201 0.1267  47   LEU L O   
3634 C  CB  . LEU C 47  ? 0.2719 0.1743 0.5890 0.0266  -0.1426 0.1209  47   LEU L CB  
3635 C  CG  . LEU C 47  ? 0.3761 0.2741 0.6895 0.0314  -0.1527 0.1138  47   LEU L CG  
3636 C  CD1 . LEU C 47  ? 0.3865 0.2740 0.7143 0.0284  -0.1585 0.1131  47   LEU L CD1 
3637 C  CD2 . LEU C 47  ? 0.4441 0.3420 0.7503 0.0384  -0.1550 0.1058  47   LEU L CD2 
3638 N  N   . ILE C 48  ? 0.3121 0.2287 0.6299 0.0137  -0.1212 0.1351  48   ILE L N   
3639 C  CA  . ILE C 48  ? 0.3001 0.2182 0.6267 0.0057  -0.1113 0.1419  48   ILE L CA  
3640 C  C   . ILE C 48  ? 0.3454 0.2670 0.6659 0.0012  -0.1039 0.1470  48   ILE L C   
3641 O  O   . ILE C 48  ? 0.3279 0.2431 0.6456 0.0032  -0.1099 0.1481  48   ILE L O   
3642 C  CB  . ILE C 48  ? 0.3407 0.2458 0.6856 0.0010  -0.1143 0.1446  48   ILE L CB  
3643 C  CG1 . ILE C 48  ? 0.3500 0.2463 0.6965 0.0035  -0.1180 0.1407  48   ILE L CG1 
3644 C  CG2 . ILE C 48  ? 0.3496 0.2551 0.7054 -0.0090 -0.1040 0.1518  48   ILE L CG2 
3645 C  CD1 . ILE C 48  ? 0.4808 0.3762 0.8279 -0.0011 -0.1104 0.1441  48   ILE L CD1 
3646 N  N   . TYR C 49  ? 0.3366 0.2672 0.6542 -0.0049 -0.0910 0.1499  49   TYR L N   
3647 C  CA  . TYR C 49  ? 0.3482 0.2795 0.6584 -0.0108 -0.0808 0.1550  49   TYR L CA  
3648 C  C   . TYR C 49  ? 0.4032 0.3349 0.7280 -0.0202 -0.0705 0.1617  49   TYR L C   
3649 O  O   . TYR C 49  ? 0.3831 0.3196 0.7169 -0.0230 -0.0680 0.1610  49   TYR L O   
3650 C  CB  . TYR C 49  ? 0.3675 0.3094 0.6563 -0.0113 -0.0718 0.1498  49   TYR L CB  
3651 C  CG  . TYR C 49  ? 0.3641 0.3235 0.6545 -0.0142 -0.0624 0.1449  49   TYR L CG  
3652 C  CD1 . TYR C 49  ? 0.3756 0.3425 0.6680 -0.0237 -0.0475 0.1483  49   TYR L CD1 
3653 C  CD2 . TYR C 49  ? 0.3660 0.3351 0.6560 -0.0070 -0.0687 0.1360  49   TYR L CD2 
3654 C  CE1 . TYR C 49  ? 0.3680 0.3535 0.6624 -0.0261 -0.0399 0.1427  49   TYR L CE1 
3655 C  CE2 . TYR C 49  ? 0.3692 0.3561 0.6613 -0.0077 -0.0620 0.1303  49   TYR L CE2 
3656 C  CZ  . TYR C 49  ? 0.4470 0.4433 0.7410 -0.0174 -0.0478 0.1333  49   TYR L CZ  
3657 O  OH  . TYR C 49  ? 0.4587 0.4745 0.7560 -0.0178 -0.0424 0.1270  49   TYR L OH  
3658 N  N   . ASP C 50  ? 0.3691 0.2940 0.6953 -0.0248 -0.0650 0.1680  50   ASP L N   
3659 C  CA  . ASP C 50  ? 0.3581 0.2830 0.6991 -0.0349 -0.0539 0.1739  50   ASP L CA  
3660 C  C   . ASP C 50  ? 0.4051 0.3256 0.7684 -0.0379 -0.0591 0.1738  50   ASP L C   
3661 O  O   . ASP C 50  ? 0.3778 0.3027 0.7477 -0.0455 -0.0509 0.1750  50   ASP L O   
3662 C  CB  . ASP C 50  ? 0.3727 0.3112 0.7044 -0.0426 -0.0371 0.1736  50   ASP L CB  
3663 C  CG  . ASP C 50  ? 0.3817 0.3227 0.7263 -0.0548 -0.0231 0.1790  50   ASP L CG  
3664 O  OD1 . ASP C 50  ? 0.3657 0.2970 0.7173 -0.0589 -0.0188 0.1848  50   ASP L OD1 
3665 O  OD2 . ASP C 50  ? 0.3280 0.2813 0.6745 -0.0600 -0.0161 0.1768  50   ASP L OD2 
3666 N  N   . ALA C 51  ? 0.3864 0.2976 0.7595 -0.0327 -0.0723 0.1715  51   ALA L N   
3667 C  CA  . ALA C 51  ? 0.3897 0.2930 0.7825 -0.0363 -0.0773 0.1692  51   ALA L CA  
3668 C  C   . ALA C 51  ? 0.4736 0.3745 0.8631 -0.0355 -0.0802 0.1652  51   ALA L C   
3669 O  O   . ALA C 51  ? 0.5008 0.3920 0.8972 -0.0336 -0.0889 0.1605  51   ALA L O   
3670 C  CB  . ALA C 51  ? 0.3839 0.2848 0.7950 -0.0482 -0.0667 0.1733  51   ALA L CB  
3671 N  N   . SER C 52  ? 0.4166 0.3252 0.7958 -0.0372 -0.0728 0.1664  52   SER L N   
3672 C  CA  . SER C 52  ? 0.4082 0.3117 0.7829 -0.0357 -0.0759 0.1637  52   SER L CA  
3673 C  C   . SER C 52  ? 0.5038 0.4195 0.8618 -0.0271 -0.0771 0.1602  52   SER L C   
3674 O  O   . SER C 52  ? 0.5219 0.4324 0.8745 -0.0235 -0.0810 0.1579  52   SER L O   
3675 C  CB  . SER C 52  ? 0.3991 0.2966 0.7822 -0.0481 -0.0665 0.1676  52   SER L CB  
3676 O  OG  . SER C 52  ? 0.4107 0.3225 0.7917 -0.0543 -0.0541 0.1717  52   SER L OG  
3677 N  N   . LYS C 53  ? 0.4518 0.3823 0.8009 -0.0238 -0.0737 0.1587  53   LYS L N   
3678 C  CA  . LYS C 53  ? 0.4446 0.3900 0.7810 -0.0167 -0.0738 0.1526  53   LYS L CA  
3679 C  C   . LYS C 53  ? 0.5202 0.4632 0.8492 -0.0051 -0.0856 0.1457  53   LYS L C   
3680 O  O   . LYS C 53  ? 0.5296 0.4702 0.8549 -0.0030 -0.0890 0.1447  53   LYS L O   
3681 C  CB  . LYS C 53  ? 0.4587 0.4219 0.7878 -0.0215 -0.0611 0.1518  53   LYS L CB  
3682 C  CG  . LYS C 53  ? 0.3187 0.2833 0.6549 -0.0346 -0.0470 0.1591  53   LYS L CG  
3683 C  CD  . LYS C 53  ? 0.1959 0.2060 0.5443 -0.0283 -0.0478 0.1456  53   LYS L CD  
3684 C  CE  . LYS C 53  ? 0.2291 0.1973 0.5806 -0.0552 -0.0271 0.1682  53   LYS L CE  
3685 N  NZ  . LYS C 53  ? 0.2354 0.2115 0.5890 -0.0619 -0.0206 0.1686  53   LYS L NZ  
3686 N  N   . LEU C 54  ? 0.4897 0.4320 0.8150 0.0027  -0.0921 0.1409  54   LEU L N   
3687 C  CA  . LEU C 54  ? 0.4952 0.4347 0.8142 0.0139  -0.1028 0.1335  54   LEU L CA  
3688 C  C   . LEU C 54  ? 0.5456 0.5058 0.8552 0.0182  -0.0996 0.1252  54   LEU L C   
3689 O  O   . LEU C 54  ? 0.5309 0.5088 0.8385 0.0178  -0.0928 0.1215  54   LEU L O   
3690 C  CB  . LEU C 54  ? 0.5021 0.4307 0.8192 0.0212  -0.1100 0.1314  54   LEU L CB  
3691 C  CG  . LEU C 54  ? 0.5818 0.5033 0.8930 0.0331  -0.1209 0.1239  54   LEU L CG  
3692 C  CD1 . LEU C 54  ? 0.5861 0.4898 0.9010 0.0310  -0.1263 0.1249  54   LEU L CD1 
3693 C  CD2 . LEU C 54  ? 0.6507 0.5617 0.9557 0.0418  -0.1266 0.1220  54   LEU L CD2 
3694 N  N   . GLN C 55  ? 0.4984 0.4570 0.8019 0.0211  -0.1038 0.1214  55   GLN L N   
3695 C  CA  . GLN C 55  ? 0.4890 0.4641 0.7815 0.0232  -0.0997 0.1121  55   GLN L CA  
3696 C  C   . GLN C 55  ? 0.5577 0.5426 0.8500 0.0338  -0.1053 0.1014  55   GLN L C   
3697 O  O   . GLN C 55  ? 0.5604 0.5323 0.8564 0.0412  -0.1154 0.1015  55   GLN L O   
3698 C  CB  . GLN C 55  ? 0.5090 0.4760 0.7920 0.0228  -0.1034 0.1112  55   GLN L CB  
3699 C  CG  . GLN C 55  ? 0.6251 0.6047 0.8931 0.0232  -0.0986 0.1003  55   GLN L CG  
3700 C  CD  . GLN C 55  ? 0.9808 0.9714 1.2376 0.0140  -0.0833 0.0988  55   GLN L CD  
3701 O  OE1 . GLN C 55  ? 0.9188 0.9136 1.1598 0.0116  -0.0783 0.0905  55   GLN L OE1 
3702 N  NE2 . GLN C 55  ? 0.9702 0.9650 1.2330 0.0074  -0.0740 0.1055  55   GLN L NE2 
3703 N  N   . SER C 56  ? 0.5297 0.5372 0.8180 0.0344  -0.0982 0.0912  56   SER L N   
3704 C  CA  . SER C 56  ? 0.5355 0.5560 0.8260 0.0461  -0.1040 0.0788  56   SER L CA  
3705 C  C   . SER C 56  ? 0.5579 0.5696 0.8449 0.0538  -0.1134 0.0722  56   SER L C   
3706 O  O   . SER C 56  ? 0.5495 0.5574 0.8285 0.0486  -0.1113 0.0713  56   SER L O   
3707 C  CB  . SER C 56  ? 0.5964 0.6464 0.8858 0.0440  -0.0936 0.0661  56   SER L CB  
3708 O  OG  . SER C 56  ? 0.7468 0.8033 1.0257 0.0373  -0.0855 0.0584  56   SER L OG  
3709 N  N   . GLY C 57  ? 0.4996 0.5048 0.7907 0.0659  -0.1239 0.0688  57   GLY L N   
3710 C  CA  . GLY C 57  ? 0.4988 0.4943 0.7876 0.0735  -0.1325 0.0624  57   GLY L CA  
3711 C  C   . GLY C 57  ? 0.5220 0.4900 0.8105 0.0718  -0.1392 0.0725  57   GLY L C   
3712 O  O   . GLY C 57  ? 0.5601 0.5181 0.8465 0.0767  -0.1458 0.0679  57   GLY L O   
3713 N  N   . VAL C 58  ? 0.4062 0.3629 0.6978 0.0639  -0.1366 0.0850  58   VAL L N   
3714 C  CA  . VAL C 58  ? 0.3682 0.3007 0.6622 0.0610  -0.1418 0.0926  58   VAL L CA  
3715 C  C   . VAL C 58  ? 0.3583 0.2734 0.6533 0.0663  -0.1461 0.0958  58   VAL L C   
3716 O  O   . VAL C 58  ? 0.3466 0.2662 0.6424 0.0655  -0.1424 0.0996  58   VAL L O   
3717 C  CB  . VAL C 58  ? 0.3936 0.3227 0.6914 0.0489  -0.1368 0.1024  58   VAL L CB  
3718 C  CG1 . VAL C 58  ? 0.3875 0.2949 0.6912 0.0458  -0.1422 0.1070  58   VAL L CG1 
3719 C  CG2 . VAL C 58  ? 0.3895 0.3299 0.6803 0.0448  -0.1334 0.0998  58   VAL L CG2 
3720 N  N   . PRO C 59  ? 0.2851 0.1791 0.5775 0.0709  -0.1529 0.0937  59   PRO L N   
3721 C  CA  . PRO C 59  ? 0.2877 0.1653 0.5724 0.0683  -0.1533 0.0924  59   PRO L CA  
3722 C  C   . PRO C 59  ? 0.3381 0.1969 0.6286 0.0647  -0.1510 0.1073  59   PRO L C   
3723 O  O   . PRO C 59  ? 0.3558 0.2139 0.6544 0.0535  -0.1471 0.1116  59   PRO L O   
3724 C  CB  . PRO C 59  ? 0.3186 0.1670 0.6023 0.0789  -0.1617 0.0926  59   PRO L CB  
3725 C  CG  . PRO C 59  ? 0.3740 0.2390 0.6602 0.0804  -0.1633 0.0850  59   PRO L CG  
3726 C  CD  . PRO C 59  ? 0.3067 0.1945 0.5981 0.0722  -0.1576 0.0882  59   PRO L CD  
3727 N  N   . SER C 60  ? 0.3015 0.1577 0.5834 0.0623  -0.1491 0.1067  60   SER L N   
3728 C  CA  . SER C 60  ? 0.3043 0.1505 0.5869 0.0512  -0.1434 0.1151  60   SER L CA  
3729 C  C   . SER C 60  ? 0.3888 0.1968 0.6738 0.0464  -0.1436 0.1229  60   SER L C   
3730 O  O   . SER C 60  ? 0.3860 0.1868 0.6751 0.0343  -0.1371 0.1291  60   SER L O   
3731 C  CB  . SER C 60  ? 0.3760 0.2037 0.6471 0.0652  -0.1485 0.1214  60   SER L CB  
3732 O  OG  . SER C 60  ? 0.5351 0.3383 0.7918 0.0778  -0.1569 0.1174  60   SER L OG  
3733 N  N   . ARG C 61  ? 0.3831 0.1769 0.6659 0.0496  -0.1480 0.1171  61   ARG L N   
3734 C  CA  . ARG C 61  ? 0.3985 0.1681 0.6838 0.0391  -0.1456 0.1164  61   ARG L CA  
3735 C  C   . ARG C 61  ? 0.4563 0.2418 0.7608 0.0270  -0.1414 0.1178  61   ARG L C   
3736 O  O   . ARG C 61  ? 0.4732 0.2441 0.7848 0.0158  -0.1379 0.1167  61   ARG L O   
3737 C  CB  . ARG C 61  ? 0.3752 0.1345 0.6527 0.0440  -0.1502 0.1064  61   ARG L CB  
3738 C  CG  . ARG C 61  ? 0.2807 0.1037 0.5650 0.0321  -0.1499 0.0873  61   ARG L CG  
3739 C  CD  . ARG C 61  ? 0.3167 0.0887 0.5972 0.0487  -0.1570 0.0900  61   ARG L CD  
3740 N  NE  . ARG C 61  ? 0.4368 0.2046 0.7109 0.0678  -0.1639 0.0884  61   ARG L NE  
3741 C  CZ  . ARG C 61  ? 0.4892 0.2809 0.7698 0.0706  -0.1667 0.0835  61   ARG L CZ  
3742 N  NH1 . ARG C 61  ? 0.3771 0.1768 0.6521 0.0825  -0.1706 0.0772  61   ARG L NH1 
3743 N  NH2 . ARG C 61  ? 0.2499 0.1148 0.5334 0.0293  -0.1560 0.0634  61   ARG L NH2 
3744 N  N   . PHE C 62  ? 0.3937 0.2079 0.7055 0.0292  -0.1415 0.1191  62   PHE L N   
3745 C  CA  . PHE C 62  ? 0.3789 0.2079 0.7056 0.0205  -0.1385 0.1216  62   PHE L CA  
3746 C  C   . PHE C 62  ? 0.4756 0.3113 0.8070 0.0125  -0.1303 0.1294  62   PHE L C   
3747 O  O   . PHE C 62  ? 0.4706 0.3182 0.7952 0.0168  -0.1280 0.1320  62   PHE L O   
3748 C  CB  . PHE C 62  ? 0.3833 0.2348 0.7095 0.0267  -0.1420 0.1190  62   PHE L CB  
3749 C  CG  . PHE C 62  ? 0.4032 0.2511 0.7267 0.0324  -0.1496 0.1110  62   PHE L CG  
3750 C  CD1 . PHE C 62  ? 0.4445 0.2849 0.7774 0.0268  -0.1525 0.1077  62   PHE L CD1 
3751 C  CD2 . PHE C 62  ? 0.4228 0.2769 0.7359 0.0428  -0.1535 0.1054  62   PHE L CD2 
3752 C  CE1 . PHE C 62  ? 0.4679 0.3065 0.7981 0.0312  -0.1590 0.0997  62   PHE L CE1 
3753 C  CE2 . PHE C 62  ? 0.4717 0.3231 0.7823 0.0467  -0.1596 0.0977  62   PHE L CE2 
3754 C  CZ  . PHE C 62  ? 0.4632 0.3059 0.7816 0.0407  -0.1622 0.0953  62   PHE L CZ  
3755 N  N   . SER C 63  ? 0.4482 0.2778 0.7928 0.0005  -0.1255 0.1319  63   SER L N   
3756 C  CA  . SER C 63  ? 0.4357 0.2712 0.7872 -0.0091 -0.1165 0.1389  63   SER L CA  
3757 C  C   . SER C 63  ? 0.4526 0.2943 0.8227 -0.0178 -0.1138 0.1397  63   SER L C   
3758 O  O   . SER C 63  ? 0.4579 0.2921 0.8375 -0.0199 -0.1180 0.1339  63   SER L O   
3759 C  CB  . SER C 63  ? 0.5028 0.3170 0.8478 -0.0160 -0.1116 0.1413  63   SER L CB  
3760 O  OG  . SER C 63  ? 0.5801 0.3722 0.9312 -0.0254 -0.1101 0.1372  63   SER L OG  
3761 N  N   . GLY C 64  ? 0.3674 0.2237 0.7426 -0.0219 -0.1070 0.1456  64   GLY L N   
3762 C  CA  . GLY C 64  ? 0.3499 0.2119 0.7422 -0.0286 -0.1044 0.1471  64   GLY L CA  
3763 C  C   . GLY C 64  ? 0.3842 0.2429 0.7872 -0.0417 -0.0931 0.1518  64   GLY L C   
3764 O  O   . GLY C 64  ? 0.3874 0.2468 0.7817 -0.0448 -0.0863 0.1561  64   GLY L O   
3765 N  N   . SER C 65  ? 0.3323 0.1886 0.7551 -0.0496 -0.0913 0.1498  65   SER L N   
3766 C  CA  . SER C 65  ? 0.3317 0.1857 0.7678 -0.0634 -0.0797 0.1530  65   SER L CA  
3767 C  C   . SER C 65  ? 0.4438 0.3054 0.9016 -0.0659 -0.0797 0.1517  65   SER L C   
3768 O  O   . SER C 65  ? 0.4337 0.3005 0.8946 -0.0565 -0.0901 0.1480  65   SER L O   
3769 C  CB  . SER C 65  ? 0.3630 0.1966 0.8003 -0.0743 -0.0756 0.1489  65   SER L CB  
3770 O  OG  . SER C 65  ? 0.4157 0.2397 0.8654 -0.0765 -0.0808 0.1388  65   SER L OG  
3771 N  N   . GLY C 66  ? 0.4449 0.3071 0.9167 -0.0778 -0.0684 0.1546  66   GLY L N   
3772 C  CA  . GLY C 66  ? 0.4502 0.3189 0.9444 -0.0801 -0.0674 0.1533  66   GLY L CA  
3773 C  C   . GLY C 66  ? 0.5241 0.4026 1.0142 -0.0794 -0.0595 0.1626  66   GLY L C   
3774 O  O   . GLY C 66  ? 0.5487 0.4325 1.0179 -0.0756 -0.0560 0.1689  66   GLY L O   
3775 N  N   . SER C 67  ? 0.4822 0.3633 0.9929 -0.0834 -0.0559 0.1621  67   SER L N   
3776 C  CA  . SER C 67  ? 0.4814 0.3681 0.9900 -0.0839 -0.0468 0.1703  67   SER L CA  
3777 C  C   . SER C 67  ? 0.5337 0.4210 1.0670 -0.0822 -0.0502 0.1666  67   SER L C   
3778 O  O   . SER C 67  ? 0.5414 0.4272 1.0986 -0.0861 -0.0549 0.1567  67   SER L O   
3779 C  CB  . SER C 67  ? 0.5321 0.4191 1.0411 -0.0992 -0.0292 0.1750  67   SER L CB  
3780 O  OG  . SER C 67  ? 0.7155 0.6085 1.2134 -0.0986 -0.0195 0.1831  67   SER L OG  
3781 N  N   . GLY C 68  ? 0.4710 0.3598 0.9977 -0.0760 -0.0479 0.1734  68   GLY L N   
3782 C  CA  . GLY C 68  ? 0.4674 0.3556 1.0150 -0.0712 -0.0525 0.1708  68   GLY L CA  
3783 C  C   . GLY C 68  ? 0.4926 0.3814 1.0397 -0.0550 -0.0730 0.1651  68   GLY L C   
3784 O  O   . GLY C 68  ? 0.4923 0.3779 1.0138 -0.0427 -0.0800 0.1710  68   GLY L O   
3785 N  N   . THR C 69  ? 0.4327 0.3253 1.0071 -0.0559 -0.0819 0.1527  69   THR L N   
3786 C  CA  . THR C 69  ? 0.4376 0.3338 1.0163 -0.0413 -0.1020 0.1448  69   THR L CA  
3787 C  C   . THR C 69  ? 0.4491 0.3474 1.0273 -0.0424 -0.1100 0.1352  69   THR L C   
3788 O  O   . THR C 69  ? 0.4620 0.3638 1.0374 -0.0302 -0.1262 0.1296  69   THR L O   
3789 C  CB  . THR C 69  ? 0.5478 0.4501 1.1625 -0.0392 -0.1078 0.1348  69   THR L CB  
3790 O  OG1 . THR C 69  ? 0.5593 0.4650 1.2032 -0.0561 -0.0983 0.1235  69   THR L OG1 
3791 C  CG2 . THR C 69  ? 0.4916 0.3896 1.1066 -0.0345 -0.1026 0.1437  69   THR L CG2 
3792 N  N   . ASP C 70  ? 0.3517 0.2461 0.9325 -0.0569 -0.0990 0.1326  70   ASP L N   
3793 C  CA  . ASP C 70  ? 0.3331 0.2250 0.9120 -0.0587 -0.1048 0.1231  70   ASP L CA  
3794 C  C   . ASP C 70  ? 0.3553 0.2399 0.9041 -0.0597 -0.1003 0.1307  70   ASP L C   
3795 O  O   . ASP C 70  ? 0.3443 0.2238 0.8857 -0.0697 -0.0869 0.1374  70   ASP L O   
3796 C  CB  . ASP C 70  ? 0.3510 0.2409 0.9591 -0.0741 -0.0982 0.1093  70   ASP L CB  
3797 C  CG  . ASP C 70  ? 0.5018 0.4027 1.1454 -0.0727 -0.1043 0.0968  70   ASP L CG  
3798 O  OD1 . ASP C 70  ? 0.5153 0.4252 1.1605 -0.0566 -0.1197 0.0955  70   ASP L OD1 
3799 O  OD2 . ASP C 70  ? 0.5863 0.4866 1.2558 -0.0877 -0.0942 0.0871  70   ASP L OD2 
3800 N  N   . PHE C 71  ? 0.3101 0.1950 0.8422 -0.0490 -0.1119 0.1288  71   PHE L N   
3801 C  CA  . PHE C 71  ? 0.3173 0.1970 0.8215 -0.0469 -0.1100 0.1345  71   PHE L CA  
3802 C  C   . PHE C 71  ? 0.3711 0.2441 0.8722 -0.0463 -0.1166 0.1248  71   PHE L C   
3803 O  O   . PHE C 71  ? 0.3662 0.2426 0.8815 -0.0434 -0.1260 0.1143  71   PHE L O   
3804 C  CB  . PHE C 71  ? 0.3456 0.2308 0.8263 -0.0343 -0.1150 0.1430  71   PHE L CB  
3805 C  CG  . PHE C 71  ? 0.3669 0.2547 0.8452 -0.0364 -0.1052 0.1529  71   PHE L CG  
3806 C  CD1 . PHE C 71  ? 0.3932 0.2810 0.8579 -0.0428 -0.0919 0.1606  71   PHE L CD1 
3807 C  CD2 . PHE C 71  ? 0.3952 0.2851 0.8856 -0.0321 -0.1091 0.1536  71   PHE L CD2 
3808 C  CE1 . PHE C 71  ? 0.3870 0.2771 0.8493 -0.0463 -0.0810 0.1686  71   PHE L CE1 
3809 C  CE2 . PHE C 71  ? 0.4037 0.2928 0.8915 -0.0350 -0.0982 0.1624  71   PHE L CE2 
3810 C  CZ  . PHE C 71  ? 0.3682 0.2574 0.8412 -0.0427 -0.0836 0.1698  71   PHE L CZ  
3811 N  N   . THR C 72  ? 0.3149 0.1786 0.7971 -0.0485 -0.1118 0.1277  72   THR L N   
3812 C  CA  . THR C 72  ? 0.3187 0.1717 0.7937 -0.0479 -0.1163 0.1195  72   THR L CA  
3813 C  C   . THR C 72  ? 0.3611 0.2119 0.8089 -0.0384 -0.1194 0.1244  72   THR L C   
3814 O  O   . THR C 72  ? 0.3803 0.2301 0.8148 -0.0391 -0.1126 0.1324  72   THR L O   
3815 C  CB  . THR C 72  ? 0.4955 0.3316 0.9780 -0.0630 -0.1063 0.1140  72   THR L CB  
3816 O  OG1 . THR C 72  ? 0.6342 0.4747 1.1453 -0.0718 -0.1042 0.1054  72   THR L OG1 
3817 C  CG2 . THR C 72  ? 0.4770 0.2961 0.9476 -0.0634 -0.1088 0.1057  72   THR L CG2 
3818 N  N   . LEU C 73  ? 0.2883 0.1393 0.7293 -0.0298 -0.1295 0.1181  73   LEU L N   
3819 C  CA  . LEU C 73  ? 0.2848 0.1339 0.7031 -0.0214 -0.1326 0.1192  73   LEU L CA  
3820 C  C   . LEU C 73  ? 0.3805 0.2086 0.7953 -0.0254 -0.1318 0.1115  73   LEU L C   
3821 O  O   . LEU C 73  ? 0.3761 0.2005 0.8021 -0.0283 -0.1355 0.1011  73   LEU L O   
3822 C  CB  . LEU C 73  ? 0.2782 0.1372 0.6879 -0.0097 -0.1432 0.1178  73   LEU L CB  
3823 C  CG  . LEU C 73  ? 0.3155 0.1719 0.7040 -0.0012 -0.1461 0.1169  73   LEU L CG  
3824 C  CD1 . LEU C 73  ? 0.2955 0.1580 0.6707 0.0014  -0.1399 0.1249  73   LEU L CD1 
3825 C  CD2 . LEU C 73  ? 0.3383 0.2030 0.7207 0.0072  -0.1563 0.1121  73   LEU L CD2 
3826 N  N   . THR C 74  ? 0.3435 0.1582 0.7419 -0.0255 -0.1267 0.1156  74   THR L N   
3827 C  CA  . THR C 74  ? 0.3445 0.1345 0.7328 -0.0287 -0.1249 0.1096  74   THR L CA  
3828 C  C   . THR C 74  ? 0.3702 0.1562 0.7373 -0.0157 -0.1307 0.1099  74   THR L C   
3829 O  O   . THR C 74  ? 0.3468 0.1420 0.7032 -0.0082 -0.1311 0.1168  74   THR L O   
3830 C  CB  . THR C 74  ? 0.5020 0.2734 0.8862 -0.0400 -0.1146 0.1136  74   THR L CB  
3831 O  OG1 . THR C 74  ? 0.5018 0.2794 0.9081 -0.0527 -0.1082 0.1127  74   THR L OG1 
3832 C  CG2 . THR C 74  ? 0.5132 0.2522 0.8819 -0.0445 -0.1116 0.1076  74   THR L CG2 
3833 N  N   . ILE C 75  ? 0.3402 0.1180 0.7025 -0.0138 -0.1344 0.1001  75   ILE L N   
3834 C  CA  . ILE C 75  ? 0.3551 0.1206 0.6979 -0.0016 -0.1393 0.0995  75   ILE L CA  
3835 C  C   . ILE C 75  ? 0.3781 0.1092 0.7065 -0.0065 -0.1341 0.0965  75   ILE L C   
3836 O  O   . ILE C 75  ? 0.3981 0.1147 0.7315 -0.0155 -0.1310 0.0877  75   ILE L O   
3837 C  CB  . ILE C 75  ? 0.4100 0.1873 0.7547 0.0058  -0.1475 0.0918  75   ILE L CB  
3838 C  CG1 . ILE C 75  ? 0.3978 0.2035 0.7552 0.0075  -0.1522 0.0941  75   ILE L CG1 
3839 C  CG2 . ILE C 75  ? 0.4391 0.2116 0.7651 0.0187  -0.1515 0.0910  75   ILE L CG2 
3840 C  CD1 . ILE C 75  ? 0.4757 0.2914 0.8365 0.0115  -0.1606 0.0855  75   ILE L CD1 
3841 N  N   . SER C 76  ? 0.3002 0.0882 0.6121 -0.0066 -0.1318 0.0898  76   SER L N   
3842 C  CA  . SER C 76  ? 0.3257 0.0821 0.6181 -0.0092 -0.1272 0.0884  76   SER L CA  
3843 C  C   . SER C 76  ? 0.4460 0.0997 0.7213 -0.0007 -0.1297 0.0927  76   SER L C   
3844 O  O   . SER C 76  ? 0.4883 0.1220 0.7647 -0.0130 -0.1233 0.0849  76   SER L O   
3845 C  CB  . SER C 76  ? 0.3723 0.0887 0.6462 -0.0025 -0.1273 0.1023  76   SER L CB  
3846 O  OG  . SER C 76  ? 0.3917 0.0908 0.6660 0.0150  -0.1349 0.1150  76   SER L OG  
3847 N  N   . SER C 77  ? 0.4083 0.0822 0.6690 0.0129  -0.1361 0.0889  77   SER L N   
3848 C  CA  . SER C 77  ? 0.4310 0.0765 0.6778 0.0186  -0.1373 0.0817  77   SER L CA  
3849 C  C   . SER C 77  ? 0.4960 0.1575 0.7586 0.0271  -0.1443 0.0791  77   SER L C   
3850 O  O   . SER C 77  ? 0.4885 0.1667 0.7481 0.0410  -0.1509 0.0812  77   SER L O   
3851 C  CB  . SER C 77  ? 0.4961 0.1023 0.7161 0.0356  -0.1416 0.0885  77   SER L CB  
3852 O  OG  . SER C 77  ? 0.6524 0.2164 0.8499 0.0352  -0.1379 0.0828  77   SER L OG  
3853 N  N   . LEU C 78  ? 0.4702 0.1433 0.7507 0.0167  -0.1427 0.0716  78   LEU L N   
3854 C  CA  . LEU C 78  ? 0.4550 0.1568 0.7490 0.0209  -0.1493 0.0661  78   LEU L CA  
3855 C  C   . LEU C 78  ? 0.5106 0.2043 0.7903 0.0326  -0.1530 0.0606  78   LEU L C   
3856 O  O   . LEU C 78  ? 0.5347 0.1988 0.8012 0.0312  -0.1489 0.0542  78   LEU L O   
3857 C  CB  . LEU C 78  ? 0.4518 0.1595 0.7639 0.0079  -0.1473 0.0565  78   LEU L CB  
3858 C  CG  . LEU C 78  ? 0.4868 0.2250 0.8131 0.0109  -0.1552 0.0514  78   LEU L CG  
3859 C  CD1 . LEU C 78  ? 0.4843 0.2497 0.8234 0.0119  -0.1593 0.0598  78   LEU L CD1 
3860 C  CD2 . LEU C 78  ? 0.4846 0.2233 0.8245 0.0004  -0.1539 0.0389  78   LEU L CD2 
3861 N  N   . GLN C 79  ? 0.4375 0.1558 0.7189 0.0436  -0.1596 0.0624  79   GLN L N   
3862 C  CA  . GLN C 79  ? 0.4363 0.1511 0.7068 0.0551  -0.1632 0.0565  79   GLN L CA  
3863 C  C   . GLN C 79  ? 0.4710 0.2035 0.7511 0.0522  -0.1663 0.0474  79   GLN L C   
3864 O  O   . GLN C 79  ? 0.4289 0.1810 0.7236 0.0443  -0.1681 0.0474  79   GLN L O   
3865 C  CB  . GLN C 79  ? 0.4318 0.1609 0.6970 0.0688  -0.1674 0.0616  79   GLN L CB  
3866 C  CG  . GLN C 79  ? 0.3509 0.1174 0.6037 0.0512  -0.1610 0.0576  79   GLN L CG  
3867 C  CD  . GLN C 79  ? 0.3070 0.0851 0.5464 0.0574  -0.1625 0.0554  79   GLN L CD  
3868 O  OE1 . GLN C 79  ? 0.2824 0.0795 0.5192 0.0620  -0.1651 0.0478  79   GLN L OE1 
3869 N  NE2 . GLN C 79  ? 0.1065 0.0400 0.3088 -0.0081 -0.1349 0.0163  79   GLN L NE2 
3870 N  N   . PRO C 80  ? 0.4379 0.1632 0.7097 0.0586  -0.1674 0.0392  80   PRO L N   
3871 C  CA  . PRO C 80  ? 0.4382 0.1803 0.7178 0.0547  -0.1703 0.0301  80   PRO L CA  
3872 C  C   . PRO C 80  ? 0.5028 0.2787 0.7912 0.0556  -0.1765 0.0331  80   PRO L C   
3873 O  O   . PRO C 80  ? 0.4916 0.2819 0.7887 0.0489  -0.1797 0.0293  80   PRO L O   
3874 C  CB  . PRO C 80  ? 0.4741 0.2024 0.7415 0.0632  -0.1695 0.0223  80   PRO L CB  
3875 C  CG  . PRO C 80  ? 0.5445 0.2390 0.7971 0.0682  -0.1650 0.0256  80   PRO L CG  
3876 C  CD  . PRO C 80  ? 0.4686 0.1698 0.7233 0.0699  -0.1664 0.0373  80   PRO L CD  
3877 N  N   . GLU C 81  ? 0.4678 0.2554 0.7524 0.0638  -0.1779 0.0393  81   GLU L N   
3878 C  CA  . GLU C 81  ? 0.4456 0.2607 0.7334 0.0642  -0.1815 0.0419  81   GLU L CA  
3879 C  C   . GLU C 81  ? 0.5035 0.3288 0.8005 0.0567  -0.1818 0.0504  81   GLU L C   
3880 O  O   . GLU C 81  ? 0.5280 0.3720 0.8248 0.0562  -0.1840 0.0535  81   GLU L O   
3881 C  CB  . GLU C 81  ? 0.4581 0.2824 0.7390 0.0744  -0.1811 0.0423  81   GLU L CB  
3882 C  CG  . GLU C 81  ? 0.5492 0.3705 0.8300 0.0777  -0.1785 0.0511  81   GLU L CG  
3883 C  CD  . GLU C 81  ? 0.6902 0.4911 0.9632 0.0873  -0.1777 0.0505  81   GLU L CD  
3884 O  OE1 . GLU C 81  ? 0.5120 0.2869 0.7799 0.0863  -0.1766 0.0480  81   GLU L OE1 
3885 O  OE2 . GLU C 81  ? 0.5180 0.3274 0.7888 0.0954  -0.1780 0.0527  81   GLU L OE2 
3886 N  N   . ASP C 82  ? 0.4313 0.2429 0.7353 0.0504  -0.1787 0.0537  82   ASP L N   
3887 C  CA  . ASP C 82  ? 0.3976 0.2181 0.7128 0.0433  -0.1783 0.0608  82   ASP L CA  
3888 C  C   . ASP C 82  ? 0.4461 0.2736 0.7726 0.0364  -0.1827 0.0553  82   ASP L C   
3889 O  O   . ASP C 82  ? 0.4187 0.2552 0.7561 0.0317  -0.1839 0.0598  82   ASP L O   
3890 C  CB  . ASP C 82  ? 0.4126 0.2159 0.7299 0.0392  -0.1720 0.0664  82   ASP L CB  
3891 C  CG  . ASP C 82  ? 0.5555 0.3542 0.8620 0.0468  -0.1693 0.0724  82   ASP L CG  
3892 O  OD1 . ASP C 82  ? 0.5760 0.3912 0.8775 0.0543  -0.1715 0.0731  82   ASP L OD1 
3893 O  OD2 . ASP C 82  ? 0.6297 0.4084 0.9321 0.0448  -0.1648 0.0757  82   ASP L OD2 
3894 N  N   . PHE C 83  ? 0.4418 0.2657 0.7668 0.0359  -0.1852 0.0448  83   PHE L N   
3895 C  CA  . PHE C 83  ? 0.4473 0.2810 0.7835 0.0302  -0.1908 0.0372  83   PHE L CA  
3896 C  C   . PHE C 83  ? 0.5195 0.3740 0.8509 0.0344  -0.1990 0.0406  83   PHE L C   
3897 O  O   . PHE C 83  ? 0.5440 0.4029 0.8621 0.0392  -0.2008 0.0388  83   PHE L O   
3898 C  CB  . PHE C 83  ? 0.4863 0.3094 0.8217 0.0270  -0.1894 0.0240  83   PHE L CB  
3899 C  CG  . PHE C 83  ? 0.5204 0.3182 0.8568 0.0210  -0.1801 0.0202  83   PHE L CG  
3900 C  CD1 . PHE C 83  ? 0.5719 0.3475 0.8930 0.0261  -0.1739 0.0235  83   PHE L CD1 
3901 C  CD2 . PHE C 83  ? 0.5381 0.3327 0.8885 0.0104  -0.1775 0.0108  83   PHE L CD2 
3902 C  CE1 . PHE C 83  ? 0.5905 0.3369 0.9064 0.0203  -0.1651 0.0200  83   PHE L CE1 
3903 C  CE2 . PHE C 83  ? 0.5736 0.3409 0.9208 0.0028  -0.1670 0.0055  83   PHE L CE2 
3904 C  CZ  . PHE C 83  ? 0.5686 0.3098 0.8963 0.0077  -0.1608 0.0109  83   PHE L CZ  
3905 N  N   . ALA C 84  ? 0.4374 0.3022 0.7778 0.0324  -0.2027 0.0465  84   ALA L N   
3906 C  CA  . ALA C 84  ? 0.4157 0.2941 0.7483 0.0360  -0.2090 0.0526  84   ALA L CA  
3907 C  C   . ALA C 84  ? 0.4284 0.3132 0.7756 0.0335  -0.2129 0.0564  84   ALA L C   
3908 O  O   . ALA C 84  ? 0.3989 0.2802 0.7644 0.0282  -0.2108 0.0519  84   ALA L O   
3909 C  CB  . ALA C 84  ? 0.4177 0.2959 0.7374 0.0396  -0.2026 0.0621  84   ALA L CB  
3910 N  N   . THR C 85  ? 0.3847 0.2773 0.7228 0.0372  -0.2180 0.0639  85   THR L N   
3911 C  CA  . THR C 85  ? 0.3772 0.2750 0.7263 0.0372  -0.2222 0.0691  85   THR L CA  
3912 C  C   . THR C 85  ? 0.4079 0.3023 0.7530 0.0364  -0.2126 0.0811  85   THR L C   
3913 O  O   . THR C 85  ? 0.4101 0.3031 0.7369 0.0383  -0.2075 0.0858  85   THR L O   
3914 C  CB  . THR C 85  ? 0.5094 0.4144 0.8487 0.0424  -0.2355 0.0682  85   THR L CB  
3915 O  OG1 . THR C 85  ? 0.6003 0.5106 0.9466 0.0420  -0.2438 0.0552  85   THR L OG1 
3916 C  CG2 . THR C 85  ? 0.4276 0.3363 0.7780 0.0446  -0.2410 0.0734  85   THR L CG2 
3917 N  N   . TYR C 86  ? 0.3513 0.2452 0.7148 0.0325  -0.2092 0.0844  86   TYR L N   
3918 C  CA  . TYR C 86  ? 0.3407 0.2323 0.7033 0.0302  -0.1993 0.0952  86   TYR L CA  
3919 C  C   . TYR C 86  ? 0.4450 0.3406 0.8124 0.0318  -0.2033 0.1012  86   TYR L C   
3920 O  O   . TYR C 86  ? 0.4430 0.3429 0.8275 0.0325  -0.2116 0.0955  86   TYR L O   
3921 C  CB  . TYR C 86  ? 0.3310 0.2155 0.7095 0.0230  -0.1899 0.0941  86   TYR L CB  
3922 C  CG  . TYR C 86  ? 0.3436 0.2199 0.7121 0.0234  -0.1855 0.0904  86   TYR L CG  
3923 C  CD1 . TYR C 86  ? 0.3709 0.2418 0.7425 0.0228  -0.1891 0.0796  86   TYR L CD1 
3924 C  CD2 . TYR C 86  ? 0.3502 0.2249 0.7048 0.0255  -0.1783 0.0967  86   TYR L CD2 
3925 C  CE1 . TYR C 86  ? 0.3747 0.2357 0.7347 0.0249  -0.1856 0.0763  86   TYR L CE1 
3926 C  CE2 . TYR C 86  ? 0.3622 0.2297 0.7072 0.0286  -0.1762 0.0927  86   TYR L CE2 
3927 C  CZ  . TYR C 86  ? 0.4179 0.2771 0.7650 0.0287  -0.1799 0.0831  86   TYR L CZ  
3928 O  OH  . TYR C 86  ? 0.4402 0.2900 0.7766 0.0329  -0.1778 0.0794  86   TYR L OH  
3929 N  N   . TYR C 87  ? 0.4322 0.3264 0.7843 0.0329  -0.1973 0.1115  87   TYR L N   
3930 C  CA  . TYR C 87  ? 0.4451 0.3388 0.7969 0.0351  -0.1996 0.1186  87   TYR L CA  
3931 C  C   . TYR C 87  ? 0.4929 0.3847 0.8483 0.0294  -0.1857 0.1275  87   TYR L C   
3932 O  O   . TYR C 87  ? 0.4784 0.3699 0.8215 0.0265  -0.1754 0.1308  87   TYR L O   
3933 C  CB  . TYR C 87  ? 0.4894 0.3789 0.8103 0.0413  -0.2048 0.1228  87   TYR L CB  
3934 C  CG  . TYR C 87  ? 0.5364 0.4273 0.8492 0.0472  -0.2195 0.1152  87   TYR L CG  
3935 C  CD1 . TYR C 87  ? 0.5773 0.4690 0.8952 0.0535  -0.2337 0.1135  87   TYR L CD1 
3936 C  CD2 . TYR C 87  ? 0.5517 0.4433 0.8506 0.0468  -0.2197 0.1092  87   TYR L CD2 
3937 C  CE1 . TYR C 87  ? 0.6005 0.4946 0.9097 0.0588  -0.2479 0.1061  87   TYR L CE1 
3938 C  CE2 . TYR C 87  ? 0.5746 0.4677 0.8653 0.0509  -0.2325 0.1019  87   TYR L CE2 
3939 C  CZ  . TYR C 87  ? 0.6665 0.5611 0.9615 0.0567  -0.2467 0.1005  87   TYR L CZ  
3940 O  OH  . TYR C 87  ? 0.7330 0.6304 1.0191 0.0607  -0.2599 0.0929  87   TYR L OH  
3941 N  N   . CYS C 88  ? 0.4561 0.3479 0.8279 0.0281  -0.1854 0.1308  88   CYS L N   
3942 C  CA  . CYS C 88  ? 0.4426 0.3323 0.8155 0.0225  -0.1719 0.1398  88   CYS L CA  
3943 C  C   . CYS C 88  ? 0.4585 0.3420 0.8092 0.0282  -0.1735 0.1476  88   CYS L C   
3944 O  O   . CYS C 88  ? 0.4515 0.3319 0.7922 0.0366  -0.1869 0.1456  88   CYS L O   
3945 C  CB  . CYS C 88  ? 0.4463 0.3380 0.8505 0.0159  -0.1680 0.1381  88   CYS L CB  
3946 S  SG  . CYS C 88  ? 0.5144 0.4095 0.9411 0.0220  -0.1823 0.1325  88   CYS L SG  
3947 N  N   . GLN C 89  ? 0.3872 0.2671 0.7266 0.0236  -0.1595 0.1560  89   GLN L N   
3948 C  CA  . GLN C 89  ? 0.3858 0.2551 0.6996 0.0270  -0.1572 0.1637  89   GLN L CA  
3949 C  C   . GLN C 89  ? 0.4012 0.2681 0.7196 0.0198  -0.1412 0.1715  89   GLN L C   
3950 O  O   . GLN C 89  ? 0.3834 0.2566 0.7031 0.0113  -0.1272 0.1723  89   GLN L O   
3951 C  CB  . GLN C 89  ? 0.4103 0.2756 0.6889 0.0277  -0.1538 0.1634  89   GLN L CB  
3952 C  CG  . GLN C 89  ? 0.4594 0.3090 0.7046 0.0288  -0.1481 0.1706  89   GLN L CG  
3953 C  CD  . GLN C 89  ? 0.5215 0.3723 0.7485 0.0197  -0.1284 0.1722  89   GLN L CD  
3954 O  OE1 . GLN C 89  ? 0.3622 0.2251 0.5902 0.0157  -0.1231 0.1661  89   GLN L OE1 
3955 N  NE2 . GLN C 89  ? 0.3505 0.1967 0.5613 0.0141  -0.1159 0.1755  89   GLN L NE2 
3956 N  N   . GLN C 90  ? 0.3493 0.2069 0.6685 0.0235  -0.1431 0.1769  90   GLN L N   
3957 C  CA  . GLN C 90  ? 0.3304 0.1843 0.6512 0.0160  -0.1263 0.1842  90   GLN L CA  
3958 C  C   . GLN C 90  ? 0.4004 0.2429 0.6814 0.0143  -0.1149 0.1896  90   GLN L C   
3959 O  O   . GLN C 90  ? 0.4268 0.2567 0.6787 0.0217  -0.1231 0.1903  90   GLN L O   
3960 C  CB  . GLN C 90  ? 0.3398 0.1870 0.6786 0.0206  -0.1311 0.1874  90   GLN L CB  
3961 C  CG  . GLN C 90  ? 0.1275 0.0917 0.4552 -0.0185 -0.1046 0.1386  90   GLN L CG  
3962 C  CD  . GLN C 90  ? 0.3902 0.2007 0.6741 0.0345  -0.1341 0.2004  90   GLN L CD  
3963 O  OE1 . GLN C 90  ? 0.4867 0.2956 0.7834 0.0455  -0.1515 0.1981  90   GLN L OE1 
3964 N  NE2 . GLN C 90  ? 0.3512 0.1567 0.5943 0.0313  -0.1274 0.1994  90   GLN L NE2 
3965 N  N   . TYR C 91  ? 0.3221 0.1685 0.6007 0.0036  -0.0955 0.1925  91   TYR L N   
3966 C  CA  . TYR C 91  ? 0.3290 0.1669 0.5718 -0.0002 -0.0821 0.1948  91   TYR L CA  
3967 C  C   . TYR C 91  ? 0.3523 0.1772 0.5924 -0.0058 -0.0665 0.2037  91   TYR L C   
3968 O  O   . TYR C 91  ? 0.3711 0.1860 0.5812 -0.0113 -0.0513 0.2060  91   TYR L O   
3969 C  CB  . TYR C 91  ? 0.3575 0.2057 0.5876 -0.0067 -0.0724 0.1897  91   TYR L CB  
3970 C  CG  . TYR C 91  ? 0.3783 0.2457 0.6297 -0.0166 -0.0595 0.1873  91   TYR L CG  
3971 C  CD1 . TYR C 91  ? 0.4157 0.2864 0.6562 -0.0270 -0.0388 0.1885  91   TYR L CD1 
3972 C  CD2 . TYR C 91  ? 0.3679 0.2498 0.6450 -0.0158 -0.0675 0.1825  91   TYR L CD2 
3973 C  CE1 . TYR C 91  ? 0.4250 0.3150 0.6823 -0.0355 -0.0282 0.1854  91   TYR L CE1 
3974 C  CE2 . TYR C 91  ? 0.3608 0.2579 0.6515 -0.0238 -0.0571 0.1803  91   TYR L CE2 
3975 C  CZ  . TYR C 91  ? 0.4932 0.3954 0.7753 -0.0332 -0.0382 0.1820  91   TYR L CZ  
3976 O  OH  . TYR C 91  ? 0.5261 0.4442 0.8215 -0.0406 -0.0292 0.1797  91   TYR L OH  
3977 N  N   . LEU C 92  ? 0.2815 0.1448 0.5571 -0.0081 -0.0684 0.1913  92   LEU L N   
3978 C  CA  . LEU C 92  ? 0.2777 0.1409 0.5567 -0.0124 -0.0536 0.1948  92   LEU L CA  
3979 C  C   . LEU C 92  ? 0.3727 0.1599 0.6088 -0.0037 -0.0527 0.2210  92   LEU L C   
3980 O  O   . LEU C 92  ? 0.4002 0.1769 0.6166 -0.0121 -0.0328 0.2254  92   LEU L O   
3981 C  CB  . LEU C 92  ? 0.2498 0.1283 0.5717 -0.0135 -0.0574 0.1927  92   LEU L CB  
3982 C  CG  . LEU C 92  ? 0.2740 0.1211 0.5972 -0.0151 -0.0449 0.2070  92   LEU L CG  
3983 C  CD1 . LEU C 92  ? 0.2402 0.1255 0.5739 -0.0261 -0.0233 0.1977  92   LEU L CD1 
3984 C  CD2 . LEU C 92  ? 0.2641 0.1156 0.6213 -0.0102 -0.0565 0.2046  92   LEU L CD2 
3985 N  N   . GLN C 93  ? 0.3153 0.1525 0.5544 0.0028  -0.0699 0.1947  93   GLN L N   
3986 C  CA  . GLN C 93  ? 0.3228 0.1505 0.5307 0.0076  -0.0704 0.1914  93   GLN L CA  
3987 C  C   . GLN C 93  ? 0.4082 0.1702 0.5739 0.0246  -0.0898 0.2123  93   GLN L C   
3988 O  O   . GLN C 93  ? 0.3781 0.1646 0.5591 0.0251  -0.1035 0.2011  93   GLN L O   
3989 C  CB  . GLN C 93  ? 0.3285 0.1506 0.5608 0.0149  -0.0815 0.1946  93   GLN L CB  
3990 C  CG  . GLN C 93  ? 0.2201 0.1118 0.4911 0.0003  -0.0638 0.1728  93   GLN L CG  
3991 C  CD  . GLN C 93  ? 0.4546 0.1896 0.7250 0.0361  -0.0874 0.2355  93   GLN L CD  
3992 O  OE1 . GLN C 93  ? 0.4483 0.1820 0.7223 0.0517  -0.1116 0.2322  93   GLN L OE1 
3993 N  NE2 . GLN C 93  ? 0.3770 0.1653 0.6725 0.0210  -0.0696 0.2168  93   GLN L NE2 
3994 N  N   . TYR C 94  ? 0.4453 0.1735 0.5647 0.0297  -0.0873 0.2188  94   TYR L N   
3995 C  CA  . TYR C 94  ? 0.5014 0.1897 0.5786 0.0433  -0.1048 0.2284  94   TYR L CA  
3996 C  C   . TYR C 94  ? 0.5816 0.2527 0.6703 0.0650  -0.1333 0.2358  94   TYR L C   
3997 O  O   . TYR C 94  ? 0.5642 0.2294 0.6713 0.0713  -0.1349 0.2403  94   TYR L O   
3998 C  CB  . TYR C 94  ? 0.5850 0.2241 0.5996 0.0423  -0.0914 0.2404  94   TYR L CB  
3999 C  CG  . TYR C 94  ? 0.6124 0.2592 0.6083 0.0240  -0.0673 0.2347  94   TYR L CG  
4000 C  CD1 . TYR C 94  ? 0.6189 0.2860 0.6168 0.0198  -0.0715 0.2251  94   TYR L CD1 
4001 C  CD2 . TYR C 94  ? 0.6250 0.2592 0.6014 0.0111  -0.0402 0.2375  94   TYR L CD2 
4002 C  CE1 . TYR C 94  ? 0.5960 0.2738 0.5809 0.0041  -0.0504 0.2177  94   TYR L CE1 
4003 C  CE2 . TYR C 94  ? 0.6263 0.2715 0.5882 -0.0057 -0.0182 0.2295  94   TYR L CE2 
4004 C  CZ  . TYR C 94  ? 0.6506 0.3184 0.6177 -0.0085 -0.0241 0.2193  94   TYR L CZ  
4005 O  OH  . TYR C 94  ? 0.5903 0.2718 0.5461 -0.0236 -0.0041 0.2092  94   TYR L OH  
4006 N  N   . PRO C 95  ? 0.5826 0.2568 0.6651 0.0746  -0.1551 0.2309  95   PRO L N   
4007 C  CA  . PRO C 95  ? 0.5847 0.2675 0.6498 0.0685  -0.1558 0.2242  95   PRO L CA  
4008 C  C   . PRO C 95  ? 0.5907 0.3121 0.7035 0.0603  -0.1538 0.2150  95   PRO L C   
4009 O  O   . PRO C 95  ? 0.5527 0.2923 0.7101 0.0631  -0.1602 0.2128  95   PRO L O   
4010 C  CB  . PRO C 95  ? 0.6416 0.3114 0.6877 0.0846  -0.1826 0.2235  95   PRO L CB  
4011 C  CG  . PRO C 95  ? 0.6905 0.3690 0.7757 0.0986  -0.2004 0.2236  95   PRO L CG  
4012 C  CD  . PRO C 95  ? 0.6204 0.2939 0.7197 0.0934  -0.1824 0.2301  95   PRO L CD  
4013 N  N   . MET C 96  ? 0.5566 0.2894 0.6601 0.0500  -0.1444 0.2091  96   MET L N   
4014 C  CA  . MET C 96  ? 0.5177 0.2830 0.6623 0.0442  -0.1443 0.2007  96   MET L CA  
4015 C  C   . MET C 96  ? 0.6331 0.4085 0.8000 0.0556  -0.1691 0.1951  96   MET L C   
4016 O  O   . MET C 96  ? 0.6783 0.4411 0.8183 0.0637  -0.1832 0.1942  96   MET L O   
4017 C  CB  . MET C 96  ? 0.5279 0.3023 0.6561 0.0342  -0.1330 0.1942  96   MET L CB  
4018 C  CG  . MET C 96  ? 0.5628 0.3348 0.6748 0.0214  -0.1078 0.1958  96   MET L CG  
4019 S  SD  . MET C 96  ? 0.5849 0.3707 0.7335 0.0138  -0.0929 0.2000  96   MET L SD  
4020 C  CE  . MET C 96  ? 0.5755 0.3307 0.6938 0.0143  -0.0827 0.2101  96   MET L CE  
4021 N  N   . THR C 97  ? 0.5822 0.3780 0.7960 0.0559  -0.1742 0.1908  97   THR L N   
4022 C  CA  . THR C 97  ? 0.5886 0.3959 0.8266 0.0654  -0.1961 0.1831  97   THR L CA  
4023 C  C   . THR C 97  ? 0.6140 0.4452 0.8835 0.0582  -0.1951 0.1733  97   THR L C   
4024 O  O   . THR C 97  ? 0.6028 0.4434 0.8902 0.0478  -0.1800 0.1735  97   THR L O   
4025 C  CB  . THR C 97  ? 0.7235 0.5294 0.9856 0.0748  -0.2070 0.1842  97   THR L CB  
4026 O  OG1 . THR C 97  ? 0.7789 0.5924 1.0696 0.0658  -0.1916 0.1862  97   THR L OG1 
4027 C  CG2 . THR C 97  ? 0.7018 0.4803 0.9282 0.0866  -0.2144 0.1929  97   THR L CG2 
4028 N  N   . PHE C 98  ? 0.5473 0.3864 0.8216 0.0637  -0.2112 0.1647  98   PHE L N   
4029 C  CA  . PHE C 98  ? 0.5063 0.3631 0.8046 0.0581  -0.2115 0.1549  98   PHE L CA  
4030 C  C   . PHE C 98  ? 0.5244 0.3946 0.8606 0.0619  -0.2249 0.1452  98   PHE L C   
4031 O  O   . PHE C 98  ? 0.5103 0.3783 0.8483 0.0724  -0.2403 0.1438  98   PHE L O   
4032 C  CB  . PHE C 98  ? 0.5339 0.3894 0.8065 0.0597  -0.2173 0.1503  98   PHE L CB  
4033 C  CG  . PHE C 98  ? 0.5478 0.3937 0.7851 0.0544  -0.2041 0.1551  98   PHE L CG  
4034 C  CD1 . PHE C 98  ? 0.6067 0.4329 0.8051 0.0579  -0.2043 0.1618  98   PHE L CD1 
4035 C  CD2 . PHE C 98  ? 0.5450 0.4004 0.7860 0.0463  -0.1921 0.1513  98   PHE L CD2 
4036 C  CE1 . PHE C 98  ? 0.6239 0.4418 0.7896 0.0510  -0.1903 0.1633  98   PHE L CE1 
4037 C  CE2 . PHE C 98  ? 0.5780 0.4281 0.7895 0.0413  -0.1797 0.1528  98   PHE L CE2 
4038 C  CZ  . PHE C 98  ? 0.5797 0.4118 0.7544 0.0427  -0.1780 0.1580  98   PHE L CZ  
4039 N  N   . GLY C 99  ? 0.4497 0.3325 0.8130 0.0536  -0.2195 0.1373  99   GLY L N   
4040 C  CA  . GLY C 99  ? 0.4300 0.3259 0.8280 0.0538  -0.2290 0.1248  99   GLY L CA  
4041 C  C   . GLY C 99  ? 0.4877 0.3877 0.8756 0.0607  -0.2447 0.1164  99   GLY L C   
4042 O  O   . GLY C 99  ? 0.4761 0.3687 0.8326 0.0622  -0.2444 0.1204  99   GLY L O   
4043 N  N   . GLN C 100 ? 0.4479 0.3607 0.8626 0.0637  -0.2576 0.1031  100  GLN L N   
4044 C  CA  . GLN C 100 ? 0.4541 0.3718 0.8573 0.0702  -0.2728 0.0949  100  GLN L CA  
4045 C  C   . GLN C 100 ? 0.4857 0.4067 0.8871 0.0625  -0.2673 0.0873  100  GLN L C   
4046 O  O   . GLN C 100 ? 0.4877 0.4124 0.8780 0.0663  -0.2778 0.0804  100  GLN L O   
4047 C  CB  . GLN C 100 ? 0.4794 0.4106 0.9060 0.0788  -0.2911 0.0831  100  GLN L CB  
4048 C  CG  . GLN C 100 ? 0.8243 0.7468 1.2230 0.0938  -0.3078 0.0903  100  GLN L CG  
4049 C  CD  . GLN C 100 ? 1.1767 1.0829 1.5278 0.0955  -0.3076 0.0997  100  GLN L CD  
4050 O  OE1 . GLN C 100 ? 1.1299 1.0403 1.4712 0.0924  -0.3099 0.0930  100  GLN L OE1 
4051 N  NE2 . GLN C 100 ? 1.0692 0.9555 1.3891 0.0993  -0.3034 0.1145  100  GLN L NE2 
4052 N  N   . GLY C 101 ? 0.4320 0.3493 0.8392 0.0525  -0.2507 0.0898  101  GLY L N   
4053 C  CA  . GLY C 101 ? 0.4316 0.3478 0.8330 0.0465  -0.2444 0.0844  101  GLY L CA  
4054 C  C   . GLY C 101 ? 0.4964 0.4187 0.9260 0.0392  -0.2424 0.0704  101  GLY L C   
4055 O  O   . GLY C 101 ? 0.5037 0.4368 0.9568 0.0402  -0.2512 0.0598  101  GLY L O   
4056 N  N   . THR C 102 ? 0.4459 0.3605 0.8722 0.0317  -0.2303 0.0695  102  THR L N   
4057 C  CA  . THR C 102 ? 0.4317 0.3449 0.8762 0.0231  -0.2251 0.0567  102  THR L CA  
4058 C  C   . THR C 102 ? 0.4764 0.3845 0.9026 0.0239  -0.2250 0.0523  102  THR L C   
4059 O  O   . THR C 102 ? 0.4729 0.3722 0.8795 0.0249  -0.2181 0.0606  102  THR L O   
4060 C  CB  . THR C 102 ? 0.4009 0.3037 0.8554 0.0134  -0.2100 0.0606  102  THR L CB  
4061 O  OG1 . THR C 102 ? 0.3242 0.2330 0.7979 0.0120  -0.2100 0.0630  102  THR L OG1 
4062 C  CG2 . THR C 102 ? 0.3362 0.2309 0.8027 0.0033  -0.2028 0.0476  102  THR L CG2 
4063 N  N   . LYS C 103 ? 0.4156 0.3307 0.8490 0.0235  -0.2326 0.0382  103  LYS L N   
4064 C  CA  . LYS C 103 ? 0.4101 0.3200 0.8275 0.0236  -0.2317 0.0329  103  LYS L CA  
4065 C  C   . LYS C 103 ? 0.4434 0.3399 0.8689 0.0142  -0.2193 0.0256  103  LYS L C   
4066 O  O   . LYS C 103 ? 0.4291 0.3275 0.8763 0.0066  -0.2170 0.0144  103  LYS L O   
4067 C  CB  . LYS C 103 ? 0.4555 0.3789 0.8735 0.0272  -0.2452 0.0213  103  LYS L CB  
4068 C  CG  . LYS C 103 ? 0.4743 0.3930 0.8721 0.0280  -0.2447 0.0175  103  LYS L CG  
4069 C  CD  . LYS C 103 ? 0.4774 0.4101 0.8777 0.0295  -0.2571 0.0042  103  LYS L CD  
4070 C  CE  . LYS C 103 ? 0.5314 0.4615 0.9061 0.0324  -0.2594 0.0049  103  LYS L CE  
4071 N  NZ  . LYS C 103 ? 0.6895 0.6320 1.0668 0.0315  -0.2691 -0.0099 103  LYS L NZ  
4072 N  N   . VAL C 104 ? 0.4109 0.2926 0.8181 0.0146  -0.2109 0.0311  104  VAL L N   
4073 C  CA  . VAL C 104 ? 0.4051 0.2674 0.8124 0.0072  -0.1991 0.0258  104  VAL L CA  
4074 C  C   . VAL C 104 ? 0.4698 0.3273 0.8664 0.0079  -0.1999 0.0155  104  VAL L C   
4075 O  O   . VAL C 104 ? 0.4667 0.3236 0.8453 0.0150  -0.2018 0.0202  104  VAL L O   
4076 C  CB  . VAL C 104 ? 0.4323 0.2796 0.8281 0.0078  -0.1896 0.0388  104  VAL L CB  
4077 C  CG1 . VAL C 104 ? 0.4308 0.2537 0.8220 0.0012  -0.1789 0.0339  104  VAL L CG1 
4078 C  CG2 . VAL C 104 ? 0.4207 0.2741 0.8281 0.0056  -0.1879 0.0480  104  VAL L CG2 
4079 N  N   . GLU C 105 ? 0.4471 0.3030 0.8561 0.0000  -0.1980 -0.0002 105  GLU L N   
4080 C  CA  . GLU C 105 ? 0.4699 0.3225 0.8721 -0.0016 -0.1977 -0.0130 105  GLU L CA  
4081 C  C   . GLU C 105 ? 0.5516 0.3762 0.9482 -0.0098 -0.1835 -0.0192 105  GLU L C   
4082 O  O   . GLU C 105 ? 0.5460 0.3569 0.9475 -0.0162 -0.1754 -0.0164 105  GLU L O   
4083 C  CB  . GLU C 105 ? 0.4897 0.3645 0.9102 -0.0050 -0.2069 -0.0284 105  GLU L CB  
4084 C  CG  . GLU C 105 ? 0.6397 0.5376 1.0694 0.0021  -0.2208 -0.0220 105  GLU L CG  
4085 C  CD  . GLU C 105 ? 1.0466 0.9665 1.5016 -0.0003 -0.2302 -0.0358 105  GLU L CD  
4086 O  OE1 . GLU C 105 ? 0.8129 0.7357 1.2885 -0.0047 -0.2278 -0.0376 105  GLU L OE1 
4087 O  OE2 . GLU C 105 ? 1.1180 1.0538 1.5721 0.0032  -0.2414 -0.0443 105  GLU L OE2 
4088 N  N   . ILE C 106 ? 0.5245 0.3380 0.9082 -0.0101 -0.1800 -0.0276 106  ILE L N   
4089 C  CA  . ILE C 106 ? 0.5319 0.3132 0.9035 -0.0165 -0.1663 -0.0335 106  ILE L CA  
4090 C  C   . ILE C 106 ? 0.5728 0.3506 0.9589 -0.0309 -0.1590 -0.0518 106  ILE L C   
4091 O  O   . ILE C 106 ? 0.5334 0.3331 0.9328 -0.0339 -0.1648 -0.0651 106  ILE L O   
4092 C  CB  . ILE C 106 ? 0.5837 0.3527 0.9353 -0.0104 -0.1644 -0.0358 106  ILE L CB  
4093 C  CG1 . ILE C 106 ? 0.5684 0.3562 0.9125 0.0024  -0.1750 -0.0257 106  ILE L CG1 
4094 C  CG2 . ILE C 106 ? 0.6242 0.3542 0.9556 -0.0106 -0.1522 -0.0330 106  ILE L CG2 
4095 C  CD1 . ILE C 106 ? 0.7216 0.5147 1.0576 0.0041  -0.1771 -0.0364 106  ILE L CD1 
4096 N  N   . LYS C 107 ? 0.5729 0.3218 0.9542 -0.0406 -0.1457 -0.0537 107  LYS L N   
4097 C  CA  . LYS C 107 ? 0.5947 0.3344 0.9866 -0.0574 -0.1346 -0.0735 107  LYS L CA  
4098 C  C   . LYS C 107 ? 0.6884 0.4104 1.0647 -0.0606 -0.1270 -0.0856 107  LYS L C   
4099 O  O   . LYS C 107 ? 0.7128 0.4127 1.0644 -0.0520 -0.1249 -0.0767 107  LYS L O   
4100 C  CB  . LYS C 107 ? 0.6387 0.3464 1.0235 -0.0679 -0.1209 -0.0714 107  LYS L CB  
4101 C  CG  . LYS C 107 ? 0.8393 0.5656 1.2479 -0.0723 -0.1239 -0.0684 107  LYS L CG  
4102 C  CD  . LYS C 107 ? 0.9890 0.6832 1.3913 -0.0866 -0.1084 -0.0702 107  LYS L CD  
4103 C  CE  . LYS C 107 ? 1.1776 0.8680 1.5950 -0.1063 -0.0964 -0.0951 107  LYS L CE  
4104 N  NZ  . LYS C 107 ? 1.3104 0.9558 1.7079 -0.1214 -0.0778 -0.0976 107  LYS L NZ  
4105 N  N   . ARG C 108 ? 0.6481 0.3791 1.0393 -0.0736 -0.1219 -0.1074 108  ARG L N   
4106 C  CA  . ARG C 108 ? 0.6792 0.3961 1.0591 -0.0803 -0.1125 -0.1232 108  ARG L CA  
4107 C  C   . ARG C 108 ? 0.8064 0.5232 1.2035 -0.1005 -0.1004 -0.1474 108  ARG L C   
4108 O  O   . ARG C 108 ? 0.8093 0.5474 1.2316 -0.1053 -0.1044 -0.1512 108  ARG L O   
4109 C  CB  . ARG C 108 ? 0.6289 0.3814 1.0178 -0.0715 -0.1269 -0.1262 108  ARG L CB  
4110 C  CG  . ARG C 108 ? 0.7901 0.5288 1.1621 -0.0728 -0.1200 -0.1355 108  ARG L CG  
4111 C  CD  . ARG C 108 ? 0.9197 0.6939 1.3110 -0.0779 -0.1267 -0.1541 108  ARG L CD  
4112 N  NE  . ARG C 108 ? 1.1459 0.9080 1.5209 -0.0797 -0.1194 -0.1630 108  ARG L NE  
4113 C  CZ  . ARG C 108 ? 1.4341 1.1835 1.8079 -0.0948 -0.1042 -0.1845 108  ARG L CZ  
4114 N  NH1 . ARG C 108 ? 1.3186 1.0565 1.6767 -0.0957 -0.0974 -0.1914 108  ARG L NH1 
4115 N  NH2 . ARG C 108 ? 1.3240 1.0733 1.7131 -0.1101 -0.0949 -0.2008 108  ARG L NH2 
4116 N  N   . THR C 109 ? 0.8055 0.5003 1.1908 -0.1126 -0.0853 -0.1653 109  THR L N   
4117 C  CA  . THR C 109 ? 0.8181 0.5171 1.2214 -0.1333 -0.0727 -0.1922 109  THR L CA  
4118 C  C   . THR C 109 ? 0.8859 0.6401 1.3234 -0.1321 -0.0875 -0.2076 109  THR L C   
4119 O  O   . THR C 109 ? 0.8683 0.6446 1.3047 -0.1180 -0.1025 -0.1991 109  THR L O   
4120 C  CB  . THR C 109 ? 0.8507 0.5086 1.2282 -0.1468 -0.0512 -0.2073 109  THR L CB  
4121 O  OG1 . THR C 109 ? 0.7641 0.4291 1.1319 -0.1381 -0.0560 -0.2076 109  THR L OG1 
4122 C  CG2 . THR C 109 ? 0.8861 0.4850 1.2268 -0.1483 -0.0368 -0.1938 109  THR L CG2 
4123 N  N   . VAL C 110 ? 0.8572 0.6329 1.3240 -0.1467 -0.0834 -0.2310 110  VAL L N   
4124 C  CA  . VAL C 110 ? 0.8428 0.6705 1.3426 -0.1460 -0.0975 -0.2491 110  VAL L CA  
4125 C  C   . VAL C 110 ? 0.8780 0.7091 1.3671 -0.1483 -0.0944 -0.2622 110  VAL L C   
4126 O  O   . VAL C 110 ? 0.8850 0.6822 1.3544 -0.1616 -0.0737 -0.2736 110  VAL L O   
4127 C  CB  . VAL C 110 ? 0.9038 0.7507 1.4373 -0.1633 -0.0903 -0.2763 110  VAL L CB  
4128 C  CG1 . VAL C 110 ? 0.8827 0.7860 1.4519 -0.1605 -0.1070 -0.2968 110  VAL L CG1 
4129 C  CG2 . VAL C 110 ? 0.8938 0.7352 1.4374 -0.1623 -0.0916 -0.2636 110  VAL L CG2 
4130 N  N   . ALA C 111 ? 0.8192 0.6875 1.3180 -0.1354 -0.1143 -0.2597 111  ALA L N   
4131 C  CA  . ALA C 111 ? 0.8299 0.7075 1.3215 -0.1376 -0.1134 -0.2726 111  ALA L CA  
4132 C  C   . ALA C 111 ? 0.9035 0.8359 1.4264 -0.1344 -0.1326 -0.2881 111  ALA L C   
4133 O  O   . ALA C 111 ? 0.8829 0.8408 1.4155 -0.1186 -0.1545 -0.2733 111  ALA L O   
4134 C  CB  . ALA C 111 ? 0.8375 0.6980 1.2993 -0.1227 -0.1190 -0.2489 111  ALA L CB  
4135 N  N   . ALA C 112 ? 0.8936 0.8434 1.4322 -0.1497 -0.1241 -0.3193 112  ALA L N   
4136 C  CA  . ALA C 112 ? 0.8836 0.8868 1.4522 -0.1476 -0.1419 -0.3387 112  ALA L CA  
4137 C  C   . ALA C 112 ? 0.9439 0.9611 1.4963 -0.1344 -0.1577 -0.3274 112  ALA L C   
4138 O  O   . ALA C 112 ? 0.9565 0.9445 1.4801 -0.1359 -0.1464 -0.3195 112  ALA L O   
4139 C  CB  . ALA C 112 ? 0.9077 0.9228 1.4944 -0.1692 -0.1253 -0.3764 112  ALA L CB  
4140 N  N   . PRO C 113 ? 0.8875 0.9464 1.4556 -0.1211 -0.1838 -0.3264 113  PRO L N   
4141 C  CA  . PRO C 113 ? 0.8842 0.9539 1.4338 -0.1111 -0.1974 -0.3175 113  PRO L CA  
4142 C  C   . PRO C 113 ? 0.9195 1.0057 1.4727 -0.1246 -0.1898 -0.3452 113  PRO L C   
4143 O  O   . PRO C 113 ? 0.9141 1.0220 1.4934 -0.1376 -0.1837 -0.3744 113  PRO L O   
4144 C  CB  . PRO C 113 ? 0.8948 1.0017 1.4594 -0.0943 -0.2273 -0.3106 113  PRO L CB  
4145 C  CG  . PRO C 113 ? 0.9475 1.0795 1.5497 -0.1002 -0.2287 -0.3323 113  PRO L CG  
4146 C  CD  . PRO C 113 ? 0.8931 0.9901 1.4954 -0.1151 -0.2019 -0.3352 113  PRO L CD  
4147 N  N   . SER C 114 ? 0.8705 0.9487 1.3988 -0.1221 -0.1900 -0.3378 114  SER L N   
4148 C  CA  . SER C 114 ? 0.8720 0.9715 1.4036 -0.1331 -0.1866 -0.3627 114  SER L CA  
4149 C  C   . SER C 114 ? 0.9068 1.0482 1.4456 -0.1182 -0.2179 -0.3592 114  SER L C   
4150 O  O   . SER C 114 ? 0.8864 1.0205 1.4079 -0.1021 -0.2333 -0.3322 114  SER L O   
4151 C  CB  . SER C 114 ? 0.9023 0.9690 1.4032 -0.1389 -0.1691 -0.3572 114  SER L CB  
4152 O  OG  . SER C 114 ? 0.9262 0.9802 1.4026 -0.1235 -0.1806 -0.3288 114  SER L OG  
4153 N  N   . VAL C 115 ? 0.8605 1.0448 1.4253 -0.1230 -0.2280 -0.3866 115  VAL L N   
4154 C  CA  . VAL C 115 ? 0.8506 1.0737 1.4221 -0.1078 -0.2595 -0.3849 115  VAL L CA  
4155 C  C   . VAL C 115 ? 0.9025 1.1463 1.4626 -0.1116 -0.2659 -0.3972 115  VAL L C   
4156 O  O   . VAL C 115 ? 0.9093 1.1615 1.4780 -0.1290 -0.2494 -0.4236 115  VAL L O   
4157 C  CB  . VAL C 115 ? 0.8944 1.1546 1.5055 -0.1048 -0.2730 -0.4040 115  VAL L CB  
4158 C  CG1 . VAL C 115 ? 0.8941 1.1891 1.5088 -0.0852 -0.3081 -0.3986 115  VAL L CG1 
4159 C  CG2 . VAL C 115 ? 0.8768 1.1143 1.4988 -0.1036 -0.2637 -0.3927 115  VAL L CG2 
4160 N  N   . PHE C 116 ? 0.8531 1.1034 1.3920 -0.0966 -0.2888 -0.3784 116  PHE L N   
4161 C  CA  . PHE C 116 ? 0.8630 1.1313 1.3862 -0.0987 -0.2980 -0.3862 116  PHE L CA  
4162 C  C   . PHE C 116 ? 0.9286 1.2280 1.4510 -0.0813 -0.3327 -0.3816 116  PHE L C   
4163 O  O   . PHE C 116 ? 0.9061 1.1955 1.4207 -0.0649 -0.3478 -0.3583 116  PHE L O   
4164 C  CB  . PHE C 116 ? 0.8857 1.1177 1.3714 -0.1003 -0.2861 -0.3652 116  PHE L CB  
4165 C  CG  . PHE C 116 ? 0.8987 1.0935 1.3794 -0.1137 -0.2539 -0.3655 116  PHE L CG  
4166 C  CD1 . PHE C 116 ? 0.9549 1.1486 1.4362 -0.1319 -0.2331 -0.3880 116  PHE L CD1 
4167 C  CD2 . PHE C 116 ? 0.9111 1.0708 1.3850 -0.1079 -0.2444 -0.3436 116  PHE L CD2 
4168 C  CE1 . PHE C 116 ? 0.9682 1.1228 1.4412 -0.1430 -0.2036 -0.3877 116  PHE L CE1 
4169 C  CE2 . PHE C 116 ? 0.9484 1.0713 1.4147 -0.1186 -0.2163 -0.3436 116  PHE L CE2 
4170 C  CZ  . PHE C 116 ? 0.9369 1.0558 1.4017 -0.1356 -0.1963 -0.3652 116  PHE L CZ  
4171 N  N   . ILE C 117 ? 0.9294 1.2647 1.4573 -0.0846 -0.3453 -0.4036 117  ILE L N   
4172 C  CA  . ILE C 117 ? 0.9521 1.3161 1.4749 -0.0678 -0.3799 -0.4010 117  ILE L CA  
4173 C  C   . ILE C 117 ? 1.0549 1.4187 1.5436 -0.0704 -0.3868 -0.3975 117  ILE L C   
4174 O  O   . ILE C 117 ? 1.0558 1.4271 1.5456 -0.0877 -0.3707 -0.4171 117  ILE L O   
4175 C  CB  . ILE C 117 ? 0.9906 1.4035 1.5545 -0.0646 -0.3964 -0.4309 117  ILE L CB  
4176 C  CG1 . ILE C 117 ? 1.0104 1.4454 1.5668 -0.0411 -0.4356 -0.4221 117  ILE L CG1 
4177 C  CG2 . ILE C 117 ? 1.0027 1.4469 1.5868 -0.0843 -0.3839 -0.4685 117  ILE L CG2 
4178 C  CD1 . ILE C 117 ? 1.1197 1.6033 1.7192 -0.0324 -0.4563 -0.4492 117  ILE L CD1 
4179 N  N   . PHE C 118 ? 1.0457 1.3978 1.5021 -0.0547 -0.4085 -0.3727 118  PHE L N   
4180 C  CA  . PHE C 118 ? 1.0747 1.4239 1.4949 -0.0570 -0.4165 -0.3677 118  PHE L CA  
4181 C  C   . PHE C 118 ? 1.1556 1.5339 1.5674 -0.0422 -0.4523 -0.3715 118  PHE L C   
4182 O  O   . PHE C 118 ? 1.1500 1.5199 1.5504 -0.0232 -0.4733 -0.3522 118  PHE L O   
4183 C  CB  . PHE C 118 ? 1.1008 1.4057 1.4817 -0.0540 -0.4089 -0.3360 118  PHE L CB  
4184 C  CG  . PHE C 118 ? 1.1097 1.3826 1.4933 -0.0653 -0.3766 -0.3292 118  PHE L CG  
4185 C  CD1 . PHE C 118 ? 1.1631 1.4266 1.5383 -0.0826 -0.3543 -0.3389 118  PHE L CD1 
4186 C  CD2 . PHE C 118 ? 1.1242 1.3750 1.5171 -0.0582 -0.3689 -0.3128 118  PHE L CD2 
4187 C  CE1 . PHE C 118 ? 1.1671 1.3977 1.5414 -0.0905 -0.3263 -0.3314 118  PHE L CE1 
4188 C  CE2 . PHE C 118 ? 1.1496 1.3692 1.5419 -0.0671 -0.3409 -0.3059 118  PHE L CE2 
4189 C  CZ  . PHE C 118 ? 1.1351 1.3441 1.5176 -0.0823 -0.3204 -0.3150 118  PHE L CZ  
4190 N  N   . PRO C 119 ? 1.1388 1.5487 1.5519 -0.0503 -0.4600 -0.3952 119  PRO L N   
4191 C  CA  . PRO C 119 ? 1.1654 1.6002 1.5644 -0.0351 -0.4962 -0.3976 119  PRO L CA  
4192 C  C   . PRO C 119 ? 1.2370 1.6375 1.5808 -0.0275 -0.5076 -0.3680 119  PRO L C   
4193 O  O   . PRO C 119 ? 1.2140 1.5817 1.5353 -0.0393 -0.4849 -0.3544 119  PRO L O   
4194 C  CB  . PRO C 119 ? 1.1984 1.6715 1.6096 -0.0502 -0.4951 -0.4304 119  PRO L CB  
4195 C  CG  . PRO C 119 ? 1.2284 1.7011 1.6699 -0.0717 -0.4588 -0.4488 119  PRO L CG  
4196 C  CD  . PRO C 119 ? 1.1558 1.5785 1.5801 -0.0733 -0.4366 -0.4204 119  PRO L CD  
4197 N  N   . PRO C 120 ? 1.2326 1.6383 1.5520 -0.0088 -0.5416 -0.3590 120  PRO L N   
4198 C  CA  . PRO C 120 ? 1.2610 1.6307 1.5231 -0.0053 -0.5494 -0.3331 120  PRO L CA  
4199 C  C   . PRO C 120 ? 1.3370 1.7082 1.5773 -0.0253 -0.5377 -0.3439 120  PRO L C   
4200 O  O   . PRO C 120 ? 1.3378 1.7461 1.5995 -0.0346 -0.5391 -0.3717 120  PRO L O   
4201 C  CB  . PRO C 120 ? 1.3138 1.6933 1.5567 0.0178  -0.5892 -0.3277 120  PRO L CB  
4202 C  CG  . PRO C 120 ? 1.3634 1.7943 1.6523 0.0228  -0.6037 -0.3579 120  PRO L CG  
4203 C  CD  . PRO C 120 ? 1.2642 1.7071 1.6042 0.0094  -0.5741 -0.3731 120  PRO L CD  
4204 N  N   . SER C 121 ? 1.3067 1.6391 1.5066 -0.0330 -0.5246 -0.3237 121  SER L N   
4205 C  CA  . SER C 121 ? 1.3201 1.6499 1.4971 -0.0526 -0.5118 -0.3322 121  SER L CA  
4206 C  C   . SER C 121 ? 1.4198 1.7647 1.5640 -0.0478 -0.5419 -0.3378 121  SER L C   
4207 O  O   . SER C 121 ? 1.4395 1.7810 1.5645 -0.0277 -0.5713 -0.3260 121  SER L O   
4208 C  CB  . SER C 121 ? 1.3565 1.6408 1.5006 -0.0606 -0.4908 -0.3095 121  SER L CB  
4209 O  OG  . SER C 121 ? 1.4702 1.7257 1.5707 -0.0470 -0.5093 -0.2847 121  SER L OG  
4210 N  N   . ASP C 122 ? 1.3924 1.7518 1.5278 -0.0661 -0.5346 -0.3555 122  ASP L N   
4211 C  CA  . ASP C 122 ? 1.4355 1.8072 1.5355 -0.0642 -0.5614 -0.3612 122  ASP L CA  
4212 C  C   . ASP C 122 ? 1.5132 1.8390 1.5517 -0.0585 -0.5713 -0.3323 122  ASP L C   
4213 O  O   . ASP C 122 ? 1.5480 1.8723 1.5536 -0.0438 -0.6030 -0.3259 122  ASP L O   
4214 C  CB  . ASP C 122 ? 1.4696 1.8640 1.5732 -0.0880 -0.5470 -0.3859 122  ASP L CB  
4215 C  CG  . ASP C 122 ? 1.6142 2.0562 1.7739 -0.0947 -0.5394 -0.4180 122  ASP L CG  
4216 O  OD1 . ASP C 122 ? 1.6212 2.0950 1.8068 -0.0784 -0.5628 -0.4287 122  ASP L OD1 
4217 O  OD2 . ASP C 122 ? 1.6963 2.1437 1.8731 -0.1165 -0.5099 -0.4337 122  ASP L OD2 
4218 N  N   . GLU C 123 ? 1.4486 1.7359 1.4723 -0.0687 -0.5443 -0.3152 123  GLU L N   
4219 C  CA  . GLU C 123 ? 1.4696 1.7106 1.4379 -0.0665 -0.5466 -0.2891 123  GLU L CA  
4220 C  C   . GLU C 123 ? 1.5410 1.7670 1.4931 -0.0410 -0.5732 -0.2694 123  GLU L C   
4221 O  O   . GLU C 123 ? 1.5830 1.7869 1.4827 -0.0341 -0.5943 -0.2571 123  GLU L O   
4222 C  CB  . GLU C 123 ? 1.4575 1.6672 1.4276 -0.0793 -0.5118 -0.2774 123  GLU L CB  
4223 C  CG  . GLU C 123 ? 1.5693 1.7861 1.5513 -0.1038 -0.4836 -0.2944 123  GLU L CG  
4224 C  CD  . GLU C 123 ? 1.7658 2.0071 1.8049 -0.1103 -0.4618 -0.3119 123  GLU L CD  
4225 O  OE1 . GLU C 123 ? 1.6975 1.9714 1.7713 -0.1015 -0.4741 -0.3254 123  GLU L OE1 
4226 O  OE2 . GLU C 123 ? 1.6328 1.8608 1.6807 -0.1252 -0.4322 -0.3144 123  GLU L OE2 
4227 N  N   . GLN C 124 ? 1.4623 1.6987 1.4574 -0.0273 -0.5722 -0.2670 124  GLN L N   
4228 C  CA  . GLN C 124 ? 1.4650 1.6885 1.4507 -0.0026 -0.5955 -0.2493 124  GLN L CA  
4229 C  C   . GLN C 124 ? 1.5380 1.7864 1.5155 0.0143  -0.6335 -0.2587 124  GLN L C   
4230 O  O   . GLN C 124 ? 1.5636 1.7873 1.4989 0.0310  -0.6575 -0.2412 124  GLN L O   
4231 C  CB  . GLN C 124 ? 1.4328 1.6634 1.4691 0.0056  -0.5832 -0.2468 124  GLN L CB  
4232 C  CG  . GLN C 124 ? 1.5593 1.7699 1.5829 0.0292  -0.6025 -0.2257 124  GLN L CG  
4233 C  CD  . GLN C 124 ? 1.6739 1.8980 1.7497 0.0386  -0.5956 -0.2265 124  GLN L CD  
4234 O  OE1 . GLN C 124 ? 1.5521 1.8066 1.6779 0.0303  -0.5816 -0.2462 124  GLN L OE1 
4235 N  NE2 . GLN C 124 ? 1.5728 1.7733 1.6362 0.0556  -0.6053 -0.2057 124  GLN L NE2 
4236 N  N   . LEU C 125 ? 1.4808 1.7778 1.4986 0.0104  -0.6387 -0.2871 125  LEU L N   
4237 C  CA  . LEU C 125 ? 1.5043 1.8353 1.5239 0.0258  -0.6747 -0.3023 125  LEU L CA  
4238 C  C   . LEU C 125 ? 1.6075 1.9154 1.5591 0.0297  -0.6991 -0.2919 125  LEU L C   
4239 O  O   . LEU C 125 ? 1.6453 1.9528 1.5768 0.0527  -0.7333 -0.2863 125  LEU L O   
4240 C  CB  . LEU C 125 ? 1.4826 1.8688 1.5527 0.0140  -0.6695 -0.3374 125  LEU L CB  
4241 C  CG  . LEU C 125 ? 1.5040 1.9313 1.6410 0.0241  -0.6718 -0.3564 125  LEU L CG  
4242 C  CD1 . LEU C 125 ? 1.5065 1.9888 1.6790 0.0156  -0.6768 -0.3924 125  LEU L CD1 
4243 C  CD2 . LEU C 125 ? 1.5380 1.9607 1.6783 0.0534  -0.6992 -0.3431 125  LEU L CD2 
4244 N  N   . LYS C 126 ? 1.5601 1.8434 1.4732 0.0078  -0.6809 -0.2876 126  LYS L N   
4245 C  CA  . LYS C 126 ? 1.6042 1.8576 1.4462 0.0064  -0.6984 -0.2767 126  LYS L CA  
4246 C  C   . LYS C 126 ? 1.6823 1.8889 1.4753 0.0272  -0.7174 -0.2474 126  LYS L C   
4247 O  O   . LYS C 126 ? 1.7356 1.9310 1.4820 0.0406  -0.7492 -0.2425 126  LYS L O   
4248 C  CB  . LYS C 126 ? 1.6176 1.8471 1.4323 -0.0227 -0.6679 -0.2752 126  LYS L CB  
4249 C  CG  . LYS C 126 ? 1.5210 1.7907 1.3748 -0.0447 -0.6485 -0.3033 126  LYS L CG  
4250 C  CD  . LYS C 126 ? 1.5366 1.7930 1.3413 -0.0653 -0.6453 -0.3073 126  LYS L CD  
4251 C  CE  . LYS C 126 ? 1.4550 1.7497 1.2928 -0.0879 -0.6269 -0.3356 126  LYS L CE  
4252 N  NZ  . LYS C 126 ? 1.4916 1.7730 1.2796 -0.1079 -0.6253 -0.3395 126  LYS L NZ  
4253 N  N   . SER C 127 ? 1.5949 1.7743 1.3984 0.0306  -0.6984 -0.2289 127  SER L N   
4254 C  CA  . SER C 127 ? 1.6149 1.7480 1.3751 0.0482  -0.7106 -0.2012 127  SER L CA  
4255 C  C   . SER C 127 ? 1.6840 1.8315 1.4569 0.0798  -0.7459 -0.1995 127  SER L C   
4256 O  O   . SER C 127 ? 1.7078 1.8158 1.4360 0.0965  -0.7622 -0.1778 127  SER L O   
4257 C  CB  . SER C 127 ? 1.6069 1.7110 1.3776 0.0406  -0.6783 -0.1845 127  SER L CB  
4258 O  OG  . SER C 127 ? 1.6501 1.7476 1.4216 0.0137  -0.6451 -0.1891 127  SER L OG  
4259 N  N   . GLY C 128 ? 1.6296 1.8319 1.4615 0.0871  -0.7569 -0.2233 128  GLY L N   
4260 C  CA  . GLY C 128 ? 1.6476 1.8716 1.4997 0.1166  -0.7905 -0.2270 128  GLY L CA  
4261 C  C   . GLY C 128 ? 1.6704 1.9053 1.5781 0.1275  -0.7805 -0.2243 128  GLY L C   
4262 O  O   . GLY C 128 ? 1.6827 1.9295 1.6060 0.1530  -0.8067 -0.2245 128  GLY L O   
4263 N  N   . THR C 129 ? 1.5787 1.8094 1.5167 0.1085  -0.7429 -0.2225 129  THR L N   
4264 C  CA  . THR C 129 ? 1.5248 1.7633 1.5146 0.1147  -0.7286 -0.2199 129  THR L CA  
4265 C  C   . THR C 129 ? 1.5120 1.7893 1.5648 0.0956  -0.7012 -0.2435 129  THR L C   
4266 O  O   . THR C 129 ? 1.5058 1.7882 1.5542 0.0735  -0.6827 -0.2538 129  THR L O   
4267 C  CB  . THR C 129 ? 1.5763 1.7616 1.5348 0.1152  -0.7117 -0.1893 129  THR L CB  
4268 O  OG1 . THR C 129 ? 1.5230 1.6818 1.4519 0.0912  -0.6842 -0.1824 129  THR L OG1 
4269 C  CG2 . THR C 129 ? 1.5964 1.7451 1.5025 0.1382  -0.7394 -0.1675 129  THR L CG2 
4270 N  N   . ALA C 130 ? 1.4113 1.7140 1.5210 0.1038  -0.6983 -0.2527 130  ALA L N   
4271 C  CA  . ALA C 130 ? 1.3475 1.6832 1.5163 0.0868  -0.6724 -0.2752 130  ALA L CA  
4272 C  C   . ALA C 130 ? 1.3271 1.6497 1.5287 0.0874  -0.6505 -0.2645 130  ALA L C   
4273 O  O   . ALA C 130 ? 1.3158 1.6425 1.5359 0.1062  -0.6653 -0.2599 130  ALA L O   
4274 C  CB  . ALA C 130 ? 1.3550 1.7471 1.5673 0.0927  -0.6916 -0.3075 130  ALA L CB  
4275 N  N   . SER C 131 ? 1.2325 1.5377 1.4393 0.0670  -0.6158 -0.2602 131  SER L N   
4276 C  CA  . SER C 131 ? 1.1766 1.4685 1.4130 0.0644  -0.5920 -0.2513 131  SER L CA  
4277 C  C   . SER C 131 ? 1.1569 1.4781 1.4434 0.0466  -0.5684 -0.2771 131  SER L C   
4278 O  O   . SER C 131 ? 1.1468 1.4703 1.4274 0.0281  -0.5517 -0.2876 131  SER L O   
4279 C  CB  . SER C 131 ? 1.2173 1.4617 1.4159 0.0568  -0.5713 -0.2245 131  SER L CB  
4280 O  OG  . SER C 131 ? 1.3483 1.5620 1.4982 0.0714  -0.5900 -0.2012 131  SER L OG  
4281 N  N   . VAL C 132 ? 1.0630 1.4060 1.3976 0.0519  -0.5673 -0.2888 132  VAL L N   
4282 C  CA  . VAL C 132 ? 1.0171 1.3851 1.3991 0.0351  -0.5443 -0.3145 132  VAL L CA  
4283 C  C   . VAL C 132 ? 1.0098 1.3487 1.4035 0.0298  -0.5178 -0.2991 132  VAL L C   
4284 O  O   . VAL C 132 ? 0.9874 1.3166 1.3880 0.0439  -0.5254 -0.2850 132  VAL L O   
4285 C  CB  . VAL C 132 ? 1.0532 1.4708 1.4821 0.0421  -0.5617 -0.3444 132  VAL L CB  
4286 C  CG1 . VAL C 132 ? 1.0265 1.4689 1.4967 0.0205  -0.5360 -0.3744 132  VAL L CG1 
4287 C  CG2 . VAL C 132 ? 1.0832 1.5267 1.4947 0.0544  -0.5957 -0.3542 132  VAL L CG2 
4288 N  N   . VAL C 133 ? 0.9454 1.2681 1.3385 0.0104  -0.4874 -0.3006 133  VAL L N   
4289 C  CA  . VAL C 133 ? 0.9158 1.2073 1.3142 0.0059  -0.4627 -0.2845 133  VAL L CA  
4290 C  C   . VAL C 133 ? 0.9463 1.2496 1.3874 -0.0083 -0.4391 -0.3055 133  VAL L C   
4291 O  O   . VAL C 133 ? 0.9444 1.2599 1.3947 -0.0245 -0.4247 -0.3265 133  VAL L O   
4292 C  CB  . VAL C 133 ? 0.9657 1.2190 1.3238 -0.0016 -0.4463 -0.2635 133  VAL L CB  
4293 C  CG1 . VAL C 133 ? 0.9359 1.1588 1.2996 -0.0043 -0.4230 -0.2472 133  VAL L CG1 
4294 C  CG2 . VAL C 133 ? 0.9915 1.2289 1.3044 0.0107  -0.4674 -0.2429 133  VAL L CG2 
4295 N  N   . CYS C 134 ? 0.8848 1.1813 1.3490 -0.0032 -0.4338 -0.2995 134  CYS L N   
4296 C  CA  . CYS C 134 ? 0.8638 1.1622 1.3629 -0.0168 -0.4096 -0.3155 134  CYS L CA  
4297 C  C   . CYS C 134 ? 0.8547 1.1106 1.3387 -0.0202 -0.3875 -0.2918 134  CYS L C   
4298 O  O   . CYS C 134 ? 0.8354 1.0732 1.3068 -0.0073 -0.3953 -0.2678 134  CYS L O   
4299 C  CB  . CYS C 134 ? 0.8725 1.1988 1.4122 -0.0095 -0.4210 -0.3304 134  CYS L CB  
4300 S  SG  . CYS C 134 ? 0.9103 1.2404 1.4921 -0.0296 -0.3906 -0.3554 134  CYS L SG  
4301 N  N   . LEU C 135 ? 0.7943 1.0336 1.2781 -0.0371 -0.3603 -0.2988 135  LEU L N   
4302 C  CA  . LEU C 135 ? 0.7761 0.9753 1.2456 -0.0407 -0.3386 -0.2791 135  LEU L CA  
4303 C  C   . LEU C 135 ? 0.7968 0.9884 1.2942 -0.0511 -0.3176 -0.2903 135  LEU L C   
4304 O  O   . LEU C 135 ? 0.7874 0.9925 1.3039 -0.0654 -0.3052 -0.3166 135  LEU L O   
4305 C  CB  . LEU C 135 ? 0.7900 0.9695 1.2316 -0.0504 -0.3238 -0.2762 135  LEU L CB  
4306 C  CG  . LEU C 135 ? 0.8495 0.9901 1.2804 -0.0569 -0.2977 -0.2639 135  LEU L CG  
4307 C  CD1 . LEU C 135 ? 0.8350 0.9508 1.2469 -0.0440 -0.3016 -0.2339 135  LEU L CD1 
4308 C  CD2 . LEU C 135 ? 0.9249 1.0541 1.3372 -0.0680 -0.2830 -0.2701 135  LEU L CD2 
4309 N  N   . LEU C 136 ? 0.7315 0.9003 1.2293 -0.0450 -0.3125 -0.2711 136  LEU L N   
4310 C  CA  . LEU C 136 ? 0.7122 0.8653 1.2292 -0.0553 -0.2910 -0.2777 136  LEU L CA  
4311 C  C   . LEU C 136 ? 0.7963 0.9079 1.2853 -0.0571 -0.2732 -0.2570 136  LEU L C   
4312 O  O   . LEU C 136 ? 0.7913 0.8874 1.2622 -0.0453 -0.2800 -0.2317 136  LEU L O   
4313 C  CB  . LEU C 136 ? 0.6866 0.8465 1.2279 -0.0482 -0.2981 -0.2739 136  LEU L CB  
4314 C  CG  . LEU C 136 ? 0.7244 0.9190 1.2847 -0.0341 -0.3258 -0.2779 136  LEU L CG  
4315 C  CD1 . LEU C 136 ? 0.7060 0.9050 1.2970 -0.0338 -0.3233 -0.2821 136  LEU L CD1 
4316 C  CD2 . LEU C 136 ? 0.7390 0.9721 1.3114 -0.0352 -0.3406 -0.3031 136  LEU L CD2 
4317 N  N   . ASN C 137 ? 0.7816 0.8762 1.2657 -0.0713 -0.2512 -0.2686 137  ASN L N   
4318 C  CA  . ASN C 137 ? 0.7875 0.8442 1.2447 -0.0722 -0.2351 -0.2523 137  ASN L CA  
4319 C  C   . ASN C 137 ? 0.8223 0.8459 1.2811 -0.0781 -0.2143 -0.2481 137  ASN L C   
4320 O  O   . ASN C 137 ? 0.8260 0.8471 1.3002 -0.0916 -0.1997 -0.2680 137  ASN L O   
4321 C  CB  . ASN C 137 ? 0.8704 0.9257 1.3143 -0.0821 -0.2254 -0.2657 137  ASN L CB  
4322 C  CG  . ASN C 137 ? 1.3194 1.3398 1.7354 -0.0807 -0.2122 -0.2500 137  ASN L CG  
4323 O  OD1 . ASN C 137 ? 1.3056 1.2981 1.7162 -0.0894 -0.1907 -0.2551 137  ASN L OD1 
4324 N  ND2 . ASN C 137 ? 1.2312 1.2511 1.6280 -0.0694 -0.2246 -0.2312 137  ASN L ND2 
4325 N  N   . ASN C 138 ? 0.7643 0.7612 1.2048 -0.0687 -0.2124 -0.2230 138  ASN L N   
4326 C  CA  . ASN C 138 ? 0.7608 0.7207 1.1942 -0.0714 -0.1943 -0.2138 138  ASN L CA  
4327 C  C   . ASN C 138 ? 0.7759 0.7343 1.2316 -0.0800 -0.1863 -0.2246 138  ASN L C   
4328 O  O   . ASN C 138 ? 0.7814 0.7208 1.2381 -0.0939 -0.1669 -0.2398 138  ASN L O   
4329 C  CB  . ASN C 138 ? 0.8226 0.7529 1.2362 -0.0790 -0.1748 -0.2188 138  ASN L CB  
4330 C  CG  . ASN C 138 ? 1.3529 1.2765 1.7433 -0.0692 -0.1798 -0.2037 138  ASN L CG  
4331 O  OD1 . ASN C 138 ? 1.3771 1.3255 1.7653 -0.0647 -0.1947 -0.2033 138  ASN L OD1 
4332 N  ND2 . ASN C 138 ? 1.2729 1.1626 1.6450 -0.0652 -0.1682 -0.1911 138  ASN L ND2 
4333 N  N   . PHE C 139 ? 0.6963 0.6719 1.1679 -0.0723 -0.2003 -0.2167 139  PHE L N   
4334 C  CA  . PHE C 139 ? 0.6777 0.6546 1.1728 -0.0802 -0.1939 -0.2267 139  PHE L CA  
4335 C  C   . PHE C 139 ? 0.7488 0.7047 1.2387 -0.0728 -0.1929 -0.2034 139  PHE L C   
4336 O  O   . PHE C 139 ? 0.7483 0.6987 1.2214 -0.0594 -0.2021 -0.1804 139  PHE L O   
4337 C  CB  . PHE C 139 ? 0.6771 0.6982 1.2035 -0.0795 -0.2105 -0.2446 139  PHE L CB  
4338 C  CG  . PHE C 139 ? 0.6678 0.7120 1.1945 -0.0614 -0.2362 -0.2281 139  PHE L CG  
4339 C  CD1 . PHE C 139 ? 0.6983 0.7595 1.2119 -0.0536 -0.2514 -0.2263 139  PHE L CD1 
4340 C  CD2 . PHE C 139 ? 0.6623 0.7082 1.1997 -0.0529 -0.2442 -0.2144 139  PHE L CD2 
4341 C  CE1 . PHE C 139 ? 0.6965 0.7726 1.2042 -0.0374 -0.2740 -0.2104 139  PHE L CE1 
4342 C  CE2 . PHE C 139 ? 0.6827 0.7446 1.2160 -0.0363 -0.2664 -0.1988 139  PHE L CE2 
4343 C  CZ  . PHE C 139 ? 0.6666 0.7424 1.1839 -0.0286 -0.2813 -0.1969 139  PHE L CZ  
4344 N  N   . TYR C 140 ? 0.7076 0.6517 1.2113 -0.0830 -0.1805 -0.2109 140  TYR L N   
4345 C  CA  . TYR C 140 ? 0.6994 0.6252 1.2015 -0.0791 -0.1780 -0.1925 140  TYR L CA  
4346 C  C   . TYR C 140 ? 0.7695 0.7031 1.3004 -0.0920 -0.1708 -0.2107 140  TYR L C   
4347 O  O   . TYR C 140 ? 0.7794 0.7066 1.3163 -0.1082 -0.1555 -0.2339 140  TYR L O   
4348 C  CB  . TYR C 140 ? 0.7240 0.6049 1.1952 -0.0789 -0.1628 -0.1758 140  TYR L CB  
4349 C  CG  . TYR C 140 ? 0.7345 0.6009 1.2029 -0.0731 -0.1630 -0.1551 140  TYR L CG  
4350 C  CD1 . TYR C 140 ? 0.7659 0.6156 1.2434 -0.0850 -0.1499 -0.1607 140  TYR L CD1 
4351 C  CD2 . TYR C 140 ? 0.7283 0.5993 1.1857 -0.0572 -0.1756 -0.1315 140  TYR L CD2 
4352 C  CE1 . TYR C 140 ? 0.7677 0.6066 1.2440 -0.0807 -0.1502 -0.1426 140  TYR L CE1 
4353 C  CE2 . TYR C 140 ? 0.7289 0.5900 1.1856 -0.0528 -0.1755 -0.1140 140  TYR L CE2 
4354 C  CZ  . TYR C 140 ? 0.8253 0.6702 1.2913 -0.0643 -0.1629 -0.1191 140  TYR L CZ  
4355 O  OH  . TYR C 140 ? 0.8055 0.6404 1.2704 -0.0613 -0.1618 -0.1023 140  TYR L OH  
4356 N  N   . PRO C 141 ? 0.7228 0.6715 1.2729 -0.0861 -0.1808 -0.2031 141  PRO L N   
4357 C  CA  . PRO C 141 ? 0.7008 0.6568 1.2454 -0.0684 -0.1973 -0.1773 141  PRO L CA  
4358 C  C   . PRO C 141 ? 0.7462 0.7357 1.2944 -0.0544 -0.2204 -0.1760 141  PRO L C   
4359 O  O   . PRO C 141 ? 0.7468 0.7588 1.3061 -0.0579 -0.2257 -0.1963 141  PRO L O   
4360 C  CB  . PRO C 141 ? 0.7095 0.6684 1.2773 -0.0723 -0.1950 -0.1775 141  PRO L CB  
4361 C  CG  . PRO C 141 ? 0.7738 0.7522 1.3718 -0.0866 -0.1898 -0.2093 141  PRO L CG  
4362 C  CD  . PRO C 141 ? 0.7408 0.6989 1.3213 -0.0992 -0.1734 -0.2228 141  PRO L CD  
4363 N  N   . ARG C 142 ? 0.7012 0.6921 1.2374 -0.0393 -0.2335 -0.1526 142  ARG L N   
4364 C  CA  . ARG C 142 ? 0.7108 0.7259 1.2424 -0.0251 -0.2556 -0.1471 142  ARG L CA  
4365 C  C   . ARG C 142 ? 0.7706 0.8219 1.3333 -0.0223 -0.2717 -0.1654 142  ARG L C   
4366 O  O   . ARG C 142 ? 0.7848 0.8571 1.3438 -0.0142 -0.2886 -0.1698 142  ARG L O   
4367 C  CB  . ARG C 142 ? 0.7166 0.7213 1.2296 -0.0119 -0.2627 -0.1193 142  ARG L CB  
4368 C  CG  . ARG C 142 ? 0.8899 0.9076 1.3851 0.0020  -0.2822 -0.1093 142  ARG L CG  
4369 C  CD  . ARG C 142 ? 1.0960 1.1036 1.5786 0.0124  -0.2864 -0.0852 142  ARG L CD  
4370 N  NE  . ARG C 142 ? 1.2049 1.2150 1.6615 0.0241  -0.3009 -0.0723 142  ARG L NE  
4371 C  CZ  . ARG C 142 ? 1.3511 1.3787 1.8093 0.0342  -0.3205 -0.0730 142  ARG L CZ  
4372 N  NH1 . ARG C 142 ? 1.2153 1.2640 1.7040 0.0353  -0.3294 -0.0877 142  ARG L NH1 
4373 N  NH2 . ARG C 142 ? 1.1237 1.1469 1.5521 0.0434  -0.3314 -0.0603 142  ARG L NH2 
4374 N  N   . GLU C 143 ? 0.7029 0.7618 1.2958 -0.0288 -0.2669 -0.1769 143  GLU L N   
4375 C  CA  . GLU C 143 ? 0.6920 0.7869 1.3190 -0.0254 -0.2821 -0.1964 143  GLU L CA  
4376 C  C   . GLU C 143 ? 0.7611 0.8791 1.4010 -0.0332 -0.2837 -0.2249 143  GLU L C   
4377 O  O   . GLU C 143 ? 0.7642 0.8721 1.4080 -0.0504 -0.2641 -0.2415 143  GLU L O   
4378 C  CB  . GLU C 143 ? 0.6971 0.7949 1.3559 -0.0328 -0.2739 -0.2052 143  GLU L CB  
4379 C  CG  . GLU C 143 ? 0.8340 0.9114 1.4844 -0.0271 -0.2710 -0.1797 143  GLU L CG  
4380 C  CD  . GLU C 143 ? 1.1701 1.2104 1.8032 -0.0405 -0.2466 -0.1705 143  GLU L CD  
4381 O  OE1 . GLU C 143 ? 1.2140 1.2311 1.8165 -0.0341 -0.2441 -0.1459 143  GLU L OE1 
4382 O  OE2 . GLU C 143 ? 1.0794 1.1132 1.7285 -0.0575 -0.2297 -0.1890 143  GLU L OE2 
4383 N  N   . ALA C 144 ? 0.7345 0.8824 1.3789 -0.0207 -0.3070 -0.2306 144  ALA L N   
4384 C  CA  . ALA C 144 ? 0.7474 0.9243 1.4058 -0.0258 -0.3128 -0.2584 144  ALA L CA  
4385 C  C   . ALA C 144 ? 0.8050 1.0190 1.4811 -0.0092 -0.3419 -0.2658 144  ALA L C   
4386 O  O   . ALA C 144 ? 0.8016 1.0113 1.4625 0.0083  -0.3589 -0.2434 144  ALA L O   
4387 C  CB  . ALA C 144 ? 0.7701 0.9336 1.3951 -0.0285 -0.3086 -0.2528 144  ALA L CB  
4388 N  N   . LYS C 145 ? 0.7601 1.0097 1.4679 -0.0145 -0.3474 -0.2982 145  LYS L N   
4389 C  CA  . LYS C 145 ? 0.7597 1.0485 1.4878 0.0019  -0.3766 -0.3100 145  LYS L CA  
4390 C  C   . LYS C 145 ? 0.8251 1.1379 1.5474 0.0004  -0.3862 -0.3284 145  LYS L C   
4391 O  O   . LYS C 145 ? 0.8148 1.1348 1.5490 -0.0181 -0.3689 -0.3524 145  LYS L O   
4392 C  CB  . LYS C 145 ? 0.7744 1.0899 1.5522 -0.0016 -0.3763 -0.3348 145  LYS L CB  
4393 C  CG  . LYS C 145 ? 0.8842 1.2436 1.6902 0.0161  -0.4068 -0.3517 145  LYS L CG  
4394 C  CD  . LYS C 145 ? 0.9192 1.3093 1.7794 0.0063  -0.4007 -0.3859 145  LYS L CD  
4395 C  CE  . LYS C 145 ? 0.9317 1.3726 1.8251 0.0213  -0.4295 -0.4118 145  LYS L CE  
4396 N  NZ  . LYS C 145 ? 1.0007 1.4733 1.9493 0.0089  -0.4204 -0.4492 145  LYS L NZ  
4397 N  N   . VAL C 146 ? 0.8064 1.1280 1.5066 0.0188  -0.4125 -0.3162 146  VAL L N   
4398 C  CA  . VAL C 146 ? 0.8288 1.1729 1.5193 0.0192  -0.4248 -0.3310 146  VAL L CA  
4399 C  C   . VAL C 146 ? 0.9138 1.2989 1.6261 0.0376  -0.4574 -0.3459 146  VAL L C   
4400 O  O   . VAL C 146 ? 0.9149 1.2938 1.6146 0.0581  -0.4785 -0.3257 146  VAL L O   
4401 C  CB  . VAL C 146 ? 0.8870 1.2024 1.5258 0.0224  -0.4259 -0.3049 146  VAL L CB  
4402 C  CG1 . VAL C 146 ? 0.9026 1.2415 1.5322 0.0203  -0.4368 -0.3219 146  VAL L CG1 
4403 C  CG2 . VAL C 146 ? 0.8736 1.1498 1.4932 0.0069  -0.3955 -0.2907 146  VAL L CG2 
4404 N  N   . GLN C 147 ? 0.8911 1.3172 1.6348 0.0305  -0.4615 -0.3819 147  GLN L N   
4405 C  CA  . GLN C 147 ? 0.9061 1.3773 1.6757 0.0474  -0.4928 -0.4023 147  GLN L CA  
4406 C  C   . GLN C 147 ? 0.9999 1.4951 1.7550 0.0475  -0.5069 -0.4169 147  GLN L C   
4407 O  O   . GLN C 147 ? 0.9877 1.4927 1.7504 0.0269  -0.4879 -0.4386 147  GLN L O   
4408 C  CB  . GLN C 147 ? 0.9059 1.4116 1.7344 0.0391  -0.4860 -0.4372 147  GLN L CB  
4409 C  CG  . GLN C 147 ? 1.1736 1.7296 2.0366 0.0582  -0.5189 -0.4613 147  GLN L CG  
4410 C  CD  . GLN C 147 ? 1.5421 2.1425 2.4618 0.0429  -0.5090 -0.5075 147  GLN L CD  
4411 O  OE1 . GLN C 147 ? 1.5546 2.1734 2.4813 0.0247  -0.4963 -0.5335 147  GLN L OE1 
4412 N  NE2 . GLN C 147 ? 1.4136 2.0338 2.3756 0.0500  -0.5151 -0.5208 147  GLN L NE2 
4413 N  N   . TRP C 148 ? 1.0050 1.5072 1.7366 0.0700  -0.5394 -0.4050 148  TRP L N   
4414 C  CA  . TRP C 148 ? 1.0361 1.5613 1.7514 0.0718  -0.5561 -0.4178 148  TRP L CA  
4415 C  C   . TRP C 148 ? 1.0815 1.6635 1.8381 0.0829  -0.5822 -0.4527 148  TRP L C   
4416 O  O   . TRP C 148 ? 1.0735 1.6694 1.8495 0.1036  -0.6049 -0.4526 148  TRP L O   
4417 C  CB  . TRP C 148 ? 1.0534 1.5500 1.7123 0.0891  -0.5769 -0.3848 148  TRP L CB  
4418 C  CG  . TRP C 148 ? 1.0678 1.5174 1.6822 0.0767  -0.5543 -0.3570 148  TRP L CG  
4419 C  CD1 . TRP C 148 ? 1.0991 1.5051 1.6865 0.0811  -0.5454 -0.3235 148  TRP L CD1 
4420 C  CD2 . TRP C 148 ? 1.0749 1.5177 1.6655 0.0595  -0.5395 -0.3607 148  TRP L CD2 
4421 N  NE1 . TRP C 148 ? 1.0955 1.4696 1.6453 0.0682  -0.5265 -0.3072 148  TRP L NE1 
4422 C  CE2 . TRP C 148 ? 1.1215 1.5163 1.6728 0.0547  -0.5222 -0.3291 148  TRP L CE2 
4423 C  CE3 . TRP C 148 ? 1.1023 1.5760 1.7019 0.0472  -0.5387 -0.3888 148  TRP L CE3 
4424 C  CZ2 . TRP C 148 ? 1.1186 1.4953 1.6403 0.0395  -0.5055 -0.3247 148  TRP L CZ2 
4425 C  CZ3 . TRP C 148 ? 1.1268 1.5808 1.6958 0.0308  -0.5206 -0.3835 148  TRP L CZ3 
4426 C  CH2 . TRP C 148 ? 1.1311 1.5369 1.6621 0.0276  -0.5046 -0.3518 148  TRP L CH2 
4427 N  N   . LYS C 149 ? 1.0430 1.6582 1.8121 0.0698  -0.5798 -0.4829 149  LYS L N   
4428 C  CA  . LYS C 149 ? 1.0565 1.7301 1.8632 0.0792  -0.6050 -0.5192 149  LYS L CA  
4429 C  C   . LYS C 149 ? 1.1231 1.8122 1.9006 0.0801  -0.6211 -0.5252 149  LYS L C   
4430 O  O   . LYS C 149 ? 1.1129 1.7866 1.8685 0.0591  -0.5983 -0.5243 149  LYS L O   
4431 C  CB  . LYS C 149 ? 1.0759 1.7859 1.9415 0.0585  -0.5830 -0.5611 149  LYS L CB  
4432 C  CG  . LYS C 149 ? 1.2440 1.9520 2.1471 0.0619  -0.5762 -0.5628 149  LYS L CG  
4433 C  CD  . LYS C 149 ? 1.3527 2.1028 2.3156 0.0430  -0.5590 -0.6093 149  LYS L CD  
4434 C  CE  . LYS C 149 ? 1.4731 2.2293 2.4765 0.0501  -0.5594 -0.6144 149  LYS L CE  
4435 N  NZ  . LYS C 149 ? 1.5865 2.3855 2.6488 0.0306  -0.5427 -0.6630 149  LYS L NZ  
4436 N  N   . VAL C 150 ? 1.1002 1.8165 1.8743 0.1051  -0.6608 -0.5297 150  VAL L N   
4437 C  CA  . VAL C 150 ? 1.1249 1.8598 1.8719 0.1081  -0.6808 -0.5374 150  VAL L CA  
4438 C  C   . VAL C 150 ? 1.1763 1.9795 1.9747 0.1155  -0.7030 -0.5822 150  VAL L C   
4439 O  O   . VAL C 150 ? 1.1797 2.0032 1.9989 0.1411  -0.7326 -0.5864 150  VAL L O   
4440 C  CB  . VAL C 150 ? 1.2044 1.9034 1.8897 0.1310  -0.7087 -0.4998 150  VAL L CB  
4441 C  CG1 . VAL C 150 ? 1.2348 1.9560 1.8937 0.1343  -0.7315 -0.5108 150  VAL L CG1 
4442 C  CG2 . VAL C 150 ? 1.1931 1.8292 1.8319 0.1206  -0.6834 -0.4604 150  VAL L CG2 
4443 N  N   . ASP C 151 ? 1.1201 1.9586 1.9413 0.0924  -0.6867 -0.6174 151  ASP L N   
4444 C  CA  . ASP C 151 ? 1.1142 2.0222 1.9894 0.0927  -0.7005 -0.6664 151  ASP L CA  
4445 C  C   . ASP C 151 ? 1.1355 2.0671 2.0692 0.0996  -0.7003 -0.6855 151  ASP L C   
4446 O  O   . ASP C 151 ? 1.1429 2.1188 2.1084 0.1222  -0.7332 -0.7063 151  ASP L O   
4447 C  CB  . ASP C 151 ? 1.1708 2.1107 2.0288 0.1174  -0.7459 -0.6726 151  ASP L CB  
4448 C  CG  . ASP C 151 ? 1.2771 2.2181 2.0965 0.1044  -0.7450 -0.6742 151  ASP L CG  
4449 O  OD1 . ASP C 151 ? 1.2573 2.2066 2.0888 0.0738  -0.7116 -0.6944 151  ASP L OD1 
4450 O  OD2 . ASP C 151 ? 1.3788 2.3162 2.1582 0.1248  -0.7786 -0.6593 151  ASP L OD2 
4451 N  N   . ASN C 152 ? 1.0502 1.9485 1.9946 0.0812  -0.6639 -0.6759 152  ASN L N   
4452 C  CA  . ASN C 152 ? 1.0142 1.9219 2.0085 0.0805  -0.6533 -0.6893 152  ASN L CA  
4453 C  C   . ASN C 152 ? 1.0371 1.9282 2.0271 0.1124  -0.6812 -0.6620 152  ASN L C   
4454 O  O   . ASN C 152 ? 1.0031 1.9035 2.0352 0.1139  -0.6753 -0.6729 152  ASN L O   
4455 C  CB  . ASN C 152 ? 1.0269 2.0019 2.0877 0.0704  -0.6519 -0.7463 152  ASN L CB  
4456 C  CG  . ASN C 152 ? 1.3227 2.2947 2.4104 0.0332  -0.6048 -0.7708 152  ASN L CG  
4457 O  OD1 . ASN C 152 ? 1.2850 2.2167 2.3716 0.0215  -0.5775 -0.7541 152  ASN L OD1 
4458 N  ND2 . ASN C 152 ? 1.1727 2.1866 2.2835 0.0133  -0.5940 -0.8123 152  ASN L ND2 
4459 N  N   . ALA C 153 ? 1.0103 1.8727 1.9473 0.1358  -0.7085 -0.6261 153  ALA L N   
4460 C  CA  . ALA C 153 ? 1.0115 1.8498 1.9347 0.1657  -0.7333 -0.5965 153  ALA L CA  
4461 C  C   . ALA C 153 ? 1.0500 1.8202 1.9315 0.1587  -0.7089 -0.5513 153  ALA L C   
4462 O  O   . ALA C 153 ? 1.0619 1.7937 1.8895 0.1520  -0.7010 -0.5241 153  ALA L O   
4463 C  CB  . ALA C 153 ? 1.0597 1.9045 1.9474 0.1962  -0.7783 -0.5855 153  ALA L CB  
4464 N  N   . LEU C 154 ? 0.9744 1.7320 1.8831 0.1596  -0.6966 -0.5455 154  LEU L N   
4465 C  CA  . LEU C 154 ? 0.9527 1.6516 1.8313 0.1542  -0.6742 -0.5064 154  LEU L CA  
4466 C  C   . LEU C 154 ? 1.0332 1.6927 1.8516 0.1784  -0.6988 -0.4654 154  LEU L C   
4467 O  O   . LEU C 154 ? 1.0493 1.7218 1.8674 0.2070  -0.7341 -0.4639 154  LEU L O   
4468 C  CB  . LEU C 154 ? 0.9271 1.6317 1.8531 0.1554  -0.6650 -0.5142 154  LEU L CB  
4469 C  CG  . LEU C 154 ? 0.9579 1.6111 1.8682 0.1434  -0.6350 -0.4838 154  LEU L CG  
4470 C  CD1 . LEU C 154 ? 0.9305 1.6000 1.8952 0.1239  -0.6087 -0.5099 154  LEU L CD1 
4471 C  CD2 . LEU C 154 ? 0.9919 1.6134 1.8748 0.1696  -0.6549 -0.4484 154  LEU L CD2 
4472 N  N   . GLN C 155 ? 0.9932 1.6050 1.7596 0.1666  -0.6803 -0.4344 155  GLN L N   
4473 C  CA  . GLN C 155 ? 1.0190 1.5873 1.7225 0.1838  -0.6968 -0.3954 155  GLN L CA  
4474 C  C   . GLN C 155 ? 1.0863 1.6140 1.7793 0.1921  -0.6892 -0.3646 155  GLN L C   
4475 O  O   . GLN C 155 ? 1.0511 1.5692 1.7690 0.1752  -0.6597 -0.3648 155  GLN L O   
4476 C  CB  . GLN C 155 ? 1.0329 1.5724 1.6882 0.1657  -0.6793 -0.3801 155  GLN L CB  
4477 C  CG  . GLN C 155 ? 0.9833 1.5594 1.6422 0.1566  -0.6863 -0.4082 155  GLN L CG  
4478 C  CD  . GLN C 155 ? 0.9635 1.5629 1.6081 0.1823  -0.7292 -0.4141 155  GLN L CD  
4479 O  OE1 . GLN C 155 ? 0.8548 1.4225 1.4434 0.1957  -0.7468 -0.3873 155  GLN L OE1 
4480 N  NE2 . GLN C 155 ? 0.7905 1.4447 1.4841 0.1897  -0.7468 -0.4501 155  GLN L NE2 
4481 N  N   . SER C 156 ? 1.0895 1.5915 1.7434 0.2173  -0.7150 -0.3383 156  SER L N   
4482 C  CA  . SER C 156 ? 1.0893 1.5514 1.7279 0.2275  -0.7105 -0.3079 156  SER L CA  
4483 C  C   . SER C 156 ? 1.2031 1.6180 1.7704 0.2417  -0.7247 -0.2720 156  SER L C   
4484 O  O   . SER C 156 ? 1.2464 1.6673 1.7865 0.2591  -0.7552 -0.2733 156  SER L O   
4485 C  CB  . SER C 156 ? 1.1253 1.6132 1.8097 0.2477  -0.7294 -0.3217 156  SER L CB  
4486 O  OG  . SER C 156 ? 1.2427 1.7845 1.9640 0.2586  -0.7553 -0.3569 156  SER L OG  
4487 N  N   . GLY C 157 ? 1.1600 1.5286 1.6971 0.2332  -0.7017 -0.2419 157  GLY L N   
4488 C  CA  . GLY C 157 ? 1.1920 1.5104 1.6617 0.2428  -0.7082 -0.2072 157  GLY L CA  
4489 C  C   . GLY C 157 ? 1.2644 1.5653 1.6816 0.2336  -0.7079 -0.1989 157  GLY L C   
4490 O  O   . GLY C 157 ? 1.2984 1.5565 1.6573 0.2401  -0.7125 -0.1717 157  GLY L O   
4491 N  N   . ASN C 158 ? 1.1933 1.5253 1.6293 0.2170  -0.7009 -0.2228 158  ASN L N   
4492 C  CA  . ASN C 158 ? 1.2037 1.5237 1.5948 0.2060  -0.6992 -0.2189 158  ASN L CA  
4493 C  C   . ASN C 158 ? 1.1917 1.5025 1.5865 0.1768  -0.6617 -0.2191 158  ASN L C   
4494 O  O   . ASN C 158 ? 1.1831 1.4957 1.5567 0.1639  -0.6567 -0.2248 158  ASN L O   
4495 C  CB  . ASN C 158 ? 1.2514 1.6125 1.6510 0.2134  -0.7267 -0.2454 158  ASN L CB  
4496 C  CG  . ASN C 158 ? 1.5929 2.0095 2.0616 0.2064  -0.7235 -0.2826 158  ASN L CG  
4497 O  OD1 . ASN C 158 ? 1.4869 1.9113 1.9988 0.1948  -0.6999 -0.2902 158  ASN L OD1 
4498 N  ND2 . ASN C 158 ? 1.5332 1.9892 2.0123 0.2116  -0.7459 -0.3081 158  ASN L ND2 
4499 N  N   . SER C 159 ? 1.1057 1.4047 1.5252 0.1672  -0.6356 -0.2123 159  SER L N   
4500 C  CA  . SER C 159 ? 1.0620 1.3484 1.4845 0.1422  -0.6006 -0.2108 159  SER L CA  
4501 C  C   . SER C 159 ? 1.0302 1.2742 1.4317 0.1393  -0.5806 -0.1818 159  SER L C   
4502 O  O   . SER C 159 ? 1.0091 1.2425 1.4162 0.1524  -0.5865 -0.1695 159  SER L O   
4503 C  CB  . SER C 159 ? 1.0933 1.4149 1.5738 0.1274  -0.5843 -0.2403 159  SER L CB  
4504 O  OG  . SER C 159 ? 1.2492 1.5803 1.7698 0.1341  -0.5834 -0.2441 159  SER L OG  
4505 N  N   . GLN C 160 ? 0.9481 1.1685 1.3248 0.1226  -0.5574 -0.1717 160  GLN L N   
4506 C  CA  . GLN C 160 ? 0.9189 1.1012 1.2745 0.1178  -0.5366 -0.1464 160  GLN L CA  
4507 C  C   . GLN C 160 ? 0.9042 1.0849 1.2795 0.0967  -0.5055 -0.1531 160  GLN L C   
4508 O  O   . GLN C 160 ? 0.8939 1.0849 1.2684 0.0840  -0.4981 -0.1671 160  GLN L O   
4509 C  CB  . GLN C 160 ? 0.9650 1.1129 1.2594 0.1206  -0.5410 -0.1241 160  GLN L CB  
4510 C  CG  . GLN C 160 ? 1.1682 1.3076 1.4311 0.1416  -0.5715 -0.1143 160  GLN L CG  
4511 C  CD  . GLN C 160 ? 1.3713 1.4749 1.5706 0.1407  -0.5734 -0.0953 160  GLN L CD  
4512 O  OE1 . GLN C 160 ? 1.3376 1.4413 1.5160 0.1289  -0.5693 -0.1014 160  GLN L OE1 
4513 N  NE2 . GLN C 160 ? 1.2003 1.2716 1.3663 0.1525  -0.5792 -0.0731 160  GLN L NE2 
4514 N  N   . GLU C 161 ? 0.8143 0.9803 1.2053 0.0932  -0.4873 -0.1429 161  GLU L N   
4515 C  CA  . GLU C 161 ? 0.7698 0.9283 1.1758 0.0752  -0.4581 -0.1466 161  GLU L CA  
4516 C  C   . GLU C 161 ? 0.8036 0.9262 1.1747 0.0715  -0.4423 -0.1224 161  GLU L C   
4517 O  O   . GLU C 161 ? 0.8148 0.9176 1.1614 0.0819  -0.4490 -0.1020 161  GLU L O   
4518 C  CB  . GLU C 161 ? 0.7566 0.9250 1.2071 0.0721  -0.4473 -0.1550 161  GLU L CB  
4519 C  CG  . GLU C 161 ? 0.9155 1.1203 1.4086 0.0668  -0.4509 -0.1860 161  GLU L CG  
4520 C  CD  . GLU C 161 ? 1.1999 1.4129 1.7359 0.0617  -0.4389 -0.1960 161  GLU L CD  
4521 O  OE1 . GLU C 161 ? 1.0048 1.1923 1.5375 0.0574  -0.4214 -0.1797 161  GLU L OE1 
4522 O  OE2 . GLU C 161 ? 1.1491 1.3948 1.7223 0.0606  -0.4459 -0.2220 161  GLU L OE2 
4523 N  N   . SER C 162 ? 0.7344 0.8481 1.1040 0.0566  -0.4206 -0.1258 162  SER L N   
4524 C  CA  . SER C 162 ? 0.7148 0.7982 1.0586 0.0518  -0.4030 -0.1069 162  SER L CA  
4525 C  C   . SER C 162 ? 0.7395 0.8191 1.1078 0.0387  -0.3787 -0.1147 162  SER L C   
4526 O  O   . SER C 162 ? 0.7331 0.8283 1.1214 0.0293  -0.3733 -0.1352 162  SER L O   
4527 C  CB  . SER C 162 ? 0.7549 0.8273 1.0591 0.0488  -0.4049 -0.1026 162  SER L CB  
4528 O  OG  . SER C 162 ? 0.7806 0.8268 1.0639 0.0441  -0.3874 -0.0872 162  SER L OG  
4529 N  N   . VAL C 163 ? 0.6719 0.7310 1.0395 0.0384  -0.3645 -0.0994 163  VAL L N   
4530 C  CA  . VAL C 163 ? 0.6448 0.6942 1.0306 0.0275  -0.3419 -0.1038 163  VAL L CA  
4531 C  C   . VAL C 163 ? 0.6834 0.7070 1.0422 0.0249  -0.3273 -0.0888 163  VAL L C   
4532 O  O   . VAL C 163 ? 0.6589 0.6700 0.9956 0.0319  -0.3305 -0.0710 163  VAL L O   
4533 C  CB  . VAL C 163 ? 0.6675 0.7177 1.0819 0.0288  -0.3376 -0.1021 163  VAL L CB  
4534 C  CG1 . VAL C 163 ? 0.6476 0.6884 1.0804 0.0160  -0.3158 -0.1112 163  VAL L CG1 
4535 C  CG2 . VAL C 163 ? 0.6668 0.7435 1.1062 0.0352  -0.3557 -0.1146 163  VAL L CG2 
4536 N  N   . THR C 164 ? 0.6581 0.6737 1.0186 0.0148  -0.3109 -0.0973 164  THR L N   
4537 C  CA  . THR C 164 ? 0.6633 0.6565 1.0028 0.0133  -0.2972 -0.0857 164  THR L CA  
4538 C  C   . THR C 164 ? 0.7423 0.7202 1.0909 0.0151  -0.2861 -0.0737 164  THR L C   
4539 O  O   . THR C 164 ? 0.7215 0.7041 1.0941 0.0137  -0.2850 -0.0778 164  THR L O   
4540 C  CB  . THR C 164 ? 0.6939 0.6811 1.0326 0.0034  -0.2832 -0.0990 164  THR L CB  
4541 O  OG1 . THR C 164 ? 0.6787 0.6646 1.0421 -0.0040 -0.2721 -0.1113 164  THR L OG1 
4542 C  CG2 . THR C 164 ? 0.6384 0.6393 0.9656 -0.0001 -0.2916 -0.1107 164  THR L CG2 
4543 N  N   . GLU C 165 ? 0.7298 0.6903 1.0597 0.0174  -0.2775 -0.0603 165  GLU L N   
4544 C  CA  . GLU C 165 ? 0.7233 0.6685 1.0586 0.0187  -0.2661 -0.0492 165  GLU L CA  
4545 C  C   . GLU C 165 ? 0.7648 0.6998 1.1136 0.0107  -0.2518 -0.0607 165  GLU L C   
4546 O  O   . GLU C 165 ? 0.7701 0.7078 1.1183 0.0049  -0.2493 -0.0747 165  GLU L O   
4547 C  CB  . GLU C 165 ? 0.7486 0.6809 1.0605 0.0229  -0.2606 -0.0356 165  GLU L CB  
4548 C  CG  . GLU C 165 ? 0.9508 0.8843 1.2394 0.0224  -0.2632 -0.0385 165  GLU L CG  
4549 C  CD  . GLU C 165 ? 1.1556 1.0874 1.4442 0.0158  -0.2563 -0.0530 165  GLU L CD  
4550 O  OE1 . GLU C 165 ? 0.8899 0.8087 1.1722 0.0154  -0.2444 -0.0527 165  GLU L OE1 
4551 O  OE2 . GLU C 165 ? 1.0893 1.0338 1.3836 0.0116  -0.2633 -0.0654 165  GLU L OE2 
4552 N  N   . GLN C 166 ? 0.7065 0.6281 1.0654 0.0095  -0.2419 -0.0555 166  GLN L N   
4553 C  CA  . GLN C 166 ? 0.7048 0.6096 1.0708 0.0018  -0.2272 -0.0648 166  GLN L CA  
4554 C  C   . GLN C 166 ? 0.8019 0.6914 1.1494 0.0021  -0.2185 -0.0662 166  GLN L C   
4555 O  O   . GLN C 166 ? 0.8029 0.6868 1.1348 0.0092  -0.2184 -0.0546 166  GLN L O   
4556 C  CB  . GLN C 166 ? 0.6986 0.5883 1.0717 0.0017  -0.2191 -0.0554 166  GLN L CB  
4557 C  CG  . GLN C 166 ? 0.5666 0.4356 0.9451 -0.0075 -0.2043 -0.0654 166  GLN L CG  
4558 C  CD  . GLN C 166 ? 0.5273 0.3846 0.9152 -0.0102 -0.1980 -0.0587 166  GLN L CD  
4559 O  OE1 . GLN C 166 ? 0.2631 0.1192 0.6473 -0.0035 -0.2005 -0.0425 166  GLN L OE1 
4560 N  NE2 . GLN C 166 ? 0.4199 0.2681 0.8199 -0.0216 -0.1886 -0.0722 166  GLN L NE2 
4561 N  N   . ASP C 167 ? 0.7841 0.6684 1.1340 -0.0059 -0.2110 -0.0822 167  ASP L N   
4562 C  CA  . ASP C 167 ? 0.8028 0.6727 1.1373 -0.0062 -0.2024 -0.0865 167  ASP L CA  
4563 C  C   . ASP C 167 ? 0.8582 0.7004 1.1823 -0.0010 -0.1915 -0.0764 167  ASP L C   
4564 O  O   . ASP C 167 ? 0.8596 0.6856 1.1891 -0.0033 -0.1844 -0.0740 167  ASP L O   
4565 C  CB  . ASP C 167 ? 0.8471 0.7158 1.1875 -0.0172 -0.1950 -0.1066 167  ASP L CB  
4566 C  CG  . ASP C 167 ? 1.0202 0.8786 1.3457 -0.0181 -0.1877 -0.1131 167  ASP L CG  
4567 O  OD1 . ASP C 167 ? 1.0236 0.9000 1.3433 -0.0177 -0.1959 -0.1161 167  ASP L OD1 
4568 O  OD2 . ASP C 167 ? 1.1267 0.9574 1.4446 -0.0192 -0.1738 -0.1151 167  ASP L OD2 
4569 N  N   . SER C 168 ? 0.8051 0.6427 1.1140 0.0061  -0.1908 -0.0711 168  SER L N   
4570 C  CA  . SER C 168 ? 0.7898 0.6053 1.0880 0.0141  -0.1833 -0.0623 168  SER L CA  
4571 C  C   . SER C 168 ? 0.8242 0.6107 1.1171 0.0112  -0.1703 -0.0705 168  SER L C   
4572 O  O   . SER C 168 ? 0.8328 0.5964 1.1184 0.0173  -0.1645 -0.0630 168  SER L O   
4573 C  CB  . SER C 168 ? 0.8203 0.6435 1.1067 0.0216  -0.1865 -0.0585 168  SER L CB  
4574 O  OG  . SER C 168 ? 0.9043 0.7291 1.1858 0.0174  -0.1838 -0.0714 168  SER L OG  
4575 N  N   . LYS C 169 ? 0.7715 0.5574 1.0659 0.0023  -0.1655 -0.0858 169  LYS L N   
4576 C  CA  . LYS C 169 ? 0.7883 0.5429 1.0743 -0.0018 -0.1512 -0.0951 169  LYS L CA  
4577 C  C   . LYS C 169 ? 0.8035 0.5445 1.0967 -0.0130 -0.1433 -0.1021 169  LYS L C   
4578 O  O   . LYS C 169 ? 0.7928 0.4996 1.0747 -0.0129 -0.1324 -0.1003 169  LYS L O   
4579 C  CB  . LYS C 169 ? 0.8417 0.5991 1.1231 -0.0067 -0.1468 -0.1096 169  LYS L CB  
4580 C  CG  . LYS C 169 ? 0.9210 0.6851 1.1935 0.0026  -0.1505 -0.1061 169  LYS L CG  
4581 C  CD  . LYS C 169 ? 0.9722 0.7377 1.2411 -0.0048 -0.1442 -0.1222 169  LYS L CD  
4582 C  CE  . LYS C 169 ? 0.8757 0.6547 1.1386 0.0008  -0.1486 -0.1217 169  LYS L CE  
4583 N  NZ  . LYS C 169 ? 0.7453 0.5360 1.0077 -0.0095 -0.1458 -0.1372 169  LYS L NZ  
4584 N  N   . ASP C 170 ? 0.7417 0.5084 1.0525 -0.0226 -0.1486 -0.1110 170  ASP L N   
4585 C  CA  . ASP C 170 ? 0.7482 0.5046 1.0682 -0.0351 -0.1396 -0.1219 170  ASP L CA  
4586 C  C   . ASP C 170 ? 0.7998 0.5736 1.1382 -0.0371 -0.1471 -0.1171 170  ASP L C   
4587 O  O   . ASP C 170 ? 0.8173 0.5875 1.1669 -0.0491 -0.1397 -0.1293 170  ASP L O   
4588 C  CB  . ASP C 170 ? 0.7819 0.5477 1.1086 -0.0483 -0.1336 -0.1443 170  ASP L CB  
4589 C  CG  . ASP C 170 ? 0.8443 0.6533 1.1881 -0.0503 -0.1481 -0.1522 170  ASP L CG  
4590 O  OD1 . ASP C 170 ? 0.8247 0.6560 1.1753 -0.0418 -0.1633 -0.1399 170  ASP L OD1 
4591 O  OD2 . ASP C 170 ? 0.9049 0.7243 1.2542 -0.0606 -0.1439 -0.1710 170  ASP L OD2 
4592 N  N   . SER C 171 ? 0.7292 0.5208 1.0708 -0.0263 -0.1603 -0.1008 171  SER L N   
4593 C  CA  . SER C 171 ? 0.6983 0.5055 1.0565 -0.0264 -0.1678 -0.0940 171  SER L CA  
4594 C  C   . SER C 171 ? 0.7353 0.5719 1.1174 -0.0348 -0.1747 -0.1095 171  SER L C   
4595 O  O   . SER C 171 ? 0.7392 0.5837 1.1381 -0.0380 -0.1768 -0.1095 171  SER L O   
4596 C  CB  . SER C 171 ? 0.7305 0.5087 1.0849 -0.0292 -0.1570 -0.0875 171  SER L CB  
4597 O  OG  . SER C 171 ? 0.7912 0.5447 1.1241 -0.0196 -0.1529 -0.0743 171  SER L OG  
4598 N  N   . THR C 172 ? 0.6706 0.5253 1.0548 -0.0377 -0.1792 -0.1229 172  THR L N   
4599 C  CA  . THR C 172 ? 0.6537 0.5399 1.0603 -0.0437 -0.1880 -0.1390 172  THR L CA  
4600 C  C   . THR C 172 ? 0.6757 0.5914 1.0841 -0.0330 -0.2085 -0.1306 172  THR L C   
4601 O  O   . THR C 172 ? 0.6645 0.5761 1.0551 -0.0233 -0.2137 -0.1146 172  THR L O   
4602 C  CB  . THR C 172 ? 0.7368 0.6263 1.1451 -0.0549 -0.1804 -0.1616 172  THR L CB  
4603 O  OG1 . THR C 172 ? 0.7832 0.6749 1.1742 -0.0497 -0.1841 -0.1586 172  THR L OG1 
4604 C  CG2 . THR C 172 ? 0.6976 0.5553 1.1018 -0.0675 -0.1587 -0.1729 172  THR L CG2 
4605 N  N   . TYR C 173 ? 0.6178 0.5628 1.0468 -0.0351 -0.2199 -0.1430 173  TYR L N   
4606 C  CA  . TYR C 173 ? 0.6073 0.5792 1.0369 -0.0254 -0.2407 -0.1381 173  TYR L CA  
4607 C  C   . TYR C 173 ? 0.6465 0.6409 1.0813 -0.0305 -0.2470 -0.1582 173  TYR L C   
4608 O  O   . TYR C 173 ? 0.6540 0.6503 1.1022 -0.0424 -0.2364 -0.1784 173  TYR L O   
4609 C  CB  . TYR C 173 ? 0.6164 0.6042 1.0675 -0.0209 -0.2512 -0.1356 173  TYR L CB  
4610 C  CG  . TYR C 173 ? 0.6340 0.6026 1.0802 -0.0159 -0.2462 -0.1153 173  TYR L CG  
4611 C  CD1 . TYR C 173 ? 0.6569 0.6068 1.1126 -0.0243 -0.2304 -0.1173 173  TYR L CD1 
4612 C  CD2 . TYR C 173 ? 0.6407 0.6082 1.0703 -0.0041 -0.2559 -0.0948 173  TYR L CD2 
4613 C  CE1 . TYR C 173 ? 0.6608 0.5938 1.1112 -0.0203 -0.2257 -0.0990 173  TYR L CE1 
4614 C  CE2 . TYR C 173 ? 0.6475 0.5994 1.0731 -0.0004 -0.2503 -0.0774 173  TYR L CE2 
4615 C  CZ  . TYR C 173 ? 0.7678 0.7036 1.2046 -0.0082 -0.2358 -0.0794 173  TYR L CZ  
4616 O  OH  . TYR C 173 ? 0.8175 0.7384 1.2494 -0.0050 -0.2303 -0.0626 173  TYR L OH  
4617 N  N   . SER C 174 ? 0.5899 0.6003 1.0123 -0.0226 -0.2634 -0.1533 174  SER L N   
4618 C  CA  . SER C 174 ? 0.5971 0.6324 1.0233 -0.0260 -0.2732 -0.1712 174  SER L CA  
4619 C  C   . SER C 174 ? 0.6243 0.6826 1.0517 -0.0142 -0.2973 -0.1658 174  SER L C   
4620 O  O   . SER C 174 ? 0.6079 0.6567 1.0208 -0.0039 -0.3044 -0.1452 174  SER L O   
4621 C  CB  . SER C 174 ? 0.6746 0.7010 1.0774 -0.0298 -0.2671 -0.1725 174  SER L CB  
4622 O  OG  . SER C 174 ? 0.8368 0.8428 1.2410 -0.0408 -0.2452 -0.1817 174  SER L OG  
4623 N  N   . LEU C 175 ? 0.5855 0.6730 1.0301 -0.0155 -0.3097 -0.1849 175  LEU L N   
4624 C  CA  . LEU C 175 ? 0.5853 0.6941 1.0315 -0.0025 -0.3347 -0.1811 175  LEU L CA  
4625 C  C   . LEU C 175 ? 0.6595 0.7928 1.1005 -0.0027 -0.3495 -0.1965 175  LEU L C   
4626 O  O   . LEU C 175 ? 0.6461 0.7920 1.1004 -0.0146 -0.3411 -0.2185 175  LEU L O   
4627 C  CB  . LEU C 175 ? 0.5676 0.6914 1.0488 -0.0004 -0.3385 -0.1896 175  LEU L CB  
4628 C  CG  . LEU C 175 ? 0.6244 0.7702 1.1144 0.0147  -0.3642 -0.1877 175  LEU L CG  
4629 C  CD1 . LEU C 175 ? 0.6093 0.7548 1.1257 0.0174  -0.3615 -0.1850 175  LEU L CD1 
4630 C  CD2 . LEU C 175 ? 0.6678 0.8501 1.1771 0.0143  -0.3794 -0.2139 175  LEU L CD2 
4631 N  N   . SER C 176 ? 0.6368 0.7752 1.0563 0.0097  -0.3710 -0.1852 176  SER L N   
4632 C  CA  . SER C 176 ? 0.6474 0.8096 1.0597 0.0114  -0.3888 -0.1987 176  SER L CA  
4633 C  C   . SER C 176 ? 0.6977 0.8799 1.1199 0.0269  -0.4149 -0.1988 176  SER L C   
4634 O  O   . SER C 176 ? 0.6855 0.8529 1.0963 0.0388  -0.4224 -0.1785 176  SER L O   
4635 C  CB  . SER C 176 ? 0.7021 0.8480 1.0722 0.0115  -0.3913 -0.1859 176  SER L CB  
4636 O  OG  . SER C 176 ? 0.7876 0.9163 1.1294 0.0244  -0.4035 -0.1623 176  SER L OG  
4637 N  N   . SER C 177 ? 0.6750 0.8913 1.1192 0.0271  -0.4285 -0.2226 177  SER L N   
4638 C  CA  . SER C 177 ? 0.6862 0.9252 1.1399 0.0440  -0.4569 -0.2259 177  SER L CA  
4639 C  C   . SER C 177 ? 0.7536 1.0083 1.1847 0.0470  -0.4762 -0.2341 177  SER L C   
4640 O  O   . SER C 177 ? 0.7460 1.0188 1.1865 0.0340  -0.4691 -0.2552 177  SER L O   
4641 C  CB  . SER C 177 ? 0.7174 0.9872 1.2217 0.0425  -0.4576 -0.2501 177  SER L CB  
4642 O  OG  . SER C 177 ? 0.8289 1.1213 1.3428 0.0611  -0.4869 -0.2535 177  SER L OG  
4643 N  N   . THR C 178 ? 0.7364 0.9800 1.1333 0.0626  -0.4984 -0.2163 178  THR L N   
4644 C  CA  . THR C 178 ? 0.7771 1.0297 1.1444 0.0667  -0.5187 -0.2205 178  THR L CA  
4645 C  C   . THR C 178 ? 0.8921 1.1695 1.2683 0.0866  -0.5518 -0.2279 178  THR L C   
4646 O  O   . THR C 178 ? 0.8928 1.1542 1.2568 0.1032  -0.5652 -0.2096 178  THR L O   
4647 C  CB  . THR C 178 ? 0.8845 1.0985 1.1967 0.0672  -0.5165 -0.1943 178  THR L CB  
4648 O  OG1 . THR C 178 ? 0.9078 1.1011 1.2166 0.0505  -0.4864 -0.1890 178  THR L OG1 
4649 C  CG2 . THR C 178 ? 0.8855 1.1038 1.1613 0.0687  -0.5353 -0.1979 178  THR L CG2 
4650 N  N   . LEU C 179 ? 0.8929 1.2094 1.2900 0.0852  -0.5650 -0.2554 179  LEU L N   
4651 C  CA  . LEU C 179 ? 0.9261 1.2716 1.3324 0.1048  -0.5992 -0.2669 179  LEU L CA  
4652 C  C   . LEU C 179 ? 1.0395 1.3715 1.3910 0.1124  -0.6207 -0.2557 179  LEU L C   
4653 O  O   . LEU C 179 ? 1.0370 1.3723 1.3718 0.0977  -0.6131 -0.2639 179  LEU L O   
4654 C  CB  . LEU C 179 ? 0.9161 1.3133 1.3731 0.0979  -0.6015 -0.3051 179  LEU L CB  
4655 C  CG  . LEU C 179 ? 0.9721 1.4072 1.4693 0.1167  -0.6277 -0.3235 179  LEU L CG  
4656 C  CD1 . LEU C 179 ? 0.9710 1.4580 1.5027 0.1111  -0.6364 -0.3614 179  LEU L CD1 
4657 C  CD2 . LEU C 179 ? 1.0385 1.4623 1.5041 0.1438  -0.6620 -0.3055 179  LEU L CD2 
4658 N  N   . THR C 180 ? 1.0359 1.3490 1.3565 0.1344  -0.6459 -0.2365 180  THR L N   
4659 C  CA  . THR C 180 ? 1.0852 1.3787 1.3474 0.1420  -0.6667 -0.2242 180  THR L CA  
4660 C  C   . THR C 180 ? 1.1870 1.5092 1.4520 0.1636  -0.7055 -0.2379 180  THR L C   
4661 O  O   . THR C 180 ? 1.1788 1.5084 1.4632 0.1840  -0.7235 -0.2368 180  THR L O   
4662 C  CB  . THR C 180 ? 1.1766 1.4156 1.3865 0.1464  -0.6612 -0.1896 180  THR L CB  
4663 O  OG1 . THR C 180 ? 1.1437 1.3625 1.3545 0.1256  -0.6258 -0.1813 180  THR L OG1 
4664 C  CG2 . THR C 180 ? 1.1901 1.4033 1.3340 0.1519  -0.6805 -0.1770 180  THR L CG2 
4665 N  N   . LEU C 181 ? 1.1891 1.5285 1.4354 0.1590  -0.7183 -0.2518 181  LEU L N   
4666 C  CA  . LEU C 181 ? 1.2309 1.5995 1.4749 0.1784  -0.7565 -0.2668 181  LEU L CA  
4667 C  C   . LEU C 181 ? 1.3432 1.6894 1.5224 0.1770  -0.7705 -0.2572 181  LEU L C   
4668 O  O   . LEU C 181 ? 1.3302 1.6551 1.4824 0.1554  -0.7473 -0.2502 181  LEU L O   
4669 C  CB  . LEU C 181 ? 1.2128 1.6433 1.5165 0.1705  -0.7574 -0.3064 181  LEU L CB  
4670 C  CG  . LEU C 181 ? 1.2300 1.6889 1.6026 0.1617  -0.7353 -0.3250 181  LEU L CG  
4671 C  CD1 . LEU C 181 ? 1.2181 1.7279 1.6336 0.1449  -0.7273 -0.3628 181  LEU L CD1 
4672 C  CD2 . LEU C 181 ? 1.2760 1.7474 1.6802 0.1861  -0.7555 -0.3261 181  LEU L CD2 
4673 N  N   . SER C 182 ? 1.3700 1.7236 1.5259 0.1997  -0.8090 -0.2594 182  SER L N   
4674 C  CA  . SER C 182 ? 1.4315 1.7691 1.5266 0.1998  -0.8274 -0.2545 182  SER L CA  
4675 C  C   . SER C 182 ? 1.4826 1.8684 1.6069 0.1811  -0.8218 -0.2865 182  SER L C   
4676 O  O   . SER C 182 ? 1.4322 1.8667 1.6215 0.1779  -0.8164 -0.3136 182  SER L O   
4677 C  CB  . SER C 182 ? 1.5418 1.8770 1.6092 0.2319  -0.8725 -0.2506 182  SER L CB  
4678 O  OG  . SER C 182 ? 1.6618 2.0526 1.7899 0.2483  -0.8934 -0.2779 182  SER L OG  
4679 N  N   . LYS C 183 ? 1.4909 1.8626 1.5676 0.1671  -0.8210 -0.2844 183  LYS L N   
4680 C  CA  . LYS C 183 ? 1.4931 1.9079 1.5909 0.1487  -0.8161 -0.3140 183  LYS L CA  
4681 C  C   . LYS C 183 ? 1.5862 2.0572 1.7198 0.1682  -0.8512 -0.3427 183  LYS L C   
4682 O  O   . LYS C 183 ? 1.5542 2.0767 1.7422 0.1563  -0.8420 -0.3745 183  LYS L O   
4683 C  CB  . LYS C 183 ? 1.5624 1.9482 1.5946 0.1344  -0.8154 -0.3044 183  LYS L CB  
4684 C  CG  . LYS C 183 ? 1.7322 2.1584 1.7809 0.1130  -0.8078 -0.3334 183  LYS L CG  
4685 C  CD  . LYS C 183 ? 1.8775 2.2750 1.8569 0.1029  -0.8144 -0.3238 183  LYS L CD  
4686 C  CE  . LYS C 183 ? 1.9325 2.3648 1.9256 0.0780  -0.8012 -0.3504 183  LYS L CE  
4687 N  NZ  . LYS C 183 ? 2.0506 2.4459 1.9775 0.0616  -0.7958 -0.3376 183  LYS L NZ  
4688 N  N   . ALA C 184 ? 1.6061 2.0658 1.7100 0.1985  -0.8904 -0.3317 184  ALA L N   
4689 C  CA  . ALA C 184 ? 1.6308 2.1395 1.7637 0.2232  -0.9294 -0.3560 184  ALA L CA  
4690 C  C   . ALA C 184 ? 1.6357 2.1946 1.8541 0.2252  -0.9203 -0.3818 184  ALA L C   
4691 O  O   . ALA C 184 ? 1.6153 2.2335 1.8806 0.2207  -0.9261 -0.4177 184  ALA L O   
4692 C  CB  . ALA C 184 ? 1.6959 2.1697 1.7794 0.2567  -0.9678 -0.3329 184  ALA L CB  
4693 N  N   . ASP C 185 ? 1.5649 2.0999 1.8030 0.2292  -0.9033 -0.3650 185  ASP L N   
4694 C  CA  . ASP C 185 ? 1.5110 2.0859 1.8264 0.2283  -0.8904 -0.3870 185  ASP L CA  
4695 C  C   . ASP C 185 ? 1.5159 2.1187 1.8736 0.1948  -0.8519 -0.4104 185  ASP L C   
4696 O  O   . ASP C 185 ? 1.4924 2.1489 1.9119 0.1914  -0.8504 -0.4447 185  ASP L O   
4697 C  CB  . ASP C 185 ? 1.5098 2.0472 1.8293 0.2385  -0.8798 -0.3609 185  ASP L CB  
4698 C  CG  . ASP C 185 ? 1.6348 2.1666 1.9469 0.2747  -0.9176 -0.3518 185  ASP L CG  
4699 O  OD1 . ASP C 185 ? 1.6703 2.2335 1.9821 0.2945  -0.9547 -0.3691 185  ASP L OD1 
4700 O  OD2 . ASP C 185 ? 1.6779 2.1747 1.9857 0.2836  -0.9103 -0.3283 185  ASP L OD2 
4701 N  N   . TYR C 186 ? 1.4500 2.0162 1.7740 0.1702  -0.8210 -0.3937 186  TYR L N   
4702 C  CA  . TYR C 186 ? 1.4019 1.9860 1.7580 0.1386  -0.7832 -0.4130 186  TYR L CA  
4703 C  C   . TYR C 186 ? 1.4151 2.0542 1.7938 0.1287  -0.7916 -0.4505 186  TYR L C   
4704 O  O   . TYR C 186 ? 1.3725 2.0503 1.8056 0.1128  -0.7718 -0.4805 186  TYR L O   
4705 C  CB  . TYR C 186 ? 1.4240 1.9557 1.7347 0.1178  -0.7525 -0.3863 186  TYR L CB  
4706 C  CG  . TYR C 186 ? 1.4280 1.9728 1.7662 0.0866  -0.7142 -0.4045 186  TYR L CG  
4707 C  CD1 . TYR C 186 ? 1.4093 1.9595 1.7958 0.0754  -0.6851 -0.4125 186  TYR L CD1 
4708 C  CD2 . TYR C 186 ? 1.4590 2.0101 1.7742 0.0681  -0.7073 -0.4149 186  TYR L CD2 
4709 C  CE1 . TYR C 186 ? 1.3958 1.9554 1.8051 0.0478  -0.6505 -0.4303 186  TYR L CE1 
4710 C  CE2 . TYR C 186 ? 1.4451 2.0074 1.7855 0.0402  -0.6721 -0.4328 186  TYR L CE2 
4711 C  CZ  . TYR C 186 ? 1.5022 2.0674 1.8885 0.0307  -0.6440 -0.4402 186  TYR L CZ  
4712 O  OH  . TYR C 186 ? 1.5022 2.0730 1.9090 0.0039  -0.6090 -0.4571 186  TYR L OH  
4713 N  N   . GLU C 187 ? 1.3885 2.0301 1.7239 0.1380  -0.8209 -0.4496 187  GLU L N   
4714 C  CA  . GLU C 187 ? 1.3866 2.0794 1.7368 0.1293  -0.8314 -0.4838 187  GLU L CA  
4715 C  C   . GLU C 187 ? 1.4215 2.1771 1.8269 0.1470  -0.8586 -0.5182 187  GLU L C   
4716 O  O   . GLU C 187 ? 1.4223 2.2286 1.8548 0.1360  -0.8605 -0.5530 187  GLU L O   
4717 C  CB  . GLU C 187 ? 1.4539 2.1272 1.7368 0.1314  -0.8527 -0.4717 187  GLU L CB  
4718 C  CG  . GLU C 187 ? 1.5916 2.2076 1.8196 0.1115  -0.8262 -0.4426 187  GLU L CG  
4719 C  CD  . GLU C 187 ? 1.8435 2.4541 2.0827 0.0770  -0.7816 -0.4491 187  GLU L CD  
4720 O  OE1 . GLU C 187 ? 1.7707 2.3365 1.9592 0.0644  -0.7673 -0.4264 187  GLU L OE1 
4721 O  OE2 . GLU C 187 ? 1.7298 2.3790 2.0261 0.0624  -0.7607 -0.4773 187  GLU L OE2 
4722 N  N   . LYS C 188 ? 1.3654 2.1206 1.7902 0.1736  -0.8787 -0.5112 188  LYS L N   
4723 C  CA  . LYS C 188 ? 1.3618 2.1805 1.8446 0.1903  -0.9037 -0.5472 188  LYS L CA  
4724 C  C   . LYS C 188 ? 1.3560 2.2053 1.9127 0.1748  -0.8728 -0.5725 188  LYS L C   
4725 O  O   . LYS C 188 ? 1.3432 2.2454 1.9550 0.1867  -0.8891 -0.6042 188  LYS L O   
4726 C  CB  . LYS C 188 ? 1.4335 2.2454 1.8995 0.2303  -0.9493 -0.5335 188  LYS L CB  
4727 C  CG  . LYS C 188 ? 1.6380 2.4883 2.0903 0.2492  -0.9932 -0.5533 188  LYS L CG  
4728 C  CD  . LYS C 188 ? 1.7749 2.5822 2.1437 0.2482  -1.0059 -0.5274 188  LYS L CD  
4729 C  CE  . LYS C 188 ? 1.8540 2.7024 2.2073 0.2461  -1.0292 -0.5400 188  LYS L CE  
4730 N  NZ  . LYS C 188 ? 1.9007 2.7592 2.2388 0.2544  -1.0451 -0.5041 188  LYS L NZ  
4731 N  N   . HIS C 189 ? 1.2756 2.0929 1.8330 0.1473  -0.8280 -0.5608 189  HIS L N   
4732 C  CA  . HIS C 189 ? 1.2239 2.0624 1.8434 0.1297  -0.7956 -0.5831 189  HIS L CA  
4733 C  C   . HIS C 189 ? 1.2650 2.1030 1.8912 0.0926  -0.7530 -0.5969 189  HIS L C   
4734 O  O   . HIS C 189 ? 1.2704 2.0738 1.8486 0.0797  -0.7406 -0.5771 189  HIS L O   
4735 C  CB  . HIS C 189 ? 1.2048 2.0043 1.8301 0.1386  -0.7848 -0.5562 189  HIS L CB  
4736 C  CG  . HIS C 189 ? 1.2620 2.0668 1.8913 0.1739  -0.8234 -0.5483 189  HIS L CG  
4737 N  ND1 . HIS C 189 ? 1.2673 2.1217 1.9593 0.1857  -0.8363 -0.5795 189  HIS L ND1 
4738 C  CD2 . HIS C 189 ? 1.3095 2.0725 1.8874 0.1984  -0.8486 -0.5127 189  HIS L CD2 
4739 C  CE1 . HIS C 189 ? 1.2797 2.1223 1.9572 0.2185  -0.8706 -0.5617 189  HIS L CE1 
4740 N  NE2 . HIS C 189 ? 1.3122 2.0983 1.9199 0.2271  -0.8786 -0.5209 189  HIS L NE2 
4741 N  N   . LYS C 190 ? 1.1993 2.0755 1.8848 0.0753  -0.7303 -0.6326 190  LYS L N   
4742 C  CA  . LYS C 190 ? 1.1772 2.0557 1.8729 0.0403  -0.6896 -0.6507 190  LYS L CA  
4743 C  C   . LYS C 190 ? 1.1931 2.0307 1.8981 0.0216  -0.6472 -0.6371 190  LYS L C   
4744 O  O   . LYS C 190 ? 1.1818 1.9779 1.8522 0.0043  -0.6211 -0.6172 190  LYS L O   
4745 C  CB  . LYS C 190 ? 1.2022 2.1500 1.9509 0.0289  -0.6898 -0.7038 190  LYS L CB  
4746 C  CG  . LYS C 190 ? 1.3593 2.3456 2.0915 0.0347  -0.7191 -0.7212 190  LYS L CG  
4747 C  CD  . LYS C 190 ? 1.4208 2.4811 2.2123 0.0250  -0.7202 -0.7767 190  LYS L CD  
4748 C  CE  . LYS C 190 ? 1.4851 2.5927 2.2692 0.0420  -0.7622 -0.7951 190  LYS L CE  
4749 N  NZ  . LYS C 190 ? 1.5107 2.6936 2.3549 0.0321  -0.7626 -0.8514 190  LYS L NZ  
4750 N  N   . VAL C 191 ? 1.1240 1.9748 1.8767 0.0243  -0.6402 -0.6499 191  VAL L N   
4751 C  CA  . VAL C 191 ? 1.0820 1.8999 1.8498 0.0060  -0.6007 -0.6431 191  VAL L CA  
4752 C  C   . VAL C 191 ? 1.0894 1.8526 1.8290 0.0210  -0.6018 -0.5982 191  VAL L C   
4753 O  O   . VAL C 191 ? 1.0792 1.8485 1.8317 0.0445  -0.6261 -0.5906 191  VAL L O   
4754 C  CB  . VAL C 191 ? 1.1129 1.9728 1.9466 -0.0048 -0.5870 -0.6843 191  VAL L CB  
4755 C  CG1 . VAL C 191 ? 1.0847 1.9085 1.9263 -0.0308 -0.5408 -0.6819 191  VAL L CG1 
4756 C  CG2 . VAL C 191 ? 1.1230 2.0454 1.9880 -0.0156 -0.5923 -0.7321 191  VAL L CG2 
4757 N  N   . TYR C 192 ? 1.0227 1.7336 1.7258 0.0069  -0.5742 -0.5703 192  TYR L N   
4758 C  CA  . TYR C 192 ? 1.0052 1.6619 1.6793 0.0165  -0.5690 -0.5285 192  TYR L CA  
4759 C  C   . TYR C 192 ? 1.0156 1.6475 1.7095 -0.0037 -0.5295 -0.5290 192  TYR L C   
4760 O  O   . TYR C 192 ? 1.0029 1.6202 1.6883 -0.0266 -0.5000 -0.5348 192  TYR L O   
4761 C  CB  . TYR C 192 ? 1.0361 1.6527 1.6483 0.0188  -0.5726 -0.4955 192  TYR L CB  
4762 C  CG  . TYR C 192 ? 1.0917 1.7226 1.6773 0.0418  -0.6138 -0.4891 192  TYR L CG  
4763 C  CD1 . TYR C 192 ? 1.1449 1.8145 1.7300 0.0389  -0.6294 -0.5142 192  TYR L CD1 
4764 C  CD2 . TYR C 192 ? 1.1075 1.7153 1.6705 0.0672  -0.6382 -0.4605 192  TYR L CD2 
4765 C  CE1 . TYR C 192 ? 1.1913 1.8750 1.7524 0.0616  -0.6698 -0.5101 192  TYR L CE1 
4766 C  CE2 . TYR C 192 ? 1.1528 1.7706 1.6890 0.0897  -0.6772 -0.4552 192  TYR L CE2 
4767 C  CZ  . TYR C 192 ? 1.2769 1.9329 1.8123 0.0874  -0.6938 -0.4802 192  TYR L CZ  
4768 O  OH  . TYR C 192 ? 1.3352 1.9985 1.8410 0.1106  -0.7337 -0.4745 192  TYR L OH  
4769 N  N   . ALA C 193 ? 0.9521 1.5800 1.6730 0.0046  -0.5289 -0.5251 193  ALA L N   
4770 C  CA  . ALA C 193 ? 0.9238 1.5293 1.6648 -0.0137 -0.4935 -0.5272 193  ALA L CA  
4771 C  C   . ALA C 193 ? 0.9620 1.5242 1.6885 -0.0032 -0.4898 -0.4917 193  ALA L C   
4772 O  O   . ALA C 193 ? 0.9640 1.5284 1.6902 0.0198  -0.5155 -0.4769 193  ALA L O   
4773 C  CB  . ALA C 193 ? 0.9234 1.5730 1.7222 -0.0227 -0.4879 -0.5688 193  ALA L CB  
4774 N  N   . CYS C 194 ? 0.9013 1.4242 1.6164 -0.0205 -0.4566 -0.4797 194  CYS L N   
4775 C  CA  . CYS C 194 ? 0.8790 1.3588 1.5806 -0.0158 -0.4459 -0.4482 194  CYS L CA  
4776 C  C   . CYS C 194 ? 0.9147 1.3930 1.6528 -0.0331 -0.4186 -0.4668 194  CYS L C   
4777 O  O   . CYS C 194 ? 0.9153 1.3896 1.6581 -0.0555 -0.3919 -0.4855 194  CYS L O   
4778 C  CB  . CYS C 194 ? 0.8805 1.3142 1.5341 -0.0216 -0.4304 -0.4189 194  CYS L CB  
4779 S  SG  . CYS C 194 ? 0.9076 1.2886 1.5437 -0.0180 -0.4143 -0.3820 194  CYS L SG  
4780 N  N   . GLU C 195 ? 0.8583 1.3376 1.6200 -0.0236 -0.4240 -0.4625 195  GLU L N   
4781 C  CA  . GLU C 195 ? 0.8433 1.3185 1.6379 -0.0404 -0.3983 -0.4793 195  GLU L CA  
4782 C  C   . GLU C 195 ? 0.8622 1.2877 1.6361 -0.0395 -0.3832 -0.4455 195  GLU L C   
4783 O  O   . GLU C 195 ? 0.8405 1.2552 1.6029 -0.0200 -0.4010 -0.4190 195  GLU L O   
4784 C  CB  . GLU C 195 ? 0.8618 1.3837 1.7078 -0.0340 -0.4139 -0.5089 195  GLU L CB  
4785 C  CG  . GLU C 195 ? 1.0195 1.5421 1.9019 -0.0552 -0.3859 -0.5337 195  GLU L CG  
4786 C  CD  . GLU C 195 ? 1.3509 1.9094 2.2808 -0.0444 -0.4023 -0.5521 195  GLU L CD  
4787 O  OE1 . GLU C 195 ? 1.1482 1.7564 2.1175 -0.0480 -0.4100 -0.5916 195  GLU L OE1 
4788 O  OE2 . GLU C 195 ? 1.3713 1.9105 2.2992 -0.0310 -0.4092 -0.5274 195  GLU L OE2 
4789 N  N   . VAL C 196 ? 0.8174 1.2116 1.5847 -0.0607 -0.3501 -0.4468 196  VAL L N   
4790 C  CA  . VAL C 196 ? 0.8044 1.1501 1.5493 -0.0619 -0.3334 -0.4162 196  VAL L CA  
4791 C  C   . VAL C 196 ? 0.8670 1.2034 1.6394 -0.0766 -0.3115 -0.4293 196  VAL L C   
4792 O  O   . VAL C 196 ? 0.8729 1.2118 1.6599 -0.0981 -0.2891 -0.4570 196  VAL L O   
4793 C  CB  . VAL C 196 ? 0.8499 1.1572 1.5523 -0.0706 -0.3155 -0.3990 196  VAL L CB  
4794 C  CG1 . VAL C 196 ? 0.8330 1.0912 1.5136 -0.0730 -0.2966 -0.3710 196  VAL L CG1 
4795 C  CG2 . VAL C 196 ? 0.8570 1.1701 1.5297 -0.0558 -0.3375 -0.3828 196  VAL L CG2 
4796 N  N   . THR C 197 ? 0.8183 1.1407 1.5944 -0.0662 -0.3163 -0.4087 197  THR L N   
4797 C  CA  . THR C 197 ? 0.8036 1.1114 1.6011 -0.0790 -0.2962 -0.4152 197  THR L CA  
4798 C  C   . THR C 197 ? 0.8151 1.0700 1.5765 -0.0796 -0.2807 -0.3800 197  THR L C   
4799 O  O   . THR C 197 ? 0.7902 1.0333 1.5299 -0.0615 -0.2959 -0.3492 197  THR L O   
4800 C  CB  . THR C 197 ? 0.9606 1.3020 1.7996 -0.0679 -0.3142 -0.4266 197  THR L CB  
4801 O  OG1 . THR C 197 ? 1.0190 1.3394 1.8446 -0.0516 -0.3239 -0.3930 197  THR L OG1 
4802 C  CG2 . THR C 197 ? 0.9292 1.3244 1.7941 -0.0548 -0.3427 -0.4500 197  THR L CG2 
4803 N  N   . HIS C 198 ? 0.7611 0.9837 1.5139 -0.1005 -0.2505 -0.3857 198  HIS L N   
4804 C  CA  . HIS C 198 ? 0.7451 0.9171 1.4651 -0.1031 -0.2335 -0.3568 198  HIS L CA  
4805 C  C   . HIS C 198 ? 0.7736 0.9199 1.5006 -0.1262 -0.2039 -0.3720 198  HIS L C   
4806 O  O   . HIS C 198 ? 0.7863 0.9444 1.5305 -0.1441 -0.1901 -0.4046 198  HIS L O   
4807 C  CB  . HIS C 198 ? 0.7634 0.9108 1.4421 -0.1003 -0.2302 -0.3391 198  HIS L CB  
4808 C  CG  . HIS C 198 ? 0.8015 0.8998 1.4469 -0.1005 -0.2152 -0.3103 198  HIS L CG  
4809 N  ND1 . HIS C 198 ? 0.8074 0.8942 1.4386 -0.0841 -0.2269 -0.2791 198  HIS L ND1 
4810 C  CD2 . HIS C 198 ? 0.8335 0.8923 1.4583 -0.1153 -0.1894 -0.3106 198  HIS L CD2 
4811 C  CE1 . HIS C 198 ? 0.8011 0.8457 1.4058 -0.0890 -0.2090 -0.2623 198  HIS L CE1 
4812 N  NE2 . HIS C 198 ? 0.8234 0.8486 1.4219 -0.1065 -0.1872 -0.2792 198  HIS L NE2 
4813 N  N   . GLN C 199 ? 0.6968 0.8064 1.4078 -0.1263 -0.1935 -0.3485 199  GLN L N   
4814 C  CA  . GLN C 199 ? 0.6913 0.7663 1.3999 -0.1462 -0.1662 -0.3549 199  GLN L CA  
4815 C  C   . GLN C 199 ? 0.7879 0.8369 1.4785 -0.1671 -0.1405 -0.3735 199  GLN L C   
4816 O  O   . GLN C 199 ? 0.8011 0.8438 1.5064 -0.1883 -0.1203 -0.3993 199  GLN L O   
4817 C  CB  . GLN C 199 ? 0.6918 0.7290 1.3740 -0.1379 -0.1635 -0.3192 199  GLN L CB  
4818 C  CG  . GLN C 199 ? 0.8084 0.8096 1.4870 -0.1556 -0.1393 -0.3213 199  GLN L CG  
4819 C  CD  . GLN C 199 ? 1.0440 1.0496 1.7382 -0.1478 -0.1473 -0.3058 199  GLN L CD  
4820 O  OE1 . GLN C 199 ? 0.9391 0.9699 1.6701 -0.1537 -0.1488 -0.3248 199  GLN L OE1 
4821 N  NE2 . GLN C 199 ? 1.0151 0.9978 1.6829 -0.1344 -0.1524 -0.2720 199  GLN L NE2 
4822 N  N   . GLY C 200 ? 0.7595 0.7937 1.4188 -0.1616 -0.1409 -0.3617 200  GLY L N   
4823 C  CA  . GLY C 200 ? 0.7779 0.7843 1.4150 -0.1785 -0.1177 -0.3758 200  GLY L CA  
4824 C  C   . GLY C 200 ? 0.8137 0.8536 1.4737 -0.1921 -0.1137 -0.4138 200  GLY L C   
4825 O  O   . GLY C 200 ? 0.8302 0.8465 1.4731 -0.2088 -0.0917 -0.4289 200  GLY L O   
4826 N  N   . LEU C 201 ? 0.7519 0.8464 1.4492 -0.1845 -0.1352 -0.4295 201  LEU L N   
4827 C  CA  . LEU C 201 ? 0.7614 0.8969 1.4858 -0.1953 -0.1353 -0.4675 201  LEU L CA  
4828 C  C   . LEU C 201 ? 0.8440 1.0001 1.6083 -0.2110 -0.1260 -0.4993 201  LEU L C   
4829 O  O   . LEU C 201 ? 0.8191 0.9929 1.6077 -0.2008 -0.1404 -0.4930 201  LEU L O   
4830 C  CB  . LEU C 201 ? 0.7458 0.9307 1.4843 -0.1747 -0.1682 -0.4657 201  LEU L CB  
4831 C  CG  . LEU C 201 ? 0.8012 0.9742 1.5040 -0.1599 -0.1798 -0.4389 201  LEU L CG  
4832 C  CD1 . LEU C 201 ? 0.7978 1.0156 1.5136 -0.1387 -0.2138 -0.4345 201  LEU L CD1 
4833 C  CD2 . LEU C 201 ? 0.8368 0.9954 1.5197 -0.1754 -0.1605 -0.4536 201  LEU L CD2 
4834 N  N   . SER C 202 ? 0.8411 0.9948 1.6121 -0.2368 -0.1007 -0.5349 202  SER L N   
4835 C  CA  . SER C 202 ? 0.8543 1.0272 1.6631 -0.2574 -0.0862 -0.5727 202  SER L CA  
4836 C  C   . SER C 202 ? 0.9201 1.1626 1.7796 -0.2452 -0.1139 -0.5941 202  SER L C   
4837 O  O   . SER C 202 ? 0.9106 1.1734 1.8060 -0.2491 -0.1150 -0.6102 202  SER L O   
4838 C  CB  . SER C 202 ? 0.9211 1.0794 1.7227 -0.2868 -0.0544 -0.6073 202  SER L CB  
4839 O  OG  . SER C 202 ? 1.0461 1.1371 1.7983 -0.2975 -0.0287 -0.5892 202  SER L OG  
4840 N  N   . SER C 203 ? 0.8835 1.1612 1.7449 -0.2300 -0.1366 -0.5941 203  SER L N   
4841 C  CA  . SER C 203 ? 0.8657 1.2082 1.7688 -0.2140 -0.1675 -0.6112 203  SER L CA  
4842 C  C   . SER C 203 ? 0.9109 1.2617 1.7908 -0.1869 -0.1973 -0.5801 203  SER L C   
4843 O  O   . SER C 203 ? 0.9237 1.2434 1.7637 -0.1884 -0.1889 -0.5625 203  SER L O   
4844 C  CB  . SER C 203 ? 0.9095 1.2947 1.8435 -0.2320 -0.1594 -0.6607 203  SER L CB  
4845 O  OG  . SER C 203 ? 1.0088 1.3835 1.9140 -0.2401 -0.1493 -0.6638 203  SER L OG  
4846 N  N   . PRO C 204 ? 0.8356 1.2268 1.7381 -0.1624 -0.2317 -0.5744 204  PRO L N   
4847 C  CA  . PRO C 204 ? 0.8270 1.2237 1.7032 -0.1385 -0.2591 -0.5469 204  PRO L CA  
4848 C  C   . PRO C 204 ? 0.8851 1.2944 1.7470 -0.1465 -0.2562 -0.5623 204  PRO L C   
4849 O  O   . PRO C 204 ? 0.8870 1.3287 1.7765 -0.1623 -0.2477 -0.6023 204  PRO L O   
4850 C  CB  . PRO C 204 ? 0.8330 1.2770 1.7429 -0.1157 -0.2937 -0.5517 204  PRO L CB  
4851 C  CG  . PRO C 204 ? 0.8750 1.3193 1.8180 -0.1228 -0.2835 -0.5627 204  PRO L CG  
4852 C  CD  . PRO C 204 ? 0.8326 1.2637 1.7831 -0.1550 -0.2472 -0.5929 204  PRO L CD  
4853 N  N   . VAL C 205 ? 0.8390 1.2208 1.6576 -0.1378 -0.2601 -0.5321 205  VAL L N   
4854 C  CA  . VAL C 205 ? 0.8514 1.2396 1.6517 -0.1454 -0.2561 -0.5426 205  VAL L CA  
4855 C  C   . VAL C 205 ? 0.8976 1.3220 1.6949 -0.1242 -0.2910 -0.5370 205  VAL L C   
4856 O  O   . VAL C 205 ? 0.8771 1.2937 1.6590 -0.1023 -0.3131 -0.5062 205  VAL L O   
4857 C  CB  . VAL C 205 ? 0.9136 1.2463 1.6689 -0.1554 -0.2313 -0.5206 205  VAL L CB  
4858 C  CG1 . VAL C 205 ? 0.9226 1.2232 1.6793 -0.1813 -0.1942 -0.5375 205  VAL L CG1 
4859 C  CG2 . VAL C 205 ? 0.9021 1.1991 1.6246 -0.1368 -0.2413 -0.4754 205  VAL L CG2 
4860 N  N   . THR C 206 ? 0.8718 1.3351 1.6827 -0.1315 -0.2954 -0.5678 206  THR L N   
4861 C  CA  . THR C 206 ? 0.8763 1.3758 1.6833 -0.1135 -0.3283 -0.5671 206  THR L CA  
4862 C  C   . THR C 206 ? 0.9439 1.4349 1.7190 -0.1224 -0.3207 -0.5663 206  THR L C   
4863 O  O   . THR C 206 ? 0.9426 1.4349 1.7228 -0.1453 -0.2955 -0.5923 206  THR L O   
4864 C  CB  . THR C 206 ? 0.9688 1.5309 1.8235 -0.1085 -0.3490 -0.6040 206  THR L CB  
4865 O  OG1 . THR C 206 ? 0.9799 1.5758 1.8268 -0.0999 -0.3723 -0.6126 206  THR L OG1 
4866 C  CG2 . THR C 206 ? 0.9492 1.5301 1.8417 -0.1345 -0.3222 -0.6472 206  THR L CG2 
4867 N  N   . LYS C 207 ? 0.9126 1.3923 1.6532 -0.1051 -0.3410 -0.5363 207  LYS L N   
4868 C  CA  . LYS C 207 ? 0.9264 1.4006 1.6352 -0.1102 -0.3393 -0.5326 207  LYS L CA  
4869 C  C   . LYS C 207 ? 0.9835 1.4989 1.6932 -0.0916 -0.3768 -0.5359 207  LYS L C   
4870 O  O   . LYS C 207 ? 0.9838 1.5018 1.6906 -0.0691 -0.4035 -0.5163 207  LYS L O   
4871 C  CB  . LYS C 207 ? 0.9581 1.3775 1.6212 -0.1076 -0.3282 -0.4939 207  LYS L CB  
4872 C  CG  . LYS C 207 ? 1.1467 1.5208 1.8036 -0.1236 -0.2928 -0.4880 207  LYS L CG  
4873 C  CD  . LYS C 207 ? 1.3110 1.6814 1.9709 -0.1493 -0.2625 -0.5160 207  LYS L CD  
4874 C  CE  . LYS C 207 ? 1.4728 1.7968 2.1268 -0.1628 -0.2303 -0.5108 207  LYS L CE  
4875 N  NZ  . LYS C 207 ? 1.6127 1.9320 2.2714 -0.1887 -0.1998 -0.5417 207  LYS L NZ  
4876 N  N   . SER C 208 ? 0.9363 1.4846 1.6509 -0.1013 -0.3790 -0.5629 208  SER L N   
4877 C  CA  . SER C 208 ? 0.9355 1.5251 1.6505 -0.0850 -0.4149 -0.5701 208  SER L CA  
4878 C  C   . SER C 208 ? 0.9706 1.5696 1.6623 -0.0957 -0.4130 -0.5794 208  SER L C   
4879 O  O   . SER C 208 ? 0.9770 1.5571 1.6603 -0.1179 -0.3819 -0.5872 208  SER L O   
4880 C  CB  . SER C 208 ? 0.9751 1.6201 1.7414 -0.0818 -0.4292 -0.6070 208  SER L CB  
4881 O  OG  . SER C 208 ? 1.0862 1.7563 1.8789 -0.1070 -0.4053 -0.6470 208  SER L OG  
4882 N  N   . PHE C 209 ? 0.9019 1.5291 1.5822 -0.0799 -0.4466 -0.5790 209  PHE L N   
4883 C  CA  . PHE C 209 ? 0.8958 1.5399 1.5561 -0.0885 -0.4504 -0.5906 209  PHE L CA  
4884 C  C   . PHE C 209 ? 0.9119 1.6089 1.5860 -0.0719 -0.4892 -0.6092 209  PHE L C   
4885 O  O   . PHE C 209 ? 0.8904 1.6002 1.5782 -0.0493 -0.5161 -0.6030 209  PHE L O   
4886 C  CB  . PHE C 209 ? 0.9260 1.5239 1.5315 -0.0872 -0.4474 -0.5547 209  PHE L CB  
4887 C  CG  . PHE C 209 ? 0.9510 1.5339 1.5248 -0.0613 -0.4798 -0.5220 209  PHE L CG  
4888 C  CD1 . PHE C 209 ? 1.0142 1.6210 1.5682 -0.0493 -0.5119 -0.5240 209  PHE L CD1 
4889 C  CD2 . PHE C 209 ? 0.9534 1.4961 1.5142 -0.0496 -0.4777 -0.4894 209  PHE L CD2 
4890 C  CE1 . PHE C 209 ? 1.0378 1.6259 1.5583 -0.0257 -0.5410 -0.4941 209  PHE L CE1 
4891 C  CE2 . PHE C 209 ? 0.9998 1.5260 1.5289 -0.0271 -0.5055 -0.4602 209  PHE L CE2 
4892 C  CZ  . PHE C 209 ? 1.0056 1.5533 1.5140 -0.0152 -0.5369 -0.4627 209  PHE L CZ  
4893 N  N   . ASN C 210 ? 0.8736 1.6007 1.5435 -0.0826 -0.4923 -0.6321 210  ASN L N   
4894 C  CA  . ASN C 210 ? 0.8882 1.6651 1.5647 -0.0676 -0.5299 -0.6499 210  ASN L CA  
4895 C  C   . ASN C 210 ? 0.9432 1.6964 1.5634 -0.0612 -0.5454 -0.6231 210  ASN L C   
4896 O  O   . ASN C 210 ? 0.9416 1.6724 1.5368 -0.0810 -0.5213 -0.6192 210  ASN L O   
4897 C  CB  . ASN C 210 ? 0.8918 1.7244 1.6063 -0.0864 -0.5212 -0.6995 210  ASN L CB  
4898 C  CG  . ASN C 210 ? 1.0515 1.9144 1.8234 -0.0936 -0.5081 -0.7322 210  ASN L CG  
4899 O  OD1 . ASN C 210 ? 0.9362 1.7901 1.7268 -0.0798 -0.5139 -0.7218 210  ASN L OD1 
4900 N  ND2 . ASN C 210 ? 0.9298 1.8299 1.7307 -0.1166 -0.4891 -0.7741 210  ASN L ND2 
4901 N  N   . ARG C 211 ? 0.8977 1.6513 1.4958 -0.0339 -0.5843 -0.6038 211  ARG L N   
4902 C  CA  . ARG C 211 ? 0.9159 1.6460 1.4570 -0.0261 -0.6030 -0.5786 211  ARG L CA  
4903 C  C   . ARG C 211 ? 0.9815 1.7436 1.5158 -0.0431 -0.6020 -0.6051 211  ARG L C   
4904 O  O   . ARG C 211 ? 0.9818 1.7993 1.5503 -0.0429 -0.6158 -0.6407 211  ARG L O   
4905 C  CB  . ARG C 211 ? 0.9235 1.6564 1.4480 0.0067  -0.6472 -0.5619 211  ARG L CB  
4906 C  CG  . ARG C 211 ? 1.0708 1.7839 1.5347 0.0157  -0.6714 -0.5408 211  ARG L CG  
4907 C  CD  . ARG C 211 ? 1.1911 1.9171 1.6430 0.0481  -0.7181 -0.5342 211  ARG L CD  
4908 N  NE  . ARG C 211 ? 1.3582 2.1498 1.8523 0.0556  -0.7415 -0.5734 211  ARG L NE  
4909 C  CZ  . ARG C 211 ? 1.5824 2.4044 2.0594 0.0602  -0.7683 -0.5889 211  ARG L CZ  
4910 N  NH1 . ARG C 211 ? 1.5124 2.3027 1.9281 0.0577  -0.7754 -0.5676 211  ARG L NH1 
4911 N  NH2 . ARG C 211 ? 1.3763 2.2614 1.8972 0.0674  -0.7886 -0.6269 211  ARG L NH2 
4912 N  N   . GLY C 212 ? 0.9440 1.6722 1.4381 -0.0594 -0.5831 -0.5896 212  GLY L N   
4913 C  CA  . GLY C 212 ? 1.2986 2.0491 1.7817 -0.0788 -0.5767 -0.6112 212  GLY L CA  
4914 C  C   . GLY C 212 ? 1.2574 2.0297 1.7790 -0.1070 -0.5398 -0.6448 212  GLY L C   
4915 O  O   . GLY C 212 ? 0.5415 1.2782 1.0633 -0.1234 -0.5035 -0.6362 212  GLY L O   
4916 CA CA  . CA  D .   ? 0.6457 0.3423 1.3402 0.1516  -0.0571 -0.1425 5001 CA  A CA  
4917 CA CA  . CA  E .   ? 0.7029 0.4322 0.9577 0.0460  -0.1990 0.2324  5002 CA  A CA  
4918 CA CA  . CA  F .   ? 0.4906 0.2179 0.8200 -0.0196 -0.2337 0.0498  5003 CA  A CA  
4919 C  C1  . NAG G .   ? 1.4354 0.9916 1.8452 0.0553  -0.1496 0.1869  5004 NAG A C1  
4920 C  C2  . NAG G .   ? 1.4406 0.9720 1.8783 0.0643  -0.1519 0.1969  5004 NAG A C2  
4921 C  C3  . NAG G .   ? 1.4509 0.9605 1.9012 0.0566  -0.1435 0.1840  5004 NAG A C3  
4922 C  C4  . NAG G .   ? 1.4769 0.9837 1.9073 0.0417  -0.1389 0.1922  5004 NAG A C4  
4923 C  C5  . NAG G .   ? 1.4512 0.9854 1.8535 0.0351  -0.1383 0.1851  5004 NAG A C5  
4924 C  C6  . NAG G .   ? 1.4765 1.0124 1.8599 0.0219  -0.1340 0.1936  5004 NAG A C6  
4925 C  C7  . NAG G .   ? 1.4294 0.9635 1.9038 0.0908  -0.1646 0.2053  5004 NAG A C7  
4926 C  C8  . NAG G .   ? 1.4322 0.9724 1.9353 0.1052  -0.1665 0.1911  5004 NAG A C8  
4927 N  N2  . NAG G .   ? 1.4191 0.9556 1.8793 0.0785  -0.1559 0.1886  5004 NAG A N2  
4928 O  O3  . NAG G .   ? 1.4625 0.9451 1.9419 0.0638  -0.1446 0.1903  5004 NAG A O3  
4929 O  O4  . NAG G .   ? 1.4837 0.9724 1.9281 0.0340  -0.1319 0.1790  5004 NAG A O4  
4930 O  O5  . NAG G .   ? 1.4222 0.9751 1.8132 0.0426  -0.1456 0.1949  5004 NAG A O5  
4931 O  O6  . NAG G .   ? 1.4931 1.0126 1.8882 0.0130  -0.1271 0.1851  5004 NAG A O6  
4932 O  O7  . NAG G .   ? 1.4403 0.9691 1.9048 0.0905  -0.1708 0.2305  5004 NAG A O7  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1378 ?    ?   ?   A . n 
A 1 2   PRO 2   1379 ?    ?   ?   A . n 
A 1 3   GLU 3   1380 ?    ?   ?   A . n 
A 1 4   VAL 4   1381 ?    ?   ?   A . n 
A 1 5   SER 5   1382 ?    ?   ?   A . n 
A 1 6   GLU 6   1383 ?    ?   ?   A . n 
A 1 7   GLU 7   1384 ?    ?   ?   A . n 
A 1 8   PRO 8   1385 ?    ?   ?   A . n 
A 1 9   ARG 9   1386 ?    ?   ?   A . n 
A 1 10  CYS 10  1387 ?    ?   ?   A . n 
A 1 11  PRO 11  1388 ?    ?   ?   A . n 
A 1 12  ARG 12  1389 ?    ?   ?   A . n 
A 1 13  ALA 13  1390 ?    ?   ?   A . n 
A 1 14  ALA 14  1391 1391 ALA ALA A . n 
A 1 15  CYS 15  1392 1392 CYS CYS A . n 
A 1 16  GLN 16  1393 1393 GLN GLN A . n 
A 1 17  ALA 17  1394 1394 ALA ALA A . n 
A 1 18  LYS 18  1395 1395 LYS LYS A . n 
A 1 19  ARG 19  1396 1396 ARG ARG A . n 
A 1 20  GLY 20  1397 1397 GLY GLY A . n 
A 1 21  ASP 21  1398 1398 ASP ASP A . n 
A 1 22  GLN 22  1399 1399 GLN GLN A . n 
A 1 23  ARG 23  1400 1400 ARG ARG A . n 
A 1 24  CYS 24  1401 1401 CYS CYS A . n 
A 1 25  ASP 25  1402 1402 ASP ASP A . n 
A 1 26  ARG 26  1403 1403 ARG ARG A . n 
A 1 27  GLU 27  1404 1404 GLU GLU A . n 
A 1 28  CYS 28  1405 1405 CYS CYS A . n 
A 1 29  ASN 29  1406 1406 ASN ASN A . n 
A 1 30  SER 30  1407 1407 SER SER A . n 
A 1 31  PRO 31  1408 1408 PRO PRO A . n 
A 1 32  GLY 32  1409 1409 GLY GLY A . n 
A 1 33  CYS 33  1410 1410 CYS CYS A . n 
A 1 34  GLY 34  1411 1411 GLY GLY A . n 
A 1 35  TRP 35  1412 1412 TRP TRP A . n 
A 1 36  ASP 36  1413 1413 ASP ASP A . n 
A 1 37  GLY 37  1414 1414 GLY GLY A . n 
A 1 38  GLY 38  1415 1415 GLY GLY A . n 
A 1 39  ASP 39  1416 1416 ASP ASP A . n 
A 1 40  CYS 40  1417 1417 CYS CYS A . n 
A 1 41  SER 41  1418 1418 SER SER A . n 
A 1 42  LEU 42  1419 1419 LEU LEU A . n 
A 1 43  SER 43  1420 1420 SER SER A . n 
A 1 44  VAL 44  1421 1421 VAL VAL A . n 
A 1 45  GLY 45  1422 1422 GLY GLY A . n 
A 1 46  ASP 46  1423 1423 ASP ASP A . n 
A 1 47  PRO 47  1424 1424 PRO PRO A . n 
A 1 48  TRP 48  1425 1425 TRP TRP A . n 
A 1 49  ARG 49  1426 1426 ARG ARG A . n 
A 1 50  GLN 50  1427 1427 GLN GLN A . n 
A 1 51  CYS 51  1428 1428 CYS CYS A . n 
A 1 52  GLU 52  1429 1429 GLU GLU A . n 
A 1 53  ALA 53  1430 1430 ALA ALA A . n 
A 1 54  LEU 54  1431 1431 LEU LEU A . n 
A 1 55  GLN 55  1432 1432 GLN GLN A . n 
A 1 56  CYS 56  1433 1433 CYS CYS A . n 
A 1 57  TRP 57  1434 1434 TRP TRP A . n 
A 1 58  ARG 58  1435 1435 ARG ARG A . n 
A 1 59  LEU 59  1436 1436 LEU LEU A . n 
A 1 60  PHE 60  1437 1437 PHE PHE A . n 
A 1 61  ASN 61  1438 1438 ASN ASN A . n 
A 1 62  ASN 62  1439 1439 ASN ASN A . n 
A 1 63  SER 63  1440 1440 SER SER A . n 
A 1 64  ARG 64  1441 1441 ARG ARG A . n 
A 1 65  CYS 65  1442 1442 CYS CYS A . n 
A 1 66  ASP 66  1443 1443 ASP ASP A . n 
A 1 67  PRO 67  1444 1444 PRO PRO A . n 
A 1 68  ALA 68  1445 1445 ALA ALA A . n 
A 1 69  CYS 69  1446 1446 CYS CYS A . n 
A 1 70  SER 70  1447 1447 SER SER A . n 
A 1 71  SER 71  1448 1448 SER SER A . n 
A 1 72  PRO 72  1449 1449 PRO PRO A . n 
A 1 73  ALA 73  1450 1450 ALA ALA A . n 
A 1 74  CYS 74  1451 1451 CYS CYS A . n 
A 1 75  LEU 75  1452 1452 LEU LEU A . n 
A 1 76  TYR 76  1453 1453 TYR TYR A . n 
A 1 77  ASP 77  1454 1454 ASP ASP A . n 
A 1 78  ASN 78  1455 1455 ASN ASN A . n 
A 1 79  PHE 79  1456 1456 PHE PHE A . n 
A 1 80  ASP 80  1457 1457 ASP ASP A . n 
A 1 81  CYS 81  1458 1458 CYS CYS A . n 
A 1 82  HIS 82  1459 1459 HIS HIS A . n 
A 1 83  ALA 83  1460 1460 ALA ALA A . n 
A 1 84  GLY 84  1461 1461 GLY GLY A . n 
A 1 85  GLY 85  1462 1462 GLY GLY A . n 
A 1 86  ARG 86  1463 1463 ARG ARG A . n 
A 1 87  GLU 87  1464 1464 GLU GLU A . n 
A 1 88  ARG 88  1465 1465 ARG ARG A . n 
A 1 89  THR 89  1466 1466 THR THR A . n 
A 1 90  CYS 90  1467 1467 CYS CYS A . n 
A 1 91  ASN 91  1468 1468 ASN ASN A . n 
A 1 92  PRO 92  1469 1469 PRO PRO A . n 
A 1 93  VAL 93  1470 1470 VAL VAL A . n 
A 1 94  TYR 94  1471 1471 TYR TYR A . n 
A 1 95  GLU 95  1472 1472 GLU GLU A . n 
A 1 96  LYS 96  1473 1473 LYS LYS A . n 
A 1 97  TYR 97  1474 1474 TYR TYR A . n 
A 1 98  CYS 98  1475 1475 CYS CYS A . n 
A 1 99  ALA 99  1476 1476 ALA ALA A . n 
A 1 100 ASP 100 1477 1477 ASP ASP A . n 
A 1 101 HIS 101 1478 1478 HIS HIS A . n 
A 1 102 PHE 102 1479 1479 PHE PHE A . n 
A 1 103 ALA 103 1480 1480 ALA ALA A . n 
A 1 104 ASP 104 1481 1481 ASP ASP A . n 
A 1 105 GLY 105 1482 1482 GLY GLY A . n 
A 1 106 ARG 106 1483 1483 ARG ARG A . n 
A 1 107 CYS 107 1484 1484 CYS CYS A . n 
A 1 108 ASP 108 1485 1485 ASP ASP A . n 
A 1 109 GLN 109 1486 1486 GLN GLN A . n 
A 1 110 GLY 110 1487 1487 GLY GLY A . n 
A 1 111 CYS 111 1488 1488 CYS CYS A . n 
A 1 112 ASN 112 1489 1489 ASN ASN A . n 
A 1 113 THR 113 1490 1490 THR THR A . n 
A 1 114 GLU 114 1491 1491 GLU GLU A . n 
A 1 115 GLU 115 1492 1492 GLU GLU A . n 
A 1 116 CYS 116 1493 1493 CYS CYS A . n 
A 1 117 GLY 117 1494 1494 GLY GLY A . n 
A 1 118 TRP 118 1495 1495 TRP TRP A . n 
A 1 119 ASP 119 1496 1496 ASP ASP A . n 
A 1 120 GLY 120 1497 1497 GLY GLY A . n 
A 1 121 LEU 121 1498 1498 LEU LEU A . n 
A 1 122 ASP 122 1499 1499 ASP ASP A . n 
A 1 123 CYS 123 1500 1500 CYS CYS A . n 
A 1 124 ALA 124 1501 1501 ALA ALA A . n 
A 1 125 SER 125 1502 1502 SER SER A . n 
A 1 126 GLU 126 1503 1503 GLU GLU A . n 
A 1 127 VAL 127 1504 1504 VAL VAL A . n 
A 1 128 PRO 128 1505 1505 PRO PRO A . n 
A 1 129 ALA 129 1506 1506 ALA ALA A . n 
A 1 130 LEU 130 1507 1507 LEU LEU A . n 
A 1 131 LEU 131 1508 1508 LEU LEU A . n 
A 1 132 ALA 132 1509 1509 ALA ALA A . n 
A 1 133 ARG 133 1510 1510 ARG ARG A . n 
A 1 134 GLY 134 1511 1511 GLY GLY A . n 
A 1 135 VAL 135 1512 1512 VAL VAL A . n 
A 1 136 LEU 136 1513 1513 LEU LEU A . n 
A 1 137 VAL 137 1514 1514 VAL VAL A . n 
A 1 138 LEU 138 1515 1515 LEU LEU A . n 
A 1 139 THR 139 1516 1516 THR THR A . n 
A 1 140 VAL 140 1517 1517 VAL VAL A . n 
A 1 141 LEU 141 1518 1518 LEU LEU A . n 
A 1 142 LEU 142 1519 1519 LEU LEU A . n 
A 1 143 PRO 143 1520 1520 PRO PRO A . n 
A 1 144 PRO 144 1521 1521 PRO PRO A . n 
A 1 145 GLU 145 1522 1522 GLU GLU A . n 
A 1 146 GLU 146 1523 1523 GLU GLU A . n 
A 1 147 LEU 147 1524 1524 LEU LEU A . n 
A 1 148 LEU 148 1525 1525 LEU LEU A . n 
A 1 149 ARG 149 1526 1526 ARG ARG A . n 
A 1 150 SER 150 1527 1527 SER SER A . n 
A 1 151 SER 151 1528 1528 SER SER A . n 
A 1 152 ALA 152 1529 1529 ALA ALA A . n 
A 1 153 ASP 153 1530 1530 ASP ASP A . n 
A 1 154 PHE 154 1531 1531 PHE PHE A . n 
A 1 155 LEU 155 1532 1532 LEU LEU A . n 
A 1 156 GLN 156 1533 1533 GLN GLN A . n 
A 1 157 ARG 157 1534 1534 ARG ARG A . n 
A 1 158 LEU 158 1535 1535 LEU LEU A . n 
A 1 159 SER 159 1536 1536 SER SER A . n 
A 1 160 ALA 160 1537 1537 ALA ALA A . n 
A 1 161 ILE 161 1538 1538 ILE ILE A . n 
A 1 162 LEU 162 1539 1539 LEU LEU A . n 
A 1 163 ARG 163 1540 1540 ARG ARG A . n 
A 1 164 THR 164 1541 1541 THR THR A . n 
A 1 165 SER 165 1542 1542 SER SER A . n 
A 1 166 LEU 166 1543 1543 LEU LEU A . n 
A 1 167 ARG 167 1544 1544 ARG ARG A . n 
A 1 168 PHE 168 1545 1545 PHE PHE A . n 
A 1 169 ARG 169 1546 1546 ARG ARG A . n 
A 1 170 LEU 170 1547 1547 LEU LEU A . n 
A 1 171 ASP 171 1548 1548 ASP ASP A . n 
A 1 172 ALA 172 1549 1549 ALA ALA A . n 
A 1 173 HIS 173 1550 1550 HIS HIS A . n 
A 1 174 GLY 174 1551 1551 GLY GLY A . n 
A 1 175 GLN 175 1552 1552 GLN GLN A . n 
A 1 176 ALA 176 1553 1553 ALA ALA A . n 
A 1 177 MET 177 1554 1554 MET MET A . n 
A 1 178 VAL 178 1555 1555 VAL VAL A . n 
A 1 179 PHE 179 1556 1556 PHE PHE A . n 
A 1 180 PRO 180 1557 1557 PRO PRO A . n 
A 1 181 TYR 181 1558 1558 TYR TYR A . n 
A 1 182 HIS 182 1559 1559 HIS HIS A . n 
A 1 183 ARG 183 1560 ?    ?   ?   A . n 
A 1 184 PRO 184 1561 ?    ?   ?   A . n 
A 1 185 SER 185 1562 ?    ?   ?   A . n 
A 1 186 PRO 186 1563 ?    ?   ?   A . n 
A 1 187 GLY 187 1564 ?    ?   ?   A . n 
A 1 188 SER 188 1565 ?    ?   ?   A . n 
A 1 189 GLU 189 1566 ?    ?   ?   A . n 
A 1 190 PRO 190 1567 ?    ?   ?   A . n 
A 1 191 ARG 191 1568 ?    ?   ?   A . n 
A 1 192 ALA 192 1569 ?    ?   ?   A . n 
A 1 193 ARG 193 1570 ?    ?   ?   A . n 
A 1 194 ARG 194 1571 ?    ?   ?   A . n 
A 1 195 GLU 195 1572 ?    ?   ?   A . n 
A 1 196 LEU 196 1573 ?    ?   ?   A . n 
A 1 197 ALA 197 1574 ?    ?   ?   A . n 
A 1 198 PRO 198 1575 ?    ?   ?   A . n 
A 1 199 GLU 199 1576 ?    ?   ?   A . n 
A 1 200 VAL 200 1577 ?    ?   ?   A . n 
A 1 201 ILE 201 1578 1578 ILE ILE A . n 
A 1 202 GLY 202 1579 1579 GLY GLY A . n 
A 1 203 SER 203 1580 1580 SER SER A . n 
A 1 204 VAL 204 1581 1581 VAL VAL A . n 
A 1 205 VAL 205 1582 1582 VAL VAL A . n 
A 1 206 MET 206 1583 1583 MET MET A . n 
A 1 207 LEU 207 1584 1584 LEU LEU A . n 
A 1 208 GLU 208 1585 1585 GLU GLU A . n 
A 1 209 ILE 209 1586 1586 ILE ILE A . n 
A 1 210 ASP 210 1587 1587 ASP ASP A . n 
A 1 211 ASN 211 1588 1588 ASN ASN A . n 
A 1 212 ARG 212 1589 1589 ARG ARG A . n 
A 1 213 LEU 213 1590 1590 LEU LEU A . n 
A 1 214 CYS 214 1591 1591 CYS CYS A . n 
A 1 215 LEU 215 1592 1592 LEU LEU A . n 
A 1 216 GLN 216 1593 1593 GLN GLN A . n 
A 1 217 SER 217 1594 1594 SER SER A . n 
A 1 218 PRO 218 1595 1595 PRO PRO A . n 
A 1 219 GLU 219 1596 1596 GLU GLU A . n 
A 1 220 ASN 220 1597 1597 ASN ASN A . n 
A 1 221 ASP 221 1598 1598 ASP ASP A . n 
A 1 222 HIS 222 1599 1599 HIS HIS A . n 
A 1 223 CYS 223 1600 1600 CYS CYS A . n 
A 1 224 PHE 224 1601 1601 PHE PHE A . n 
A 1 225 PRO 225 1602 1602 PRO PRO A . n 
A 1 226 ASP 226 1603 1603 ASP ASP A . n 
A 1 227 ALA 227 1604 1604 ALA ALA A . n 
A 1 228 GLN 228 1605 1605 GLN GLN A . n 
A 1 229 SER 229 1606 1606 SER SER A . n 
A 1 230 ALA 230 1607 1607 ALA ALA A . n 
A 1 231 ALA 231 1608 1608 ALA ALA A . n 
A 1 232 ASP 232 1609 1609 ASP ASP A . n 
A 1 233 TYR 233 1610 1610 TYR TYR A . n 
A 1 234 LEU 234 1611 1611 LEU LEU A . n 
A 1 235 GLY 235 1612 1612 GLY GLY A . n 
A 1 236 ALA 236 1613 1613 ALA ALA A . n 
A 1 237 LEU 237 1614 1614 LEU LEU A . n 
A 1 238 SER 238 1615 1615 SER SER A . n 
A 1 239 ALA 239 1616 1616 ALA ALA A . n 
A 1 240 VAL 240 1617 1617 VAL VAL A . n 
A 1 241 GLU 241 1618 1618 GLU GLU A . n 
A 1 242 ARG 242 1619 1619 ARG ARG A . n 
A 1 243 LEU 243 1620 1620 LEU LEU A . n 
A 1 244 ASP 244 1621 1621 ASP ASP A . n 
A 1 245 PHE 245 1622 1622 PHE PHE A . n 
A 1 246 PRO 246 1623 1623 PRO PRO A . n 
A 1 247 TYR 247 1624 1624 TYR TYR A . n 
A 1 248 PRO 248 1625 1625 PRO PRO A . n 
A 1 249 LEU 249 1626 1626 LEU LEU A . n 
A 1 250 ARG 250 1627 1627 ARG ARG A . n 
A 1 251 ASP 251 1628 1628 ASP ASP A . n 
A 1 252 VAL 252 1629 1629 VAL VAL A . n 
A 1 253 ARG 253 1630 1630 ARG ARG A . n 
A 1 254 GLY 254 1631 1631 GLY GLY A . n 
A 1 255 GLU 255 1632 1632 GLU GLU A . n 
A 1 256 PRO 256 1633 1633 PRO PRO A . n 
A 1 257 LEU 257 1634 ?    ?   ?   A . n 
A 1 258 GLU 258 1635 ?    ?   ?   A . n 
A 1 259 PRO 259 1636 ?    ?   ?   A . n 
A 1 260 PRO 260 1637 ?    ?   ?   A . n 
A 1 261 GLU 261 1638 ?    ?   ?   A . n 
A 1 262 PRO 262 1639 ?    ?   ?   A . n 
A 1 263 SER 263 1640 ?    ?   ?   A . n 
A 1 264 GLY 264 1641 ?    ?   ?   A . n 
A 1 265 SER 265 1642 ?    ?   ?   A . n 
A 1 266 HIS 266 1643 ?    ?   ?   A . n 
A 1 267 HIS 267 1644 ?    ?   ?   A . n 
A 1 268 HIS 268 1645 ?    ?   ?   A . n 
A 1 269 HIS 269 1646 ?    ?   ?   A . n 
A 1 270 HIS 270 1647 ?    ?   ?   A . n 
A 1 271 HIS 271 1648 ?    ?   ?   A . n 
B 2 1   GLN 1   1    1    GLN GLN H . n 
B 2 2   VAL 2   2    2    VAL VAL H . n 
B 2 3   GLN 3   3    3    GLN GLN H . n 
B 2 4   LEU 4   4    4    LEU LEU H . n 
B 2 5   VAL 5   5    5    VAL VAL H . n 
B 2 6   GLN 6   6    6    GLN GLN H . n 
B 2 7   SER 7   7    7    SER SER H . n 
B 2 8   GLY 8   8    8    GLY GLY H . n 
B 2 9   ALA 9   9    9    ALA ALA H . n 
B 2 10  GLU 10  10   10   GLU GLU H . n 
B 2 11  VAL 11  11   11   VAL VAL H . n 
B 2 12  LYS 12  12   12   LYS LYS H . n 
B 2 13  LYS 13  13   13   LYS LYS H . n 
B 2 14  PRO 14  14   14   PRO PRO H . n 
B 2 15  GLY 15  15   15   GLY GLY H . n 
B 2 16  SER 16  16   16   SER SER H . n 
B 2 17  SER 17  17   17   SER SER H . n 
B 2 18  VAL 18  18   18   VAL VAL H . n 
B 2 19  LYS 19  19   19   LYS LYS H . n 
B 2 20  VAL 20  20   20   VAL VAL H . n 
B 2 21  SER 21  21   21   SER SER H . n 
B 2 22  CYS 22  22   22   CYS CYS H . n 
B 2 23  LYS 23  23   23   LYS LYS H . n 
B 2 24  ALA 24  24   24   ALA ALA H . n 
B 2 25  SER 25  25   25   SER SER H . n 
B 2 26  GLY 26  26   26   GLY GLY H . n 
B 2 27  GLY 27  27   27   GLY GLY H . n 
B 2 28  THR 28  28   28   THR THR H . n 
B 2 29  PHE 29  29   29   PHE PHE H . n 
B 2 30  SER 30  30   30   SER SER H . n 
B 2 31  SER 31  31   31   SER SER H . n 
B 2 32  TYR 32  32   32   TYR TYR H . n 
B 2 33  THR 33  33   33   THR THR H . n 
B 2 34  ILE 34  34   34   ILE ILE H . n 
B 2 35  SER 35  35   35   SER SER H . n 
B 2 36  TRP 36  36   36   TRP TRP H . n 
B 2 37  VAL 37  37   37   VAL VAL H . n 
B 2 38  ARG 38  38   38   ARG ARG H . n 
B 2 39  GLN 39  39   39   GLN GLN H . n 
B 2 40  ALA 40  40   40   ALA ALA H . n 
B 2 41  PRO 41  41   41   PRO PRO H . n 
B 2 42  GLY 42  42   42   GLY GLY H . n 
B 2 43  GLN 43  43   43   GLN GLN H . n 
B 2 44  GLY 44  44   44   GLY GLY H . n 
B 2 45  LEU 45  45   45   LEU LEU H . n 
B 2 46  GLU 46  46   46   GLU GLU H . n 
B 2 47  TRP 47  47   47   TRP TRP H . n 
B 2 48  MET 48  48   48   MET MET H . n 
B 2 49  GLY 49  49   49   GLY GLY H . n 
B 2 50  TRP 50  50   50   TRP TRP H . n 
B 2 51  ILE 51  51   51   ILE ILE H . n 
B 2 52  LYS 52  52   52   LYS LYS H . n 
B 2 53  PRO 53  53   53   PRO PRO H . n 
B 2 54  ARG 54  54   54   ARG ARG H . n 
B 2 55  TRP 55  55   55   TRP TRP H . n 
B 2 56  GLY 56  56   56   GLY GLY H . n 
B 2 57  ALA 57  57   57   ALA ALA H . n 
B 2 58  ALA 58  58   58   ALA ALA H . n 
B 2 59  HIS 59  59   59   HIS HIS H . n 
B 2 60  TYR 60  60   60   TYR TYR H . n 
B 2 61  ALA 61  61   61   ALA ALA H . n 
B 2 62  GLN 62  62   62   GLN GLN H . n 
B 2 63  LYS 63  63   63   LYS LYS H . n 
B 2 64  PHE 64  64   64   PHE PHE H . n 
B 2 65  GLN 65  65   65   GLN GLN H . n 
B 2 66  GLY 66  66   66   GLY GLY H . n 
B 2 67  ARG 67  67   67   ARG ARG H . n 
B 2 68  VAL 68  68   68   VAL VAL H . n 
B 2 69  THR 69  69   69   THR THR H . n 
B 2 70  ILE 70  70   70   ILE ILE H . n 
B 2 71  THR 71  71   71   THR THR H . n 
B 2 72  ALA 72  72   72   ALA ALA H . n 
B 2 73  ASP 73  73   73   ASP ASP H . n 
B 2 74  GLU 74  74   74   GLU GLU H . n 
B 2 75  SER 75  75   75   SER SER H . n 
B 2 76  THR 76  76   76   THR THR H . n 
B 2 77  SER 77  77   77   SER SER H . n 
B 2 78  THR 78  78   78   THR THR H . n 
B 2 79  ALA 79  79   79   ALA ALA H . n 
B 2 80  TYR 80  80   80   TYR TYR H . n 
B 2 81  MET 81  81   81   MET MET H . n 
B 2 82  GLU 82  82   82   GLU GLU H . n 
B 2 83  LEU 83  83   83   LEU LEU H . n 
B 2 84  SER 84  84   84   SER SER H . n 
B 2 85  SER 85  85   85   SER SER H . n 
B 2 86  LEU 86  86   86   LEU LEU H . n 
B 2 87  ARG 87  87   87   ARG ARG H . n 
B 2 88  SER 88  88   88   SER SER H . n 
B 2 89  GLU 89  89   89   GLU GLU H . n 
B 2 90  ASP 90  90   90   ASP ASP H . n 
B 2 91  THR 91  91   91   THR THR H . n 
B 2 92  ALA 92  92   92   ALA ALA H . n 
B 2 93  VAL 93  93   93   VAL VAL H . n 
B 2 94  TYR 94  94   94   TYR TYR H . n 
B 2 95  TYR 95  95   95   TYR TYR H . n 
B 2 96  CYS 96  96   96   CYS CYS H . n 
B 2 97  ALA 97  97   97   ALA ALA H . n 
B 2 98  ARG 98  98   98   ARG ARG H . n 
B 2 99  GLY 99  99   99   GLY GLY H . n 
B 2 100 SER 100 100  100  SER SER H . n 
B 2 101 PHE 101 101  101  PHE PHE H . n 
B 2 102 TRP 102 102  102  TRP TRP H . n 
B 2 103 PHE 103 103  103  PHE PHE H . n 
B 2 104 GLY 104 104  104  GLY GLY H . n 
B 2 105 TYR 105 105  105  TYR TYR H . n 
B 2 106 TRP 106 106  106  TRP TRP H . n 
B 2 107 GLY 107 107  107  GLY GLY H . n 
B 2 108 GLN 108 108  108  GLN GLN H . n 
B 2 109 GLY 109 109  109  GLY GLY H . n 
B 2 110 THR 110 110  110  THR THR H . n 
B 2 111 LEU 111 111  111  LEU LEU H . n 
B 2 112 VAL 112 112  112  VAL VAL H . n 
B 2 113 THR 113 113  113  THR THR H . n 
B 2 114 VAL 114 114  114  VAL VAL H . n 
B 2 115 SER 115 115  115  SER SER H . n 
B 2 116 SER 116 116  116  SER SER H . n 
B 2 117 ALA 117 117  117  ALA ALA H . n 
B 2 118 SER 118 118  118  SER SER H . n 
B 2 119 THR 119 119  119  THR THR H . n 
B 2 120 LYS 120 120  120  LYS LYS H . n 
B 2 121 GLY 121 121  121  GLY GLY H . n 
B 2 122 PRO 122 122  122  PRO PRO H . n 
B 2 123 SER 123 123  123  SER SER H . n 
B 2 124 VAL 124 124  124  VAL VAL H . n 
B 2 125 PHE 125 125  125  PHE PHE H . n 
B 2 126 PRO 126 126  126  PRO PRO H . n 
B 2 127 LEU 127 127  127  LEU LEU H . n 
B 2 128 ALA 128 128  128  ALA ALA H . n 
B 2 129 PRO 129 129  129  PRO PRO H . n 
B 2 130 SER 130 130  ?    ?   ?   H . n 
B 2 131 SER 131 131  ?    ?   ?   H . n 
B 2 132 LYS 132 132  ?    ?   ?   H . n 
B 2 133 SER 133 133  ?    ?   ?   H . n 
B 2 134 THR 134 134  ?    ?   ?   H . n 
B 2 135 SER 135 135  ?    ?   ?   H . n 
B 2 136 GLY 136 136  ?    ?   ?   H . n 
B 2 137 GLY 137 137  ?    ?   ?   H . n 
B 2 138 THR 138 138  ?    ?   ?   H . n 
B 2 139 ALA 139 139  ?    ?   ?   H . n 
B 2 140 ALA 140 140  140  ALA ALA H . n 
B 2 141 LEU 141 141  141  LEU LEU H . n 
B 2 142 GLY 142 142  142  GLY GLY H . n 
B 2 143 CYS 143 143  143  CYS CYS H . n 
B 2 144 LEU 144 144  144  LEU LEU H . n 
B 2 145 VAL 145 145  145  VAL VAL H . n 
B 2 146 LYS 146 146  146  LYS LYS H . n 
B 2 147 ASP 147 147  147  ASP ASP H . n 
B 2 148 TYR 148 148  148  TYR TYR H . n 
B 2 149 PHE 149 149  149  PHE PHE H . n 
B 2 150 PRO 150 150  150  PRO PRO H . n 
B 2 151 GLU 151 151  151  GLU GLU H . n 
B 2 152 PRO 152 152  152  PRO PRO H . n 
B 2 153 VAL 153 153  153  VAL VAL H . n 
B 2 154 THR 154 154  154  THR THR H . n 
B 2 155 VAL 155 155  155  VAL VAL H . n 
B 2 156 SER 156 156  156  SER SER H . n 
B 2 157 TRP 157 157  157  TRP TRP H . n 
B 2 158 ASN 158 158  158  ASN ASN H . n 
B 2 159 SER 159 159  159  SER SER H . n 
B 2 160 GLY 160 160  160  GLY GLY H . n 
B 2 161 ALA 161 161  161  ALA ALA H . n 
B 2 162 LEU 162 162  162  LEU LEU H . n 
B 2 163 THR 163 163  163  THR THR H . n 
B 2 164 SER 164 164  164  SER SER H . n 
B 2 165 GLY 165 165  165  GLY GLY H . n 
B 2 166 VAL 166 166  166  VAL VAL H . n 
B 2 167 HIS 167 167  167  HIS HIS H . n 
B 2 168 THR 168 168  168  THR THR H . n 
B 2 169 PHE 169 169  169  PHE PHE H . n 
B 2 170 PRO 170 170  170  PRO PRO H . n 
B 2 171 ALA 171 171  171  ALA ALA H . n 
B 2 172 VAL 172 172  172  VAL VAL H . n 
B 2 173 LEU 173 173  173  LEU LEU H . n 
B 2 174 GLN 174 174  174  GLN GLN H . n 
B 2 175 SER 175 175  175  SER SER H . n 
B 2 176 SER 176 176  176  SER SER H . n 
B 2 177 GLY 177 177  177  GLY GLY H . n 
B 2 178 LEU 178 178  178  LEU LEU H . n 
B 2 179 TYR 179 179  179  TYR TYR H . n 
B 2 180 SER 180 180  180  SER SER H . n 
B 2 181 LEU 181 181  181  LEU LEU H . n 
B 2 182 SER 182 182  182  SER SER H . n 
B 2 183 SER 183 183  183  SER SER H . n 
B 2 184 VAL 184 184  184  VAL VAL H . n 
B 2 185 VAL 185 185  185  VAL VAL H . n 
B 2 186 THR 186 186  186  THR THR H . n 
B 2 187 VAL 187 187  187  VAL VAL H . n 
B 2 188 PRO 188 188  188  PRO PRO H . n 
B 2 189 SER 189 189  189  SER SER H . n 
B 2 190 SER 190 190  190  SER SER H . n 
B 2 191 SER 191 191  191  SER SER H . n 
B 2 192 LEU 192 192  192  LEU LEU H . n 
B 2 193 GLY 193 193  193  GLY GLY H . n 
B 2 194 THR 194 194  194  THR THR H . n 
B 2 195 GLN 195 195  195  GLN GLN H . n 
B 2 196 THR 196 196  196  THR THR H . n 
B 2 197 TYR 197 197  197  TYR TYR H . n 
B 2 198 ILE 198 198  198  ILE ILE H . n 
B 2 199 CYS 199 199  199  CYS CYS H . n 
B 2 200 ASN 200 200  200  ASN ASN H . n 
B 2 201 VAL 201 201  201  VAL VAL H . n 
B 2 202 ASN 202 202  202  ASN ASN H . n 
B 2 203 HIS 203 203  203  HIS HIS H . n 
B 2 204 LYS 204 204  204  LYS LYS H . n 
B 2 205 PRO 205 205  205  PRO PRO H . n 
B 2 206 SER 206 206  206  SER SER H . n 
B 2 207 ASN 207 207  207  ASN ASN H . n 
B 2 208 THR 208 208  208  THR THR H . n 
B 2 209 LYS 209 209  209  LYS LYS H . n 
B 2 210 VAL 210 210  210  VAL VAL H . n 
B 2 211 ASP 211 211  211  ASP ASP H . n 
B 2 212 LYS 212 212  212  LYS LYS H . n 
B 2 213 ARG 213 213  213  ARG ARG H . n 
B 2 214 VAL 214 214  214  VAL VAL H . n 
B 2 215 GLU 215 215  215  GLU GLU H . n 
B 2 216 PRO 216 216  216  PRO PRO H . n 
B 2 217 LYS 217 217  ?    ?   ?   H . n 
B 2 218 SER 218 218  ?    ?   ?   H . n 
B 2 219 CYS 219 219  ?    ?   ?   H . n 
B 2 220 ASP 220 220  ?    ?   ?   H . n 
B 2 221 LYS 221 221  ?    ?   ?   H . n 
B 2 222 THR 222 222  ?    ?   ?   H . n 
B 2 223 HIS 223 223  ?    ?   ?   H . n 
C 3 1   ASP 1   1    ?    ?   ?   L . n 
C 3 2   ILE 2   2    2    ILE ILE L . n 
C 3 3   GLN 3   3    3    GLN GLN L . n 
C 3 4   MET 4   4    4    MET MET L . n 
C 3 5   THR 5   5    5    THR THR L . n 
C 3 6   GLN 6   6    6    GLN GLN L . n 
C 3 7   SER 7   7    7    SER SER L . n 
C 3 8   PRO 8   8    8    PRO PRO L . n 
C 3 9   SER 9   9    9    SER SER L . n 
C 3 10  SER 10  10   10   SER SER L . n 
C 3 11  LEU 11  11   11   LEU LEU L . n 
C 3 12  SER 12  12   12   SER SER L . n 
C 3 13  ALA 13  13   13   ALA ALA L . n 
C 3 14  SER 14  14   14   SER SER L . n 
C 3 15  VAL 15  15   15   VAL VAL L . n 
C 3 16  GLY 16  16   16   GLY GLY L . n 
C 3 17  ASP 17  17   17   ASP ASP L . n 
C 3 18  ARG 18  18   18   ARG ARG L . n 
C 3 19  VAL 19  19   19   VAL VAL L . n 
C 3 20  THR 20  20   20   THR THR L . n 
C 3 21  ILE 21  21   21   ILE ILE L . n 
C 3 22  THR 22  22   22   THR THR L . n 
C 3 23  CYS 23  23   23   CYS CYS L . n 
C 3 24  ARG 24  24   24   ARG ARG L . n 
C 3 25  ALA 25  25   25   ALA ALA L . n 
C 3 26  SER 26  26   26   SER SER L . n 
C 3 27  GLN 27  27   27   GLN GLN L . n 
C 3 28  GLY 28  28   28   GLY GLY L . n 
C 3 29  ILE 29  29   29   ILE ILE L . n 
C 3 30  ASN 30  30   30   ASN ASN L . n 
C 3 31  ASN 31  31   31   ASN ASN L . n 
C 3 32  TYR 32  32   32   TYR TYR L . n 
C 3 33  LEU 33  33   33   LEU LEU L . n 
C 3 34  ASN 34  34   34   ASN ASN L . n 
C 3 35  TRP 35  35   35   TRP TRP L . n 
C 3 36  TYR 36  36   36   TYR TYR L . n 
C 3 37  GLN 37  37   37   GLN GLN L . n 
C 3 38  GLN 38  38   38   GLN GLN L . n 
C 3 39  LYS 39  39   39   LYS LYS L . n 
C 3 40  PRO 40  40   40   PRO PRO L . n 
C 3 41  GLY 41  41   41   GLY GLY L . n 
C 3 42  LYS 42  42   42   LYS LYS L . n 
C 3 43  ALA 43  43   43   ALA ALA L . n 
C 3 44  PRO 44  44   44   PRO PRO L . n 
C 3 45  LYS 45  45   45   LYS LYS L . n 
C 3 46  LEU 46  46   46   LEU LEU L . n 
C 3 47  LEU 47  47   47   LEU LEU L . n 
C 3 48  ILE 48  48   48   ILE ILE L . n 
C 3 49  TYR 49  49   49   TYR TYR L . n 
C 3 50  ASP 50  50   50   ASP ASP L . n 
C 3 51  ALA 51  51   51   ALA ALA L . n 
C 3 52  SER 52  52   52   SER SER L . n 
C 3 53  LYS 53  53   53   LYS LYS L . n 
C 3 54  LEU 54  54   54   LEU LEU L . n 
C 3 55  GLN 55  55   55   GLN GLN L . n 
C 3 56  SER 56  56   56   SER SER L . n 
C 3 57  GLY 57  57   57   GLY GLY L . n 
C 3 58  VAL 58  58   58   VAL VAL L . n 
C 3 59  PRO 59  59   59   PRO PRO L . n 
C 3 60  SER 60  60   60   SER SER L . n 
C 3 61  ARG 61  61   61   ARG ARG L . n 
C 3 62  PHE 62  62   62   PHE PHE L . n 
C 3 63  SER 63  63   63   SER SER L . n 
C 3 64  GLY 64  64   64   GLY GLY L . n 
C 3 65  SER 65  65   65   SER SER L . n 
C 3 66  GLY 66  66   66   GLY GLY L . n 
C 3 67  SER 67  67   67   SER SER L . n 
C 3 68  GLY 68  68   68   GLY GLY L . n 
C 3 69  THR 69  69   69   THR THR L . n 
C 3 70  ASP 70  70   70   ASP ASP L . n 
C 3 71  PHE 71  71   71   PHE PHE L . n 
C 3 72  THR 72  72   72   THR THR L . n 
C 3 73  LEU 73  73   73   LEU LEU L . n 
C 3 74  THR 74  74   74   THR THR L . n 
C 3 75  ILE 75  75   75   ILE ILE L . n 
C 3 76  SER 76  76   76   SER SER L . n 
C 3 77  SER 77  77   77   SER SER L . n 
C 3 78  LEU 78  78   78   LEU LEU L . n 
C 3 79  GLN 79  79   79   GLN GLN L . n 
C 3 80  PRO 80  80   80   PRO PRO L . n 
C 3 81  GLU 81  81   81   GLU GLU L . n 
C 3 82  ASP 82  82   82   ASP ASP L . n 
C 3 83  PHE 83  83   83   PHE PHE L . n 
C 3 84  ALA 84  84   84   ALA ALA L . n 
C 3 85  THR 85  85   85   THR THR L . n 
C 3 86  TYR 86  86   86   TYR TYR L . n 
C 3 87  TYR 87  87   87   TYR TYR L . n 
C 3 88  CYS 88  88   88   CYS CYS L . n 
C 3 89  GLN 89  89   89   GLN GLN L . n 
C 3 90  GLN 90  90   90   GLN GLN L . n 
C 3 91  TYR 91  91   91   TYR TYR L . n 
C 3 92  LEU 92  92   92   LEU LEU L . n 
C 3 93  GLN 93  93   93   GLN GLN L . n 
C 3 94  TYR 94  94   94   TYR TYR L . n 
C 3 95  PRO 95  95   95   PRO PRO L . n 
C 3 96  MET 96  96   96   MET MET L . n 
C 3 97  THR 97  97   97   THR THR L . n 
C 3 98  PHE 98  98   98   PHE PHE L . n 
C 3 99  GLY 99  99   99   GLY GLY L . n 
C 3 100 GLN 100 100  100  GLN GLN L . n 
C 3 101 GLY 101 101  101  GLY GLY L . n 
C 3 102 THR 102 102  102  THR THR L . n 
C 3 103 LYS 103 103  103  LYS LYS L . n 
C 3 104 VAL 104 104  104  VAL VAL L . n 
C 3 105 GLU 105 105  105  GLU GLU L . n 
C 3 106 ILE 106 106  106  ILE ILE L . n 
C 3 107 LYS 107 107  107  LYS LYS L . n 
C 3 108 ARG 108 108  108  ARG ARG L . n 
C 3 109 THR 109 109  109  THR THR L . n 
C 3 110 VAL 110 110  110  VAL VAL L . n 
C 3 111 ALA 111 111  111  ALA ALA L . n 
C 3 112 ALA 112 112  112  ALA ALA L . n 
C 3 113 PRO 113 113  113  PRO PRO L . n 
C 3 114 SER 114 114  114  SER SER L . n 
C 3 115 VAL 115 115  115  VAL VAL L . n 
C 3 116 PHE 116 116  116  PHE PHE L . n 
C 3 117 ILE 117 117  117  ILE ILE L . n 
C 3 118 PHE 118 118  118  PHE PHE L . n 
C 3 119 PRO 119 119  119  PRO PRO L . n 
C 3 120 PRO 120 120  120  PRO PRO L . n 
C 3 121 SER 121 121  121  SER SER L . n 
C 3 122 ASP 122 122  122  ASP ASP L . n 
C 3 123 GLU 123 123  123  GLU GLU L . n 
C 3 124 GLN 124 124  124  GLN GLN L . n 
C 3 125 LEU 125 125  125  LEU LEU L . n 
C 3 126 LYS 126 126  126  LYS LYS L . n 
C 3 127 SER 127 127  127  SER SER L . n 
C 3 128 GLY 128 128  128  GLY GLY L . n 
C 3 129 THR 129 129  129  THR THR L . n 
C 3 130 ALA 130 130  130  ALA ALA L . n 
C 3 131 SER 131 131  131  SER SER L . n 
C 3 132 VAL 132 132  132  VAL VAL L . n 
C 3 133 VAL 133 133  133  VAL VAL L . n 
C 3 134 CYS 134 134  134  CYS CYS L . n 
C 3 135 LEU 135 135  135  LEU LEU L . n 
C 3 136 LEU 136 136  136  LEU LEU L . n 
C 3 137 ASN 137 137  137  ASN ASN L . n 
C 3 138 ASN 138 138  138  ASN ASN L . n 
C 3 139 PHE 139 139  139  PHE PHE L . n 
C 3 140 TYR 140 140  140  TYR TYR L . n 
C 3 141 PRO 141 141  141  PRO PRO L . n 
C 3 142 ARG 142 142  142  ARG ARG L . n 
C 3 143 GLU 143 143  143  GLU GLU L . n 
C 3 144 ALA 144 144  144  ALA ALA L . n 
C 3 145 LYS 145 145  145  LYS LYS L . n 
C 3 146 VAL 146 146  146  VAL VAL L . n 
C 3 147 GLN 147 147  147  GLN GLN L . n 
C 3 148 TRP 148 148  148  TRP TRP L . n 
C 3 149 LYS 149 149  149  LYS LYS L . n 
C 3 150 VAL 150 150  150  VAL VAL L . n 
C 3 151 ASP 151 151  151  ASP ASP L . n 
C 3 152 ASN 152 152  152  ASN ASN L . n 
C 3 153 ALA 153 153  153  ALA ALA L . n 
C 3 154 LEU 154 154  154  LEU LEU L . n 
C 3 155 GLN 155 155  155  GLN GLN L . n 
C 3 156 SER 156 156  156  SER SER L . n 
C 3 157 GLY 157 157  157  GLY GLY L . n 
C 3 158 ASN 158 158  158  ASN ASN L . n 
C 3 159 SER 159 159  159  SER SER L . n 
C 3 160 GLN 160 160  160  GLN GLN L . n 
C 3 161 GLU 161 161  161  GLU GLU L . n 
C 3 162 SER 162 162  162  SER SER L . n 
C 3 163 VAL 163 163  163  VAL VAL L . n 
C 3 164 THR 164 164  164  THR THR L . n 
C 3 165 GLU 165 165  165  GLU GLU L . n 
C 3 166 GLN 166 166  166  GLN GLN L . n 
C 3 167 ASP 167 167  167  ASP ASP L . n 
C 3 168 SER 168 168  168  SER SER L . n 
C 3 169 LYS 169 169  169  LYS LYS L . n 
C 3 170 ASP 170 170  170  ASP ASP L . n 
C 3 171 SER 171 171  171  SER SER L . n 
C 3 172 THR 172 172  172  THR THR L . n 
C 3 173 TYR 173 173  173  TYR TYR L . n 
C 3 174 SER 174 174  174  SER SER L . n 
C 3 175 LEU 175 175  175  LEU LEU L . n 
C 3 176 SER 176 176  176  SER SER L . n 
C 3 177 SER 177 177  177  SER SER L . n 
C 3 178 THR 178 178  178  THR THR L . n 
C 3 179 LEU 179 179  179  LEU LEU L . n 
C 3 180 THR 180 180  180  THR THR L . n 
C 3 181 LEU 181 181  181  LEU LEU L . n 
C 3 182 SER 182 182  182  SER SER L . n 
C 3 183 LYS 183 183  183  LYS LYS L . n 
C 3 184 ALA 184 184  184  ALA ALA L . n 
C 3 185 ASP 185 185  185  ASP ASP L . n 
C 3 186 TYR 186 186  186  TYR TYR L . n 
C 3 187 GLU 187 187  187  GLU GLU L . n 
C 3 188 LYS 188 188  188  LYS LYS L . n 
C 3 189 HIS 189 189  189  HIS HIS L . n 
C 3 190 LYS 190 190  190  LYS LYS L . n 
C 3 191 VAL 191 191  191  VAL VAL L . n 
C 3 192 TYR 192 192  192  TYR TYR L . n 
C 3 193 ALA 193 193  193  ALA ALA L . n 
C 3 194 CYS 194 194  194  CYS CYS L . n 
C 3 195 GLU 195 195  195  GLU GLU L . n 
C 3 196 VAL 196 196  196  VAL VAL L . n 
C 3 197 THR 197 197  197  THR THR L . n 
C 3 198 HIS 198 198  198  HIS HIS L . n 
C 3 199 GLN 199 199  199  GLN GLN L . n 
C 3 200 GLY 200 200  200  GLY GLY L . n 
C 3 201 LEU 201 201  201  LEU LEU L . n 
C 3 202 SER 202 202  202  SER SER L . n 
C 3 203 SER 203 203  203  SER SER L . n 
C 3 204 PRO 204 204  204  PRO PRO L . n 
C 3 205 VAL 205 205  205  VAL VAL L . n 
C 3 206 THR 206 206  206  THR THR L . n 
C 3 207 LYS 207 207  207  LYS LYS L . n 
C 3 208 SER 208 208  208  SER SER L . n 
C 3 209 PHE 209 209  209  PHE PHE L . n 
C 3 210 ASN 210 210  210  ASN ASN L . n 
C 3 211 ARG 211 211  211  ARG ARG L . n 
C 3 212 GLY 212 212  212  GLY GLY L . n 
C 3 213 GLU 213 213  ?    ?   ?   L . n 
C 3 214 CYS 214 214  ?    ?   ?   L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1 5001 5001 CA  CA  A . 
E 4 CA  1 5002 5002 CA  CA  A . 
F 4 CA  1 5003 5003 CA  CA  A . 
G 5 NAG 1 5004 5004 NAG NAG A . 
H 6 HOH 1 5101 9    HOH HOH A . 
H 6 HOH 2 5102 1    HOH HOH A . 
I 6 HOH 1 301  8    HOH HOH H . 
I 6 HOH 2 302  7    HOH HOH H . 
J 6 HOH 1 301  5    HOH HOH L . 
J 6 HOH 2 302  3    HOH HOH L . 
J 6 HOH 3 303  2    HOH HOH L . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5760  ? 
1 MORE         -29   ? 
1 'SSA (A^2)'  28240 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A LYS 18  ? A LYS 1395 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD1 ? A ASP 21  ? A ASP 1398 ? 1_555 71.0  ? 
2  O   ? A LYS 18  ? A LYS 1395 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 O   ? A ARG 23  ? A ARG 1400 ? 1_555 147.0 ? 
3  OD1 ? A ASP 21  ? A ASP 1398 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 O   ? A ARG 23  ? A ARG 1400 ? 1_555 76.0  ? 
4  O   ? A LYS 18  ? A LYS 1395 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 25  ? A ASP 1402 ? 1_555 100.2 ? 
5  OD1 ? A ASP 21  ? A ASP 1398 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 25  ? A ASP 1402 ? 1_555 87.4  ? 
6  O   ? A ARG 23  ? A ARG 1400 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 25  ? A ASP 1402 ? 1_555 75.4  ? 
7  O   ? A LYS 18  ? A LYS 1395 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD1 ? A ASP 36  ? A ASP 1413 ? 1_555 69.2  ? 
8  OD1 ? A ASP 21  ? A ASP 1398 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD1 ? A ASP 36  ? A ASP 1413 ? 1_555 139.4 ? 
9  O   ? A ARG 23  ? A ARG 1400 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD1 ? A ASP 36  ? A ASP 1413 ? 1_555 142.5 ? 
10 OD2 ? A ASP 25  ? A ASP 1402 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD1 ? A ASP 36  ? A ASP 1413 ? 1_555 91.7  ? 
11 O   ? A LYS 18  ? A LYS 1395 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 36  ? A ASP 1413 ? 1_555 121.8 ? 
12 OD1 ? A ASP 21  ? A ASP 1398 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 36  ? A ASP 1413 ? 1_555 166.8 ? 
13 O   ? A ARG 23  ? A ARG 1400 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 36  ? A ASP 1413 ? 1_555 90.9  ? 
14 OD2 ? A ASP 25  ? A ASP 1402 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 36  ? A ASP 1413 ? 1_555 87.5  ? 
15 OD1 ? A ASP 36  ? A ASP 1413 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 36  ? A ASP 1413 ? 1_555 52.9  ? 
16 O   ? A LYS 18  ? A LYS 1395 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 39  ? A ASP 1416 ? 1_555 77.3  ? 
17 OD1 ? A ASP 21  ? A ASP 1398 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 39  ? A ASP 1416 ? 1_555 82.5  ? 
18 O   ? A ARG 23  ? A ARG 1400 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 39  ? A ASP 1416 ? 1_555 101.3 ? 
19 OD2 ? A ASP 25  ? A ASP 1402 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 39  ? A ASP 1416 ? 1_555 169.8 ? 
20 OD1 ? A ASP 36  ? A ASP 1413 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 39  ? A ASP 1416 ? 1_555 96.5  ? 
21 OD2 ? A ASP 36  ? A ASP 1413 ? 1_555 CA ? D CA . ? A CA 5001 ? 1_555 OD2 ? A ASP 39  ? A ASP 1416 ? 1_555 102.3 ? 
22 O   ? A LEU 59  ? A LEU 1436 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD1 ? A ASN 62  ? A ASN 1439 ? 1_555 74.7  ? 
23 O   ? A LEU 59  ? A LEU 1436 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 O   ? A ARG 64  ? A ARG 1441 ? 1_555 149.3 ? 
24 OD1 ? A ASN 62  ? A ASN 1439 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 O   ? A ARG 64  ? A ARG 1441 ? 1_555 74.7  ? 
25 O   ? A LEU 59  ? A LEU 1436 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD2 ? A ASP 66  ? A ASP 1443 ? 1_555 84.9  ? 
26 OD1 ? A ASN 62  ? A ASN 1439 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD2 ? A ASP 66  ? A ASP 1443 ? 1_555 82.3  ? 
27 O   ? A ARG 64  ? A ARG 1441 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD2 ? A ASP 66  ? A ASP 1443 ? 1_555 90.6  ? 
28 O   ? A LEU 59  ? A LEU 1436 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD1 ? A ASP 77  ? A ASP 1454 ? 1_555 78.6  ? 
29 OD1 ? A ASN 62  ? A ASN 1439 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD1 ? A ASP 77  ? A ASP 1454 ? 1_555 152.3 ? 
30 O   ? A ARG 64  ? A ARG 1441 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD1 ? A ASP 77  ? A ASP 1454 ? 1_555 131.8 ? 
31 OD2 ? A ASP 66  ? A ASP 1443 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD1 ? A ASP 77  ? A ASP 1454 ? 1_555 102.5 ? 
32 O   ? A LEU 59  ? A LEU 1436 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD2 ? A ASP 77  ? A ASP 1454 ? 1_555 132.0 ? 
33 OD1 ? A ASN 62  ? A ASN 1439 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD2 ? A ASP 77  ? A ASP 1454 ? 1_555 153.0 ? 
34 O   ? A ARG 64  ? A ARG 1441 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD2 ? A ASP 77  ? A ASP 1454 ? 1_555 78.5  ? 
35 OD2 ? A ASP 66  ? A ASP 1443 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD2 ? A ASP 77  ? A ASP 1454 ? 1_555 94.6  ? 
36 OD1 ? A ASP 77  ? A ASP 1454 ? 1_555 CA ? E CA . ? A CA 5002 ? 1_555 OD2 ? A ASP 77  ? A ASP 1454 ? 1_555 54.6  ? 
37 O   ? A HIS 101 ? A HIS 1478 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD1 ? A ASP 104 ? A ASP 1481 ? 1_555 76.5  ? 
38 O   ? A HIS 101 ? A HIS 1478 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 O   ? A ARG 106 ? A ARG 1483 ? 1_555 153.4 ? 
39 OD1 ? A ASP 104 ? A ASP 1481 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 O   ? A ARG 106 ? A ARG 1483 ? 1_555 78.0  ? 
40 O   ? A HIS 101 ? A HIS 1478 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 108 ? A ASP 1485 ? 1_555 94.8  ? 
41 OD1 ? A ASP 104 ? A ASP 1481 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 108 ? A ASP 1485 ? 1_555 98.2  ? 
42 O   ? A ARG 106 ? A ARG 1483 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 108 ? A ASP 1485 ? 1_555 81.5  ? 
43 O   ? A HIS 101 ? A HIS 1478 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD1 ? A ASP 119 ? A ASP 1496 ? 1_555 75.2  ? 
44 OD1 ? A ASP 104 ? A ASP 1481 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD1 ? A ASP 119 ? A ASP 1496 ? 1_555 149.7 ? 
45 O   ? A ARG 106 ? A ARG 1483 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD1 ? A ASP 119 ? A ASP 1496 ? 1_555 131.2 ? 
46 OD2 ? A ASP 108 ? A ASP 1485 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD1 ? A ASP 119 ? A ASP 1496 ? 1_555 94.7  ? 
47 O   ? A HIS 101 ? A HIS 1478 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 119 ? A ASP 1496 ? 1_555 127.0 ? 
48 OD1 ? A ASP 104 ? A ASP 1481 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 119 ? A ASP 1496 ? 1_555 153.4 ? 
49 O   ? A ARG 106 ? A ARG 1483 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 119 ? A ASP 1496 ? 1_555 79.5  ? 
50 OD2 ? A ASP 108 ? A ASP 1485 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 119 ? A ASP 1496 ? 1_555 92.5  ? 
51 OD1 ? A ASP 119 ? A ASP 1496 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 119 ? A ASP 1496 ? 1_555 51.9  ? 
52 O   ? A HIS 101 ? A HIS 1478 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 122 ? A ASP 1499 ? 1_555 93.4  ? 
53 OD1 ? A ASP 104 ? A ASP 1481 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 122 ? A ASP 1499 ? 1_555 76.4  ? 
54 O   ? A ARG 106 ? A ARG 1483 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 122 ? A ASP 1499 ? 1_555 87.8  ? 
55 OD2 ? A ASP 108 ? A ASP 1485 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 122 ? A ASP 1499 ? 1_555 168.9 ? 
56 OD1 ? A ASP 119 ? A ASP 1496 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 122 ? A ASP 1499 ? 1_555 94.7  ? 
57 OD2 ? A ASP 119 ? A ASP 1496 ? 1_555 CA ? F CA . ? A CA 5003 ? 1_555 OD2 ? A ASP 122 ? A ASP 1499 ? 1_555 88.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-01 
2 'Structure model' 1 1 2016-12-07 
3 'Structure model' 1 2 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 3 'Structure model' 'Derived calculations' 
4 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' chem_comp                 
2 3 'Structure model' entity                    
3 3 'Structure model' pdbx_chem_comp_identifier 
4 3 'Structure model' pdbx_entity_nonpoly       
5 3 'Structure model' struct_conn               
6 3 'Structure model' struct_conn_type          
7 3 'Structure model' struct_site               
8 3 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_chem_comp.name'                     
2  3 'Structure model' '_chem_comp.type'                     
3  3 'Structure model' '_entity.pdbx_description'            
4  3 'Structure model' '_pdbx_entity_nonpoly.name'           
5  3 'Structure model' '_struct_conn.conn_type_id'           
6  3 'Structure model' '_struct_conn.id'                     
7  3 'Structure model' '_struct_conn.pdbx_dist_value'        
8  3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
9  3 'Structure model' '_struct_conn.pdbx_role'              
10 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
11 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
12 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
13 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
14 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
15 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
16 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
17 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
18 3 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
19 3 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
20 3 'Structure model' '_struct_conn_type.id'                
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -5.6380 -17.5861 -44.5322 -0.0454 -0.3364 0.2297  -0.0046 -0.1360 0.0589  2.7833 1.6388 1.4174 
0.3910 0.1479  0.3942 -0.0975 0.0516 0.0459  0.1829  -0.3997 -0.1273 -0.0958 0.1478  0.2156  
'X-RAY DIFFRACTION' 2 ? refined 6.8527  9.4536   -7.7014  -0.1005 -0.1799 -0.1120 0.0991  -0.1846 0.0894  2.7024 4.2176 2.8021 
0.9070 -0.2360 1.5708 0.0855  0.0257 -0.1112 -0.7333 0.1252  -0.0982 0.5225  0.0737  -0.1434 
'X-RAY DIFFRACTION' 3 ? refined 19.3920 16.0591  -19.6693 -0.1310 -0.1357 0.3114  0.0375  -0.3045 -0.0393 0.5247 1.5078 1.7216 
0.4972 -0.5928 1.4605 0.0445  0.3173 -0.3617 -0.5436 0.1000  -0.6029 0.3555  -0.0287 0.4095  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 1391 A 1633 '{ A|* }' ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 H 1    H 216  '{ H|* }' ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 L 2    L 212  '{ L|* }' ? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? BUSTER-TNT  ? ? ? .      1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .      2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15   3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? BUSTER      ? ? ? 2.11.2 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 1392 ? ? -142.67 57.96   
2  1 GLN A 1432 ? ? -99.99  34.81   
3  1 GLN A 1593 ? ? -92.12  35.20   
4  1 SER A 1594 ? ? 56.44   -170.34 
5  1 HIS A 1599 ? ? -91.84  39.07   
6  1 ASP A 1621 ? ? -108.79 73.95   
7  1 PRO A 1623 ? ? -76.66  49.88   
8  1 PHE H 29   ? ? -51.14  12.20   
9  1 PRO H 41   ? ? -19.44  -92.06  
10 1 PRO H 150  ? ? -91.50  -150.97 
11 1 VAL H 155  ? ? -161.15 102.20  
12 1 SER H 159  ? ? 59.73   15.83   
13 1 SER H 164  ? ? -59.24  107.00  
14 1 ASN L 30   ? ? 52.64   -117.20 
15 1 ALA L 51   ? ? 70.70   -45.37  
16 1 SER L 76   ? ? -66.08  -80.49  
17 1 ALA L 84   ? ? -170.80 -173.50 
18 1 LYS L 190  ? ? -101.14 -60.17  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 H ARG 213 ? CD  ? B ARG 213 CD  
2  1 Y 1 H ARG 213 ? NE  ? B ARG 213 NE  
3  1 Y 1 H ARG 213 ? CZ  ? B ARG 213 CZ  
4  1 Y 1 H ARG 213 ? NH1 ? B ARG 213 NH1 
5  1 Y 1 H ARG 213 ? NH2 ? B ARG 213 NH2 
6  1 Y 1 L ARG 24  ? CG  ? C ARG 24  CG  
7  1 Y 1 L ARG 24  ? CD  ? C ARG 24  CD  
8  1 Y 1 L ARG 24  ? NE  ? C ARG 24  NE  
9  1 Y 1 L ARG 24  ? CZ  ? C ARG 24  CZ  
10 1 Y 1 L ARG 24  ? NH1 ? C ARG 24  NH1 
11 1 Y 1 L ARG 24  ? NH2 ? C ARG 24  NH2 
12 1 Y 1 L ASN 30  ? OD1 ? C ASN 30  OD1 
13 1 Y 1 L ASN 30  ? ND2 ? C ASN 30  ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1378 ? A ALA 1   
2  1 Y 1 A PRO 1379 ? A PRO 2   
3  1 Y 1 A GLU 1380 ? A GLU 3   
4  1 Y 1 A VAL 1381 ? A VAL 4   
5  1 Y 1 A SER 1382 ? A SER 5   
6  1 Y 1 A GLU 1383 ? A GLU 6   
7  1 Y 1 A GLU 1384 ? A GLU 7   
8  1 Y 1 A PRO 1385 ? A PRO 8   
9  1 Y 1 A ARG 1386 ? A ARG 9   
10 1 Y 1 A CYS 1387 ? A CYS 10  
11 1 Y 1 A PRO 1388 ? A PRO 11  
12 1 Y 1 A ARG 1389 ? A ARG 12  
13 1 Y 1 A ALA 1390 ? A ALA 13  
14 1 Y 1 A ARG 1560 ? A ARG 183 
15 1 Y 1 A PRO 1561 ? A PRO 184 
16 1 Y 1 A SER 1562 ? A SER 185 
17 1 Y 1 A PRO 1563 ? A PRO 186 
18 1 Y 1 A GLY 1564 ? A GLY 187 
19 1 Y 1 A SER 1565 ? A SER 188 
20 1 Y 1 A GLU 1566 ? A GLU 189 
21 1 Y 1 A PRO 1567 ? A PRO 190 
22 1 Y 1 A ARG 1568 ? A ARG 191 
23 1 Y 1 A ALA 1569 ? A ALA 192 
24 1 Y 1 A ARG 1570 ? A ARG 193 
25 1 Y 1 A ARG 1571 ? A ARG 194 
26 1 Y 1 A GLU 1572 ? A GLU 195 
27 1 Y 1 A LEU 1573 ? A LEU 196 
28 1 Y 1 A ALA 1574 ? A ALA 197 
29 1 Y 1 A PRO 1575 ? A PRO 198 
30 1 Y 1 A GLU 1576 ? A GLU 199 
31 1 Y 1 A VAL 1577 ? A VAL 200 
32 1 Y 1 A LEU 1634 ? A LEU 257 
33 1 Y 1 A GLU 1635 ? A GLU 258 
34 1 Y 1 A PRO 1636 ? A PRO 259 
35 1 Y 1 A PRO 1637 ? A PRO 260 
36 1 Y 1 A GLU 1638 ? A GLU 261 
37 1 Y 1 A PRO 1639 ? A PRO 262 
38 1 Y 1 A SER 1640 ? A SER 263 
39 1 Y 1 A GLY 1641 ? A GLY 264 
40 1 Y 1 A SER 1642 ? A SER 265 
41 1 Y 1 A HIS 1643 ? A HIS 266 
42 1 Y 1 A HIS 1644 ? A HIS 267 
43 1 Y 1 A HIS 1645 ? A HIS 268 
44 1 Y 1 A HIS 1646 ? A HIS 269 
45 1 Y 1 A HIS 1647 ? A HIS 270 
46 1 Y 1 A HIS 1648 ? A HIS 271 
47 1 Y 1 H SER 130  ? B SER 130 
48 1 Y 1 H SER 131  ? B SER 131 
49 1 Y 1 H LYS 132  ? B LYS 132 
50 1 Y 1 H SER 133  ? B SER 133 
51 1 Y 1 H THR 134  ? B THR 134 
52 1 Y 1 H SER 135  ? B SER 135 
53 1 Y 1 H GLY 136  ? B GLY 136 
54 1 Y 1 H GLY 137  ? B GLY 137 
55 1 Y 1 H THR 138  ? B THR 138 
56 1 Y 1 H ALA 139  ? B ALA 139 
57 1 Y 1 H LYS 217  ? B LYS 217 
58 1 Y 1 H SER 218  ? B SER 218 
59 1 Y 1 H CYS 219  ? B CYS 219 
60 1 Y 1 H ASP 220  ? B ASP 220 
61 1 Y 1 H LYS 221  ? B LYS 221 
62 1 Y 1 H THR 222  ? B THR 222 
63 1 Y 1 H HIS 223  ? B HIS 223 
64 1 Y 1 L ASP 1    ? C ASP 1   
65 1 Y 1 L GLU 213  ? C GLU 213 
66 1 Y 1 L CYS 214  ? C CYS 214 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'                            CA  
5 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
6 water                                    HOH 
#